2HVBA

Crystal structure of hypothetical protein ph1083 from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
113
Chain Sequence
MLKETIRSGDWEKHVPVIEYEREGDLVKVEVSVGKEIPHPNTPEHHIAWIELYFHPEGGQFPILVGRVEFTNHSDPLTEPRAVFFFKTSKKGKLYALSYCNIHGLWENEVQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide reductase
publication title Crystal structure of hypothetical protein PH1083 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 28
structure length 113
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2hvbA00
2AMUA 2HVBA 1DQIA 4BGLA 4BRJA 4C4BA 1DQKA 4BFFA 3QZBA 2JI2A 4BV1A 4BFJA 1VZGA 1Y07A 1DFXA 1VZHA 4BK8A 4C4UA 4D7PA 2JI1A 2JI3A 4BRVA 4BFKA 1VZIA 1DO6A
chains in the Genus database with same CATH superfamily
1CL7L 3LH2H 5AAMC 3U83A 3IMWA 2XWTA 1FPTH 3U0PA 3FH7A 3M17A 5FA4B 5KVFH 4WV1B 5EF0A 5CO1A 4KJQD 4OFIA 3E2HC 3KVQA 1DVFA 4HIEB 3V7AE 3IS1X 2BRRH 3IAQA 4ANKA 1KTBA 3MRCB 2C7FA 2XWXA 3NJVA 1NJ9A 2NW2B 4HJGB 3UIYA 1R3JA 2VXQH 1V7ML 3WI9A 5D96B 4YE4L 4Z78A 1KEGH 1NDMB 4XMKH 4U0RC 1MFNA 3SDAA 2VERA 1S4IA 1S46A 2R1YA 2LLNA 1EEZA 3CZFA 4KV5F 4LPTA 4EI5B 3EFOB 1TQWA 5JQHC 3TXAA 1FYTB 1LD9B 4X99B 4L3CB 1CGSL 1KN4L 3BH4A 1YEIL 1B6DA 1EHAA 2F8IA 3T2PA 5ITBL 4E9QA 3ULVL 5MEQB 1MF2L 1C5BL 1YDPB 4NBYB 5KZCB 3ABZA 3VXME 3PXLA 2JXMB 4ZTPH 2R4SL 1NGPL 4KO5A 1BIIA 3QH3B 4GW5B 3ML8A 4M1GH 1MCFA 2EO7A 1RH8A 2ZOOA 4FXKC 4R4BB 4TQEH 1BF8A 4M6NH 5E00A 5EIIA 3Q1SL 3X3GH 3FFCB 4X6CE 3VD4A 4MBOA 2GCYB 4RGND 5JOPE 1RERA 2DWXA 1MVFA 2AXHA 2DQJL 3CCHB 2WXFA 4QXTA 1QW8A 1KTDB 3B9KD 3KPMB 5H4YA 4B5ZA 1J1PL 1JXDA 5TDNB 4JPIB 1NMBH 3CBKB 4U7SA 2AGJL 4JQXA 4QT5B 3H9YA 4OCSL 3WMSA 1AI1L 3Q8CA 2QL1A 4G70B 4MNGB 4M1DL 4YHML 1QTYT 3R7RA 1JGEA 2G3NA 4NAQA 4L1SA 3AREC 2AV7B 3FU3A 1ACYL 1DBBH 1IEBB 3HI1A 3L5HA 1Q0XH 1A6ZB 2FYYA 4KXDA 4BRJA 4F15B 5E8NA 1E4XH 4G8GB 1OK8A 3N1PC 1KGCD 2X0VA 4MFHA 4OM0L 4BFJA 1D5IH 5T1MB 4YDLB 5CAYB 1IBBA 1TXKA 3QQXA 1HKLH 4WFGD 1X6NA 3DX3A 4ZFOB 1HZKA 4WCYH 5DD6B 3VGAB 1F42A 1ACZA 1VPOL 3MCKA 4PRIA 5IF0A 2V3EA 1NFIA 4YHIA 4K94C 5D7JC 1EEYB 3MV9A 3WE6B 2QDVA 4AVIA 2EQDA 2YXMA 3TIDB 2CPUA 2PO6A 5A3ID 2TSAA 3ZW3A 4DZBA 2C4FU 5I0ZA 4OF3A 4JY5H 2APTA 2JQAA 2ZCLL 3I75A 2N7SA 1F4YH 2LU3A 2BMKA 4MAYC 3RWIA 3TVMC 5EZLA 5EN2A 2PTUA 3ELQA 1N2RA 4C4UA 1N68A 1CGXA 4WW1B 1X44A 2CM5A 2PYFA 5IROD 2CJUL 3EJUA 4P2QD 4WFEE 2NTFA 5LO7A 5JPMC 2JLLA 4LSPH 1BM3L 2WBXA 3TV3L 1YCSA 3LY6A 3O8XC 1I85A 3WS3B 2FQGA 2VDKB 3RE0A 4UT6H 4YSTA 1TVHB 4JGJA 1G9NH 3EZ8A 3KL5A 3O4LA 1PY0A 4HK0A 2D9QB 4K5OA 3GGWB 1UCBH 2H45A 1WT5C 4WTWA 1TENA 4LPYA 3W37A 4GKNB 1DJGA 1ZEAL 1UVQA 1YUHB 2C1PB 4KC3B 2VDKH 2A74B 1EFXA 3GLDA 1AZUA 3FT4B 4AYFA 3WJLC 3DUSB 3IRCA 3Q44A 1WBZA 3OMAB 1I8KA 3HAEA 3THML 3O2DL 4EN3B 1J7VR 1H0DA 2BP0B 5FS5A 4HGMA 2SEBA 4FXLA 4TRPL 3HC3L 5DVLA 3FT2A 4RCAA 1KG0B 2F54D 3ARXA 4BZ2A 2W1NA 1ZJBA 4LOUD 5K59F 4YAQA 1VJSA 1UJ3B 3OLDA 4U1NA 1FVCB 2XN2A 3DOIA 4M48H 5DZJA 1BVLB 1RJYB 4R2GB 5IY5B 2O61B 2F53E 3TBVA 1NCBL 1JF5A 3RGVA 5E1GA 4AKQA 4XOCA 2DQHH 3OV6A 1UD5A 4AWJC 5IUCA 3TF4A 2K1MA 3D69A 1EJFA 4JO3H 3HMXL 4ANUA 4HJUA 2JI3A 2A73B 5TF0A 4GIPD 3WNMA 1ED3B 4RFOH 2XZQH 3MBEB 4BXSV 3GHPA 3LH2L 2Z1PA 4XTRD 4V1DB 3WELA 5B7FA 3DURB 1KGUA 4BM7A 4OBRA 1VSCA 3QQ3B 4UQ2B 4N8CH 4NSKB 4F7CA 5IHZA 4PJ7B 1FPTL 5ICZB 4DJMA 1E28B 3T65A 4R96A 2L7QA 4D9QD 5KVFL 4PJ5B 4NPYB 4WTXA 4Y4FC 1AGBA 2WLLB 1OGAE 3D39A 1PD1A 1CPUA 1IEAA 3GPSA 1FFQA 2BRRL 5C08B 3SGDI 1OP5K 3KXFE 4IHBA 3BMWA 2Z4TA 1TO5A 2VDRB 3MFFA 4YMPA 2VXQL 3NSXA 1MW3A 1WC7B 3DKHA 4PJGA 3N40P 2B39A 3QQ9D 2A7BA 5B7MA 1KEGL 4GB9A 1MCWM 4XMKL 3FO2A 3BWZA 1C8PA 4ZAKB 5GRVL 4A7TA 1Q9WB 2VDRH 2CWRA 3E6FB 4LPCA 5KJ4A 2MRYA 1NFDA 1GTFA 3KL3A 1WFUA 4ADIA 3TNNB 5D7KE 4FMVA 2NW3A 3RVUD 3B6SB 3N40F 3C6SB 4FQCH 4ZTPL 3M8OH 4M7LH 5FX3A 5T1LB 3NCMA 1NWPA 1P4LB 4XMLH 1F4XH 4M1GL 4PVMA 4TQEL 1OAUH 2VTFA 4LPWA 4M6NL 5D6DA 1A7OH 3O81A 3X3GL 4LNRA 1A66A 3GKWH 5K1VA 1FL3A 1O7VA 4ELMB 2WBJC 4HCIA 4RRPG 1S7QA 2H1PH 3MX0B 3UZEC 3W0WA 1RFDH 5EU3A 1TTUA 2X1XR 1IIKA 1NMBL 4PW9A 4AMKH 3GXFA 4GQ9H 1ZLUK 4XVOA 1ORSA 3L08A 4X4MA 5AENA 2ZOKB 1S9XB 2AVFA 2P8MB 1MCJA 3LKPB 1NMCC 1RURH 4BXVA 1FN4B 1Y1UA 3AQDA 1D5ZB 4H2CA 5FYJU 2XN9D 3VFUA 1AYRA 2X4RB 4KXCA 4X6DE 3UAEA 5CCKH 1DBBL 4WO4C 4PGDA 2C9XA 3AQYA 4H26A 2Z7ZA 1YAIA 1AR1C 3ESPA 3LH8A 5DJAB 3EO1B 1D5IL 2XWBB 5I82A 1HKLL 3EFFA 4FADA 1A1MB 4WUUE 5I1LB 3NBNA 3IFLH 2IV8A 2XICA 3SE3C 3S8WA 1KJ2A 2VKWA 4N90D 1OTTC 1TEYA 2VR3A 2YXVA 2GC4C 4K4KA 4O2EB 5F1IB 4AGPA 3OXRB 5JW3H 2A83A 3L3IA 3QWRD 4F1SA 2H2PC 3ZQXA 1VKXA 1VZIA 3US9A 4GJTB 4KO7A 4JY5L 1BAFH 2C9AA 2ZKHH 4W9ZA 5T1KA 5JHLH 2XN1A 1D5XB 1KN2H 5EU5A 3MV8B 4U3SB 3KBFA 5ESVA 3ZZLA 3V52H 1IGTA 1F6AB 4N0UB 5IKCA 5DRZA 2WXHA 1S9YB 3OQRA 1O9WA 2Y7OA 1OM9A 3KM2A 3B5GA 1CG9B 2YJQA 4LSPL 5KYXA 2YMXH 3WNKA 1KCSH 3NH7H 4M6OH 3EG9A 2HRHA 3I6KA 3PWVB 4IMLB 4UT6L 3AJ7A 2KT6A 1CICD 1KB9J 5BS0E 1YQ2A 2IEPA 3AMKA 3LZNA 3KPNA 1UCBL 1IL1A 4LDCA 4MA3B 1DVSA 4YDIL 4DCQB 3HZYB 3MUY1 3ZJAA 1NGWA 1T0MA 4QNPF 4N2GA 2R15A 2G5BA 3APFA 5JDSA 5CEYA 1HL4A 5AZ2H 3HZMA 3BHBA 3D85D 4KRMB 2ICEB 2ED9A 3MUZ1 4OY9A 1I4FA 1I3UA 4GG8B 2LU4A 1FG2A 4LHUD 3UPCA 1LNUA 5DQJA 2HLAB 1CR9H 3CFIC 3VMNA 4TVUA 4AXWA 1JGLH 5IW1B 4BHUA 1UD3A 4TLSA 1GZHA 3FFDA 3AW5A 2NCMA 3KLQA 1ZTXE 3L13A 4I9WD 4M48L 2NYYC 4GRLD 4ZK8A 1H8OA 1UENA 5EBWB 4HLEA 3NGBB 4A63A 2E9BA 5K33A 1MRFH 4N8PA 3WENA 1QZ1A 3G6JF 4K5NA 2CBPA 2DQHL 4QY8A 4NQDE 2DMHA 4OZGF 3LCYA 2MTAA 1XH2A 3SDCC 1GXEA 5CIPA 2P47B 4Y4FD 4JO3L 5HDBF 1BMGA 3ZDXE 4AK1A 2ZG2A 1BFVH 5H35B 2V2XB 3OF6D 1JZGA 4RFOL 2XZQL 4PBDA 2EXTA 5LAXA 1SYSA 4GEJA 4IRZA 4JQIL 3UXFA 1GPOH 5DMKA 4Z95H 1NL0L 4KJPD 4BFIA 4K8RD 5I2IA 5IJVB 1AOZA 1P84K 1IBFA 1XCWA 3DOSB 3L6FA 1A6AA 4KX7A 4HPYH 5J1TC 5C0GA 5TE7H 1BD2D 3AQZA 4PGJA 4RISH 3QE5A 4G5ZH 3EOAB 1PYWB 5DS8A 1M3JA 4KVCH 3RFRA 1A3LH 5F9OH 2ZAHA 1WIPA 1N59B 3GMPA 5C6WH 4P5SA 4YL9A 3MYJA 3QUYC 4DOHE 4FMKA 5E6SB 1KIUB 4RFNC 3TEXA 3QIBB 1EJ6A 2VDRL 4FQHA 1BWWA 2P24B 2QPEB 1WFOA 3ARBB 5TK2A 4Y89A 4P57B 1T1ZB 1ET7A 1YJDC 4PWKA 3TV8A 2W65A 1ZSHA 4HS8H 4JKWA 3S48A 1JDDA 2WBJD 4J7RA 4FQCL 4CMMB 3ABGA 4GS7C 1PKOA 2EXSA 2W0PA 3M8OL 4M7LL 2ZQKA 2LAGB 4YN3A 5CEZE 4HWNA 2WLHA 4XMLL 1F4XL 4JM2B 3CDZB 3JUZA 3EHBB 2FBJH 4XNBA 4N6QA 1OAUL 2OI9B 3O2WH 1A7OL 3GKWL 4JL2A 2DQIH 3C9NB 4TVPH 1E4HA 5DC4B 4M5SA 1KBBA 2UZYA 2H1PL 3KLLA 1CYXA 2NYZA 1RFDL 4G80A 3SE4A 4L8BB 3UYPA 1EO5A 1TQUA 2DLFH 1WZAA 4WO4D 4AMKL 4GQ9L 4Y19D 5IEKA 3L5WA 1PW3A 3AGWA 1SHMA 3CHOA 1P5UC 1I1FA 1RURL 3VSUA 1QWUA 3DGCR 2YAHA 4QRUA 2AEQH 3N41B 5DD0L 4H0HB 1L5GA 5EU7C 1G7QA 3EH3B 1PD0A 3Q7JA 5DD1H 2WXOA 5CCKL 4YUEH 4DVBB 2WN3A 3IDGB 2Z8RA 3TZVD 4ENZA 1MFAL 5F7UA 2JKNA 5CR8A 1YYCA 3PABA 5ISZE 1XBRA 3T2OA 2H2PD 3VFSA 4RZCB 3M86A 3V2AR 3LRSA 3TF7C 1GKOA 4PJAB 3SCMA 1RZ7H 2FT6A 4G1MA 4RDQF 4HUNB 3IFLL 3KL0A 3ZKSD 5JPNA 4LCWE 4DQOH 1WD9A 2NDFA 2BVOB 2FWUA 4CADB 4OFKA 4RMVA 3CPUA 1WF5A 5SWSE 4JJHA 5FYLD 3SQOH 3X13B 2RIKA 3PJSA 2OL3A 4FC3E 1BHGA 4ODXB 1ZIAA 5EO0B 2P45B 4JO1H 2EEXA 1UUNA 1LEIB 3VU2A 3FSOA 2GB2A 1WA2X 3Q2CA 4IBSA 3LKQA 4LFHG 1T2XA 4X4YB 1BAFL 2ZKHL 5JHLL 1R75A 3LNDA 4R83A 1KN2L 1H5BC 4ODTH 3QW9A 2OSLB 4Y8DC 2V4LA 2EKSA 4ABWA 1QASA 5T3XH 1BZ8A 3KR3H 4RVBA 5IW3A 3V52L 3OKKB 5GGRB 3LS5H 3E6HB 5A16B 1ZGLP 1NAMB 3AXLB 4CDGC 3FQNB 4WWKD 3WFZA 1UWYA 4OFPA 2DKUA 3VXSA 1ZIBA 2NLJB 2R27A 1KCSL 2YMXL 3H3PH 5G55A 4BINA 4DEWA 4PJEB 5KSBF 3NZSA 4MJ4A 4PJDA 3U25A 2WXKA 4YBQD 5ICYB 5D7LE 4OJAA 4ENEC 3T08A 3JTBA 5GZNA 1KDIA 2XX1A 3BW9B 3ESOA 3NYKA 1A8JH 1J48A 2D31A 3ZO9A 4FERA 5CJQL 2G2RB 1P6WA 3FFOA 2GBUA 5AZ2L 4WNQB 2MOVA 3L3GB 2PXYB 3RLSA 3Q13A 1U2HA 3QORC 2UY6A 3CVHB 1T1YA 3T0BA 5DHYA 1RZKL 2HN7B 4HHGA 2QJDA 1T6BX 1JGLL 5IVXE 2DI9A 4XBGA 4X6CF 3D4GA 4H20H 4ORGA 4UI2A 1I8MA 4DKFH 1XGTB 2NXYC 4PB9H 3VU1A 1QPXA 3CVHH 1BDYA 1GYUA 4YDJA 2FEEI 1MRFL 3RQ3A 3SBWC 3ETTA 4PRHE 4ZNEA 2HG5A 5AKSA 4NPJA 2VWEC 1P5VA 4QOKD 3HHSA 4G8EA 3A47A 4WU5A 4IRSC 4YNYB 1PJ9A 4G7QB 4PLJC 4X5WA 3LQZA 3N1QC 4NHCH 1DQQB 4JG9A 1GPOL 5DHVA 4Z95L 4A2EA 2CRZA 4YHZH 2FNBA 2L4OA 3GM0A 3EBAA 4P9HL 1OL0A 4HH9B 4HPYL 2ZZUT 1E90A 4KK5C 2GAZA 4JPSA 4F9PC 5TK4A 4HJTA 4QEGA 3UFIA 4RISL 5TD4A 4G5ZL 1FVEA 2VH5H 1DN0B 1CI3M 3RJDA 3B8SA 4KVCL 1GOGA 2HJFA 4YSDA 4D2NA 1A3LL 3EW3B 5F9OL 5IG7A 2WP3O 1MH5B 7FABL 3KYMB 3BQUD 2BCKA 3LD8B 5J56B 1EBAA 5L0QC 1A9BB 1AQDA 3HNSH 3CLFH 3FHQA 4QLRA 1EAPA 1M42A 3KLSA 2ZXEB 5G5DA 3U48A 1OSPH 1SYVB 2O30A 5ERWA 2ZG1A 4OAWA 4QKTA 5C09B 3ZT6A 1NCCH 3P0GB 4JE4B 4W6XB 4AG4H 35C8H 1WDAA 4Y9GA 4HS8L 3SD5A 2B77A 3PPEA 4Q6IA 1FSKC 2H32B 3DROA 3PAYA 3SZ6A 4CU6A 4AT6B 5HHOD 5JR1H 4PRAB 5FLVA 5I1EH 4QHLA 1IIIA 4UANA 3TYFA 2GTQA 4RGOH 1EGJA 5E9DD 1Z7JA 1DSYA 1QTSA 4XCCL 3O2WL 4J5VA 1S6NA 4N2DA 2H32H 5GHWH 1MIEH 1HN1A 4RX4D 2DQIL 4TVPL 1KB5B 3UL4A 5DC9B 4KUCF 1OGSA 3C08H 1FLTX 2DLFL 4WENB 2YQBA 3ZHKA 3VWKC 1I7RA 1KXQA 1HH6A 2YSSA 5I0DA 3K6OA 2XETA 1HILB 3P2TA 1KB5H 1QABA 2ZX6A 3D48R 3O6KH 3VI4B 5HHQA 3V8CA 1HEZA 1KGIA 3PNWB 4G1EA 5DD1L 4JFDB 2XTJB 3L3JA 4HGWB 5M95B 4U31A 3H55A 1RK7A 3IMVA 4QRRA 4Q9QH 2FSEB 2YQ2A 1QYGH 3QDGB 4MCMA 3U2SB 3BH8B 4AYDC 3C6EA 5F7DA 4YZWA 4Q52A 4NQEA 1YMMB 4F8PA 2FJFA 2CG9X 3DHUA 5FAAA 2ZF9A 4M6AA 4PJ8A 1RZ7L 5DMGD 5LGYA 5FYKU 3Q6GH 1M57B 1ASPA 4DQOL 4WFFE 4MMZB 2ICWA 3SQOL 4MXQD 3S8GB 1HDMB 4Z0XA 2YPKB 1MJ8H 2MIZA 1S8DB 2E9GA 4JO1L 1AC0A 2EDNA 3KH4A 3OAYH 43C9A 4C56A 4KRPB 4UZSA 4AEIH 2JCWA 1GSKA 3LVTA 5LGKA 3A6OA 4ODTL 3TA3A 2C3XA 5T3XL 2QV4A 3MRNB 4OZGA 1IQWL 3TCTA 2FIKA 5KS9B 1SBBA 3LS5L 4L4TE 5B22A 2NCEA 3GJEB 3TFKD 1A4CA 1O9ZA 4KPHH 5L7XH 1JGUH 1VGKA 4JO4L 1D2PA 3H3PL 2WV3A 1M71B 4GG6B 5C0RH 4L5FE 3RWFA 1IZJA 4AVKA 2C9VA 2Y5TB 3PWJA 3QG6B 4WJ5A 1A4BA 3QIWA 1SN2A 3ULSB 2ARWA 1A3RH 4I87A 5DO8A 4AUUA 4KUZL 3ARGD 4MQ7B 5BRPA 2B5IC 2Z91A 3H7BA 2V5TA 4FYRA 2GVYA 4NO0A 4C83A 5D1QB 3IB4A 3I3BA 4YGVB 4Y16B 1MFDL 5AOLA 5I6XB 2NXYD 1UKSA 1QLEB 4HIXL 1UD2A 5BV7C 3DX9B 3OG4B 4F7PB 4ZSOA 5CHNB 4AM0B 3NJMA 2FGZA 3C6LB 5I6OA 2QPFA 1PKQA 2Z35B 4YVUA 3HEIB 2BS9A 3NJLA 3QPXH 3MNMA 3DYMA 4WJKB 3VVVA 4H20L 4PQXA 3IJYA 2CUMA 1QLEH 4Y5VB 4A7UA 4DKFL 5GS0D 4YK4C 1YY8A 4PB9L 3CVHL 2XQBH 3NCFB 5B1BB 5IB4B 3W39A 4WKZB 1U2YA 2ZWLT 1QOKA 3QUZC 4N26A 1UXWA 2MOGA 3F64A 4B50A 3BVWA 2UZXB 1QBAA 4EAEA 3HA0A 4X6DF 5IJKA 2W07A 3FTXA 4N6RB 5JIQA 1CURA 3PDOB 4NHCL 4RGMB 5IMLA 4PI0A 4F7EB 1FZJB 3SDXE 3VXRA 1CO1A 1BLIA 1JF1A 3O0RH 1LE5B 2Q87A 3DVIA 4PY7A 3B9AA 4JVUA 3SEPA 4P4RA 3APMA 2VH5L 5GRVK 2CGRL 4A7VA 4KKNA 1OT2A 2WAHA 3IGAA 5T5FA 2AEPH 3QIUD 4JFXA 4PGBA 1MCHA 1NUGA 4J3OD 3AAZA 4CJ1A 2Z4QA 1LILA 5DS2A 4QXWA 1YEHL 3HNSL 2YUXA 3CLFL 4M6MH 4WWOA 1DE4B 3DO7B 5KVDH 5A2LH 1ZHNB 2VSMB 1DANU 3BPOC 4I1PA 1K8IB 1MIMH 1RIHH 1OSPL 1U41A 2X9XA 4O4YH 2HJLB 2WD0A 3T2QA 1QHPA 1SF3A 4J6IA 1NCCL 2DWDA 5K39B 4YX2H 2HRGA 4G11A 3S3DB 4LNVA 4AG4L 2E46A 35C8L 4MD4B 1IJNA 1AVAA 1YEDA 4ETQA 3FTZA 4QHPA 1JZ4A 1TU2B 4QKXB 4BSVA 2DQGH 3SO3C 1BYPA 1CGYA 5C0EA 5JR1L 2AJYL 5CD3A 5I1EL 3SPIA 4AJYV 3O9WA 4QXVA 2AQQA 3H4HA 5IHWA 5E9NA 3LZFH 2XV6B 4RGOL 5C6TH 2WTPA 3D87B 1X7TA 1MIEL 1MZYA 2WVVB 4FI6A 3E0GA 4EUPG 2FHFA 3UCRA 5H37G 3C2AH 4HUMB 43CAB 3C08L 2GT9B 2PUQT 4MJJA 3RVTD 3QNYB 3MRGB 5E4EB 4GI8A 3S9DB 4N0CD 3KCPB 3H9SD 2SODB 4R7LA 4PRDA 4HAGA 3MVSA 2I9LB 3VRJA 1D9KA 5KSBA 3DMMB 1KTKE 1J0KA 2YD8A 2HJKA 1NCGA 4N2IA 4Q9QL 1OALA 1QYGL 3L4VA 2WNXA 5IMMB 3MV01 4WRLA 5I1CH 4RBPH 3UJTH 1N3NB 1XCTB 1U8IA 5KTEH 5D2NB 2FO4B 3FN3A 1ZGLA 3HLKA 5EEVA 1IC5H 3OGOE 2VDMB 3Q9QA 4XH2B 3BN9C 2OSYA 1I8LC 4UQIM 3FK3A 2X4TB 1UUSA 4XCNB 5FYJD 2O6CA 1MLBB 1OGTA 2PWDA 4MQXC 4TV3A 2Q0ZX 3ZKMC 4NAMA 4B9IA 4MMYB 3N50A 5DK2A 5B8CA 2VDMH 1EO7A 4PBWD 4X6CA 3ZPDA 4FLRA 4ZUUA 5DUML 3CSYA 4AEIL 1GGCH 4AENA 3V5KA 4CA4A 1MJJB 4Y1AA 1UD8A 3MRKB 1CTOA 2X4UB 3GWJA 4N0RA 5I8CB 1QO3A 3C60C 3QDJD 2BH0A 5KVEH 4Z77A 4BA0A 3C5XA 3MRPB 1KLFB 2CDFA 5HHPA 3F62A 1IZKA 4IDJH 5I5RA 1M6UA 5KSUB 5J1SC 1MCIA 4KPHL 5L7XL 2O5ZH 1MCEA 4I4WB 4IK7A 2Y72A 3CLEL 1KJMA 4QJ5B 5C0RL 2C9SA 4W9KC 2XVGA 3CN0A 5AG9A 1REIA 4CVUA 3N6YA 4FXGB 3EYOA 3OWRA 3D52A 3V9CA 1CIUA 3QJSB 1A3RL 1I9EA 4DEUA 5SWQB 1XEUA 3V0AC 2A6JB 1K72A 3WFHA 1RP9A 5HGBB 3SD2A 1WSST 1K3IA 2FLBT 1M2VB 4NOFA 5D71H 3K74B 3IGUA 1U36A 3V0EA 4GKOA 2HRLA 1J8KA 4N68A 4PJ9B 3QR0A 2FH6A 2XPGA 4LU5H 4F9LA 3QI9A 4L9DA 3MREB 4HOWA 3LXUX 2WZPD 3T2LA 5HVFB 2J2ZA 2AAAA 1P9MC 3FO0H 3IKKA 1IU1A 3QPXL 2AK4A 3ULUH 1JWMA 1S7UB 4KO9A 4CJ0A 2Y7SA 1QLEL 3GIZH 3EGXB 4YSOA 1A6TB 2VM4A 5CR1A 1AGDB 3QSKB 4HEME 4LXFA 4B3VA 4IBQA 2VXQA 3DTUB 1G7MA 2H0EA 3GBNH 3QS2A 4WV1A 3IJSA 4AL8C 4PLOB 2W80C 3H1ZA 4O2FB 5DUBB 4A2LA 5DO2C 1LEGA 3NIGE 3BWAA 4ALAC 4WDIA 4X5PA 4LOEA 1NKGA 5DJDB 3U9UB 4U1GB 1Y6NR 4Z7VE 2CCVA 5BZZA 5I30H 3BAKA 4NQXA 4JFYB 3WSQH 5CLWA 2XNAB 2J88H 4PCYA 4A68A 4EI5A 3LHPH 3EFOA 3S35H 3E8UH 4Z7UE 3EADA 3GSVB 3POHA 1T5KA 1JTPA 2C3VB 4X99A 3TN0A 4L3CA 4LE8A 4Y9CA 3WMPA 4HT1H 3S3BB 1N6QH 4XRCA 1A14H 2X5PA 1B0RA 5C0AB 1YDPA 4P2AA 3UX9B 2AEPL 4I3SH 4IBLT 4KNQA 5LBGA 5C07E 2QVFB 3PL6C 4EE2A 4U1KB 4M6ML 3V5DB 1FZOB 1MIML 2ZXBA 4R4BA 4O4YL 4XXCA 2FX8H 1ZLSH 1G0YR 4YX2L 2FLMA 4FULA 5I16B 2MKWA 2GCYA 1GS7A 1UB5B 3CCHA 3KPMA 3ZRSA 5TDNA 1C12A 4P46B 1AS7A 3STLA 3L3HA 5DRXA 3OR6A 2ZUQC 3Q5OA 4QT5A 1DVXA 3EJTA 1WWWX 4MNGA 3RDTB 1WAAE 3LZFL 4JREB 4NKIL 4G8FB 5C6TL 3JYBA 5HYJB 3TJHC 4KKRA 4QRQA 2AV7A 4ZMPA 1IEBA 4LSTL 3C2AL 4WI0B 4BWWA 3FKUS 3MA7B 2VLJD 4K0OA 3IJEA 4G8GA 4HG4K 4F2FA 5E56A 5E8PB 1J1OH 5FDWA 4FCHA 1F18A 4ZFOA 4APXB 3FF8A 1E2WA 5DD6A 2IWFA 1JI1A 3MRHA 5C0CB 4X42A 3BN9D 5IVXF 4P8QA 4BUQA 1VZGA 3UPRA 4UV7H 1GMIA 1XIWA 4YDMA 2UWEB 3PQYD 3QQDB 5I0VA 3SYAA 1XD0A 2IF7A 2WLKA 4MQXD 5I1CL 3UJTL 2NX5D 5KTEL 4CSPA 3CN2A 1X3DA 1KCRL 5FHAH 1VFMA 1IC5L 3CN4A 4LL4A 4X7CC 1OLLA 1H3PH 2ENYA 1NOAA 5DEZA 3PJLA 5IBTH 4ODVH 1NUDA 4UT6A 5E4AA 2BRQA 4NPKA 2V2WB 4DGYH 4MJ6A 4UBDC 1GJWA 5LDSA 3CZEA 4MGXA 1NIFA 3QDMD 4JN1H 5BUGA 5CBEB 2M83A 3O6MH 2VDML 1JP5A 4HUVB 3E2HB 2JVUA 1TVHA 2ZYSA 5EEUA 1KXVA 2QHRH 4W93A 5KVEL 2GHWB 4GKNA 4GQRA 4Y9FA 5KYUA 1YUHA 1OTUD 2C1PA 2A74A 4N8VA 2HLFD 2O5ZL 4X6DA 1HXMB 1KGCE 1KJVA 1OHZA 3GMMB 3WNJA 4EN3A 3QULB 4WFGE 4P49A 5ETUB 3LSOA 3SDDA 2I85A 3QO1A 5ACLA 4NQSA 4U3HA 1BREA 2Y7QB 4PWEA 1UJ3A 2BWDA 5C70A 1SVCP 4AQ1A 4ZS6C 5AVRB 3BP4B 5D71L 1BVLA 1KPVA 3UJJL 5PCYA 2TAAA 1IMHC 2O61A 3UAJC 4A55A 4EUPB 5DVPA 1HC1A 3QEUA 4OV6F 4LU5L 5F0LB 1ROWA 2AERT 3QYMA 4FNPA 1QLFB 3UIZA 4OI9A 1DO5A 3OKYA 4UQBA 4KJYB 3EYQC 4EUPH 5SX4I 3ULUL 1CLYH 1EJ8A 5H37H 2ZKWA 3ZE2F 3KPSD 3NOIA 3GIZL 3MC0A 4V1DA 3WBDA 5CGMA 1Q9LB 4P2QE 3QQ3A 3TPUB 4NSKA 1AGCB 1S7WB 2XWRA 4PJ7A 1E28A 3RWJA 2ZX9A 3GBNL 4NPYA 1T5WA 2YQGA 3WN6A 3AREB 4B27A 4E9WA 5D2LB 2I9TB 3INOA 2EDOA 3PAUA 4F7MA 5DJ2B 1WPCA 2KZWA 3L4UA 1L9MA 5FGBA 4YDVA 2WO4A 1WC7A 1GGIH 2WWMC 1NANI 5I30L 4W4OC 4FQIH 1N8OE 2VJ0A 4WY7H 2GK2A 3EJQA 1CXEA 3WSQL 2OTPA 1YYLH 2J88L 4ERSH 4GINA 1IVLA 4O2CB 3LHPL 5D7JB 2YAMA 3E8UL 4CGTA 1EXHA 1MRCH 1DEEA 3V6ZB 2E0PA 3BISA 5HJ3B 2F54E 5GS2D 4FA8A 2YK1L 2YLKA 4HT1L 3FU6A 3TNNA 1N6QL 2A1WH 5L2KB 4I3SL 3JWNC 3R7QA 4K94H 4LL1A 4R4NC 2BY1A 4MAYB 3TVMB 1YA5A 2EVIA 1WWCA 1DQDH 1JZIA 1INQB 5JZ7C 2NRDA 1JHKH 3TBSB 4I8DA 1IC4H 4H40A 3OAUL 3H7LA 1QVOB 4NIKB 1TTGA 4JS7A 1NGQH 3AT0A 5JPMB 2OCCB 4IEFB 4NQDA 4KTYA 4ELMA 1CVSC 2JCCB 3O8XB 4HJSA 4OZIF 4TUJB 2KZ1B 5T3ZD 3MX0A 5BRZB 1IAMA 4JRXE 1DJHA 2HLEB 3P3TA 3JZ7A 3SDAD 2OR8A 1AHWA 2XSKA 1N0LB 3G9VA 4WEEA 3FQ2A 4UOQA 3BP7B 2P8MA 5JO5B 4QGTA 5KEZA 3LKPA 1P7BA 2Q7NA 3ARFC 5A2BA 4RFEB 4MXWH 1MQ8A 4J1UA 2V37A 2FO1A 2OCJA 5AAWA 4PVNA 4TYUA 2GKIA 3HBZA 3MHZA 1EHLH 3GSOB 3BIAX 1MKFA 2I32A 1FNAA 3DSNA 4JDTH 5F2FA 5BXFA 2R8SH 3WUWA 2QGBA 32C2B 1F97A 3LNFA 2WLNA 3ZUCA 4CN4A 5IFAH 1U30A 4U1MB 2AQNA 1J1OL 4NENB 3ARDC 3EO1A 5DJAA 1WBXA 4UUJA 5K9JL 2CDEB 3GMLA 4PP2B 2ODHA 3PCYA 2DM7A 4HKJB 5D55A 1J1XL 1FYHB 1T5XA 3MQIA 2XTSA 1WD8A 4GQZA 4O2EA 5F1IA 1S7VA 4PBXA 3UC0H 4QD2E 5D8JH 2VE6B 3LNEA 3OSKA 1TJIL 3NK4A 4UV7L 4P23A 2F1EA 3QEQD 3LKNA 3R18A 2KPWA 4UBDD 4JFEA 1I1YB 2EAEA 3GB7B 3QJHB 5LGJB 4MS8C 5D4IA 2QSTA 3MNWA 2NY5L 5DI8B 1JXJA 2FIRT 2LHAA 4NQCB 4ODVL 4ZPTA 3F7YB 1F6AA 2QHLA 4N0UA 2IDQA 4XGZB 5E4IA 4DGYL 1CD1B 4XOAA 1W2KT 3CPLB 3HG3A 4GAJH 4JN1L 3WIHH 3WOVA 1CG9A 3APNA 3PUUA 3DUUB 5B4MD 1OGAB 3FHEA 3ME0B 3SDXF 3PWVA 2FO8A 1CDGA 1DCEA 1U8LB 2X87A 5DDHB 4PRID 4MA3A 2DQEL 4XCEA 5FM8A 2FX9H 5CGYD 2QHRL 4E42A 3MV9D 5FYKD 3HZYA 2MQGA 2XN9E 1MPAH 2PO6D 1FJ1B 4M8RA 4AQOA 3CX5K 5FUCE 5EOTA 3KDMA 5I9QC 1DQIA 5E2VL 4JY6A 3MCG1 2N7BA 2ADIB 1IFGA 2CZNA 3GM8A 4N90E 1P4BH 5IW1A 1IILE 4KZ0A 2CIKB 3P4MA 1HQRB 1PCSA 3US0A 3UTPD 3FB5B 1ADWA 2R9HD 3D09A 1I9IH 2OPCA 2X70B 5SWSA 1EX0A 4PHXA 4D0DB 1HCVA 1KIQA 3ETBF 5DUPH 3NFNB 3GS4A 2UVFA 4HBCH 2HVJA 2BWQA 3HE6C 4KGLA 5BZXA 4M61A 1MXGA 5GIRB 3SGDH 2OA9A 3FQ4A 2X6MA 5H35A 3NSYA 4LQFH 1EZVX 1N9PA 3CHPA 1EFXD 4DGUA 1PZDA 5GGRY 2ORBH 3WN5C 1QD0A 4P2OB 1NTDA 2JV6A 3EGDB 1WICA 2WWMD 5IQOA 2J1KA 3DOSA 3DVGA 3D3VB 3HUJE 3FYEB 3VYPA 1ESOA 1UWGH 4XN7A 3G5WA 2AABH 3VFPB 3TT1H 4EJ1C 5DSCA 2YD3A 4XNMB 2EUVA 5E24E 1GGIL 1N59A 3RGVD 2Z31C 3GDBA 4FQIL 3EZJB 3FT3B 4UNUA 4WY7L 4A67A 4BH8B 1MCLA 1YYLL 2XKNA 4ERSL 5CINL 1TUPA 5JZ7D 2V8MA 3R4RA 3ARBA 2P24A 1MRCL 2HFTA 1T1ZA 4XT1C 4YPGA 3ECUA 2X6AA 4KY2A 2FE0A 2CHWA 5GSRB 1F8TH 2VRQA 4F8OA 3KS0J 2A1WL 1LL1A 3FTYA 1T21A 4Q4IA 1F00I 5E5MB 1BFTA 2FUTA 1WS8A 4X4KA 5EOQH 5IVXA 4I9WE 5AW0B 4CMMA 2VRKA 3F85A 1DQDL 3T3PE 2VUOA 1JHKL 4YVNA 1BVNP 1KCBA 1UM6H 4NP4L 4EKJA 4KVNH 3TO4C 3FF7A 3REWB 1Z9NA 3T0AA 4AIZB 3ARFD 5D72H 4MJIA 1E5YA 4PRHA 4CBZA 4FQ1H 3U6RB 4JANA 1FLRL 3I84A 5DJ0B 2DB8A 3ILPA 2Q5BA 3NSJA 4HFUH 4L1DA 4L8BA 5ABAA 1X5AA 3IEAA 4BRVA 3JVGC 1U3HC 5IHBA 5FA3A 3K2UH 1FA4A 2GSIB 4HS3A 3ZE0B 5A2CA 2V0AA 3CH8A 1BD2E 4G43A 3SBQA 4Z7WE 3D7PA 1UHVA 4NZJA 3RZWA 4DN3H 3UTSA 4DVBA 1EHLL 2EE9A 2R2EA 4JDTL 3GC3A 2VGLM 2R8SL 4GRWB 3GZPA 4RZCA 2EIZA 4KDTA 1VFAA 4MMXB 3RL1A 3HPJB 3W82A 4BZ1H 2DQCH 5EPMB 2X4QB 1PBYA 3GBMH 3W81A 4F5CA 1PCXA 3TBCA 5BQDA 2BVOA 3N55A 5EWIL 4KXZI 3SBPA 4GRWH 1RPUA 4GYBA 3X13A 3L4TA 5JIPA 5D8JL 3W0WD 4ODXA 3JT0A 4KI5F 2DWSA 4FABH 5CLZA 2XACC 5E08H 1QWHA 2AC0A 1IFHH 3CD4A 2C7UB 3MBXH 4OQTA 4HWEH 2WVUA 3SDCB 3Q3GA 3AB0C 3UEZA 3WO4C 3D9AH 1G7JA 1ZTXH 1HFUA 4HD9A 3OAYK 1FAIH 2AQ2A 3WAKA 4QHNB 4ZXBB 4R90H 3OKKA 4HIJB 1QI5A 4NFBA 4XE5B 3HKFA 1URIA 3E6HA 1XO8A 4GXFA 5E94A 1NAMA 4GAJL 1C7SA 4YS4A 1VADA 4HCGA 2X2JA 4XN1A 2EE6A 4PJEA 4Y19E 5E51A 4B9CA 4CSZA 2H8PA 3C8DA 2X2UA 4BIKA 2TRYA 3LNGA 2FEJA 4Z7UF 2OXHA 2FX9L 3EJYC 3NDZE 3BW9A 4YXKH 2A6KB 3VFWA 5HHVH 4FNLH 1MPAL 1TFPA 3Q2LA 3QUYB 4RFNB 4CW1B 1HX0A 4OCRH 1J12A 2HFEB 4AX3A 1J0HA 3OKEA 4ZTOH 5T1KD 2AQ3A 1AO7D 4K3EH 1ONQA 2FEDC 5G4MA 3RU8H 3QRBA 3SYOA 3IDYC 1EDYA 3N1GC 4J8RB 3CVHA 4N2LA 1XSOA 3MZTA 5D9SA 4M7LT 4ZX3A 1MAJA 4OF6A 2B1HH 3BP6B 3MTXA 1I8AA 3BGFB 3T3MB 1P4BL 1QHQA 3P4NB 1RUPH 3TYGH 3OLGA 1JHLH 4JUTA 5FYLE 4GS7B 3QJOA 7PAZA 2ESVA 5KYYB 3RNQB 2IOMA 1I9IL 4XNQB 5HYIA 5CZVH 5DUPL 2OR9H 3LIZH 4H8HA 4BCXA 4GSRA 2LV4A 5DD3H 2OMWB 3V95A 4HBCL 5KANI 4K5PA 1DBJH 2VW7A 4HF5H 1COBA 5LCVH 3SO5A 4ODSH 3B2MA 4I7ZC 3EBGA 1JWSB 1O6SB 2A2QT 4XX1E 2X41A 5AW5B 4KKBC 4TUKH 2E6PA 4N9OB 1KCVH 1HU8A 3QBTB 2ORBL 2YA0A 1P5UB 4I2XE 4OLZH 3FB7A 4ZBJA 4LSQL 4OZIA 3B83A 2Z31D 3JTTB 2OXGB 1QR1A 1NUNB 1RUMH 5LHDA 3DDFA 2AABL 4FZ8H 4HW6A 4OH2A 1LK2B 3J2PA 3TT1L 2R0ZH 5E99H 4PAZA 1KCKA 2GJ6A 2W81C 4NN7C 4E5XA 4TTGA 3BIBX 1XB3A 3LKOB 1MH5A 2BLFA 2D03H 3GMQA 4AGMA 3DJRA 3FUFA 1UM5H 4LCWB 4RWHA 1W72B 4WHCA 4M5ZH 1A9BA 2ADGB 1HE7A 3EXLA 1BSIA 3NIDE 5HGGS 4D8PA 1KY7A 1S7TB 3KHQA 2LGNA 3MAWA 15C8H 1SYVA 2DICA 1ICTA 1Y18B 5I5JA 5C09A 3UOAB 3TO4D 2DDQL 1F8TL 1X5JA 1W72H 4KWUA 4OLEA 4HSAC 2H32A 1XSKA 5EOQL 4AT6A 1J5IA 4JDVB 1HL5A 2VUYA 3BWUF 2CO2A 5TQ0H 2GC7C 1UM6L 5DURD 3VQMA 2BSSB 4AQ8C 4KVNL 4WW2F 3K2IA 4YZFE 5HP5A 1ZVSB 4QOKE 5D72L 5DJZA 5DQDL 3ZTNH 4FQ1L 2GJZA 3MRLB 1KB5A 1BZDA 1RI8A 1U8KA 4HLJA 1SDYA 2P42B 4HFUL 1HOEA 4WI5A 4JVPA 1QQDB 5AQ0A 3DIVA 4MX7A 1JZJA 2GBTA 3AXIA 5D7LB 4A04A 4MYPA 3K2UL 2J8UF 4QRPE 4IMKA 2WIMA 1HILA 5IJBC 4FOMA 1LK3H 3NJHA 4KDWA 4PG9A 4X4XA 2ZKMX 3VI3E 3PNWA 5AVSB 4DN3L 4JZJC 1BA9A 1MLCB 3WS6A 3EJCA 1U9KA 1BFOB 3QORB 2FSEA 3Q2WA 3LTVA 4KTDH 2G2PA 4XO3A 3FPXA 2WGXA 1E2VA 3A6BH 5JLZB 1ETB1 2E7HA 2X6BA 3V55A 1Q9OA 4HIPA 3LN5B 3NVQA 5GGTH 2DQCL 5ID0B 5C0JA 1IEHA 3GBML 1XR8B 1NBZB 1PNDA 1TQTA 1JI2A 1GYWA 4RBPK 5I15H 4GY4A 1HJCA 3ZYIA 4Y2LA 3MRRB 1OD7A 4MMZA 2IOOA 1KWGA 3V4VA 3K6DA 2ZYIA 4LBEB 3T8VA 3LZLA 4FABL 4ZUSB 5E08L 2CPCA 2LQRA 3KLHC 1ZE3C 1IFHL 5AAPA 1U95B 3MBXL 2J1YA 4HWEL 1NDTA 1A25A 4IGBB 3WKML 1LQSR 1X7SA 3BCFA 1JZEA 1CLZH 4XN4A 5HHOE 3RNKB 2GUOA 1ZTXL 4XN8A 5DA4A 3OKOA 1YMHB 4IRSB 4OCLC 1KLGA 3K71B 2ZUWA 4R7NA 4MDIB 3VXOA 4R90L 5H2BA 5E9DE 2APFA 4AMXA 4NN6C 1XMWA 3S5LA 1TTFA 2YEQA 2W9DH 3EOBA 1E9QB 3FQXB 4IYKA 4W4NA 1BX2B 3GJEA 1HH9A 3RPIA 3FOLA 2MFNA 3KJ4B 2CJTA 3JZYA 1M71A 2YN3A 1QNIA 2GSMB 4D9LH 1YEJH 1DN2A 1TYRA 2RFXA 2FEDD 3ULSA 2XKSA 4I18B 3GIVB 5KJ7E 3WE1A 4YXKL 2R29H 3ARQA 1KSRA 2FR4B 2V7NB 2X3BA 5HHVL 4FNLL 5I24A 1RK0B 4LF3A 3DJZA 4YC2B 3S88L 1OKEA 4H88H 4OCRL 4I13B 4YGVA 3SGJC 3ZR6A 4I0PB 4F91B 4ZTOL 1ET8A 3HFML 1DJYA 4Y4HB 4K3EL 3C5ZD 5I8KH 3RU8L 4ZX6A 3IWVA 3DARA 1GYCA 1X5LA 3DX9A 3PWNB 1RZFH 2GJPA 2WQSA 3QNZB 3IKCB 2UX7A 4U2YA 4AM0A 4F7PA 2HTKC 5CD5C 4Q9RH 2B1HL 4Y8AA 3VXQB 5J3HC 4APQA 3LRMA 1OIOA 1PIFA 2C9RA 1RUPL 1DQMH 4QTIH 1JFHA 1JHLL 1K8DB 3DI2B 4BFFA 3VXSD 1RL1A 2JKSA 4R97B 4EXKA 5L4MA 1UADC 2Q9OA 3WLWC 5CZVL 2FDBP 2OR9L 3LIZL 5E6IA 4RA3A 5IB4A 2VAAA 5DD3L 3HR6A 1A0QH 5TPWH 2KDGA 3QJFA 3RG1C 3BKMH 1DBJL 4KK6C 4C59B 4HF5L 4NWUL 5LCVL 5CEZL 4ODSL 4JO8A 3BKJH 3QK0A 2UZXA 4A2DA 4XPTH 4EEEA 3UZVA 2NXZC 4R8WL 1K5NA 1QBML 3MUGB 3B2XA 2F61A 3E9UA 4TUKL 2XDHA 5C6PB 1FC1A 3PDOA 2HVBA 2LOEA 1KCVL 2NY1B 2WNGA 5JQ6H 1UXSA 4OLZL 4MA1C 1FZJA 4KXBA 1E6JH 4AV0A 1U8HB 1SN0A 3VMPA 4RMBA 3CIQA 1ZLEA 3V5HB 2AP2A 4OR1A 4MJ5B 4IIZA 5HHMB 1RUML 5TDPA 2VL5B 1K2DB 3WEXA 4PJXB 5HI4C 4FZ8L 5D7IE 1NCHA 2R0ZL 4JPWH 3HB3C 3JV6B 5E99L 2WIIB 2EDBA 3P4OB 3TLRA 5AW8B 3V6OE 3VD1A 1X5YA 4XP5H 4GW4A 2D03L 3RVXC 4N5EC 4MS6A 2FWLB 3NEXA 5I76B 4E0RB 1DE4A 2KC0A 4P3DB 1ZHNA 2BVTA 4KJWD 3C8HA 4M4RB 4N2BA 2VDNB 4TM9A 9CGTA 5K39A 5K69A 2AXWA 1QSFB 2LTQC 4DZ8B 4MD4A 3NP3A 4P4KA 1W72L 4Y4KC 3QXUA 1KYDA 2W95A 5JNYA 4DO6A 5JDJA 2BINA 4QRTB 1J9QA 1KZQA 5D2LF 2IH9A 3FH5A 2VDNH 1RUQH 5TQ0L 4HCRA 1QFOA 2R2BB 4HU8A 1UA3A 4JJOA 3HNTH 4L4TB 3HN5A 3QDAA 1XF5B 5CZXC 3ZTNL 2WVVA 1KEML 4AGOA 1AIZA 1E7UA 2O6DA 5J12B 43CAA 4FNQA 1JV5B 4FG4A 2K7PA 3ZL1A 2Z34A 2PYEA 3NUKA 3QNYA 1QNZH 4PV8B 3U7YL 2ZWZA 5J89A 4AM0Q 4QI3A 1OWWA 5IQMA 4IBWA 3C5JB 2B5IB 1LK3L 3OC8A 3MBWB 4XO9A 1BZ7A 3DMMA 4KTEH 1ZLVK 4XXDB 3RY6A 1E9PB 2P5EB 4HKBB 3J8F7 5FC9A 4Z7OF 1AZVA 3OAZK 2AMUA 3MUJA 4KTDL 2NNAA 4JHWH 5EZJB 3A6BL 2VT0A 1N3NA 1XCTA 4Z5RB 3VXUA 5D2NA 2O5XH 1R34A 1W0YT 4MJHA 4UOJA 4LLUB 2D2OA 5GGTL 3T0DA 5EU6B 2CBOA 5I15L 1W16A 1S9VB 4HHAA 1LMKA 1PZ5A 2X4TA 2DKMA 4UTBH 4YK4B 4AW4A 2AS5M 2E47A 3NZ8A 4XCNA 1WBYA 3AY4A 4XVUC 2EZ0D 4UOW1 1R46A 4F57H 3AM8A 4NB7A 1G7IA 2PCPB 5JHDB 5DS1A 3ZZSA 5F3BB 2FWOB 1CLZL 2EXYD 3EYFB 2ATAA 4W9DC 4LHJB 3HUJF 5EBMB 1MJJA 1FNEB 1JBJA 1Z9MA 5I8CA 2KLRA 2X89A 1CLOH 2FTAA 4KKCC 4LARH 4LKXB 5KG9A 1UEMA 4M3JA 1D2OA 4HA1A 4JM0A 4N8UA 4IRJA 3MRPA 2JH2A 5FKPB 2W9DL 1KLFA 2H26B 4W70A 2HTLD 3VD0A 2CDGB 1IM9D 4LAQH 5KSUA 3VQ2C 3K8LA 3RVWC 5TH2A 3PGDB 4N9GB 1P84J 5JW4Q 2HH0H 5D5MF 1B3IA 5E8EB 3ES6B 3PJNA 2DTMH 1YEJL 4BBWA 2XVKA 5IM7B 5B21A 2ZONA 3F84A 3H9SE 4FXGA 4JKPH 3RKDD 4KZDH 4PWFA 3K8MA 4ZUVB 1BAGA 3D0AA 2PETA 2R29L 2WXJA 3GSWA 4OJEH 5CD5D 1SJMA 4U2ZA 3G04B 3STZB 3Q8BA 4NZUL 1FQ9C 1EDQA 4C56D 1M2VA 4H88L 1MG3C 2Z93B 2XXFA 3BPOB 4HC1A 2FEEL 3MO1B 2R0WH 4IW4C 4AI7A 4D0CB 3T3PF 5F3FA 5I8KL 3TA3D 3OKNB 1JZ2A 3WLWD 2BSRB 1MJ7H 3MREA 1RZFL 2CLZA 2E7LA 3ZMNA 4Q9RL 1OXYA 4DK6A 1CTMA 2QT6A 1G9EA 4GIAA 2AITA 2Z0UA 3WEMA 4QTIL 3VCLA 1CD0A 5I1GL 1T83C 3MRMA 5FYJE 3NCBB 3CWGA 3FN9A 4XWOD 2XVLA 3LRLA 1ZWIB 1A0QL 5TPWL 3TEUA 2AAVA 3BKML 3B9KA 1AXTL 1KCWA 1MOEA 1JZHA 1DLHB 1MCSA 4Z7WF 3BKJL 4HDIB 4PLNC 4YLQT 3LPFA 3QDJE 4P2RB 4FF9A 5L2JB 4XPTL 4NO0D 5I1KH 2ITDA 4U1SB 1HXKA 4EIGB 1KCUH 4QCIB 3GMNB 3N44F 4GNKB 3AWEA 3DX0A 4JFSA 4JGMA 3U9UA 5DJDA 3ECQA 1T6WA 1TT6A 2Z0BA 4LKCA 4YXLH 4CKVX 3EYVA 5IT2H 1E6JL 4V2CB 2FECI 2YEVB 2Q76A 4HJIA 5BRQA 5KWYC 3IMRA 3KYNB 4TNFA 2C3VA 3LPGA 1D5MB 4JBSA 2Q8BH 1X9UA 2J8UA 4L3ED 3S4SG 4JPWL 1U8QB 3RZCC 5D1ZC 5J11B 1Q1JH 4KKQA 3Q5YA 4XP5L 5CLXA 5LLIC 4Y4KD 5INDB 4PRPD 4HEPG 3BXNA 5T1DH 3G5ZB 1B4LA 2BO0A 3V5DA 3KBHE 3ZE1B 2KL6A 1FZOA 2YGNA 5E6UB 2QSCH 1AIFA 1QFHA 3VX1A 1ZGLM 4BQ6A 1IAKB 2P8LB 1UB5A 1FFNB 4XNZB 1NLDH 4NNYA 3ULVD 1BF5A 2AMGA 1CF8H 5IHLB 4IIQC 1T0NB 5BQ7A 4JN2A 5C1MB 3JQOB 2AK1L 3GD1C 4IOSA 2IXQA 1TITA 1RUQL 2VDNL 3JWNG 1A1OB 4WIQA 4KKLC 1AQKH 1PMYA 3V4PB 4JAMA 4TTDD 5DRWA 3O41A 4JDEA 1WTLA 1AZRA 4RA0C 5F88B 2R0KH 3WV0A 4YEFA 3PWUA 4XB3A 2I27N 2WTOA 3GSUA 3PPSA 2A6DB 1HNFA 3BRDA 4I48A 5KVMC 4I3RH 4WI0A 2WINB 2OYMA 3MA7A 4ABUA 2OMZB 4GFTB 4FTDA 1ZVYA 3TBBA 1B4RA 1QNZL 3L17A 1DEDA 3P73A 4GXUM 4OGXH 2CKBB 4ZFZB 3SJVD 4APXA 3RIAK 5FK9B 1GOFA 4KTEL 4MLSA 3RTQC 3VRLE 3LVEA 3B1TA 3D4ZA 1SXBA 2CKBH 3HG1D 3KPLA 5LNGA 2UWEA 3QQDA 4JHWL 4M8QB 1LP9B 2VR7A 3K3QA 3CFQA 3PYCA 1HQ4B 1R5IB 1B0WA 2X1OA 4OSUH 1NGZA 4UIKH 1Z0NA 2QQKH 2O5XL 3ARUA 3GUFA 3IDUA 1GHFH 2ZWNA 3L3OA 1UWXH 3SKUD 1H9DA 4W9HC 2H0FA 4F33B 1YNKH 4FTVB 4ODHH 3L4WA 3MKGA 4NKMB 2V2WA 2WSDA 1DDHB 4ATWA 1AGEB 1AKJB 2XXGA 5E6RB 3RUGB 2BSCA 5CBEA 4UB0L 5GSVB 2JIXB 3F12B 1TJMA 3P4LA 3ECBA 1O75A 2J12B 3JV0A 3RVWD 4XB8A 1Z5LA 3A4EA 3DC0A 1AAJA 2GTZB 4FFZL 4WI3A 3NIGB 1D9KD 2OSWA 4FQJH 2LE9A 4HUKB 3NFPA 1CLOL 4LARL 1C08A 3GLZA 5FO9B 1IARB 4Z7VB 3FTGB 3D30A 1EAJA 4POUB 4LAQL 1B3JA 4N5UA 3VGAC 2IQ9H 2A0LD 1E8XA 1HXMA 4ALAH 5FB8A 1XVSA 3GMMA 2ITCB 5B38A 2FCBA 5BJTA 2DTML 3NIDF 4PJCE 3QULA 5A43C 1SJEA 4JKPL 4W9EC 5ETUA 5ILTH 4KZDL 3D18B 2C9UA 4H1LA 2O5NA 2CO4A 1VDGA 4OJFH 1VGEH 4X8GA 5AVTB 2Y7QA 1VENA 2K9FB 1A2YB 1PLGL 3A3YB 3PQYE 4ZS7H 3ZLQC 2XBZA 1R24A 2R0WL 4OV5B 1W6LA 4FXKA 2QZQA 2NX5E 4Y1AD 1WEJH 1MJ7L 4MZRA 1QLFA 5DD5H 3IBEA 2IWKA 2TRHA 4YZFF 1EERB 1JGVH 3TM6A 5IR1B 2C3HA 3OKMA 1ZANL 3NJKA 2AJXL 5KSAC 1QKZH 2DJMA 3H3KA 2YWYA 3L8QA 1TOXA 1Q9LA 3TPUA 3QDME 3RGHA 4N28A 2YAPA 4AYBA 4PR5B 4JFFB 3AG1B 2LFEA 3FBQA 3SGEI 3MACH 3TOPA 1IX2A 4DO4A 2CO6B 4PJFE 2EILB 3AREA 1KV3A 3FUEA 5HYSG 1T4WA 12E8H 5F97E 5D2LA 2I9TA 3EJZD 3UJIL 1E4KC 3VI3F 3JV4B 5I1KL 5DJ2A 2XG4A 3UTZB 1IE5A 1SQMA 1KCUL 2PPDA 4NUQA 5IMOB 5D1XC 2G75B 1URZA 2WBWB 4H0IA 4KOCA 4RQQA 1MI5E 1M1SA 4YXLL 5IT2L 4LASL 2YD7A 4UV4H 4LDOB 3QI9D 1T89C 2YARA 1LJMA 4KOBA 4DKAA 2JJTC 4O2CA 5D7JA 2AK4D 3LKSB 3V6ZA 5HJ3A 4P2YA 2EE0A 2FBOJ 5L2KA 5C0IA 5FKAB 1AD9B 1Q1JL 4WEMB 3BZFB 4NNXA 5DVKA 5CP7A 1U3YA 5T1DL 3TVMA 4LHQB 3VE0B 5FGSA 3QWRA 4L8SC 5FFGA 3AT9A 3IGFA 2JKIS 4AGNA 3MBEC 4YQXH 3I9GH 4L3FA 5AOJA 3OSVA 5JPMA 2NY7H 1INEH 3SKMB 1E42A 2JCCA 4H5SB 2WHVA 3HC2A 3O8XA 4TUJA 5IB3A 3IJHB 3KPSE 1NLDL 4Y5XB 1TEGA 3FHAA 1CF8L 5AB0A 4G9FE 1QX1A 1N0LA 5E1HB 2DQTH 1WT5A 1TVBB 3F83A 4FD0A 4EI5D 3BP7A 4J3WA 1GAFH 1NC4B 4YR6B 2YOCA 1AQKL 1FYTD 1R17A 2IH1B 3FUDA 3RY5A 3KLKA 2GBAA 3IDXH 2KH2B 1UQSB 1SHWA 3WJLA 1JTOA 4WK0B 1CICA 5KZCD 3GSOA 3VXNB 4I3RL 4OLUH 3KS0H 2V5RA 4HFWB 3VFOA 5I19L 4NQVA 4PWHA 4FDWA 4PS8A 4NENA 4B53A 4OGXL 3M7FB 3TWYA 3K0YA 1A7BA 1ORQB 1SM3H 3RBGA 3IGKA 4HKJA 1R3KA 2ZAIA 3BDBA 3FJTA 2P1YA 4HLZH 5D5MA 2VXSH 5KUMA 4L18A 2GUYA 5GJTH 2VE6A 1G94A 2IV9A 4LHUA 2CKBL 4JW3A 2LLGA 3LQAH 3VWJB 1I7ZB 4LSVH 1JGDB 4OSUL 1I1YA 4S2SB 2VITB 3GB7A 4Y2NA 1TZHB 5LGJA 5GGQH 5KOMC 1GHFL 3QUXB 3WIHA 2BOBB 3APCA 4PV1C 3O45A 3QEHB 4R26H 3UG3A 2E9IA 4GRLA 4NQCA 1FO0L 1KZYA 5FV1L 5CJ5A 1YNKL 2CNZA 3T0EC 5LNEA 4P2QB 4ZT1A 1JWUB 2X42A 4FKHA 4G8GD 5T3ZE 2OMTB 4HKZA 1H3WM 3S4SB 4Y4FA 4S1DC 3DUUA 5D7SH 4XMXA 4NHUB 1IGYB 1ECZA 1L7IH 3ME0A 3OF6A 3IDIB 5CMAB 3N43B 5DDHA 3BEWB 4OGYL 2BW5A 3VJ6A 3A67H 4FQJL 4D3CH 1Y0LA 3K81A 3ZDWA 2DIBA 2UX6A 3UADA 4CUCA 1S5IH 4A6YB 4MHHI 4L8DB 1ILUA 3VFMA 3B2PA 1QWNA 3OGCB 1FJ1A 2NZ9C 3RVVD 5FUZH 2BHYA 1P7KB 3X1EA 1DUZB 1BZ9B 5DZVA 4ALAL 3LRHA 3GBDA 3ZKQD 2XJLA 5H94B 4A6YH 4BFOA 2F54B 4J4PC 4BFGA 3RBSA 4PD4K 3UCQA 5E7FA 5ILTL 4UMGA 2VZOA 5DMIL 4YOKA 2HT2D 4OJFL 3HLAB 2CIKA 1HQRA 2GSGB 2ZICA 3DO3A 1MW2A 2B7DT 5IBLC 3WY4A 1V3KA 2NQDA 3X14A 5DVMA 3QEQE 2X70A 2KBGA 2NYKA 4FRWA 4ZS7L 3ATFA 4ZFQA 1RZIA 4D0DA 4WF7A 5KAQG 1MFVA 2H6UA 4WEUD 5IJDC 3NFNA 1X5FA 3JWNH 3TASA 1CYGA 5I23A 2CKNA 2WBJA 5DD5L 1JGVL 2B14A 2DI7A 4JRXB 3UZEA 3N42F 2J21A 2D3JA 4IU3B 1AACA 3QZNA 3GXPA 3DV4B 1OARH 2AHIA 2VIRB 5F21B 4F7TA 1T2QH 2P43B 3X12B 5ADPH 1UWEH 4J12A 1NANH 3CZUB 4UDTB 3D2UB 4U1HB 4EN3D 4BKLB 5ESAA 1XX9C 5ES4B 3KM1A 2R56H 1A7PH 3MACL 5DFVC 3QRFM 1RZKC 4PRIE 4AQEA 4WO4A 3UDWA 12E8L 1T1XB 2I5YH 3MRBB 1LM8V 5CBAB 3VFPA 3IMBA 3MV9E 5FYKE 2R2HB 2XXMB 2ICEC 4O02B 1HVXA 4R2GD 3REVA 1P2CA 2MNUA 1QPPA 1V3JA 4XX1G 1F13A 5SWZB 5HY9B 4F20A 3SE3A 4Q7DA 4G72B 4UV4L 4BH8A 4J3OF 2YEZB 4Y2OB 3BUYA 4FG2A 4MDJA 4UM9B 3NSCA 3MROA 2K0RA 1Z9PA 4F2MB 1AHMA 4O02H 3NCWA 2CLVB 5DQ9B 5I6PA 2OMYA 2CH8A 4XN9A 5GSRA 4V1DD 3NGBC 2AJUH 5KOVC 5E5MA 1LVEA 3UTPE 5IW6B 3S98A 4FG6C 5HYEA 1KGYE 3NQKA 1OWRM 5JMRA 5E70A 4BWUA 5IZ7A 3B7RL 4P9HC 4PJ5D 1FZKB 5KANG 1NQBA 4QYAA 4H7VA 1FIGH 4N4YB 3WXWH 5C08D 2VSCA 3B7YA 3L95A 4JHBA 5AB9A 4AIZA 2V5SA 1UG9A 3D25A 1U8JB 3L54A 1INEL 1W9XA 4TL4A 1RZQA 3ZXAC 1TSHA 3KLAA 3AS1A 2JI2A 3LEXB 5C0BB 5LQBH 4ZAKD 5ALCH 5C0FA 2CO3A 1E3ZA 4DEPC 2MCAA 1GAFL 4Z0BH 1QSEB 2XN9B 2E4FA 2FUQA 4WWKA 4TMPA 4X5LA 2C9QA 3PLYA 4QRBA 3V6FA 1XD1A 1Q94B 4BZ1A 1UOWA 4LOFA 3IDXL 1A3QA 4X80H 3M6DA 2FJGA 1CFSA 2Y36H 4OLUL 5I9QB 4OKVB 4ONHB 3R06B 3CFKB 3QIBC 4BFNA 4CU8A 1HI6A 2OYPA 4ILDA 2WJ5A 3QXAB 5T1LD 1MWOA 3HPJA 1SM3L 2DBJA 1BEXA 4G71B 2EC8A 2X44D 4UIMB 2HKFH 2VXSL 4XAKD 5GGVY 5JOFA 4OF8A 5GJTL 1X7QB 1U8CB 5HYSB 1TZIB 4JFQB 5DWPA 3LQAL 2WUCH 2GY5A 4LSVL 4JM2C 3HE6B 1YEGH 1HSAB 1FRGL 2BY3A 3EHBC 4NO3B 3SDCA 2G60H 1MY7A 2OI9C 1ZDSA 5GGQL 2QR0A 1XAUA 5IBUG 4NYLB 3D39E 2F7RA 3O6FC 2AFNA 3U36B 1AY1L 1G7HB 4R26L 5CZKA 2HUEA 2KS0A 3X1FA 2QGCA 3GXMA 3KWWB 4HIJA 3BAWA 3WN5B 5GGSA 4QMEA 3CFTA 4GBXB 5LJYH 5EFIB 4PJGE 4TPRH 3T9WA 4X0KA 1OLZA 2FQDA 4AZ8B 4UT7H 2NZ9D 3ZTJG 3AS2A 4HZLA 1FNGA 1L7IL 4M56A 2F5BH 3A67L 3O3UN 3VNZA 1NFDE 2WKGA 3K4DA 4EI0A 3VB8A 1S5IL 2PNDA 5EUOB 3NAAH 4LEOB 3IFOA 3D85B 3UABA 4AH2B 3QUYA 5FUZL 3BYYA 1QLRB 3VI3A 4TL5A 2HFEA 4XPBH 1DFXA 3ZBMA 5I18H 5CSGA 3EJRA 4H8WH 1OE3A 4A6YL 1EVTC 4WI8A 3BT0A 4EZKA 4HHWA 1JS4A 3BQUA 3K80A 4P3CH 5LAPA 4G8IB 3PGFH 4JY4B 1QP1A 1FL5B 2I07B 1BIHA 3B7SA 3GINA 4XAWH 1OTSC 5CKGA 5I0YA 5LXGH 1U3NA 3W0WE 3QYCA 3HVNA 3P9MB 4NC2B 1TCRB 2AI0L 2GIYA 3P3SA 1RULH 2IAMB 2F7PA 3AITA 4DK5A 1AC6A 4UU9B 1JZ3A 4XNQA 3A6CH 2VNCA 2IANA 4OUUB 4FFTA 5HPMA 1D5RA 1EHKB 3HBGA 3Q2NA 5DFAA 4K7FB 4OCMC 5DFVD 1ETJA 5B3JF 1O6SA 4ESKA 3WFBH 2VN3A 1S2EA 4RWYH 3DIFB 1OARL 4HUWB 1TJHH 1BCIA 1FZMA 4FQXC 1T2QL 1U3HB 4OUOA 3RIFK 2BOCA 1SEQL 3BKCH 3GQFA 3P77B 1UWEL 4QWWD 5ADPL 5MEPA 1P5UA 1BD2B 3GZKA 1RK1B 2EYRB 1JCVA 2X4PB 4Y2DC 4RX4A 3JTTA 5IV2A 4OW6A 2R56L 1ZLWK 1A7PL 3TBTB 3U9WA 4U6HA 2OXGA 3WDJA 3FN0H 1G4RA 2I5YL 5DLMH 3RL2B 3F6JA 4MZIA 4GQQA 1LK2A 2DIJA 3WDHA 1SJHA 3VRLF 2PXYC 1DQJA 4AKPA 4LCYA 4PS7A 2CLRA 2CHXA 2CA3A 2IDTA 5IREA 3VAEA 2BNRB 1AO7E 3PIQB 3FSAA 3L1OH 3MPCA 5F7BA 5CCHE 2X7LB 1OP3K 2K7QA 5IVZB 1ZAGA 1GYAA 2WTRA 1AYOA 3OVUB 3PWPB 4LQ1A 4XZ4A 2AJUL 2Q6WB 4POZC 2F18A 2D8KA 2MSPA 4BHUI 1GL4B 1H5BA 2COQA 2AEIT 1EVUA 3FU0A 5CCJA 4JDVA 1CF1A 1CT8B 2X9ZA 3BJ91 2W59A 1CMOA 1MCKA 2BSSA 3WXWL 3UO1H 2BSDA 3IF1A 4ZW3A 1D7FA 5LUMA 4WHYG 1NLBL 4GAYA 3NDYE 5K9OB 4Y9BA 1TZOA 6FABH 3TTYA 5F89B 5IOPB 4F92B 1FGVH 2GBVA 4JHVA 1QQDA 5C7ZA 3GXIA 2GG1A 2CBMA 3AGVA 2ZUXA 1Z32X 3DWTA 4L05A 3OHXB 2DEYX 3RPKA 3VNYA 2PCFB 4Z0BL 2AF2A 3ARBD 3AUWB 4PJCF 1KULA 5HDOA 4H0LC 4LVNC 2A77H 2IQAA 1CDBA 4KV5E 1HYSC 4U3CA 4X80L 1J8RA 3WFEH 5FO8B 1MLCA 4U4IA 1BFOA 2Y36L 3QORA 1J88A 4ZO8A 2EVFA 3F7LA 3ZIYA 4PHZA 5JLZA 3TP4A 4PP1D 5ID0A 1XF4B 4JM2D 3EHBD 1B9KA 2Z92A 5LB1A 6TAAA 2D7PA 1N7MH 4MJID 3E3QC 1TLMA 2IPUK 5E4OA 1UB6B 4HVBA 2VKXA 3VM7A 1AZCA 3LB6D 5BZDB 4K5LA 4ZUSA 4UTCA 3SBWA 2MQ0A 1ZSDB 2WUCL 4U05A 3ESMA 2OQJB 1YEGL 2CUAA 3FCSB 3KCWA 5CJBA 2G60L 5BVJB 2PTTA 2NY6B 3HI5H 3QISA 5J6SA 1OOAA 1S9WB 3DHMA 4PJFF 5EEYA 3WKQA 4G7SB 1A4JB 2JK5A 2VRAA 4A7GF 5JW4R 4WTZG 3CMOH 4PJIF 2H3KA 4BD4A 3U1SH 1OM3H 2VN7A 3ARSA 4TPRL 4X4ZA 2WWKT 2N1KA 4CSTA 4UT7L 3BKYH 4F9PA 2ZP9A 2BIOA 1A7RH 3FB8B 1GS8A 2RGSA 3FC8A 4XPGH 2F5BL 1J5OL 5DTFB 4NN7B 4O51B 4OT1H 4J3SA 2M2DA 3NAAL 3RIKA 5T3XD 2OK0H 4ZI8A 1JMZA 3PUCA 1GZQB 1MY5A 4GRMB 4J23A 4AK2A 4R3SA 3CXFA 4X9FA 4LGRB 3DYOA 5I18L 1WO2A 4H8WL 3SE9H 2PR4H 5B1JC 2ODIA 5JIDA 3QNZA 1M7XA 4WI6A 2ZYRA 1EDHA 5B39A 1ZMYA 3B3IB 3VXQA 2VR8A 3RUGF 3PGFL 2EC9T 4FNSA 2J43A 1C16A 5AZUA 3BIKA 4F1ZA 4XAWL 5LXGL 3F7VB 3M07A 1H3TA 3IFPB 4ZOEA 1G43A 5CKAA 5TGBB 1MRDL 4A1RA 4WSGA 2QQLL 3MJ7B 3S97C 4M62H 4IBZA 2QDWA 2HFFB 2OMNA 2DJUA 2AANA 3AT8A 2QFRA 4PIBA 1KYOJ 1HHKB 1ASOA 3IXAB 3AUVA 3WIFB 4ADJA 3WFBL 2KLTA 5BZWB 2WXLA 1OAYH 3IE4A 4K3HA 3FB6B 1DJSA 1PZ2A 5AVUB 4XNYH 3VWKA 5AOIA 4JZOB 4QRPB 3BKCL 1C5DA 4M8UA 1CFTB 3BPLB 1OB0A 3VRIB 1T1WB 4URKA 4TQHA 3FQRB 1U58B 2VN5A 5F1NB 4LRNL 1B9ZA 3AC0A 5FO7B 4FMFA 4MJ5A 5IIEB 3FN0L 2MCMA 4GMSL 4L48A 2VL5A 5DLML 5D1QC 4PJXA 2E3VA 3B2DC 4KH9A 2JTYA 3CVDA 5ICUA 4IKLA 4Y16C 3P40A 3H9SA 2EDWA 4PRBB 3TTSA 5I6XC 3P4OA 3S3CB 1L0QA 2D7NA 2JB6B 4M00A 5IQ7H 5GS1B 1UATA 3C6LC 1AG0A 3WTSA 2Y2YA 5DGRA 3L1OL 2B59B 3SOBH 5IB1B 1DQVA 2CRIA 2FL5B 4Y5VC 1A1NA 2JLPA 4ELKB 2BP5M 1JNLH 4DZ8A 3CH1A 1NCJA 2NY0C 2VLRB 4BH7B 1Q9KB 2R1XB 3KGTA 5HHOB 3FO9B 2R69H 4BGLA 4ZDHB 1RLBA 4S0SD 4LLDB 3VXSE 3NMEA 5I1DA 3D50A 2NSMA 2VDQB 3ZTJH 4KKZA 2IADA 4PJDE 4M7ZC 3WTTA 4G6AC 4JG5A 3D1MC 3CFJB 4NN6B 5A2JH 2PPCA 5FGCB 3UO1L 1JPSL 1OT1A 4LL9A 5EORL 5F71A 5GZNC 4R0LC 2XX0A 5HD8C 1XF5A 2DYRB 3QUGA 6FABL 2GJ6D 1SMDA 4PG2C 3NP4A 2PW2B 2YD2A 2BVQB 2VDQH 3ALWA 3RHWF 1O6TA 4FLHA 1BVKB 5BO0D 4NDMB 1JV5A 1FGVL 1BQHG 2FJUB 3AADB 1YNTB 2DLHA 3IAPA 5C3TA 1GMEA 4EOWH 4HUXA 3QDJA 4JPKH 4FNTA 3VSQA 1F45A 3QG7H 2DYPB 1BBJA 4L4VB 1N6VA 3HBPA 1E43A 1FFTB 4H0GA 4MZ3A 1NFKA 1TMCB 5C09D 1L0XA 2A77L 5AKTA 4X98B 3BSHA 4ODUB 1E9PA 2YBRB 2P5EA 4HKBA 4HV8B 4I1RA 3WFEL 5AB1A 2V5YA 4UTBA 3GTNA 4GMTL 5EZJA 4AY0A 5C9JB 3MU3A 1AP2B 3CX5J 2E9WA 3FW6A 5JIHA 2K6ZA 5MHSD 4ZNEE 1JDAA 3N1FC 5EU6A 2PPEA 3PP4L 1H6TA 1JPFA 1VFOA 2RR3A 5KSAB 3MJWA 2Y6SC 4KGJA 1OAKH 1UWXK 2BSTB 4PTUA 5EIVA 1ZT1A 2KQNA 2Z8SA 3IMSA 2VQTA 1TZ8A 2IFFH 2WZPA 1YPZF 2VDLB 3O2VH 2C1OB 3QUZA 5E2UH 3FH8A 4WU7A 2Z3FA 2QVTA 4BUHA 3VD9A 2FWOA 1CXLA 1ZCRA 1E0OB 3EYFA 3HI5L 1YEFH 1RZ8B 3KNBA 3CC1A 2XA3A 3LOWA 3ARYA 3IVKB 2HWZH 2NXZB 5IJCC 1ZV5A 1QRNB 4JFDD 2XTJD 4B95C 4Q97A 1BG9A 2VDLH 1BQKA 1M2OA 2O4EA 3CMOL 3QDGD 4G42B 3U6XS 2NY2C 5D4HA 1OM3L 2H26A 3U1SL 3L9BA 4XMPH 4FFVD 1C9SA 2CDGA 1ZXQA 1YMMD 4K7PX 4MD0B 5HDQL 4FL4B 4OZFG 3BKYL 4X83A 1AGFB 5EBLB 5E8EA 3ES6A 1A7RL 2X3AA 3GEWB 3D6GA 4LCIH 4XMWA 4XPGL 5D7IB 3KZ8A 5BVPH 3ARGB 1WYJA 3ZL4H 3HB3B 4NZDA 3S36X 3SDYH 4ZUVA 1C7TA 1DP0A 2UXVA 3LDBB 4Q6YA 2JELL 3WNPA 2F08A 1XH0A 4GFXA 2YA2A 1W0WB 3E80A 2OK0L 1A9EB 3IDNA 3NIFE 4XPHH 4BSJA 4NZFA 2NY4C 4Q6IC 3K72B 3DVNA 4I5BB 4KRPD 5HGDB 5GXBB 4PLKC 2OULB 2Q10A 2Z93A 5C0ND 4D0CA 3SE9L 1D6EB 1QRKA 2ZE0A 2PR4L 2ZXGA 2PLTA 2LTQB 2RTTA 2XBDA 3QQNA 2CK0H 4LBAA 4WHYH 5JW4M 3LV3B 5IFJA 3W56A 2PCXA 1T4KB 1GGTA 4CBPA 3DBXA 4U1JB 2YMTA 3EYSH 5E1AA 2WMPB 3L4YA 5DA0B 2QPUA 1HSBB 2OBGA 4M62L 3T1FA 1EANA 4N87A 4BCYA 1U4EA 4N1HB 2ZUVA 3ZDZB 1V7MH 1ZWIA 2FZ3B 4MWFB 3L4XA 3O0LA 4YE4H 3OKDA 4P0DA 4AYID 2FATH 4HP5A 2VZSA 5AYUH 1G1YA 2I69A 4HDIA 1OW0C 4P2RA 5L2JA 1ADQH 1B0IA 1OAYL 1WHOA 3HG5A 4I1NB 5D1QD 1XCQB 3GMNA 4XNYL 1FFPA 5IB2B 2E76C 1UWFA 4JCMA 3VD2A 4NQEE 4TQIA 3V0GA 2WQRA 2EDLA 4Y7OC 1GJUA 1DQLH 1JPGB 4X6BB 3C6LD 3ZHNA 3WL9A 3GJFA 1U91B 2B08A 2VLJA 1PAZA 2UUDK 3KYNA 3DTDA 1E8ZA 1OT4A 4K9JA 1GZPB 1R19A 1UACH 4B41A 3QIUB 4S1SH 5JXEC 1OPOA 1U8QA 4E9TA 2VQUA 4MCZB 4FA6A 5IQ7L 4C56E 2HB0A 3UGEA 4AV5A 3EBIA 5F44A 5INDA 1NBVH 1I8LA 4XPAL 1IT9H 2DQJH 3CHQA 5F1KC 5DHEA 1W0VB 1BOYA 1DVYA 2EC9U 4J3VA 3PQYA 4JFOB 4OVVA 3CU7A 3SOBL 5D6CB 4BQ9A 3QJRB 3GMOB 3VXTB 1IAKA 4I85A 4OZGE 1F58H 1JNLL 2ZUYA 2P8LA 5A2IH 2R69L 5HDBE 3SOTA 4JJ5A 1RJLA 3OR7A 1AXSB 1KTLB 3K6SB 2XRAH 1R47A 1ACYH 1QMUA 2CNYA 3GSXB 3C60A 4J27A 3HBQA 3QIWC 4LFHD 3HG4A 4G7VH 3IPBA 3NABL 3QDMA 3V4PA 3CC5B 1ITBB 2WVSA 1INDH 2Y2WA 2EXWC 3EH2A 4LGPB 4IKNA 1ZVHA 5F88A 4GKLA 4U1GC 2VDQL 5DHXB 1VPOH 2IALB 4PJFA 4Y5YC 2WINA 3HC4H 1G4MA 1NKOA 4EOWL 4TKWA 4A7GA 4JPKL 1JTTA 3I6SA 5EUKB 5JW5A 3QG7L 2A4ZA 4MQSB 4PJIA 2CIIA 3WG7B 1XHHA 2CKBA 2X4OA 3OLIA 3Q01A 3OPZH 3CVCA 4ZFZA 4ZSOE 2YZ8A 3L3DB 1PKQE 1U8MB 3FO1A 4U1LA 1S3KL 4JZNB 5FK9A 3POCA 2ZCLH 2YRLA 3V7MA 2Y6SD 4ZOCA 5I6MA 3DX8B 1HINH 4XCYA 3BGMB 5ACZA 3OXSB 2XPZA 1NCWL 4M8QA 2BNUB 5L6YH 4K73A 5DHDA 1LP9A 4KI5D 1NGYA 3C75A 5J0BA 2DMCA 2E8YA 4QPEA 4PRPE 3I6LD 2V33A 4E9RA 1P9MA 1FUNA 1U3JA 4M02A 5DYOB 2O93L 3BESR 4F33A 1ETZA 2VL4A 4PVBA 3CZNA 2PWHA 4FTVA 4P46C 3FQUA 1XQ4A 3VMOA 4NKMA 2VQ4A 2XVBA 4PMFA 2NQCA 3V9EA 1DDHA 4JHAH 2PYED 1AGEA 1AKJA 2YPLB 2IFFL 3IRZA 2V6HA 1XGQB 3QPKA 4ZTEA 3RUGA 4CGUB 4NRXB 4W9JC 2JIXA 3RDTC 3ULVE 3AG4B 2BIHA 2GYSA 4G6FB 4P5MB 1E8WA 1YEFL 3OJDB 2V3FA 4U6YB 2VISA 1CBJA 1MREH 1T0PB 3DMMD 3IETB 5IVNA 2Q20A 2E7BA 1OF2B 1XF1A 3K6NA 1D7CA 2VDLL 3MGTB 1MHEA 4Z7NE 4AZUA 1PLBA 2BS71 1A5FH 4Z1PA 4XMPL 2CAKA 5LVEA 3O11A 3ZL2A 1EXUB 3EGSB 5I17B 4LCIL 2HPOA 5BVPL 2NY5C 2DWEA 4W9CC 1PPIA 3SJVE 3ZL4L 3D18A 3SDYL 3RZCB 5KYWA 1XTLA 4M1CC 4RIRB 2XLLA 1FF5A 5D1ZB 4BCZA 4ZD3L 4YSUA 1JHTA 5K9QG 3T8MA 3QUKB 1P53A 3O4OB 4XPHL 3PL6A 5I1IH 1M56B 3HG1E 3QXVA 5E8OB 4HKXB 4JEGB 4BEIA 3T6ZA 4OV5A 4NFDA 1BQHB 2DIEA 3RJOA 1OSYA 3DDGA 2WBKA 2CHZA 2X89D 2WYHA 4XI5C 2CK0L 5GRUH 4FFWD 2P80A 1EA9C 4IOIB 5IR1A 3BEVB 2APVA 1E30A 4IRJD 3QA3B 2OW6A 4PCTA 3WJMB 3WLBB 1KBVA 4IIQB 1FV1A 4UAOC 1G6VK 3C09C 3T77B 2OTWA 2ERJC 3EYSL 3VB9A 1N26A 2G3MA 3O6LL 5C86A 3D0VB 1S7XA 3Q06A 3RKPA 4JQVC 1ZHLA 5J9PB 1M6OB 1NICA 5GS0L 1M7IA 2B9AA 2FATL 5KSBE 5AYUL 3CXHJ 2DMBA 3CDGA 3GZQA 4MHHG 2AKRB 3ZYZA 1DZ0A 4YHOH 1ADQL 3B9VA 2FVNA 4KK9C 3RWEA 1VACA 3GSQA 1IBYA 3ULUD 2Q7AA 4NRZA 4PJ9D 2H0PA 3O3AB 3WY1A 1A21A 1WK0A 4QF1A 4JRYB 5CWSA 1RZJC 1DQLL 3D07A 1J8HB 1XZ0A 1IC7H 3RTQB 1JRHI 4KH2A 1U8OB 1GIGH 4F93B 4ZMAT 1EUUA 2ZOTA 1TQBB 1SHXA 2FT7A 1UACL 3F7QA 5HVGB 2ZT9C 1E2ZA 4S1SL 3IXTB 3L5XH 5AZEH 4AEFA 5FKAA 1AD9A 1T04A 4LOVA 4KZEL 2G0LA 5DEFA 4LCUB 2DZEA 2HKHH 4N2AA 5MERB 1NBVL 1OAZL 3ZU8A 1IT9L 3VE0A 2XQYK 1WWAX 4U0QB 4Y1AE 3VDCA 1EAQA 3QEQA 4OZFB 4CC1A 5L9DL 5C3IA 3P30L 1F4HA 3EF7A 1JV2B 1F58L 3FAWA 1S5HB 1LE9B 1OQOA 5CN2A 3IJHA 3WIIH 1TLKA 4OGAD 5ESQB 4WFHD 4OZFH 4ABQA 4OFYA 2VSDA 2XRAL 4NT6B 1BJ1J 2P5WB 1NSNH 1TVBA 2N56A 1AXIB 3FRUB 5I74C 2ZNXA 3U2JA 1NC4A 4HSQA 1YPZA 4G7VL 5SV3A 3ZN6A 2IH1A 3PWLB 4L1BA 4X7SH 1INDL 4L8CB 3BO8A 2LR4A 5G2NA 5AYQA 2GJRA 2VCOA 2NUPA 5C0AD 4TF4A 1GGUA 2PKDA 1SY6H 3ALPA 3VXNA 3HC4L 2BJML 2XHNA 2VABB 4MCYA 3GMRA 1I75A 3OPZL 4JDZB 2ZSVB 2ZCKH 1WCBB 1RD6A 1EZSA 1SEBA 1UEYA 3K4ZA 4MASA 1TDQA 5IHUH 5KVFE 4Z7QE 2AK4E 5EHFA 4RNRB 4RMSA 3UAJA 1HINL 3DX7B 4P46D 2F74B 3KPQB 3LS4H 2GI7A 3EKCA 5L6YL 1U2CA 4IOSD 4S2SA 2COVD 2FLRT 1J0YA 3BJLA 1AR2A 5D93B 2EDQA 3CFBA 3RDTD 2BOBA 2FX7L 3DX6A 2PABA 1F41A 4LLYB 1NEZG 4G59C 5CXPA 5BO1H 4KBPA 3FQWA 4PGCB 1G5GA 1R3HB 3T4AB 5HYJD 1GC1H 3DHJA 3UTTB 3G5YA 3ZRFC 2ICWJ 1JWUA 4U49A 3DECA 4R4FH 4JHAL 3PHOA 3GHBH 2VLKB 4YDIH 2HT4C 3S4SA 4TXVB 2CR0A 3FCUB 5DT1H 3ET9F 4MVBD 4HJ0D 3W11C 2OJEB 3IDIA 5DGQA 3HS0C 3BEWA 4WNJA 2R51A 1MREL 5C0CD 4NKDB 1FYTE 5D1XB 1KLUA 1E4XI 1QEWB 1ULVA 3P0YL 4L8DA 4AITA 2ADYA 1MI5B 3K4AA 1HHGB 2Y0SA 4A7SA 3E38A 4W4OA 1A5FL 3OGCA 2V8LA 1JK8B 4FQQA 2ZX7A 3LXCA 2OMUB 1P7KA 3NPZB 4QHKI 1CK0L 4HOZA 2BIIA 4QHUA 1N5AB 3QJUB 3NCJH 1EUTA 4G6MH 4JFWA 2DM2A 4HOXA 4NZTH 1NCNA 3ARTA 3L7EB 2VR4A 1N4XH 3MLXH 3VFGL 5MENB 3CTTA 3IDJA 3V4UH 3CDFA 2BIMA 5I1IL 5CP3H 1QPKA 3VGBA 4L8SB 2G9HA 5AVWB 5IJKC 3ARPA 4UZGA 1UM4H 3DJSA 4PJDF 4WI2A 2QTVA 3GSRA 4JQIH 4MNGE 3BN3B 1O6VA 2KPNA 1NL0H 3DPDA 5GRUL 4OJDH 4RSYA 1T66C 1J0JA 3ZY7A 4G9FB 1NC2B 3DV4A 4PJBB 2IPKA 3ZTDC 3U7AA 2ROYA 4POYA 1G6RB 3MNZA 4G8GE 4DTGH 4BDVB 2ICES 3QHFL 4QYOA 4XX5A 3ARFA 3HCVB 4LLMB 3VFRA 4BKLA 4Z76B 4N20A 2VN6A 1F6FB 1NZRA 1FL6A 2DOCA 1T1XA 3L2MA 3MRBA 5CBAA 1G6RH 2DMGA 4LLVA 4WEBH 4YHOL 3S34H 5C9KA 2PWFA 3GZOA 4O02A 3ARDA 3TIEA 4ZFFA 3SYPA 1XIWC 4JPVH 1HESA 4FEMA 4NO5B 1WJ3A 2X38A 5SWZA 2WYIA 3BUQA 1LWJA 1UH2A 3VQLA 4OTXH 2YEZA 2C9PA 4UM9A 2D3LA 4J6RH 5G4NA 4F2MA 1IC7L 4ELDA 4RESB 5DQ9A 5HHNB 1GIGL