2HVBA

Crystal structure of hypothetical protein ph1083 from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
113
Chain Sequence
MLKETIRSGDWEKHVPVIEYEREGDLVKVEVSVGKEIPHPNTPEHHIAWIELYFHPEGGQFPILVGRVEFTNHSDPLTEPRAVFFFKTSKKGKLYALSYCNIHGLWENEVQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide reductase
publication title Crystal structure of hypothetical protein PH1083 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
total genus 28
structure length 113
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2hvbA00
1VZHA 1DFXA 3QZBA 1DO6A 2JI3A 4BRJA 1DQIA 4BFJA 1DQKA 1Y07A 4C4UA 4BV1A 2HVBA 4D7PA 4BGLA 2JI2A 1VZIA 4BRVA 4BK8A 4BFKA 4C4BA 2JI1A 1VZGA 4BFFA 2AMUA
chains in the Genus database with same CATH superfamily
5JXEC 3FF8A 1WD8A 2Z92B 4QRAA 2NX5A 4NHCH 3L5XL 4JY5L 4G7RB 4WW2F 1ZLWH 1MCSA 2UZIL 3IRZA 3MLXL 4YFLI 2D0HA 1FYTB 2PN5A 3QH3B 4AG4L 3L1GA 2F53D 1BCIA 1JL8A 4IKNA 2J6EH 5F7FA 2IBGA 2ESVB 1QVOA 2GEEA 3LZLA 2IXQA 2C9PA 2X9XA 1YMHB 2YWZA 3BVNB 4GSUA 3VI4F 1LK3L 3GI8L 2IAMD 2NY2B 5H8DA 4OZHF 3FAXA 2B1HH 3D33A 2J3SA 3FQYA 2VDRL 3ML8A 4M29A 4JM4L 4ABVA 3RTLA 2N7SA 3EHBB 3OJDB 1BFSA 3TVMC 2PETA 1E28B 1INDL 5CGYC 1WBZB 3RU8H 5MEND 3GD1C 2ADIB 4OI9A 1IT9L 4NQVA 3CFJA 1XH0A 2VKXA 4FFWD 1MEXL 3UTQA 1GKEA 5FK9A 3ARXA 4KWUA 5KJ7E 5LBVA 4WFHD 1R5IB 5FUOL 4KO7A 1BIHA 3PHOB 1BJ1H 2YK1L 2ROYA 3MTXA 3PHQA 3LPPA 4U3CA 3LEVL 1JF6A 4OVVA 3TBTA 3O8XC 3RVUC 1T6BX 3IU4H 2AXFB 3H9SA 3WTUA 1ZIAA 3BVWA 3PRZA 4QRUB 4B50A 1R5VA 4G6JL 1QLEL 3KCWA 4NC1C 3NRFA 3V79C 4G8GB 4X6DE 2FUTA 1FCGA 1SHSA 4UNUA 4UTCA 2XV6B 4KY1L 2IANE 3T04D 2D4DA 1S78D 2FO8A 1NDMB 4HF5H 1XFPA 5F1OB 4BFGA 4N2CA 1NGWA 4N2BA 2FEEI 4JHWL 4RA3A 3QPQD 4LOFA 1JZHA 1CFQB 1DN0A 2CDEB 1RP8A 4Y5YC 3KPOA 5I8EB 4JRFA 5GGVL 4OLVH 4EIUA 4F93B 5AUMB 5F3HB 1DJWA 4PB9H 3GXIA 2W07B 1P2CA 5A2FA 2FHFA 1MAJA 1PIGA 5B22A 2FECI 1R3IH 1MCEA 1MCOH 5D2LB 5DQ9B 2WKOF 4JPWL 4AENA 2BCMA 5TK4A 6TAAA 3JTSB 3DIFB 4K7PX 1R6VA 1TQCC 3O4LD 2HMIC 4TKWA 3NSCA 3C09B 5D1ZB 4P9HC 3RZWA 1G7HB 4Q52A 3U7YL 3VXMB 4UQ9A 2WWOA 4O51A 1ETB1 3QT2A 1NGYA 4FQJH 4HPYH 5I17B 2X6CA 4YE4H 1PLCA 2FIRT 5TE6L 1PMYA 1S7TA 4HUNB 1PZBA 1TZIB 3IM1A 3KWWB 1ZT4A 2EIKB 1TMCB 3HZMB 3MTRA 4OZFA 4QEGA 2CLRA 3UH8A 1NOAA 1ZHNA 1PG7H 1A25A 3AQYA 2ADFH 2BVPB 1HL4A 2NYYD 1EAQA 4M7JL 4QTIL 4P59H 3TGXA 4V1DB 3C6LB 4GBXC 4PRPA 1JN6B 3QRBA 1M4KA 1SXCA 1U91B 5I6KA 1HCVA 2A2QT 7TAAA 5MENE 1A65A 5C07A 4X5WA 5F1IA 1P84K 1MCNA 5JW4Q 3D12B 4KGLA 1L6ZA 2EYRA 5G4NA 1JBJA 3OWRA 2DQTL 3D5OF 4CVZB 2OW7A 2JVUA 3IGLA 3UBFA 3SE4A 2V2XA 3VDCA 2AZUA 2YARA 5CINH 2BSED 4KKAD 2VIRA 3CVBA 4QXVA 3RUGA 4UBDC 3BP5A 3IBEA 1VZIA 3FMGL 3DJ9A 2PO6A 5KBDA 5KOMC 2WBJC 4R3SB 4D8OA 5BOJA 5IHZB 5F1NB 2WNKA 1BG9A 5LO7A 4R7LA 4LL9A 1CC3A 2VZUA 5E8EB 5KSVA 3HCVB 3TT1H 4MA7L 4WHYH 2YGVA 4U2ZA 4O02H 2E7HA 2JCCB 3VMOA 3ULUD 4GG6A 1BF8A 2K8QA 2XOTA 4G83A 5B39B 5IKCA 2VISA 4APXA 1M1XA 1AGDA 4UM8B 3U2JA 1PCXA 1KEGL 5ABDE 1MCWW 3S34L 2XG4A 1P1VA 2FHCA 1XH1A 2NUTB 3V4VH 5MEPB 3L5IA 2QVKA 4PJAE 2YPLD 1KT2A 2J57A 3WXVH 1T66C 4Y1AB 4Z78B 1F3RB 4K5NA 1TYJA 5ANME 3TWCH 4DGVH 5EBGA 5IB4A 5INDA 1Q8MA 3B7SA 3LZPA 1AHWA 4BFBD 1IBHA 5IMKA 5LCVH 3RGVC 1BLIA 4UUJA 1WSST 1BFVL 3WJJC 3IKKA 3WMQA 2ZWYA 5TDPB 1OARH 4P5TA 4U1SB 2UX7A 2KDYA 3MYJB 4J6IA 2X4QB 1RULL 2OL3B 2XWTB 3LQAC 4FG6C 1DQKA 1Y1UA 3O4LE 4F1ZA 2UZYB 3EDKA 1LO3H 3QR2A 5FDYA 3MA9L 3MX0A 2OTWA 1EV2E 4UAHA 4FMKA 1UADC 3CD4A 4UILH 5DRZA 1KJ3H 4C47A 4J8QA 3ARDD 5I1EH 3ZL4H 3ILQD 3UC0H 1OM3L 1F3JB 5ECJE 5TF1H 5A40E 1MH5A 3EH4B 3TS8A 1LD9B 1WIPA 4BFNA 4Z77B 2JXMA 4IIZA 5BS0D 2FJFA 1I8KA 5H35A 4PJEB 8PAZA 4Y4HC 3BQUD 2F5BH 3CXDL 3PDGA 2K6WA 4G8IA 3X14B 2OZNA 4U0RB 1BREA 4LQFL 3FTGB 3NP4A 4H26B 1JZ4A 1MW2A 4KQ3H 4ABQA 4KQ0A 3EYFA 3KPNA 5C7XL 3FQTA 4OIIL 4HWZA 5FEBA 1UXLA 5A16B 2CBMA 3ABLB 1IBDA 2PCFA 1LP9B 3GXDA 3L3IB 2GBAA 3MRIB 4KI5E 4Y2DC 4B5ZA 3FU7A 2VDOH 2EXYD 5KVEE 1NDTA 1PX3A 5EHFA 3CZFA 1T4KA 5BV7B 4D0BB 1PAMA 3MU3A 2YJQA 1DEEB 4IBUA 1XH2A 3OR7A 2X4OA 4EUPB 1ZIBA 5DXWA 5F9AC 1CU4H 2FGZA 1MI5A 3HIZA 4I4WB 4JQXA 4YBLC 2BMKB 1QPPA 2CMRL 3OKKA 3G5ZB 2GCYA 3G5VA 2XRAH 4F37F 4F7PA 4U6HB 4YHYB 1WJ3A 2WSPA 4YXLL 5C0JB 1IGIH 2C9VA 3ILPB 2OMYA 1GCYA 1MRDL 4NQCD 4G6FB 3HVDA 1AD9A 1YQVL 2Q76B 3WO3B 5I1LB 1VENA 4PCTA 5I6XC 1QFWL 5FPIA 5HHVH 3VFNB 3KZ8A 1NTDA 4AMKH 1FNHA 4CUCA 4QCIB 4X6DA 2Y5TA 3U2SB 5DVOA 1IJNA 4QWWC 3ZPDA 4H8HA 1I3GL 2C3XA 3U6RA 4ZPTB 2IANA 1YNKL 4BHUI 3NA9L 5LBSH 5MEQA 5T3ZH 1T5KA 1E4WH 2YPVA 2D4FA 4KK8D 4LPCA 3H54A 4XN1A 4HUXA 2Z4TA 3FQ4A 1A6VH 1QNZH 4UIKL 1F56A 2FX9H 2APBA 3E0GA 4ZUUA 1SHWA 4L05A 1FORL 4LVNB 5FB8B 1FA4A 5FYLD 4YDMA 4KJYA 5IQ9B 2D9CA 3FTSA 1DBBH 1RY7B 1ZRUA 1GZHA 3U4AA 5E2VH 1UYWL 1NEZA 3SPVA 3UDWA 2QSQA 5DA4A 1VPOL 1AIFA 1FAKT 2CA4A 3P9LA 3QARA 5JPNA 4L18A 4XVSL 4JO3L 4JFHE 4XO4A 3D4GA 1XCXA 3BVUA 5L2KE 5D7SH 1JSYA 5DUMH 5LXVA 4P3DB 2ZYSA 3ISRA 2LOEA 3PWUA 3QQDB 1MLCA 3ELQA 4XPGL 3BUTA 4PJ5B 5C0AD 2ATPA 3OKMB 4RETB 5EOCL 3CFCL 4MHHG 4NKMB 1B6UA 4K7FB 1KELH 1UCBL 2GT9B 2NY2C 3RTQD 3TBBA 3PNRB 5JW4R 1TKWA 4P8QA 4KKCC 3ZKNC 4OCYH 3EHBC 1F90H 3O9WB 5EOTB 4F57L 2GC7C 2AXHA 1YVLA 4N86A 4UDTB 1B0GA 2TSAA 1LVEA 3DHMA 4IK6A 1OP3H 1URZA 1A4AA 2HJLA 2JK5B 4JN1H 3BIKB 4RAVB 1R19A 3IKCB 1A3RH 1BVLA 4N6QA 2P28B 4H88H 1T20A 4GAGH 1NFDE 1ZE3H 1Z9PA 4J3SA 4TN9A 3G04B 4U0QB 5F71A 1JGLH 2VR8A 2XIDA 3FOMA 1ROWA 5CZXD 3V5DA 4AIEA 4AQ8A 5JIIA 3Q06A 4W1TA 3C5SB 4MBOA 5DJ6A 2YGQA 4LBEB 3ZDXE 1CIDA 4KVCH 2R2BA 4LK4A 5JORA 1E9QB 1JHTB 1U8PB 4OCWL 1QSZA 1H3WM 3FT1A 2XN9B 1WTGT 4PJXB 5GGQH 1XGTA 1ZMYA 4M1GL 5J4MA 2WY3B 1B90A 1RJLA 1ZD6A 4KNUA 1UOVA 3HMWL 3S88H 2CBOA 4NQCE 1G1YA 4NZDA 1AD0A 4L8DA 5JO5B 3B3IB 3D25B 4XMZA 4XTRD 5LAXB 1S5IL 2UY6A 4HWEL 3UC2A 3SKOA 3GSNL 3SZ6A 3U25A 5FUZH 3EBAA 2NYZA 4AUYA 1MIEH 3DETC 4OIBA 4YQXL 3NEEA 1V3LA 2XTSA 5ESAA 1U41A 1WQVT 4KK5D 1X5HA 1CFSA 4ETQB 1E5BA 3ZE0E 1A6PA 3ZDZF 3DJTA 4H8WC 4WI2A 2FJSA 3GINA 3T65B 1EUUA 3IETA 4UOW1 4S1RL 5EZPA 3U9UB 4PJAA 1CGVA 4QOKE 5DUPL 1XF2A 4I0PB 1RJCA 1X6LA 2R4SH 4FCHA 5ANMA 4MXWL 1WAPA 3DUSB 1BQUA 3O2VH 3V7MA 1BPLB 5DHVA 3QXAA 4H8PA 5JXED 1JF1B 1AYRA 3D4YA 4HEPG 4A7GA 5IT2L 2E9GA 1EERB 3MCKB 2AXJA 1BEXA 3C09C 4TMPA 2ITEA 2HXAA 3DUUA 5D1ZC 1EO8L 1LEGA 1CGWA 5CZVL 3TT3H 5KSUB 1RIVL 3L16A 2IF7A 3W3BA 3CAFA 5BOPA 4JO4L 3T6VA 2H26A 2OLDA 4XC1L 4ES8A 4L1HA 4R96B 1XR9B 1LK2A 4NHUB 2GIYA 1RK1A 2V9RA 1FZOA 3UTZA 1G9MC 1XGQA 1J11A 1YEWA 3H3BC 4Y19D 5CEXA 1DBJH 5HHNA 1PD0A 4NOFA 4GKSA 3TVMD 3QSKB 1W72B 3C6LC 3MHZA 3UYPA 5L4JA 1CLVA 2VSDA 4HCRA 3ZBMA 1ZV9A 5CGYD 1R3HA 1NLBL 1AH1A 2BJML 1TZAA 1KWGA 2DKMA 2PW2B 4FG4A 4MX7A 1KPVB 5I6OA 3RNQB 2X2UA 4RGOH 3V52L 5L8LB 2VLKB 2CPCA 3K1KC 2FSEA 3KPTA 5T1MA 4ZNEE 3P4NB 3HR5A 2X4PB 3PXLA 4XCFL 1MFDL 1XF4A 3KM1A 2F19H 1U2YA 3RWDA 3OKDA 3KWUA 1E2WA 1R4XA 4AIZB 1UG9A 3WGUB 2A6JB 4YO0B 1V27A 4FDWA 4KU1A 3O8XD 3APDA 3LB6D 4P5MB 4KKLC 3RVUD 4Z3FA 1OLZA 4XPAH 5DJDA 5DSCA 3FU5A 4KBPA 3ZQXA 4JAMB 4JFDD 2Z4QB 3MACH 3U46B 2F9BT 1TUPA 4OZFH 3T3MF 4PBWD 4IM8A 1RZIB 3R8QA 1PQZB 3QFGA 5IHHA 4M48L 4GAJL 2A1WL 1KJMB 2YAHA 5T1DH 2PF6A 3L5JA 1UACH 3RNKA 3K74B 5KTEH 5K1VA 4FNPA 2B5IB 3FQUA 3GBML 1KB3A 3UEZA 4BZ1L 2XWJB 4GG6F 2UVEA 4F8QA 5B38A 1N59A 5BO1L 3J7HA 1M7IB 2MWCA 3H9HB 3MDJA 4DP0X 1DLHB 4TSBL 4MDJB 2WO4A 5IJDC 4XMLL 4S1SH 1ASQA 4PS4L 1FNLA 1EO7A 2IBZY 1XQ4A 3WUWA 2X6MA 2XPYA 1ZT1A 1GGBH 1XX9C 4FQ2H 3OXSA 4M6NH 4AZ8B 1O7DC 1P1ZB 1QSFD 3VI3E 3QYNA 3H2QA 2HMID 2MNUA 4EBQL 4LDCA 5M94B 5H94A 1TO4A 4JFXA 1CXIA 3B43A 2BWIA 4FFTA 1A64A 1DQQB 1NIDA 3KYKH 2IGFL 4HKJB 5IROC 1GJWA 2X4TA 4RMBA 2F8XC 3UBHA 1ZXKA 1QKZL 1CDUA 3TF7C 2VITB 1CBJA 1HHJA 2ZKXA 3K71B 1T0PB 4X42A 5JIQA 4RFOH 1GMEA 4AYGA 3ZT6A 1WRFA 2VXQL 5BUPA 4GIOA 5L2KA 4GBXD 4U0RC 4XI5C 3UXFA 2NW3B 3TN0A 2JIXB 2H9GB 1BZQK 1QWHA 1RPKA 3BAWA 4AYSA 4XP5H 3UG5A 5E7BA 4XBGA 4LAJH 4U1IA 3GYRA 3K72A 1GCFA 4JY4A 4X9HA 4WSKA 1E2VA 3WY2A 5AG8A 4RMSA 4EEEA 2OZ4A 2CUHA 4DP5X 2ERJB 3KXFE 3R0NA 2Z93B 1CXKA 2OCJA 4NXKA 4UBDD 5BV7C 3NZHL 1PZ5B 1PX8A 3S35H 2PYFA 1KIQB 3VFRA 1MNUH 2BWQA 4G43B 2WBJD 4X7TA 4M8QA 5F8RC 1S9VA 4JDVA 4N2HA 4IOIB 4TQHA 3W2DH 5E2JA 5JHBA 3ROOA 1H9DA 1RZKC 1NKRA 4HFWA 1NFDA 4LNVA 4DERA 1FGNL 1D5BA 2X09A 3N9GL 3RUGF 2V8MA 2JJWA 4YHYC 1I7RB 1I1CA 4MCNA 4U6YA 4E9VA 5IMLB 3U0WH 2IH3A 3IDJA 2H0PA 1HK6A 1MFCL 1AGCB 1K9TA 2LLGA 3LPWA 5FOBB 4FHKA 5LVEA 1FVCB 5CSZB 2ZXBA 1T66D 1XSKA 4RBPH 5HI5C 4YWGL 5KVDL 3KEHA 2EIMB 1OAYL 1O6SA 1BAFL 5F3FA 3RGVD 1VSCA 3N44F 4ZQKA 3WMPA 2FJGA 1QLEB 2X1OA 3QJZA 4TL4A 2XQYK 4NFDA 1S4IA 5EA0H 4FG6D 4PY7B 5FHBL 5JHLA 4XMKH 2EDHA 1G7MB 1PSKH 2RHEA 3GSWA 4ZAKB 1U8MA 3IB4A 4LVNC 1JPGA 4KJPC 3V6ZA 4X5XA 3MV11 5GPRA 1CT8B 5KG9A 2FL5B 3ULVE 4D9RD 4QOKA 4JFUA 5ISZB 4OJFL 4YHMH 4N0CC 2AW2A 3INUL 1KC5H 4L9LB 2PXYB 4G59C 2YPKB 3KCPA 2AQNA 5LDUA 5EF1A 1QAWA 3FOLA 3ZE1E 1XH3B 5AQ0A 4GH7B 3U48A 4Y4HD 1ODUA 4GSRA 4AH2A 1U3ZA 2OJZL 2JKLA 3MRLA 4IIQA 1L5GA 3O9WC 1XGYL 1SLVA 2GJZA 3DX8A 4UB0H 4DO4A 3HG5A 1IC4H 2GVYA 4GI8A 4Y88A 4PRNB 2YPVH 3WIHL 4ES9A 1AI1H 1RUKH 4OBRA 3NSXA 1JERA 1MWOA 1QA9A 2C1OB 4Y2DD 3T8VA 4POZC 3RJQB 1MFNA 3KLAB 3PABA 5JOFB 1G6RL 1WITA 4X0KA 4F9LA 4FN0A 3W5NA 2GW5A 1DBAH 5FWQA 3Q6FB 3LMJH 2GEQA 5JYMA 1MY7A 5DMKA 4ZNEA 5BRZD 1HS6A 1TSRA 4WFED 5T5FL 4G5ZH 4BYHA 3A6CL 5ESQA 2LE9A 1MXGA 4PRBA 4RQQB 5DS8A 3SY6A 3X1GA 2WTRB 3ZTCC 2WXFA 3PHAA 4W9CC 3RZCA 4HUCA 5D7LE 1T4WA 4NFBA 2VB5A 3EO1A 1Q0XL 1TZGH 3PDDA 1XAUA 4U1HA 4A1RA 3HG1D 3WEBA 1LO4H 2E9IA 1XZ0A 2ZCZA 3MRPA 1P5UB 3N1FC 1I3RA 4P2AA 5KZCD 2YSSB 3HI6H 1FFOB 4ZZFA 5J06A 1FG9C 4J27A 3QZMA 3SO5A 2R8SH 1HHIA 3L3KB 3SDDA 5ICZB 4QWWD 3QBTB 4XGZB 3P4MA 5T1LA 1E5UI 2WLIB 2WW8A 3K8MA 4KHTL 4MS8C 3QG6B 1LHZA 5JW3H 3GMQB 4QAWA 4LARL 5KVFH 5J13B 1HYRC 2I60L 4H44C 5C92A 4AL8C 1C5BL 1HWGB 1QX1A 2PPAA 2E6JA 4I48A 4ANKA 3HBQA 5F93C 4I0PC 4QXGL 3BCDA 5E6SB 2BFVH 4UT9A 4WJ5A 2COVD 4FABH 5FF6A 1TOXA 5DVNA 2X4NB 4B5EA 4K8RC 1IAII 3LZOA 3ULAB 4H0LC 5GRVL 5E4IA 3FKUS 1FRGL 2BFGA 2ZQKA 5GXBB 1FYTD 3JWOL 3VRJB 3OQ3B 2NYKA 2TRHA 3DOSA 3NH7L 3EDFA 4G1MB 2V6HA 3OXRB 3VI3A 3E38A 2A6KB 3CFDA 1R17A 2ESVD 3U9PH 3HPLA 5H2BB 1Z1WA 3W1ZA 4R6UA 2NY2D 3T1WA 4KKCD 1VERA 4FEIA 3ZTJH 2OPCA 3ZKND 3EHBD 1R3LB 1SF5A 3EOBA 2ITFA 3MBEB 4RRPG 1WO2A 3EH5B 1IGMH 4JGJA 5CFAA 1TTCA 1WP6A 1JGUL 3WNIA 2WCSA 2DLHA 3LZFH 3QCTH 5D7IE 1FGVH 2XWEA 2YOCA 3WS3A 4JEGB 5HY9A 3QEGL 5CILL 1PFOA 1P4IL 4HBCL 4RNRA 2UYLA 4HV8A 4K7PL 4NKIH 5K1NA 5DHVH 1XSJA 5F6IB 7FABH 4IOSD 2FEEL 1U6AL 3ECUA 2RACA 1KFAL 1U8NA 4WLCA 4XE0A 2N0MA 4OSUH 4WFGD 4EDXA 4P4KA 4QXTA 1GYCA 2VDMH 2P42B 4FTVA 5MP6L 4WO4A 3O6LL 2F74A 5E6ZA 4MAYB 3MLVL 3PWPE 4KMLB 3D4ZA 3H0TA 1KACB 1HSAB 3KXFA 3GB7A 4ZXBA 3V5HB 4G8GD 4JM2A 1LE9B 4TUOA 5IB1B 5FDWB 3CC5B 2GTZB 1MFAL 3CDZA 4ONGL 3ABZA 4NKDA 2V7NA 3LS4H 4YSEA 2R56L 3PAZA 3X2QB 1L3NA 4XT1C 3E8UL 3DRQB 5FIEA 3KL0A 2B9BA 3AABA 2FEJA 4I1PA 3DETD 4XB3A 4JHAL 4DIXA 4QLWA 2B5IC 1KJVB 4KAQH 4ZUSB 1KB5L 5HP5A 4HMEA 1LDPL 5J1AA 5JHDE 3OM3B 4M43H 4DVBA 1JNHA 1A4JA 1GOFA 1H3VA 4MD0B 4U1NB 3RL2A 1Y18B 4HWBL 4HBQA 3GZQA 3M1BA 2BVQB 1TJGH 2R23A 3AWEA 5F9JB 3SY0A 2GITB 1C1EL 2QSCH 4ZO6A 4K2UH 4B6ZA 5GJTH 5D9SA 2QL1A 3MVSA 3V4PA 5AAMC 3NJVA 1KIRB 5CEYB 4PJAF 5D1ZD 1FYTE 3VXMD 4OLYH 4QT5A 1CDCA 3V4LA 4JJ5B 3EBIA 3QJFB 2JKIS 4LLUB 4KTEL 5HJDA 4DNLA 4A7GF 4XPBL 5E8DH 2O6PA 3ARFA 4AQZA 4DGYL 4YHNB 1U8HA 3ZVVA 2DH3A 2IGTA 3HBZA 2G5RA 5FV2A 4PRIE 4DN3L 4F33A 4L3AA 2DYPB 1A4KA 2BVOB 2VDPH 3UZQB 1QFUH 3B7TA 3IJEA 3TEXA 1RMFL 2ZG3A 4V1DD 1JS4A 3C6LD 4ODWA 1JGDA 1A47A 4LLVA 3PL6A 4G42B 4CN1A 2IVFC 2YBGA 4XP9L 3WBDA 1GZPB 3II3A 2A4CA 2I5YL 4TULH 5HHXL 3MNWB 3A22A 2OSLA 2X3AA 4L8CB 3MAWA 2X6UA 1CQKA 5J7CC 2HX9A 3KYOB 1AGFA 4HX1A 1RIHH 2ERJC 1E3XA 3BLPX 4KMQA 3RWIA 1UVQA 5TPWH 3VACA 5IF0B 1KY7A 2LU7A 2Z0UA 4KKLD 2A73A 4AGQA 4PGCA 3QC5X 4FLOA 3FO2B 3L6FA 1Q9WB 2ADJB 5I8OL 5HYQA 5T5NG 3WE1A 4EKXA 4FERA 2XG5B 4MNQE 2ZCLL 4PREB 3HNVL 1NAML 1A7BA 3QO1A 1ZTMA 4KI5F 5IWLA 2VWEE 2IADB 3QPKA 4BV1A 1W16A 3A24A 4UTBL 4KK6D 4QRPB 5D7LA 1O9WA 5K39A 1FPTL 1ZA6B 2DICA 2IG2L 1YUKB 3ALXA 3LKQB 5HGAB 5I1IL 4Y1AD 5FYKU 5GIRB 1TEFA 4R7DB 5IOPA 2VH5L 3QFJB 3MFFB 4LCCB 2B9AA 2J21A 1BQHG 1VADA 2C9SA 2OZ4H 4BE6A 3LRSA 5DQDH 5CD5C 1BEYH 3A47A 4HHAA 1BW8A 2ENPA 5E6IB 2Q6WA 1HQRB 5F7UA 3ECWA 2ICEA 1KULA 3KS0J 2M83A 3RLSA 3N04A 4D8PB 2V9UA 3IDUA 2VW4A 5DC9B 5JUEL 4CAGA 2WLYA 4ZAKC 1WZLA 1N64H 4LXFA 4ONOA 3TBYA 2JELL 1WZKA 3A4DA 4NQXB 2FJHB 1WAAE 4TSCH 3VXME 3HLAB 4HEPA 1S7SA 3BGMA 3VXSB 3II1A 1EHAA 2A6DA 3TOPA 5B3JE 2AI0H 5EUOE 1OCZB 4M7KH 5IROD 3MCYA 3IJYA 2VQ1B 1YY9D 1U92A 4L9LC 1YPZB 2PXYC 4A7UA 1MLBB 3SO3B 1XD0A 1PYWA 4J4PA 5C08E 3DI3B 4BSVB 1UT9A 2EC9T 3MSPA 1KGIA 1KDIA 2QVTA 5D72H 4PBVC 2NTFA 4FRWA 4G71B 3MCLH 4TVPD 2IFFL 4JG5A 4V1DE 2Z7WA 1SEQL 4LLDA 1T5WA 1AZZC 3BRGC 1GRWA 5HHME 2AXGA 4QO1A 4XI5D 4JL2A 2WJ7A 4MD5B 2UZPA 4WUKH 4M62H 5I1JH 2O5NA 1BQSA 2WVTA 3CN1A 4N2IA 4CSZA 2R2CA 3QXVA 4MDIA 1UH4A 2XVGA 2EP6A 3CCHB 3DSNB 3L9RB 4PTTA 1QEXA 1S7QA 1UWGH 2NZ1A 2XXCB 5DR5L 3CVHB 4UV4L 4X6BA 4X0NA 3HFMH 4YHZH 4EZMA 5JHLH 5JQHC 5SV3A 5JXAH 1X7SA 1JYWA 1C16A 1QPKA 3D7PA 1L9MA 1VJSA 4JGMA 3QRLA 4JFYB 5HVGB 1D6EB 5HYJB 5I0YA 4Q0XL 2EE2A 1T0MB 4BWTA 3CV5A 2DW5A 2EACA 4ANUA 4LSQL 4PJDB 1MHEB 2XFGB 3MUGB 3T2QA 3SKJH 3ARZA 1B88A 2JCCE 4JPIB 5IUCA 4JRYA 4XXCA 1G7QB 3NG5A 3ES6B 5A6MA 1WT5A 1ZSHA 4G6FD 4PRDA 1P5UC 3P3SA 4LFHG 2WBWB 3PWPA 3OX8B 5I75B 3HZKB 1BOGB 4JG0L 1GY1A 4Y89A 1NFDF 5C6TL 1Q94A 1NUGA 1WA0X 2NY5L 1P84J 4Y1AE 1QR1B 1WEJH 5HI5D 5LWYH 4GB9A 1RZPA 1YUHA 3VM7A 3N43B 3FQRB 2WUCH 3T6WA 1OCRB 4JKLA 4A2LA 2I27N 4I77H 4EQ2A 5J13C 1G43A 3FRUB 5E2WH 3ZTNL 2UX6A 3H2WA 1ET5A 2OTUA 1R0AH 4L1SA 5GSVA 3LQMA 4K5PA 4NHCL 3QPXH 5JHDA 3KD4A 1JNNH 3C5ZB 4GW5A 4QXWA 2ALWA 4X5LA 3ISYA 4WHDA 4Z76A 3I50H 5KSAB 4KJPD 5D6CB 1KBGH 4LDEB 4N0CD 4XO8A 1JGEA 1AMYA 2O5YL 5CMAB 3UABA 3ZE0F 5C97A 4M8UA 4Y5VA 2DI7A 1WWCA 3MRNA 3OC5A 1CXLA 5JOPD 1SYVB 2PW1A 4ZODA 4PJ5D 3NP3A 4ZG1A 1G9NH 4PJ9A 4OFKA 3UO8B 1HCZA 3RP1A 5E5MB 2VZVA 4WY7L 2Q7YA 4QI3A 3VNZA 1J1OH 2BX5A 2HCZX 2I07A 1YEJH 3O9WD 3MBEC 3OMIB 2VSCA 3D0LB 3LN5B 1FZMB 4X4YA 2J8HA 3MJ6A 4A7VA 4PRIA 1BF2A 4XODA 3DV6B 3QCVL 3IVKA 3TH2T 3QIBA 1ZK5A 7PCYA 1AR1B 4LE8A 5ERWB 2H1PH 4D9QD 4POZD 4MCZB 3ZZ1A 2HA1A 4UT9H 3JZ7A 3SE6A 2OMTB 2ZWZA 1QFOA 3PWLA 5F6IC 1I1RA 2PYEB 5DD1H 2DM3A 2IOMA 2XZQH 4IMKC 4PJBE 4ZOBA 3H7BA 3PFQA 3HE6A 4FLHA 1UZGA 1S46A 1OCWH 4ZO8A 3HI5L 4MAYC 1UJ3A 2YHGA 3V0VA 3VQ2C 3WE6B 2CLVA 1ETZA 3KBHE 4TQEH 3RB5A 2F1BA 1EGJL 3KDPB 4JFQB 5FYKH 1LYQA 3DVIA 3CNKA 2WQUA 1B2WH 3BVVA 1RFDH 3LRMA 4JR9H 4WWKD 3QEUB 3LV3A 4LKCA 3FFDB 4FLRA 1DANU 4QHLB 4ABWA 1ICTA 2BZ7A 4MNQA 4N2NA 4MS8D 4ZS7L 4IRSB 1H8NA 1JWMA 1QHQA 5HVHB 1BWWA 3O3DB 1GAFH 3APFA 4LVOB 2DIBA 3VFGH 5JA9A 1CUOA 4XCNA 3CLFL 2FH8A 5E9DE 5LQBL 3GJFA 1QUPA 5DJZB 5F0LB 4BCZA 1A4CA 4I0PD 3SQBB 4FNSA 1JWUA 5HDRA 4HOZA 4BK5C 1KLUA 3BIAX 2CKBL 4KKQA 4QJ4B 4OI8A 2Z91B 3PV6B 1A66A 4IU3A 5BZZA 4K8RD 1GGUA 4HPYL 2XWZA 3DHJA 2CDFB 4CC0A 4AKOA 1UWYA 3O45B 4A67A 32C2A 2BNRE 4CN4A 4FNQA 2E7BA 3TZVB 2YD4A 1U93A 3P30H 2EKSA 2MQGA 1OSPH 2ADFL 3WENA 3OKYA 3SDXE 4PJ5E 3R4RA 4UT6A 3WKQA 5D7HA 1WAAA 3P3RA 4I0CC 5GRZA 1K72A 1BGXL 1OT1A 5EUOA 4A7TA 2AK4B 5DRXB 5GJSL 2GQHA 1OQOA 3LIZL 3T5WA 2AMGA 1FFTB 1CD1A 5C08A 1WIUA 1Z3GH 4NBXB 1HXKA 1NGQH 4KFMA 2E8ZA 4OD3L 1CICB 3BDBA 2VLKD 1ZEAH 1HJBC 4RMTA 3IXAB 3BN9C 2ZG2A 5E03A 4ZK8A 1ETA1 3EYVA 1MCWM 1A6ZA 4EPSA 5IW6B 4UDUA 1FAIL 3OSKA 5KUMA 3MN8A 4MWFB 1NCDL 3V6OE 3ZIYA 2ZUQB 4JFVA 5AZEH 1NBZB 1B9ZA 4M5TA 3WJLA 1YAZA 2APWA 3VD2A 1UFUA 4OH2A 2AKRB 2CNYA 1AKPA 3OGCB 3GSUA 3LN4B 1HHKB 1CE6B 1NC4A 3MV8E 4NAQA 1G6RB 3VTAA 3SQRA 4L1DA 4GLRI 4E41E 4YNYA 2VZSA 1UT2A 4HSCX 4URTB 2Y06H 4JM2F 4HLEA 4QYOB 4GKOA 5LCVL 3BE1H 3EUDA 3BUIA 2B3IA 4F8PA 2O6DA 4LCCC 3EFOA 2IMNA 2V2TA 3W0WB 3BWUC 3AMLA 2YAQA 4BK4A 4XX1G 3WOVA 5E6IC 2IPUG 2M1KA 4BFJA 1BZ9B 1M9SA 4ODTH 2DD8L 4TUKH 4JZJB 3ARGA 1P6AB 2WWKO 3E2HB 4A2EA 2K6YA 4DJMA 4MJIB 4P23B 2GTQA 5IP4A 2C3GA 2A77L 5I1EL 2KYIA 3MRMB 5DO8A 2ODIA 2YKLH 3AJ7A 5HDWA 2AEPH 2HLEB 5ICYB 2DJUA 4WI4A 1S6NA 1OT4A 2B3RA 3QZWG 2ATKB 2V7HA 5AW3B 3SO3C 3GHPA 5IBUB 4AI7A 2ZXDA 3PP3H 1DQJB 3RPIA 5KS9A 3BLBA 4KQ3L 4W6WB 5K9OB 3GS4A 2K0RA 5T3XH 4Q58C 4UU9B 4YOKA 1XGRB 1X5IA 4WU7A 2JIXD 3F12A 3L4YA 4XBPB 4RIRA 2J8UE 4HCIA 3QRGH 3CH1A 4RRPA 4BKTC 3KPMB 4BZYA 2X89A 4HC1H 2X4SA 2AJ3B 4LF3B 1CLZH 3PJSA 2NZIA 1OE2A 1NCUA 3NTCL 5AVSB 1FBIL 3I3BA 5IBLC 3BP6B 1SFDA 4N8VB 5ICXA 5FFLA 3CJJA 1D9KB 1BX2B 3ESMA 5DJAB 4NQEE 5TQ0L 3KPPB 3ZE1F 3T0AA 3A4AA 1YJDC 1HX0A 2JTDA 2G5BB 5F3BA 1IEBA 5GS1A 2E59A 1QBBA 3B56A 3FB5A 3BCFA 4Z5RB 5DD5L 3IFPA 4RDQF 3HHSB 3DMMA 3C2AL 4XB8A 2L4OA 3WI9A 1U8IB 1MHPH 4XP1H 3WSQL 4YEEA 4CW1B 3LH8A 3QI9B 4PJBA 5ITFB 2WK2A 3BH9A 5HHVL 4TUUA 4LSDA 2F1EA 3EFDH 4NO0B 3L48A 4UNVA 5J9PB 4P57A 5I75C 2W0KA 4I2XA 4O2FB 4GAFB 3O0RL 3TNMB 1KCUH 1E27A 3G5WA 5KUKA 1QUNB 2ZXAA 2GJ6B 1ES0A 4ERSH 4LCUB 2HLAA 3UTTE 5IM7B 3CSFA 1PEWA 3I6SA 3VXNB 4U1JB 5CD5D 3IAPA 4X6CA 1BZ7B 1A6VL 1QNZL 3IFNH 2I24N 3QDAA 3QR0A 4S1QH 2FX9L 5KYUA 1SQ2N 3RWFA 2VDNL 3GHBL 5C0BB 2VZ1A 4GRLB 5DJCB 3R18A 5CWSA 2M2DA 4N9GA 5AWNL 5CEZE 5CHNA 4GIPD 3C5ZC 3FU6A 2Y22A 3I9AA 5I30L 1F2XK 3M7FB 4FXKB 1LO5B 2JFCA 3X12A 4ZAKD 1JZ5A 1ZVYA 1ZS8B 1C9SA 3SOTA 5KSAC 1WGOA 5LN8A 5C0RH 5HHOB 5CJQH 2HTKC 1OGAD 4OZGB 5E9DA 1KB5B 2XA3A 5ISZD 2IBBA 2A4ZA 4FQXB 4E42A 3CDGB 1YNTB 5KVGE 4PBXA 5DT1L 1UJTA 1BA9A 2PXYD 3V9CA 2V2WA 4UINH 5BVJB 1KELL 3OLGA 4BFIA 5KSBE 3K4AA 1I53A 5KBLA 1T7YA 1VZHA 4LSTL 1A2YA 4OUUA 1G0DA 3UZEA 3C75A 2VLLA 2BNRA 1X7TA 2HN7B 4R8WH 4LPVA 1CVSC 1XF3B 1ULVA 1J7VR 4WHTB 4LNRB 3SDXA 4Q9BA 1A3RL 4CU6A 4KTDH 3FFCB 5EU4B 3SGKC 1C5CL 1ZHBA 3WXWH 4HHWA 1IKOP 3N40F 1AR1C 1IC5H 2CBQA 3SCMA 3SDCB 3NFPA 5GS0L 2EYSA 1KLGB 2WXQA 4L37A 3EGXB 2FD6H 3AWGA 3GO1H 3EG9B 3AS0A 1E67A 4HJIA 1BVKB 1NOFA 2YD8A 3CH8A 1SOKA 2DTSA 3R1GH 4JZNB 1WICA 3UJJH 3NCBB 5EEXA 3NA4A 3TJHC 5EWIH 3FUIA 3RVTC 1NWPA 1X4XA 4PUBH 3JVFC 5KW9L 4FMVA 3LSOB 1FLRL 2EH7H 4YGAB 4XZ4A 3QQ4A 1YEIH 4BK8A 5KBKA 4FFZL 4G9FA 1PDKA 1ACZA 3V6OA 1FIGH 4F8TA 3MV7B 4AW7A 3MGOA 3N55A 4HXBH 4NRXA 3BSZL 2X70B 1EZLA 4U3SA 5DD3H 2CO2A 3V8CA 4MBRA 1F4YH 5D71H 4P2CG 3WN5A 1IAIL 1GYUA 1XB3A 4CADA 4HPOL 3LTVA 1TEYA 1T2JA 2OMNA 3LXCA 4Z7VE 2CXGA 5EF3A 4AQAA 2O4EA 4POYA 4IRSC 3IN2A 3AT9A 1NMBL 1GJUA 4IRZH 3VFVB 2H0EA 3H4FA 4WV1B 5HVHC 3MV8A 2YUWA 2EE0A 3S2AA 3AS2A 1MAML 1T1YB 4NNYA 2W0FB 1BQHA 1W8OA 3F7KA 4E41A 1AOZA 1TCRA 2Q1EA 2H32B 4P4RA 4TF4A 4YL9A 5AW2B 1NAMB 4S1DC 3U7AA 3QUXB 2AC0A 2IPTL 1XSOA 5F7LB 3MUZ1 3VYOA 1EZVY 3RQ3A 3F7PC 5EZOH 1QSEE 3JVGA 4PJCA 3OJVC 1OGAE 1QG3A 5FCUL 3G6JE 4MNGE 5ISZE 3VD7A 1OHQA 4HLZG 5I18L 2ZYRA 4XCCL 1OGTB 1UXSB 3STLA 3N42B 3HE7B 3I2CL 4KGJA 1U3HA 3ZJAA 4WIQA 1TVDA 4HUVB 2CD0A 2ZSVA 4LHUG 4TRPL 4QY8A 5D4JA 2JH2A 4GXVH 1IQDB 1ED3B 4E9SA 1IGYB 1DHKA 3L4CA 2CR3A 4DO5A 4MA1B 4NDMA 4S0HA 3F58L 4KVNH 1T2QL 3T6QC 4ZOCA 4Y9FA 2EDEA 3GI9L 1BM3L 2CO6B 4NC0B 2HX8A 3MBED 3HNTH 2AJSH 4YXKL 2BNQB 3SKMA 2Z1KA 2E4FA 3BVDB 3GMNA 1E6OL 3QS3A 1NBYB 4N1EA 4WEBH 2F19L 1CICC 4JN2B 3GJFH 3L3OB 4XNBA 1SBSL 4OJCA 5EU3B 3UGXA 3RY6A 3AMKA 2UY7A 4JW3A 4NP4H 3GEWB 2YEZB 4H8QA 1SHMA 1V7MH 2J8UA 2N0KA 5TQ2L 3GRWA 2KHAA 1Q1JH 3T2NL 5ETUB 4XCEA 1HDMB 5J3HC 3ESOA 4RZCB 2ZUQC 1BF5A 4G6KL 3TA3B 4PWJA 2FK9A 4AC4A 4RAUA 3DARA 4MAYD 4WW2B 3HNSL 4HYTB 4AE1A 4B9CA 3BVTA 4ZYKB 2Y23A 1IBBA 4EIBA 1FO0A 1TEGA 3P69A 1M71A 4UT6H 1EDYA 3DV4A 1NDGA 4M6OH 1M2OA 4NQEA 1IKFL 5INCA 4HUWB 2IH9A 5T1DL 3EYSH 2A99A 3VWJB 1YAIA 5KTEL 5FFGA 2DZEA 3FPYA 1UUNA 4AYID 3VI4B 3VFMA 1ZHLA 2X2HA 3GQFA 4MXQC 1IUZA 3VU1A 3DXAE 4XX1E 4N6RB 4B3VA 1LDSA 5FYJU 1S7RA 1E5AA 4GAYA 2LAGB 3WNJA 2RMNA 4MRCA 2FWOB 3BKCH 4H1LG 1ONQA 1FNEB 1GW0A 2FIKB 4LAQH 4NAMA 3WIIH 5AB2A 3I84A 3KHOA 2SEBA 1QZ1A 2L3BA 1E6JL 5HGDA 3CSYB 2JJSC 3QUKA 4AT6B 2R2EB 4L8SA 2LR4A 3KGSA 4GQRA 1KJ2L 1H0DA 3H3PL 4XO3A 3UTTA 2ADGA 3A3YB 4JZJC 5K33A 3SJVA 4M7LT 5CF3A 5M7QA 3E2HC 3MJ8B 5GZOA 1S7XA 3WTTA 4P23C 3FK3A 3T0VA 2ZONA 4MJ5A 1A6AA 1ECYA 4ORGB 3D18B 5HD8C 3OAYK 4CSPA 1A0QH 2V5MA 3HTLX 4FQCL 5MEOA 2K3HA 1A1NA 1K4DB 4IBLT 3QUMA 1YC7A 5DURB 3C8DA 2NY1B 3LH2L 1VIWA 2G2PA 1I1AB 2F68X 3B5TA 4QHNB 4ZO7A 4KKBC 5FUCE 1SXBA 2HVJB 3UBXB 5CGMA 3L4VA 2B1AH 3NESA 4EO5A 4B9IA 2DYPD 3DVNB 2J4WH 4YDNA 1OB1A 5FM5O 3S0PA 3G5YB 4NGHH 5DI8A 1UZ6E 3CU7A 2IDUA 5C6PB 2JF1A 3DX6B 3ZXAC 3CFKB 4NERA 5KSBA 1AHKA 1N67A 3EW3B 2VM3A 5B3JF 5EUOF 1EXUB 1MUJB 1KF9B 2BO0A 3JWOC 4ODSL 3BN9D 2Q87A 2WLHA 3PQYB 5DJ2B 2CIIB 5EFIB 1Z5HA 3D4CA 1OCOB 5DEZA 3T3PE 4H0IA 1XEDA 3P0GB 5DJ8B 4PCKA 1DQVA 1D9KC 1KG0B 1YO4A 4AVHA 1AQKL 5G55A 5EZLB 4QJ3B 1HCFX 2MRYA 3IFOB 2J20A 2NZ9D 3LRHA 3HN8A 1TENA 4AQEA 5FECA 5J57B 3QUZA 2BHZA 4OGXH 3U0WL 2JTYA 3MV9B 4AYMC 3O11B 1T7VA 3SZKC 5J1TC 3O3EA 1SDAB 5BW7C 3ZQWA 1D7DA 1B2YA 1U58A 3QI9C 1RV6X 2ICWB 4IU2A 5DJYA 3N1MC 3MKKA 1NGPH 2MMXA 4FLQA 4GSQA 4R5TA 1BLNB 1DVXA 1GZQA 1OF2A 1C12B 1S7UA 3ME0A 1P4BH 4NJ9H 4RMRA 5K9JH 1TETL 3MODH 4HU8A 1S9XA 1E8XA 3JUYA 4LSPH 1CGSH 4QRPD 1XF1A 3ARRA 4WI0B 1J9QA 4YDJA 5SX4H 2R1XA 3CFIC 2C4FT 3JV4A 1GGIH 5I74B 5ALBH 3QFJD 3I6GB 1B4JH 5CP3A 3LVTA 1R24A 2E8YA 2EH8H 2XBDA 4G2AA 2OR9L 3OAWA 5JIDA 1PS3A 1F42A 2EECA 3Q3GA 2I85A 5E6ID 4GRLC 1CLYH 4Z7VA 1IFHL 3QEQB 5I1AA 1LILA 3D9AL 4N9OB 4HAKA 5CZKA 3DVGB 4FXKC 4YHML 1NFAA 2WLZA 3GXPA 5DFTA 3I9GL 4M4PA 3M1OA 4MTMA 5E08L 2GUOA 3VXSD 3HUJE 3H1ZA 2WO3B 3ERXA 3L3JA 4LHUD 2W9EH 4FQXC 4XC3H 2XT1B 1U3NA 4R7NB 3P4OB 4QRRE 5EN2B 4HJ1A 3TV3H 5IESL 4KI1A 3ABKB 1QSEA 5I1HH 1AKJA 5IEKA 5E6YA 4R2GB 3WNPA 4D9LH 4NRZB 3MGTA 3G6JA 4MNGA 3BAEL 4LEXH 2AXWA 4WTWA 3V0AC 3V7AG 3WFBL 2OSXA 4FZEL 3JUZA 4X7CC 1A21A 1G7LA 4OCRL 4GS7B 4N5EC 4DP4X 1IM9A 2B20A 5D2NE 5JOEA 5EEZA 4PGDB 1DQTA 3DRTA 3IMUA 3KDMB 4H2CA 3OLEA 5KS9F 3HMXA 5DGRA 2O61A 2C4XA 2OMZA 1HKFA 2VDQH 4XNXH 4XRCB 1PZCA 2PR4H 1ZXQA 2DTML 1M05B 3EJPA 3SDCC 2QKIB 1T21B 2DLEA 1RU9L 3ASNB 5IBLD 3O0LA 4NP9A 2FYVA 4ZUWB 4KRLB 1H6TA 4PJ6A 5FW7A 5K9KB 5AVVB 1YEEH 4HGWB 1J18A 5HYJD 1RZJH 4XXWA 1CS6A 2E74C 3GS7A 1EAPA 4CVXB 4F7MA 1G4RA 4FL4B 1VF5C 2XWRA 2FR4B 1M7DA 3HLKA 2QEJA 4DZ8A 1DVSA 2FQFA 1KGCD 1M6OB 3OF6D 1KBPA 5I8CA 5FYJH 2BRRH 2Y1ZA 4F7EB 2DQEH 5HDQL 1DQMH 3P0YH 1N0LA 4Y16B 5JDSB 4XN7A 4HFUH 1MIML 5BNXD 2PKDA 2FT8A 4IGBB 5INCB 1DE4A 2V9TA 3AU1B 2OSWA 4IHOA 5CIPH 2VM9A 3Q8FA 3IMBA 1YEDA 2B08A 2XBZA 1OTSC 4E9TA 5CGTA 4WV1C 3VXRB 5AVXB 4C83A 3EGDB 3MLSL 3N0AA 3MBXH 4RFNB 1YEHL 3AQZA 3WKPA 4ALAH 1UH2A 2BOBB 1JCKA 1L7IL 3IWUA 2UV3A 5LXGL 3DXAA 2OXHA 3V4VB 1TXKA 3C5ZD 3P2DA 3QUXC 3TNNB 4I18B 4HIIB 1BD2B 1G0YR 2Y25A 1EXGA 3F3HA 4X6CF 4AVJA 2HUEA 1KBBA 1ZLVH 5E9AA 5KSAD 1TR7A 2HTKD 1R46A 1RUPH 2BIMA 3D08A 1CYWA 4KVPA 43C9B 1SHXA 4PV8B 1ZSDA 3U9PL 3ECBB 4UV7H 3VA6A 2VXVL 5BOZG 3QO0A 2YA2A 2EUZA 3NRPA 4MZ3A 1DL7H 3HE7C 4NRYB 4J3TA 2VDLH 1YEKL 1PIFA 3H42H 1FH5H 1KPUB 5ACLA 2Z8WC 3QZWA 5D4IA 3GJEA 2Z31B 1KZYA 5CJOH 2K7QA 4ICXA 4MA1C 1A7NH 1VEPA 3S4SA 4KPHL 4LGPB 1FGVL 5I5IA 2KLSA 3PGCA 4AM0B 3U30B 4OJEH 3IS0X 1KY6A 4WUUE 1HHGB 5DJ0B 4NUJA 4NZJA 2MQCA 4P49A 5EC1B 2R51A 1A4BA 4GW1B 4OCXL 5DD0H 4D3CL 1UD3A 3L3OC 1AR1D 4OLXL 4OM1L 2K78A 1SLXA 2R83A 4YS4A 4IJTA 4MXVE 1K8DB 1XF5A 2NPLX 1EHLH 4OZ4A 1SMOA 1PW3A 4OSUL 4KROB 3SDXF 5CBEA 4WU5A 2GTWB 2PYED 4H25A 4H40A 4Z7WF 1TNNA 5IV2A 1M6UA 1Z32X 3EOTL 3TYGH 2FB4L 3TA3C 3RVTD 3TJHD 3VXOA 2EAEA 2J55A 2FEDD 4WW2C 3DECA 4F8OA 1ZLSL 1RH8A 2F8VA 4OBSA 3K4DA 2P8LB 1WF5A 4QTHA 2VDOB 2AQRA 2M26A 4DGUA 3SDAB 5DEFB 3MBWA 2XZCL 2XVKA 2OI9B 4HCRL 5E4AA 1MELA 2E46A 3VWJC 3KPLB 3WKML 4KXDA 1ZLUH 4YZFF 2VN4A 4JE0A 4LSVH 3JTTA 4WSGA 5I66A 1H8SA 5KJRH 1NCBL 4Y4KB 5D5ME 2OJEA 4XN2A 4M9PA 2GK0A 2XWDA 4IRSD 2JNZA 4L4JA 4N8CL 5LGHL 2QHRH 5FM8A 1TJGL 4JQIA 3G5XA 4IKKA 3FT3B 3KYMB 3NIGE 4N2OA 1QZNA 5D1ZI 2NQCA 3MLRH 4LLMB 2A9MH 3BKMH 1WA2X 1HE8A 1RJZA 1UB6A 2Y1VA 4LASH 4M93B 4OKVA 4GUOA 3CX5K 1JZGA 3GRWH 4PJ7B 2YA0A 5JPMB 4OLWH 4S1DD 4F24A 2RBLA 1I3VA 1ZS2A 2F5AL 5KVEL 4G6MH 3EO9L 5D93B 4UQBA 3NJMA 2X05A 2F7QA 1LQBC 1T22B 3KS0H 5F96H 2NTSP 3LNGA 2CK0L 5IFAL 4PW3A 4HP5A 2NY5C 2Q86A 2CIKA 3HG4A 3O6FB 3U36A 2RJMA 1TFPA 2VJXA 2NXZB 4C8XA 3GMRB 3RIFF 5DGQA 3TZVD 5E1IA 1BBDH 3NCJH 4U33A 1NMCB 3CSTA 4PQXA 5CLYA 3ZKQD 2NY1C 5AZUA 4F7TB 1H3PL 5D7KD 4PJCF 3LVEA 1I1AC 4XZUA 1G5AA 2P7TB 4R4FL 3KJ6H 3UPCA 1CFBA 4AW4A 2D0FA 3HUJA 2NXYB 1A6WH 2J43A 4OIAA 5DK3A 5GHWH 1U3JA 3HS9A 2AK4D 2YC1B 4F9PC 1KN4H 1F11A 4QRRA 1LEKB 3ASWA 4PV1C 2E3VA 3NFNB 5EEUA 1EO5A 2FO1A 3FCTA 3OZLA 1IAKA 1CDJA 3V0JA 3GGWA 1BOYA 3IFLH 3ZDZB 1SUHA 1XEUA 3FU0A 2W60A 1AXSB 1XR8B 4OW6A 1A7QH 1UCTA 1CGUA 2EINB 5D2NA 3FHQA 1NC2A 3NCCB 4YDKL 1M56B 4PP2A 5EU6E 3MNZA 4X9BA 2QQLH 2XNAA 2IQAB 5J3HD 4K94L 2ZOKA 2D7PA 4ELKA 1F41A 1T5XA 2XV0A 5CEZH 4RX4A 2C1PA 4GQZA 4MCYA 3QUMH 1J05B 2J8UF 1YNLL 5F7MC 4ZTPH 2XKNA 1TVBB 3A67H 3DPBB 3MRBB 3H4HA 4GRWH 4HH8A 3F7VB 1IGTB 4L3EB 1FFPB 4PSPA 4AQ1A 3VD4A 2VMCA 2NX5B 2HP4A 2F58H 4P3WA 5KVGH 1CDBA 1X3DA 2P5EA 2BIQA 3CSPA 4NNPL 4J6RL 3Q5YA 1C7SA 2VNCA 3PGDA 3PXJA 4MXQD 2JSFA 1BEYL 2EEFA 4NWTL 4GMSL 1QVOB 2D7NA 5I74C 2IXQB 4BXVA 5IJKC 1URIA 2AHIA 3QVAA 4P9ML 4MLSA 3W0WD 4WEMB 4NIYE 3I6LD 4UM9A 4JG1L 3HBPA 2KZ1B 3NSYA 1JRHI 1IIKA 2YD6A 2VL5A 2EIBA 4N4YB 1N9PA 1KV7A 2VUOA 1L9OA 2F8IA 4N0UE 1S5HA 4IBYA 4NQVB 1MCPH 4MFHA 2VR7A 2HPTA 3WTSA 1MFMA 3CFJB 4LRIA 2XIIA 1N3NA 4H20H 4IKLA 4MJID 4P23D 4OZIE 4YHKL 4W9LC 4PBDA 2IGLA 2AEIT 5FK9B 2I32A 5TDOA 2V33A 5HD8D 2C9XA 1NWOA 4OD1H 5E2UL 5TDNA 2XV2A 3C9NA 3PHQB 3V7AE 5D7KE 4WKZA 2EXWC 4PJFE 1AVAA 2UXGA 2DDQL 4KKBD 3MLTA 3T3MB 3TBTB 5ADPH 5J12B 4MZRA 4R2GC 2CH8A 3H9SB 4K3JH 2L7EA 2DLFL 4XP6L 2AK4E 2R29H 5L8JB 2ED6A 1R5VB 4GKLA 3LOWA 3OB0H 4G8EA 4QIRA 4P3CH 4AYFA 5BVPL 1KWKA 1T83A 2OW6A 3ZW3A 5CP3H 3DOHA 1HZHH 1N4XL 1K2DA 4AGMA 2Q7AA 3SB3A 2VQTA 3HFML 4GQQA 3O6KL 2K7PA 2EKJA 3MREA 3C6EA 4U4BA 4D0DA 2B59A 3DGCR 3HPJA 4B9YA 1NGWB 4Z95H 3TASA 1ACXA 3FTYA 1QNIA 1EBPA 2QKIC 4BA0A 4APQA 4JDEA 4Y4FA 1DN0B 2YXMA 2EYTA 4XCYA 5KSBF 4MVBC 4R5XA 4XPTH 1D9KD 4HGKC 4LESA 4WUUA 1OOWA 3KPOB 4I3RH 4UT7H 1M2VA 1ML0A 2IAAC 1MG3C 1ZLEA 4BH8A 3FCUB 5FYLL 3SKJL 1A9EA 3ULUH 1P2CB 3LXUX 5EORH 4XBMA 1HXYA 3MJWA 4NKOA 4RMUA 5C0CE 4FL4C 4LZKA 2AS5M 4WJKB 2WCPA 3STZA 4N3UA 4AENB 3FJTA 2VE6A 1OF0A 4EXPX 4P5RA 3QI9D 5E0QA 3IDXL 2BY0A 3ATBA 3WIFB 1O7VA 2GSGA 4ZFGH 5A43C 4NO0D 4Y16C 3GXMA 5C0IA 2EDFA 4O51B 1MHCA 4IGBC 4PP1C 1NGYB 5GRVK 1VLXA 2IOIA 3CDCA 1F02I 3D85A 3CHQA 1OALA 2GJ6D 3HMXH 1S7TB 1ZT4B 1OGPA 5EIIB 4OZFB 3W0WE 1JFQL 2CLRB 4A2FA 1MJUH 1ZHNB 5IHUH 2ZTBA 4RFNC 1YQ2A 1JNNL 4PS7A 2OR8A 5C0BD 4H1LA 1XGPA 4GRLD 4X9YA 3QQ3A 4K9EH 4PRPB 5D5MA 1RERA 4RISH 3TFBA 1CLCA 3FB6A 3VB8A 3Q01A 5C07B 4X5WB 5F1IB 2DIEA 4I18C 2BP8A 3UTPE 2HFGL 4PW4A 1X5MA 2EYRB 3C08L 2E86A 4Y5XA 3UZVA 5HHOD 3VFPA 5DDHA 2GJPA 2H2SC 5CBAA 2FX7H 1UOKA 3MRDA 4GMTL 5ABZA 3HHMA 4FQXD 3BAKA 2VIRB 4AK2A 3QQNA 1GY2A 2EVJA 2X87A 2HH0L 3L7FA 4QRSA 1G9NL 4PRHE 3RUGB 1B4TA 3BP5B 3RG1C 2EQDA 3GTVA 1MW0A 2MEJB 5DCCA 5KANG 4KDTC 1DQLL 2PO6B 3B7RL 5IG7A 2Z31C 2YAPA 4YX2H 3S36H 1EFXA 3ULUF 3WFCL 2VCOA 2RFXA 4N5ED 3CUPA 3OLIA 4GG6B 3U30C 1VEOA 2QR0A 2DS4A 1UD4A 2YD3A 3G6JF 4ORZC 2VISB 4APXB 5IKCB 1M1XB 1AGDB 1CFTA 3FFCD 1I8AA 1Y1DA 2W65A 4OTXL 4OLUL 2XG4B 3T1FA 5DD1L 5GGSA 3SDCD 3GSXB 3GNMH 1KXVC 2YQGA 3TBSA 1MCHA 4KROC 1KT2B 2CRZA 3QIUA 3MMEA 4GRMA 4NBZB 43CAA 5IB4B 5INDB 2NY3B 3R06A 1AHWB 1BZEA 4PJHA 3CZSA 5IMKB 4UUJB 3VH8A 5BPPA 4JJOA 4EMZA 4TSAL 1WG3A 2Z3FA 1PL3A 5DYFA 3VWKA 4TXVB 3US9A 4P5TB 2D3JA 4WGVB 4O5LL 4XXDA 3NVQA 2P49B 1FE8H 2LU3A 3NQKA 5EU6A 3PE9A 1MWAA 5DFAA 3LXBA 2D03H 4XH2A 4U6VL 3SBWC 3UAAA 3SDAC 3MV7D 2OI9C 3ASOB 1OD7A 4LCYA 5DJXA 3MX0B 2OTWB 3N5AA 4AM0Q 1Z0NA 1AXIB 1BQKA 1EANA 1JK8A 3Q1SH 1JV2A 5I71B 4E0RA 4FJ6A 1HINL 2MOQA 2WSKA 5C0NC 2DQDL 4HQQH 1DVUA 4BFRA 5E2TH 1J8KA 3D2UA 1NAKL 4XMPL 1Q4NX 3Q2CA 4M3KB 5E00A 4R26L 4Y4KC 3IWVA 3WS6C 1KIUA 3VFGL 4UMSA 1OTSD 3SOBH 1MH5B 2MIZA 4D0CB 2NQDA 4GW4A 1DVFA 4P2YA 3VXUE 2UXFA 3DIVA 4NWUH 4M5ZL 4U7SA 2JXMB 3T0XA 3ZX1A 1AC6A 1XCWA 1I8KB 5C0BE 5SX5K 5JR1H 5H35B 2WXKA 3T4AA 3NPZB 4M93C 4W4OC 1OKEA 5CCKH 1AP2A 4G8IB 4IS6A 5JPMC 4LKXA 1NGZA 4OFYD 3QUXD 1HL5A 4M61A 3EYFB 1CE1H 4LEEA 1YA5A 3KPNB 4FX5A 5D93C 3FQTB 4O9HH 1CCZA 5C0DA 4HWZB 5HHOE 3APNA 15C8H 2PCFB 1PG7W 2DQHH 2BIPA 3P30L 3ZHNA 3QC6X 4JHZA 3FW6A 3FU7B 2PP9A 1MDAA 1NOLA 3O6FC 5F9DC 1MAKA 2NXZC 4NN7B 3ZGIA 3CZFB 1T4KB 4LPUA 5G4OA 3HE7D 1HIMH 1HOEA 4N0UA 1NMCC 2HTLC 2A4EA 2WYIA 1KENH 2Y36H 4XN9A 3WEOA 4N68A 4OZIA 1PY0A 3OR7B 2X4OB 2NMSA 3Q43A 3FU3A 1V05A 4TOYH 4LU5L 1A8JH 2NXYC 5EBLA 1ZTXE 4A37A 1MI5B 3K8KA 1BZOA 3OKKB 4JFPA 2ITCA 4M7ZB 2GCYB 3CFMA 3G5VB 3UIYA 4F7PB 5IGXL 2BNQD 4PJFA 2IH1A 1UGNA 1A6UH 2OMYB 3VTTA 3SDYH 1DBML 5F7EH 3IJ9A 2ORBL 2J56A 4ZMOA 1JXFA 4PVLA 4JO2H 1RXLA 3V4PL 1MFEL 1A7OL 3FZUC 3QHFH 4NO5A 3O6MH 1YRKA 4R84A 3G9AB 4JB9H 2WUBH 2Y7QA 1K6QH 4X6DB 4Y9EA 2Y5TB 5AZEL 4X99A 2VC2H 3MI6A 1EZUA 1XTMA 4RGMB 2AP2A 3TA4D 2P4AB 3U6RB 2IANB 1WFTA 4LPYA 5ELIA 5DMIH 5MEQB 3TEWA 5EPMA 4OGYL 2VXUL 1UZ6F 1J5DA 1R5WA 4GY4A 5CZRA 1F1AA 4N22A 3ULVL 2VXSH 5FGBC 3S8GB 4HUXB 1I8LA 3ESPA 3FTVA 1H9VA 2EIJB 5EBMA 4ZUUB 5D70H 1QO3A 1YMHA 3VWJD 4KZ0A 4BE5A 1OB0A 4KJYB 2XQBL 4FFVC 1NFIA 2N4IA 1NEZB 3SPVB 5GS0C 5C0CA 3P9LB 1AIFB 5B8CA 1T04A 1WYJA 2FJUB 4PCYA 3SKNA 1N8OE 5FKPA 4HULB 5JPNB 4BQ9A 3FN9A 3U0PA 2O5ZH 1A7RH 4XPFL 3VG0H 1OE3A 2DBLH 3PWUB 3DTXA 1MLCB 2DQIL 2XN1A 2ATPB 1U8OA 3WJMA 3NGBB 2WLLA 2O6CA 4WHYG 1TKWB 4QUOA 1ZGLM 4K23L 5ITBH 1U8LA 1XVSA 4YPGA 1B0GB 4JO1H 3P2BA 3RI5K 1DSWA 3QFDA 2HJLB 1ZWIA 5JIPA 4HOMA 1DSFL 5I19H 1BXAA 1JHKH 1NCOA 2A9CA 3UAEA 1ZT7A 1BVLB 2NY4B 3QUYA 1I7TA 4KQ4L 1T20B 1F3DH 3MRRB 5DURD 4ELME 2NY1D 3T4YA 4LLAA 1I1AD 3VSQA 3V5DB 3FOMB 4UNIA 1XCTA 5J12C 3QR1A 4GXUM 5PAZA 1NKGA 5DJ6B 5I1CH 1E5ZA 5JORB 5BXFA 2R2BB 1Y0LA 3QHZH 5GRUL 4F7KA 4G7VL 1XGTB 1TYEB 4XBEH 1RJLB 4PRHA 1OAUL 4FGMA 2XKUA 4ONFH 1AD0B 4L8DB 5BO0D 5F9WB 4JHVA 1CFMA 4XVTH 1QFWM 2FX8H 1CGXA 3OMNB 3HUJF 4FXTA 2WZPD 3CFQA 5GRJH 2UY6B 1IBGH 1W6WA 5AKRA 3SKOB 3TO2A 2HRGA 4EI5A 4ZSOE 1JAEA 4U6XA 5BQ7A 5ACZA 3PQYD 3COOA 3OZ9L 3RX8A 3V6FA 1BAGA 3ET9F 3A6BH 1BMZA 4JCLA 5ESAB 5TFSL 1IC0A 1CFVL 1U2HA 4TUJA 1CFSB 4IYKA 1TITA 3CZNA 4PJIE 2EE6A 3RFZA 1R9FA 2V17L 3DUHA 3IETB 2KLRA 3IPEA 4XP1L 5TK2A 3MNVA 1CF8H 4LOVA 3VSVA 3S8FB 2BPBA 2UWEF 4PJAB 2APFA 1XF2B 3MV9D 1IBZA 4XMVA 1SOXA 5ANMB 5DHVB 1U8JA 2VN7A 3QXAB 1ADQA 5CN1A 1RURH 3VI4E 3DUUB 1LEGB 4DESA 3LNFA 4OZHE 2OK0H 4W9FC 4X7DC 4MB1A 5B1KA 1MFBL 2JJTA 3S5LG 3OJMB 2H26B 1W0VA 3CXFA 2XQ0A 4HXAH 3R7QA 3J2PA 2VERA 3VJ6A 1LK2B 2XTLA 4JUTA 1RK1B 5DMYA 1FZOB 3UTZB 1VFMA 1MCRA 3T0WA 1XGQB 1MJJB 5CEXB 1NLDL 5HHNB 3V0WL 4FQHA 4GKSB 4JDTL 2J8OA 3EADA 3UYPB 1RKRA 3QEQD 4N0YL 2WNXA 4P9HH 1R3HB 3MXWL 1K85A 1DLFH 3VXUA 4MX7B 4PG2A 1BBJA 3JV0A 4FXLA 4YR6A 2FSEB 3Q5OA 2R69A 3FC8A 5T1MB 4I3SH 3HR5B 5AVUB 3SE4C 1QEWA 1XF4B 1RUMH 1JHLH 2VERN 3RWDB 4KX7A 3OKDB 1RUQH 3LZNA 2EO9A 4PGJA 3WFEH 2EXWD 2J2ZA 3VD5A 3W82A 3UJTH 4R2GD 1ZHKA 5CSGA 2PO6C 4UTAA 1PLGH 2QPDB 4R8WL 5DJDB 3KW7A 2IV9A 4Y7MA 5DSCB 4KRPB 4G3YL 2HVBA 3HR6A 1L7TL 4ILDA 2EXSA 3BWAA 1A22B 1S3KH 2VR6A 2B0SH 3BPOB 4H1LH 3MZTA 2XY1A 3LN9A 3PQYE 1DUZA 1N8ZA 3PWVA 4KZEL 4Z7OF 3RNKB 2Z8RA 3JQOB 5CXPA 2ISDA 5DWUH 3FQUB 2VDPB 3MOQA 5I24A 4MVBD 3WKYA 5DZAA 1JXJA 2Y9RT 3JBG7 5B38B 1N59B 2NY3C 4JE4B 3K5RA 1R3KA 1AHWC 3M46A 5C09E 4TLTA 1EEYA 3BIBX 3OAUL 1PZ3A 4AOFA 4YXHL 4QPEA 4A7QA 5C70A 4P5TC 2G3MA 2W9DL 1UKQA 5CJXA 3ETTA 2QGDA 4PCSA 3WUWB 5DD3L 1ZT1B 3OXSB 5D71L 4KUCD 2WLNA 1PD6A 1COBA 3ARSA 2O6FA 3EYOA 4Y16D 5H94B 1LLAA 4JFXB 4QLRA 5D7JA 1FIEA 4H0HB 5I71C 2QQQA 4IGBD 4PP1D 3OD3A 1S9WA 2X4TB 1LTXA 3CDFA 3QJHA 4JFTA 2Z65C 4U05A 3IRCA 3U4BH 1VCAA 1HHJB 1AACA 3VXRD 3TLRA 1B0IA 3L3IA 4BA8A 1YN7A 2CHDA 4M6MH 1YHPA 5C0GA 1M9WA 3AQDA 3RPKA 3VYPA 3UBGA 1DJGA 3IF1A 5B1BB 4NUMA 2WO2B 5L2KB 1OXYA 5HDOA 3TN0B 1ADWA 3AM8A 3P54A 5D1QE 4G1EA 4XBGB 1L9QA 2JKJA 1BD2D 4OF7A 4U1IB 1Y6NR 5F7DA 3K72B 4MAUL 4JY4B 2H2SD 5ADOH 5L9DL 4U6HA 1JI1A 3CQFA 4X8GA 4NN7C 3U82B 3CLEH 2CO7A 2PYFB 3VFRB 1EUTA 4GOSA 4X7TB 2Z31D 2ZOWA 4M8QB 1S9VB 4JDVB 3GM0A 3ROOB 4JQXC 2PWGA 1ACYH 4HFWB 4PR5A 1SRDA 4DGWC 2CUIA 1NFDB 1D5BB 4QJ5B 4M7ZC 2Q8AH 1X9QA 3S2CA 1NA8A 4ELMA 1DFBL 5IEHA 4U6YB 4G11A 1NBVH 2IH3B 4KUZL 2DWXA 3IDJB 4ZOEA 1Z9OA 5EOCJ 2ZPKL 4HIPA 4LRNL 1MCFA 4ENZA 3ZDXB 1MY5A 3CHXA 1I1YA 1MQKH 4L5FE 1CDHA 3KVDD 4AJYV 4MD4A 5T1KA 2Z9TA 4DO6A 2ED7A 3R0MA 5LG1A 1MG2C 1CG9A 4KROD 4O4YL 2BHFA 3V0DA 4RGNE 4RGMC 2H8PA 1O6SB 5CUSL 3VGEA 5L7XH 4ZQKB 4ZSOA 2FJGB 4UT6L 2Z35A 4HW6A 4M6OL 4JKPH 3MRKA 4DF9A 2YUVA 3BZEA 5I82A 4GT0A 1I9EA 5EMYA 2GKIA 1P9MA 2JI2A 4PJHF 1IGJA 3SDAD 4HCGA 3GSWB 4PJIA 1J9CT 3ZE0B 2O93L 1U8MB 3NAAL 3S48A 4F15B 1G9ML 1JPGB 3V6ZB 4X5XB 5K9QG 3MXVH 1GZHC 3UDWC 1OAQH 2ZF9A 4QOKB 5C0ND 1HL8A 2AJYL 4GG8A 5JPNC 4JFOA 1GGCH 4MB5A 2EEDA 2LTQB 4NCDA 4Y4KD 5BRQA 3BKCL 2F54E 3VXRE 2W0PA 2HWZH 3KCPB 3P40A 2EE9A 2MPAH 1XSIA 1Y07A 4PD4K 1IIIA 1FDLL 1A1MA 3FOLB 2BRQA 4J28A 4OZHA 3DX9A 3LZQA 3WEXA 3NGBC 4D7PA 2ZXQA 4GEIA 4AH2B 1OAKH 1P69B 1IU1A 2OR7A 3BX7C 3MRLB 4IIQB 2EDOA 1L5GB 3SGDI 4DKDC 3DX8B 2GJZB 3IMVA 2QGBA 3KPQA 1JMXA 3FHEA 3TO4A 1J1PL 3VGBA 3WKNA 2GI7A 4FJZA 1IFGA 3S9DB 2XN9A 1QA9B 1QBMH 2VMDA 3O6FD 3PABB 3ALPA 3DC0A 2NY4C 2NXZD 4X0KB 1LWJA 2DMHA 3SE9L 5AENA 2HTLD 2FWUA 4FP8L 3SYOA 1OEZW 4OQTL 5GS2H 5IUSA 1N5YL 5IFJA 2JKNA 1WCBA 5DMKB 2XVLA 5B7EA 5D96B 3EJZC 2HVKA 2NXYD 5ESQB 5DS8B 4PRBB 3NCYS 2D0GA 4Y8DC 4LSUL 3RZCB 1OIOA 4DKTA 4YEFA 1MQ8A 3F04A 2V9QA 2D3LA 3EO1B 5E8NA 3X1FA 4U1HB 5SWZA 4OZIF 3WTVA 5F9WC 1XZ0B 2MTPA 3MRPB 5FA4A 3T65A 1AG0A 3ARUA 1I3RB 4L8BA 3N85H 5EF0A 1J0IA 1R3JA 2Y1AA 3FZUD 3PIQA 1OAZH 1YEGH 1AE6L 1HHIB 5DK2A 3SDDB 1CYXA 4PJFF 5HHPA 1IGCH 3CZJA 3P4MB 5T1LB 1TJMA 3ARBA 1KFGA 1Q9KA 1XAKA 2AEWA 3TCLA 4A2HA 1YYML 2Y69B 4YFEA 1N0XH 1XIWD 2C9QA 3Q8AA 1JTTA 3MZGB 4P2RE 3U7WH 5E4OA 5CJBA 2MQ0A 3L4TA 4JCWA 4BBWA 3DSFH 1JRHL 1P4BL 2DY2A 3CIQA 4GP4B 4L3ED 1QI3A 1RZFL 4M03A 4MAZA 4OJYA 1NGXA 4WJ5B 5FF6B 5C09A 3UFIA 3MO1A 3CN2A 4UYPA 2NX5D 1CGSL 1CJYA 2NW2A 4UQ2A 4FFVD 4NYLA 3ZMEA 4HJJH 3NIFE 1KN2L 3RDTA 4JO8A 1J9TA 4NO3A 3MOBH 4MKTA 3DOSB 2YJLA 1GR7A 2EH8L 3VI3B 4DKFL 4IKIA 3CFDB 3HPLB 4MB3A 1D7CA 2NY0B 2FUQA 4MA8L 2EXTA 4YMPA 2YS4A 1BVNT 2Z8SA 1PY9A 3U9WA 3VVWA 1XMEB 4PYGA 4TPRH 1INQA 4I9WD 3EOBB 1F86A 5BV7L 3IMSA 1CL7H 3N3EA 4J8RA 3WS3B 5HY9B 4JRLA 4XC3L 1KCBA 3EFFA 5T3ZE 4RNRB 3UYRH 2UYLB 1RZKL 1LL1A 1A9BA 4G7YH 1WHPA 1G7JA 3UEQA 1FV1A 2IDSA 5D1QA 1ADQH 2JB6A 2B16A 1U8NB 3H7LA 1YMME 4MJ6B 4EDXB 3QISA 3CN0A 4P4KB 4QXTB 1ZDQA 2AGJH 4FTVB 4WO4B 2F74B 1Q9LA 3H9SD 4KI5C 1RHHA 3SKUD 5LB1A 3H0TB 3P4LA 5CLXA 3FB7A 4KRPC 4P0DA 4UWQB 2ZXGA 3GB7B 3KXFB 4ZXBB 1KUMA 4JM2B 4YAQB 4TUOB 4XNXL 3P0VL 1RIUL 3G7TA 2J1KA 4JG9A 2PR4L 4WW1A 2AQ1A 1NPNA 3CDZB 4FYQA 5LKNA 3DJSA 2KPNA 2WKLA 3BPOC 3CX5J 2V7NB 4NKDB 4DPAX 1MN4A 1ZANH 1MCCA 3QIWA 1DJZA 1U9KA 2ZKWA 3CK0H 2LQRA 3QAQA 5J1AB 1NH6A 5AAMA 4DVBB 4ODVH 4G82A 1JNHB 1A4JB 3RL2B 4ZW7A 3BGFB 5FX3A 5AD0B 1V3MA 4PH8A 4WCYH 2KDGA 3M1BB 4LCIL 3LH9A 2R23B 1V5JA 3II2A 3PAUA 5A2BA 3SY0B 3OZKA 4ADIA 1IAOA 1DQML 5F7BA 4KX9A 5TGBA 4I89A 5D9SB 3V9EA 2IIJA 4WVRA 4UTAH 5DLML 1UWXK 3V4PB 3W38A 1E4KC 5FW8A 2MNJB 4M1DH 3GHEH 2LU5A 1ND0A 3GMOB 3GTTA 5DA0B 4QT5B 1QTPA 2VLMD 3BI9X 5CD3A 3DYOA 4WWOA 4GUQA 2W81C 5BMFL 1ACCA 2VW6A 4N85A 2R0LH 2RQEA 4K94C 5HJ3A 3BD3A 4Z7NE 3MLWL 3ARFB 4NZTH 1ZTXH 4CC1A 2MHAA 1U8HB 3Q44A 2MCPL 3LS5H 4LSSL 4YUEH 2OL3H 4F33B 3L3GA 1A4KB 4WRLA 5F21B 3IJEB 1AZNA 1NCWH 1PLBA 5K59E 4ODWB 2NSMA 1JGDB 4PRPD 1F4WL 2BHUA 2F54A 4LLVB 3TN0C 3PL6B 3QZPA 5C07D 4O02A 5ABAA 5TF0A 3QG7L 4ATTA 4XPHH 2W9LA 1GGTA 3HKZA 3MLZH 4C4KO 1IBYA 4JL1A 4QRQA 2E4TA 3ZE1B 1KYDA 4KH9A 3FONA 5IREA 2QQNH 3QULA 4UQ3A 1AGFB 2B2XH 3LKRA 4HX1B 5I0DA 1HN1A 3H42L 2ZCKH 2KBGA 3RWIB 1J87A 4FI8A 5CJOL 5EO0A 1AZRA 4LCWA 3WY3A 2PO6D 3H9SE 2A73B 4PGCB 2J25A 2DQJL 3QXWA 2DMCA 3L6FB 5HYQB 4TQ8A 3T71A 2DWTA 3EGSA 4AC2A 1ID2A 1ZLDA 4HIJA 3JT2A 2C7UA 5DD0L 4RMQA 3SQOL 1TQBB 2ZSWA 3OLDA 3EO0A 3QO1B 3CMOH 4B95C 3HG3A 3MRFA 2FO4A 4C58B 1ODAA 2BC4A 4NM8L 3D69A 4OI7A 4HJGA 1JNLL 3DIDA 5HPMA 1QWNA 5D7LB 5K39B 1KTLA 2BNUA 4Z0BL 4OLZL 4EUPH 3SEPA 3FSZA 1SGKA 3TYGL 4BIKA 3I74A 4OCSH 1NUNB 2HRPH 3C8HA 2NY3D 4QXUL 4WTXA 1VADB 4E5XA 5EO9A 2FATL 5TE4H 3B34A 3LRSB 5EIVA 1W8EA 2BDNL 4OJDH 1D5IL 3LKSA 3ZTJG 1BVNP 4HHAB 4P5TD 3TYFA 2Q6WB 4K3GA 2R1WA 1OWWA 1QTYT 3OG6B 2ICEB 3CPUA 4ZS6C 3UO1L 3T8MA 4DKEH 5CP7A 4ZMQA 3IRPX 4MQ7A 4EOWH 1QWUA 4JGNA 2KZKA 3TBYB 4F15C 3VW3H 1SM3H 4KK8C 4P2RA 3IMRA 1LO2H 1S7SB 3BGMB 1P7BA 2HKHH 2VLME 1JE6A 1OW0A 2A6DB 4RAHA 1XZWA 1XO8A 5CKGA 5DUBA 1MREH 2YXWA 1TT6A 1BHGA 1W72L 3IJYB 1EVUA 1OZTG 2GYSA 4W4NA 2ED9A 2LTQC 4UQIM 4PRNA 3CDYA 4J3OG 1SNRA 3S5LA 1PYWB 4PJEF 4DEPB 1MRCL 3GRWL 3RA7H 1USZA 2XJKA 2NTFB 5FGCE 4GI6A 4LLDB 1T5WB 4YSAA 4DTGL 1E4XL 2AXGB 4QO1B 3AITA 5LGJA 5IK3A 4OD2A 3A4EA 4IIQC 2IBZX 5BUGA 4XNYL 3Q0HA 1FO0L 4XN5A 4P2QE 4Q9RL 3VAEA 4PTTB 1S7QB 3CE1A 1BBDL 3NCJL 4X6BB 4ZFOA 1DQIA 2DQGL 3ZY7A 3PUUA 1EXHA 3MJ9H 4DEUA 5ECGA 1WTLA 1C16B 1KCRH 3HZ3A 3FT0A 1OE1A 5D55A 5FHAL 2DLGA 3KBFA 4F9LC 5L2JA 2ZAIA 1GIGH 2Y3AA 5D7IB 1FFOA 2R27A 4ZMWA 4P99A 1KN4L 2ZKHH 5LBSA 5D96C 2J1XA 4ZW3A 1MI5D 1YZZA 1X6NA 3RZCC 4W9KC 4XMUA 3RPBA 1I9JH 4LVHB 2HJKA 1BQLL 3HZYA 1YMMA 2ROXA 5I15L 5JMRA 1UM4H 2CK2A 2L8AA 2AEQH 2WAHA 2ZJSH 3B3BA 3G6DL 4PRDB 3PWPB 1A7QL 4Q74A 1IEAA 3M45A 4AKPA 5AW0B 1I7ZA 1Q94B 2QQLL 3AROA 4TNVF 1G9NC 1PGRB 3SDDC 1UM5L 4WNQA 1YUHB 2H1XA 1WVZA 2WN2A 3L3HA 2V8LA 5AW8B 2YQ3A 3NZ8A 1NIFA 3GPSA 4AJVA 2IAND 4HS6A 3ZSTA 1Q0YL 2A74A 3DX3A 3O2WH 1NANI 4GO9A 1O5PA 1RP9A 1RK0A 4NUGH 3U2IA 3BT2H 2X0UA 4FYSA 2WHVA 4BQ8A 2OTUB 5KYXA 4MJJA 3CHSA 5GSVB 4N2FA 5JHDB 4GW5B 4W9JC 3OPUA 3GBNH 1HZKA 4M8RA 2ALAA 2ZX6A 1TG8A 4NN5B 4U1LA 3TL5A 1ZPUA 1EH9A 3KLQA 4Z76B 3GSRA 4JPVL 2WP3T 4Z9KB 1M42A 4GSDH 2J7LA 4B9PA 1JXDA 3APMA 1JGEB 4XMTA 3ULSA 2AQ2A 1CLOL 2I69A 4G8FA 4PJIF 1Z3RA 2ZG1A 1WBYA 4GFTB 4TNEA 4NLAA 3MRNB 4Y5VB 2OYPA 4AL8H 4HVBA 3GDCA 3JSSA 2X6VA 2G60H 2PW1B 2H1LM 1F4XH 4GKNA 3EYUL 4KMTH 4XAKE 4YGVA 1CBVH 2NY0C 3L1OL 1PU0A 4PJ9B 2DYRB 2Q7YB 2I07B 1J5OH 3F85A 3EIFA 1REIA 1O9ZA 1SDDA 4X4YB 4PRIB 4AEHL 4DP2X 1EIBA 3IVKB 1CDYA 2CPUA 3QDMA 4I5BA 3QUGA 2WMPA 3QIBB 1LWRA 4KXZI 3NACH 5EULV 5FKAA 1ZGLA 4O58L 3VE0A 4HUUA 1IRAY 2NY4D 1JZ2A 3BP7A 4J7RA 3PWLB 2YN5A 4HDIA 2NLJA 3IXTA 1N7MH 4K3JL 4WZ9A 1MVFA 2DWEA 3V8OA 3RWJA 4P4KC 1THAA 1AO7E 3F7RA 3H7BB 1UA6L 3BPNB 3EJZD 1LMKA 3HE6B 4OGQC 2EVGA 4WO4C 1MI5E 1VFBA 2N56A 1HZHL 4FYRA 4P2OA 1UJ3B 4QF1A 4PS3A 3V0VB 4HWNA 2CLVB 4ZXBC 1ETZB 3W9DA 4JM2C 4ACPA 2E27H 3EDDA 3LB6C 1AY1H 4NX0A 5DC2A 4CN6A 1A6TA 5AW6B 4AV5A 2ZUXA 1T80A 2HG5A 5B7FA 3L4WA 1KBVA 1ORSA 3LV3B 4LKCB 1F13A 4M7LL 4B27A 4QHMA 4UT7L 4BK5A 3QJSB 1JYNA 3QW9A 1CYGA 1SY6H 4MNQB 3QCUH 2VRKA 3H85A 1JWMB 5J6HA 2ZUSA 2FGWL 4UQEA 5IR1A 3K6SA 3FQNA 3BGFC 3CVIH 3J27A 5ENWA 5EZIL 25C8H 2QQKH 1JWSA 5L6YH 4XCNB 2WINA 1T0NA 3RWHA 3GJFB 2QTEA 4NNXA 3BLKA 3UTSE 1JWUB 1OM9A 4GXUN 2EDYA 2K3TA 1HEZA 4G80A 1KLUB 4OM0H 3VXTA 5E99H 1INEL 3ARTA 2QBWA 4IU3B 1HNGA 4EIGB 5CCJA 4HETA 2FAUA 4ZMXA 5A2KH 2FCBA 4ZMTA 2YUZA 3S37H 1KSRA 4DFHA 3VD1A 32C2B 35C8H 4KNQA 5KYYA 2C4FU 3BD5A 1MCKA 1U93B 2EKSB 1MJUL 3APCA 1KEMH 3THMH 3VGAB 2P44B 4Z8FH 2XWBA 2YAMA 1WS7A 3ARFC 3M6DA 4K4KA 5GGRA 2CSPA 1N5AB 3JWDL 3P11H 3Q05A 4U1GB 3ULVC 2XPZA 3TP4A 4FQLH 1DO5A 1JTOA 4R0LA 5EUOB 4OB5L 2LGNA 4GP8B 3I02A 3P3YA 3PL6C 1CD1B 5C08B 1KNOA 4BSWB 4L5FH 1V7NH 4EI6A 1HH6A 2ZX9A 1UOWA 2Q3XA 4IDJL 5CCHE 3ZL2A 4DAGL 5CM1A 1KDJA 5FO8A 5HHMB 3KPSE 5KVFE 3WMSA 2GFBA 4J2XA 3EYVB 2XG5A 1A6ZB 2GUYA 2L7QA 3C6SA 4UDUB 4MZIA 5DC4B 4ZUVA 4DUXA 3IPFA 4P2QA 4YX2L 2ZUVA 2HJFA 3W11C 1A3LH 5LJYH 4KI5D 1H15A 3L5XH 3UMNA 2NDFA 4JY5H 4AYBA 4ZTEA 4H8UA 4HWUA 4KRPD 3KR3L 1C7TA 1BYNA 2WXPA 3MLXH 3REVA 1OP5K 4JRXE 4AG4H 1EJ6A 2ITDA 4YIQA 3GSUB 1LO0L 1UT1A 1TQBC 3KBPA 2Y7MA 4X8JA 1NC4B 3N1PC 1OSZA 1ZKAA 5IWLC 3F00A 1U8QA 4HS3A 1RZGA 1TYRA 5CJ8A 2J73A 1LK3H 1DVYA 3GI8H 4YNYB 2BVYA 1HI6A 2VDRH 3BDXA 4JM4H 3GSNA 1A14L 5GGUA 1INDH 3IJSA 3EFOB 4NC2B 3Q48A 3HLAA 5A6IA 2P46B 2OMXA 1IT9H 1FE8L 2V2TB 2Y07L 2R0KL 2G75A 2X53A 1J1XL 3HAEA 2P8PA 4H0GA 1BIIA 2ZUTA 2VL4A 1IO4C 5FUOH 2ICEC 4BSVA 2YK1H 3ARGB 2C3HA 4KTYA 3DDFA 4K3EL 1QI5A 1GYAA 3RY5A 3LEVH 2VXTH 3MRCA 1CXFA 4XNUL 2VLRE 1E90A 4HT1H 1L9RA 1X4YA 4WWID 2AV1A 2H5UA 2YMTA 1TQVA 4HIXL 4G6JH 3ALWA 4FG0A 1VRSA 2V7HB 4J4PC 4OFDA 4XWOD 4DEPC 3RPIB 5KS9B 4KY1H 3IDIA 2IMMA 4JFHD 4PVMA 3AZUA 1A3ZA 1JGVL 4MNHA 5L2KD 5IMOA 2XVBA 4WU7B 3TN0D 3F12B 3O81A 1N10A 4JHWH 4OT1L 5DHMC 4RIRB 4B60A 4M56A 4E9RA 5IQ7L 15C8L 3FH5A 1YG9A 2DQHL 3CH1B 3B9KA 3LKNB 3FDWA 3DX0A 5D4HA 3TWYA 2X4SB 4PJDA 4RLDA 1CZ8H 3PJSB 1GSKA 5E23A 4BQCA