2HVBA

Crystal structure of hypothetical protein ph1083 from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
113
Chain Sequence
b'MLKETIRSGDWEKHVPVIEYEREGDLVKVEVSVGKEIPHPNTPEHHIAWIELYFHPEGGQFPILVGRVEFTNHSDPLTEPRAVFFFKTSKKGKLYALSYCNIHGLWENEVQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide reductase
publication title Crystal structure of hypothetical protein PH1083 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
total genus 28
structure length 113
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2hvbA00
2AMUA 2JI2A 2JI1A 1VZGA 4BFFA 2JI3A 4BRVA 4C4BA 1DO6A 4D7PA 1DQKA 1DQIA 4BV1A 4BFKA 1VZIA 4BFJA 2HVBA 4BGLA 3QZBA 1Y07A 4C4UA 1VZHA 1DFXA 4BRJA 4BK8A
chains in the Genus database with same CATH superfamily
5HHXL 3V0DA 1E7UA 5I71B 3OAUH 2NSMA 1AHWA 3MRFB 4LRIC 4XXWA 1P7BA 5FPIA 1GGBH 1GS6X 1QHQA 5F7AA 1O6SB 1BQSA 1IL1B 5DJ2A 3L2MA 1NC2A 2DQHH 2LOEA 4JFFE 3D3VB 1IC5H 4ENEC 3DUUA 3STZB 4NJ9H 2AEWA 2P8PB 4MJID 3WO3B 4AENA 4B0MM 1DP0A 5TE4H 3QIBB 2AJZA 4GSRA 1H3VA 2YKLL 2DDQH 4UT6L 5CXPA 1KWGA 1UB6A 7FABH 4MXVE 4YL9A 2XWJA 3VRJB 2OMYB 3BE1L 3U6RA 3S97C 3P0GB 3NBNA 2EKJA 2Q7NA 1KUMA 3QDME 4AYFB 1ZS2A 4P46D 1AXTH 4B50A 4U6HB 1NCCH 2V2XB 3CUPA 1AZNA 1ZWIB 3ZRSA 3U46B 5KYWA 2EXSA 3LPPA 4HUWA 4ZQKB 2Z8RA 4F8TA 5KVDE 4JPSA 2APSA 2F7IA 4LLWB 4AG4L 4BWUA 4R7XA 2YD8A 3HAEH 3V0GA 4AQEA 2DS4A 1MEXH 2C3HA 3QQDA 1FPTH 1DEDA 5FOJA 4NYLA 4I9XA 4KTYA 1UXWB 3SKMB 1TNNA 1F1GA 3F7QA 4P5RA 1PZCA 2JCCA 3MO1B 1MQKL 4JPVL 3IKCA 3T65B 4EZKA 1A6WL 4J6RL 3ZKMC 2CBTA 3ZHNA 1JVOA 1SVBA 4BSWB 3JTTB 5MI0B 4B6ZA 3ZDYF 5T5FL 3IGKA 3NSCA 5TDOA 2NTSP 3HS0A 5T1KB 2FJHA 1R5IA 4HX1A 5BUAA 1ZK9A 4DP9X 4JN1L 4F15B 2PNDA 2BSSB 4Y4FB 3MXWH 4X9HA 5FHAH 4N0UA 2B2XH 3T6ZA 1NOFA 3FU8A 5D2NC 4XOBA 5JOPE 1BZ9A 2Q6WB 3C5ZB 2XN2A 4NENB 4BQBA 2FX7L 3FB7A 2PW1B 1JG9A 4X5LA 2KZ1B 3CV5A 3TH2T 5FHBH 3ZE2B 2R0KH 3ATDA 3OAUL 4GRLD 3FCTB 3IGFA 2YFNA 3LV3B 3QJVB 3O3DB 1IM3B 2GJ6A 1GGBL 1NFDB 4N85A 3OGOE 1MJUH 2YIHA 3QUXD 2BVEA 2DQHL 3RZWA 5E9DE 2X4RA 1IC5L 4TMPA 2Q8AH 3BP4B 1A9EB 1NFIB 3WEXA 3RIFF 4NJ9L 4MJHA 4WKZB 1T21B 5CLWA 5TE4L 1LK2A 3VAEA 1WBXA 5I19H 4N3UA 4RDBA 3VFGH 3RB5A 4FNUA 4ODUB 4OZGA 3P4MA 7FABL 3CFQA 5FDWB 4M56A 1JZEA 1UCBH 1FL6B 3ESOA 4L29A 4MSWA 1X3DA 1AIZA 1MXGA 2IG2H 3OKKA 4QY8B 4EKXA 2WUCH 3WTSA 3KBPA 4XB3A 4P07A 3UBGA 4CNIA 1QR1B 2JLPA 4P59H 5CJ8A 1AXTL 1R19A 3A6OA 1NCCL 4P3CH 4D7PA 3PHQB 3TURA 4XOEA 3FTUA 2CIIA 5EBMB 5F8RC 2VDRB 5KSAB 2HFFB 4ZXBA 3S3SA 1E30A 1ICTA 4XPFH 4FERA 3CFCH 4KJWD 3TYFA 4JRFA 2YD9A 5I1DB 3MNVA 1JZGA 4MNQE 2NZ9C 1TNMA 1CYWA 1KYAA 1V3MA 1GCYA 4A63A 5D7LE 3WIFA 3DV6B 3OWRA 1DVSA 5C0CB 4PLJC 3WDIA 4N24A 2PWGA 1IBBA 3HRZA 3MBEB 4TULH 3UCRA 3VTMA 2W88A 3GUTB 5F6HJ 2FHBA 2Z8WC 4PMFA 2EDNA 1IEAB 4S1DC 4BUQA 5MERA 3FMGL 4ZO7A 4QRTB 5B38G 1J9TA 1UT9A 2V5TA 3MXWL 4I3RH 1HILB 4NM8H 2B2XL 5K59E 1B0RB 1H0DB 3VVVA 2DQGH 3F7YA 2OMVB 2X4OA 4JFDE 4L4TB 1YQVL 5DR5H 4RWYH 1NBQA 4ACPA 4UM9D 2VQTA 4PRDA 1BYNA 1YEJH 4Z7WA 2R0KL 3ETBF 1U8MA 4D0BB 2UY6B 4TS6A 4UM8B 4YIQA 3MMEB 1C5DB 4I3SH 4S0SD 1MJUL 4GUQA 1TCMA 2ZCKH 4KO7A 2Q8AL 1Z9SB 1XIWC 4NKOB 6TAAA 2FWOA 3NIDB 4G7VH 4L4VA 4RAVB 2XY2A 3VFGL 3HVNA 1FSKB 1T1WA 3TWCL 1QFWI 3AY4A 4IU3A 2A6DB 1ZV2A 2VERA 1UCBL 4PJAA 4XBGA 5CD3B 5HYSA 2IG2L 2Y7OA 1YMMB 3ULAB 1YLBB 2B4CL 3X12A 3C6SB 4P59L 2WMPB 2V2TB 4GW5B 1T20B 1I8KB 2A6JB 1KULA 1J12A 2BIIA 4ODXA 1KENL 2OJZH 4GRWH 5GSVA 5ISZD 5C97A 4ORGB 3QUYD 5F9WC 2QEJA 3VFSB 1B90A 2YGOA 4XPFL 3VWKC 5IEKB 3FUIA 3CFCL 2EYSB 4R6UA 5FGSA 4WCYH 5AZUA 4KKLD 1NUDA 4KVCL 4NZTH 4UQ3A 2ZUYA 5I1IH 3WY2A 4UTAL 1M71A 2XQYG 5BXFA 2OMXB 5E0QA 2BSCA 4PRID 2WHVA 3B2UD 4NC2B 3EYFB 1J05A 4TULL 4HAKA 2JIXA 2J55A 3O2VH 2WLHA 1GS8A 4D0DA 2X1WL 2H0PA 5D4IA 3RJOA 3FTGA 3KPRD 2EDHA 3QQXA 4I3RL 4G9FA 1CDJA 4KK5D 2KS0A 3CHSA 5A3IC 4TVPD 1HHKA 2VLKD 2DQGL 3Q5OA 1MJJA 2XKNA 2JCCF 1FFPA 5JA9A 2W0LA 2DWSA 4E41E 4JFPB 3U1PA 5DR5L 2H45A 4PP1D 4GLRH 3UTQA 4KI5C 4DEWA 2EUVA 3H56A 4K2UH 2E7LA 2ED6A 4X8CA 4F27A 3VSQA 5AUMB 5HGDA 4ZW5A 4JPIA 4I3SL 3NJJA 3JYCA 4PJ8B 5EZPA 1ZGLM 2Y24A 3TC9A 2ZCKL 1CICC 3WTXA 2EIEA 3P3UA 7CGTA 3JXAA 1F58H 4F20A 2HX8A 2EINB 4FXKA 1AZBA 4UIMA 1A02N 3VXSA 4L1SA 3H9SD 5J06A 4AJYV 3VFPA 1CLOL 4OBRA 2AVGA 2DF3A 5KSBF 2GTZA 4K07A 4NO3A 3CD4A 4OQ1A 5JLZB 4P5KA 1C7SA 1QLEB 5F1IB 1EPFA 1F3DJ 1WPCA 3SDDA 5LCVA 4V33A 2X88A 3QNZB 3TO4B 3VWJA 2BP8B 3OD3A 5F7WC 5ACLA 3T04D 4HD5A 2O5YH 4KVPA 3FB5B 3QUZD 3S96B 3OR6A 2OJZL 4NUJA 1WCQA 3TVMC 2IWGA 1H9DA 2HAZA 2QVTA 3UYRH 1HYSD 2FATH 4MX7A 2X6MA 1EHXA 1KBGH 1MCLA 2WWMD 2VN3A 3BO8B 4HGKC 4Z7QE 4WCYL 5ESAB 4A7VA 4NAQA 4DIXA 2WLLA 1DZ0A 5FCSH 3CJJA 3QG6B 4IRSD 1MHHB 4HCGA 1ASPA 4YC2B 4DF9A 2PO6C 5E2WH 1XCXA 4N26A 2JB5H 3S4SA 2LU7A 3NVQA 3QORA 4G6FB 1NAKH 1A5FH 1X5FA 1M2VA 3QI9C 1S7SA 3QJTB 5DVPA 1CD0A 3O2VL 3RWIA 2QGCA 2CRMA 3ARBC 3WMQA 2XWTA 4KNTA 2XI9A 2V5RA 1SHSA 3K7UA 2IH9A 4LVNC 4CU6A 1MPAH 2ODHA 3IM1A 4M8RA 5L7XL 4QYOB 3N85H 2G60H 4ODWA 5C0CE 5F3FA 1CBVH 4RMRA 5JW4Q 2AK1H 4HCRL 3S3PA 3KDMA 3GTVA 1KJVA 4ALAC 1LWJA 4G6AD 3D09A 4K2UL 1I1AC 3PL6C 4PYHA 1U2HA 4I3GA 5FO9B 1F56A 1EANA 1N26A 3BD3A 3QO0B 3Q8FA 1F5WA 2PCFB 1F90H 2L7UA 3ZTEA 3IE4A 4DN3H 4WWKB 3WGUB 3BPCA 2E9JA 2UXGA 3AS2A 5E99H 5D5MB 4I5BA 3GMOB 2YXVA 3WHXB 1KIQA 3EDJA 1EO8H 2JF1A 4HUUB 2G0LA 1F6AA 4Q89A 2X9WA 1QG3A 4PRHA 2I69A 1K8DB 2D31B 5C0FA 2EDKA 3BD5A 3SYCA 1FL3B 5DMKB 1EQWA 4XVUC 4ZMAT 1FE8H 2L3BA 1LYQA 3OC5A 2FB4L 5IROD 4PJ6A 4LRNH 3W39B 2AZUA 3MACH 4XT1C 3K2UH 2VLJE 3CVHA 2ZJSH 3NIDE 3SDXA 4PJCA 1IVTA 4RFOH 4GEJA 4OF7A 1ANUA 3UYRL 3DX4A 2ZP9A 2FATL 5EULV 5IJCC 1U3YA 3OKOA 3CSYA 1SOSA 2YA1A 2ALAA 3DX6A 1D6EB 4NIKB 3RPIB 4PJAF 3CWGA 2XCMC 2HZHA 1U8HB 3HG2A 2X6AA 4R5TA 1MCKA 2HP4A 5DD0H 2YD6A 3QR0A 3L54A 4PD4J 1FFNA 5E2WL 1QLFB 2JB5L 4J4PD 3S7GA 3APNA 4Z9KB 1NAKL 1A5FL 4RMUA 3C6LD 3DX3A 5L88H 2CPCA 4LESA 1KFAL 4UF7C 1KTLB 4JRYE 4TOYH 2W80C 5JYMA 5HP5A 3OLDA 2ICEB 5BRPA 1ZT1B 3HE6C 4OJCA 4YSEA 1RP8A 4XMLH 1MPAL 1SVCP 3HCVB 3MLRH 2R29A 1RUPH 4JL1A 4OZIA 3N85L 3UYOD 4Z78B 3I3BA 4Y1AD 4YDVB 1JV2A 1U8NA 4ANXA 1CBVL 5JIKA 4L37A 4NQCB 5IKCB 3UDWA 5E6IA 4UDUB 4IIQA 1AGCB 2RCSH 2EILB 2PYEA 5HYJD 4HK3N 4DKFH 3GBEA 5IVXB 3CFIC 4OUUB 1F90L 1VB9A 2AMUA 2JKSA 4OFYD 4DN3L 1KLUA 3IDIB 1YEFH 1VFBA 3KPSA 5E99L 1SQ2N 1I85C 4JDTH 1DDHA 1KOAA 4QJ4B 5CINH 1PS3A 3FT2B 3VXUD 3WY4A 2XUWA 3SQBB 3UTTA 4J3WA 3UP6A 3IRPX 1OCWH 2KKQA 3TH4T 4KROD 3PNWA 1QRNE 3CBJB 2KL6A 5E03A 5EEUA 3CCHA 5DS2A 3G6DH 5C08D 1FE8L 3MV01 2EABA 2ADIA 5L2KE 2X41A 3NA9H 4LRNL 2DM4A 3S5LB 5CZXC 1OP3H 2ATKA 4JAMA 4ZD3H 1JI2A 2OKMA 3RL2B 2AXJA 2R69H 4XGZB 1NKOA 2B20A 3KJ6H 3NSXA 4RFOL 1LVEA 3C09C 4LBEB 3EFDL 1YNTA 3NTCL 4OZHA 5EU6E 1JMZA 4KFZC 1HCVA 5JQ6H 2BRRL 2A99A 4IGBC 4RMQA 5DD0L 3O2DA 4HEME 3ULVF 4A6YA 3QXWA 1U21A 1E8WA 1AO7A 3RTQC 1UWYA 3OZ9H 3VXMA 4AQ1A 3IU3B 4QRBA 5L88L 3M46A 4TOYL 4KX8A 4NPYA 5C9JB 3MXVH 4PSRA 3SY0A 2VXTH 2Q0ZX 3SQOH 2UYLA 3LPGA 2W1NA 4XI5D 1BAFH 4KJQC 4XMLL 4YZWA 2CPUA 5SWSE 4JRXB 1RUPL 3AREC 2DLTA 3MV9D 3ATEA 4ZUWA 5BUPA 4U0RC 4J3OF 4YN3A 2EDEA 5LBVA 1BQHA 3D0VB 2E76C 2RCSL 2I5YH 3L4XA 1KIPA 3SOBH 4NKDA 5ETUB 2YMOA 5DEGB 5HDBB 4UQ2B 3NJLA 1SN0A 2MCAA 3ECQA 4JDTL 5IHLB 1BJ1H 3GMQA 5CINL 4FFVD 4ZW7A 4KO6A 4NNPH 1OCWL 4QHNA 1MHEB 1MI5E 1S9YA 4TNFA 1MCWM 2IPUK 4DVRH 3L4YA 4E9RA 5HHQB 3M7FB 1W0VA 5SWZB 1OB1A 2WXLA 3G6DL 5DO2D 4FQXC 1O7DE 1RFDH 5INDA 3U0PB 3FO9A 4F7EA 1WTGT 2ZUUA 5I6LA 1NLBL 1DJGA 5DK0A 3B5TA 3X14B 4ZD3L 4GRMA 5C07D 2R69L 4AMWA 3KJ6L 1HCFX 1SMDA 4J3XA 5IFHL 5ID1A 4FGMA 3UBXB 3MRKA 4B9KC 2VW6A 1T3FB 1UGKA 4LHUG 2XHNA 5CD5D 4XWGH 4G43B 2AK4D 3N06B 1WC7B 2F0CA 2X28A 2X4QB 3MTXA 5BZWB 4UOW0 3OMNB 2B9AA 4XZUB 3ARVA 1BDYA 2ZXCA 1N6VA 4KXZH 3TM6A 32C2A 5KUMA 1OAUL 3DTDA 2GFBA 5E4IA 2IF7A 3II2A 4PV9A 1A4BA 4OIBA 4QO1A 5HYFA 4CA4A 4CMMA 1UZGA 1OAKH 2XG4A 4HS8H 3MXVL 4N2NA 4K3JH 2H2SC 3SQOL 1RU9L 3U6XS 2H1PH 1BAFL 1KB5B 3NCEB 5FW8A 4PYGA 3TNMB 4PREA 2RBLA 3VFVA 4N0RA 3IJ8A 5E6UB 2O6FA 1FGNH 2XA8H 2DLFH 4YH6A 1HH6B 3VD3A 5JNYB 2J6EA 1H6FA 5I9QB 5DRNB 1EAQA 3PV6A 4QRAA 1E4XH 2DL2A 1S7XA 2KUTA 4P3DB 1BVKB 1DQMH 2HJKA 2CHNA 1ZA3B 2GSIA 2QADC 2VR8A 3SDCA 3GBLA 4AC4A 5D71H 3SOBL 4PRNB 1ET8A 4IM8A 5DFTA 1SGKA 4Y19E 3HG1E 3OPZL 4AMXA 2CA3A 5F7UA 1ZLVH 2C4FU 4NC0B 4OZIF 3OAZH 2FR4B 3APCA 4NQTA 4NQCE 5FUOH 3DOIA 3FPXA 4PG9A 4WF7A 1FJ1B 4KRPD 1VEOA 3VG0H 3D69A 4NNPL 4DVRL 2Y06H 3TBSA 4JFEA 4P2AA 2WBXA 5F0JB 3F6IA 3MV7D 5B3JE 1XIWB 15C8L 4AK1A 4LSVH 2JKIS 3DVGA 3ZYOA 1RFDL 2JQMA 5JW4N 5F7LB 5LAXA 4XAKE 1T0MB 1UZ8B 3L9RA 2YD4A 3MJWA 3S35X 3FOLA 1GYVA 2CG9X 5BOPA 5I0XA 1G7HB 3WFHB 3WNJA 4DJMA 5KYUB 4NKQB 1ZCRA 5FW6A 4YEEA 4N20A 1PIGA 3GT6A 5M94B 5DJCB 5K93A 4RZCB 2X70B 1FDLH 1YQ2A 2PUQT 5LO7A 4KZDH 2J73A 3TJPA 4K3GA 4NT6A 4E42B 1WUNT 4M9OA 3VUAA 4QRQA 4XWGL 3V9CA 4Y4HB 4Z1PA 1TZOA 1OIOA 4QRRA 3TEYA 4L1TA 2DLGA 5D1XB 3WE6A 2P24B 1AYRA 5F0PB 5JDJA 5FYKH 1IV8A 3GYRA 3IRZA 1VZHA 3PDOA 1OSYA 4Q7DA 3QYMA 1OAKL 4HS8L 2LFGA 2F08A 4PJFA 1G7PB 1YNTF 2BOCB 2ZP8A 2OR7A 1UKTA 3JVFC 3KGTA 3BPNB 4YHLH 4TTDC 1U8JB 5AL8A 2VKWA 4C56E 3SKJH 3L4TA 2DLFL 3PGDB 5EO0B 2YMXH 3L6FA 4FXLA 3VNZA 4F7CA 4HFWA 4QHLA 5D1QA 5H94A 1JYNA 2BVQB 1Y6NR 1ZV5A 3HLAA 1E4XL 2FO4A 1DQML 1R34A 2BHZA 2J8UA 2RHEA 3ZL1A 3CDZA 5D71L 2J43A 4HT1L 3TJHC 1PCXA 3FN0H 3OV6A 4AKPA 5IHUH 2P8LB 2V3EA 1E3XA 1JGEA 3HN5A 4JDZA 1A14H 3CC1A 3O8XC 4OGZA 1JWMA 4NN7B 2W60A 4YO0A 1H6UA 4WIQA 5E0FA 1LE9B 3CZJA 2YSSB 4NRYB 5FUOL 1JVKA 4PV8A 2RQ8A 3VG0L 4KK9C 1DQKA 2Y06L 1LWRA 1P6FA 3SKNA 3KPLB 4LSVL 1AQMA 2HX9A 4OW6A 2NT0A 1IT9H 4NQUA 4J3TA 1SDDA 1KJ3L 4YXHH 4N2CA 3B34A 2H9GA 3L1OH 1MCFA 2WYZA 4BQCA 3KXFB 1Y07A 2HJFA 5HDBE 3UZEA 5IM7A 3A0OA 3MRGA 1N0LB 4PG2A 2ZX6A 3S34L 4JGNA 2VDNH 3NFSL 2NY4B 1VFOA 3ARFA 1EZVX 1P5UC 1QEXA 2UY7B 3MR9A 3P77B 5CMAB 3BUPA 5CSGA 5I74B 3VXNA 2G5BA 1TETH 4KZDL 4N1EA 5AOJA 2GSGA 5AW2B 1U3ZA 4Y1TA 5F1SA 1HL5A 3EJUA 2AJVH 4M93B 3D33A 3RIAF 5E4EB 2EDRA 1T80A 3NQKA 5GGSA 3MA7A 5I28A 1ASQA 5AYUL 2P42B 4N6RB 2J12B 5FYKL 43CAB 1I9IH 5AB2A 3G5XA 1IKNC 4G8FA 4KJYB 1A4CA 2ADJB 1XGTB 4XO8A 3O2WH 4FLSA 2DYPA 1OPGL 1GZQA 4M1DH 2Z7ZA 2AEQH 3C8KB 1YEIH 3GRWH 4XBEH 1EJ8A 3SGJC 3QI9B 3KHOA 2E56A 4JPQA 1QVOA 4R90H 3RGVB 5KBNC 1SJHB 3L5HA 3BZFA 3QXUA 5F72S 4Z95H 5IB5B 4DGYH 5IUCA 4I0KA 3CH1A 3FDWA 2YMXL 3K6SB 2JKRM 2CO4A 2V7NB 5CM1A 1HEZB 1KEGH 3GWJA 4W4OC 4X6DB 2RALA 4LT7A 4NLHA 4YR6B 1E5UI 3BI9X 3HUJE 2ZG2A 3DGGA 1Z1WA 3UAJD 2ZXQA 3UMTA 1L7TH 1A14L 4G6MH 3K0WA 1XTLA 1EVTC 2IH3A 1W9XA 2BK8A 3M7OA 2HYMA 5D9SA 3U36B 3TPUB 4R7VA 2YD3A 4ZUUA 3AG4B 3OKMA 4HWZB 1PIFA 5JIHA 3NIFE 5DHYB 3DVNB 3LAFA 4G7QB 3T4AB 1IT9L 4LNRA 1J8HB 3NYKA 5FUCC 5DZOA 4YXHL 4ZXBD 3F12B 3L1OL 4Q8BA 1S8DA 1E27A 2FJUB 4X9FA 4MZIA 3CHPA 4F1SA 4WNQB 4P2RB 4AI7A 1H8OA 4Y4KB 1WHPA 2CIKA 1XGPB 2VDNL 1TT6A 5ERWB 3FOMB 1XGRB 2Y22A 4IMLB 5IG7B 1P6AB 4MAYC 1BQUA 1E9PA 1LLAA 5C3TA 5FB8A 3OR7B 3EOAB 5IW1B 4U1LB 3MRBB 3QXVA 5CLTA 2W94A 2XZCH 2AJVL 5HHVL 1A65A 5JOFB 2VQ4A 1HCZA 3H9HA 4WZ9A 3B83A 4KKBD 5HHOE 1CGUA 4S1RH 2YXFA 4P57B 3IDYB 5JORA 4NZJA 3RL1B 2HLAB 3O2WL 5IBLD 4M1DL 1V7MH 2ERJC 2AEQL 5CILH 1CG9B 3GRWL 5DZJA 3IFOA 4XBEL 4XN1A 4KKQA 2EUZA 4R90L 2IANE 3AY2A 4RMTA 4ZFFA 3V4VH 1WZKA 4Z95L 3ZDXB 3OLEA 4QRSB 1A6TB 1IBHA 2HTLD 3TA3C 1KEGL 4HDIB 5ANMB 3PWPA 1M05B 1QFHA 1AD9B 3KLLA 2D2OA 5I1CH 4PIRF 2F8OA 1FL5B 1ONQB 5DHVH 2OJEB 1OSPL 2NSQA 3BAKA 1CD1B 3LDBB 1X5IA 3MODH 4GIAA 3U9UA 1K2DA 4AE1A 2EQDA 5F1NA 4MD5B 3ZE1B 2LE9A 4XP6H 5KAQF 1E28A 5F1OB 2ZQKA 3SGDH 2F54D 4GKZB 1J7VR 3R8QA 3IJSA 4MMXA 1KN4L 2GBUA 5LQBH 4XNDA 3WJLC 5JIIA 3JVGA 3IRCA 5JQIB 3TESA 2KPNA 5DMYA 4X6BA 3U2SB 1J5HA 1S7QB 2W0PA 4HH9B 3GM0A 3SY6A 2R0LH 5A2KH 1NDMA 4ODSH 3D2UB 3O11A 3OB0K 1MCEA 2ISDA 4QNPF 3FFOA 4OCNC 4YSPA 1BM3H 1GS7A 4CVXA 2F53D 3DTUB 2WTRA 4YDJB 2IFFH 1E5YA 1X4YA 3QZWA 4IBYA 1PSKL 2D0HA 2Z65C 3SPVA 3WL9B 1BZ8A 1N59B 5CEZH 4GT0A 1ETZB 2XZCL 1CU4H 1ZVSB 4OJDH 3JWDH 2QL1A 2Y5EA 3OAYK 1C16B 4G9FD 4LLAA 4QGTA 4S1RL 5CWSB 3MDJA 1YVLA 3SJVE 4JO8A 1E3ZA 3NJKA 4IGBB 2BW5A 3FUDA 5DRXA 3OF6A 5DLMH 1V7ML 2AQTA 2HG5B 1N4XH 3FQUB 5CJQH 2J1XA 3WS6C 4BZ2H 3CSFA 5CHNA 2OSLA 4Y2DB 3GIZH 5ABZA 1TSRA 3V4VL 3G04B 1DVFD 4FJZA 3RWHB 5I16B 4B9JA 1DQLH 1NCIA 2OCCB 2QMJA 1QA9B 3BPOC 4G5ZL 4V1DB 3FU3A 2AXGA 3VFMB 2WB1A 5KTEH 1BJMA 1YPZB 5HDQH 5JW3H 2SEBB 3HPJA 3MODL 2WKGA 4WJG3 1RPUA 4OLVH 3U4KA 1URIA 1KELH 3SCMB 1UUNA 5JO5A 4WUUA 1G84A 3BWSA 3G9AB 2YPKB 3QIUC 2OSWA 4G8IA 3P4NA 1N10A 5I1JH 1TVDA 3KL0A 5LQBL 5BPPA 2BVPA 4FKEA 3S37X 1E9QA 3RWJB 5I8KL 1H8NA 3MRIB 4X6DE 3T0VA 4PJ7A 4PGCB 2BXYA 2LLLA 3ABZA 4IOFC 2NSXA 2HN7A 2DAVA 2R0LL 3D1MC 4ODSL 1G9MC 2NY5H 3H0TA 3KPOB 1I3UA 4UAOC 2JKTM 3NIGE 2A9NH 1VADA 4CGUB 3U7WL 1XH0A 3EYSH 5T1LD 2G3XA 1QW9A 3QH3A 4B9ZA 1M7IA 1RZKH 4P23D 4I0PD 1OD7A 1HZKA 2EADA 2IFFL 1QEWB 5ICUA 3PABB 2JB6B 3QORD 4QXWA 1UD5A 2JJSC 3HE6A 5FOBA 4KTEH 5CEZL 5AAMC 1E6OH 2WIIA 5E1AB 4KZ0A 2A4EA 1CU4L 5LBSL 1I53A 4LVEA 1R3KB 3NCYP 1KGYE 1UENA 1I1FA 4P2RE 1F11A 2C3XA 3N44B 4ZX6A 3IDXH 1KGWA 4GUPB 4MYPA 3PWUB 1UFGA 1A9VA 5ICZA 3QULB 3VJ6A 1TU2B 4Q9RL 1TQTA 2BS8A 2BVOA 3E6FA 1ZLUH 5CJQL 1V3JA 3F05A 1M6OA 1UATA 1S7VA 4B5ZA 2ZZUT 4OM0H 2J57A 3IETB 4ZRGA 3SE8H 5KVEH 1I85A 3GIZL 1ZIBA 1QP1A 3BQUB 4ZW8A 4JKPH 1UM5H 3FQRB 4AGOA 5E1GA 5A2JH 2AITA 3HI6L 4TNVF 1DQLL 4KI5F 1PY4A 3ESMA 3UTPE 2XXMB 5KTEL 4HGWA 4PJ5B 4AIZA 5JW3L 2X4NB 5DQJA 5GISH 2C3WA 4MCZB 2OL3A 3KYMB 2EKSA 2VCOA 1V7NH 1UCTA 1SMAA 1VSCA 1AHMA 2GSMB 1U41A 1AP2B 2IBZY 4HFUH 4PRHD 5DZPA 5F88A 4APQD 4ONGH 1D9KC 3HW7A 5I1JL 2JWYA 2H32B 4E9LA 1ETA1 4PJEA 3RG1C 4OTXH 1OLZA 4OZ4B 1N8ZB 1YEKH 3KD4A 1T1YA 2BS9A 1P69B 5BRZA 2AJYH 2DQUH 2VDLB 4WW2B 4X42A 2WLJA 4LLDA 3TBVB 5ITFA 1PKQB 3HHMA 4NNXB 2NY5L 2OTWB 5D2LA 3RVWC 2A9NL 5A6IA 3TEUA 3HZYB 1RZKL 4XR8C 3SOTA 3TBYB 3B7SA 3L7EB 5HBBA 4JUSA 4OR1A 5AEAA 3Q1SH 4YHYB 2EVHA 4KTEL 5IVZB 4NQDD 1S7RA 3EJPA 5I24A 1MCIA 1E4KC 2GUOA 3ARTA 1XBDA 2XJLA 1PPIA 3D52A 3UABA 3EO0B 3FB6A 4HK0B 2EDXA 3IDXL 2EDOA 3T77B 5AW1B 2NNAA 1JPEA 3C8HA 2YC1B 3UBXI 3GSRA 5EU5A 1J5OH 2PPDA 1W8EA 1OF0A 2F7PA 2QPFA 4WWOA 3NSFA 1CYXA 1NIDA 4W9KC 3AFLA 3BWAA 4OM0L 3SE8L 5TF0A 2PYED 3PYCA 1L9RA 2VRQA 4N8PA 3L3JB 2H6UA 4DAGH 1CK0H 1KN2H 5GRXG 1FNLA 1JTOA 2CUIA 5B1JA 1OTUC 5C0EB 3ZDZE 1DJZA 2JJTA 4IS6B 4K94C 3KPSD 3V0VA 5SX5K 1SBBA 3GSWB 1RZIB 5GISL 3V5HA 1NAMB 4LSDA 4QHMB 3L2LA 4ZFOA 1NLDH 3PQYA 4OF6A 3BVUA 4HKZB 3NMEA 1E2WA 3MGAA 4HFUL 4EN2A 4W81A 2GW5A 1Z32X 3P73B 2UZPA 3PLYA 4ONGL 1MF2L 3T4YB 5CFAA 1RVFH 3DPBB 4FADA 3N1QC 1N70A 1WH0A 4OTXL 5B1CA 4XPTH 5GRVK 5GS1C 1BD2A 2V8LA 1DVQA 1XGQA 1O7DC 1AE6L 4LEXH 2AJYL 3D85D 3PP3K 3IEAA 2GT9B 1Q9KB 3QB7C 3RKDD 4C47A 2XJKA 5IW6B 1HNYA 3OQRA 1NBZA 4Y5XB 3W9EA 3E9TA 3O4OB 3CFDB 3U48A 3W57A 4Z7VA 4WI2A 3UG5A 4I4WA 4ADJA 4N0FA 5L2JB 4YJZL 4GO9A 4AQ8A 4YX2H 4GPVA 2QZ5A 1RJLB 4ZO6A 2F9BT 1PYWA 3AQYA 3V5KB 1WLHA 3RA7H 3LKSB 1AO7D 4N5EC 3AU0A 3KLAA 4UCFA 4PJ7F 2IALA 2QKSA 1CD8A 5CO1A 1CGVA 2DYSB 2ZAGA 4M1CD 2X3AA 3H7BA 4LQFH 1JXJA 4WSKA 4HWBL 2GITB 3E7JA 5KSUA 1W80A 5JHMA 4GRLB 2ZKMX 3CMOL 3V0EA 3UACA 3QK0A 4X0KA 1SUHA 3CZFA 1PQZB 1J5OL 3ES6A 2L0DA 2V17H 3QUXB 4YSTA 3UPAA 4JFFA 1AGBA 2V2WA 2A1WL 5KN5A 1RJZA 2NT1A 4OKDA 3RVTC 2X9ZA 5DMGD 2NUTB 5TK4A 5EU7E 4M5YH 4DAGL 4G3YL 5SX4H 5ACZA 5D7EA 5IF0A 1KDJA 2OX5B 3BDYL 4P2QB 5E8DH 3CDGB 4Y5YC 3HE7B 1USZA 2XVGA 1JF1B 1URZA 4ELMA 1IBFA 2VMFA 3QDMA 5DUPL 5TQ2H 2V8MA 1SEBB 3QJFA 3VE0A 1NLDL 1D2PA 4NKMA 1ZHKB 2AF2A 3QO1B 4KY2A 1AJ7H 3L4WA 3NN8B 5HGBB 1RK1A 5TPWH 1RVFL 4F9LC 3TS8A 4WWPA 3ZBMA 4GT7A 5EV7A 4ZYKA 3BGMA 1EBAA 4JM2C 1M7UA 5D7IE 3OKNB 5F70A 4XPTL 2EVIA 3EH3B 4L4JA 1BPLB 3RX8A 3VXQA 1S46A 2F2HA 5TQ0L 4N90E 3VFTB 3AGWA 4CL7A 1BX2A 2VUYA 1P7QB 5JPNA 4FP8H 3V0WH 3OKLA 2ESVA 2G3MA 2VDOL 4PTUA 3K8KA 4QXVA 3RA7L 2EIZB 4DETA 4E5XG 4HUMB 3AB0B 2BZ7A 2EYRA 3BP7A 2XBTA 2C26A 2WN3A 2XPZA 1PKQE 4UM9B 5F6HI 2EXYC 2OYKA 4NBYB 3WEAA 3WLWC 2WOBA 1NEUA 5GZOC 4B96A 5AOZA 5I1KL 3UFIA 1OAYL 2NPLX 2H3NB 4R7NB 2V17L 4FD0A 3AVEA 4GUCA 3CIAA 5E9DA 1UZ6E 5E8PA 4QEGA 1D7BA 3G6AA 3O8XA 4JCLA 4JPWH 4Q56A 5KVFH 4HKBA 5B39B 4M5YL 2XETA 4LOVA 1G9HA 2UZYA 4HWEH 3QUKB 5C09D 1HAUA 1JI1A 3S3BB 5KS9B 3L3IA 5E8DL 4EI5C 1W0WA 3MCG1 2HJLA 3AW5A 3HBQA 5JPMC 4UT9A 5EFIB 2YD5A 3U0TA 2E7MA 5EZLB 1GYUA 3CFJB 4XHJD 4DEPC 1PGRB 2ZCLH 1SHMA 3KYOA 3D18B 3P9MA 1V8HA 3AAZB 4MJIE 3DVFA 5BOJA 5ISZB 4XNBA 4LP5A 5AG9A 1AJ7L 2UXFA 3VVWA 4C54A 5EU4B 5TPWL 1T7VA 4NZ8A 3CVIH 2E7BA 2X5PA 3G5ZA 3LKNA 2BO0A 1HT6A 1KZQA 2WXQA 2XRAL 3BIAX 5DZ9A 3RUGB 3V0JA 1UJ3A 2C8NA 4PWFA 1OOAA 1CLZH 2X89A 5FX3A 4PLNC 1MFAH 3P9WB 4MNQA 4FS0A 1ORQB 4X7CC 1HU8A 3LKPA 4G8GD 4KKCC 2BSTA 1FV1B 4D8OA 1DANT 1H3WM 2ZSWB 5C0GA 3VI3B 5ES4B 1QSFD 4FP8L 3V0WL 1P4UA 4HPYH 5ELIA 5ESQA 5J6SA 4PJ9D 4WO4D 1MFBH 1OHQA 3WUWB 1TKWB 3BJ91 4KC3B 4XTRD 1LHZA 2VJ0A 4QRRD 3H6AA 5AVWB 1NINA 2UVFA 1SDAB 1ZHBB 3JWNG 4K5MA 5K39A 3WNKA 1JAEA 3CGTA 4NC1E 2PTUA 2J21A 1IEBA 3E6HB 2VLKB 1Q1JH 4QTFA 4UBDC 3GMMB 3OJMB 3ABGA 2CDEA 4FRWA 2AQSA 4EEEA 3ESUF 5I6PA 4L9DA 3SKUD 1G9NC 4POZC 2WXFA 3IDNB 4FX5A 4ZO9A 4HS3B 1MRCH 3L1EA 4Z7VF 1IGYA 5IK3B 5TD4A 1JD9A 4ABUA 4F2MA 3Q7JA 3EADA 2ZXBA 5DFWH 3MUHL 1FZJB 4DQAA 5JIDA 4Y5VC 3IGAA 3FRUA 4YHMH 4D0CB 4X4ME 4DSYA 5DC4B 3ARDD 2ICCA 3TN0A 4JPWL 5GRWA 3FHQA 5KVFL 3H9SB 2VOTA 1R24B 1N64L 2IXQA 3EYOA 5EIVA 1R3HB 2H0JA 1NCTA 2CR6A 3GD1C 2EE2A 3HZMA 4HWEL 4JM4H 5IESH 5IBUG 2Q86A 5ECJE 3AADB 4PCTA 1Q4NX 3BYTA 4A2EA 3IYLW 5I8OH 3MRFA 4ANUA 4Y16C 3GKZA 1G5AA 1AGFB 1NEZG 4MQ7B 1O6SA 1IL1A 3QEQD 5DTFA 3UMNA 2CXGA 4LLMB 3SPIA 2VITB 5E9NA 3M8OH 3QCTH 1P4IH 2XBZA 1BEYH 3QIBA 4Z7OE 3RY4A 3CVIL 3VXRB 5EPMB 2WIMA 3B9KB 2RTTA 2JELH 4Q52A 3L5JA 3VRJA 2OMYA 3LSOB 2H8PB 3LS4H 4IRSB 1MFAL 3EGDB 3GXMA 4JDEB 3HZKB 1RIHH 4AYFA 2AJSH 1SHXA 2FBOJ 4HJ1A 3ARFD 1TJGH 2V2XA 4U6HA 1ZWIA 1JF5A 1QTSA 3U46A 4U1MB 4HPYL 1JPGB 1MFBL 5EO9B 5BS0B 1H9VA 1UOKA 1GYWA 1JZDC 3QPXH 1XF5B 5LWYL 4OLWH 4G8EB 3D12B 3HR5B 1UXWA 3J7HA 3V2AR 1Q1JL 1TF4A 1H6TA 3VG9C 1TJIH 3MO1A 4Y0GA 3T65A 1IC0A 2WANA 1CFBA 3FONB 4O2CA 4U1NB 1JNJA 2ZYIA 4GSUA 4GW4B 4BSWA 1E7VA 3EW3B 3JTTA 2BFGA 1OTTD 4F33B 1MRCL 4PV1C 5T1KA 4U1IB 4ESKA 3PGFH 4ODVH 5FGBA 5EIIA 3ALPA 3DVIA 3K5RA 2G9KA 4Y4FA 4JO1L 4RVBA 3ZKND 4N2BA 4IBSA 3UO1H 4YHML 2VAAB 1V3LA 1Q0XL 2HT4D 2Q6WA 1MVYA 3G5VB 2P80A 4NENA 1AFVH 4UQEA 4WFHD 1LDPL 3OSKA 1I8LA 3VA2C 5IESL 2DI9A 4BXVA 5LKNA 1HINL 3FCTA 4WWNA 3MLTA 3O3DA 3X3GH 5EOTB 2VM3A 2YUZA 3Q6GH 4JFYB 5DMJB 2BVUA 3AZUA 4J8RB 3H42H 3ZHLA 2J44A 1NICA 4Y9FA 4AYBA 1T7XA 3BP4A 1A9EA 4EAEA 1U6AH 3QCTL 1T21A 1BEYL 2F6AA 4P4KB 4H8WL 4FQCH 3TZVD 5F96H 1OVZA 4MKMA 4CDHA 5CR8A 4YHPB 5FDWA 1ZJAA 4BK4A 5IJKC 1K85A 1FL6A 1UWXK 3BGFC 2F5BH 3LS4L 4IOIB 5DVLA 3RVVC 4IEFB 3T8VA 1VJSA 1QR1A 1TCRB 2AJSL 4XCCH 3WI9A 5JA8B 2XC8A 4OCSH 1IAOB 5AZ2H 3PHQA 3C6LB 4O02L 4MA1C 3N91A 4RFNB 5AB9A 3EDFA 1N6QL 2HFFA 3PWLB 3R4DA 4OLWL 3MQIA 1D5MB 3RUGE 2VRKA 4YPGB 1J18A 3T0EB 4X50A 3OC8A 2CAKA 5I1DA 4UI2A 4V2CB 1YYCA 1DVYA 1TJIL 4UMSA 1CGSH 3DV6A 3O81A 4LCCC 1IC7H 4PRIE 1XAKA 4RRPA 5C0CA 1LO5B 3NZUA 1YECH 3CPUA 2K70A 3X17A 3MBEA 4Q2ZB 2VZTA 3NJXA 1EEYB 1DBKH 3QWOB 3WFCH 1IEAA 4ADIA 4GBXC 3KH3A 3PGFL 5I8EB 2W9DH 3KPRE 5HYJB 4ODVL 4QRTA 2UZXB 4PGDB 1HILA 1RAMA 4UOJA 3UO1L 4TVPE 5K59F 4D9LH 1T83A 1DN0B 2YO3A 3PWPD 4JO2L 1H0DA 4O2FB 3G6JB 4XP4L 2OMVA 3D30A 4GP8B 3VXUB 4E9QA 1AFVL 4FDWA 1U2CA 4L4TA 4ZQTA 4MVBD 5CJXA 1J9SA 1ITBB 1R6VA 4KROB 4LASH 4DFIA 4D0BA 2UY6A 1IIKA 3QHZH 1BMZA 1DCEA 3FCUB 4UM8A 1T0OA 3MMEA 3Q6GL 3X2QB 5CLYA 1C5DA 4CN6A 2WY3B 4EUPB 4XNYH 1Y0LB 3H42L 1ZVYA 3GDBA 4ZZKA 1OAQH 3HNSL 1Z9SA 1I1YB 4NKOA 3OJVC 4JJOA 4GG6B 3R7RA 1SDYA 4FQCL 1VERA 1K3ZA 3ETSA 1SEQL 4RAVA 5F96L 4KKZA 2WXGA 3NCBB 4AUYA 4FQ1H 2A6DA 4U6TA 1A66A 3P3TA 5CD3A 2YLKA 4L1HA 1MW3A 1YMMA 4FHKA 1PD0A 1MJ8H 3C6SA 2R15A 2G4EA 2WMPA 4DO4A 3GGWB 4XCCL 4GW5A 1T20A 1I8KA 2A6JA 2BCKB 4JZNA 4OCSL 4OIFA 5AZ2L 4DESA 1JZ5A 4H2CA 1WGVA 2P43B 3WMSA 1I9RH 1QBMH 3BFWA 2ARJQ 2NMSA 2VIRB 3O41A 2HCZX 4W93A 3VFSA 3WJMB 5T1DH 4ZFQA 4JFZH 5IEKA 1QNIA 3KVDD 2E59A 4BH8B 5L9DH 2LGNA 4K5NA 2GIXA 5DD1L 3FQXA 4BFOA 2AGJH 2ADFH 3BFQG 2B15A 3UZVB 2OMXA 5LCVH 5CAYB 1IC7L 2DMCA 3OHXC 3ULVH 1YECL 3ZL2A 5C92A 3EYFA 5C6TH 2JK5B 1DBKL 3WFCL 2QTEA 5ID0A 4MXQD 2W9DL 4BZ1H 3DURA 1GC1C 1YDPA 3CLEH 4GIOA 4PWGA 1CGXA 3RX9A 1TZAA 1U8OB 2J8OA 2JJVA 2K9FB 2BY2A 4BH7B 5KW9H 3NEXA 1E5BA 2YEZA 4ZMTA 1KV3A 4IBZA 1D9KA 4JFPA 5I0VA 2PF6A 4J3OH 3BRDA 3KW7A 1A4KB 3B3BA 4WUUD 1INDL 1SVZA 1NC4B 4LASL 4Q14A 5CGYC 4ABQA 3QHZL 1QRNA 2A4CA 4WKXA 5AUMA 3SDYH 3ROLA 4M6OH 2W38A 3SDAD 2NY2D 4FNLH 1AIFB 3N50A 2WBJC 4R97C 5L2KA 4XNYL 5CU5A 1OP5K 1A7OH 4W9DC 4EN3B 4PLKC 4U31A 5EZOH 3SB3A 1MWOA 1FNGB 4KKRA 4PHZA 3A21A 3ZDWA 2XQBH 4I13B 1KBBA 3INUH 2YPLB 3ZE2F 3I3EA 3PHAA 4FQ1L 5B4MD 2LR4A 5I26A 5JLZA 3V0FA 1YJDC 4MASA 1T1XB 5F1IA 4UQ9A 2DY2A 1OXYA 2DWXA 1WWCA 1FORH 3QNZA 3TO4A 2DJUA 2AQNA 2BP8A 3D34A 4N2HA 3ZKXC 1HAWA 5L4IA 2X10A 2P5WB 4HEMA 3RWFA 1MCDA 3TEZA 3FB5A 2AI0H 3S96A 3B9EA 1DJYA 5KVEE 3UERA 5M95B 5T1DL 1EDHA 4ODHL 5C0AD 1O9WA 2DW5A 4JFZL 3BO8A 1JWUB 5ESAA 3DETC 1S9XB 3LH8A 3DO3A 3DMMC 2VN5A 3EJQA 2EIMB 4XMUA 3QQNA 4LEBA 4ZAKB 2AERT 2ZYSA 3JUYA 5C6TL 5D6DA 5IR1B 3CVHH 5GGQH 4UV4L 3S36L 1NANH 3LN5B 1I8AA 5BQDA 4BZ1L 5E8NA 4LOUD 3CLEL 3QBTB 2W9LA 4QRFA 1IFRA 4RCAA 4U1GC 2I25N 5F44A 5HJ3A 3BGAA 3BN9D 3OM3B 5KW9L 4RZKA 4Y1AE 4IBTA 4QYOA 4OFPA 3VH8B 2EJ1A 4TF4A 3ET9F 5C0BB 4U4BA 3T08A 3L3OC 2NY1B 4XMPL 1KC5L 5DEZA 2XBDA 1DDTA 1Q9WB 2BWQA 3MV7B 1WBYB 1YZZA 3SYPA 1NCUA 4M02A 4PTTA 4KX9A 5HYJE 5FO9A 3IN0A 3X1GA 1I7UB 3F7PC 3TTSA 1PX4A 4AJVA 4GY4A 3QO0A 4M6OL 2LT9A 1OCRB 2PCFA 4FNLL 1N5YH 3BVXA 3G5YB 4LVOC 4WWKA 1A7OL 4Z6AT 2R29H 5EZOL 3GMOA 3VXUE 4XP9L 2A77H 1PVHA 1Y18B 4K8RH 3WHXA 5BRZD 3HAEB 3KR3H 2DIBA 2XQBL 3QDGD 1ZT7B 4HUUA 4XMVA 5DS1A 5F71A 2ROXA 2PXYD 3NPSC 4L8SB 4M00A 2VR6A 4OAWA 5CKGA 4ONHB 3CXHJ 5C08E 1K8DA 2D31A 4YXLH 1CDBA 1FLTX 3D0AA 4F7TB 1MCSA 1FL3A 1XCQB 5DMKA 4B95C 4F5CA 1WE5A 4M7LH 3QWRD 3LRMA 1FORL 3SGEI 3N0PB 3W39A 1DQDH 1ZGLB 3DI3B 4CVZB 2AI0L 5J1AB 5HDLA 3VU2A 3NIDF 2KLRA 2Z6FA 4B9GA 4AK2A 4LSTH 5DJ0B 3GJFB 2K3HA 4LPCA 4P9HH 1P2CB 4FQPA 2Y7MA 4G7RB 1DQQA 1M1XB 3H54A 3FN3A 5IT2H 3RPIA 4BD4A 2RAMA 4LU5L 3JV5A 3H4HA 1U8HA 1GOFA 3ELAT 4EO5A 3UIZA 3R18A 3KWVA 1E65A 3NEOA 3CN0A 2WQUA 2V33A 5JUEH 1NBVH 4XH2B 3ZQ9A 3MLZH 4PS8A 3CVHL 5GGQL 4XCYB 1KTLA 3CQFA 2LABA 4P2OC 4FL4C 4EZLA 1OK8A 3L3KB 3Q2NA 4UTCA 5BW7A 1YEEH 2BSEA 4JK0D 3HCVA 4JG9A 2A4ZA 3MV9E 1IKOP 3QC6X 4Z78A 4YDVA 1U3HA 2GJZA 3I74A 5EU7C 1I3GH 3H2QA 3DDFA 4EDWH 4NQCA 3O2DH 4IMKC 5IKCA 4A6YH 3ZE0B 4Y5VB 2VQUA 3PQYD 4WWID 5E5RB 4P04A 4UDUA 3OMAB 4PVMA 5K9QI 1TTUA 1AGCA 3CZUB 1U8IB 4ZO8A 5CN2A 1GIGH 5IVXA 4OUUA 3VB9A 1KYOK 4I8DA 4QYAA 1N5YL 5CZRA 1DBJH 3IDIA 4GP5B 1O9ZA 4Q6KA 5AVSB 2R29L 5J13B 2P5PA 5GS0D 2A77L 2WW8A 5JMRA 4K8RL 5GS3A 3SQBA 1A7NL 3GKWH 4JQVA 4FZ8H 3CZSA 3SIKA 5HYQB 4LQ1A 1MFDL 4H8UA 1NSNL 4YXLL 4DGIH 1IAIH 2TRYA 2R2CA 4C4KT 4WTZA 4CMHC 3UC0L 1PNDA 3EIFA 4FXGB 1L6ZA 4WK2B 3VXPB 2EUXA 4AL8L 1DQDL 5F89B 3S5LA 1G0XA 2DEWX 4WGWB 3CX5J 2C3VB 5C07E 5EG6C 2EDDA 1BVLB 1FH2A 4XGZA 4XE0A 4BFNA 5D93B 3QJHB 4GS7B 2P52A 3NRFA 4LBEA 3QS3A 5IT2L 2AK4E 2OSXA 8FABB 3V4PL 1SMOA 3VRIA 3IMSA 2WAQA 5DZLA 2H0EA 2DQTH 2XVLA 2EIJB 5JUEL 1NBVL 2JXMB 3IU3A 3MLZL 1LO2L 3MOQA 3S8FB 2BWIA 4GAJL 4AX3A 4TQIA 2NY6C 5C9JA 2EXTA 2KZKA 3UP1A 4MQSB 5JZ7D 1YEEL 4KK8D 5I73B 3LKOA 2ROYA 3QDAA 4LL1A 2MCMA 4AM0B 5CKAA 3UZQA 1QZNA 5FO8B 1PLBA 3V7AG 4F37K 3G9VA 4BDVA 1JGUH 1I3GL 3ZYZA 4QR7A 1K4DB 1JPST 3ZMRA 1X5MA 2HFGH 2X4TB 4E9TA 1MN4A 4WI3A 3C60B 3RJQB 5FM8A 1A7QH 3EHBB 3D06A 2UV3A 5IV2B 4U1SB 5DGQA 1GIGL 3QQ9C 2FWUA 2A6KB 5ETUA 3SGKC 4BEIA 3PHOB 5IP4A 5DEGA 4UQ2A 4GRWB 1UA7A 4P49A 4Z7UE 2GYSA 1H5BC 2F19L 2IPTH 1DTUA 1JK8A 4TUKH 4FZ8L 2J6EH 5KSAA 4ZTEA 1MHEA 5C6PB 4N0CD 5HHQA 4G5AA 3WO4B 1L5GA 4HA1A 4DGIL 1IAIL 4OFKA 2ZPKL 1KCBA 4MA3B 4DO5A 1J0HA 3NRPA 1BZOA 2G2RB 4P46C 5GZNA 3U0PA 2JQAA 4YNYB 4N8CH 5ADPL 3K6OA 3X14A 3SE4A 1BFVH 4KX7A 2EXWD 3FTSA 1BXUA 4XHQA 4D9RD 2VDKH 3UBXA 3IU4H 5CBEB 1VESA 3ZHDA 2X1QA 1T3FA 4ZUSA 4L3FA 4NC1C 4WFED 4IRJB 2C5DC 3C75A 4ACTA 1I4FB 1WC7A 5BZWA 3VB8A 2WQSA 3WXWH 5IMLB 4BA0A 1TOXA 1WYJA 3EJSA 2DQTL 4LOFA 2AEIT 4PH8A 3NDYE 2CR0A 2WLIB 3GXUB 3BKYH 5DO8A 3B1TA 4LSPL 4AT6B 4YOKA 3HBGA 4I89A 4GQZA 4PBXA 2QFRA 1MELA 3VFOB 4D9QD 2KZBA 3KMDA 3FO1A 1KB5A 4JFHE 1N68A 4AEHH 5I76B 3TNMA 1PD1A 5FA4A 2AFNA 1BZQK 2F54B 4HJ0D 4GBXB 4GSDH 1I3RB 3UPCA 5B38B 4G11A 2Z35B 5E70A 4K0OA 1HH6A 5JNYA 3FNKA 5E2UH 3TASA 3HI5H 2CE6A 2HFGL 3DYOA 3JV4B 4P3DA 5JQHC 1C08A 1BVKA 2QSQA 4LKXB 1ZA3A 4N87A 4XX1E 1AZUA 4PRNA 3SYQA 5JHBA 4FQLL 2HH0H 4A7GA 4DUWA 2VYRE 4KH9A 2BPBA 2IPTL 3PWJB 1GY2A 4KMTH 2F53B 5I82A 1SYVB 1FJ1A 1FVEA 5A40E 4TUKL 2J6EL 1RUKH 1KT2B 4FA6A 5C7XL 5B3JF 4G42B 5CP3A 4GW1B 2OBGA 5IVXF 1OB0A 5AQ0A 1OP3K 1UZ8A 5ECGA 2YRPA 1G1OA 4L48A 4N8CL 4YE4L 1ZTXL 4IDJH 1G7HA 3LJ3A 5KYUA 2IPUG 3GSOB 3WFHA 2AXWA 4ZNEA 1F97A 2JCCE 2ZWKA 4HHWA 5HGAB 2J1WA 2VDKL 3V79C 2L04A 3IU4L 4RZCA 1RMFH 2X70A 2Q87A 4DP4X 4ZI8A 1SZNA 1C5BH 4N6QA 4Y4HA 3B5GA 4DVBB 3DHJA 1RLBA 1F4HA 3CBKB 3WXWL 4GAAA 4OCYH 5D1XA 1DVFB 2P24A 4JO5A 3ZN6A 4IIZA 4DPRA 1ID5I 3VI4E 1YY9D 3BKYL 1F0LA 1JZ7A 5HI5D 2XWBA 3TN0D 3FFDB 3UXFA 4C4UA 4E9WA 1JRHI 1OY3B 3GLDA 1G7PA 4M4PA 4F2EA 4YS4A 1CPUA 4JZJC 3HFMH 1QWUA 4AEHL 3ILQC 4HIIB 2GJ6E 4CC4A 3AS0A 3CFMA 4GSDL 3KPPB 3PGDA 1WAPA 3R0NA 4NAJA 3C9NB 2WVVB 5A2BA 4R96B 3D3VD 2BVQA 1MOEA 1QBLH 3KW8A 2CHWA 2CU9A 1AZRA 2P9RA 5EEVA 4P3WA 2ZAHA 4U3HA 2CNZA 2A0LC 2J1KA 2QHRH 2B3RA 4LVHC 4XOAA 1F8TH 3ZT5A 4OZGE 2HH0L 2B59B 2P8LA 1WHOA 2EO1A 3LS5H 3WN5B 3IAGC 1XL4A 4OSUL 5T1LB 4BCXA 3ASNB 1LE9A 2YSSA 1O0VA 2N0KA 4I0PB 4K7PX 4KMTL 4UDTB 4LP8A 1CL7I 1F86A 1RUKL 3CU7A 3UGXA 3ARXA 4NN6C 5AAWC 2AJ3A 3KPLA 1ES0B 2J1YA 3RY6A 3M6DA 4PJHB 4M6ML 5E1IA 2FECI 1TQCB 3APDA 2Y36H 4A2MA 2EDMA 1AQKH 3KXFA 3FQWB 4IDJL 5HDBF 3QUYC 4J27A 1Y6MR 1SLXA 1BWWA 3MRRB 4DN4H 1SN5A 1N0LA 4HJEA 1OGAB 1JHLL 4OQTH 4AOFA 2ZWYA 2JTDA 1RMFL 4KXAA 5FYLH 2UY7A 2BLFA 3P77A 5CMAA 3A4EA 2G0KA 4YFLI 5HGHA 3ZPDA 1C5BL 4ZPVB 3HB3C 2OMBA 3NABH 3V6FB 1A47A 4JQXC 4M43L 4GAGH 3MRHB 2JJWA 5T1KD 4S11A 3KM2A 2QV4A 1BIHA 2Z91A 1B3IA 3AWFA 4OCYL 4CN1A 5CBAB 4HISA 3FS9A 4K23L 4RSYA 1MCHA 4HPHA 3MLPA 3O6FB 3LQAC 2ITCB 1MHCB 3P4LA 5E6SB 43CAA 2EVJA 4NUPA 5EC2A 4KJYA 2ADJA 1XGTA 2XXGA 5F7FA 2E75C 3C5ZD 1LE5B 5DT1L 1F4AA 3RPKA 1B4JH 4Z7WE 3FZUD 2C9VA 1AQHA 4FG6D 2W59A 3RGVA 4OLZH 1SJHA 1XV8A 3EUDA 5EORH 4WV1C 4APQB 1IM3D 4PP1C 5FIEA 5BQ7B 4NO2B 2JKNA 2IGFH 1HHIB 3LQZB 5IB5A 2M1KA 1KIRB 3FPYA 3K6SA 3T3PE 2V7NA 1TVHB 1HEZA 1VFAB 1PLGH 1QBLL 2P44B 4A2HA 1C1EH 4MB3A 4X6DA 1UASA 4CADB 4X6EB 3WSQL 4L4VE 2VISB 4YR6A 4Z77B 3QGVA 1GJWA 4HC1H 3EJYD 4P5TC 2BFVH 4LCIH 3HUJF 1VENA 1XBRA 3FF7A 1ZLVK 1MVUB 1MIMH 4L5FH 4PJAE 3OAZK 3LS5L 5TE6L 4XCEA 3U36A 1Q9OB 3JWDC 3TPUA 4JHZA 4XXCC 2VERN 1RZJC 3NIFF 4FG4A 2HLFD 4AGMA 1KTJA 5FLUA 1WFIA 3T4AA 3U7YH 4OF5A 4NQDB 3SE3A 4XX5A 1KCSH 4PJGB 1J8HA 3W82A 1IKFH 4NQED 4AEEA 3F12A 4KRLB 3U6XA 1R33A 2Y36L 3DIFA 4MNHA 1AQKL 5EBGA 1HFUA 4ABWA 4A7GF 3BHBB 2YJQA 4WNQA 4P2RA 1H3PH 2YEQA 2BHFA 4DN4L 4Y4KA 2F53E 5CUSL 5ERWA 1XGPA 2WWMC 4L1BA 5TDNA 4OQTL 5FGRA 3FOMA 2RB8A 4IMLA 3B3IB 5IG7A 5I1AB 1A2YB 3OR7A 3EOAA 5IW1A 1D5RA 3NABL 4QRPD 4U1LA 2F8XC 1EIBA 2DKSA 5MEPB 4DKEH 5JOFA 4G9FE 1Z0NA 1LEIB 4P57A 3OXSB 2X3BA 3HC2A 3PJNA 3O3AB 2JKXA 3RL1A 2HLAA 3GI8L 1NIAA 3CZGA 4GMTH 3W2DH 2J8HA 3AC0A 1B4JL 5B8CB 3CIQA 3S88H 2VWEE 1BLIA 4N2KA 4OLZL 5EORL 3RI5K 3DOSB 3F8UB 4DOHB 4AJ0A 4HUVB 5LNEA 4QRSA 1ODAA 3FSVA 5E56A 4IKNA 3DHUA 1W72L 4MB4A 5ANMA 5J4MA 1M05A 1PLGL 1AD9A 1BAGA 5J3HD 1JE6A 1TITA 4ALAH 5T3ZD 1ZKAA 1FL5A 1ONQA 2FJFB 3B8SA 2OJEA 2F7RA 4JHWL 4YSUA 2L8AA 2FQEA 3QDJD 4HC1L 3DO7B 2BFVL 4LCIL 4MD5A 4DP8X 1R17A 1UC6A 5AENA 3AXHA 4HMDA 1JERA 1B2WH 1FFQA 1MIML 2DICA 3FJTA 4L5FL 2APTA 2BS71 4H5SB 5GSRB 3A22A 3I6GB 4GKZA 4PUBH 3NCXA 3CQPA 1ZAGA 1TTBA 3ULVE 2K7QA 2XN9B 5HVHC 2UWEB 5FLVA 3DYMA 2BHUA 3U2SA 3VFRB 4RQQB 1S7QA 1IKFL 4MCYB 4HH9A 4CDGC 3OG4B 5KJRH 2AVFA 3D2UA 3K2KA 1ZLWK 2Q8BH 1CXKA 1H3PL 2QTVA 4CILA 1XZ0B 1EJOH 2XV3A 3IMTA 4ANWA 4MQXD 3LIUA 4YDJA 1JZ8A 2WXHA 3WL9A 1GXEA 1N59A 4ZMWA 2AJUH 3WV0A 4KFMA 4U6XB 2W65B 1ETZA 4BSVB 1SXAA 1ZVSA 4J4PC 4DKEL 4RISH 4OIAA 3P40A 1C16A 1UH3A 5CWSA 4FEIA 4AE0A 4G7YH 1AXSB 4WEBL 2OSYA 2IMMA 1AKJB 1QSZA 1U8PB 1FVDB 2ZIDA 3W2DL 2HG5A 4CBZA 5KZCB 1CT8B 4JFVA 5E94B 1JDCA 4J39A 3HC4H 3IMRA 3QEHB 4FC3E 4GQRA 4Y2DA 3BWZA 1AQ8A 3RWHA 5I16A 4PJ8D 1HOCB 3DARA 2Q7YA 2WZPA 1QA9A 3NFNB 5ACMA 1GYAA 1U58B 4ALAL 5I18H 5A43C 2SEBA 4TYUA 2OJ1A 1L0XA 3CZLA 2Y69B 3SCMA 4HULB 3MU3A 4FNPA 4M03A 1B2WL 4PRHE 1MDAA 2O61A 3FYEB 1P84K 4AW4A 2FJGB 1XB3A 4L9LC 2CJSA 3IGUA 4OCRH 1X7SA 3KYNB 2DQJH 3RWJA 3C8DA 4PW4A 1QFWH 3SDXE 4H13C 4PJCE 3NZ8B 3RVXD 4X6DF 5KVMC 1TYRA 3HIZA 2OL3H 1FLRH 4JEGB 4PY8J 4CKVX 3HN3A 3GB7B 1ACZA 3KPOA 3P0VL 1OF2B 1E40A 3TT3L 2Q8BL 1DJHA 1EJOL 2DBLH 2NNRA 4OM1L 2BP0B 1QEWA 1ZV9A 1U8LB 3PABA 2JB6A 1SJMA 4U3XA 1VDGA 2DMKA 1WD9A 2AJUL 4I18C 3J27A 4GB9A 1QUPA 3B6SB 5E1AA 4POUB 1MZYA 3K3QA 5DVMA 3W0WB 2D3NA 4FQIH 4HJJH 3WFBH 4RISL 4DO6A 1R3KA 1N3NB 5I0WA 5C09B 3RDTA 3ZX1A 4LHUB 4WNSA 5DK2B 4I7ZC 5BV7C 1NJ9B 3QARA 2M26A 1M9WA 4G7YL 3PWUA 3CZEA 3MUY1 2EVGA 3WAJA 3QULA 1J87A 4KRMB 4NO0D 1IE4A 4XI5C 1TU2A 4M7JL 4WRLA 2KDYA 3TV3H 3WLBB 1HZHH 3ZRFC 3KPNB 1J10A 2PYEE 3HC4L 3IETA 3Q2LA 5K69A 2EE3A 3HFFA 3P02A 3BQUA 2OLDA 1XH3B 4UIKL 4NZDA 1T5XB 3KPSE 3LRSA 4WWKD 1ZDQA 5D1ZD 5I18L 4PJ5A 2X4NA 1XR8B 1JF6A 4MCZA 4XODA 3UTTE 1ULVA 3KYMA 4OIIL 2CLZB 2VXSH 4S0TD 1FN4B 4D3CH 2WBWB 4F7PB 1AP2A 4BFKA 2F5AH 4WO4B 4FFVC 4Y7OC 1AR1B 3KVQA 1RULH 2VDNB 3R8BB 2H32A 4OCRL 4C55A 4BELD 4HAGA 4E0RB 1UKQA 2DQJL 1LD9A 4N25A 2MCG1 3CFUA 3TCTA 3IFPB 5IIEB 2PR4H 1UB5B 3PAYA 1N8ZA 2FLMA 4OZ4A 4P5MB 5F7MC 1NFKA 3QJRB 2DQMA 3BZ4B 2EC8A 3V8OA 2F8IA 1KCUH 2OL3L 1OSEA 2HVKB 3O0RH 1FLRL 3PY9A 3TOPA 5IEHA 3TBVA 4OLUH 1PKQA 2HT2C 3EFOA 3F83A 3IBEA 4GKLA 4NNXA 4OZHE 2JI3A 2OTWA 3ZE1F 4KJPC 5FECB 1NH6A 3QJSB 3HZYA 2BNUB 3D50A 3L7EA 3A6CH 3U0WH 5CD5C 1AO7E 2ZSVA 4X7EC 2AQ1A 1M7DB 1GZHC 1J8SA 3VNYA 3DIDA 3NT0A 5IVZA 1MFMA 5K9OB 1JZIA 1WK0A 2IIJA 5EZJA 4BSJA 2DIAA 3B37A 1ZPLA 4FQIL 4FFYA 4HJJL 5AWNL 3WFBL 4YK4B 4L1DA 3EO0A 2WJ7A 2Z31D 3FO0H 3ZGHA 4HK0A 3T77A 4KVNH 5AKRA 4I1PA 2HFEA 2ZG1A 2YC1A 5DQDH 1B4TA 3RX5A 1MW0A 3DX8B 1E4WL 4JRWA 1G0DA 3QEQB 4MQTB 1NMAH 3N0AA 3DHMA 5CZKA 2AQRA 3S98A 5I1EH 1J9QA 1U92B 3LB6D 3W9DB 3TV3L 1WT5A 2M8XA 1U8QB 2DRUA 3I6KB 1F4XH 4ZMOA 4OJEH 2WC7A 2E6PA 3MNMA 2ICWJ 3LEVH 3NFPB 3N43B 4GLRI 4LHJB 1H5BA 4TNWK 3TIEB 1LO0L 1E8XA 3L3JA 5DJZA 2XFXB 4CSSA 2WK2A 5C0EA 4IS6A 1PZDA 1A3LH 3ZDZF 5DEFB 3OB0H 4MCNA 5C6WH 2N7BA 2W9EH 3GSWA 4X7TB 5JHDB 4JE4B 1WZLA 4R26L 3GSNA 4QHMA 3T2OA 2VW7A 2V5MA 2VXSL 2YJLA 2G5RA 4RMWA 5ESVB 4D3CL 4YBLC 4HKZA 2IGLA 2EE0A 2F5AL 4QTHA 3UJIH 4R0LC 3P73A 2R0WH 2A74C 4KRPC 4I48B 1RULL 3T4YA 3DPBA 3ILDA 4TLSA 4QTIL 1OE2A 2D7QA 4KNSA 2GKIA 4DP6X 2PP8A 4WFGD 1JL8A 2WXIA 1YUHB 4DGUA 4RNRB 3TCLA 2PR4L 4QMEA 3LKQB 4BA8A 3KLKA 1ILUA 4JHVA 1U91B 3RLSA 1KCUL 2GT9A 1Q9KA 5IW6A 2WUBH 1ZANH 4ZFOL 4ETYA 4Y5XA 4PRPB 4PWKA 3CFDA 3J07A 3U4EB 3AROA 2Y1AA 5KG9B 3FTZA 5CR1A 1KF9B 4KUCF 3HI1B 1RJLA 1NCDH 4OCXH 3V5KA 3MBWB 1B88A 3LKSA 3EF7A 1NUFA 3BPLC 3FBQA 1U8KB 3MBXH 3IFNH 3V4VB 3BAXA 4HETA 3ENEA 4F3FB 3RZCC 5KVGL 4WHDA 3US0A 1ZT4B 4YUEH 5T3XL 3L9YA 5BZXA 1QFWM 2BP3A 3FO0L 4MKTA 3ISWA 4GRLA 3RWCB 4KVNL 3L8QA 4CBPA 3ESNA 4JRXD 2WQXA 1PQZA 4RAHA 3BZEA 1NMAL 3QUXA 1KYFA 2DKUA 1ZLUK 5I1EL 3H8NA 5MEQB 1UJTA 1AHWC 3ZT7A 4XXWC 3KCPB 1JOIA 1SJVA 1WCBB 3LEVL 2NUTA 3O3BA 1KACB 3TZVB 1YEHH 1FYTD 5B7FA 1QI4A 2ZYRA 2EC9U 2DWDB 1A3LL 4PJIB 2G2NA 3CDGA 3HE7A 1IGTB 2W9EL 3IDMB 4IRZA 1JF1A 1TZGH 1I1CA 5IB1B 1J5DA 3A4DA 3L3HA 3IAPA 1SEBA 5DFVC 5KSAD 3BH9A 3B7YA 2NNXA 1XTMA 1ZSDB 3CE1A 5H4ZA 1ORSB 3ROOA 1ZHKA 3QO1A 4O51B 1BCIA 2V0AA 3F3HA 1J0IA 3NN8A 3QXDB 5DJDB 5SWZD 3ATFA 2WVUA 3UJIL 4EF3A 2OMUA 5HGBA 3BEWA 3LOWA 5FV2A 5GZND 5SWQB 1QPPA 3I84A 2IFGA 2Z92B 3ZQWA 1BFOA 3OKNA 5D4JA 1LEGB 5D7IF 5TGBB 1JZ6A 3WMPA 2CJUH 4EQ3A 2HRLA 3VFTA 4G8GE 2OAAA 1RQ5A 2DN7A 3CPLB 2WUBL 1ZANL 1L3NA 3IJEB 1P7QA 1QSFE 4EI0A 2I07B 3GTTA 4BKSC 2XTJB 4EIGB 1EUTA 4QRRE 1F2XK 5KVDL 1KJ2L 2WM0A 2CUMA 5AB0A 3UOAB 5IGXH 2YRZA 4TM9A 1FO0H 2AXFA 1HNFA 5EEYA 1KB9J 4OCXL 2MOGA 4DNLA 2UZIH 4W9LC 1E90A 3EUUA 3HS0C 3VFWB 1P4LA 3FQTB 4JZJA 2CXKA 3MBXL 3IFNL 4JKWA 2NZ9D 2GIMA 1WA0X 4PJFE 4D8PA 4UM9A 4YUEL 2EDQA 1RCYA 1NGWB 3EJTA 4YHNB 5IFAH 2KQMA 2JMRA 1OE3A 3NJVA 4P05A 4S1DD 4R9HA 3KH4A 2JLLA 4P99A 3TIDB 4R7NA 2F15A 1UH4A 5I75C 3T2LA 3IDGB 2QT6A 1CN4A 5B22A 3DDGA 5BZDA 1UZ6F 4UV7L 4CJ1A 2J8UE 4ZS7L 3VW3H 5B39A 3DX9B 3BIKB 5H37A 4PGJA 4HOZA 5F7EH 1T6VN 4U4IA 3K46A 3S8WA 1S9KC 5KS9A 2OZ4H 1ADQL 4ORZC 4ZX3A 1MLCB 5IQLA 2NLJB 4X6CB 1KFGA 1TZGL 4AYDC 2Z1KA 2UX7A 5DU7A 4DZBA 3CFJA 5FC9A 3F04A 3UAJC 2KYIA 1LO3L 2VMCA 1QYGH 3D18A 2CO6B 3AAZA 5ISZA 1XIWD 1R0AL 3L4ZA 3QUYA 1OTSD 1WTLA 1EXHA 1PNCA 4MJ2A 1CDHA 5GGTA 2YPVH 4Q9BA 3GSXB 3RUGA 3TTYA 4LLUB 5FYJH 1IB5A 3RIKA 2CJUL 2YXWA 3LIZA 4O2EA 2MOQA 4ZXBC 1ZA6B 3BKCH 2KZWA 2N0MA 1FV1A 2AV1B 3W81A 5IMOB 3P9LB 4GMSH 2QBWA 2ZSWA 3U30C 3VI3A 2NQ3A 4AGNA 4RFEB 2BIQA 1LNUA 2YZ8A 4Y4HD 5B3SB 1WV7T 3WUWA 1O5DT 1TKWA 5IGXL 1S9VA 1DE4B 2IDUA 3UTSB 4OAWB 3RI5F 3KPRA 4MMZB 3CFEB 1FO0L 1ZHBA 3VWKD 1EZUA 2J5LB 3HRZC 2UZIL 1TZIB 2VSKB 4FYRA 1HHGB 3E6HA 5GS2D 2CNYA 1OAXH 2VLKA 3GMMA 4L3CA 4DK3A 1B6UA 4WAFA 4UTBA 1KG0B 5SX5H 3A6BH 3W11C 3MGTB 1ZRUA 1DLFL 2HRPL 2H6OA 1KXTB 3IDNA 3V5DB 3O4LB 4HS3A 3ZUCA 2D0GA 5IK3A 2XNAA 3CU1A 1A6ZB 3QZNA 4QKXB 5FGCB 3Q8BA 4DK6A 5IBLC 1FZJA 1L0QA 3EZ8A 3MFFB 4BQ9A 3GLEA 3ZVVA 1A9BB 1N12A 1NBYB 2IOIA 4J7RA 2FLRT 3L5WB 1RZGB 4BBWA 3K5SA 4XXDB 4XN4A 4WFHE 3VW3L 3EAKA 3H9SA 1R24A 3K8LA 2HTLC 3PP3H 1WZ1L 3CZNA 4MDIA 4W9FC 5F7BA 2FJSA 3OGCB 3G08B 3SBWA 3WU1A 2ARWA 2EDTA 3IMWA 2OZ4L 4IBLT 3T0AA 5J11B 1AGFA 2VLME 1CXLA 1DJSA 4MQ7A 4ELKB 1BW8A 1LP9B 2WYHA 5FYLE 5PCYA 3AY4C 4MLSA 4LLMA 3FB8B 3LNHA 1M57B 3QUZA 3BLKA 4HIJB 4Y1SA 4J28A 4J6IA 3FF8A 3FT4B 4APXA 4B9IA 1KB3A 4Z7OF 5EPMA 2YPVL 3I6SA 3E1ZA 2LU3A 3LSOA 1XEUA 2H8PA 5TH2B 4IRSA 4ZTOH 1A0QH 4MZ3A 3EGDA 2FBJL 3HZKA 3BKCL 4JE0A 2NY4D 4HJIA 4GMSL 4U1MA 4BZYA 1KPUB 4LMQE 1JPGA 1C8QA 2LLGA 5EO9A 1J8KA 1MJ7H 1T66D 4N3TA 2K9UA 4AW7A 1XF5A 3VD9A 1CE1H 2BP5M 2HT3D 3HR5A 4HLJA 3FC8A 1OAXL 4R84A 1IAKB 3GMPB 1KNOB 3FONA 2XX0A 3K6IA 4U1NA 3A6BL 2X05A 4GW4A 2OMWB 5C86A 2APWA 3LXUX 3QI9D 3MRLB 4U1IA 3GHBL 4U1JB 2VDRH 4YDNA 3ARBD 3ARGB 3E2HC 4QGYA 3PWPE 2E7LC 2VAAA 3M1BB 4U6YA 3MROA 4J3UA 1CLVA 3QDGB 4GO6B 4TSBH 2GEQA 1E4XI 3DIVA 1KMGA 3NGBB 2BOBB 4FXKC 1I1AD 2WKOA 1BREA 3BSZH 4JFYA 1RERA 1HEHC 5IROA 4J8RA 4BCYA 4BFRA 2EEBA 3FSWA 2A6IA 4Z8FH 4LIQE 1KLGB 2VDOB 2K45A 3SDDC 3WIAA 1J8HD 4QOKB 1TJHL 3VWJC 2IOMA 3ULVC 3LZOA 1O7SA 4YHPA 2E47A 2JJUA 4MBRA 4DPAX 4Q74A 3JSSA 1SOKA 1A0QL 1CE6A 2NY0B 4RDQG 4IEFA 4Y4KD 4N28A 2ADYA 1AGDB 1TCRA 5LNGA 1B0GB 1BIIB 4FHBD 4LEEA 3ZDYB 1IAOA 1YYLH 1G9MH 1LJMA 5FYJU 3C6LA 3KLSA 2C9SA 3UEQA 3P54A 3T6VA 4N8VA 4P23C 5G2NA 5LB1A 5HYIA 5I0YA 1MJ7L 4PS7A 3PWLA 4MAUH 2F1EA 4P2CG 2GAZB 4J3OC 1HOEA 1JFQH 2O26U 3QORC 1CE1L 1D5MA 3T0EA 1R3JB 1BQ5A 3RUGF 1L9MA 2BRQA 3OKEB 1TG8A 5HVFB 1JYXA 1E4JA 2EIKB 2GVYA 4XVOA 4HIPA 4HUCA 3RX7A 7PCYA 1CI3M 1LO5A 2XWXA 4HPOH 3GEFA 3TNNB 5DHMC 3VI3F 3FXIC 1S7TB 1EEYA 3QWOA 1JNLL 3RU8H 3IK2A 1QO3B 1ZHNA 3IXTB 5HYJA 5I8EA 3N2JA 3WY3A 5MENB 4MDJA 1MFUA 1X7QB 2UZXA 2VKXA 2ZXAA 3FQNA 4NOBA 4IU2B 4OFYA 1FAIL 4PGDA 2ZOLB 3I50L 1Q9LB 3K2MC 1EEZB 1DN0A 4O2FA 3X3FH 3Q06A 1DO6A 3G6JA 2ED8A 3VXUA 3GK8H 2Y3NA 4HKJA 2OFQA 2FQFA 3VFNB 4PLOB 3VMNA 4EXPX 4WUUE 3LNIA 4TSBL 4NN5B 2H26B 4HEPG 3IJHB 1DBBH 5T33H 1XGUB 3NQIA 4U7MA 3BSZL 5L6YH 4GSXA 3ME0B 3ZLQC 2VSMB 3ASOB 4EUPA 1ZS8A 4XN7A 4I0CC 1AG0A 3ZO9A 4JHUA 4OD3L 1I1YA 2B5IB 1WP6A 3THML 4GG6A 1X4ZA 3W5MA 2H0FA 3OX8B 3LNEA 2ODIA 1CXFA 3W56A 4FI8A 1MAMH 2ZKYA 2B14A 3D2UD 5I1LB 1CMOA 3HHSB 5F8QC 4R0LB 5JDSB 1LP9E 3A67H 4DP0X 5L0QC 4ZUVB 4NCC1 1DL7H 2CKBL 3QDHA 4A2GA 1AMYA 1G9ML 3CAFA 5C8JB 3QFDB 2VIRA 3QUML 2WQAA 3Q2VA 3KWUA 4PJDE 4Z5RB 4MD4B 5C0AE 5EEXA 3WJMA 4N2GA 2N7AA 1UQSB 1JFQL 1LEKB 4U2ZA 4BH8A 4OV5B 2J72A 4M7LT 3WY1A 4QI3A 1QW8A 4RGNB 1B0IA 4HSCX 4W1TA 2VGLM 1BF2A 4WEMB 1ED3B 2ZICA 3UZVA 5EWIH 3OKYA 4IGBD 4K4KA 2V5YA 3F84A 3LPWA 1RZ8B 4HPOL 4NWUH 4FABH 3O3UN 3RTQD 1J5CA 2E0PA 2JK5A 4DGVL 3RU8L 4FCHA 5DWPA 3KAAA 5I15H 3UDWC 1CF8H 5ILTH 3DUHA 3GINA 4K7FB 5CGBA 5E6IC 5ITBH 5I5JA 4IIQC 4UB0H 4V1DD 1U8OA 5EA0H 2PWDA 4BH7A 1F6LL 3X3FL 2H2PC 3LD8C 3ARED 4AEFA 3GK8L 3ERXA 1J86A 1CZ8H 1EAJA 1TEFA 2F74B 2IMNA 3JQOB 4OLEA 3SCMD 1A4KA 2DQIH 2PETA 3MV8B 2E27H 3WJJA 3BRGC 1RZPA 3F7VB 4H44C 3ULUE 1NC4A 4X8JB 4K94H 4W9ZA 3K4DA 1D5ZB 5DJ2B 5D7SH 5CCHE 1WRFA 3H55A 4ODTH 4P9HC 1AIFA 4AQAB 4PJEE 5J12B 3BAJA 4HAFA 3RTLA 4EN3A 1AD0A 3I02B 2Y5TB 3NA4A 5C07A 4BK5C 1FNGA 5BRZE 2WQRA 2E9BA 5D55A 1A8JH 3PJLA 1MAML 3DOHA 1NQBA 2YPLA 3CC5B 5D2LE 4TSCH 1OSZB 2FT7A 3QYNA 4PN6A 2AK4A 1SUJA 2WKOF 4RRPM 2PWEA 4FQXD 5D96B 2CUHA 3S0PA 3KLHD 1TO5A 5F6IC 2EH8L 1XSOA 1DL7L 3CFBB 5BO1H 5T5FA 4QHKJ 4FYTA 4GFXA 2XPGB 2E86A 2ARJA 2FWSA 2IWEA 5JHLL 1TTRA 1ITCA 2FLBT 4AQ1C 5CN3A 4I2XB 5C0DB 1S9XA 5I30L 4KXDA 4HIEB 3KCWA 1T7ZA 3DSFH 1DSYA 3KS0H 4NO5B 4JMNA 1TPXB 4KMLB 5T3XD 2CD0A 2CH8A 3B7TA 3T1FB 4ZAKA 5EZIH 4FABL 4LDEB 4K71C 5IR1A 5AW7B 4E5XB 3JYBA 1S3RA 1E9OA 2NW3B 2ADGB 2FJHB 1R5IB 4H1LG 4TRPH 3POHA 2CRZA 1WA2X 3FO2A 5C0RH 3BQUD 1JD7A 3ZL4H 1GTFA 4NP4H 1CF8L 1KXQE 3NDZE 5ILTL 3WIIH 2H2SD 5ITBL 3K6NA 1XEDA 4UB0L 4LP4A 1JV5A 5DMGC 5EA0L 2J2ZA 3ZXAC 4ANVA 4Z7UA 3OBAA 3VH8A 1WS8A 2QLVB 1IEHA 3IPEA 3BUBA 4UQCA 4ELDA 1CZ8L 2A74A 2C7UB 3GZQA 3H6JA 3FSAA 3PQYE 4NWTL 1FZOB 2DQIL 3VGAC 5KSBB 5I75B 3L08A 2LLNA 1WBYA 3MV7A 3ZMNA 5BCAA 4K94L 4BFJA 1QATA 3PRZA 3VSTA 2R1XB 1I8UA 2PCPB 1T1ZB 2GBTA 4ODTL 3KGSA 4QDGA 1XCTB 1H15B 3G5YA 2QLYA 5TDPB 2V37A 3WEXB 1BD2E 4O02B 2CCVA 2VXUL 3RGHA 3MJ6A 1Y18A 2ATPB 4B7IA 1GL4B 2KC0A 2QMKA 2K8MA 2FQGA 2FVNA 3HAEA 4FLHA 1XH1A 1ZT7A 4UINH 5FCUH 3ULSA 4L8SA 4W9CC 4JKLA 3QFJB 4TSCL 4Z7VE 4HOMA 2V4LA 3OKKB 2XTSA 4F7TA 1J1PH 5GGUB 4ES8A 3SO5A 1EHLL 1YEWA 4NIYE 1YY8B 2CKNA 5BO1L 12E8H 2BZDA 1W8OA 3AJ7A 1SXZA 1JGVH 5J1AA 2YUVA 3BLPX 1U95B 1D7CA 1KWKA 5DJ0A 3GJFA 1P2CA 4BXSV 4F7MA 1M1XA 2IEPA 2C1OB 2COVD 1T6BX 2XG5B 3GPSA 3N55A 4FLOA 4YFLF 3SE9L 4AC2A 2VR4A 4KKPA 3DSFL 4D2NA 2WXOA 1ZXKA 4WNJA 4FMKA 3ECVA 3WFZA 3HMXH 4N68A 5A2IH 3FCBA 1OQOA 5EZIL 2D3JA 1HZLA 3LZPA 4XCYA 3RB7A 3ZW3A 4ZODA 4TRPL 4NPJA 3RNKB 4A39A 5C0RL 1BGXH 4V11A 2FEDD 5E2VH 3L3KA 4NP4L 2WINB 3WIIL 1J0KA 2VMJA 5JXEA 4WI6A 1B4LA 1XF3B 4PJXE 3WFDL 4EIUA 3SDCC 3C5SB 4TTDD 3ZTJH 4ELME 4ISVB 4EBQL 4ENZA 3HS8A 4LXFA 4TNEA 3NCJH 4GQPH 1NIFA 4PRDB 3WD5H 5FM5M 4YHOH 3E0GA 4YIQB 1U8IA 2ZUQB 1JDAA 2RD0A 2VL4A 3D25B 5DHEA 4JY4B 1PX8A 2HUHA 3FYIB 3TJHD 3OJ2C 5IBUB 5GQBA 1F6FB 1CR9H 3ZHFA 2W0FB 5DLLA 3SZ6A 1VGKB 4H1LH 4PW3A 1NEZB 1BYPA 5AVRB 1KGUA 2LTQC 3NAAH 2IDTA 1GW0A 4UINL 1T1WB 5FCUL 4MZRA 5HYQA 3OSVA 3HKFA 4KK9D 2Y5QA 2HVJB 2ESVE 1XF1A 4UTAA 3II3A 3KZ8A 3F6LA 4OD1H 3QIWB 3UROR 4HUNB 1Y1DA 2F7QA 2VXVH 4FXGA 2EH7H 3JZ7A 4F80A 5F89A 2I9LA 2C3VA 1RK0B 2IPKA 4ODXB 4PJ9C 2NNFA 1AR2A 1BVLA 4Y9BA 3VI4A 2Z9TA 1MW2A 1JZHA 3L48A 2ZX5A 3QJHA 4XVJL 3BH4A 1CFTB 4WFEE 1TQBB 4ZG1A 3CSBA 3P2DA 3NK4A 4UQ3B 2D3LA 5I2IA 3A5VA 1KYDA 8FABA 1HKFA 1K72A 3LMJH 2P7TB 1HYRC 3HMXL 1AS6A 4QT5B 4M7ZC 1G9NH 4QHUA 2JXMA 4MAZA 3N1MC 3NACH 4XNUH 1OP5H 2VRAA 4OGQC 3QSKB 5DVNA 1GY1A 2WV3A 4BFEA 3C08H 5D1QC 1BGXL 5E2VL 3S35H 4WI9A 1F4WH 2DDQL 3UAJA 1GGCH 1EH9A 1JTPA 1SJEB 3ARDC 3GBDA 5CIPB 4P2QD 2GG1A 1PJWA 4DTGH 3HE7D 5FO8A 4FG2A 1G0YR 2L7EA 4JFDD 4BINA 2CHZA 3NCJL 4JQIH 4Z7NE 3HMWH 1MLBB 1K4DA 2WQ8A 4KTDH 3VTTA 1Z5YD 2X4TA 2IJ0C 3C60A 4YHOL 3DV4B 2FIKB 1QKZH 2W5PA 3GNMH 4FZEH 5IV2A 4U1SA 1CUOA 3A24A 3V0IA 3WKYA 4NQEB 3FQ1A 5D7JB 3RFRA 2A6KA 3AMKA 3PHOA 2QELA 1MEXL 4S1SH 1KB5H 1CR9L 1FPTL 2NXYB 3MCKB 3PXLA 4XO5A 2NW2B 4NI3A 3SO3C 4JFQB 4Z7UF 1UEYA 2HKHH 3NAAL 2R4RH 1ECZA 1B9ZA 3VFPB 1S9WB 3N5AA 1IGFH 3VCLB 3UZEC 1AI1H 1P7QD 1PDKB 4QRPB 4LE8A 1JCKA 4PG2C 4MA3A 3SDDB 2G2RA 4LPYA 4OD1L 3ZRCC 4NFCA 3ARFC 2VXVL 2EH7L 4CVWA 3S48A 4YNYA 1TUPA 5FHAL 2GHZA 4NUJB 2R1WB 1D5BB 2XKUA 2WZ6A 1FH5H 3EYVA 4H0HB 4LKCB 1OCZB 3LCYA 4KXBA 1HSAB 4OV6F 5CBEA 3N3EA 3PU7A 1K6QH 1NPNA 2YRBA 3RFZB 4F2ME 4IRJA 4MAYD 2WLLB 5FHBL 3ARYA 3K1DA 1I4FA 2OK0H 3V6OA 2ITDB 5HI3D 4H7VA 4J2XA 1AACA 3LMJL 5IMLA 5JW4M 2Y1VA 4HCRA 3AXLB 4OGYH 1NMCB 1CD9B 4BRVA 1M1SA 4QCIB 1G9NL 4NRXB 2WLIA 4UOW1 1J48A 2X4PB 1AG6A 2VLRB 4GO8A 2Q2LA 1G7JB 5HHMB 3QDJB 3VFOA 3ZKNC 3C08L 2G3NA 4WDIB 5I19L 4FCAA 2OYMA 1WS7A 1IILE 1F4WL 4W9IC 1GGCL 2ICES 5FYJE 5I76A 4PRBB 2E46A