1YEJH

Catalytic antibody complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
b'EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
molecule tags Immune system
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1998-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejH02
3GSRA 2DDQH 1JGEA 3ZKXB 4FQCL 3G6JF 5MP6L 4Y4HC 2GITA 5EU7C 2X1WL 2X4QA 1DQJA 5HYJD 3WDHA 3CDCA 5JW5B 3SKJL 5CD5C 1RUMH 3S3PA 4OIIH 4YBLC 1QRNB 4PP1D 2I07A 1BVKA 2B1AH 4PJAB 3CK0H 4XNYH 2VDPL 1AKJA 4HPOL 2WANA 4MX7B 1PKOA 5D70H 3I75A 3P0VH 2ZUTA 4XC3L 2IH1B 1ZLUH 1LE5A 3GNML 1RV6X 3HFML 4KHXH 4M62H 4IMLA 4O02L 4JAMB 5JMRA 4AMKH 2P43B 1F6FB 4N0FB 5I16B 5C3TA 4HS6A 5LAXA 1G0DA 4ZS6D 4J4PC 2W92A 1FGVL 1UXSB 2VLLB 2VH5L 4UIMA 4IHOA 2DQCL 3UZQA 5F1SA 4ZXBB 5CILH 3IDYC 2R0LH 1ZLWH 3TFKD 5CZKA 4D8PA 4ODBD 4QF1B 1MJ7H 4YHZL 1NLBH 3VA6A 4PJ9D 1L7IH 4P23A 2HG5B 1ITCA 5I75C 1JZ2A 5I6XB 5EORH 4EJ1C 3MOQA 1JK8A 2O5XL 4XVTL 3FO1B 4PRDB 3QULB 5DHVH 4ETQB 1GZPA 2Q7YA 3O4LA 1LDSA 3DECA 2R2HB 1K2DA 3K1DA 5ICXA 3SGEH 3ZHDA 3C5SA 3U46A 5EU4A 4TRPH 4G6MH 1UT9A 3G5ZB 3HLAB 5GGQH 5J9PB 3BKML 3DX7A 3FRUA 2B5IB 4LLDB 4FQXA 4OFVA 5CGMA 4X7SH 3DX6A 2DQFB 3BGFC 4O2CA 1CE1H 4N0UA 4PJCB 3HI1A 4I2XA 3Q48A 3E6HB 1L4IA 1D5IL 3IAPA 4U3XA 5CLWA 3RWCA 4NN6C 3CFCH 3HZVB 4K9EH 2DAVA 3HUJE 3SDDA 1G84A 5TE6H 4O2FA 1H8SA 3LD8B 3TJEH 5JXAH 4UAOC 4HEME 3OQ3B 4RMQA 1ZEAH 1IAKA 3B2UC 1NGWA 1IGJA 3MLWH 1IQDB 1G7QA 2CKNA 4PR5A 3EDFA 1HILA 4JPIB 5I1CL 1PDKA 4OUUB 1U8LA 3L3HA 4NQDA 1XIWD 1YC8A 4H25B 4KI5F 4V1DA 1NCBL 2AV7B 1DE4B 3LHPL 2ED7A 1LK3L 2IQ9H 3P11L 1P9MA 2X7LB 1M05A 2W0FB 5HY9A 1ZHKA 1T21B 4UDTA 2PYEE 2F8XC 3O6FB 4M8QA 1KNOB 1LD9A 4K2UH 1ED3B 4PRPD 3SDYH 5IUSA 1NAKL 3KYOA 2OTWA 2CD0A 4WFGE 2DD8L 4FZ8L 1WZLA 4C59B 1A6VL 3BIAX 3N1FC 4U6HA 2BVTA 4G6KH 4G8IB 2PF6A 4DUVA 4IOFC 2AJ3B 4KAQL 1A1MB 3PQYE 1OP5H 5CZXC 2P45B 5IT2H 1L7IL 4YNYB 1BLNB 1DQDH 4WO4B 3LH2H 4PJHE 2QTEA 1JV5B 5F89B 4JB9H 2KQNA 4HWNA 4LK4A 3W9EA 1FZOB 2GAZB 5E94A 1BIIA 4BQBA 3UBXA 2N56A 3TA3A 4W4OA 3RRQA 3C2AL 4KFZC 1XGPB 2BVYA 2AJSL 1O0VA 4HBQA 5K9KB 5JMOC 3MNWA 4NRZB 3QDGE 5ISZB 4GXVH 3RDTB 2P5EE 1S7SB 5CEXB 1RUML 5HGBA 1QBLL 1EX0A 3FN9A 4WO4A 4BJLA 5IM7A 5JPMB 4KK8D 5I1AA 3BKJH 3OKOB 1IZJA 1MY5A 2O26U 3QH3A 3P0YH 1X44A 1OT1A 4I0KA 3O8XC 4IRJB 3HMXA 2DBLL 3ARTA 5T1KD 1M4KA 3RNQA 1CL7I 3BZ4A 5HHMB 2OZ4H 15C8H 4JFXB 3GMNA 2IMMA 4NM4H 4MQXC 2IALA 3DMMB 2VXSL 4M6AA 3WSQL 2VABB 4YDKL 5FYLD 2COQA 4FQIL 1OPGH 4ZUSA 1K3IA 2VXTH 5DZOA 1XCTB 2YKLH 3MNWB 4PJXF 2VLRA 1KB9K 2BNQB 2W38A 4YHNB 4LGPB 5GGSB 5L7XH 2YXMA 5K33A 4ZUTB 1KN4H 3PWPE 1S7RB 1X5IA 2ZWLT 1CLOL 5J89A 32C2B 1OLZA 3WO4C 3BDYL 4XMPL 4LEOA 4KJPD 3MGOA 3I50L 5EO9A 3NCEB 3U7WH 4AJ0A 3EOAB 3GSOA 2VDQL 4YXLH 3MV9A 3RUGB 1MWAH 5ADOH 3MRFB 1M7DA 1RU9H 1ZWIB 1Q94B 3ZKSD 1FDLL 2VITB 1S3KH 2VDKL 2EXYC 4MNGB 5T1KB 1OTTD 5E70A 4HJ0D 4I4WB 1GXEA 4UT9H 3X13A 2NY0B 3NIFE 3O6KH 5E4EC 4IMKA 4EXKA 1E4WH 2OR7A 4RFOL 5DC9B 1CG9A 3RTQB 1JRHH 4RZCA 1C08A 2PW1B 2VXVH 1CDJA 2B39A 1T1XB 2IFGA 2DTMH 5CIPB 1WBXB 3STBA 1CFSA 3ECBA 3UMTA 5KS9A 4JO4H 4EXPX 2V2TB 4I18C 2OX5A 4CADB 4NRYB 3PWUA 1JMXA 1KB9J 5DO2D 3SPVB 1UCTA 1VESA 5FM5O 2XN9B 5E8PB 1UA6H 4P0DA 5CP3A 1UJ3C 3PV7A 4X9IA 2VDML 4F33B 1FZKB 4P2QE 3X3FL 3ZYJA 1KPUA 5GRUL 4DAGH 2YSSA 1DSFL 4O51B 6FABH 1J11A 4WI5A 2Y07H 1EERB 4ETYA 4MNGA 4I3RH 1OB1A 4F9PA 1FNAA 2CO7B 3GI8L 4IRSD 4X7FC 3MBEC 1DBML 4EBQH 1B6DA 5D8JH 1KLUB 4G9FA 5MHSD 3QEQD 1AE6L 2ICWB 4J3WA 4OZ4B 4ORGB 3NCYS 4KJPC 3T4YB 3ARSA 5TGBA 1P84J 4NO5A 5DVMA 2VWEC 2QV2A 3FFDB 2VL5A 4GW5A 3WIIH 4KUZL 4LDOB 1X5JA 1OVZA 3MUY1 4Z78B 2HT3D 1U42A 3F7VB 3O3BA 3C8HA 3FOLB 2WW8A 3WIIL 1IGML 3B9EA 3BQUA 4HUKB 1KIQA 3WHXB 5KJRH 4P9MH 5SX4H 5L2KA 5EIIA 2R29L 1U95B 4CRPA 1QA9A 2VIRA 3FT3A 5D1XC 3JTTB 4BH7A 4RFEA 1XF4A 3QHFH 4M61B 4OUUA 1LO2H 5JZ7C 4IIQB 2FJFB 1LO4L 1GHFL 1JV5A 3WLWD 2Y07L 1FCCA 4CVZA 1XGYL 3LQZB 2X89A 3QQ3A 4PPTA 3O6LL 2Y36L 3RZWA 2HLFC 1H3PL 1J0IA 3PXHA 3KPPB 3X3GH 5ACZB 3GSXA 3SBWC 1MUJB 1NGZA 1FG2A 4I2XB 4ZG1A 5DMIH 4OF3A 4N0UB 1P84K 2FH6A 5DR5L 2YC1B 3VDBA 1K3ZA 2YN5A 1YJDH 1N0XL 2FECL 1CDGA 2SEBB 2WSKA 1V5JA 2AVGA 4MA1B 3O6KL 3RWIA 3HC3H 3QFJD 3CFJB 1ZOXA 4HUMB 5D2NE 1S3KL 4MJIA 3HC0B 1Z3GL 3KG5A 3MLYH 5HPMB 1D9KD 1P4IL 1RU9L 1AGFA 2FEDC 3ZTJH 4NNXA 4APQD 5CINL 4FQIH 3UTQA 3Q6FB 1MCPL 1QRND 2NY4D 3ARDA 2OL3L 4S1DC 3CVHH 3O2WH 4JCMA 2P4AB 3S5LG 5FO7A 2M26A 4OZHA 4N9GA 3VXTB 4POZD 3ZE2E 3RVUD 3BUYA 5TQ0L 4NN6B 4UIMB 1V7NH 2C3VB 3QG7L 3AUVA 3B6SB 3V4PH 1RIHL 3MBXL 1KLGB 2FGWL 4HH9A 3V4UH 3T65A 4J8RB 4Z7UE 5EUOB 1V3LA 2UVFA 3UPRB 5GGVL 2AP2A 4W4NA 1MLBB 4K55A 7CGTA 1W2KT 4HC1L 2RGSA 1QFWH 4XPGL 4B7LA 4WUUE 4OQ1A 3FZUC 4ZSOA 1MH5B 2X4NB 3FO2B 4WDIB 1F58H 4PBXA 5EUOF 1GIGH 3WJJA 1HZHL 3SCMA 4ZO9A 5D7KE 4F8TA 3D3VB 3T0AA 3P30L 2HVJA 5B21A 2Q87A 1PZ5B 3MJ9H 5E1AA 3M8OL 1R5WA 5IFHL 4BK4A 2DMKA 5JHLL 4JFDD 2AJSH 1MUJA 3RTQC 1DQDL 1W0YT 1YYML 3AREB 4JFOA 4Z7VE 4PJCA 3KS0H 2F74A 2IAMA 4HFUH 2X42A 4K3EH 5SWSE 3MV7D 4OGXL 5IMOB 1J88A 5F44A 2H32A 5C0BD 4MJ5B 2VE6B 1QVOA 4YX2H 2ZUUA 2H32B 1NBVL 1WFUA 5MEPB 1EBPA 1GZPB 3PGDA 1WWBX 3HE6A 1KPRA 1NMAL 2KQMA 2F53E 2CDFA 2Z8VC 5EU6E 1B2WL 3SDYL 2R2CA 1CICA 4QGTA 4XVSL 1DJSA 5BS0E 1NL0H 1JHTA 3ARFC 1KJ3L 4Y1AE 5EZIH 5C9JA 4MQ7B 3VFTA 2YD5A 1N59B 3F65A 4XB8A 3RY4A 1BPVA 4KQ4L 5F96H 4A6YA 1DVFA 1NANI 2FZ3B 3DV4A 1V7NL 1URLA 3P4NA 3ULVL 4JPKL 2VZTA 3KPQA 1JGEB 4MAUL 5EDXA 4Q74A 4IHOB 4K3JL 4PY8J 4U1HB 4YHIB 4KVCH 3L3OA 3UDWC 3M1BB 3S36X 4U49A 3CJJA 2ED8A 2VN4A 1OTSD 1YEFH 3HI6H 2XWBB 2JJWA 4NWUL 1WAAE 3IB4A 5KSBF 3GSUA 3LHPH 5IESH 4M5ZL 5HDQH 1HSAA 5KSAB 4PGJA 3Q0HA 3T0BA 4G9FD 4RFNC 4RRPA 3MYJA 3LKQB 4BFEA 3RGVA 3L7FB 1ZGLM 5CAYB 2UYLA 4MLIA 3RNKB 1AFVH 4QRSB 3LS5H 2BVOB 4NHCL 4PJHF 4WU7A 5DFTA 5TDOB 1G6RL 1WUNT 1N8ZA 3MNZA 3BDXA 2CXGA 3MXVL 1YEDA 2AGJL 2NR6D 1EGJA 4RWHA 1W0VA 1LP9F 5EA0H 4EUPG 2ORBL 5D7LA 4ALAH 3CU1A 2AGJH 3VGAB 3GI9L 1XEDA 2CLZA 4TUJA 3SKMA 4OJFH 1RUKH 4WEUD 2DYPB 1U8MA 4U7MA 4MSWA 4YXHH 3V95A 3JV4A 5D96C 3K2UH 3CNKA 4L3EB 1AD9A 2R2BB 3NN8B 2D3VA 2X4OA 2I27N 3MV7E 3F6IA 4FTVD 2IMNA 2EYRB 1YZZA 5T3XD 1SJHB 3PV6B 1DUZB 4DGIH 4MD4B 2AXFA 3FT2A 4NBYB 4FXKB 4QTHA 1RD6A 2FWOA 5A3ID 1CT8A 1RZGA 2XWTA 5IMMA 1HOCB 1M6OB 3E2HC 5BXFB 2WM0A 4MDJA 3CUPA 3P4OB 4XP5L 4G9DA 4K3JH 3OKNA 3OGOE 5F1NA 2VLRB 3LRSB 4IRJD 2Y06H 1MFAL 1FFQA 2A6JA 1HQ4B 2YPLA 4ONHB 4MCYB 4U0RB 3V7AG 4PGCA 1TETL 3MLRH 1UWXK 4XCYB 4MYWB 4CBPA 4OV5B 3MRPA 2VLRD 5D8JL 1TZGH 3UJJH 1YEKL 1JNLL 1U8KB 2E9BA 1KYOJ 4HK0A 4NQEB 4FQCH 5KSBA 4QRTA 3U2SA 3O9WC 4PRNB 3HZKB 4O58L 1I8LC 1T2QH 4RA3A 4XPHL 5GRUH 2A1WL 3EFFB 5IB4B 4MNQA 3G04B 4BKLA 1CFVL 1A2YA 2EYTA 2VITA 1FORH 1MFEH 1PG7H 2R1WA 1XGRA 3RWJA 1HDMB 4O5LL 1QSEE 3LKPB 5D6CA 5I73C 1JHKH 4UIKH 2NW2A 3T8XB 2R56H 4WO4D 1S5HB 5EFIB 3PABA 4ISVA 2WLZA 2ICWA 1F5WA 2XV6B 3F58H 2GJ6E 4UT7L 1KTDB 3QDME 5E2UL 3WFEL 4YJZL 2V5MA 2JK5B 3MJ8A 2HFGL 4RDQF 3L6FB 2APXA 1IRAY 3SO3B 5FYKE 3W0WD 4Q0XH 2R0ZL 2Z35A 2YMXH 3BWUC 4UU9B 4NDMA 3RVVD 3G5VB 5DD3L 1NUNB 2AEQH 5I8KH 2IC2A 3TA3D 1GIGL 4NDMB 2JELH 2XN9A 5FA4B 3WXVL 5ISZD 1YPZA 5CJOH 4HUXB 1KTLA 4PJGE 3SDAC 1L6XA 4LPXA 5MHSE 2BMKB 5GRWA 4PRBB 4I1NB 3VRLF 5GZND 4L4TE 2EIZB 1GGBH 3IJYB 1IQDA 4LKCA 2NY5L 3OKOA 3MRJA 3HCVA 1SVZA 4Y4FA 1LNUA 5ENWA 1KELL 1JPGB 5ICZA 1CU4H 2DM2A 5MI0B 4LCYA 4LOUD 2CDGA 4LSTL 1EVTC 1OQXA 4Y1AB 3T0EA 3QXAB 3DUUA 4XGZB 1GC1L 1B4RA 3IDIA 4XNZC 1DEEA 3L5XL 4WW2A 2OSLA 1IE5A 4RRPG 2OZ4L 1FVEA 1I8KA 4CMHC 1LDPL 1EV2E 4MAYC 4NJAL 3CXDH 3FRUB 4LLDA 3SKUD 1OGAE 1TJIH 2H3NB 2JELL 2L4OA 4TUOB 2YD8A 4O00A 4KRNA 2XZAH 4KZDL 2AEQL 3H3KA 2BHZA 4FXLA 3VI3E 1YEHL 4GT7A 4JM2C 4ZTOL 3NH7L 3FQUB 4APQC 1A6WH 3QUYB 3U0WL 2YHGA 1XIWA 4JZOA 3MUZ1 3CAFA 2QQNL 3BPCB 4BUHA 1JGDA 1YJDL 4W68A 1KN2H 1MFBL 2GK0B 3SGEI 1J9CT 3QUYD 3VH8A 1FLRH 1JYNA 3P77B 2ITCB 5J6HB 4C56E 3MNZB 3RNQB 4EQ2A 4OCMC 1AD0B 1LMKA 1OQOA 4WWKB 5F88B 3VXSB 1RZKC 1WCBB 5DK2B 5KSUA 3WUZA 2VQUA 3U4BH 2BVPB 3KPSB 5BRZD 5DHYB 2YXFA 4PJEE 2OL3B 4E0RA 1Q72L 4OCLC 1CLCA 3ESVF 2YPKB 2VE6A 5CWSA 3NN8A 3UJTH 4KKLD 3FHAA 5CEXA 1NUDA 2Z92A 5F1OB 4UIKL 3DI2B 4EN3B 1SEQL 3OHXB 2MKLC 4KAQH 3EYFA 3SDCD 4HGWB 5E08H 3NGBC 1PAMA 5D6DA 4EI5B 2O61B 3SJVE 1G9NL 4EIGB 3E6FB 5A16A 3LMJH 3QI9B 4X6BA 1H15B 3SDCB 3DVNA 5FUCE 4EKXA 2NY4C 4S1DD 4BQ9A 5BOPA 5EU3A 5I8CA 1A7PL 3CVIL 2VUOA 3QXAA 3H0TB 3IAQA 1Q0XH 1S9WB 4HFWB 5EIVA 3FN3A 3GMRB 4PRIA 4C83A 5JHDB 4N0FA 1LP9B 4F9LA 2OBGA 3GSWA 2YD4A 4BA8A 2XT1B 3PGDB 3BESR 2R23A 1BOGA 4OCNC 5I1IH 1KPVB 2ATPA 3H42H 2WP3O 3MV8B 5ID1A 5E4EB 4KMQA 3EO9H 2VZSA 2IAMC 5E2VH 4LPVA 3ROLA 6FABL 1BQHB 1YY8B 5KVEL 3P0GB 5HYQB 2XRAH 1LO3L 3RGVC 1BZ7A 5FYLE 1IAIM 4GMSL 4F57H 3U7YH 4PRAB 3GSVA 3SO5A 4YBLB 4JRXE 1IC4H 4ENEC 3RVVC 5DMGC 5B39A 5DUBB 1YEIH 1WZKA 1HINH 3SEPA 4MXVF 1YEDB 3TCLA 1MAJA 4XCFH 4X7TB 3S4SG 4WHYH 3EIFA 4L8CB 4XCEA 3GRWH 1I75A 1N64H 1H0DB 2ORBH 1FLTX 3MJ7A 5MENA 3GMOA 3IRZA 1RZIB 4NRXB 4E41A 3RGVB 3SOBL 4N90E 2IJ0C 3THML 4UNVA 3MXVH 5DD6A 4TNWK 5KN5B 2H1PH 5HD8C 1AXTH 3SGKC 2VJXA 3GJEB 2BSRB 3VI3F 2VDQH 3RAJH 1A5FH 2Z0BA 5A40E 4PJAA 4X6CB 5C8JB 2FDBP 3KPPA 3OAYH 1QSFA 2PETA 4X80H 1QRNA 1M7IA 2MTPA 3RGHA 3TF7C 3RA7L 4BELD 4APQA 4XWOD 5D2LB 5FKAA 1JP5A 2DKSA 1OAQL 1V3MA 1KJ3H 4RIRB 3TBYB 1CXKA 3QFJA 4KC3B 2BNRB 1K4DA 3CPLA 5HYJB 2GFBA 4YDJA 4XP9L 4HSQA 1A64A 3DURA 4HS8H 3CMGA 4PJ5B 8FABA 2RAMA 5A2LH 3CFBA 4KGLA 2HFTA 1KIQB 3WHXA 4D9QD 1MCOH 4R0LB 3VMPA 1ZVHA 4QXTA 1K8DA 2XTJB 3DRQB 2HT4C 1T5XB 2ZSWB 3RWHA 2R4SH 3V9FA 1LGVA 4OGXH 5D1XD 3BFOA 1CTOA 1ZVSA 5FYJE 1M71B 4WGWB 4M7KH 1T3FB 3NGBB 3MJ6A 1UQSA 5CZVL 2CRYA 3QXVA 2VDRL 1FGNL 3O3EA 4I5BB 1BF8A 4TQEH 1MHHB 1WWCA 1KC5L 1DUYA 1SBBA 2D31A 3HN3A 4Q9BA 4YIQA 1HKLL 2Q76B 3FB7B 3QPXL 3LRHA 4GMTH 1FP5A 2AJZA 1XF1A 4XX1E 1GC1C 1KCUH 3T08A 5TPWL 5MEOB 4KXZH 3MV11 3F12A 3CVHA 4K7FA 1BQHA 3IVKB 1A6PA 1TVDA 2D03H 5M94B 3HAEB 2RBLA 1KFAL 3LH2L 2MCPH 1TJGH 1LO0H 1BOGB 4AIZB 3HHRB 4ONFL 1EDQA 3PIQB 1ULVA 2GIYA 1QHPA 1NCAL 4M3KB 2P1YA 1FE8L 2FGWH 3W9DA 1BX2B 5CJBA 3QXDA 3RZCD 1ITBB 3ETBF 1IGFH 1SJEA 2GQHA 3FB5A 4LDLB 5IJVA 2HMID 3HC4L 4IOFD 3VXUE 5C0AE 4F2MB 2AK4E 1FO0H 2A73A 4YQXH 2NTFB 4R6UA 1ZGLA 3ARYA 3SO3C 4M7LL 1H3WM 3PWNA 1HINL 1JN6A 2ZG1A 4F7EB 2ZKHH 5AUMB 5IOPB 5CSBA 2EC9U 1AR1C 3RWEA 3GFUA 2IBBA 4XBGA 4L8CA 4TSCL 3BWAA 2VR9A 2FL5B 4LQFL 5T3ZL 5DWUH 3MLZH 4QHMB 3MXWH 4L29B 2X44D 3LKNB 3SY0A 4HHAA 5L88L 2PYFB 1ND0B 4PB0H 5D5MA 4Q9QL 5I66A 3V7AE 3GHEH 5ERWB 1FYTB 1P7QD 1MLCB 4PB0L 1BJMA 3P3YA 4U1MA 3GMNB 5C7XL 4G8EB 1QPXA 1FZMA 2JF1A 5D9SB 1QOKA 1MEXL 1VADB 2GSGB 3GM0A 5F8QC 2PTVA 1R3LA 4Y19D 2P5WB 3VH8B 4KXZI 4RAHA 3EJYC 8FABB 4XH2B 5IB2B 3UTZB 4MQXD 2BY2A 2A74A 1RZKH 5AAWA 3MV9D 5GGQL 3IAGC 3ZE1E 1CXFA 1GHFH 3KPSE 4XNMB 1NFDA 1AGEA 4NCDA 3UPAA 1H0DA 1WWWX 3A6CL 4XCNA 4XVJH 3MV9B 3ARPA 3DO7B 3O6FD 1F00I 2V17H 4LSUH 4XPBH 4YHYB 5DJAB 4D0DA 3OGCA 3H8NA 5DK3A 5E9DA 5B8CA 3SE9H 2OJEB 1P7QB 2YEZB 3T2QA 3DETD 3QR2A 4X6CE 2R0KL 4I13B 5T3XH 2APWA 5EB9A 5C07E 4OZHB 2CUIA 8CGTA 1Z5LA 4JFXA 1NLDL 2DLTA 4UB0H 4JGUA 3D25B 4R9HA 4HZLB 3SQOL 3IU4L 3ZDZE 1EZVY 4NQSA 4PJXA 1X7QA 3LS4L 3HI5L 4BQ8A 5M95B 1OP5K 4J12A 4PJXB 5F97E 3GBLA 4C55A 3P0VL 1KN2L 3HPLB 4JQVC 1T0MB 3C60B 5F1IB 3TCLB 3JTTA 3OAZK 4MA7L 4L1DA 4F9LC 5GGTH 4TOYL 4X99B 1Q9WA 4WCYL 4JANA 1A7RH 5DD0H 2W0KA 2CDEB 4M7KL 1VACB 3OKMA 2W1NA 1U8PB 4JO4L 4JANB 1BQLH 4NC1E 4D9RE 1ETZA 3H7BB 4NO3A 4OGAD 4P5TC 2CUHA 1DFBH 4MGXA 1WIUA 2YD9A 3GB7A 4E9LA 2O61A 3G08A 2HJFA 4H8WC 1UWEH 3QT2A 2AEPL 3QYCA 1C08B 2Q3ZA 4DTGL 3JSSA 5ALBL 4FXGA 5LJYH 2P8MB 5D96B 4YDVA 2PN5A 1IEAA 3LDBC 2UV3A 1MCBA 5FB8B 1FFPB 3IKKA 4FQHB 4G8GD 4PG2C 3X14B 4XNMA 2Z31B 5C0FA 5E8EB 2V5YA 4KZEH 5GJTL 4DUXA 3C60D 4WHYG 3GMRA 1AXIB 4R90H 2W07A 5GS1A 3FN0H 2VXVL 1XMWA 4H8WL 4O2FB 3RUGF 2Z31D 4JFPB 2A77H 4X5LA 1T89A 1KCRH 1A6UL 5BRZB 1GPOH 3G6JA 4NO2A 5L8JB 3MRIB 1EK3A 1B9ZA 4Q6YA 4RGOL 3WIFA 1NJ9A 5JUEL 3VI4E 1KN4L 5A16B 1BJ1J 3B5GA 2FLBT 4KK5D 3QEGL 2LFGA 4PRBA 3SDXE 1ADQH 5DLML 1TVHB 3D5OF 1A9EB 5FOBA 3HZMA 1UH3A 3HR6A 3PHQA 3S36L 1Q9WB 5EWIL 3O2DH 1XF2B 1EFXA 2NX5D 3A67L 3MA7B 4U1GC 5KANG 2VABA 3T2OA 4Y88A 1YMMD 1CDUA 2AEPH 2UUDH 4F7MA 3C6LA 1SY6L 1KG0A 2XKSA 3EYUL 1A4KB 1LP9E 3PJSA 4LHUB 1YPZF 3PHSA 3WYRA 1OPGL 3MRGA 3BP5A 4HV8A 3VG0H 2XKUA 4WCYH 2IBZY 1MQKL 4PGDB 1NEZG 2AJVL 1T5WA 3PP4L 3QO0B 2DQUH 32C2A 1UYWL 4WUKH 1U3YA 4L9DA 1I1AD 3MV01 3ZKND 12E8L 1FIGH 3MJGX 5EH1A 3I6LE 3SHSA 4G5ZH 2BRQA 1MAKA 3CDGA 4U3HA 4X9HA 3DGCR 4PLNC 1PG7W 3NIGF 4OB5H 4GW1A 1J0JA 4RX4A 3K4ZA 1YNTA 2VAJA 3ARBA 1VFAA 5E9DB 1FYTE 3SKOB 1EO8H 4OBRA 2XQYK 2MHAB 4PREA 1S7XB 1XAUA 3P73A 5GJSL 3WIFB 5ITBL 3DX7B 2C3WA 2ZUWA 5I0DA 3LEYL 4HJGA 3NAAH 1Q38A 1KEML 1G7HA 4Y4HA 5DUPL 1FNGB 4JB9L 4Q9RH 5IW6A 1NBZB 4OM0H 4QXUL 4ENED 5L9DH 4OZIB 4Z9KB 2Q1EA 1TQCB 3B2VH 1ZS8B 1J5OL 2PR4L 5ELIA 1MWAB 3L6FA 5IJKA 4G9DB 3MA9L 1CFNA 1OGTA 1G7JB 5DJ6A 1J86A 1TZIA 3O3EB 1T04A 1KJ2A 3OR7B 2H2SC 2RJMA 4FFWD 4QRQB 2DLIA 1TJHL 2Y72A 2D9CA 3MMEB 4KHTH 4OM1H 4D9RD 1MVFA 1EEQA 4P4KA 2YRZA 4RQQA 1P6AB 5IEKA 3C8KB 2FO4A 2G9HB 3ILQC 5FHAH 2OR8A 3TH2T 4OGAC 4P5TD 5EBMA 2X7LA 3QEUA 3IDXL 3PQYD 5HYJA 3NAAL 4NP4H 1IKNC 2D31B 3QFJB 1YEJH 3DLQR 5T1DH 5ID0A 4YC2C 4XCYA 5I74C 5KZCB 5FGBC 1P4LA 5IEHA 5JIIA 5GXBB 2XNAB 1E6OH 1UB5A 4QF1A 3ARGA 3P11H 3TJEL 5JXAL 4OB5L 2AJXL 1CLYL 5T3ZD 5C07D 3JV6A 1MCRA 5IJVB 4HQQH 4Y5VC 2YK1H 1P69B 1S7SA 3IDMA 3KR3H 4OUOA 1PEZA 2F74B 2DM7A 4R7DB 1PSKH 2ZSWA 3RWHB 2DQUL 4M03A 1LEGA 4GQ9H 1CLZL 4UQ2B 1YEHH 3LRGA 2ZKHL 5I1DB 5DSCA 1NGYA 2FX7L 2I9LA 5IK3A 5FFLA 3S96A 2E9JA 3RWGB 3MGTB 2O5YL 5TDNA 4MS8D 3GI9H 3H9SE 2FL5A 3S35L 1U8KA 5DUML 4KV5F 5E94B 3WN5B 4OFIA 2BSSB 4N1HB 1WLHA 5HHNB 3MJ7B 4Z7VB 3CVHB 25C8H 4LRIC 5LQBL 1NFDB 4MSWB 1JNHA 1TNMA 4LOUC 3BI9X 5I1GL 1CWVA 4LP5A 1F8TL 1DQLL 1MJUL 3FQWA 5H8DA 5LXGH 4M4PA 1QSEB 3V0WL 1KELH 4AM0A 1I9JL 1I7ZA 4OV6F 5DDHA 2WBJB 1IVLA 2CXKA 4G6FD 3TN0A 1PYWB 3MC0A 3V6OA 2R1YB 5E00A 4X8JB 4LIQE 4JQXC 3UJIL 3LN5A 4LLMB 4MWFA 1MRFH 4NUGL 1BF2A 3B9KD 3GRWA 2VR4A 4FOMA 1CR9H 4M62L 3WUWB 2KH2B 3G9VA 2VLJA 3U4AA 4E41B 4I0PC 4LLAA 5DD3H 1HH6A 1XCQA 2AXGA 3QPQC 1FH5H 3AS1A 2ADGA 1A4JA 2EH8L 4UBDC 1KACB 1MPAH 2CMRL 4ZAKC 2BNRD 4P23B 1U6AH 3ARWA 2R1XA 1BMGA 2K9UA 5EIQA 5EUKA 4EDXB 5JO5B 1W72A 1REIA 3D39E 4HCRL 4HC1H 3QEHA 3QI9A 2Z8WC 5GGTL 1J0HA 1C12B 4M43H 1N2RA 1KIRB 3B2UD 4XMKH 3B9KB 2CDFB 3KLHD 5TDNB 3FCTA 1OW0A 3PIQA 4M9OA 4BZ1L 1U8QA 1U6AL 4QHKJ 1K4CA 4ONGL 4ZFGH 4NZRL 3KPTA 1DBAL 2CKBA 2X4PA 1IZKA 5GZOD 3C5ZD 4M6OL 2V5RA 1WISA 1RZIA 1MJ8L 4MWFB 5KVDH 3QUXD 3IVKA 4JRYA 4TTDD 2Y4SA 1J8HA 2Y5TB 4LIQH 1J0ZA 5E5UB 5EBWA 4XHJD 3BISA 3T1FA 4ZFFB 1OP9A 2UZIL 1X5AA 4X0KB 4PGEA 5A3IC 4RMVA 4OAWB 3S5LB 3QCVH 1A1OA 3CD4A 4DOHE 1M1SA 3AB0C 5CEZE 5D7JD 3N1MC 2R4RL 3SDXB 4GG6E 1EJOH 4HGWA 1CDBA 1DL7H 1FFNA 1QP1A 1MIEL 2CJUL 2AK1H 4X6EB 1N0XH 3FFCA 3K7UA 1MY7A 4JE4B 4OD1L 4XVUD 3LDBB 4BQ6A 2HTLD 1B6UA 3KPNA 4LVNB 1INEH 3RZCB 3ULUL 1OF2A 4HKJB 2JLLA 4KKAC 3X17A 4E5XB 1AXSA 2DQIH 1U8OB 3CFEB 1Y18B 4FQ1H 4D9QE 2ENSA 1CFTA 4NSKA 4YFDB 3IFPB 3O2WL 5IROC 3R06A 1UWEL 4JHZA 3GMLB 5E24E 3VXRA 1INQB 5JPNB 4C83B 5KVEH 1WZ1L 1NCNA 3ARRA 5DGRA 3VFWB 1CQKA 5I1EL 4NN5C 4ZPTA 5DRWB 3S3SA 1UB6B 2P5WD 2AW2A 5EZLB 5C0CD 2HLAB 2GSIA 2JB5H 3FQTA 4LU5L 1A6TB 1RZFH 2G75A 4K23H 3VXME 1V7ML 4GS7B 3WBDA 4MA7H 4OCWH 1WVZA 2YBRB 5E6YA 4RWYL 1BD2A 5EU5A 3ZL4L 1FN4A 1NH6A 5J6GB 3DXAA 2ZUQB 2QQQA 5CMAB 3BN9D 3EJZD 5J12B 4S2SA 1K8IB 4PJ8A 3UPRA 4LCIL 5HHME 1FVEB 4QHNB 1RIVL 4NQED 4WFFD 4XHJC 3NTCH 1R5IB 1WZMA 2BVEA 3CH1B 1JPSH 5D7JC 4E0RB 1UCBH 4XRCB 4K8RL 3STZB 1I8IA 4GG8A 1MHEB 3SE3A 3MRFA 4LPTA 3QEHB 4LSRH 5SWZE 5I1KL 4W81A 4LVNC 3RZCC 1KCVH 4JO2H 3ET9F 2B7DT 5SWZA 3TYFB 1TCMA 4JN2B 1YA5A 1HHIB 1I7ZB 2Y5EA 1C16A 4X5WB 5TQ2H 4YUEH 5EZIL 3N06B 2X1XR 1GAFH 3EUUA 3UJTL 3QHFL 4YHLH 2Q86A 1PGRB 3BPCA 5T1LA 3BVNB 4OZFB 4R3SB 4PGZA 4L4VA 3ILPA 4K94L 4XVJL 2AJUL 1KFAH 4J3OC 5GGUA 4JM2B 5HYQA 5C08B 1OP3H 1CGWA 2CIIA 1VPOL 1G1CA 4H0IA 4ZO6A 1I3RB 1DN0A 2VXUL 5LGKA 1U2CA 3JXAA 4H88H 2NY3D 2H6PA 4U3CA 3GK8H 1A7BA 4XPAH 2QR0B 4OZGB 3WL9A 2EIDA 2FBJH 4ELKA 1U93A 2DB8A 3HRZB 5DUPH 3P77A 5J6HA 4NO2B 2HFEB 2BK8A 4J7RA 3BD4A 4WI8A 1D5BB 3FL7A 5D7IA 4ERSL 5GIRB 1T5WB 1K6QH 1WFOA 4NJ9L 5I8OL 3P2TA 2WQRA 3I9GL 4WNQA 4NJAH 1WQVT 2IG2L 1CT8B 2NY5C 3I50H 2XPGB 3EFFA 2XFXB 4MD5A 4Y2DC 4G5ZL 3MLZL 1X3DA 4OZFH 1DBBH 3MLTA 4OKVB 3L5XH 5SWQA 2HVKA 2PUQT 4M6NL 3RVTD 1VCAA 2DQHL 2EYRA 3WKMH 5C0GB 3OBAA 5ILTL 3QZWA 4I8DA 4QRUA 1YQVL 3W9EB 1CQYA 1YNKL 4P46A 3VW3L 1RHHB 1MCWW 3IFLL 2BSTA 5IHLB 5IP4A 4N0UE 3AM8A 3MBXH 1RIHH 1U8IA 5FYKD 3MLUL 5CFHA 5A1AA 3KPMA 3PGCB 4FQQA 4OKDA 5B3JE 4X5WA 2VDKH 3MRLA 4WW1A 3BKJL 4X6DF 3PUCA 5FO9B 1T66D 3CFIC 3IDYB 2PCPA 5CEYA 4JKPL 3NZHH 5CINH 3WL9B 1NKRA 4Q6IB 4KVNH 5LKNA 2ZG3A 4DGVH 3X13B 3U0PA 4S10A 4TSBH 5DK0B 1YY9D 4WWKD 3VXSD 1OB1B 3V6FB 4NQTA 3UX9B 4V1DE 5E2UH 3WFEH 4MQSB 4RGOH 2AERT 3KWWA 2F54D 3MRMB 2FBJL 3KJ4B 4G8FA 4JREC 3IRPX 4LRNH 4JFFA 4JLRA 4IOSD 2HTKD 2EDEA 4WFEE 2ZOLA 3TBSA 4TULH 2VAAB 2HLFD 2X05A 5D1ZD 1F4AA 1DTUA 1P2CB 2BNQD 5LCVL 3VWKD 3PDDA 1NDMB 3GGWB 2WINA 2GSIB 1CD1A 4ZAKA 5B4MD 4BH8A 4DKEL 3B9KC 3UTSE 2X4SA 2NNAB 2H26A 4FRWA 4NCC2 4QRPD 3WE6B 5B38A 3VWKB 1J87A 3QO0A 4G43B 3KPSD 3PXJA 2DM4A 5GRVL 5TQ2L 1FRGL 1INDL 4GRWF 4R8WL 5ENWB 4U31A 3U9PL 4MNQB 1G1YA 4ERSH 1JRHI 1WEJH 5CIPH 4X9BA 3U83A 3ROOA 1VHPA 1JL8A 3KYKL 5HHOB 5JQ6L 2V5SA 1AXSB 4FXGB 2LE9A 1BBJA 2HT3C 4JFHD 4IIQC 4LSDA 1KB5B 5HVHB 5F3BB 3PP3H 1MRFL 4NUGH 3VFVB 1ZHBA 2W9EH 3EJJX 3NABL 3AREA 2QADD 4NNPH 1S8DB 5BO1H 1WITA 1PY4A 4WV1A 3VA2C 4XHQA 3QDGA 5JZ7D 3IKCA 5I1CH 2WUBL 1FG9C 3DUHA 3P9LB 3UC0H 2MQ3A 1H3UA 3GHBH 1S5HA 2E9WA 2A9NL 3QIWA 3V4VH 5C92A 1EGJL 1FL3B 2WBKA 5BVJA 1HILB 1D9KB 1KOAA 4JPIA 2DIBA 5JW4N 1DUZA 4G6KL 4RMRA 1AQKH 3FMGH 4F2MA 1FL6A 4GXUN 1D5MB 2O5YH 1GSMA 3FO9A 4AZ8A 1BFVH 1ZT1A 1GZQA 4PJHB 1ZSDB 4I18B 1CGVA 3O0RH 5J6GA 4HH9B 4NO0B 1CLZH 2VLRE 1F4HA 3QHZL 1FSKC 3NA9L 3PWPA 3DOSA 5GGRB 2J6EL 2GJZB 4JHWH 3K4AA 3UBXB 5F7HA 5C86A 4QT5A 5GGTA 1Y6KR 3L3GB 4NFBA 3MV9E 4K23L 5C7XH 3MLWL 2FJGB 4OCYL 3J7HA 4PJ7B 4PJ9C 1MCWM 1ZEAL 5IB1B 3WEXB 4PJ7E 3MRCB 1MJ7L 3OR6B 4U1GB 2BXYA 3VFGH 5E5RB 1JI2A 3Q3GB 5D1QA 4GKZB 3VE0A 4J4PD 4PJAF 1YMHB 1ZGLB 4NQXA 1EUTA 3HG1E 5DJ2A 4EDWH 4PJ5D 4MAYA 4D0BA 4X4MA 5HGGS 1CF8L 4ONGH 4BZ1H 3CX5J 3HZVA 1B2WH 1INEL 4ZOEA 4X9FA 1KF9B 4TRPL 5D1XB 3O2VH 2D2OA 4BFBD 2V9TA 1IC7L 2XA3A 4JJ5A 3LKNA 2AQ1A 3WFHB 1NBVH 2YOCA 5E03A 2YPVL 5EOCL 3REWB 4FQPA 4GAGH 3QQ3B 1JWUB 2YD7A 1C5BH 5TDPB 3WEXA 1G0XA 1GGIH 1KXTB 2X4UB 3T04D 5I1JL 4K71C 4HWBH 1RZ8B 4MNGE 1U8LB 1MREH 3L3HB 3LIZL 4NQDB 2PO6C 3QCVL 3OX8B 1K2DB 4PY8I 4IOIA 4W6WB 5ICXB 5K9QG 1Z6JT 5F1KC 2WMPA 2G75B 2G2RB 4KKLC 3MBED 5FKAB 3T3ME 3V0VB 1L9NA 5HYSG 1Z5LB 5C09B 3MRRA 5GSRA 4ZFOL 3JZ7A 5I30L 4M7ZC 2F5AH 3DRTB 3UYRH 5DTFB 4I5BA 2FBOJ 5E99L 3F7VA 1IT9H 2FIRT 1CL7H 3T65B 1CR9L 2FD6H 3U1SH 3MCLH 3ZE0F 3HG1B 2J4WH 5TE7H 1JI1A 1IAIL 2HJKB 4JKLA 4XNYL 4XMKL 4XP6H 4XPTH 4ODHL 1A6WL 5L2JA 4QRRA 3VGBA 3CMOL 1JZ6A 3HG1D 5MENB 3FHQA 2QKIB 2IF7A 4P2RD 5EC2B 4Z8FH 4Z95H 5BZWB 3OZ9L 5ADPL 5BS0D 1LEKB 4Y8AA 5I75B 5GRYA 2DLFH 1OT2A 2RQ8A 1FZKA 4YDLC 2YUXA 5EBMB 1MHHA 5DYOA 3JWDH 4P48A 1KGCD 4JO3L 5E95B 3O2DL 4Z18A 4ODVH 3WUWA 1IC7H 1NSNL 3B83A 4HEPG 1U91B 3G9AB 2H32H 4LPWA 4YZFE 5CJ5A 3MCKA 4NNYB 1U58B 4EQ3A 1P4IH 2IAMB 5FCUL 5DQ9B 1D6VH 3VXTA 3LAFA 2HRPH 4ZO8A 3EDJA 1CDIA 1XF5A 3ARGB 4I3SH 4JHAL 4L3ED 2V9RA 5CLTA 3SDAA 2X1QA 1CBVL 1QLFB 2ZOKA 4M8VA 5F7FA 1AIFB 5SV3A 5ETUB 3ZDXE 2LAAA 1JTTA 4NN5B 3MYZA 2GFBB 4RGNE 2EDYA 1NC2D 4MHHI 4W70A 4MJIE 1JGVL 3RU8L 1EEZB 4KZEL 4C4KO 4UV4L 1ZWIA 4IOIB 3NZ8B 1IGIL 1MH5A 3ZYOA 2R39A 1S9KC 2XZQL 1WJ3A 5DXWA 1IC5L 1WBYA 4OZHE 4JDZB 3NA9H 4H5SB 5C08D 2EC9T 3OR7A 1CGSH 2H8PB 4X6DA 1CD9B 3GJEA 5FYLH 5DD5L 3F5WA 3QXTA 3S37X 1MFEL 4GRWE 4MQTB 4PTTB 5DD0L 4U6VH 3C6SB 2NY1C 3OAUH 1FFOB 1MWAA 4Z7VF 1I85A 3QO1A 4PGDA 3WJLC 43CAB 4MXWL 4QXTB 3DUSA 4OLYH 3S97C 1QD0A 2ZNWA 4ZSOE 1U8NB 3QHTC 5D1QB 1U8JA 3C8DA 4MZ2A 1U36A 4YR6A 3L5WB 4NCC1 1JBJA 2PW2B 4ZOBA 3D0LB 3P9LA 5HSFA 4PRHB 4WJ5A 5HGBB 1SHMA 2H9GB 4H0GA 1FL5B 1PX3A 3ELAT 1OP3K 3SKNB 2X6MA 4PP2B 5DHVA 1NFIB 3GGWA 4LLUA 5IVNA 3FQNA 3VFPA 1IFHH 5DFWH 3BH9B 1I8MA 4G80B 4NN7C 5GGRA 4L8DA 3TGXA 5F7UA 4NO5B 2W9EL 1DQML 4Z7VA 2HYMA 3UCRA 1V8HA 2NXZB 4UBDD 4KHXL 3S8WA 3X3FH 5E6IA 1ONQA 2X1PA 5KSVA 1W0WA 4OLEA 4MAYD 4LLYA 3GIVB 1A6ZB 2VLMD 5CGYC 4LPCA 1AGDB 3IS1X 3TT3H 4J4PA 3ZLQC 5IWLA 2F53A 5EU6A 1N7MH 1T2JA 2YUVA 3JWOC 5LG1A 1KJMA 4GG6B 3UYOD 1AGBA 4LCWA 4Y1AA 1T0PB 2PR4H 4Y4HB 1NUGA 1X4XA 2WQ8A 3GBMH 4JN1L 4ODWB 1MVUB 4MDIB 3DYPA 4J23A 4Z6AT 5KS9B 2WLYA 5J12C 4LSVL 2NY6B 1AC0A 3BQUB 3AM8C 2VSCA 3M8OH 4N8VB 1G6RH 4EZMA 3RY6C 5IW3A 4CVUA 1CG9B 4PP1C 4G7VH 3QCUH 4UV4H 4H0HB 1ADQL 4JDTH 5GS1B 1WAAA 5IVZB 4MJ6A 1F02I 3BGFB 3SGDI 2G60H 4G8GB 3MXWL 5DK0A 4TSCH 2M8XA 3MLTB 4OKVA 4GRLB 1M7DB 4PY7B 1RK0B 3PDOB 3CSBA 3PP4H 2XPGA 4HIEB 2CGRH 3NIDE 4LHUA 1NCWH 5F72S 5JHDA 3TBWB 1UWGL 1IAKB 3LPFA 1T04B 3QIWC 4L9LC 1QFOA 3PWLB 4YQXL 2YSSB 4XGZA 3GB7B 1N0LA 4Z7NF 1FV1B 4NM4L 1DLHB 2K1MA 3D2UD 3BN9C 2DQHH 4BFGA 3L3KA 4X8XA 5D7LE 1EJ6A 4XI5C 4KI5C 1EHLH 3AS0A 1ZHBB 3HI1B 4DN4L 3IFLH 2YD6A 2W0FA 2DLFL 3VW3H 1YNKH 5TJWK 4EI6B 3Q5YA 5J06A 1YMMB 5DJAA 4M1CD 1AHWB 5CS7A 4GLRH 4ZDHA 4R7NB 3EYFB 2UWEB 1Z3GH 1NCTA 2R8SH 3B4NA 2F5BH 3C5SB 1S7XA 4KI1A 5FXCH 3NCFB 2MOVA 5CGTA 1OARH 1XGTA 2FHBA 5GGUB 4HG4J 4NQCA 2W91A 3G6AB 2GY5A 3AMKA 2J4WL 4RMTA 3U0PB 1RJYA 2JK5A 3MJ8B 4MA1C 1UGNA 1XR8B 4HX1A 2AJ3A 3MGAA 1UJTA 3N9GL 4CNIB 4Y5VB 1WK0A 3RWCB 4B41A 3JWOH 5DZNA 5E99H 1N6QH 5MERB 1H3VA 3EO1A 4UOW0 5EFIA 4KKCD 4JHBA 4M00A 5IFHH 2YPLE 2JTDA 4OGYH 4JFED 4XP1H 2PTTB 4JEGB 2BNQA 2VDLL 3C9NA 3GKWH 4OZGE 2X4OB 1LWRA 2FNBA 1U8HB 2ZPKH 4RISL 2VXUH 1HHKA 1PBYA 3RJQB 3UTPE 1EHXA 1FNFA 1C5BL 4P4RB 2DD8H 3KPRD 4UTAL 1TVHA 1UACL 1KEGH 4MXVE 1CICC 2P7TB 4WTXA 3SE8H 4PIRF 5HD8D 1G7QB 2XFXA 4KI5D 2FECI 3NACH 4MD5B 4NQSB 2IH3B 3NIFF 5KJRL 2LU7A 2ADJA 3NMEA 2ITCA 2J7LA 3FONA 4XB7A 5IHZB 1DBKL 4DKFL 4HT1L 4QXGL 5D72L 3D0VA 4EOWH 4QY8B 2GJ6A 4WHTA 2PXYD 4DVRH 1HHGB 4N8PA 4CVWA 5GRJL 1R5IA 4ZFOB 5LBSL 4I3GA 4PG9B 3QDJD 2EEBA 3PHOA 2F8VA 1WBYB 2CK0H 5DQDL 1AXTL 4P5TB 1YJDC 1TNNA 5EO0B 3RI5F 3U4EA 3HTLX 4PJGA 4K9EL 4PR5B 3INUL 3OKLA 4FQ2H 1RULH 3O4LB 2Q7YB 4CU6A 4DGIL 5K93A 4YEEA 2Q76A 4L4VB 4EDXA 4DZBA 4WHDA 2FHCA 4ELME 3Q1SL 1GGYA 3STLA 1QACA 4Y5YC 4ELMB 1Q9KB 3TNMA 3WO3B 3VMNA 2FATH 3BEVA 4I0PD 2FGZA 4X4YB 2ESVB 2GTZB 5I73B 1OD9A 3KJ6H 1JNJA 3U7YL 4NWTH 1BBDH 3VWKC 3D9AH 4LCUB 3KLDA 5I19L 5SV4A 3QIBA 3KJ4C 1SJHA 3PV6A 3KJ6L 4HJ0C 2V5TA 3VFUB 4JY6A 1IM9B 2AJYH 4GKNA 2R69L 1OGAA 1O5DT 5EC1A 1QKZH 1LO2L 5IVOA 2A9NH 2Y6SC 3RIFK 2ID5A 2Y23A 4K7PL 3LEVH 3EOTL 1JNNH 3C08H 1Q1JH 2C3XA 4GRMA 1VA9A 3MRKA 1G6RA 5DJYA 4DVRL 1QFWM 5IG7A 2I60L 4OAWA 3KNBB 5DD1L 1JE6A 4MCYA 3WNLA 4WI9A 5E1AB 2J5LC 1NGWB 4OFKA 3F7YB 2VNCA 2HAZA 2WBJD 3HE7C 2UUDK 2VQ1A 4D0CB 1OCWH 1UH2A 4UNUA 1ROWA 2XICA 5B4MC 5SWZD 4PJEA 2J6EA 3GSNA 4JO1H 2ZSVA 4L8SC 4WTZG 3H9HB 5HHQB 2YD3A 5ETUA 1JHLL 4X4XB 1W0WB 4G3YH 1MCLA 5ABDE 2VERN 4PTUA 4GOSA 5EUOA 2XI9A 4N0RA 4M48L 2BHYA 1NGXA 1OL0A 4LHJB 5E7BA 5D9SA 3VFMB 3CPLB 4RMSA 4I77H 3V5HA 1BVKB 2VDLH 2VDMH 4QTIH 5FA3A 3TBVB 3L7EA 1BFOA 4FFZH 5C08A 2E7HA 3DXAD 1LK2B 2NY6C 2R1YA 2ZCLH 5E00B 1FFNB 5LGHL 5EPMA 3X11A 1FNSH 3FQTB 1J18A 4M6ML 3MLXL 1DVFB 3DV4B 4LPUA 4KI5E 1XZ0B 5TPWH 5HHPA 5HI4C 5I6XC 3FJTA 3STLB 3U36B 4Y5XB 3QSKB 3SGJC 3WHE0 2P8LA 1T0NB 2XY2A 2ADFH 3C2AH 4P2RB 4GAYB 3S34H 1T7WA 4FNLL 1E27B 5IGXH 4PRIE 1EFQA 3RFZC 5AUMA 5MEPA 4GW4A 3OKLB 2DLHA 3NH7H 3HPJB 3QNXA 4XCCL 4YHPB 1A1NA 3VFMA 43CAA 4P57B 1IM9A 3DRQA 4FFVD 5SWSD 1HIMH 4JFDB 5GHWL 3MRQA 5F71A 4P2OD 4XNZB 1MREL 2IPKA 2QSCL 3C6LC 4ZNCD 4GBXD 4HWBL 2AI0L 1F8TH 3I6KA 3H9HA 4KROD 4U1LB 3DBXB 5JDSB 5L6YL 3QAZB 1UM4L 4DCQB 2ESVA 3ZDXF 3BP7A 4PV8A 3THMH 1PVHA 3N85H 3RPIA 3DX9B 4PB9H 1QFWL 2J8UB 4JRXA 4XP9H 1DQJB 5D2NC 5I74B 5AD0B 3W2DH 5GGVH 5D7JB 2B4CC 4NPYA 2O93L 5AD0A 4A6YH 1LK2A 5L0QB 4OF6A 1GGUA 2XTLA 4HIXL 4HKZB 4Q2ZB 5CCKL 4RFEB 5MENE 1FPTL 2JE8A 4OZHF 3RA7H 1F3RB 2D7OA 1IEBB 4UUJA 4E41E 3MV8A 5F9JB 5D93B 1DBBL 3GJFK 3S35H 3WXVH 4EN3A 1MRCH 2V2XA 2I9LB 1MFDH 3G5YB 3VWJA 3HZYA 4XWGH 1WT5C 4GW1B 1FYHB 4I9WD 1UXWA 4OCYH 3WDIA 3QNZB 4R4BB 3CZFB 4PJAE 1NANH 5EZOL 3VXSE 3TBVA 1QRNE 4JKKA 4UOW1 4G6AC 3ZKMD 3D39B 3P4NB 1CVRA 4YE4H 3MRNB 4TTDC 5GGRY 3MBEA 4CNIA 3WIHA 3GBML 1F4YL 3QDGB 4O4YH 5IJKC 4YPGB 2XG5A 3FQWB 5T1DL 1FORL 1PG7L 1A4JB 2FIKA 1A7PH 3QFJE 1J1PL 3I2CH 3ALWA 5F9DC 5FV2A 4RGNB 1HHHA 1XGTB 1QG3A 3KS0J 2JCCB 2NY2D 2OMBA 1TCRA 3QJHB 1NAML 1X4YA 5FA3B 4ZOAA 2F58L 2AJUH 3FMGL 1HSBB 3D85D 2X4UA 2YPKA 1A9EA 4R26L 4EI6A 1UFUA 1NGPH 2O5XH 1GAFL 4PYHA 3T3PF 4JKWA 5JORA 3VFNB 1SEQH 4RGMC 3MRKB 5C0DB 4PD4J 5MERA 3B9KA 5CHNB 1GZQB 1A7NL 1KCVL 1FYTD 4JO2L 5HVGB 2R0LL 3NCBB 4OF0A 4KV5E 5JOFA 1TENA 1RVFL 1TDQA 4GRLD 2XXMB 2HVJB 4TNVK 2LV4A 5I17B 5E56A 2BRRL 3UTTE 2B20A 1J5OH 4LVEA 2QHRH 3HCVB 2G2RA 4LARL 1NMBL 3BSZL 3EYQC 1NBZA 3ARFB 3WO4B 3OJVC 1IFHL 4GAJL 3C09C 4ZDHB 5JQ6H 5D70L 2Q8BH 4W4OC 4A2MA 1D5XB 3U0WH 4NC2B 3E1F1 1I4FB 4AEIL 1RZJC 3FOLA 2V2WB 5JNYB 1I1CA 3BO8B 4YDLB 2EZ0D 4JPWH 5JLZB 1KJ2H 4UI2A 1S7UB 4DKEH 4PLOB 3QFDB 5I1EH 1YY8A 3R4DA 3CFCL 4KUCD 1UADC 4LCYB 1FPTH 5IROA 5C6WH 4AL8H 4OT1H 4IM8A 2AJVH 5C0AA 2AQ2A 3I2CL 1UA6L 1ZT1B 1GL4B 2X4RA 1OAXH 4Z0XB 2MPAL 3A67H 1Q9KA 4S1RL 1K5NB 1RK0A 3PDOA 2P8PA 3HNVH 4HGMA 2WIMA 3TN0C 1F3JA 1QBML 1S9VB 1AFVL 3GJFH 2F8OA 4GQPH 1D5ZA 5AWNH 3HB3D 1YPZB 5DJZB 4OD1H 1IKNA 3RU8H 5KAQF 4PRIB 2BSTB 1AGDA 2W0LA 5I1LA 1RJLA 5GS0C 5JUEH 4OZIA 3QXWA 5IB5A 1QLRA 1G7LB 2OJZH 4YGVA 3V6OC 4R2GB 5BV7H 4O9HL 3RUGA 2WINB 4PYGA 4EI5C 2E3VA 2YA2A 3MGOB 2LTQB 4S1QH 4KVNL 5D5ME 4XTRD 2R2EB 3GMPA 3SKOA 3L3DA 3EDKA 2R2EA 5DSCB 1RFDL 3IDIB 4U0RC 1JIBA 4KRPD 3VXMD 2Q3AA 2GAZA 4EVNB 3SKNA 3AY4A 1HH9A 1MJJB 2MKWA 1MJ8H 3I02A 3GMQB 2H9GA 4K3DL 5KVFH 1HN1A 3V6ZB 5IHZA 5C0CE 1GC1H 3HRPA 4OD2B 5GJTH 1AO7B 5DRXA 3DVGA 1KLFA 3UXFA 3KPSA 3FQRA 1AO7E 4MMXC 2XZZA 3OPZH 1X7QB 2EYSA 4R2GD 5IVXA 3EOAA 2H6PB 4R7NA 2CR6A 4NZTL 2EDFA 3O3AA 3AREC 4M43L 2P24A 4WUUB 2VUYA 3UAJC 2A6DA 1ZA6B 2FLRT 4CDHA 5FUOL 1ZLUK 2ITDA 1MCIA 1YNTB 4JFEB 4KTEH 3Q6GH 4U0QB 3OXSB 5MEQB 3FB8A 5T1LB 1IGTB 2XWJA 4LLWA 1G9MH 3VFVA 5HI3D 5E8OB 1XGPA 5FM5M 4RX4D 3DARA 4U2YA 1HQRB 4YHML 1A0QH 3WJJC 5T3XL 1EAJA 2UY7A 4JFPA 3NFNA 2N4IA 4N68A 4TUKH 5LVEA 3FQRB 4QOKA 3IFOA 4HJJL 2B4CL 2R1WB 4PJXE 1AGEB 2WUCL 3WS6A 5DQJB 1T7XA 1F4WH 1G0YR 3HB3C 4LARH 4Z76B 2LVCA 1T1YA 1BZ9B 3OKDB 1QFUH 4CJ0A 4NBXB 4FMKA 5IVZA 4JY4B 1BFSA 3WE6A 2ZCLL 1IGCH 5B38B 4PUBH 4BM7A 3GUTB 4XAKD 2JJSC 1QLFA 1H8OA 3WV0A 2C7UB 3WMSA 1S7VB 3DMMD 3C5JA 4NQVB 3MRJB 1WFNA 1EFXD 2NX5A 5DEFA 3KPMB 3SE9L 4DVBA 5J1AA 5CSZB 4ORZC 4M02A 5GISL 2UY6A 2GY7B 5ERWA 3KPRB 1WBZB 4R0LC 2PO6B 5HVHC 5FA4A 2JIXA 4M8QB 4EDWL 2K7PA 1I9IL 2VZVA 4HCRA 1NC4D 3O2VL 4JJHA 1DE4A 1L0YA 5E2WL 4Z77B 3UTZA 4KPHL 3TJHC 5FB8A 2EEAA 4ZTPH 1QSZA 4M9PA 3SBWA 5JA9A 1C16B 5FECB 2PCPB 3RIAK 5ESAB 4KK5C 5D6CB 3TO2B 4YHIA 3RDTC 5FF6B 1D5BA 2WWMC 3KYOB 4K7PH 5JW4R 1UM6H 1CCZA 5EZOH 5JLZA 5DR5H 1Y0LB 2BHUA 4YO0B 2PYED 3HZMB 4HIIB 1QKZL 2CK0L 3SDXA 3K8KA 4NHUB 5DMIL 3G04A 4WEBH 4OFYA 2X4TA 5F9OL 1LE5B 5SX4I 4PJGF 5JORB 2XQYG 1CFQB 4KMTL 2PYEB 4KKCC 4Y4KA 2EDWA 3DYMA 4J3SA 5C09A 2BY0A 4XAKE 1D5IH 3Q2CA 4QRSA 3BX7C 5D71L 1L0QA 1OWRM 1HQ4A 2YPLB 4B53A 1BFVL 4A6YL 4XVSH 2E7LC 2A9MH 3V5DB 4LL9A 1B0GA 4U6YA 2HG5A 3CH8A 1IL1A 2EDDA 2FB4H 5HJ3B 4FQ2L 1G6VK 3QXDB 4W6XB 3QNYB 4HW6A 5I8EB 4EIZC 1XF5B 5DO2C 1DBJH 3KHQA 5EOTA 2EDLA 2O5ZH 3NCJH 3U6RB 5AEAA 5D7SL 2J8UE 2YRLA 1U8NA 2UWEF 4PJ8D 1QO3A 3NABH 1FYTA 2AI0H 5F3HB 2OTUA 3Q5OA 5J13C 5FYJD 1KC5H 4KROB 3GO1L 3U46B 2F19H 3QUKA 5FGSA 5ESVA 1HCVA 4DGYH 3SCMC 2GTWA 4PJDB 5C0IB 4JM2A 3MRDB 4EBQL 4TUJB 1UKTA 4XBPA 5KG9B 4HUVB 3QWRD 3GI8H 3ZTNL 2ICWJ 3FRPA 3MRDA 5EC2A 3SE3C 2VDNL 4D9LL 3RWIB 3IETA 5C6TH 1MHPL 1D7FA 2P5EB 4FQJH 2OLDA 1QR1A 4P3DB 1X5HA 2HJKA 5E8DH 12E8H 1FIGL 3SDXF 3QIUC 1MSPA 1LEIB 4GSDL 4KUCF 1PYWA 2JJSA 1ZK9A 4JG1H 1P7QA 2YEZA 4ZNEA 1ZXQA 3NPSB 4M48H 4J3UA 2NW3B 1D5MA 3DRTA 3T2PA 3RY5A 1HHJA 1YYMH 4LPYA 4GBXB 5DVKA 5JHLH 2XYCA 2VL4A 1RFDH 3D3VA 4NRXA 2ARJQ 3MJ9L 4P3WA 4PJ9B 1A5FL 4UINH 3UTSD 3ZDYF 5JW5A 4XC1H 3D18B 3U48A 35C8H 4ZS7H 5DA4A 4QRRB 5ADOL 4LKXB 1JWUA 4WW2C 5T5FL 3EO0A 1F11B 1H15A 2CIKA 5D7SH 5L2KB 2HT2D 4JG0H 3FB5B 2DWEB 2ZOKB 4LDEB 3LQAC 3U6RA 3SOBH 2EIBA 5C2BL 3C5ZA 4L8BA 3L95A 4DGVL 4PV9A 5I18L 4YHOL 1A7OL 4N5ED 4Z5RB 3L7EB 4XC1L 2H1PL 4XCFL 3A0OA 2VN7A 1U8OA 2DQGL 3G5ZA 3HLAA 3RVWC 3H9SA 4NN7B 1FNEA 3Q6FA 2N7BA 1KPVA 2ATPB 5KTEH 5ACMA 4JM2F 1UWXH 2IGFH 5C0ND 5IQ7H 2YRPA 5DUMH 4JFOB 1KJ2L 3MLVH 3QISA 4X5XA 4LEXL 5F9JA 4YFLI 4XBPB 5F7MC 1AJ7H 1VGKB 3B9AA 5HYSB 5I76B 1CGUA 3ULVC 4F33A 2ARWA 3ZHLA 5IBLC 3IJHA 2AKRB 5BVPL 5E8PA 3WKML 3ZSTA 1A7RL 4Y4KD 4HQQL 3LPGA 3BMVA 4J1UA 5IG7B 3TYGH 3CDYA 4JM2D 5FEBA 3KXFA 3ROLB 2A0LC 5HGHA 3O9WA 4EI5A 5C8JA 4G6JL 2VLJD 2APFA 1AY1H 2BNUA 4MLSA 1UC6A 2X70B 2VLJE 4UNTA 2IFFH 4G8FB 5DQDH 2C3HA 3IU4H 1CFNB 1OGTB 1NFDF 2VLJB 1OY3B 4UQ2A 3OXRB 1C7TA 3LQZA 2VISA 3TN0D 1KPUB 2GJ6B 3KYAA 3TVMA 1ES0B 5A2JH 4XT1C 4YHLL 3TIDA 4BH8B 1E4KA 3BPNC 1RURL 3F8UB 3NCJL 5DFVC 1VPOH 1IKFH 2X9WA 3TT3L 3LKOB 1TJHH 1IL1B 3VD5A 4BK5A 2LQRA 2P7TA 3LB6D 1AGFB 2X4TB 3C5JB 4QXWA 1KTLB 1UQSB 1J0YA 4HWZA 4QO1A 2ICWI 3EDEA 3U4BL 1I1RA 5CUSH 2FR4B 3QIUA 5TFSL 4O4YL 2IAND 3V5HB 2LU3A 4MAYB 2ZNXA 2HTKC 2IQ9L 4OFYD 3GKWL 2V7HB 2VXQL 5JOPD 4Z7QF 3RX5A 4L9LA 2BOCA 1GGTA 3CXHK 5HHQA 2VC2H 4OLWH 3NTCL 1J8HE 4NQVA 5FDYA 3W11D 3B5HA 1DEEB 3TLRA 4WW1B 5M7QA 4F7MB 3FO9B 4XWGL 2VZUA 3H0TA 4HXBL 4KTDL 1FLRL 5FF6A 2HH0L 4OGZA 1AY1L 1TMCB 1CD1B 4ZAKB 4X7DC 1MWAL 4BKLB 4NKQB 5MEQA 4FA8A 1GYAA 5HDOA 5FUOH 5HHMD 2BC4B 3LCYA 2HN7B 3GIZH 5HYEA 1X5LA 3UTOA 5KSBB 3FFCE 2IADB 5CP3H 1R3IH 4Z77A 4HJGB 4P3CH 2PW1A 3O4OB 5FYLL 1FBIH 1S7TA 5CBEA 4MB5A 2HMIC 1J0KA 5HHOA 4K7PX 3BGAA 1QEWB 1JVKA 5ISZE 2FH8A 4L1HA 2Y7QA 2X41A 1YN7B 2J8UF 4ZS6C 3ARXA 4HKXA 3O3BB 4DWHA 1T1YB 3EKCA 4UTBL 3BPNB 3VFUA 3L5HA 5IQ7L 5LWYH 2ARJB 4DEPC 1IGFL 4N5EC 1FVDB 2X4SB 2A2QT 1OTTC 5IMLB 2PXYA 3P9WB 2CLVA 3DGGB 1CU4L 3TO4A 1UB5B 4LEOB 3TT1L 4X6FA 3GUTA 1ERNA 4Q9CA 4PY7A 1R5VA 1A7OH 1UZ6F 1LE9A 4Q0XL 4RGNC 3F7RA 3VXMA 1FGVH 4PRAA 5HHOD 1BD2E 4O9HH 2KZWA 4HZAA 5CKGA 4QHLA 1FZOA 2FD6L 4JFFB 4H8WH 3F58L 4UT7H 3DXAE 2ITDB 3GMQA 5F3BA 1ZANH 4AEFA 3GNMH 1U2HA 4EVNA 1FNGA 1X5KA 3QCUL 3VXNB 4H26B 3BZ4B 1CFBA 1QBMH 4N8VA 4Y16D 4H25A 4PLKC 5CEZD 5DS8B 4CVXB 3BPLB 3RDTD 5ALBH 2EECA 1WSST 3DVGB 3OAYK 3DGGA 3TO4B 2EO1A 4WGVB 3E3QE 2FX8H 5MP6H 4AH2B 1Z9OA 1QLRB 3CXHJ 4O2EA 3HA0A 4N8CL 4QHUA 4OLZL 3TEUA 1BZ9A 3OKDA 1KBGH 4KK9D 1QQDA 1G7MB 3JBG7 5K9OB 1BQSA 4L4VE 4Y4FB 3MLRL 3OKYA 4IEFB 1RHHA 3PP3K 2EE2A 4LLQB 4FXKA 3I3EA 4S2SB 5AZEH 2ZCKL 2Y06L 3BPLC 5F6HJ 1X5FA 2JJVA 2X4RB 4NQCD 2VB5A 1XGQB 1WC7A 5C6TL 1SJXA 5GSVA 1CL7L 3T77B 2CR3A 5CP7B 1N6VA 4FTVE 4U1HA 2IPTL 1BECA 3JVGA 1YNLL 3BT2H 4QHLB 4UILL 2EDOA 3C9NB 1CI5A 1D5ZB 1FH5L 3P4MB 1T83C 1MCQA 3HS0A 5EZLA 5D7IB 5DRZA 1A7NH 4QGYA 2E8YA 1WCBA 5F70A 3TIEA 2HFEA 5D7IE 4U33A 4FFYH 5IT2L 2PXYB 3SGJA 1S5IL 2FWOB 1R3JB 3RJDA 4F37K 3I84A 5I1GH 4IBLT 4XXDB 2Z4QA 3WLBB 5HHVH 4OI7A 3UZVB 1JGDB 5JHDD 1R6VA 4YLQT 4JM4L 4M7LT 4NWTL 1G9NC 1EAPB 3RTQD 1F6LL 5FUZH 1I7RB 3QHZH 5DJ0A 2DQTL 1N64L 5CEZH 2R2HA 1NAKH 3FFCB 3QIUB 2BFVH 4M7JL 2QEJA 1S7TB 3ARUA 1OAXL 1ACYL 2W60B 1F4YH 5GRZA 1HNGA 1IC1A 3TH3T 2QLVB 1RUQH 2N1KA 3N1PC 4S0SD 2EDXA 1P4BH 2Q6WA 1MF2H 5JA8B 4OBSA 4GMSH 2A73B 1B0WA 2IEPA 4HPYL 1NKOA 5F1NB 1LO3H 5DMKA 4RAUA 3GSRB 3K74B 4HIHA 5LGJB 3QWQB 1E6OL 1UXSA 1PG7X 4FG6C 4CN4A 5L88H 2C1OB 1A2YB 1EEZA 4F15B 3D0LA 4J3TA 1RZGB 5HYIA 1PQZA 1KPRB 3S98A 3NFSL 5CILL 4LQFH 5T3ZH 4KKBD 4GAJH 4GRLA 3QUYC 5C07B 2AJXH 2CKBH 3CFEA 2BNUB 4HZLA 4JFFE 3PL6C 1HEZB 1P7KA 5D1ZC 1VB9A 4HKZA 4Q2ZA 4EN3D 3B6SA 2NYYD 2MMXA 3AXLA 2EDBA 1HHHB 5JXEC 4XC3H 3MV8D 5EOCJ 4JZNA 2QQLL 3F5WB 5F7WC 2A6JB 2GCYB 1QYGL 4YAQB 5E5MA 1KT2A 1AI1L 5JNYA 5I2IA 1QFHA 1NGQH 1P5VA 3G5YA 3ULVH 5H2BA 3BOVA 1E4KC 4JM4H 4HD9A 3UTSA 3O8XB 1PEWA 4NNXB 4QHMA 1UM4H 5HHVL 2CUMA 4JFYA 4RNRB 4C4KT 4E42A 3TVMC 5C6PB 4KJWD 2Y25A 4Z7WB 1UM5L 3D3VD 1MI5B 2HFFA 5FK9A 3A6OA 2BERA 3IDNB 3E3QC 3QG6A 3AMLA 1NMAH 3E2HB 4OF8A 1XCQB 2AXGB 4FG6D 2J88L 5C0NC 4IRZH 5IR1A 3S6CA 2CRIA 4YXKH 4MCZB 4Q9RL 3RVWD 4F9PC 2CSPA 4KMLB 2VDOL 1IGCL 3EJYD 1IAIH 3O11A 4P2OA 4GMTL 3VXOA 3VCLA 3NPSC 3U1SL 2OTPA 4RCAA 2ADFL 2G5RA 2CLZB 3GSNB 1F4WL 3GSXB 4TQEL 5F6IC 1YECH 4X4ZA 4FZEL 3W82A 3EYQD 1OHQA 2C3VA 5DJDA 5I71B 2Y6SD 2NZ9D 3MLXH 2CIKB 2F5AL 1I9RH 1R0AL 5CBAA 1IEHA 2P48B 2DMCA 4WI7A 1QR1B 1IQWL 1GGCH 1PD6A 5ID0B 5T33L 3RBSA 1G6RB 5FO8A 1MCSA 1YYLH 1WIOA 4U1SB 4PJDE 2DDQL 1L6ZA 1H5BC 4Y4KB 4DN3L 3OTTA 2VLKD 1EZVX 3MBEB 1HH6B 1T89C 2AS5M 4JJ5B 3QUZB 1RMFH 1BAFH 3RZCA 5J13B 3MR9A 1LEGB 2C26A 3S36H 1JUFB 4DW2L 4GKSB 3V4UL 5BW7A 1T03L 2YC1A 2XA8H 3QIBB 4GW4B 2NR6C 4LSTH 1FBIL 2XTJD 2NXYD 5I15L 2E5EA 5DHXB 4JFEE 3ULUE 5BRZE 1CZ8L 1SY6H 3HUJF 4KJYB 4PJIA 3VRIA 2R1XB 5EUKB 3OJMB 1KSRA 3HC3L 1GPOL 4LAJH 1XGUA 4IRSC 1UENA 2ZSVB 5GHWH 3ULVE 1HIML 4OLVL 4XMLH 5D4QA 5IR1B 4PJ7A 3EOBA 3QEUB 1CXIA 5JIHA 2R69H 3RVXD 3FO2A 4S1QL 4WDIA 3EOBB 1ZE3C 3LQMA 3TC9A 2GITB 3CCHA 5H35B 5IFAH 2M1KA 5C0JB 3BRDA 2RFXB 4P2RA 2FO1A 4P4KB 4ZPVB 1FC2D 3DYOA 3HG1A 4DQOH 1BBDL 5I19H 1U3HB 4X4ME 5D1QC 2DYPD 3ECBB 4ESKA 3BKYH 3IGAB 1IJ9A 2NXZD 5D1XA 3OL2A 2C7UA 4L5FL 2CQVA 2X9YA 5ILTH 3O3DB 4U1KB 3ZZ1A 4UMGA 3DROB 3EYSL 1ZV5A 2Z31C 2OZ4A 1WIPA 2IPKB 4HIHB 5LGJA 4F57L 3HMWH 3VGGA 3IYLW 2HJLB 2XNAA 3PWJB 4CMMA 4PTUB 4XPHH 2UVEA 1CXEA 3E6FA 3LN5B 5EG6C 1NC4A 3WUWG 1RZ8A 2C9AA 3QQ9C 3WN5A 5GQBA 5L8LB 3UJJL 5EO9B 5BOZG 5I1KH 1HQRA 4FHBD 1OTUD 4UB0L 5J4MA 5KVGL 3U36A 1MCKA 4OLWL 3HE7A 1HXYB 4PLKD 2FO4B 2G9HA 4XWOC 3O81A 2E7LA 2GCYA 2IBZX 2IFFL 4YAQA 2V2TA 3IDUA 3CVIH 3ALPA 3OB8A 3MX0A 4XNQB 2YZ1A 1NJ9B 4FP8L 1DBJL 5TFSH 4KY1H 3BP4A 5DEGB 4P9HH 5DJ2B 4LASH 2GJ6D 1RVFH 3GBNH 1F97A 4QRRE 1RZFL 1UACH 2B0SL 3DHMA 3ESUF 3OAUL 3B3IA 4WV1C 5FUCC 1PQZB 2JB5L 3ARFD 3O6ML 1SBSL 4CVZB 3L5IA 1KG0B 2AJYL 4NKDB 3R8BB 5D1QD 3MRHA 3MJ9A 4LNVA 1GOFA 5FOBB 2PO6A 3ARZA 3SGKA 1WV7T 5DC0A 1CFQA 5DRZB 2VAAA 3VXUB 1L7TH 1M7IB 4S0TD 4Z0BL 1II4E 5E8OA 4LCIH 5F9OH 3BIKB 4PG9A 4WI6A 4WV1B 1T1XA 1N5AB 3ZKMC 1NGZB 1E4JA 4C54A 4M1DL 1IAMA 2OP4H 1U9KA 2XTJE 5DJ6B 3H3PH 3WD5L 3TO2A 4KU1A 5FHBL 4I4WA 3TYGL 1WAAF 5JIKA 2GUOA 1KJVA 3FOMB 5ESAA 4U6XB 2ADJB 5EO0A 4YNYA 4ODXA 4Y8DC 2OK0H 2R0WL 3NOIA 1XT5A 4PRID 3TH4T 1XR9B 1FL3A 5BVJB 4FN0A 1UZ8A 1MIML 2Y1VA 2KKQA 4OD2A 5HPMA 4M7LH 4DW2H 3BIBX 2Z9TA 1RMFL 4POYA 4XAWH 2ZP0T 1DBAH 1VFBA 1I3VA 4UDUA 1YDPA 3BW9B 2IGFL 4Z7OF 4ZFZB 2DQIL 5IKCA 5FM4A 1J05B 4ZUSB 1YYLL 3ULUH 4X6DE 5ICYB 3BXNA 1NCAH 4D0DB 3BQUD 4Z8FL 5C3LD 4NZDA 3NACL 1CFSB 4MXQC 4YDKH 1UVQB 2KDGA 3TA3B 4TUOA 4PRPB 5INCA 5INDA 3SQBA 5TE4L 4LRIA 2EYSB 5B39G 2IADA 5EU7E 1T22B 3JV0A 4Y16B 4G42B 5TE7L 1HHKB 4PB9L 3OAZH 5DFVD 5ANMA 4F7CB 1RJYB 2G60L 5CWSB 4LHUD 3PE9A 3WN5C 1EAPA 1YN6B 3EFDH 3NPZB 2WUCH 2DL2A 5I8OH 1N3NA 4AIXA 1DR9A 1QHOA 5DQJA 3N1GC 4N1CA 2A6IB 2MCG1 3ZTJG 1E6JH 1VFUA 4XP1L 1BM3H 2P8MA 2MCPL 1G7HB 1Q9OB 3WFCL 1I1AB 1TITA 3N0PB 1QA9B 4TSAH 1S7RA 2NTSP 3MUGB 5JW3L 3BH9A 1VFMA 1HKLH 2W60A 4JN1H 1QFWI 1ED3A 5D1ZA 4S1SL 1GGIL 3SY0B 1CXHA 3ARQA 4UDUB 4Z7WF 2LU4A 4XCNB 1RZJH 4LHUG 5J0BA 1K85A 1CFVH 4P49A 4GH7B 2IWGA 2PO6D 1SM3L 1FNSL 2P24B 5T5NG 2UWEA 4GXUM 4GKOA 3V5KA 4YPJA 4LCWD 4K8RD 2ENYA 4OLXH 2DLEA 2NYYC 1R5VB 4EUPA 1XR9A 2A9ML 3NFPB 1BJ8A 5D2LE 2CRMA 3IT8D 4LCWE 3GSOB 3T0ED 4D9LH 2DQDL 2MQCA 5C0AB 3FQXB 3RWFA 5JR1L 3ZTNH 1TETH 4MZ3A 1PZUB 2GK0A 3JV4B 5F9WB 1VENA 5E2TL 2CKBL 3ULVF 3T0EB 3K0WA 2EZ0C 3QI9C 2OL3H 4XPFL 2H8PA 2EICA 3ABZA 1PY9A 2DKMA 4KMTH 2B5IC 3VD3A 3PGFH 5KOMC 3BJLA 4DZ8A 1FFPA 3PNWB 4FQXC 2V2XB 1OAQH 3AAZA 2D7TL 4CVXA 4JFDE 5BZDB 4QRTB 3GSNL 4HAGA 3QQNA 2DWDB 1LILA 2QADB 4XBEH 1HSBA 2OK0L 3OJDA 3H6JA 5DRNA 3DVIA 1I3RA 2WAHA 1I9JH 1R3HB 1OSPH 4NO3B 4MXWH 3BPOB 2HKFL 3PQYB 4UU9A 3KWWB 5GGVY 3H3PL 1LHZA 5T1KA 4URTB 5C9KA 3MYJB 1ACYH 3BVNA 4KWUA 4DOHB 4X7SL 5JHDE 2FEEI 4YPGA 1FVCB 1SJEB 1EMTL 3UTTB 2QQKH 4POZC 1UH4A 3KYNB 4ALAL 4YBQC 4QCIB 1AC6A 5FUZL 4F37F 4X5XB 2F53D 1H3PH 1I7UB 1FVDA 2DQFA 4JDZA 3VWJD 4PJCF 2XRAL 4NNYA 5J1SC 4L8DB 2DJUA 1HE7A 4M1CC 4YHNA 2BFVL 1CYGA 3MFFA 5C0BE 3VWJB 1YN7A 1I4FA 1RQ5A 4NO0D 1MCHA 4FS0A 2M2DA 4MMZC 2YPLD 2DQCH 4NQCE 4V1DB 1XGUB 5B3JF 4IRJA 1FHGA 5IB2A 4LASL 3INUH 1A22B 3ZHKA 2AABH 3RL2B 1KTDA 1NC2A 5FKPA 3B2VL 4KJQD 4L4VD 4RAVB 1A6TA 4QNPF 3VXQA 4IRSB 5J8OA 3S9DB 4KUZH 1XFPA 2YUZA 4ODWA 5FYJU 3CUPB 3P4OA 4Y4FC 1VGEL 5AAMA 1G7PA 4X98B 1ZTXH 4JPKH 5EZJB 3MACH 1P6FA 3EHBC 2BNQE 3LVEA 4OZGA 4O02H 1JWMB 3WXWL 2LVEA 4HT1H 4QXGH 1TTGA 2F9BT 3WNPA 1JWMA 3V79C 1IM3B 1ZT4A 5E1HB 2YUWA 3OZ9H 4HK0B 3PWVB 4NQEA 4PJBE 5ADPH 2YWYA 1CGTA 4WU5B 3E0GA 4NFDA 1N2RB 2JJTA 1ZLVH 4ZODA 3CFDA 1W8NA 4BZYA 4HCRH 4HKBA 3MNVB 1TQCC 3AROA 2P8LB 1F2XK 4XH2A 1AP2A 1HWHB 4JRXB 3RWDA 3WNMA 2DTML 4NM8H 3NIGE 1FL5A 4QRRD 1LQSR 4K07A 1EO5A 1U3ZA 4LNRB 2QSVA 3C2SA 3KPLA 3E6HA 5EPMB 1KEMH 5EULV 3RGVD 4OGYL 1T7VA 3SDDD 5C0IA 4C58B 4L9LB 3AXLB 4GG8B 2CK2A 1FNHA 2NTFA 2PTUA 1F90H 4PJFE 5I16A 1KENL 3DETC 3OXRA 3VFSB 3S35X 4L3EA 1MFBH 1MRCL 5D7IF 2A83A 5ITFA 4FQXD 5F7EL 5DYOB 3EW3B 4Y0GA 5BJTB 4X8JA 4X6EA 3DO3A 3UJIH 1LDPH 3IF1A 1G9EA 4NYLB 1Q8MA 5EO1B 5FV1L 3PF2A 4I3SL 4JHAH 4ELMA 1ZGLP 3UO1L 3L3GA 5HHPB 5I15H 3BJ91 2CO6B 5IBTH 4TVPD 3O45A 4WEMB 4APQB 3O3UN 1BZ7B 5HDLA 3TBTB 4A6YB 4JZNB 4B5EA 4P23D 4U1NA 1DLFH 2VZOA 2VLLA 1G7IB 3HE6D 2XQBH 1U3JA 3DI3B 1EHLL 3B5TA 3SE4A 3FTGB 25C8L 5LQBH 4LVHB 2BSSA 4NO0A 3A6BH 5E0QA 4OD3H 3GMLA 4JZJA 3QP3A 1MFCH 4JR9L 3N50A 2GTWB 3QBTB 4LVOB 2E7MA 1JMZA 4PJ5A 4HF5H 1R3IL 2IAMD 1F90L 3MFFB 3HR5A 4CGTA 3VGFA 2W9DL 1DANU 2FJGA 4ODHH 5CJ8A 1QO3B 5FHBH 4GXVL 5FGRA 5GZNC 5CJOL 3BE1L 4JHWL 2OP4L 3FONB 4H1LG 4LVHC 3O6FC 4X4YA 3QEQE 1DUYB 4LNRA 3BKCH 5F21B 1NMBH 3AGVA 3KLSA 3H9YA 1FVCA 3TA3C 1AP2B 3SQOH 2MWCA 1JHKL 3HNVL 4NYLA 2I26N 4DZBB 5LGHH 2VZ1A 3RX7A 4HUUB 1T7YA 2CH8A 4X7CC 1ADQA 5IMKA 5F7KC 4JCLA 1A3RH 2X4NA 1P53A 3ZDZF 3T4YA 3QDJA 3W0WE 4AG4H 1Q0YL 4DEPB 5TDPA 5EUOE 3M17B 1UEMA 5FECA 4G3YL 1NDGA 4WO4C 2D7NA 2AV1B 5J1AB 5FYJL 3QA3A 3JVGC 4Z5RA 3PNWA 2V17L 4LSUL 4XPBL 3DURB 4CW1A 4JZJB 3QIWB 1FAIH 5C08E 3R0NA 3GEWB 2F58H 1MCEA 4YO0A 1MCCA 3ARDD 5AZ2H 2DWEA 1QYGH 4Y19B 4N9GB 3VRJA 3LZFL 1CF8H 3KHOA 1SEBA 4U1IA 3V0AC 3VXQB 1XIWB 4Q97A 1S8DA 3ARDB 1DDHB 1OAUH 43C9A 3IETB 5DD1H 3KPRA 3U82B 3KNBA 3ULVD 4QOKB 4YE4L 1NBYA 4IS6B 5GS2D 5IW6B 4LVOC 2GT9A 2APTA 3IXAA 3TPUB 1BBJB 2EDKA 5INDB 3OF6D 3VXNA 1F3DH 2E7BA 3LEYH 4JFYB 3T3MF 3PHOB 1BZQK 2ADIA 3ZT7A 3ULUD 5EC1B 4JREB 5FDWA 1N4XL 2QHLA 2BOBB 4R26H 5I0ZA 2EDHA 2ESVE 2OTUB 4KRPB 3VXMB 1JPFA 3FFDA 4GW5B 4DVBB 1BEYH 3FRPG 4K94C 4JFZL 5H94A 1LO5B 5BVPH 4ODSH 4YGAB 2NXYC 3VE0B 1P4LB 2HT2C 5B39B 4P5MB 3RWDB 1AJ7L 5BCAA 4OJFL 5CD5D 2YN3A 5T3XE 4OCRH 1VERA 3VGDA 1EEUA 1QBBA 4WENB 4G6ML 5FYKU 1MIEH 2CJUH 1E4WL 1J8KA 5DVLA 3MV8E 1KV3A 1WTGT 3QUML 4PRNA 4WFFE 4Y16A 4NZUH 1TPXC 2DM3A 1CD8A 3BN3B 1X6LA 3HI6L 4NWUH 5IBUB 1RUAH 1RUPL 2VIRB 2D7TH 2GI7A 2F54A 2R23B 4YHOH 4AT6B 1MFDL 2HKFH 3MCG1 1I3UA 4WWKA 3VXSA 1T1ZB 3BDYH 4M6OH 4XMPH 5KVDL 4K71B 1MVUA 3R1GH 3N1QC 4XX1G 1KXQE 1ZMYA 3V6ZA 1IAOA 4QY8A 1A7QL 2KZ1B 2VKXA 1XR8A 5TGBB 1NMCB 5JR1H 4HXAL 3PWLA 4BZ2H 4HG4K 1YN6A 1WICA 4WHCA 4HH8A 1ZS8A 3WSQH 3IXTB 2EH7L 4ELKB 2IH3A 1W72L 1P2CA 5I1HL 3LN4A 1F3JB 3MRGB 1IEAB 4GSDH 2E9IA 5DK2A 5KSUB 5DS8A 1F45A 5AYUH 1O7SA 2VDPH 2H3NA 2HTLC 1WEJL 3LKRA 3N85L 4HWUA 4O51A 5HI5D 3O41A 4P46D 1MHPH 4FQJL 5JIPA 1FRGH 1RZJL 4WFGD 1QZ1A 1DP0A 3IKCB 3EZJB 1IMHC 2HN7A 2NNAA 1XF2A 3MLPA 2XWJB 3O2DA 5AG8A 1CDCA 2DN7A 2IBGA 3BW9A 3FQUA 1KGCE 3HNTH 3L3DB 4ZQKA 3L3IB 3HE7B 5KVMC 2A6DB 3AVEA 2WWMD 3L5JA 4YK4C 1AD0A 4FZEH 2XWTB 3TBWA 4QCIA 5IMMB 3BRFA 3D1MC 3PABB 1B3JA 1Q9OA 1E6JL 2VDNH 2V9QA 4QRPB 4BZ2L 3UTTA 3IJYA 4HXAH 2BOCB 3NFPA 1Z9MA 3ARFA 3DX8B 4HGKC 4TNWF 3RHWF 5DZLA 5IB3A 1OTUC 1SVCP 4WNQB 2J5LB 5K9JL 5E8EA 5IB3B 2D0GA 4F3FA 3DROA 4IRZL 4K94H 1BFTA 5HDBF 5TE4H 3ULSA 4Q6IA 3P30H 4PJFB 4NKIH 2D7MA 3W0WB 5HXMA 5C0GA 4IDJL 2IANA 4JQVA 2R0KH 4R3SA 3TT1H 2DLGA 2R4SL 5FOJA 1BD2B 5HGHB 1TLKA 5D71H 3MODH 2AXHA 3HE7D 1JFQH 5DT1H 3CGTA 5T1LD 4HS8L 1U8IB 2OR9L 1YQ2A 4LSRL 3OKEB 4J3VA 3CVHL <