4Z7WE

T316 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
199
structure length
199
Chain Sequence
QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVGETGANNLFFGTGTRLTVIPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 199
sequence length 199
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7wE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7wE01
3CH8A 3TBVA 2EC8A 5EC1B 4LNRA 5IB4A 2ESVB 3O2WH 1WUNT 4U33A 3ULUD 3MRMB 2J5LC 1FNAA 4QRTB 4JFXA 5I17A 3LCYA 4HIJB 1U93B 3C6LB 5HGGS 4KHTH 1HI6A 3HI1A 3C5ZA 4KPHL 1YYLH 4RX4A 4QRQB 5D93C 3IXTA 2EEDA 1OAQH 4PRHA 4TNWF 1DR9A 4YDLC 1LILA 1F5WA 1QQDA 5GGUB 2J5LB 4XMKH 5T3ZD 3QNZA 4KROD 4NBZB 4NRYA 4ZNEE 3QEQA 5F7NC 1DEEA 1VHPA 2AJXH 2IG2L 32C2A 5CHNA 1N59A 1T2QL 2YBRB 4M5YH 5IEHA 4ONOA 1KENH 3QWOB 2R39A 2WLYA 5D93B 3HFML 4OZHE 2F54A 4FQIL 4G3YL 1SJXA 3FAXA 4R8WH 3VWKB 5CZXD 4G6ML 4UB0L 1PX3A 1SQ2N 4MA7L 1Q9WA 4TUOB 4HG4J 4QYOB 1W0WA 1G9MH 1LO5B 5FYKD 2YK1H 3HPJA 4A6YH 3QUXC 2APFA 2WMPA 2CRYA 4UMGA 4OZHF 5DUML 4XCFL 2F15A 4P2RD 1R5WA 3O2DA 3TZVA 2ESVE 2GK0B 3UTQA 2J6EL 4FP8H 3UAJD 1JGVH 3MRQA 1EO8H 1EUUA 2WP3O 2R69L 2EDHA 4N9GB 5I74C 2KBGA 3Q48A 4ZUTA 4HSQA 4R97B 5AG9A 1TITA 5J89A 4XVUC 2W0KA 2YN5A 1JN6B 5F7YC 4LOUC 4H1LB 2OP4L 4N1CA 3MOAH 4P9HL 4R7NB 4CMMA 3H9SE 4I77H 5ACLA 3QDME 5CEYA 5ERWA 4YGVA 4PRNB 1HXMA 1C1EL 3MLWL 1IE5A 2IH1B 1NLBL 3P0VH 3BWUC 1FDLL 3MRFA 1P7KA 4S1SH 2VDQL 1GGIH 2NY0C 1HSBB 4QHNA 1XAUA 3D39E 3T2OA 2GFBA 3ARFB 5FHAH 4HIXH 5ELIA 3ILQD 1B4JL 1N4XL 3TVMC 1V3LA 2VLKA 4RQQB 2RR3A 3QIUB 4Y4FA 4C56B 3MCLL 1DSFH 4F58L 3GMPA 4QCIA 4YHKL 4P2QA 1J7VR 2EDQA 5CSZB 3OB8A 5DS8A 4FQLL 3L3KB 3TJEH 3WIFB 2HKHL 1O0VA 5C9JA 5H35A 3QDJD 5TQ2L 3BP7A 5HYJA 5IT2H 4K9EL 3U4BL 1J11A 1LHZA 4F33B 3TVMB 5EUOA 3BP4B 4L8BA 1BZ7A 3HLAB 5HHOB 3O3EB 3FQWA 4YHOL 3FTGA 4Q9RH 2YPLB 1JL8A 3HR5A 4FXGB 1OGAD 4HXBL 5EBLA 3DROA 5GGSA 3FB5B 3QRFM 1U8IB 3NABL 3DXAB 1HH9A 5B22A 2FX7L 4LEOA 2VR5A 4DGVH 1WQVT 3U9PH 1FZMB 3PGFL 2ZUXA 5MEPA 3TNNB 2HT2C 2X4NB 3NAAH 3RL2B 1MHPL 1ZT4A 3D48R 4G8GB 3G6JA 4O51B 5EC2A 3K0WA 4PRPE 2EDLA 4YBQC 5MP6H 3ZKND 5D5MB 5TDOB 4XPBH 3GM0A 5HHQB 1FLTX 5I66A 2E9JA 2W91A 5KSVA 4K7PL 3H42H 1T83C 1RURL 4NWTL 1EGJA 1N3NA 5MENA 4M61B 1F58H 4X8JB 2VDPH 1VFAB 4IIQA 3PDGA 1MWAA 2VYRE 1F2QA 1Z6JT 5KVDH 5HDQL 2CGRH 3B4NA 2HFTA 5DK0B 1YDPA 1G1CA 4YHNA 2YD8A 2B8OT 4L9LA 1EEYA 1G9NL 1YC7A 2YPLE 3U1SH 3DYMA 4ODXA 1G7LB 1Y0LB 2JIXB 1S7WA 3B5HA 1JWUA 4G8EA 1H15B 1K4DA 1VPOH 1AXIB 4QOKB 3BIBX 4U6HA 3RNKB 4YHML 3BKML 3LPFA 3MACL 3A0OA 4XNQA 25C8L 1ND0A 4YPGA 3OAUL 2NY5H 1SM3H 2FGWH 4KZEH 3PHOB 5EU4B 2A83B 4G8GE 5GSVA 4JZJA 1G1YA 5DYOB 4Z9KB 2C4FU 4WEBH 4OLWL 5D5ME 2HTLD 3PWJA 3P77A 2OL3L 3TT3H 1JZ3A 1BD2A 1XIWA 3VFTB 4DQOL 1FO0A 5BVJB 3QDGA 1EHAA 3TESA 1XT5A 5F71A 5I1HH 1QRND 3FL7A 2K1MA 3WXWL 5CCKH 4NFBA 4HKZB 5D5MF 1L7IL 2V2WB 1RJYB 4NZRL 4G8FA 1BHGA 1QLEL 4HWBA 1WCQA 3BPCB 2DD8H 5L9DH 1VB9A 3BXNA 2C3XA 4P23C 1T1ZB 3IDIB 4ODWB 2Q8BL 5DLMH 4P57A 2WUCH 2J8UB 1SBBA 4QXWA 2QADC 1WZ1L 1Q1JH 4WFFD 5DUPH 5C09B 4BSWB 4WW2C 3DLQR 4P9HC 1T5XA 3VXRB 1KNOB 2IAND 3LRSB 3TBWB 5D72H 2EDXA 1MVUB 5A2KH 4K3DH 1AD9A 4P23B 2EDOA 5DHXB 4TSAL 1ZA3A 2P7TB 3ARED 2BSTA 2YD2A 1BP3B 2ADFH 4YQXH 4PGBB 1U3YA 4X4ME 1TCRA 1DL7L 2UWEB 4Z77A 4WW2B 4LBEA 4ZO9A 1X5LA 4Z7VB 5AAWA 4EVNB 2XQBH 5E8PB 4WTXA 3O6FD 4UNVA 4CN4A 5HYFA 3UDWC 4YIQB 4J3WA 4ZUVA 1ZT7A 2DKUA 1VGEH 1A5FL 1F4WL 4LSDA 3QH3B 1UB6A 1Q94A 2PO6C 1OHQA 4EIZC 3MROA 1KC5L 1NAML 5F8RC 1JF1A 3VFMB 2X4SA 1A1NA 4FTVB 1U41A 2UZIL 1S7RB 1S7UB 3PGDB 2R9HC 2JJSC 3RVVD 2X4TB 1BIHA 4K71B 1XH3A 2ZUVA 3KS0H 2J8UE 5CEZE 1NMBH 3BGMB 1H5BA 3O8XD 2SEBB 3UX9B 1BLNB 3VXRE 1VADB 2I24N 3OKMA 5K59E 3RWGB 2E27L 2PO6B 4K3JH 5EIIB 1JPFA 1ZVHA 1GAFL 1IAKB 1HXYA 1ORQB 4F2MB 4Z8FH 1ZANL 2J8UF 3SEPA 3MZGB 4GKOA 4RFNC 1A4KA 2LU3A 1NCUA 4U1GC 1HILA 3BIKB 1GOHA 1Z3GL 2I9LB 3BKYL 1VFUA 5ITFB 5K59F 1I1AC 2DM2A 3D6GA 4YDIH 5D2LB 3N1PC 4KXZI 4WFGD 3X3GH 1MCFA 1UVQA 2VIRB 3SGKA 5INCB 1CWVA 3IRPX 2VQ1A 3WFEH 5ID1A 4MSWA 4OFVA 5FOJA 3QFDA 1BJ1J 1IQDB 3L9RA 5GRJH 4RBPK 4X7SL 3KYMA 5FEBA 4WW2F 3T0ED 1HEZA 2OQJB 1V3JA 1BQHG 1JVKA 4Z7VF 1NGZA 3BD4A 3P73A 1I1AB 5D7JA 1MREH 4V1DD 4DVBA 4FTVE 3O4LE 3C60A 3T77A 3O6KH 5IVOA 1G9NC 3IU4L 3F62A 3B9EA 4MNQD 1D5BB 4JQIH 1UXWB 5TJWK 2XN9B 3OG6B 4LP4A 3TN0C 4ZFOA 5GS1C 5GISL 1A3QA 1A7QH 3KDMB 1A7PL 1C5BL 4KKLD 1HHJB 1TNNA 2G9HA 5JLZA 3TNMA 3LEYH 2V9QA 4FQJH 3UBXG 1RULL 2G75A 2N7BA 1GGCH 4FQPA 1RFDH 4WI9A 3EO9L 1YY8A 3KHQA 3PGCA 1OGTA 3CX5K 3KWWA 1A7RL 4F3FA 4C83A 1TTFA 4XC1H 4Y1AD 5GGTH 3WDHA 3TN0B 5C7XL 3TBSB 3GMMA 5E8OA 4NQED 1TVBA 2EXWD 1P2CA 3SPVA 2EO9A 3VW3H 3HUJA 5SV4A 4UQ3B 5D2LE 1J0JA 3VI4E 4Z0XA 4PJGB 1NMCB 4K8RD 4I48B 1J0ZA 1FVEB 3NIGE 1EJOL 4M93C 2J7LA 3IJHA 4ZOBA 1NGQH 2DQUL 1SYVB 1GJIA 3GRWL 1BZ9A 1ZHNB 4HUNB 3V5HB 3AU1B 4DUWA 4Q97A 4MJIB 3S8WA 5D2LF 3HNSH 1C12A 5T1KB 3ALPA 3NIGF 4NNPH 5JHDB 2V17H 4MXQC 4MCYA 4FABL 3ULVL 4NSKB 2VN4A 5C6TL 4NO3B 3SKOB 2V5SA 5EZJB 4G9DB 4JKMA 4U1IA 1RMFL 3O6FA 1SVCP 2XN9E 2MQCA 4HK3N 4X5XA 1KBGL 4GRLA 3W11D 3OKEA 2ADJB 3O6MH 4BFIA 5IIEA 3VFGH 4TYUA 3QJHB 3ZT7A 4OCRL 2O5YL 5BZDB 1RUQL 3H0TA 3ULUH 1J86A 1NSNH 2YN3A 4HFUH 3VFVB 5E6YA 5EU5B 4FQ1L 5FAAA 4G9FD 3IDGB 5D70L 4PLOB 4AIZB 4H25B 4NT6A 5E8EA 1KEGL 2Z35B 1NGPL 5C0JB 3MGOB 3PWVA 3HG1E 4AMKH 5FM5M 4JQXC 3EFFB 4PJGE 5L6YH 1QBML 2X9WA 3WJJA 2E6PA 1T66D 1ZV5A 2DQEL 3EW3B 5SWZB 5IM7B 4O2FB 3VGHA 3TJHD 4DTGH 1IKNC 1HQRA 4IHOA 1CD0A 3RDTD 1ZT1B 2XKNA 4W6YB 4N8PA 4S1RH 4EXPX 1XF5B 1YJDL 4OLUH 5C0AB 4PJGF 3BZ4A 3EOTH 1EIBA 1ORSA 3C08H 4YK4B 1U8QB 2D7MA 2K3TA 2BSSB 1YY9D 4M4RA 5CGYD 1E4KC 4I5BA 3KPPA 3U30C 3K4DA 3BJ91 5FYKH 2VDRH 4XAWH 3RWCA 3QT2A 3INUH 2NLJB 4EI5C 5T1DL 3VD5A 3LOWA 4M8QB 5EIVA 1OAXL 3OKDB 4Q6IA 4MWFA 4B53A 2YMXH 2AJUH 3EYQD 3VCLB 1N6VA 2HJFB 1T2QH 4CVZB 1KJ3H 3RZCC 2AJVL 5FO9A 4MNQA 3OSKA 3OXSA 3U30B 1VEOA 1W72B 5I30L 1RZ7H 5C0CD 4EI5B 3T1FA 5DMIL 1FGNL 4U7SA 2AI0H 3BH8B 5SWZE 1P4LB 2E9BA 4Y5VA 4PB9H 1KELL 2X4QB 2NXZC 5TF1H 3NACH 2V9RA 1BJ8A 3RZCB 3QO1B 4Z7UA 5ADPL 4CL7A 5IK3B 2BFVH 5C0AE 1JGUL 2LVEA 4PLKD 4RMSA 1J8HB 1BQHB 1FZOB 2BNRE 4H0HB 4YNYB 5EPMB 3CMOH 2IALA 2ZZUT 2P49B 2IFGA 3WNKA 1MNUH 2NYYD 5F93C 2NX5E 2NXZB 4YDVA 5EO1B 1OY3B 5IJKA 1L0QA 1KOAA 2OP4H 4JPVL 5SX4H 5B38G 5GS0L 3BDBA 1NAKL 3VXTB 3IDNB 5HY9B 5GRVL 2CPCA 3D0VA 4Z5RA 5I71C 4NZUL 2PW1B 3HI6L 5T1MA 1VACA 4RWYH 1NLBH 2EICA 4UU9B 1T22B 2D7TL 4OM1H 3HNTH 2EDWA 4KRPC 3R8BB 1DBBH 5FCUH 5JQ6H 4G7VH 3DMMC 5DEZA 5DRNA 4JHZA 4ZTOL 1T20B 5L88H 2EEAA 4M9OA 3MNWA 2YRPA 1IC5L 4PY8J 4Q74A 1BFOA 5A3IC 4RRPG 4U1MB 4Y4HD 3MJ9H 2WINB 4RBPH 4G9FA 5IROC 5EUKA 4E42B 5JOFB 3FN0L 2FR4B 3QQ9C 1QBLL 3ULVC 3DMMB 1DQJB 1HKFA 2VE6B 1G6RL 2CR6A 5KSUB 4ZTPL 1CXFA 4JKWA 5F9OH 1M7IA 3KJ6L 5IG7A 1I7RA 4NWUL 4NC1E 2Z9TA 4ETQB 5T3XE 3G9VA 2D2OA 3UTOA 1G7PB 3BPOC 1MUJA 3NABH 3Q6GH 4XPFL 1D9KD 2XA8L 4KUZH 1PD6A 1I8IB 1ZLUH 2QQKL 2NTSP 5KW9H 2L7UA 5BO1L 4PP1D 3BWAA 3N50A 3AMLA 3MA9L 5T1LB 4XHJD 4P5TB 5DD3H 1MH5A 3KPOA 4IEFB 4HS6A 1RIHH 4TUJB 5ID0A 5IUSA 3VD9A 4QTIL 1CFBA 4IOFC 3FQUB 5EOCL 3O4OB 3BPOB 2PYFB 4OZGE 1F8TH 4V2BA 3SGJA 4X7EC 4ZXBC 1I9IH 5IOPB 4JY5L 4U1KB 2VLRB 3TYGL 1RK0A 4OQ1A 4NO0B 4I13B 3RY6C 1T1XA 5IB1B 4L8CB 2A77L 4EN3A 5KSBA 4PJHA 1YJDC 4XWGL 4OZGF 2ZPKL 4IBLT 1A6WL 2HFGL 4NQDE 3VXMB 3CSPA 4DZBA 2E9WA 3MMEB 2RCSL 2ZJSL 5C0CA 4OZ4B 4X6CA 1IAOB 2L0DA 2VITB 4JN2B 1J1OH 1T1YB 1S7SB 2AQ3A 1PYWB 3LKQB 1Q0XH 2XKSA 1U95B 4E5XA 2GTZA 5DDHA 1JHLL 3GHBL 5JXEA 4D2NA 4OCYH 4RFEA 3B83A 3PWPB 4ZYKA 4M7JH 1I1YA 5ANME 1AGCB 1AP2B 3M07A 3PUCA 2BNQD 1RJLA 1QBAA 4LSRH 1G9MC 4HGMA 3MGTA 4M5ZH 3X3FH 2UY6A 1BGXL 5J7CC 4LEXL 1ZOXA 2WBJC 3UPRA 5HHNA 3NH7L 3FOLB 4GAYB 2ICWA 2VZ3A 4WUKH 1KJ2L 4F8TA 3DHMA 2VLRE 4ODTL 3SOBL 2R1XB 2B4CH 4NUGH 4LLVB 5EBWA 9CGTA 2HTKD 2ARJA 2IBBA 3L7EB 3MCG1 1ACYL 4HPOL 4KKAC 1CXEA 3WFCL 1AIFB 5ILTH 4ZG1A 3JTSA 3FZUD 2BOCB 3DOSA 2C1OA 1YEJH 2YD1A 4PLNC 2VO5A 5IB2B 3BZFA 3D18B 3NPZB 4ODVH 1CGYA 3ESUF 1YNTA 5F7DA 4PGDA 1H8OA 3ROLA 2YUWA 5DZLA 4FFZL 4ZPTA 5GRWA 2EDRA 2G2RB 3LQZB 5GS0C 1S7VA 5IB5B 1NBYA 3GKWL 2F19L 5B38B 5I1EL 3PWPE 5E8DL 4K94L 1E6OL 4XMPL 1UWEH 3OR7A 2EC9U 5D7IB 4NKOA 5KTEH 3SDCB 1D5IH 3VGEA 2W65B 4LNVA 2E8YA 5JPNB 2AK4D 2C4FT 4QRRE 4XTRD 2VZSA 3REVB 4GQ9H 2FECL 1FRGL 1QFWM 2CLVB 5BQ7A 3HNVH 4GAJL 43CAA 1FIGH 1KTDA 5BRZB 4HJGB 1BFVH 1ZTXH 1R3KA 2F53D 4BUHA 5I1KL 4GOSA 5C0IB 2V5RA 3X14A 2ZOLB 1HOCB 1QFWI 3C5JA 5DFVC 2VERN 5TH2A 3ISWA 4WU5A 4F7CB 1JRHI 1J12A 2AERT 4LRNH 2F5AL 3S37H 3QUKB 2FJGB 4NQTA 2C7UA 1GYAA 2MTPA 4PRIB 1T0MA 5E08L 1EPFA 1IL1B 3FONA 5C8JB 3EGSA 3BEVB 1NGXA 2OBGA 4G6FD 3ZKQD 1T1WB 1YEGL 4ZS6C 1GC1L 4YE4L 1I85A 1QP1A 2DYPB 4W4OA 1GAFH 4IRZH 3VGBA 1G6RB 4PBXA 3U6RB 5DGQA 1RZGA 2O5ZH 2PXYC 1BREA 1Z9OA 1SBSH 1A7OH 2MWCA 4PJ8B 5KJRL 4M00A 1OTSD 5I1GL 1B9ZA 5D7IE 5DWUH 1ZVSB 4UV4L 1OTTC 3BD3A 4OJFH 4JFYB 1J1PH 2ENYA 2Q76B 4X5LA 3TBYA 4UT9H 4WI5A 3O2DL 4M02A 4LFHD 1X7QA 2VJXA 1IGTA 5BRZE 5JOPE 3AFLA 2PXYB 2CUHA 5BS0B 1U3HB 3ARSA 2J1KA 3HAEA 5D7IF 2R23A 3KAAA 3MRBA 3VI3E 5JIPA 4GRMB 2YD9A 5D96C 2GJ6E 3T2PA 2YC1B 4NKIH 2F58L 1TVHB 3RI5F 4U3HA 4LU5H 4WUUA 3ZHDA 3IJYA 4LDOB 5TFSL 4FN0A 3EZJB 4QHMB 3GMLA 2JCCA 4S1DD 4K8RH 1XGRB 2ZUSA 3IETB 4ODHH 1MCWM 2WANA 4YWGH 3GI9H 3D0LA 3VI3F 4URTB 2LABA 1AGEA 3H6JA 1H3WM 5GZOC 4XMLL 3H3KA 5I1DA 3JV5A 5SWSB 3RWJA 4GXVH 1BVKA 2XTLA 5HVWA 1PKQB 4HGWB 1PY4A 4JRXB 2CDGA 3QI9D 4KKBD 4L4TB 4DKDC 4DGIH 3GEWB 3LS5H 1QSEE 1CFNB 1RZ8B 3J8F7 5CMAB 3NGBB 4PG2C 1A0QH 3FFCB 2ZKHH 3PDOA 4PGJA 1WIOA 5FYJL 1EJOH 1QG3A 3QG7L 5JIKA 3ALXA 1LDSA 2X4OA 4XCYA 5LCVL 3GRWH 5BS0E 5J1AA 2GKIA 4HIHA 5EZLB 1JPTH 4D0CA 4PS4L 2HRPL 2H32H 2V2XA 3DVFA 2A73B 2ILLA 1MI5E 4OT1H 3LS4L 1C8PA 4U1NB 4PJBE 3QQ3A 5HBBA 5C3TA 4U1SB 1YMMB 2BCKB 1X5HA 2V7NA 5DQJA 1OAKH 2AK4A 5F88A 4P5KB 5DT1L 1UM5L 3S35X 3WSQL 4O5LL 5CJQL 4ESKA 1MPAL 1QFOA 1Y18A 3FO2B 4MMZC 4PJBF 3ZYOA 4OCWL 3SCMC 1JTPA 2YKLH 4S0TD 3VXSD 3UROR 1S78C 3WS6C 1H3UA 4LLWA 5FCSH 3O11B 1JMZA 5IHLB 1CDHA 4N0UA 5IEKA 5JDSB 4D8PA 1PKQE 3NA9H 4NM4H 3P40A 3RY5A 4E9LA 3DUSA 1T3FA 4NBXB 2VLJB 3CC5A 1CL7H 1KXVC 5TF0A 1EGJL 2PF6A 4M62H 3LZFH 4PGEB 2XY2A 1KPVA 1L4IA 1MWAL 4I3SH 3DBXB 3CFCL 4JFQA 4F57L 3CFEB 2Q8AH 1XGQB 5EZIH 2GJZB 5LVEA 4X0KA 3C5ZC 1S8DA 4LCYB 4ORGB 3C6SA 3SDYH 1IC4H 4I3RL 5ISZB 4N8CH 1JGDA 2DLEA 1WWBX 1CGSL 1KIRB 3SQOL 1V7ML 5EO9A 4AEIH 4I0PA 1RZFH 1FPTL 1L9MA 5F9WC 4W6XB 2UV3A 1QUNA 4Y19A 5C86A 3U82B 4XBEL 4NN6B 5E5UB 3MO1A 4JRWA 3RWHA 2IADB 1IFHH 3F65A 4P2YA 3MRCB 1GC1C 1IKFH 2AQ2A 5I8OL 3QG6A 4HQQL 4OGAC 1QACA 1SEBA 5D7SH 2NPLX 4PRAB 3AUVA 3WKML 5D8JL 1HNGA 4O02H 1G9EA 1K3ZA 3SDAC 5C0EA 1YEEH 4OD2A 5F9WB 5HI4C 4PJAA 3NVQA 4APQD 4PTUB 4Y4KC 2VLJE 1NUNB 4JFEE 1U92B 5F9AC 3GIVA 5JR1L 1KN4L 4AT6B 1FO0L 4PG9B 5GJSL 1P7HL 1PQZA 3TZVC 1P53A 4OB5H 5JW4Q 3PG2A 1ZSDB 1BJ1H 1UB5A 4KMLB 4YAQB 2R4SL 4G7YH 3BHBA 3PP3H 4XH2B 2AK1H 3GO1H 1XF4B 3IFOA 3SDAB 2W0FB 4HWBL 3RIAK 2QSCH 1MCDA 1AQKH 3W9EA 1JGLL 2AAVA 4LLAA 1Q9WB 1X4YA 1W0WB 3DSFH 4Y4KB 2DMCA 1VKXA 2YEZA 4OM0H 4HT1H 5I73C 1JMXA 4U6XA 5B3NA 3L3IA 3SKJL 1R5WB 4LKXB 1NQBA 3U2SA 4BH7B 2ZCHH 4WFHD 5IBUG 2ZOKB 3MV9B 4Y8AA 2VQUA 3MV7D 1OM3H 4NJAH 3TBTB 4U6VL 5L2KD 4PJ5B 1S9VA 3LN4A 4HS8H 2PUQT 1DEDA 1AHWC 5TE4L 3ULSA 1QOKA 4Y4FC 2IPUK 3JV6B 5DHYB 4QRPD 4Y5XA 5K9JL 4HFWB 4I2XB 5CEYB 5ERWB 3RKDC 1CLYL 4G6JH 4IS6A 3MRFB 2X4UA 4LCWE 3WNNA 3VXUE 4RGNC 3VXQA 4K7FB 2NY2D 1AGBB 1IGCL 2GFBB 2NY1C 1AHWB 1PG7X 2P5WE 2VLKB 5C0BD 4OLYL 4R96A 4PB0L 3KXFD 4JO4L 2BVPB 4P2QB 2JJTA 4X5WB 3F5WA 1A4JB 4RZCA 4HUVA 4KJWD 3MREA 3HRZA 2ICES 4HEME 2AEPL 4L3AA 4L8DB 4G6KH 4KK6C 5LXGL 5L8KB 1QBLH 1CDGA 3BX7C 1ITBB 3VFUB 2WP3T 2BDNH 4K55A 4RMTA 4EUPH 1FZJA 1LP9A 4GLRI 4L3ED 1YYMH 5HGAA 1UM6H 5KVGH 5IMLB 2UVFA 3W5MA 5I15L 1OWRM 2R0KH 1NMAH 1RVFL 3U0PB 3HRPA 3QEHB 1M05B 1QLRA 2PR4H 1QSZA 4DAGH 4MJ6B 5EFIB 4GSDH 1WZKA 5IESH 3R0MA 5K9OA 1CI5A 4XPTH 3G5YA 4NQVA 1OP9A 2Y36L 1XR8A 4YBLB 4CVXA 4YHPB 4LEOB 3O0RH 4I2XE 3MLTB 4DOHE 3H7BA 2E6JA 2BRQA 3P30H 4F37K 3G6DH 3QXDA 2AJSL 4KROC 3MOQA 5A43C 2KZWA 1T4KA 1ZT4B 1LO0L 3E1F1 1KEML 5EC2B 4LQFH 4M7KL 3TGXA 4AQOA 4KJQD 1T04A 2OJEA 2VDKH 3UJTH 4JM4H 1QNZH 3P11L 2E8ZA 2M26A 4OUUB 5CZXC 4L9LC 5I66B 2EH8H 2H2PD 1CXIA 5KSVB 1LE9B 2XI9A 1DDHB 2X40A 4APQA 4KROB 5E94A 4HWUA 4ZFOL 4FG6D 1GCFA 4NJ9L 3AXLA 2R4RL 1EEZA 3ZE2E 1JCKA 4OGYL 5DFWH 4MMXC 5E0QA 3KPSD 3BPLC 1KB9J 1WEJH 2XZQH 3UAJC 4MZ3A 4L9LB 1FGVH 5HHME 4JZJC 5I1IH 4XXDB 2KUTA 5ADOH 2GEEA 3ZE2F 4MJ5A 4U6HB 4HUUA 4P2RB 4YEFA 5CAYB 3TO2B 3WL9A 3ULUE 1YA5A 3GSNA 3CZJA 3GSUA 1XIWC 3BPLB 3RNQB 3MBED 4Z6AT 5E03A 2XWJB 4WIQA 3OL2A 2AXHA 3V6ZA 1I3VA 4RMUA 5GSVB 4JY4A 4M8VA 5CINH 2HVKB 3H2WA 1UH2A 1I8KB 1KJ2H 2ZCLH 3ILQC 1N2RB 4EOWL 3FRUA 4HX1A 3S88H 3PWJB 4O9HH 2HT3D 3P77B 1NFKA 3ULUF 3U0TB 1U58A 3M1BB 4QRPA 4MX7B 2XZAL 4UT6H 3SE8L 5EN2B 3MSPA 1FO0B 5J13C 3WN5A 1ACYH 2HJLB 5BMFL 4PJDE 4GBXA 4PY7A 1JHTA 1MHEB 2F74B 3P9MA 4ZSOE 4N8VG 3UTZA 4P59H 2H8PA 1JNHA 2Z8WC 5ALBL 3PL6D 2IAMA 1MCHA 4FQ2L 5C0BA 3KXFA 1DQLL 5IBUB 1YUHA 1U8HB 2DTML 3VH8G 5ICZA 1NFDA 3KYNA 5E1AA 4L3CA 5J13B 3MLRL 4QHKI 2X70A 2HYMA 1QA9A 5FYKE 2AW2A 5I1CH 1I3GH 5HHVL 4MNGA 4HPYL 4P2RE 1GGYA 1ROWA 4LSTH 5B8CC 2E7CA 5KSAD 1QLFB 2EIEA 1MCQA 2ZUWA 1VA9A 2IC2A 2R29H 3GUTA 2PYEE 4JFPB 5CEXB 3OZ9L 4M7LH 3VXOB 4IDJL 3N1FC 3QAZB 1CD1B 2FNBA 1OGAB 4Y89A 4KK8C 1LWRA 4X9HA 1I9EA 1MLBB 5M94B 3TIEA 3QNYA 5CJBA 4Y16A 5D71L 5E4EC 5B8CB 1FC1A 5F3BB 4JO1L 1H5BC 1ZT7B 2NY6D 2QKIA 3OMZA 1OF2B 5ETUB 1M1SA 4JHAH 4LIQH 4ZD3H 1NBVH 1MFAH 1BQUA 4J4PD 4C4KT 4OFYD 4Q2ZA 4UDUA 1XCQB 5AUMB 4P4RB 3V4UL 3RVWD 3S96A 5IF0A 2NXYD 1UCBH 3GMRB 4UT7L 5DR5H 1UA6H 3FO0H 1H5BB 5CUSL 5EBMA 4YC2B 4TPRH 5DRXA 2FB4L 3QDJE 4WGWB 4GG6B 1XZ0A 5BVPH 3M8OL 3SGKC 4K7PY 4X7FC 2P24A 3QQNA 3THMH 5GRUL 1PSKH 5DEGA 2DTSA 4MYWB 2FSEB 4U2YA 4X6EB 1BBJB 1HHKA 3KPSA 1A4KB 1IBGH 3S36X 2ICWJ 1NL0H 2A74B 4MD5A 1FFNA 2BY3A 3AC0A 3IRZA 4XCCL 2BVQB 1NJ9A 5D7JC 3ARDA 3FRPA 4PP2B 3VRLF 2DQIH 5I2IA 1OGAE 3C60C 4R6UA 4HXAH 4M6ML 2CO7B 3H9SD 4MA8H 3QIBD 3QDMD 2HTLC 4XP5H 2VQ1B 2YPKA 2R0WL 5ID1B 1A1OA 3QFDB 3QRGL 1MHCA 5C0GB 1AI1H 3S9DB 5HHXH 4F7TB 5IVXA 2WZPD 5INDA 3TO4D 1AD0A 4PV8B 3D39D 2IBZY 1HEZB 3GGWB 1K3IA 1QZ1A 5D2NA 5E2UL 4MCZA 5C07E 2AABH 3U4AA 2G60H 4DVBB 3T77B 5EB9A 5IR1A 1F90L 1R5VB 4L1HA 2WW8A 2QQLL 3KYKH 4WI3A 1FNHA 5F70A 2JF1A 4ZFOB 4ZFFA 1I1RA 2UZXB 5CJ8A 4LSSL 1BWWA 5MI0C 3NPSC 3MLYH 4WEMB 1S5IH 1CIDA 2HN7A 3BO8A 1NCDL 2APXA 2G9HB 4FQQA 3V6OE 2AJ3A 1QRNB 3QUMH 1JPST 3OHXB 4KDTC 3IDJA 4LKCA 1YY8B 2WUBH 5EU6E 1FP5A 4QWWC 3ARRA 2BVOA 2IPKA 3S35L 5MERA 3CXHK 3KWWB 4F3FB 1GZPA 5JXAH 1E28B 4GG6F 1MAJA 2B5IC 2QSTA 4OLXH 3WXVH 3MRDA 5H8DA 1TVBB 5CGMA 3QXUA 4Z0XB 3QCUH 3MX0A 2XPGA 4XCNB 2IANB 1K4CB 4HUXA 4NZTL 2C4XA 3O6FC 1H9VA 1I7TA 4LVNB 4FRWA 1MQ8A 1C16B 4H5SA 4AENB 3NZHL 4Q9CA 1NCCL 3LKPB 3QZWG 2DLHA 4UTAL 2Z91A 1FORL 4NHCL 3AREB 4GMTH 5GGVH 4PRPD 1C12B 2B5IB 2KH2B 1FJ1A 3HZYA 1A6UH 2JJUA 3HI5H 1KB5A 4MCYB 4MZ2A 3UO1H 4HJJH 4GKZA 2RJMA 4N8VB 5DVMA 5J12B 2XRAH 1G6VK 1OAUL 3RVVC 5L8LB 3ELAT 3IGAA 4U1IB 3V5DB 3BE1H 3O6FB 1JZ6A 1RJCA 4XWOD 5JNYA 3C8DA 1I9RH 1CZ8L 4ZNEA 3O8XC 3OKEB 4BFIB 3CLEL 4NDMB 1LGVA 3WJJC 1BZQK 5CBAA 1QRNE 1UWGL 5H2BA 1CLCA 2AEWA 3WDIA 4OZHA 5E2WH 4DVRH 1O5DT 3VFNA 4H0GA 4J4PA 4JCMA 1NDMA 5DO2D 3MNZB 1NCAH 1H8NA 3P9WB 2YOCA 1L6ZA 4NGHH 3VGGA 4LHUA 1MFEH 1RUPH 1FYTD 4WFFE 1INQA 1F00I 3O8XB 5LAXA 4UINL 3Q1SH 3AY4A 4XVTH 4QF1B 3B3IB 3QQ4B 2NY7L 4OCXH 2IANE 5EC1A 2ESVA 4I3RH 2BJMH 4M43H 3MRMA 4Q58C 3TH4T 1FZKB 3N1GC 4QRTA 3SQOH 2XKNB 4HCRH 4HMDA 1A3RL 1SHMA 4I0CC 4HIJA 1U93A 4OCSH 5D6DC 2CRMA 4XPGL 3T0EC 1S7TB 3K1DA 1ORSB 4QRQA 1X44A 3KNBA 1IGMH 2DAVA 1OARL 3H9SA 2A2QT 3QDMA 2G5BB 4HQQH 3BIAX 3RVXD 1I3RB 3KLDA 5GGUA 4UZGA 1QFWH 2Y6SC 4H0IA 3E6FA 2X41A 4KKLC 4OAWB 2H45A 2YBRA 4JPWH 3O45B 3QISA 1CQYA 5EG6C 3D39A 3T0EB 1F4XL 4R26L 4IMKA 3QWOA 1JRHH 3DRQB 3U7YH 2KPNA 2XYCA 4MWFB 4TULL 4UI2A 4Y5VC 3WEXB 1NCNA 1MCKA 4K3HA 4V1DB 3BH9B 3VWKA 3CGTA 4ZOCA 1JZ5A 3VU2A 5IHZA 5FO9B 4MNQB 4HC1H 4JJHA 4XVSH 4WDIB 3QHZL 1MCOL 4PJ9D 2ZG2A 4TUOA 2FEDD 4I4WB 5I18L 2DQGH 1LO5A 4KY1H 5C2BH 1CCZA 2EXWC 1U36A 4WCYH 1P1ZA 5DJ6B 2VDMH 2MKLC 2BP3A 2GK0A 4HUKB 4OD3L 1FNSL 3QUYD 3GNML 5IQ9B 1BECA 1H3PH 4N9GA 3WHE0 2D7QA 1HE7A 5FF6B 2ZNXA 2XTJD 4Y1AB 4N0CC 3I85A 5IB3A 2HLFD 4IMLB 5L0QC 4NQEB 5EWIL 1JN6A 1MFBL 4H1LA 1N7MH 4R7NA 2EKSB 3NCJL 5HHPB 3BVNA 1PEZA 5HI3C 4FZ8L 4JN1L 1DUZB 2IH1A 3S3SA 5HSFA 3V7AG 4ONGL 4HK3J 1HSBA 4WW1B 3W11C 4Z5RB 3ARFA 4NC2B 1KCUL 4PRPA 2DQDL 3QCTH 5L0QB 1OSPH 4YHLL 3BP5B 4V1DE 4RQQA 3QIUA 3Q6FB 1YMHB 2BY0A 2EEBA 3UZEA 5CEZD 3WIFA 4JGJA 4NM8L 4LSUH 5I1LA 5DTFB 5F72S 1DLFH 1U2CA 3GI8H 1MIEL 4N0FB 1FL5A 4Z7QE 3MOBL 5IFHH 1OTUD 3BP4A 5DC9B 2WQRA 4P0DA 4LLMB 1WBXB 4D9LL 4G9FB 1YEHL 2ARWA 4HF5L 5HHOA 4EUPG 1J1XL 4LSVL 4UIMB 3SHSA 2YPLA 4XVJH 2J8HA 4Y1AE 3QZWB 4FXGA 3UYPA 4NQEE 1VENA 4Z7QF 5KVEH 2N56A 3FB5A 1U8IA 1UC6A 1M7IB 4EBQH 5IG7B 1DE4B 3OAZK 3BUTA 4ZPVA 2LV4A 3GFUA 1FZMA 5GGRY 1P4IL 1A3LH 3SGJC 3TNNA 6FABH 3O6LH 3RDTB 5HPMA 1MCLA 4D9RE 5BW7A 3RL2A 3ROOB 2B39A 4G8GA 5DD0H 4DGYH 1TQBC 3O4LD 3ILPB 3BWAB 2FO4A 4XNXL 1ZA6A 3ZTJH 1FC2D 2CJUL 4R7DB 5D5MA 5TDOA 3EYQC 5EOQH 1SJVA 4JKLA 2OK0H 1KV3A 4M7KH 5HHQA 1R5IB 4ZFGL 4WO4D 5KZCD 1Z2KA 3JXAA 4R0LC 3PP4H 1H0DB 3BDYH 1PGRB 1UWXK 2C3HA 2HRLA 3DV4A 4M61A 3VG9B 1IM9D 2Y72A 4M7ZC 3I3BA 2DJSA 3T3PE 4EJ1C 4O58L 2R0ZH 3UBXI 1T1XB 5DK0A 4GXUN 2HT4C 1TCMA 2EIBA 3T0AA 4EDWH 3FKUS 1FL3B 4NKMB 4WWKD 3GJFA 5JXEC 2MNUA 1LD9B 2X4PB 1T83A 3ARXA 4ODSH 4R0LB 1G7LA 1Y0LA 4KKNA 4PJ9A 1H15A 1GL4B 5C0CB 3RNKA 3T3PF 3TWCL 1RUKH 3MXVH 5B4MD 3BQUD 4M7ZB 1OD7A 2HJKA 5JPMB 1YN6A 1IEHA 1RD6A 2NYYC 2WWMC 1EO7A 1OAYH 3EYSL 4M1GL 1S7QB 1DQML 2VN7A 3PHOA 5IQ7L 5EU4A 4E41D 5BV7L 4M48L 2A83A 4RFEB 4X4MA 4ZYKB 1K6QH 5DK2A 1QHPA 4Z78A 1RK1B 3CK0L 4DKEL 4PJ7E 3RX5A 3BISA 3AMKA 3OGOE 1FL6B 1U8NA 1YNLL 4WTZG 4F15C 4CU6A 1HDMB 1EBPA 5HYEA 3UPRB 5ICXA 3VFTA 5GSRB 4NC0B 5BVJA 4AEHH 3SQBA 2BSRB 5DJCB 4PJ7F 4HKZA 4NRXA 3OKKB 2QTEA 2V2WA 2OZ4A 4OQTA 3BPCA 4LMQI 3ZL4H 1LK2B 2BMKA 1T1ZA 4ODWA 4Y4HC 3GJFK 5FM5O 3HG1D 4F15B 4W70A 2J8UA 5CLWA 3JTSB 3MRLB 5F9JA 1FH5H 3I6LD 3N85L 3OAYK 3PV6B 1KPRB 3ZKSD 1DP0A 1E4WH 2YD3A 2BHYA 1J8KA 3VXRA 1KNOA 2CDEB 4JO2H 1YNTB 4M6OL 3RQ3A 3K80A 3ROLB 8CGTA 3N06B 3TBWA 5DVNA 1MRFH 1NC2D 4AK1A 4JFFE 1LO2H 1H3TA 4JHBA 5TQ0L 4J3VA 1S7VB 4P23A 1BOYA 5DJ2B 4Y4HB 1NBYB 2P7TA 4UBDD 4AL8H 5E2VH 3WIHH 1D9KC 2KDGA 4PGBA 3E8UH 3ZYZA 4JFOA 4QXUL 3H9ZA 3WD5H 4NQUA 1B0RB 4J6RH 2UWEA 3EO0B 4WW2A 2ADIA 2JELL 4Z7VA 4PP1C 1R3IL 5T5FH 5JW4M 1ES0B 2VL5A 1WFTA 2X7LB 3QO0B 5E8PA 4NKOB 2Z31D 4JZOB 5DEFB 3MRIB 2AS5M 1JNJA 3HE6D 1UM4H 4KTDL 3W2DL 2E6QA 1CXLA 2NR6C 4YIQA 3OPZL 5C0DB 1AXTH 1BIIB 5IBLD 1ZLSH 4CU7A 1D9KB 2PW2B 5BQ7B 3QH3A 4NOFA 1KTDB 3EFDL 4KFZC 2O26U 3V4PL 3ZO0A 3VFMA 3V52L 1R3KB 4FTVA 1MIML 1JV5A 3O4LA 3X14B 1S7RA 1S7UA 3PGDA 2HH0L 1I85C 2X4TA 3BRDA 5D7LE 5AZ2H 4WO4A 4EUPB 2DLFH 2SEBA 3KLSA 2DDQH 5J4MA 2C7UB 1BLNA 3QEGH 43C9A 1T0MB 3RWGA 2PO6A 5EIIA 1IM9A 1Q72L 4POZC 2MHAB 3X13A 5JHLH 1IAKA 1NGXB 3MUHL 1MJUH 3U7WH 1T7WA 3WFBH 3MJGX 1ORQA 2IPUG 35C8H 4PBVC 4F2MA 1R3LA 1NANH 4JO3L 1IGIH 2JJSA 5D1ZD 1N5AB 3GMNB 3OX8A 5ACZB 1DUYB 3D2UD 4FZEL 3MV11 2AXGB 4GLRH 3BIKA 5IVZA 4X9BA 2I9LA 4WWKA 1KG0B 1G0YR 1RZGB 5ITFA 3V7AE 2DLTA 2BNRD 5D2LA 1U8MB 4CAGA 3G6AA 5INCA 3PWUB 3BQUA 2NX5D 2VZOA 4EXKA 5GGQL 1IQDA 4JGMA 4LAJH 4ZUUB 4YXLH 2QQNH 1QTYT 1X7QB 1MJ8H 2APTA 1NLDL 4BZ1L 5DUBB 2OQJA 1BEYL 3P4OB 5IJVB 2IMNA 3LSOB 3L1OL 4NN5C 2Q6WB 3LHPH 2VWEC 1CT8B 5CJOH 5EU7C 4R90H 4X6DE 2BNQB 3U79A 1D5BA 4PYHA 1UXWA 2XN9A 3CAFA 3C2AL 3KDMA 3CPLA 4HKXB 1NCWL 4QRUA 1QSFE 4M6NL 4PJFE 1PLGH 4NN5B 4X6DF 4ELKB 5CZKA 5BV7C 2CIIB 5C0RL 5LGHL 1J0KA 5IFAL 2HAZA 5I1DB 3HG1A 2I9TB 4W68A 3RWJB 3ETBF 4RGOH 3TN0A 3I2CH 3TBSA 4YJZL 5BOZG 4UQ3A 4XP1L 2BVTA 5F7WC 4PJGA 4I48A 2AGJL 1LO4H 4XXCA 4CUCA 2NNAB 1GZQB 3G04B 2VR4A 3QBTB 5T3XD 4OFKA 1NC2A 1SYVA 3IVKB 3SE9L 3QYCA 1UWXH 4L4VE 4MD4B 4HLZH 5HI5C 4TSCH 3V5HA 4XTRC 3AU1A 1GPOH 4OZIE 3KGRA 3LRGA 3TFKD 5T1KA 4HIHB 5JHDA 2CRIA 4Z7OE 2AKRB 5TDNA 3RGVD 2V2XB 1N0XL 1P69B 4NO3A 2BNQE 5CBEB 4DUVA 4G9DA 1MJ7L 4HIIA 4JEGB 1OW0A 1JWMB 4LAQH 4JM2D 4GAGL 5DQJB 2BC4A 2AK4B 2H1PH 5F88B 4PLJD 5C6PB 4XB8A 2ADJA 2LU7A 4OGXL 4OZIF 1NC4D 3I6KB 4Z7OF 3BP6B 3UTSD 1GHFH 1RUMH 1RQ5A 1DQQA 4BKLB 4YHIB 3VFVA 1B6DA 4P49A 5EU5A 4CW1A 2F53B 5HD8C 1INDL 3IDGA 2VZ1A 1MFCH 4AIZA 1KIQA 4H25A 5FO8B 2Z35A 5C0JA 3MGOA 4ZS7L 1NCTA 3IYLW 4LLWB 4NQDD 2FATH 5I8KH 3IFNH 3L7FA 5IEKB 5KOMC 2V2TB 1EVUA 1T3FB 3MFGB 3B5TA 4NKQB 5SWZA 2KZ1B 4I0PC 3IDXH 4O2FA 1JPGB 3MODL 4G6FB 3F7YB 4Y2OA 1R3JA 1GGBH 2IFFH 5IW1A 3A6BL 5AWNH 1U8KB 5TE6L 2XZZA 3OJDB 3D2UA 1XF5A 5C0AA 5LBSL 4LLDB 2W9DL 5KVFH 3C6SB 3FCTB 3NTCL 4U1JB 1N5YL 2BNRA 1JGDB 2OX5A 4KI5D 3HMXA 1U8QA 1DBJH 5ACMA 5SV3A 5EO9B 3N1MC 2BSSA 1JTOA 1CFVL 5CSBA 5GQBA 1IZKA 3OAYH 2NLJA 1MEXL 5GRXG 4S1DC 2W59A 3V0VA 4UDTA 3GSNL 2EYTB 3OB0K 3FB6B 3W81A 4BH8A 4M8QA 1C7TA 1JP5A 5KG9B 5JQHC 1EFXD 4K2UL 3NFSH 2HJFA 3RVTD 4CVZA 1F4XH 3GM8A 1RUAH 1PJ9A 1JHKH 1MLCA 3AS3A 3BEWA 4CKVX 2PTUA 4PJAB 1W72A 4ENED 4XP9L 1A7BA 2VC2H 3RRQA 3HE7D 3ZHKA 2VR9A 4EI5A 2J12B 4KKBC 3SO3C 3CVIH 3PNWB 2EH7H 1Y6MR 1PQZB 5LQBL 5F8QC 3SKMB 2VUYA 3GSVB 3RIFF 4JKKA 3IFOB 3QO1A 3QHFL 5IK3A 1IEAA 1KSRA 1LK3H 4XNMB 2CKBH 3LY6A 1QR1B 5DJDB 1VKXB 1BQHA 1FZOA 3GSXB 1YQVH 2YEZB 3QI9B 4YNYA 5EORH 3SO3B 4WHTB 1FAKT 1PG7H 1RU9L 3DUUB 5EPMA 3RKPA 2XIDA 3L3IB 2A9NL 1TQCB 4K23L 2X2YA 4Y5XC 4AEFA 5IHUL 1AR2A 1ERNA 4IM8A 4LIQE 4TUKH 1OVZA 4QRRD 3LPWA 1OPGH 4ZAKD 3RIAF 4MAYD 2F5BL 4MDIB 3AROA 5TE7L 3VXTA 3KLHD 3QEQE 1YEKL 3WS3B 5CLTA 2PW1A 1HZHH 1MCNA 3AGVA 2FZ3B 5TGBB 4BM7A 3HTLX 1JF6A 3UBXA 2OJZH 3KPMA 4WRLA 3F12B 2F54E 4FMFA 1MCCA 1QPPA 1A6TB 2JJTC 2AV1B 2ZUYA 2R2HB 4OZGA 1T20A 5DMGD 5GGSY 2OR9L 3GHEH 1PZ5A 4Y88A 2D4DA 3UTTD 3MXWH 3CDGB 2OMNA 3FN9A 4GMSL 2R56H 1KLGB 3A6CL 4U1MA 3B9AA 3KPNB 5JOFA 3BW9B 4E42A 1DFBH 3BKJL 2FR4A 1GOGA 3MQIA 3VXSB 3V4VL 4XPHL 3MREB 1MF2H 4KMTL 1DQJA 2DF3A 3RL1B 2CK0H 4NQCE 1A9EB 5JMOC 3SGDI 4CDHA 5JW5B 2AEQH 1S3KH 3UTPD 2Q7NA 1SEQL 2I60H 1Z0NA 3W0WE 4ETQA 5DD1H 1JE6A 4OD1H 5HGAB 1G7PA 3TYFA 4CNIA 2FX9H 3V0WL 4XNZC 1I8IA 4WU7B 1WGOA 1S9WB 1JNNH 1CLOH 2VXQH 1WTLA 3HS0B 4XT1C 3IDUA 4P5TA 4GW5A 3QWRD 4TUJA 4NQVB 2GJ6D 3IXAB 3SBWC 4F7EB 1F3DJ 3FQUA 2EZ0D 2JJVA 4KAQL 5D6CB 3RA7H 3ZTJG 1X5AA 3VFSB 2EIDA 3CSYB 5EA0H 2PYFA 3H7BB 5ALCL 1VGKB 3GKZA 2FD6L 4APQC 4K3EL 4MA1C 1FE8H 4XNZB 4U1KA 3T04D 4QHLA 2VLRA 5HYJE 5JW3H 1LEIB 4NO0A 4MB5A 1FCCA 3WE6A 2OJEB 1CR9L 4MQSB 4L8CA 5AYUH 1WITA 3G5XB 2JK5B 3LH2H 2D31A 5HVGB 5C92A 4WVRA 4XPAL 1KCSH 1L7TH 3VXSE 1A6ZB 1KCRH 4RAUB 4KJPD 4YXHH 5F97E 3VXMA 1QPXA 4LCIL 2ATKB 3MMEA 1EDQA 4APQB 1QSED 3QNXA 4OZ4A 2BXZA 1FG2B 3CZFA 2JB5L 1IAOA 1ULVA 1EEZB 4UV7H 3N9GL 5FUOL 5FYLD 1S7SA 1RAMA 4NKDB 2IPTH 1BMGA 3K2MC 4JG0L 1ZGLA 4F9PC 5CJXA 3GBMH 4P2OD 3ZLQC 3PWPA 2N4IA 3REWA 4J3XA 3R0NA 4G8IA 1KTLB 1AGCA 4K7PX 1AP2A 1XF2B 1Q0YL 2NW2B 1MI5D 4MJ5B 4J2XA 4HUUB 4G43B 1ZEAH 1LO3H 3FJTA 4YHZL 3GJEB 3GSNB 3A67H 4QRRA 3FOLA 4GAYA 3WN5C 3KPTA 4ZAKA 4N5ED 3CCHB 5HYSG 4P9MH 2HVJB 4GBXC 1PDKA 3MV7B 2XY1A 5LWYL 1QEWB 5L2KB 4LLVA 3CSBA 3FAWA 4J3SA 4CMHB 3FRUB 2XZCH 3L7EA 4A6YA 1JGEB 2Z93B 1KB5L 1DJSA 4OSUL 1NEZG 4QRPB 4BZ2H 2BOCA 4P3CH 1EMTL 4KJWC 2IBZX 5J0BA 5IB2A 5EZOL 2W9EH 4HHAB 4PY7B 1JHTB 1U8LA 4UILL 3MLVL 1T5WA 2F8VA 2NY2B 4LSQH 4ZUSB 2WAHA 2G2RA 3LQZA 1JNHB 4MJ4A 5C0FB 1HYSD 1IM3A 1ODAA 5C0BB 3ECBA 3KXFB 1AFVH 1OAZL 3RUGB 2A9ML 5B38A 2NCMA 1S9YA 4L3CB 4KU1A 3SE4C 1PW3A 5D1XD 4LDEB 4R3SB 4RMQA 1UACH 5D7IA 5GIRB 2VDLH 2Y06H 1F4YH 3SDCA 4MNGB 1IC7L 4MS8C 2W65A 2MKWA 2R2BB 4Y16C 3LKNA 5JPNA 4L3EB 3I50L 4WFHE 2F8XC 3ZDXF 2VOTA 2DQFA 1BD2E 2CLVA 5E2TL 1A8JH 2ZG1A 3MJ6A 5CGTA 5GPRA 3MV7E 5BRZA 3H7LA 4HJGA 3SO5A 3D9AH 5L2KE 3SDDD 3B8YA 3HC0B 3T1WA 5C0IA 3RU8L 2ZOLA 3EYVB 2B1HH 1E4XH 3LD8C 4NNXA 3QWRA 1HOCA 4FFYH 3DRTA 5HPOA 2H41A 2XWBB 4RRPA 3S36H 3QNYB 4F7CA 1FAIL 2H2PC 3LKRA 2CQVA 3QUKA 2MCPH 4JFED 2FJGA 2QKIB 3EYUH 4PRIA 3LN5B 3RX8A 3BGFC 4XB7A 2FDBP 1EV2E 3T0XA 3BZEB 2NW3B 4JB9H 3RPKA 4Q2ZB 1L0XA 2DYPA 1SVZA 4N0YL 3LDBC 3U6RA 3RUGE 5CZVH 4JKPL 5DRXB 3ARDC 4JFHE 4PJ8A 2QLVB 3BKCH 1K5NB 1QSEA 5HGHA 3BGFB 1N6UA 4HWEL 1YECH 4TVPD 4HS3B 3RWFB 2OTWB 4X6BB 4TOYL 5DEGB 4JFYA 2Q76A 4WY7L 3RI5K 3QULA 2FLBT 3VMOA 5J11C 2XWTB 3RUGF 4HKJB 1PY9A 1D5XB 2FO1A 1ADQH 3KPSB 5FHBL 3FQNB 3EUUA 4OV5B 1FLRL 4LSPH 5FUZL 5KANI 5GZNC 5BS0A 3QCVL 3VG0H 1U3HA 4NHUA 5DA4A 3DHJA 4Q0XL 4MD0A 1BEYH 1CGTA 5SX4I 4GRMA 3ZT6A 2I07A 5KOVC 4PJBA 2HT3C 4LPTA 2BOBB 3P3YA 1TVHA 1C08A 2C9AA 1A1OB 5FGBA 2DN7A 5J11B 3MLZL 4AG4L 1TZGH 2YXFA 4LCWD 3T8XB 2J4WL 5INDB 3VXUD 4FQHA 2FHCA 1XGRA 3IETA 2VXVH 3S6CA 3Q2CA 1JZ2A 3FMGL 1MFDL 4DW2H 2P5WD 4HBCH 1CGWA 5FV2A 3PQYD 4NQXB 1DQDH 5AZEH 3MUGA 2HA1A 2RFXB 1WFUA 1IT9L 4PD4J 4BQCA 4JFDE 4ZFFB 4XHQA 4R4NC 2UYLB 1PKQA 3UP1A 4HGWA 4LPXA 3DO7B 4L4TA 4NUJB 3QUXD 3BO8B 3D3VE 4FQQB 1CFNA 2AJ3B 1RZ8A 4JPKH 5CMAA 3ZDZE 3KR3L 1N6QH 4XP6H 2VXSL 4KHXH 4AH2B 2BZDA 3T4AB 5DC0A 1CVRA 5DD5H 3PL6B 5KSAC 1T6VN 3CVHH 1PG7W 2DWEB 1CBVL 4PUBL 1ZHLA 5EOTB 4OIBA 2H3NA 5HYSB 5EZLA 3MRDB 4I9WE 1ZWIA 4HLZG 3ZDZF 3E3QE 2R8SH 4ODUA 1MRDL 4RA0C 3T0DA 4KMQA 5DJ8B 2A73A 1SYSB 4LOUD 5F6HJ 2ICEB 2DICA 4U1SA 1YMMA 3KLAA 1RIUH 1JFQL 4OLVL 4H5SB 5KSAB 1BVLB 1NEZB 3LQAL 4J3UA 4LK4A 4P5KA 4FFWC 2Z91B 1TVDA 4L4JA 1P4BL 2NY6C 4OLEA 3PWLB 2NY0D 2HLAB 2C3GA 4R4FH 2VKWA 3FO2A 4DKFH 3TVMD 3VD4A 1S9XA 4KZDL 3R06B 4J4PC 1KTKE 4GKZB 3QXVA 12E8L 1R0AH 1HINL 4KWUA 1CDBA 1CVSC 4XBPA 3IAQA 3RVWC 3IGAB 4ALAL 2NXYC 3O11A 4ONFH 4RIRB 4XCEA 3C5SB 5JDSA 5E70A 1PFCA 5HYQB 1RZKH 2VLJA 5JTWA 4RISL 2NY6B 3AY4C 4NPYA 5E7FA 5F1SA 3WUWG 4X98B 3BAEH 3CX2A 1SJEB 4Z0BL 1BBDL 3RY4A 5DRZA 1QKZH 2W38A 4TTDD 1KN2L 3SGEI 3CFEA 5HHMD 5C0NC 2NXYB 3MODH 1XGQA 1F4HA 2GJZA 2YUXA 4LCYA 4ORGA 1INQB 2ADGB 2YWYA 2X1QA 4XNUL 5LAXB 2CR3A 1BX2B 1KIRA 1FFRA 3QIBC 1N5YH 5TPWL 1C5CH 4X4YA 2OCFD 3RAJL 2Z8SA 1CFVH 1TDQA 2NY4D 1T7ZA 4XP4H 2IADA 2AV7A 4FNLL 3MRCA 1CLZH 1HWGB 5CIPH 4IMKC 3FQTA 1JIBA 4EEEA 1DBKH 4PV9B 2VZTA 3DURA 4S1QL 4PPTA 4YBQD 4RFOL 3KNBB 1KCVL 3VWKC 4PRAA 3O9WD 5DVOA 3H9SB 4UIKH 1MQKH 3QIBB 3QDMB 5E99L 4X99B 4JR9L 3JWOL 3UYOD 1B2WH 3FQRB 1GH7A 1LEGA 3PABB 4YDJB 5T33L 4PTUA 5AG8A 2CXKA 2VH5L 4YUEL 5KAQG 4LCWA 3E6FB 1U92A 4RSVA 3TO4B 3VXUA 3WMSA 4AT6A 4IRSD 3D39B 4PG9A 2ZUTA 3KJ4C 1RZJH 1I9JH 1ZSDA 2P5WA 1OP5K 3TT1L 2DWDA 4YAQA 4XH2A 2OZ4L 1XF4A 2MQ3A 3CLFL 2WLZA 4OQTL 2W0FA 3SDAA 4YFLF 5IGXH 5IHZB 1DBAL 3S4SG 4KRMB 4XNYL 4R97C 4Y4KA 4XI5D 5CEZL 4ORZC 3DWTA 1P1ZB 3CFBB 3KJ4B 4LKXA 3UCRA 3FFDB 3T65B 4BH7A 2ZOKA 3MV9A 4H8WH 4QXGL 1EHLL 3I9GH 3G08A 2PYED 3TBTA 5I19H 3DGCR 1CK0H 3ZTNH 4PJ5A 3MV01 1B0GA 1FVDB 1HHGA 4NNYB 1U0QA 1X5GA 3ARFC 4U6YB 2WBWB 5IB3B 4X80L 3QIUC 3JV6A 1A21A 3W9DB 4U6TA 1RIVL 1MY7A 2FX8H 5DHYA 2NMSA 4E0RB 5IBTH 3UC0H 4HFWA 3BVNB 4I2XA 2CMRL 5I8CB 1XGYL 2UVEA 4XWOC 4EZMA 1EVTC 1NBZA 4K7FA 4R9HA 1AGBA 1P84K 4PRPB 5GGTA 3GMOB 4NZJA 2ZCKL 1AHWA 2LFGA 1U8OB 1NCBH 3P0YH 1JUFA 3VRIB 2HWZH 3ES6B 2BVPA 3V6FB 3K4AA 4X5WA 1A4JA 4Z7UE 4O2EB 5ICYB 2QADD 4L8DA 2VDOH 4Z18A 5I1LB 5ESVA 4M1DL 5DQDL 3RX7A 3TPUB 3G5VB 3VFUA 1I7UB 4YFEA 1FL5B 4KQ4H 3LQAC 1NBQA 4L5FH 5IMLA 2B0SL 5FB8B 2QEJA 5BW7C 5K9QG 3U0PA 3QEHA 1M05A 4OIIL 2R0LH 1MY5A 4H20L 1ETZA 1ZHBB 4MJ6A 5EFIA 3UYRH 1G7HA 1FYTB 4FXLA 3LMJL 3UJIH 4YHPA 1ZAGA 3MLXH 1PX4A 4ZPVB 5FM8A 1E6JL 5HDBE 4F7PB 3MLTA 2D3VA 2VXUH 3JWDH 1BAFH 3B2VH 5HPMB 1J5OL 5C07D 1GIGL 1YEDB 5FYLH 4CU8A 3CUPB 4FXKA 3IDYC 2FO4B 2HMIC 1ZA6B 3PHSA 3STZB 3MBXL 1T2JA 5GJTL 3WUWB 2R9HD 3FT2A 5GHWL 5F7EL 3IB4A 4OCLC 5HDBF 3M17A 4OUUA 2CLZB 1TZHB 2MPAH 3R1GH 1LE9A 4JHWH 5L2JB 1QFUH 1DDHA 1CE1L 2M2DA 2OTUB 2ERJC 1P9MA 2OM5A 4PJ9C 1WIUA 2FEDC 2GTWA 3DV4B 4KQ3H 3CXDH 3D87B 4KH2A 1IGFL 5E00A 1UYWH 1LDPL 3BJLA 3SN6N 5J6GB 4ZSOA 1VDGA 3IDYB 3NBNA 3ESVF 2ORBL 5EU6D 5E9DE 2I25N 2D0HA 1T03H 4YX2H 4LARH 4DN4H 4LASL 4CBPA 3GK8H 3O3AB 4UTBL 1EAPB 1VESA 3DX9B 3GJFB 2F9BT 4J8RA 2ERJB 3T2NL 4ELME 2VDNH 4PJ9B 4XXDA 3BSZH 1FYTE 1GXEA 3HC3L 2NZ9C 3IF1B 2YRLA 1IEBB 1A6VH 3JWOC 1SY6H 1G7IB 4P2RA 3TO2A 2HJKB 7CGTA 1YN6B 3U0WL 5F1KC 1IGYB 3HZKA 1A14L 3RNQA 2XWJA 3QUYB 4JFZL 4ELMF 2PYEA 2X1WL 1I4FB 1WCBA 2B2XL 2HVKA 1P7QD 2XTJB 5DK2B 4Z78B 4AIOA 1I8KA 1A2YB 4N1HB 1N2RA 1NGWB 3P4MB 2P48B 4Q9QL 3VFRA 4DKAA 3ZSSA 1U8NB 2YPVH 3VFPA 3U0TA 2JB6B 3M1BA 4FQXD 4PJHE 1IVLA 4MX7A 3L3JB 5EN2A 5ICXB 2DQJL 1XEDA 5CWSB 3S4SB 2HJLA 1AO7D 2Y7QB 3QPQC 4XC3L 4WGVB 5HVHC 1MHEA 2F74A 4NRXB 1IQWL 3L5XL 4RCAA 5ESQA 4OF8A 3WFDL 2CKBB 1JI1A 2A38A 2DL2A 2BRRL 3IFLL 1OTUC 2BMKB 3VWJD 2DBLH 4MDJA 4HZAA 1TETH 2LVCA 1KLUB 1CL7I 1U8HA 4KVCH 4CADB 3EO1B 5F9JB 3UMTA 4KVNH 5CP7A 3QDJA 2OMBA 3DYPA 3S34L 5HVHB 1HSAB 5C9KA 1EFQA 4TQEH 3F6LA 7FABH 4MXWH 2VISA 1AR1D 1U6AL 1QLFA 3HMWL 4GRWH 4B7IA 2FEEI 1G7QA 1JPSL 2OYPA 3BT2H 4JFPA 5F1OB 5CEXA 1CU4L 4JFOB 1LVEA 2XACC 1YEIH 2XTJE 3VXOA 3MA7A 2ADIB 3KPQB 1R3HB 1CD1A 1OP5H 3U46B 4MXQD 1OGAA 3T0BA 3KYAA 1D6VL 2BVYA 2VL5B 1INEL 3VDCA 5IFJB 2HFEA 2EIZB 1MLBA 4K71C 3TV3H 1RZIB 3UJJL 5B8CA 3HMXL 5FECB 3GSQB 4WO4C 3K3QA 4X7DC 5F3BA 3GIZL 5C08E 3IS0X 2Z4QB 2C1PA 5KAQF 1UKQA 1OF2A 4TVPH 1EHNA 3MJ9A 2IQ9H 4X9GA 5ETUA 3WLBB 4JRYD 3V5KB 5E6ID 5A2JH 1JV5B 3O4LB 3PV7A 1XCQA 3LKOB 1PKOA 5AUMA 4P4RA 2FHBA 3TH3T 4Z95L 3V6BR 4N5UA 3H3PL 2OXHA 3GMRA 4WO4B 4WWKC 3B9DA 1VEMA 4ZO8A 5KZCB 1OCWH 3MRRB 4GG6A 1AE6L 2P8LB 3LEVL 2JE8A 3WFHA 1GRWA 1NGYA 3V6OA 43C9B 1W72L 2VL4A 1IM9B 1TMCB 1IAIL 4ZOAA 1F3DH 1QYGL 1HHIB 3X13B 2DBJA 3BQUC 1N64H 5DGRA 1R3LB 2FSEA 3SGDH 4GW4B 4X6EA 5JUEH 1BBJA 3OX8B 4CJ1A 2A74A 1B88A 5IVZB 15C8L 1IAMA 4WWKB 5MEQA 2BVQA 4P46D 1FIEA 4PP2A 4MAUL 2DQTL 4PRDA 4TNVF 4U7MA 4QXTB 2D7PA 3G6AB 1MCPL 1JZ4A 2D03L 3F7PC 4QT5B 3BQUB 1BM3H 3VXPA 2P4AB 4O4YL 3CFIC 2QHRL 5C0GA 4F7TA 4YXKL 3S3PA 3ZYJA 5FGSA 3F7RA 2QSVA 4PV8A 3CU7A 3GGWA 1TJIH 3QPXH 4E41B 1JYWA 2HKFL 3UPCA 4NP4L 5L7XH 3L3DB 5DMKA 2DS4A 1P7QA 3EJZD 3IKCB 1GVIA 3FB8A 4RAVB 2P44B 2Y23A 1R5VA 4P3DB 4D3CL 4OLZL 1CXKA 4CJ0A 4ONHB 3ME0A 2A1WL 2QV2A 2A0LC 1KYOK 5DF0A 4LLYB 2O5XH 1IZJA 3CPLB 1NMCC 2EDKA 1ZLUK 4QRUB 1QRNA 4XXCC 1IRAY 4M7LT 3OHXA 1N26A 1K8IB 4HBQA 4X4XB 4XGZA 4QLRA 3Q5YA 6CGTA 4ERSH 4DN3L 3LIZL 3SJVD 1H3XA 3HG1B 4UBDC 1E28A 4I8DA 2IGFH 4YDKL 2DQHL 3Q5TA 3IS1X 3MV8D 2WWKT 5F96H 4XCNA 4C55A 2IANA 1K4CA 4TRPL 2YS4A 4IJ3C 4KDTA 4G5ZH 2BY1A 1OW0C 3VXNB 1NC2B 1C16A 1BQLH 2B1AL 2ICCA 4AENA 3WIIL 4D9RD 2DQCH 3LKPA 2Y07L 5IBLC 2AJYH 3AREA 3N0PB 3VI4F 4E41E 3MNVA 1UH4A 1KCKA 4JG1H 5TDNB 1JZ8A 3F8UB 3F58H 4BELD 1KFAH 1A7NH 4N8VA 1QRKA 4KJYA 3E0GA 4IJ3B 5DHVH 4KTEH 4KRPD 2Z31B 4HIIB 4LGPB 2GCYB 3V5DA 3HE6B 5A1AA 2RQ8A 3IDMB 1F3RB 2BC4B 3VH8A 5F6IC 5KN5A 4NDMA 3VE0A 1YEFH 1TJHL 1MAML 4WV1C 3NCBB 1RHHB 1DQQB 2I5YH 3I3DA 4CW1B 1KIQB 2W0PA 2EDEA 2GT9B 4JDTL 1HIML 3GBNH 1RPQA 3MNZA 4O00A 2E7LA 1AY1H 3ULVD 3MRJB 1FBIH 1CF8H 5CILL 3L7FB 3BN9D 1DN0B 3STLB 4HG4K 2VNCA 3I6LE 3O8XA 5BXFB 2VUOA 5F6IB 2GYSA 4UOW1 4QF1A 2YA1A 5EOCJ 4YK4C 3O2WL 2X89D 3B3IA 2X42A 3QQ4A 4WV1B 2DI7A 2XA3A 3EDJA 4QHUB 3M45A 1FZKA 1ED3B 4J3TA 1R3JB 3ZYIA 4P48A 1FNFA 5IW1B 4KHTL 5D1ZB 1YYLL 3D2UB 4UAOC 1S7TA 2YD7A 1MJJB 4LVHB 1OAQL 2CLRB 3WJLA 2BNRB 4KPHH 3B9KD 2Y9RT 1DZBA 2QQQA 3HZVB 5IV2B 2G5BA 4XMKL 1Q9KB 4IOFD 1I3RA 2NX5B 3EAKA 3A6OA 4M5YL 4ZXBD 3PF2A 4N0UE 1KENL 3V0VB 4OAWA 4UDTB 5D6DA 4BH8B 3O45A 4UAOB 3T0EA 1WFNA 3DRQA 4R8WL 3WEXA 1M71B 4V1DA 2IG2H 4XRCB 3MFFB 5H94A 3BH9A 1KGCE 5IKCA 5AD0B 1MLCB 3HFMH 1WAAE 4FQIH 4LCCC 1G9ML 4G3YH 2YK1L 4A6YL 4WDIA 3BEWB 2P8MB 4P3WA 4LPCA 4I4WA 4I3GA 4G6MH 4TTGA 4WI4A 4D0DB 4UB0H 5DJ6A 1DBAH 1V05A 3H9HB 4MA7H 5D7KE 4FP8L 4JFFD 4NC1C 1JGVL 4PJXE 5J3HD 1EO8L 3BI9X 3S98A 5DUMH 4XCFH 1WAAF 4BQ8A 2ITDB 5IQ9A 1JK8B 1IEAB 2J6EH 3LV3B 4LCCB 5FF6A 4Y1AA 1I8MB 1TPXB 2R69H 4IMLA 3TFKC 4NQEA 2ARJQ 3MOAL 1FG9C 3QFJD 4I77L 4PJXF 5ECJE 3RGVC 2EKSA 5HHPA 5IMMB 4PY8I 3H9YA 4JY6B 3P0VL 2WBJD 4IRJD 4S1SL 1U91A 4P9HH 1DUZA 1GGIL 2CDFB 4JM2C 5FO7A 5FHAL 4HIXL 4PLJC 4WW1A 1YC8A 2KQMA 4LF3B 1C1EH 3MLWH 1T0PB 1DSFL 1FDLH 1WJ3A 2BHZA 3BP5A 1F97A 2ZUUA 3UBXB 3F7VA 2VDQH 4DEPB 3KPMB 3RGVB 3Q6FA 1B4JH 1YMHA 1N4XH 1K9TA 5D7LD 3CNKA 5IT2L 3MCLH 4OZGB 4F58H 4JM2B 4YHKH 5D1QD 5E95B 5DTFA 4P4KD 2YD6A 3DGGB 4FQLH 3MLPA 1NC4B 2HKHH 3CVHB 3FO1B 1PZ5B 1KJMB 4N0FA 5TQ2H 3C8HA 3UTSB 4L8SB 4BSJA 4K9EH 3GRWA 5GS0D 1ZVYA 4LLMA 1WBXA 2D9CA 3U4BH 4X6FB 4Q9RL 2H32A 4UIMA 5I75C 4NQDB 1RHFA 2APVA 3DPBA 3QZWA 2A6JB 3KS0J 5K33A 4YHOH 4P5TC 1G7JB 3JSSA 3X11A 5E4IA 1FFPB 1RZKC 1DE4A 2P1YA 4DGVL 3U9PL 4OCNC 4HXBH 1AGFB 1EERB 2QSQA 3BZDA 3O4OC 3NAAL 4GJTB 4G42B 3T08A 3TYFB 3GSRA 4POYA 4CNIB 3RDTA 2FX7H 5I75B 1A1MB 3ROOA 2Y25A 2V7HB 2VAJA 3D1MC 3PGFH 5MP6L 3ILPA 4XPBL 5ANMB 3TH2T 4PJ7A 4R7DA 4GW5B 1MHPH 1U42A 3HA0A 1AC0A 3QEUA 3KPRD 1R5IA 3H42L 3B9KA 4OGZA 1ZLWK 5DFVD 3WLWC 1T21B 4YGAB 1F58L 1H0DA 2VDPL 2DLIA 4PR5A 5F7EH 4JAMB 1QSFD 2VSCA 5KVDL 4QHLB 4K7PH 1JNLL 3TC9A 1RURH 2CGRL 4NWTH 3UTSE 3WE6B 1EFXB 1WWWX 2MMXA 3U1SL 2D31B 5CJXC 3IJSB 5DQ9B 3CFDB 1FL3A 5HDQH 4JM2F 4NKMA 1LD9A 2X4PA 3QJFB 1VPOL 4R0LA 4OF6A 1KLFA 3SGEH 1G9NH 3QNXB 3HE7B 5F1IB 3CZFB 3Q3GB 1OTTD 5JPMA 3ZT5A 4DFHA 4YHMH 2NY5L 3L95B 1SM3L 2FGWL 4L4VD 3SE3A 4KZEL 1FCGA 3BKMH 1S7QA 5BJTB 1ZGLB 3NFPB 3ZE0E 3MACH 1I7ZB 25C8H 4ZAKC 1CFSA 3KLHC 3OAUH 1JWSB 3O81A 4WEBL 3REWB 4BA8A 1RK1A 4G8IB 4ZMAT 2OSLA 2DIBA 4JFZH 4LMQE 4DJMA 3U36B 1J0IA 1FL6A 3TT3L 2XG5A 4KI5E 1JTTA 5J8OA 1CDUA 4PJCB 4MVBC 1HDMA 4OLWH 1JZ7A 5GSRA 5I1HL 4QRRB 4HUWB 4PYGA 4IRJA 2YRZA 4YBHA 5CCKL 2OL3H 4ZAKB 1A02N 1CFTA 5DURD 4MAYB 2BSRA 4PBWD 5DJCA 5DMGC 1O7SA 4ACPA 4DQOH 5C71A 3OKKA 2DI9A 2DD8L 3GSOB 5L9DL 2D0GA 3DX7A 4KI5F 1LK2A 5DLML 2WUCL 3WXWH 4A6YB 4QNPE 1L7IH 4WJ5B 4NZRH 1Q1JL 5DUPL 1QLEH 3MRLA 3EIFA 4LLQB 3PV6A 1KPRA 2BNUB 2Q8BH 1L6XA 2CDEA 5D1QA 4ETYA 4WTWA 1X4XA 4P4KA 5D72L 1WZ1H 1U8LB 4HMCA 1T5WB 4K3DL 3SDCC 3BMWA 3RTQD 3UTTB 1NDGB 4QNPF 2P5ED 2XNAB 2Y4SA 1IM3B 1AKJD 2ADFL 4YQXL 4QO1A 5DJ2A 3BFOA 3ECBB 4Y4HA 2E7HA 1FV1B 3HZMB 2I27N 5D9SB 3L3OB 5ITBL 1FVCA 1B0RA 1S9YB 5F21B 3EO0A 2A6DB 4TSAH 1D5MB 1JYNA 3PE9A 3KPLB 1ES0A 2X7LA 3QO0A 4U3CA 4JANB 4JZOA 5DEFA 1DL7H 4S2SB 3MRIA 3DYOA 4PJCE 2EZ0C 3LKNB 4LP5A 1VGEL 1KPUA 1X5KA 3P0GB 5C0DA 1BIIA 3PP3K 3V7MA 2DQFB 1D9KA 1HWHB 2PW2A 3ARBD 4U2ZA 1Q38A 3P4LA 4KRNA 4POUB 2P43B 1F2XK 3RWEB 1A5FH 1F4WH 5A16A 3K7UA 5JZ7C 3O2VL 4PJCF 2GITA 4NNXB 3L5WB 3SCMD 4X6DA 1KC5H 3WUZA 1NAMH 3DRTB 1NMBL 5JIIA 2GJ6B 1S78D 2UZIH 2JLLA 4EUPA 3LKRB 3MRGB 2RBLA 1EXUB 4EQ3A 4K3JL 1F6FB 4PJ8C 1SJHA 2YSSB 2V5TA 3JWDC 4HEPG 5K93A 4Z8FL 2MHAA 3UTTE 1S7XB 2E27H 5GRVK 4WNQA 1N5AA 3K4ZA 1EA9C 1QO3B 3GMNA 1U8JA 5ACZA 3DVNB 1DUYA 2AXGA 4P2OC 1KG0A 4YDIL 1ZANH 3TEUA 4X7TA 5DSCB 1EJ6A 4XBGA 3X3GL 3C5ZD 1U3HC 2ZSVB 3S37X 4RX4D 1U8MA 4OI8A 3GDBA 3B5GA 1QSEB 4WI8A 5HGHB 3WFEL 1Z3GH 5DJYA 1XGUB 5CP3H 4PRHD 3BKYH 4MHHG 3UTPE 3PWUA 5J06A 3RBGA 4Z7WB 5GRJL 4JDZA 3T0VA 3QULB 4ZO6A 5FGBC 4L4VA 4ZUUA 2IQAA 4MA3B 1UJ3B 3QEQD 3I84A 5DUBA 1MREL 4P2OB 3S5LG 1CGUA 3P4OA 4OZIA 5IJVA 1RY7B 3O6KL 3LSOA 4NHUB 4X7SH 1U3JA 2Q6WA 4Y2DD 4OGAD 2F54D 4MD0B 1XR9A 4JQIL 1CT8A 1HQ4B 1MI5B 1MRCL 1X9QA 2BNQA 2I07B 2PETA 4PJBB 1A7QL 4JLRA 1C08B 3F7QA 3IU4H 2Y5TB 4J23A 4D9QE 3LEYL 4FQJL 4HKXA 4FQHB 5IWLA 1GGCL 3E2HC 4C57C 1RFDL 5IW6B 5GISH 2NY5C 4XAKE 3NGBC 4NO2B 1A7PH 3TZVD 1C5BH 2MSPA 4ELKA 2ED7A 1QVOB 1RULH 4FFVD 4X9IA 4XC1L 2CIIA 5GGTL 4JPIA 3C09B 3OKOA 3MUGB 3EO9H 3FB7B 2I9TA 3VW3L 4FA8A 5CD5C 2GUOB 4LGRB 3DVIA 4NQCD 1U8PB 4MB3A 3K46A 1A7RH 1Q9LB 3E2HB 5D1XC 5C7XH 4LQ1A 3G04A 1NGQL 1GZQA 2NNAA 3W0WD 1CTNA 2N1KA 4Q7DA 1ZLWH 3EOBB 4Z7WE 5CSGA 3RTQA 5FYLE 5BOPA 3IVKA 4WTZA 1KJ2A 4MD4A 3HNSL 4AM0A 4TVSa 3O3UN 4QTHB 1PEWA 2DQUH 1ZHLB 1CG9B 4MNHB 2V17L 3EOAB 4NNPL 4RMWA 2H3NB 2HG5A 1ZWIB 2EE9A 2AKRA 4ODUB 5D2NE 2R1WB 5D1XB 4Y4FD 4MQTB 4Z7WF 1OWWA 3EJJX 5CBEA 1TJGL 3L3GB 3ULVH 4FABH 1JWMA 1PBYA 3KLAB 5C6TH 3O6ML 3VFGL 5A2FA 5HYJD 1RMFH 3I6KA 3ULUL 1XGTB 1NSNL 5GS2H 1J05B 3ARBA 2QHLA 4HFUL 3BP6A 2X1XR 4RGND 5I1AB 1KBGH 5FYJD 4BKLA 2QR0A 4YHIA 3SDDB 2NY1D 2F53A 1S9XB 3MCKA 5TDPB 4OCRH 2O5YH 1RUQH 5FO8A 4TSBL 4AMKL 3NZ8B 1BQSA 5ESAB 4XBPB 3CX5J 4FQ1H 1J18A 4XCEB 3GSWB 5D70H 1T7XA 3RHWF 5L6YL 3IU3A 2V2TA 1KEGH 1NGPH 4KK6D 4JFEB 3NCYS 4QY8A 1QHOA 4GRWB 4NPYB 2RAMA 5T3ZL 2CH8A 4DTGL 2GY5A 1JPGA 3B2UC 3C87A 3F7YA 1QBMH 3CJJA 1CE6B 2DQEH 2EKJA 3MGAA 4S1RL 2ITCB 1U8KA 5DRZB 1A6PA 4OLUL 4NN6C 3EOTL 3OJDA 4LLDA 3C08L 4HIEA 2GQHA 4N68A 3FCTA 5JIHA 5I9QB 4U1JA 5JO5B 1WWAX 2PTTB 1YJDH 4AYFA 1X5IA 5FYKL 2VKXA 2K7QA 2VDRL 4XAWL 1UG9A 2UZYB 3INUL 1C5DB 4X4YB 4J1UA 2VABB 3TM6A 2FIRT 5MEND 3CH1A 2EYTA 3MR9B 3FB6A 5DJAA 2EO1A 3K81A 2YMXL 2AV7B 2AJUL 4YEEA 5KG9A 3FQTB 1YPZB 3DURB 1KJ3L 4Y2DA 5T1DH 3VDAA 4J3OC 1OAXH 3RIFK 2CIKB 3G9AB 1FNGB 4YDLB 1RZ7L 3ZDYE 2EE3A 1LEGB 1UZ6E 3V8OA 2AJVH 2AI0L 4LCWB 4PJIB 4GRWE 3VXUB 2XQYK 1L0YA 3PNWA 4PB9L 5TF1L 5I30H 5CFHA 3NACL 3SKMA 1X5ZA 5DMIH 2FGZA 2P5WB 4KKCD 1FGNH 2DMKA 3GSVA 2DWDB 4OCMC 2BFVL 3PQYB 3ZDYF 5FKPA 4MB4A 2AQ1A 1UZ6F 1KELH 4XNMA 2GK2A 4YFLI 4GRWF 1QR1A 4NQCA 5DJDA 3S5LB 5ADPH 3CMOL 3GSXA 3QI9A 1MNUL 3MJ7B 3QUXB 4WHTA 3DUUA 1JGUH 3JVGA 3ALWA 4TVPE 3W0WA 4ZFZB 1CIUA 2M8XA 3ZSTA 2DM3A 1BD2D 4YO0A 2DJ4A 1XIWD 5KANG 3QDGD 3G08B 4K07A 4MDIA 3RVUC 2B7DT 4RWYL 3WS3A 1B0GB 1HHGB 5I74B 5I0DA 2EDTA 4JPVH 1QFPA 1YPZE 2FZ3A 2NY3D 5TGBA 2KL6A 5GS0H 4OM1L 3HNTL 1REIA 2Q86B 1NAKH 5FK9B 1TZIB 1DBBL 5FCUL 5JQ6L 1CD8A 2C26A 3F12A 4NZUH 2BXYA 4G7VL 1F6AA 3HI6H 1A6TA 5SWQA 2AV1A 1KF9B 3MYZA 3QUMA 2D4FA 2R2HA 5L88L 4DOHB 2D7TH 3O3DB 4JE4B 1MHHB 1YPZF 4PJIE 2WQ8A 4EI6B 3QSKB 1NBZB 3VGAC 4ZTOH 2NY0B 5E5MB 3CDGA 3MJ9L 1KLGA 1DANU 3K2UL 3RJQB 1IC5H 3KPNA 4PTTB 3WYRA 3BW9A 4R4BB 3PQYE 1JUFB 3VXSA 3E6HB 4BZYA 4TTDC 3RL1A 5F9OL 4PJIF 4JFHD 5DRWA 3FN0H 1A9EA 1CDIA 1NANI 5ESVB 5JW5A 3VGAB 5HGBB 4LHJB 4YBLC 1G6RH 3Q6GL 4ZTPH 4GUPB 4KUZL 1WT5A 3ULUC 3KJ6H 4NWUH 3RWDA 4GAFB 4DUXA 5KW9L 4WU7A 1S9WA 2NY4C 5HHMB 1OSZB 5DHVB 5B39A 5DD3L 1ETZB 1EEQA 4XPFH 3HS0A 2XA8H 1RIHL 1G7HB 2AJZB 2QQKH 1M7DB 1XGPA 4KK8D 3IXAA 4C56E 4F7EA 5BO1H 1V3KA 3O9WC 3MA9H 5D6CA 1F8TL 2GSIB 3VFSA 2QJDA 3CSYA 1I9IL 1NKRA 1VGKA 4QTIH 1P9MC 1EHXA 4OKVA 3HB3D 5EULV 4F7MB 1WC7B 2NY4B 5EOCH 2GSGA 2Q3ZA 1LEIA 4FXKB 4IRSC 4MLSA 4JY5H 1NH6A 4MLIA 2O93L 5F44A 3TYGH 1JNLH 3G5XA 3FT2B 2JK5A 3SBWA 3M17B 3O9WB 2DJUA 4JFDD 4QRSB 1A6ZA 4RAUA 5HHOE 2A77H 3ARQA 2ATKA 3EHBD 2FLRT 4XWGH 2ZPKH 3D3VD 2GTWB 3EKCA 1NKOA 4PJDB 1AXSA 4XI5C 1A6WH 1LNUB 1FG2A 1J1OL 4HCRA 2HFGH 4H26A 5E00B 5LGKA 2PTVA 4IRSB 1JJUA 1OD9A 2FCBA 1Q0XL 2RCSH 4ZSOB 2ZJSH 3DXAE 1DVFD 5J1TC 1X4ZA 3RP1A 4OI7A 4NKDA 2VZUA 3FOMB 4OCYL 1FNEB 3LB6D 1ZS8B 4M7JL 4I9WD 4HZLB 4J8RB 4NRZA 5KBNC 1ACZA 4OIAA 1U3ZA 1KTLA 4GKSB 1JHLH 4LSRL 5D7JD 1XF2A 3GHBH 2NW2A 4M5ZL 3X3FL 3C60D 3V2AR 3LKSB 2OR8A 4G43A 3U7AA 2WSKA 3U48A 3NN8B 4WUKL 3GJEA 3HZKB 1T0NB 4F9PA 1K8DA 1BGXH 2B4CL 3CCHA 2HVJA 2PYEB 4LEXH 4NUGL 5EIQA 1WCBB 3MV7A 3JTTB 1QEWA 2RIKA 5L2KA 3MUJA 3NH7H 4HC1A 3OF6D 2OI9C 2DLGA 4ODTH 3SOBH 1ZLVK 3VFRB 3LEXA 5ILTL 1JGEA 2Z93A 3VFPB 1YEJL 2H6PB 1IC1A 5HJ3B 1FFOA 4ODVL 4C4KO 2FWOA 4HPOH 3WFCH 4HHAA 2AP2A 3OTTA 2R1YB 4QOKE 1T2XA 3JBG7 1MCJA 5ESQB 4ZUSA 2OI9B 3AS0A 4DZ8B 5C0FA 1UZ8B 4MDJB 4BFBD 4QWWD 4FFZH 4HGKC 4UUJB 3RUGA 1U2HA 4M1CD 4NO5B 1UWEL 4PJDF 1EBAA 5CP7B 3DSNA 2QADB 3GKWH 3QDJB 3QAZC 4HKBA 5KTEL 3OGCA 4R3SA 2F19H 1D5IL 2FJFB 5I1EH 2MQ0A 5GIRA 5ITBH 1UGNA 2MJWA 5E8DH 4K94H 1E6OH 2ZWLT 4XMPH 2R2BA 3BD5A 2VISB 4GQ9L 4L3EA 1IARB 4OZFH 3HNVL 4K9EC 4C54A 1FIGL 1G7QB 3L3HB 1DLHB 4GRLD 1BFVL 2XXCB 1ZTXL 1EUTA 3ARVA 3MA7B 3SE4A 1FRGH 3HC0A 4MXVE 4GAJH 3EYVA 3ZKNC 4P5MB 2XWBA 2HFEB 2LTQC 3QXWA 4G6AD 5I1KH 4LRNL 3S37L 5E2JA 3O2VH 4FQCL 1UEYA 4ZUWB 4YC2C 2C1PB 3LN5A 5C09E 3V6OC 4MXVF 2ICWI 2F5AH 5C07B 2EDFA 3BZEA 4LL9A 2NW3A 3VFOB 2P8PB 1ZGLP 5E08H 1OB1B 4IRZL 4EIGB 1UKSA 4JGUA 1HCFX 2LTQB 3CMGA 4YR6B 3PIQA 2O5ZL 1SBSL 1TENA 1A7OL 1OT1A 1YEGH 1GC1H 4JFDA 2CRZA 4U3XA 4YE4H 3AM8C 5DWUL 3WFHB 2UWEE 1NGYB 1K5NA 4JDVA 3D3VA 4L29A 4LHQB 4OJFL 4Z7VE 2VSDA 1J1PL 4HS3A 4UT9L 3RWFA 2OTWA 4X6BA 1J9CT 5AEAA 3ARPA 4WHCA 4X4ZA 5KJRH 5I1GH 1DVFA 5EU6B 2XWTA 4HKJA 1D5XA 4UV4H 3FQNA 2EC9T 3U83A 5F3HB 4OV5A 4RFNB 2ZSWB 4U1GB 3O2DH 2UWEF 5MEQB 3BDXA 2FJHA 3U4EA 3V95A 4EDXA 4NZDA 4PRDB 1T7VA 5DD6B 1I1FB 4YLQT 1YZZA 4NKIL 4LU5L 5AYQA 1BVZA 2BOBA 2IH3A 3VXPB 1C7SA 4FQXC 4K8RL 4C58B 5BCAA 1MRCH 4OFPA 4NCC1 2A6KB 4ODHL 3T8XA 2OLDA 3MBEA 2Y6SD 2F58H 4WI7A 3GI9L 4YWG