1YEJH

Catalytic antibody complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1998-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejH02
1P2CA 4MAYA 2QQLL 2ZKHH 5C1MB 2IQ9L 3I2CL 4GS7C 4XVJL 5EBMB 5JOFB 3KLSA 5AUMB 3A6CL 4P5TD 4G9FB 5TFSH 2X05A 3LKQB 4FXGB 3MLTB 1JGEB 5EO9A 4PRAB 3AS0A 2W07A 4F37K 1GH7A 3GBMH 3HPJB 3VDBA 4P9MH 3EJYD 5HVWA 4Y4KD 1D5MA 4HC1A 5KANI 3P30L 4PRPB 3MLZH 2Y9RT 2N56A 4XBGA 2GJ6D 1DUZB 1FVDB 4RMUA 1L7IL 2YA2A 5DHYB 1OAYH 3WIIH 5ICYA 4YNYB 4YQXL 4M4RA 1YECL 1KCRL 3FTGA 1G7QA 3QISA 4HPYL 3L5WA 4W6YB 4TSBL 5FM5M 3EYQC 3L3JB 4XNXL 4LFHD 4OIIL 1X9QA 2CK0H 4Y4HB 2XN9E 2DAVA 4OCWL 3KGRA 2PR4H 3EOYG 5BRZD 3AXLA 3HNTL 4NT6B 5GJSL 2DYPB 3BIKB 2FB4L 2BVQB 4HUNB 1F6LL 4FZ8H 4MSWB 3CFCH 4KROB 4OF0A 1FIGL 5GSRA 4J3SA 1MRDH 4RRPA 4YHOH 3SDAC 3FRPG 4Y1AA 1JUFB 3FQRB 1F11B 1PY4A 4WV1C 1NKOA 2X89D 1XR8B 2BK8A 4R4NC 5DQJA 4WHYH 3L3DA 1JGUH 4QTIL 1DN0A 4U6XB 3H9SA 1A3QA 3ELAT 4HSQA 1RZKC 3RNQB 3PWPE 1VKXA 3JV4B 1NAKH 4Y16C 3SKOA 5F9WC 3QUZA 1AO7B 5DURD 1JZ6A 3RA7H 4OLYH 2QHLA 3RBSA 3EFDH 1TNMA 1SVZA 5FA3A 1FZOA 4QTHA 4EN3D 4DVBB 3ZTNL 1J05A 4WFEE 3BP4B 1WZ1L 1K2DA 3OGCB 4IRZL 4MS8D 2AJYH 1PX3A 4Y5VA 4PJ9B 2V5RA 4U0QB 4V1DE 4CN4A 3D39A 4M61A 1A6ZB 4M1CC 1FVEB 1W0YT 3IU4H 5D7IA 1CVRA 3F6LA 2HRPH 4HFWB 1OAUH 4HLZH 3WDJA 5DDHB 3FO1A 1R3KB 1OTSD 4LP5A 2OK0L 4B7IA 4OD1L 3L7FA 1XGUB 4I9WE 5LBSL 3MRDB 1AJ7L 4RNRB 5GHWL 3TO4D 5D2LB 2PYEA 3UYRH 1YY9D 2VUYA 1RIHL 1WWAX 4PJBA 4UTAH 5HYFA 4MHHI 3ZSTA 1D5IL 2D7TL 2HLAB 2VLMD 3MLSL 2NTFA 1U8LA 4IIQC 2ATKB 1NLDH 2H1PL 2DLFH 4HC1L 4P5TA 3S88H 8CGTA 3H42L 5IQ7L 5MEPB 3MRLB 2AS5M 2AP2A 2ZJSH 1RUML 3E6FB 1P4LA 4IBLT 4U33A 3OR7A 4Y4KA 3UZEA 4PR5B 1FORH 2Y07H 1O0VA 3ES6B 3LV3B 5KSBB 1QSED 2H45A 2GJ6A 1ZTXH 1FO0L 5F96H 5F7NC 1VHPA 3C60D 4ODUB 4XPFL 2R2BA 3RL1B 5C0EB 2ICWA 4LU5H 1W0VA 3PP3H 3F5WA 2X4NB 4LCCC 4UT7L 3VXSD 3BKCL 3S5LA 4UU9B 5J1AB 4F7CB 5I1AB 5BRZA 2XZAL 3SDDD 4M1DH 2W0KA 1CZ8L 1KENL 1N64L 2AV1B 2MPAL 1N7ML 5C0JA 1HCVA 4P46C 1FLRL 4NFCA 3AREB 1MCIA 5E6ZA 1CCZA 3H9SE 4K9EL 3D0LB 2X89A 4YH6A 1XF5A 1MY7A 4WCYH 1OVZA 1P84J 2C26A 1AC0A 5BVJA 1TPXC 2AGJL 3SQBA 1R3JB 3GMMB 1UWGH 4JKPH 3LRSB 1IT9H 5I8KH 1G6RH 2O5XL 1NAMH 2KUTA 1OAKL 3CFBA 4U1MA 3IDYC 2EE6A 4Y8DC 4R6UA 5B39A 5SWZE 5ADPH 5A40E 1FZMA 4F57H 2B2XH 3EDEA 1DBBH 2MWCA 4PLKD 1C16B 5CJQH 4JJ5A 35C8L 1IC4H 2AJVL 1EUUA 2Y36L 4NCC1 5CBEA 4L8SA 5ETUB 4Z77B 3LKPB 2VXSL 3WN5B 2A9MH 2YZ1A 1AI1H 4HIXL 2Y23A 3CFJB 4F80A 2MHAB 4OCXH 4X5WB 4JREB 4O4YL 3GO1H 2ITCB 1KIUA 4ODBD 5DQDH 3WNLA 4EIGB 5HBBA 1CBVL 2ARJQ 1WZKA 2AAVA 1FZKB 1HSBA 4N9GB 1EH9A 4JRXD 5FHAL 5KANG 2PYEE 4XWGH 1FL3B 1AGBA 5TGBB 1NDGA 3VW3H 3QUYB 4OCSL 4L1DA 1T1XA 2X4RB 4WW2C 2R39A 3DNKA 5TE4L 3V0VB 5L88H 1FAKT 3TO4A 1TQCB 12E8H 3T2PA 1HYSD 3F65A 1RJYB 1KPVB 1OSZB 2OTUB 3VD9A 4JGUA 3T1WA 5D72H 1KTDB 2P49B 4N90D 1RV6X 3TV3L 5JOPD 3H9HA 2W9EL 1RD6A 3VRJA 2I26N 3T65A 5LWYH 3MRNA 5M95B 3EUUA 4GSDL 2QTEA 1N5YH 3MLWH 3S35L 1VACB 2EH8L 2J6EH 4QRQB 5IW1A 3VGFA 2WQRA 5E5MB 2X44D 2GJ6E 3P4MA 4K3JL 1QSEA 1AKJB 4FQXC 1H5BC 2D03H 1SVCP 3C60A 4CADA 4BQBA 3MRHA 5T1DH 3TA3B 3X14B 1RJLB 1I7TA 5KSAC 5BRZE 5C70A 4HIIB 4L8BB 3KPNB 4LDLB 3VXSA 4HGWB 5AAMA 1JTOA 5CZVL 4PD4K 5DD3H 4LPYA 4O02L 1CDGA 4G42B 4L1HA 2AEQH 5E2WL 3MOBH 4KTEL 3SDDA 2ZNXA 1G7LB 1WAAE 3I50H 3FQXA 3OJMB 4M7LL 1KXTB 3BT2H 3Q6FA 3FQWB 4LLYA 3LKRA 5E8NA 5IROC 2A73A 5J3HC 3MUJA 3RZCD 2GTZA 3W39B 1P7KA 4YZFE 3QHFL 4PJ8B 3C2AH 1FFPA 2R29L 3I6KB 5T3XL 2VZTA 3O6MH 4I0PB 4P2OB 2OTWA 1G84A 5HGAA 1FV1B 3DYMA 2V7NA 4RGNB 1I9JL 2VABB 1DEEA 5IHZB 5ESQA 1ZT7A 5J6GA 1CR9L 1F02I 3VXNA 4JR9H 3KVQA 1RZJH 1DEDA 2LTQC 3ARGB 4LPXA 3T1FA 4R4FH 5TQ2H 3CX2A 5GJTL 3E3QC 4PGZA 4WU5B 3ZKQD 5KS9A 1D5XA 3S9DB 4G8FB 2F58L 2C3GA 1Q9WB 4XI5C 5EWIH 4PJGF 4L9DA 1F4WH 2DQDL 1SMOA 2QSCH 3GMQA 2OZ4H 2IH1B 2WINA 3RWFB 4B50A 4AK1A 3MROB 2IMNA 2C3WA 2BVPB 4GXVH 4ETQA 5H37G 2X6MA 1F4AA 4HKJB 3LN4A 5LQBL 1P9MA 3VI3E 2VLME 4KZEL 4U1GC 5H8DA 43CAA 1BD2A 1MCPH 2Q86B 2I9TB 2HFFB 4MQTB 2E9JA 1AC6A 5DO2D 3MOAH 5JZ7C 2FGWL 4ISVA 1P7QD 4LSRL 4RAVA 3AY4A 4HHAB 2W38A 4QNPF 4FXKB 1HHHA 3WLBA 4M43H 5FHBH 3WD5H 3CLFH 4OCMC 1QSEE 3V6OA 5ADOL 3E6HB 4NRYB 3U9PL 1R3LB 1EFQA 4EUPB 4WI2A 4HUVA 2JB5L 4P5MB 1G7HB 2A6DA 4YXHL 5KVEL 3DPBA 4PP2B 4QGTA 3VXSE 4AENB 4DJMA 4P9HH 1U8QB 3U48A 4MD4B 1RHHA 4EUPG 1WIPA 5D71L 4DZ8A 3U2SB 2XFXB 2CLVB 4JM4H 5CP7A 4D9QD 3V5DB 3GGWA 4ODHL 2CDEB 5T1MA 2GEEA 1K4CA 4OCNC 4WWKA 3LRGA 3G04B 3SDCB 1T0MA 5C86A 1FBIL 1Z0MA 2Y25A 1MWAA 4M6AA 4TN9A 2XPGA 1JV5A 4OGXH 1CE6A 3RZCA 2A74B 4ZXBD 3D3VB 2V2TA 4GRMB 4HUKB 4BQ8A 1T6WA 3QJFA 1YEGH 2WZPD 1ZHKB 4U6VH 1YC8A 4N5ED 4UTBH 3TZVD 1JNNL 5C0AB 5I18L 4P9HC 4HIJA 1RFDL 2FH6A 4KV5F 4NSKA 3BVNB 4LKCA 5ECJE 3GMNB 1I75A 5GZND 3S37L 4PRDA 4P3DA 4G9FD 3PDDA 3U0WH 3WYRA 4BZ1L 1SY6H 1P4BL 1DQDH 2PW1B 4JRXE 1VEOA 2LAAA 4GQ9H 1HINL 4J6RL 4JKKA 1QRKA 4PRPD 3BEVB 3RTQD 4LSQH 5JXAH 2J2ZA 5TPWL 4TUOA 1D5ZB 4OT1H 1CGTA 1A1OA 2DQUL 5D6CA 4G6KH 4OD3H 5AYUL 2BCKA 3MLUL 2ZUQB 3ME0A 1INEH 2WBJB 4N90E 4JQIL 3NA4A 5JOPE 4EVNB 1F45A 3MNZA 5E08H 3EYVA 4R8WH 3S37X 4NNYA 1N5AA 1U8HA 5FDWA 2OBGA 4HGMA 1JGDB 1P7QA 2VXQL 2LE9A 1BZ9B 1J86A 1YEIL 3WXWL 3K2UH 5HHVL 4KROD 2X4QB 4OZ4B 5I15L 4ZUVB 2X9XA 2O61A 3QIUB 4IMKA 1GC1C 3V4UL 4OZGB 4ZO9A 3QUMH 4XRCA 5IESL 1B0RA 1HSAB 4C4KO 4XH2A 5C2BL 1T7XA 5ESVB 5A2KH 2AK1H 3P4OA 3QRGH 2D7QA 2ZP0T 5L7XL 4PB9H 4G80A 3OAYH 2Z8RA 3M07A 1MWAL 1NUFA 1WBYA 1S3KH 25C8H 1KCLA 4HPOL 4MJ5A 1G7MB 5A1AA 2GJZA 2C5DC 3AROA 2DJ4A 3ZE0F 4PJ9D 3VRLE 1BREA 5GGSB 1UB6B 3UAJD 5DD6B 3UMTA 3VE0A 2J3SA 3FFDB 4MB3A 2PO6B 1QLEH 3GHEL 4MJ2A 5SX5K 4ZXBA 3CX5K 4LSPL 4U1LB 2VTFA 2X4OB 5ADOH 1UXSB 3TYFB 4GQPH 4NPYA 1GIGH 5F1SA 1AGFB 3TZVA 4XVTH 5J4MA 1ZS8A 4FQQA 2Q87A 2DKMA 4ODVL 2NY5C 2F5AH 2DIBA 5IQ9A 1MCOL 4LLUB 1AIFB 5JXEC 3Q5YA 3D25A 1A4JB 3LEXB 1QPPA 2X41A 4G9FA 1FP5A 3V52H 4C83B 5EUOE 5D1QB 3MLTA 3CSYB 4PRAA 3UZVB 2DTMH 2H26A 5DSCA 2V7HA 1NCDH 3NPSB 4PRPA 2ZCKL 3HR5B 4FQLL 3RTQA 5JW4R 3VI4F 1BLNB 3ZDXF 2EDLA 3LQAL 4HMDA 1DUZA 1FVDA 4NZUL 3DVIA 3W2DL 4MVBC 4WO4D 1L7TH 2UY7A 3VFPA 3KPMB 4M7JH 2CLZB 1IZKA 1GVIA 4DGIH 5JW3H 3BUYB 4L29B 4NO5B 3FRPA 4YHLL 5EA0H 5HSFA 1UM6L 1JVKA 1ZAGA 4MCZA 5BV7B 3G9AB 4F9LA 2W0LA 1OP3H 4G6AC 5KVDH 2DIAA 1FC1A 1HDMB 4MB5A 5C0CB 3MV9B 3SE9H 5DJ8A 3ARED 4JEGB 1NBVH 1IM3A 2VISA 3EIFA 3KNBA 1ZV5A 2VRAA 4OKVA 4CDHA 1OTUC 1TVBA 2QHRL 5E95B 1KG0B 2Z91A 1Q0XH 4FQ2L 3ZTJG 1PG7L 1R3IL 3SGDI 4R3SA 4ONFH 3QAZB 4HWZA 2Z35B 4UDUB 4LRIC 4RFNC 1SMAA 2AJXL 1X5FA 1Q9KA 4D9QE 1CGVA 2GTWB 3RVWD 4HF5L 2X70B 1E6OH 5GRZA 3QXDB 3HN3A 4N0FB 2UVEA 3KLHC 2QL1A 1FPTH 4BELD 4BFBD 4KVNH 1IEAB 1JWMA 3V95A 1G7JB 4S1SL 1BIIB 1MREL 3VWKD 4UV4H 1LE5A 5TF1L 1PG7X 1YMHB 4XMPH 3BDBA 4JHAH 5IMOB 4N5UA 5IEHB 3ARQA 1LEKB 1F6FB 2VQ1B 3B2UD 3QUYD 5TDNA 3TIDB 2VR9A 4FG6C 5EOCH 3NCJH 1XGUA 2P43B 1I1YB 3F12A 3BXNB 5DRZB 3RU8L 2A1WH 4Z8FH 5AYQA 1GHFH 3N0PB 3QUXC 4LHQB 1IGIH 4KK5C 4G9FE 2BOCA 2A9NH 1MCWM 1MRCH 1P7HL 1F2QA 4UILH 4GMTL 3PJSA 3VMNA 2Q6WA 1CGYA 4HBCL 4YO0A 5FYLD 3PWLB 1BJ1H 2Y6SC 3MRLA 4F8TA 5SX4I 4PRPE 3RIFK 4CN1A 1ED3B 3IDJA 3INUL 4ELKB 3BZEB 4OTXH 1QVOB 4X9GA 5I1JL 2P5WB 4M62H 2AXJA 2DWDB 3T0BA 3OB0K 1TLKA 1D6VL 4YPJA 3CMOL 5F3HA 4KKCC 1TQBC 3KJ4C 4WO4A 4UOJA 1URLA 4DVRH 1PYWA 1U93A 4M5YL 5GGTA 2GITA 1OF2B 3LMJL 5E2VL 5CINL 4IJ3B 4UU9A 1BFOB 1FVCA 3ZL4L 4XX1G 2VXUL 1Y0LB 3F7YA 5D93C 1FFNB 1GSMA 2C7UB 3RNKB 2GW5A 5E8EA 4X6BA 1I7UB 3E2HC 3AREA 4DTGL 5TJWK 1YPZB 4JG0H 2E7CA 3R1GL 5E6YA 3V7MA 5HYSG 1CICC 7FABH 2OP4L 4H26B 4IOFD 3U7WH 2R0KL 1CTOA 3RUGF 5DUML 1QBMH 3PABA 4IDJH 2QR0B 4I0PD 5MP6L 4H20H 1ZHBA 4JZOA 4KAQH 5F71A 4RGND 1U3JA 4ZFZB 3QHZL 3CFKA 2RQ8A 3BSZL 3PGDA 3DJ9A 4L9LB 2IANB 4O2EA 1ORQB 3QIBB 1DBJL 4RWYH 2FZ3A 2Q76B 1INQB 4B41A 1NGXB 2F9BT 2W60A 4JO1L 3V4PH 3WN5A 3HCVA 3WNOA 1BX2A 2K7QA 3C2SA 1T5WB 3VWKA 3QI9B 5EU5B 1YQVL 2ITCA 5C0GB 1WBXA 3BO8A 3MLVH 1EVTC 2VDKL 1IAOA 5T3ZD 1I8MA 1FZKA 3MLXL 1QRND 4N9GA 1CLCA 3C8KA 4JY5H 2ILLA 1LDSA 2GYSA 3QXAB 2ITDB 4YXLH 2VKWA 2WWKT 4HKXA 1KCUL 5D5MB 1X5HA 5HY9A 5MERA 1AXIB 3B9EA 4AG4L 1ES0B 1OT1A 3H6JA 5AEAA 1OSZA 4ZPTA 3PGFL 2RB8A 4JO4L 1LGVA 3CDYA 5D7JC 5HDLA 1E4XI 3Q6GH 4HFUL 3MO1B 3BYYA 3MTRA 8FABA 3JV5A 4WNQA 5DJ0B 4NWUL 2D7OA 2ZG1A 4K3EL 3G5XA 5KSBE 3QUKB 5IR1A 2Q8AL 3MRRB 1IC7H 1T21B 3C9NB 5E5MA 4QHKJ 3KS0J 3JVGC 2X2YA 5F7HA 1RMFH 2CH8A 4QWWD 1FGVL 3QDMB 5JUEL 2FECI 4NQDB 3OSKA 4LPWA 1Q8MA 2J7LA 1A2YB 1OP5K 3P4NB 4LLDA 4NUJB 2BDNH 2H6PB 2FD6H 3L7EB 1RULL 3ZKND 1SHMA 3V6FA 4O2FA 2W92A 3UROR 2M8XA 4R90H 2AJSH 2ZUWA 4DEPC 3SDCD 1NFKA 2EEBA 1NKRA 3IRPX 4LNRB 5I76A 3V0WH 4AL8L 5HVHB 1OARH 5CWSB 3UTZA 3KYOB 4CW1B 3D3VD 4FQCL 1S7TA 2ENSA 5B8CB 4HK3N 4JFZL 4XP4L 3U4AA 5LGHH 4XNZC 1INDL 4I0PA 1BBDL 1FLTX 1TTFA 1FV1A 5K9QI 1FL5A 4CNIB 1ORSA 3CXDH 4EDXB 3M45A 1KEGH 2NXZD 3OAUL 4JG1L 4CUCA 1Y6KR 3C5SA 4QHUB 3CVHH 4K7FB 1C5CH 3NABH 2YA0A 3QWOB 3UTSB 3LQZB 1EHNA 5DVNA 1MFBL 5E8OA 5I1GH 1YUHA 1EPFA 5K59E 1I1CA 1I85C 3HMWH 3BP6B 1RJCA 1NCAH 2VC2L 4JANA 1QRNA 1MEXH 4Q9QH 3CC5A 4G6MH 2BVPA 3HZKB 4HKJA 4PJAB 4JCMA 4LBEB 1KLGA 5C7XL 3MXWH 4R97C 4U1HB 1AXTH 1DBKL 3F7PC 4X8JB 3D0VB 5D70L 4MA8H 1I7RB 1KJ2L 4XCFL 5FYLE 2VDQH 4HHAA 4LLWB 1C5DB 4AH2A 2NY0C 4ZD3L 3HE6B 3HNSL 5DT1L 5I1DB 3VFMA 4FXKA 5DFWH 3B9DA 3FOMB 5DC9B 4FZEH 3DO3A 1OAZL 2X4TB 4K8RH 4L4TD 3QIUD 1IQDB 5HHPB 2VSCA 2XZQH 1KIPA 3TWCL 3LEVH 5I19H 2DM3A 5IW6A 3REWB 3V4VL 3WUZA 2YS4A 2H9GB 4TTGA 3PHSA 2HKHH 3SY0B 1EDQA 4BUGA 2Q8BL 4N0YH 3KYNB 4AENA 2YD1A 5DZLA 3MACH 4MD4A 3AB0B 3GSUB 4OZHF 3OAZK 3U2SA 4YHNB 3KLDA 2XFXA 2XI9A 2E8YA 3JWDL 5HHMB 3V5DA 5C0DB 5CJBA 2XRAH 5I8OL 2OXGA 4IMLB 3FO0L 1YQ2A 3ABZA 3CPLB 1WGOA 1RUKL 5IBLD 3O8XB 2FO4A 1ZLSH 1RUPH 3QG6B 3PV6A 4XHJD 5FKPB 5E2JA 1S8DA 1GGBL 3FMGL 4JRYB 2BSTB 1LO5B 3HE7D 1WITA 1SJEA 2PO6D 1FRGL 4KXZH 2HT4D 4MA1B 5IHBA 3B9KA 4RGNE 4ZOBA 3RUGB 5DD5H 4KH2A 3RVXD 5D6DA 2X7LB 3RAJH 4PJXF 5E4EB 4Z5RA 1JWUB 5L2KB 4JVWA 3U9UB 3ARFD 3EHBC 5A16B 1WBZB 2NW3A 4KTDL 2DLIA 1XZ0B 4F7MA 2R9HC 5DGRA 3DUSB 4TOYH 4ZFGH 1JF1A 3ZO0A 1HIMH 3IAPA 1NC4B 2HTKC 5D1QD 4K2UH 4JO3H 3HZVA 2BHYA 5T3ZE 1QRNE 1WT5C 3HI1A 5TQ0L 5HHOA 4XP5H 1DBMH 4MJ6B 3ZT5A 3QO1B 2ZCLH 1TXKA 3BMVA 4NP4H 3BEVA 1QFUH 3BGFC 3FKUS 3VU2A 3BDYL 4U1IB 3WV0A 4CN6A 3SPVB 2V17H 2Z93B 5F1OB 4XMKL 2HTLD 3ARRA 4WUUB 3IKKA 3LVEA 3JSSA 3KPQA 2GHWB 1XIWC 4EVNA 3C6LD 4DN3L 1KCSH 1DUYB 3AS1A 3CJJA 3PP4L 4JRWA 5B21A 1QFPA 4NJAL 1JGDA 5EU4B 3MRBA 3FJTA 3IJYB 1AQKH 3C08H 5F89B 5C0CD 4I18C 1NCWL 3T3MF 1MAJA 3FB5A 4KPHH 3MODL 4L4TA 4BFEA 3TH2T 4KGJA 2J4WL 2AJ3A 2NW2A 2AXFA 2NX5B 3O6FA 1FSKB 2QADB 1TJGL 3BWUC 1H0DB 3IDYB 3MRJB 4KUCF 2FX8L 5JDJA 4FA8A 3OR6A 5DMIL 2FR4B 1FAIH 1U3HC 3WLWD 1Z3GL 3IDUA 5ITBH 2XA8L 3I2CH 4XVJH 4IRSA 3A6CH 4ODTL 2QEJA 4TNVK 3MRGB 5K9QG 2IQAB 3G6AA 2R0ZL 2C4FU 4YUEL 2M26A 4KJYB 2ICES 3MLRL 4CMMB 5LCVH 3P30H 3G6JB 3IS0X 1DQJB 3P73B 3D3VE 3WSQL 3KLAB 1UB6A 4PUBL 2WWMC 2RGSA 3HE7A 1L7IH 3RWGB 3DRQB 1G6RB 3O2DA 1NAMB 2ZUYA 3K8MA 1Q9LA 2X4OA 1KCRH 2BNRB 4RGMC 1UXSA 1VENA 4HPYH 1T89A 5L9DL 4M9OA 4KJWD 4TSBH 4XNXH 3SGJA 1YNTA 4JJHA 3QH3A 4OCWH 1P69B 3HNTH 5GJSH 3BPOC 2APWA 3ARFA 1FN4A 3T04D 5I71C 3ULSB 4PJIF 3NZ8A 3G5VB 4ODXB 1FIGH 1K6QL 5CBAA 4P2QA 1UH4A 4JFEA 1S5IH 4PYHA 1PD6A 5C6WH 2VZSA 1WLHA 1HXMA 2FNBA 5D1QA 1Q72H 3HPLA 3CSYA 4GT7A 5HGHA 3QEUB 3O3BB 4X4ZA 1QLRA 1DSFL 4QTIH 4P5KB 3DO7B 5KVMC 4HWBL 4DKEH 1AD0A 2ARJB 1JNHA 4MNHA 2P5WD 2BSSA 4PJGA 4UZGA 4V2BA 4AEEA 2QQNL 3HR5A 4O58L 4DZBB 2YEZB 5ALBL 5CIPA 3V6ZB 4NRXA 1JTTA 1FYTB 1BF2A 4HS3B 5I6XC 4FTVA 1KLUA 1ETZB 1QA9B 3JV6A 4GAJL 3WS3B 4NO5A 3RY6C 1WZ1H 2ADGB 3C6LA 2IAMD 1CFQA 5DR5L 2FWOA 5CGTA 2VDLL 5J1TC 1XGTA 1S7RB 1UJ3B 1F3DH 1XGQB 3BP5A 4L4TE 4WTXA 4YDVB 1WSST 2ERJB 3LH2L 3F6IA 2FHBA 2JK5B 3E8UH 3UTQB 2OK0H 1Q1JL 3NN8A 4OD1H 1MHCB 4UI2A 3T0ED 2WBWB 4NO0B 2Z92A 5LBSH 4Y5XC 3U7AA 2XWTB 5TH2B 2YC1B 3ARBC 1RIHH 5F70A 4LSVL 1A6AA 2NY3B 5K9JL 5B38G 4MDJB 1MLCB 2X1WL 2D7TH 3MLSH 5IMKA 4J4PD 5D1ZC 1AE6L 3O11B 2E5EA 4EBQL 4MWFB 4HC1H 3AM8A 1FCGA 1EO5A 5GGSY 1KOAA 2CRZA 5ANMB 2OL3A 3EYUL 4DFHA 5I73B 3VCLB 3O3EA 3VXQB 4YHYB 3TPUA 3IDGA 3KWWA 3DUHA 3OKEB 3UCRA 1K8IA 2ED9A 1D5BA 3O2DL 3DVGB 4L4VB 3QI9D 3G5YB 3CFDA 4M3KB 4MAYC 2CIKB 1CL7L 3I02B 1QSFD 3IDNB 4GKNA 4JKMA 2A6JB 2E27L 3BKCH 5I1EL 4KMQA 2HT3D 2XY2A 1I1YA 3BXNA 2DI9A 5FA4B 1A4KB 1F42A 4D9RD 1N64H 1IM9D 2P8LB 4YIQB 2MPAH 1N7MH 2VAJA 2R0WH 1EGJA 3OB8A 5H94B 3VGEA 4K9EH 1V3MA 4DOHB 4FFWD 4PJGE 1ZMYA 3GDBA 4WDIA 2CMRL 4YAQA 2ZWLT 3WJLA 3K8KA 2E7BA 2E6JA 3AU1A 2P5WA 2J8UB 2O5XH 4MQ7B 4TSAH 1OAKH 3E1F1 4XCCL 4U1KA 1VPOL 4RAHA 3QDMD 4TTDD 4NQDD 1BAFL 5C6TL 1J0YA 3X3FL 3BFOA 4XC3L 3DTXA 1A6UL 3X13B 2HKFL 1G1YA 35C8H 2AJVH 1YEJL 3IFPA 3K4DA 1WEJL 1DQQB 3VFOB 4MXWL 2GSGB 5D2NA 1Y6NR 2VSDA 2P5EB 1H9VA 2IAMA 5DA0B 5HYSA 4JFFA 5EZJB 4LLQB 1BFOA 5C0CE 4QNPE 2NY4B 5B3NA 1CBVH 5JDSB 4CU8A 1ZWIA 3CFIC 4L8DB 4RQQA 4OCSH 4J3UA 3T0EA 4AQ1B 1VESA 1CWVA 4PJEB 4EIZC 3NGBB 5IVOA 1KSRA 2OL3L 5EN2B 4Y5VC 2X9YA 3B6SB 4LK4A 4J4PA 3ULVF 5CKAA 5B3JF 2W9EH 2IPKA 1Z2KA 2WP3T 5FF6B 4JFXB 4GSDH 1F58L 3B83A 4MD5A 2VDNH 3FT4B 1FZJB 3HHRB 1INQA 3HZYA 3L9RB 4Z7WB 1NSNL 4JFPA 3UTSD 3GM8A 2DBLH 1CF8L 2HVJA 1T5WA 4GH7B 1LK2A 3AAZA 3V8OA 4Z7VF 5SX5H 4PJHF 5C09B 5JNYA 2M2DA 2OI9B 5KZCB 5D9SA 1QSFA 2BMKB 3QQ4A 4P5TC 5EBLA 5KN5B 1LHZA 4NNXA 1SM3H 3TGXA 3QXAA 1F4XL 1D9KC 4GAFB 4O02H 3UYPA 3EJYC 4B0MM 4JHBA 4Y4KC 4XHQA 5E2WH 4KTEH 4KV5E 1LD9B 4R0LC 3KR3H 2YZ8A 1IM9A 1DN2A 5C08B 4Z7QF 2XZZA 1EO7A 2V5MA 1OT2A 2EDTA 3SCMC 3HE6D 3U4BH 2B0SL 3HB3D 3QHFH 4XGZA 2P5WE 4CJ0A 5JR1H 3D2UB 1S7VA 5J11C 1DVFD 4UUJB 3DBXB 3OKDB 4Y2DD 2VLLB 3V5HA 5T3XH 4XX1E 4W4OA 5CHNA 4YBLB 1F4HA 1QFOA 5DEFB 4YX2L 5ELIA 1I9JH 4CGTA 1NC2B 5BCAA 2EYRB 1CFNB 3OXRB 4FN0A 4W68A 2MQCA 3KHQA 2WNGA 4MA3A 4PV9A 5GS0D 5DJYA 4JDVA 4NUJA 3FQUB 4S2SA 5GJTH 3L7EA 1A7OL 3BHBB 3IF1A 4R26L 1NH6A 4QRTB 5EUKB 4HULB 3U0TA 3UBXB 2DQDH 4JDTL 1R5VB 3OKLB 3CCHA 1IC5H 3BWAB 1YPZE 4LSTL 3BN3B 3FHQA 4UQ2A 3T0EE 4FFVC 1S5HB 5F9JB 3HMXA 3LKSA 3L3OA 5CSBA 3QUMB 4LIQL 1E27B 1GZQB 2H8PB 4JRYD 3IKCA 4LNRA 5LQBH 5EIIB 4EN3C 3KYKH 5IT2H 5FGBC 3QIWB 2VDML 4AM0B 1FH5H 3TN0C 4MCYB 2HLFD 4XP9H 2HMIC 3I6LD 5EZIH 3TLRA 3HFML 2J5LC 2NMSA 1TENA 4CU6A 2FGWH 4RWHA 4LSRH 5L2KD 4EDXA 5MENB 2HJKA 4Z7UF 1N2RA 3T2NH 2X4SB 1Z9MA 4P2CG 1OTSC 3WIFB 1WWWX 2D0FA 3PWVB 4NUGL 2F53D 4K7FA 5EFIA 3BPCA 4B5EA 1TZGH 4GBXD 3RQ3A 4APQD 3HRZA 1Y18B 2DLTA 1MJ7L 1NC4D 3N9GL 3JUYA 4IRJB 3VWJD 3S36L 3ZE0E 3AUVA 3L95B 1YY9C 4Q9BA 2ZUXA 5KVEH 4QF1A 3RPIB 3CU7A 3TJEL 2EYTA 4NQXA 2VQUA 1F3JB 4Y4FB 4E41D 5D7SL 5BOPA 1JYWA 5D5ME 3EO9L 3PIQA 4D9RE 4ZTOL 4RAUB 1TETH 1NGPL 4K3DH 4ODHH 2LU3A 5EIVA 2OJZL 1I7RA 1MQ8A 1LE9B 4TVPD 4D9LL 4U1NB 1MOEA 1OTTD 1FL6A 3C60C 43C9B 3LRHA 3FFCD 4HJ0D 5EO0B 1JPST 3FOMA 3VFGL 2X4TA 4O2CA 5HHPA 4I3GA 4PY7A 2O5ZL 1JYVA 1DVFA 1CS6A 3B2VL 3OB0H 3QDME 4Y2DA 4NQDE 3OKKB 2AI0L 2NX5D 3VI4E 3ZDXE 4QOKD 5D1XB 3SDDC 5GS1B 4QO1A 3R8BB 3WBDA 5MEOA 1RFDH 1ZA6A 3CZFB 4QKXB 3BZFB 2BNQB 3D85A 4NN5C 4LCWA 2BOBA 4WUKL 3MJ9L 3S37H 2FHCA 3DXAB 3RZWA 4HDIB 4X6CF 1NFIB 3MREA 3TNMB 1P4BH 3HMXL 4ODWB 2FJHA 4PJ7F 4GW4A 4IMLA 2PTVA 4QRPD 3MJ7B 3C5ZB 4D0BB 5TPWH 5FKPA 1HHJA 4OQTL 2EIDA 1PLGL 5AYUH 2BZDA 4MZ2A 4NO3B 2GAZB 3QCVL 1IL1A 1Z0NA 1JPGB 1C7TA 1FNLA 2PW2B 4JQIH 2FBJL 1PFCA 3MX0A 3HS0A 3BN9D 1FHGA 4NFBA 4X98A 3BKML 2VB5A 2VXQH 4YDJA 4RMRA 3WXWH 1WBZA 3QCTL 4K07A 4XP6L 4YHIA 2WUCL 3MRKB 5HHVH 3VXTA 1YEHH 3ARVA 3RVVD 3UTSE 4JKLA 5I15H 3GNML 2F53A 4GBXA 1DLHA 4PJCF 4APQA 3MC0A 3VWJA 2Z4QB 1HYSC 4DCQA 1NJ9A 2X4UA 4X6FA 1CT8B 3IXTA 5IESH 3UC0L 5HYIA 4PJHB 1J5OL 2IJ0C 2BRRH 1OB1A 4E41A 4OBRA 4FQHA 4F2MA 1GZPB 3TFKC 3SPVA 5C8JA 1FYTD 2Z93A 4PGDB 5L7XH 4G6FB 4ZUUA 1IEBB 1T04B 4POYA 1U8OB 4C59B 5AD0B 1MWAH 1QOKA 2XG5A 4HPOH 1A7RL 2JJTA 1IGYB 4GKSA 4NZTL 2AK4B 5F89A 1HXYA 3FFCA 2A0LD 3TO2B 4LSPH 5EC1B 4HS8L 1BOYA 2CDGA 2UWEB 4P3WA 4ODSH 4AEHL 2NX5A 1CD9B 2GCYA 4QOKA 3BH9A 3HC4L 3MRJA 4KDWA 3ALXA 2NY3D 1RI8A 4NM4H 2ZOLA 2XTJB 4PS4H 4NKIL 1OP5H 1UXWB 3UPRA 2HRLA 4O9HL 1MCOH 3QPQC 4JAMB 1KTLB 3VA2C 4CBPA 5HPOA 4HQQL 1UB5A 3SO3B 4N0CD 3IDIB 3MRGA 1PKQB 3UJJL 3JWNC 3N85L 1BFVL 3FB8B 4WI8A 4UIMA 2DQTL 1MI5D 1FJ1B 4OCRH 1FFOB 4NWTL 2CO6B 4I13B 4QRPA 4JRYE 2ZCKH 4FQLH 1NL0H 3TF7C 1I7ZA 2E9BA 1V3LA 5FEBA 2BY0A 4L4VD 3LQAH 5AWNL 1A6TB 4NZUH 4L3EB 2OR9H 3WFHB 5HHXL 1E4XL 3RUGE 4YJZL 3I6LE 1MSPA 3NCFB 5CLWA 3ULUF 3G5ZA 1TCRA 1V8HA 1GGYA 5L2KE 4NKDA 3RGVB 3BRGC 5DGQA 2APXA 3T8XB 3U4EA 5HDOA 3DYPA 2DDQH 1Z9SA 2F53E 2ADJB 5C07A 4NN7C 4U3XA 4Z7UB 4DAGH 4PTTB 2FECL 5E70A 1A9BB 3EGSB 1CLOL 1RIUL 2QHRH 1C08B 1O7SA 1PG7H 1I1RA 4RZCA 1FDLL 1NCNA 2C9AA 5SWSB 3U79A 4EEEA 4E41E 3MJ8A 1RUAL 2EYSB 4D8PB 5DO2C 2ATPA 2IBZX 3GI9L 3TBVB 3QZWG 3MCKA 2NLJB 2YUZA 4RMWA 4HF5H 2DMBA 3IAGC 4YPGB 4UB0H 4IMKC 5ICXA 5ESAA 5IMMB 5LXGH 2YBRB 5EU6D 4TVPE 5KSUA 1TTGA 1UG9A 2ADGA 3DGGA 4F7EA 2P5ED 4YDLC 3OTTA 1CK0H 1MREH 5F6IC 2VZOA 3PE9A 1T0NB 2YPVH 3FFCE 2NY4D 5TF1H 5FOBB 1SEBA 1YYLL 1XF3B 5B38A 3Q3GB 3WMSA 3V6BR 3L3KB 2IWGA 2NX5E 3THML 3BQUA 4NKMA 4QOKE 2ICEA 1T2XA 1I9RL 4BJLA 3BPNB 3KPOA 4M7KL 4QXTA 2XWTA 5TH2A 1PZUB 1JHTA 3DX7B 4KUCD 1LMKA 5IFJB 3ALPA 3BAEL 3SBWC 3O11A 4LAQL 1U8IB 4LCUA 3M17B 3OAZH 2IG2H 1MY5A 4ZXBC 1WISA 3RWCA 3VFVA 4QRPE 4LF3B 4X6CB 1WZMA 4OZHA 3SKNA 2FX7L 1MI5A 1VGEL 5IGXL 3INUH 4N5EC 1CG9A 5I1JH 5CSZA 1S9KC 3W5MA 1KPUB 4P59L 5DEGB 5CMAB 2EIEA 4GRWF 1ZHNA 4L4VA 1LO4H 4ENEC 1MCJA 3DMMB 3G5YA 1UWEL 3UTOA 5C09D 5EOCJ 2YPKA 4OZFA 5GZNC 4UNVA 5LVEA 4U31A 1ZHLA 4I5BB 2A6JA 1F97A 3RDTB 3FO2B 4JPWL 3NCCB 4G6JH 2ADIA 5E2VH 5CINH 1IAIL 1N4XL 3CVHB 1ZGLB 2PN5A 5CD3A 2VXUH 4X7TA 2FSEB 5HI4D 1H3GA 5DMGC 5HYJB 2I9LB 4PJXA 2E7LA 1S7XA 1JPSL 3PGCB 3RJDA 3OZ9L 4JPVL 4ZO8A 1RPQA 2IBBA 5C08D 1BJ1J 3PXJA 4YDIL 3MV7B 4LASL 4DTGH 1HEZB 4HIHA 1IKNA 4LCIL 4YGVA 2OP4H 3R06B 4M6OH 3ARDB 4G7YL 5JIKA 1B6DA 4HV8A 3IDMB 3EYOA 1HQRB 4R7DB 3QNZB 2EC9U 4ZSOB 3OWEA 4Y4HC 5J89A 1FYTE 2EDOA 4WTZG 1NEZB 4ZUWB 5J9PB 2D0HA 1T03L 1AGCA 1IQWH 3BSZH 3WNKA 4KROC 1R5WB 3O9WD 4W81A 1YNKH 1DBJH 4ZMAT 3X13A 5DQ9B 5BJTA 1LK3L 3VXMD 4AQOA 5EU6A 1KIQA 1XGRB 3F62A 2W1NA 2GSGA 4ZAKB 1NEZG 4Z0XB 5DK2B 1JBJA 4G5ZL 3RY4A 4ZFOB 4XCEA 4P23B 3VXOA 2D4DA 4M93B 3O4LD 2NY2B 1PKOA 2X9WA 1KCUH 2KBGA 3JTSB 5IWLA 4AG4H 4OB5H 3EOAA 3IU3A 5GISL 2HP4A 3PGFH 3ZKXB 4PRBA 4PJ9C 3RIAF 5ANME 5FCSH 4PGCB 3WDHA 3FRUA 5EU3B 1BQLH 3A0OA 1CDIA 4O51B 5MEND 4HS6B 2NY7H 4F3FB 3PHOA 1MI5E 3MRCB 4PLJD 1AP2A 4NWUH 2YD5A 4K3EH 4MJ4A 1BF8A 1ZXQA 1JPFA 2Q8AH 4IRJD 4L4VE 2NNAB 4H5SA 5ACLA 3QHTC 2JIXA 3L3GB 3K46A 5F7EL 5GGTH 1M7DB 3WS6C 5JUEH 1FGVH 4LLMA 4YEFA 1AGDB 3BESR 2E8ZA 5C09A 4DUVA 4WW2F 4Y4FD 4UAOC 1B6UA 4N0UB 4OUUB 2B4CC 5KN5A 3VJ6A 2VLRA 4PJXE 1RULH 3U6RA 3OKNA 5IIEB 4IOIA 3FO9A 4XNMA 5TE7L 1WJ3A 3X3GH 1L0YA 1YNLL 3FAWA 3LS4H 2XY1A 4JLRA 3SGKC 5C08A 4PJIA 3EJZD 3MYZA 5MI0B 4WO4C 4YHML 5E1AA 1UCBL 1K8DB 2R2HB 4I4WA 4MQSB 5FGRA 1TNNA 1NCBL 1R5IA 5CEZL 3STZA 4XP4H 3DBXA 5DEFA 4NC2B 4OGAD 4LRNH 4Z95L 1RK0B 3CUPB 4G7VL 5D1XD 2DQJL 2FBOJ 1CFNA 4J3VA 3OAUH 4EXKA 1VFBA 5EU6E 3O9WA 5I2IB 3T4AB 5I1LB 3GUTB 3AREC 2G60H 2P5EE 4ERSL 1CD1B 3ARXA 1W72A 1U8JA 3VXMA 3DXAD 1NGWB 4CVWA 4CVXA 1T7YA 4HXBL 3RWHA 3FQUA 1OD7A 4POUB 4PJBF 5BW7C 3R0NA 3MPCA 1EMTL 4AY0A 5EUKA 3VFWB 1EXUB 3CFEB 1DQLL 2FEDD 2JELH 3ZYJA 1KEML 1DLFH 3C5ZD 2VC2H 3NIFF 5F9JA 1S5HA 1YMMA 1YEEL 3WUWB 3RVWC 5ACZB 1RZGA 3SJVB 1TJIH 5EIIA 3O4LA 1CGSL 4N9OB 5C7XH 4LSUH 2EKJA 4FQJL 2R1YB 1DBKH 3WN5C 5ITFA 1QPXA 2YUWA 5D70H 5FYLH 1KF9B 1HOCA 4WHTA 4YHPB 4HK0B 3VFSA 4JREC 5HHNA 3ULVD 1N6QL 2MSPA 5DT1H 5DK0A 1UWXK 5E2TH 1CDBA 1L6XA 1DQTA 4TNWF 5FUZL 1UZ8B 3QUYC 3B2UC 4KKBC 1XGPB 3TWCH 4IRJA 3BKJL 2GI7A 1FC2D 3RWJA 3ZT6A 1RZIA 2OYPA 4DN4L 1TQCC 1EZVY 5C09E 2VDPL 5INDB 3RWEA 4NBYB 1WC7B 2XN9B 1J9CT 1MCLA 5INCA 4DK3A 3WCYA 4Y4FA 2Q8BH 4FXLA 2VZ1A 1KCVH 5DUPH 3BH8B 3NZHH 3SQOH 4G6FD 1CXHA 1MLBB 4WFGD 4OLEA 3E0GA 1H3TA 1TZHA 1BZ7A 5C08E 4PJIE 3JWOL 4GMSL 4U1SA 1RUKH 3BI9X 4OZIF 4PV8B 4XBPB 3CU1A 4Q6IB 3FMGH 2Q1EA 5DUBB 3VXPB 1MFEL 3O2WL 2CLRA 1S9VA 1MCDA 4MNQB 43C9A 5H2BB 1DQMH 3TA3C 2JB6B 5EO0A 2V2XA 3CGTA 1HQ4A 1U8NB 3ARBB 2P47B 2KL6A 2AJZA 4J23A 1P5UA 2YD2A 4LQFL 4QRSB 1E6JL 2NPLX 4KTDH 3VXME 1ZSDA 4F9PA 2VXVL 3VFRB 2HJLA 3BD5A 1FFRA 2YHGA 1RK1B 4IOFC 1N3NB 5T3ZH 2C1OA 5HYQA 1UENA 2RBLA 4NRZB 5TQ0H 1P2CB 3LS5L 1CLZH 4I0PC 4P2OC 2H3NA 1QFWI 4WI3A 5EOTA 3F7VA 1GGIL 3L5XL 3O4LE 3C5ZA 3D9AL 1EV2E 1IFHL 4RGNC 4D0BA 3QJHA 4Y88A 2N7AA 3BDYH 4KTYA 2EIBA 5EO9B 1K9TA 1CU4L 4L3ED 1CXLA 2KPNA 3DETC 5I8EA 3T3PF 3NFSL 5HD8D 5CJXA 2K3TA 5K9OB 5MENE 2CUMA 3P0YH 1PG7W 4OLUH 4LGSB 4XBGB 1A3RL 1H8NA 2L4OA 4OLZL 5IHUH 2CPCA 4M8QA 4EUPH 2GK0A 4HKZB 5ICYB 3A67H 3MRKA 1OW0A 1NCWH 2NY6B 4V2CB 3TIEA 1G7QB 3MODH 3L5WB 1FO0B 3JTTA 3TVMB 2DQGH 2Z4QA 5SWSD 4WEMB 3AXLB 3T0WA 4J3TA 4S11A 1TJGH 4XBEL 4EDWH 4ZPVA 3NH7L 5KJRH 1KT2B 2YRPA 3DX6A 1CLYH 5EZLA 5GSRB 3TBTA 4Z7VA 1BJMA 4K23L 4PJHA 3SE3C 4Y1AB 1R0AL 4DWHA 3SKJL 4ODTH 1AGEA 5DQJB 2WMPA 3GSOA 2LFGA 3L3DB 1DN0B 4BQ6A 2LV4A 4YUEH 1G9NC 2G5BB 1H3PL 1VKXB 1MFDH 4XAWL 4P4KA 1QEWA 1YJDL 4D0DB 4QWWC 3QUZB 5AZEL 4ELMF 1EEZA 5E8DL 1UKSA 2VITB 4PUBH 3MNVA 6FABH 5FA3B 2EXWD 1FZOB 4QTHB 2VOTA 2GSIA 1PEWA 1J05B 2RHEA 1K2DB 2DM4A 5L9DH 1JZ8A 1JYNA 3NBNA 3DROA 4X80L 3ZKNC 2KH2B 3MRIA 1DR9A 1XFPA 2P8PB 5KG9A 3D39B 3OKOA 5CGYD 5D7IB 1F3RB 5FV2A 1I1AD 4PD4J 3DXAE 2J12B 3FO1B 3SDCC 3UZQA 1UXWA 1S9YA 5FGCB 1W8OA 1K6QH 1XAUA 1MELA 4RMQA 3TJHC 3L7FB 4OCYH 5FK9A 3IDIA 2KZWA 1PKQA 2B8OT 5HGDA 1ZEAH 1EHLH 1DSFH 1R24A 3L3HA 4PJBB 1Z9OA 4KRMB 1UQSA 2NTFB 5D6DC 1U8LB 3O6KL 3J7HA 2F19L 1MCRA 2QQNH 4ALAL 5I1HH 3F7QA 5C9KA 2NXZC 4P5TB 4PP1C 4TULL 3RWDA 3DMMD 5JPNA 3FN9A 1A6TA 3S34H 2Z8WC 4L3EA 1P4LB 3ULVL 3OR7B 4Y4KB 1YYMH 4PIRF 4P2RB 2FL5A 3ULVE 5B3JE 3GJEA 2VDLH 4U3CA 2GJ6B 2OSLA 3WIHH 5DRXA 5FKAA 4TUJA 4OGZA 3C87A 3LH2H 5AZ2L 1BGXH 1WFUA 2R2BB 3KJ6L 3OJVC 1A6PA 2ICWB 3MV7D 1Q1JH 4KKAC 4XVSL 3F5WB 2AJUL 3QZWA 4QYOA 5I74B 5I66A 3S5LB 2ZUQC 1BBJA 2XOTA 2BVOA 2WBJC 5BRZB 4Z7VE 2EE9A 4QHMA 4PJHE 3GIZH 5DHVA 1A0QL 3BUTA 4D8PA 4LMQI 5C0JB 3QEGH 1AE6H 1CQYA 1X44A 1FFQA 3ARUA 2E9IA 4NQCD 4WFGE 5FUCE 5IVXF 1LO0L 1M71A 3TYGL 3KYMA 2ESVD 3EYUH 1HE7A 3B5GA 4YPGA 5BVJB 1YA5A 3QIUC 4UV7L 5J8OA 2P4AB 1AHWB 5IB2A 2YBRA 3TPKA 1F3DJ 4PBXA 2QJDA 2DTSA 1RIVL 4ZAKD 3UDWA 3O2DH 3CFBB 3QG7L 2VWEC 4Q74A 4U1MB 3S3JA 3MXVH 4GG6F 5B39B 1HI6B 3WFEL 5GZOC 2DB8A 1J0HA 1FZMB 1Z9LA 2VIRA 1KYOK 4P23D 2R1XA 2IALA 4PRIB 3STBA 4JJ5B 3O2VL 5CBEB 1IVLA 4KUZL 4L8SB 3LCYA 3WNMA 4UDTA 4H88H 2YA1A 5I1EH 3WXVL 1IAKA 1U8MA 2J5LB 2XXCB 4HXAH 4XCNA 5HI3D 4X4MA 1I1AA 4JY6B 4UBDD 5IFJA 1HSBB 5GGRA 5JW4Q 4YE4L 1PKQE 4XHJC 1NFDF 1AGBB 4CDGC 4KJPD 1T66C 4JGMA 1A6WH 3M17A 2WUBH 3WFDH 1T1XB 2PO6C 3MFFB 3N1QC 2N7BA 4AIZA 4HD9A 2OTPA 3TO4B 4JQXA 2AABH 4LARL 2HT4C 5CIPH 4GXUM 2X1PA 1LP9F 4KMTH 3RVXC 4X9IA 4PJ7A 4L3EE 4PBWD 4QCIA 2WLYA 1VPOH 1F8TH 3VRJB 5CMAA 3T65B 3NCBB 4JZJA 2GT9A 3MRNB 1BAFH 3MUZ1 4FFYH 3DMMA 1A6UH 3ZTJH 5I0ZA 3GKWH 3ILQD 4X9HA 5IW1B 2IFGA 3WE6B 1IAIM 2E6QA 5DMJB 1WEJH 3DRTB 5D1QC 3FO2A 3P4MB 4RMVA 3ULUD 1P6AB 1QSEB 1I8LA 4Z7UE 1XGYL 4OV5A 3OBAA 3ESUF 3NPSC 2OLDA 5JOEA 3C60B 4OM0L 3MRHB 4LVEA 1UM5L 3P77A 4HUUA 1MFAL 4WTZA 1I7TB 5SWSE 2IEPA 4GG8A 3VXSB 3HI5L 3TBSB 3MRMA 4PJCA 4G9DB 3R06A 4ZFFA 5BQ7A 1XF4A 1ZANL 1AR1D 5ID0A 1HQRA 3TH3T 3FQXB 2OL3H 2CJUL 2YXFA 4ZSOA 5BV7C 5C9JA 3Q6FB 4LLYB 5E8NB 2A6IA 2A73B 4QXUL 4NQCA 5HPMB 3TBYA 5A2FA 4LVOB 1J12A 2Z31A 2ESVA 2HWZL 1P7KB 4LPTA 2CUIA 2MQ3A 3L1OL 1FFPB 3EYQD 3EYSL 3ZHKA 2Q3ZA 1NSNH 4OLWL 3RKDD 2OTWB 2MNUA 5HGAB 3QAZC 1LEIB 3FOLA 2L7JA 5ESQB 1ZT7B 4X83A 4FRWA 5J6GB 4CJ1A 3SDAD 5FUOH 3WLWC 4UINL 4YHKL 3VXNB 1MCEA 4OJFH 4DGVL 2Z9TA 4ZS7H 3IFNL 4R4ND 3BKYH 3SJVD 1X5AA 3OMZA 1F4XH 4X4ME 5KS9B 3EZ8A 1J18A 1AY1H 5BXFA 1KJVA 1EGJH 4WGWB 4K94C 2MTPA 4Y16D 3OPZH 1IKFL 5FYJU 3GMQB 4PGBA 1JI2A 4OBSA 3FAXA 5EU3A 5FO9A 4ETQB 5DC0A 4X6CE 1T83C 3UP1A 3LN4B 2B0SH 2YSSA 5DJ2A 4PJ7E 4M03A 1LQSR 43CAB 5GGVY 1I4FA 1MCBA 4Y7MA 1BD2B 2D31A 4KJWC 1DBAL 4U7MA 3QT2A 4AMKL 3CX5J 5BMFL 4ISVB 2X1XR 1M7DA 4RAVB 3H3PH 1WTGT 3GMOA 4JDZA 2CXGA 1NBQA 1HHHB 5BS0D 3AVEA 3N1MC 1A9EA 3GJFB 2ZCHL 4NQTA 3FT2B 2APTA 3WKML 4HUVB 1CFVH 4R26H 4UNTA 4GRLB 3WJLC 2ZNWA 3MV7E 1CDHA 4JDTH 5E24E 4QHNA 3O6LL 4DW2L 4PJCE 1RVFL 5ENWA 4DZ8B 4MNQD 4JPKH 4PGJA 3O0RL 2FX9L 5CP7B 3G9VA 2QKIA 2R2HA 3GGWB 4ZSOE 3V7AG 4NDMA 5DYOB 5T1MB 4NQCE 5KOMC 2IAMC 4WWKB 4IJ3C 1T0MB 2ESVE 4H8WL 3TP4A 1MWAB 1RK0A 3CUPA 4PJDF 2XPGB 1JV5B 1CE6B 3RZCB 2V2TB 2XT1B 3QJFB 3GUTA 3TNNA 4O5LH 5FOJA 4MXVF 4BH7A 3T0EC 4U6HB 1MJ7H 1Q0YL 3N9GH 1YDPA 1NGWA 3FZUD 3RI5F 1MF2H 4TSCL 1E4KC 1MPAH 4HIJB 4J4PC 3CFEA 3SDAA 4NSKB 3I9GL 3S3PA 4WV1A 4R2GD 4PRDB 4P3DB 4G8IB 5E03A 1JYXA 4L9LC 3QDAA 3QIBC 5CEXA 3BRFA 1HZHL 2XKNA 5E5UB 3VXRA 4ZTOH 1U6AL 5GRJL 1KXVC 4Y16A 3P11L 3SGDH 1HCFX 3ROLA 4JB9L 3MV8B 5DLML 4TUOB 3QI9C 4HK0A 5D6CB 4L3CA 3QFDA 1NFDB 2BCKB 4MQXD 3QEQA 3VFTA 4HH9A 3NCYS 4OKDA 3HAEG 2AKRA 3QWQB 5KVGL 3KYAA 2CDFA 1MFNA 3MNZB 2O5ZH 3EYVB 3TVMD 4I3SL 2HT3C 4I77L 1N5AB 1U8HB 2AI0H 4NNYB 5FDWB 1PSKL 5GXBB 1P7QB 4MXQD 2NY1B 5I1KL 5E00B 4N0UE 1ULVA 3ULUL 5BS0A 3ZKMC 3ULUE 3UJTL 4Y1AD 3GIVA 4IM8A 3U30B 3LAFA 2F15A 2O61B 4M02A 5CLTA 2XACC 5A3ID 5DMKA 1RZ8A 4NQED 3HMXH 1QG3A 5F7LB 2ZUTA 3GBNL 4IIQA 4MMZC 3PHQA 1VADA 4JM2F 5JHDA 2YN3A 1RUQL 2Y7QB 4BZ2L 2GY5A 4PV8A 3P4OB 1HHIA 3L3IB 1J8KA 3N1FC 3BE1L 4XT1C 2FEEL 5IVNA 5BZWB 3QCVH 4MLIA 4G80B 1WBYB 4MJ5B 3QNXA 4FQXD 2FBJH 1MNUL 3KHOA 5F3BA 5GGQL 2GJZB 3G6DL 5SX4H 4KI5E 2CRIA 4R9HA 2HJFA 1G7PA 1K4DA 5FAAA 4AT6A 2ZKHL 5FYJD 3VE0B 5DRWB 4QRSA 4R7NA 2QQKL 2JCCF 2O26U 2XNAA 5HYEA 4LCCA 4JPIA 3GNMH 1A6VH 3VFUA 4M7LT 3RVUC 1M7XA 4JFHD 4NPYB 4LNVA 5JO5B 5HVHC 3X12A 5KW9L 3HUJA 4RISH 1OQOA 3TZVB 1N3NA 1ZS8B 5B8CC 3MLZL 4FQQB 3F7RA 4NRZA 4KKNA 4Q2ZA 4P46A 3SJVE 3UO1H 3WO4B 5IQ9B 1RZKL 1KBGH 3RWIB 4M6ML 3MRQA 1OAYL 2G75A 3D25B 3WIIL 4PLOB 2OCFD 1TVHA 2H26B 3OHXA 5DSCB 2Q7NA 1YEKL 2V7HB 2Z0BA 5GIRA 5IB3B 4OFVA 3ECBA 3ZLQC 4P2RD 2PR4L 2EDNA 2A2QT 1UACL 5K9OA 3RTQB 5FIEA 3CFCL 1MRDL 5I75B 3DYOA 3VFPB 5KOVC 3S4SG 4HKZA 5BVPH 2Z8VC 3ETBF 1FQ9C 4K71B 1JGUL 1FO0A 3TVMA 1XCQB 4XI5D 4MCZB 3SOBH 4GRWE 1NAKL 3ARYA 3KXFD 5GS0H 3HC4H 1QLFA 2Y06H 5FCUL 5FM8A 5EH1A 1KT2A 4OLYL 4NKIH 5DJ8B 4OKVB 1IM3B 2VISB 2VLKB 3KNBB 1TVBB 4WW2A 4HQQH 3HE6C 2Z91B 3PG2A 2QSVA 4NC1E 3HB3C 3UJJH 2MFNA 4J8RA 4LSSH 4R3SB 3MA7A 4NQEA 4BFIA 4HWZB 2AJYL 1BFVH 1HKLH 2DQTH 1DVFC 5JZ7D 1S7WA 2G5BA 4NWTH 4WI5A 4M48L 4C55A 2IGFL 2HRPL 4MNQE 2DLEA 1T0PB 4D0DA 1Q9KB 2VITA 5CEYA 3WJJC 5T3XD 5IFHH 3SO5A 5HHXH 2C3HA 3LHPL 4PRID 1S78D 4HUMB 5GS0C 4JKWA 1YEFL 3AB0C 3RHWF 1JWMB 2SEBA 4FQXA 2R8SL 4LHUB 4UTAL 5FGSA 4M5ZH 1H5BA 4J2XA 4MA7H 3LDBB 2P8PA 5IB1B 1X5XA 3EOBA 3WHE0 1LE5B 3V5KA 2FATH 4NGHH 3O8XC 1NLDL 2CKBA 2YKLH 4HH8A 2VKXA 1T2QH 1KJ3L 5TDNB 4LHUG 1P53A 3HI6H 1FORL 3F12B 1FDLH 1G9MH 4MA1C 4OSUL 1JWSA 4ONHA 1RUAH 1EVUA 1U91A 1ZTXL 2BOCB 4Y2OA 5IROA 2ORBL 4CVZA 5E4EC 4UAOB 5JW4N 3PJSB 2Q6WB 2CUHA 4YO0B 3NMEA 4LU5L 3MGOA 3ILPA 3EO1A 4ZTPL 1JF5A 4TVPH 3IDJB 2QQQA 4P2RA 1JNLL 3EFFB 3DV6B 3QNYB 1UWXH 1YYLH 5F3HB 4WO4B 1G9MC 1TJHH 4Y5YA 1NMBH 1PYWB 1U93B 5EO1A 1GXEA 2GITB 3THMH 5DJZA 2I60H 1I9RH 3BW9B 4K55A 1E4JA 3LN5B 2PTTA 4M7KH 1FVCB 1IT9L 1EEYA 1ZVHA 5T33H 3F7YB 3KXFA 1NAML 4Y1AE 4URTB 2RCSL 5E8EB 5ADPL 3FB7A 4HMEA 4X6BB 3RVTC 5JTWA 1OTTC 4NQEE 1V5JA 1UKQA 5CJQL 4BKLB 1IC4L 4HJ0C 3LKOB 1U41A 1FIEA 2A9ML 4FABH 1KXQE 2P7TA 1LILA 2FX7H 1J1OH 1AHWA 3GSWA 3PABB 3GO1L 5DQDL 5C0FA 4P59H 3M1BB 1ZHBB 4JZOB 1A64A 1FSKC 2QADC 3CFKB 4KK9D 1HI6A 4OZIA 2HFTA 3PGDB 4NO2A 4O2EB 1UWEH 4XWGL 3VW3L 2FZ3B 2YN5A 5T5FH 4PRIA 5EULV 1Z6JT 5FYJL 5L88L 2W60B 3NCMA 3D39E 12E8L 2CKBL 2WAHA 3HCVB 5FYJE 5D7IE 1BX2B 4ZOCA 2EO9A 1N4XH 3VWKB 4M8VA 5D72L 4YBHA 1JFQL 2X1OA 3FT3A 5FGCE 1WBXB 3QQ9D 3BO8B 1JPSH 4JY6A 1IAOB 3OZ9H 4JFHE 1XR9A 4JPVH 4U7SA 1I8MB 1OM3H 3P0GB 4YDIH 1Z5LA 3C8KB 4LASH 3MLWL 4X99A 4RBPK 2AW2A 2DMCA 4PJBE 4MAUH 3PWUB 2YXMA 3MFFA 1FGNH 4HKXB 4LCIH 5HY9B 1RJZA 5MERB 1F00I 1BD2D 2IF7A 1QBLL 3QR2A 4U0RC 4LSDA 4ZPTB 2D03L 3NIFE 4JFDB 1J1XH 3CXHJ 5IBUG 2VE6A 2XV6B 3ZDZF 2AVGA 1JK8A 1G1CA 8FABB 5T1DL 1EERB 4WNQB 4P2RE 3RVVC 1KJ2B 3G5XB 5B22A 5IR1B 5DD3L 3WE6A 3FHAA 4IHOA 3DRTA 3MRPA 3MOBL 5F1NA 3AC0A 3VFNA 3I50L 1OGAD 5MEQA 4GRLD 1S9XB 3GK8H 1R6VA 5JXED 6CGTA 3KPPA 3D69A 1HHGA 4LLDB 5JHLL 1M05B 4JY4A 3Q2CA 3KXFE 3C2AL 2H32A 3TBSA 4G9DA 5SV3A 4QGYA 4PY8J 3V6FB 4O2FB 5GISH 3S35X 4WWKD 4K7PL 4MVBD 2IADB 1UJ3C 3TBWB 5I76B 1QFWL 5HPMA 2ERJC 2JJSC 2PCPA 5DFVD 1AQDB 3UTZB 1U42A 5C0IA 2A0LC 4E9LA 1PGRB 5TQ2L 1BPVA 1I8KA 4WY7H 1OQXA 1S7TB 4TRPL 2HH0L 1NMAL 3D87B 4OZIE 4PLNC 3GRWA 1HWGB 1F4WL 2QSCL 5T3XE 5F7EH 4BYHA 1FL5B 1YZZA 3VGBA 4D3CL 1ORSB 4U2YA 4ESKA 4PRIE 2NY3C 2COQA 1LEIA 5EG6C 1S9WA 4ELMA 3C5SB 4MHHG 4KQ4H 2DD8L 3TT1H 4W6WB 5CUSL 2N4IA 5J6HA 1SJHB 1ZT1A 4N0CC 3BYTA 4Q6YA 4Y89A 5I73C 4K7PX 1EFXB 5IF0A 4YHYC 3L5IA 1BVZA 3MOAL 5E8OB 4HT1H 1YUHB 2ZZUT 3TH4T 4XP1H 5TE7H 4PJFF 1YNLH 5HVFB 4JANB 3MV8D 3CK0L 1QRNB 5DC4B 3CC5B 4YEEA 5DFTA 3CLFL 4YHMH 1KLGB 1QHPA 3EYFA 1UT9A 4JZNA 1OSPH 4NCC2 1ZLVK 1TCMA 1RZJC 3HR6A 1CL7I 3HLAA 4AH2B 2NY1D 4TVSa 1QQDA 4UOW1 3GSXA 3T3PE 4MNGA 4P9HL 3VFMB 1DL7L 2VXTL 2IMMA 1FG2B 2ZUUA 4G8GD 5ISZD 3GJFA 1KIPB 2NQCA 1JHLL 3FT2A 4WI9A 5IW6B 2UV3A 4GW5A 3QUXD 1OGAA 4GRLA 1EMTH 4D0CA 3STLA 5F88A 2DMKA 2H41A 1DQLH 4ZOAA 1KJMA 2Z8SA 3DHJA 3MUHL 5JXEA 3OJDA 1VB9A 3GSNA 2JJVA 3Q1SH 4WW1B 1JPTL 2Y6SD 4M7ZB 3T0AA 3DX9A 2AERT 2J88L 2PXYD 4YXKL 4UTBL 2WWKO 1XT5A 5IB5A 1YN7A 5DYOA 1J10A 4ONGH 3RIAK 2FO4B 1JNJA 3SDXF 3PV6B 2NY4C 1S8DB 4XPAH 4KKCD 1WAAF 1MFCH 4MZ3A 1N6QH 1SJEB 3GRWL 1X7QA 4Y0GA 15C8H 5IVXA 3N1PC 1L0QA 1WCBA 3ZE1F 2Q20A 3U0WL 5FUZH 1II4E 5C71A 2UZIH 3B9KB 4OI8A 1DQDL 2YPLB 1M6OB 4U6HA 3BKJH 3QA3A 4ELME 1GC1L 3NGBC 5IWLC 4DN4H 4Z5RB 4GW1A 5JXAL 2ARWA 2NW3B 2RR3A 5KVFL 2NXZB 4GG6A 4F7MB 4G6KL 4G3YL 4OD3L 5KS9E 1JF1B 5F6HI 1CICD 4Z0BH 3P9WB 4G8IA 3HC3L 4ORGA 2GQHA 3HZVB 2ZUSA 2O93L 4R8WL 3HAEA 1I8IA 4LRIA 1BOGA 3HI1B 3JWOH 5HHOB 5T1KA 4U4BA 4JO2H 3MV8A 3K2UL 2XG4A 2EC8A 3IETA 1G6VK 2EDFA 1NFDA 3O2WH 4AEIL 1BD2E 2OI9C 4H1LG 5C0BB 1P4IH 3KPQB 2FYYA 2YD3A 1CXIA 1LP9A 4RA3A 5HI4C 5DJXA 1W72H 3MRBB 3LZFH 1E6JH 5E00A 3V6OE 1WQVT 2C1PB 4G8GA 2VXVH 3FB5B 1DTUA 2NY5L 4PB9L 2VLKD 4L4TB 5FO7A 5ISZA 1OGAE 2Y5TB 3KPRA 3V7AE 2AJ3B 2NW2B 2AXFB 1EO8L 3SGEI 2BC4A 4EJ1C 3O6FB 3QPXL 1XCTA 3B4NA 2LVEA 3GSNL 3QUXA 1A3LL 3OR6B 3DOSA 4YBLC 5D7JD 5EORH 4TPRL 3G08A 5GRVL 1GGIH 2DM2A 3L5XH 3D9AH 1IFHH 4S1RL 5HHQA 4IRSB 1FE8H 2Y7QA 3L3IA 3RX5A 1HNFA 4KK6C 3G6AB 1CU4H 2HA1A 4C56B 2P42B 1VFAA 5I8CA 5BZWA 1CIDA 2VDOL 5GSVA 1EX0A 5D4QA 3NFSH 2PXYA 5T5NF 3BGAA 2AXHA 4XVTL 1MIEL 1YY8B 1NEUA 4LHUD 2GJJA 4TYUA 1MH5A 5IVXE 3CDFA 4LQ1A 1A3RH 4XCYA 5DRWA 4OLZH 3FQTA 3HE7B 1LO2L 3ORJA 4TNWK 3PDGA 1Q9LB 3GMRA 5JO5A 4W6XB 2JE8A 3QIWC 1YNTB 4GG6E 3QH3B 1ROWA 4X7FC 2F8XC 3ARFB 2OM5A 4XBEH 1IGFL 1FN4B 1XH3A 4IEFB 5F1KC 3NZ8B 1CQKA 5CBAB 4U1JA 1L7TL 4K23H 4P2QB 3RWIA 1R0AH 4JFEB 1CICA 3QDJB 4WHDA 4PLJC 2HFEA 1HXMB 5JW3L 2AEWA 3HPLB 5HGHB 3S4SA 1QLRB 3MV8E 1AD0B 4IRJC 1H3PH 4XNQA 5IB3A 1JNHB 4MNHB 2BSSB 2HT2D 4PJGB 1NFDE 3QEHA 5E9DB 1F4YH 2X42A 1YJDH 3T0VA 3H7BA 5AZEH 5CIPB 4NRXB 3SE9L 1I1FA 5C0RL 1NBVL 2J8OA 4FTVB 1KLUB 4KQ3L 1MJJA 3P0VH 4Y4FC 1Q0XL 5DJ6A 2V9QA 3JV6B 4ONFL 5ACMA 2BSRA 3C6LB 4L5FL 1CFQB 4X80H 2FWOB 1XCQA 4OFKA 5DRNA 1CTNA 5IVZB 1XGTB 1NANI 4KMLB 4G8GE 2OJEA 3BP5B 5ISZE 4LEXL 1CDCA 1E6OL 2DQHL 2NCMA 3EJZC 3DX8A 2VLKA 3H2WA 3NN8B 1UYWL 1RHFA 4DKAA 2Z92B 4HZAA 2P1YA 3BPLC 4X5XA 1A6AB 2EDXA 1J8HA 2JJUA 5DD0H 4OF5A 1UKTA 5IMKB 5D7JA 4OGAC 4I2XA 3O6KH 5E7BA 2YK1H 2F19H 2YD8A 4JHAL 5D1XC 5GS1C 4ALAH 1KLFA 4JM2D 4F9PC 4HW6A 2OL3B 2E3VA 4NZRL 1T3FA 1P6FA 1RZ7L 3O3EB 3NCJL 1LEGA 2WIIA 3TPUB 3ULVH 3IDGB 3KWWB 1K8IB 2A1WL 4Z8FL 3LB6C 1D5BB 4L3AA 4LHUA 1IGIL 3KPLA 2EH7L 3K4ZA 1NBYB 2A9NL 5IB1A 3CFDB 3DURA 5I16A 4PJDA 3C5ZC 5F7WC 3VRLF 5IEKA 1Y6MR 3KJ6H 3P9LB 4LFHG 1J7VR 4GKNB 4ONOA 5HDQH 2EDYA 2AJUH 5DS8B 4E5XA 1EJOL 2AV7A 4LEOA 1B2WH 4KHTH 5CZXD 4JFDD 3U0PA 3O3DA 4GUPA 1LO0H 5KSVA 4D2NA 3NOIA 4ZYKA 4NKOA 1OW0C 2EO1A 4WDIB 4YAQB 4UV7H 5EUOF 1Q9OA 4AIXA 3AU1B 5DJCB 1RIVH 3NFPA 4J12A 4Q9RL 3EFFA 5DVLA 3QG7H 2KQMA 1U8PB 4U1KB 3DV6A 3HZMA 2OQJA 3WFEH 3QNYA 2R9HD 4XNUL 4Q9CA 5EBGA 1EHXA 3DTXB 3O41A 4RIRA 4H0IA 4JG0L 1REIA 7FABL 3O2VH 4S0SD 3IS1X 3IFLH 4KUZH 3IFPB 5CJOH 4KWUA 5D2NB 3BW9A 2IAMB 5HYSB 5F8RC 4JFFB 1QBML 3LN5A 4IDJL 3WXVH 4C54A 3SDYL 4H20L 3HG1D 1F13A 4KAQL 5IG7A 5F7KC 2VLKE 4BH8B 3GMLA 2IBGA 1N6UA 1ZWIB 5HDBF 4YE4H 5I0DA 4RQQB 4RWYL 2G9HB 4H0HB 4XTRD 5T1LB 4BKLA 3T0EB 1IGTB 3LKOA 3TT3H 4I2XE 4JE4B 1CXEA 4LARH 1N59A 5C3TA 1CN4A 3MLVL 4M6NL 3M1BA 4FP8L 2IPKB 4JM2A 3NAAH 3AGVA 1Q94B 2XTJC 2PYFA 2LU4A 3GJFK 4G8EA 4MD5B 4U2ZA 1SYVA 1H3WM 4YXLL 4Q97A 3HZYB 3BISA 3SO3C 3TC9A 4JFPB 1SEQH 3CZJA 4PGEA 4YBQD 1EFXD 2DWEA 4PJDE 1OAQL 1BQHB 2HVJB 4ZQKA 1XGYH 3ARWA 1LK2B 3AAZB 1EEUA 1U3YA 3SE8L 2PETA 5JNYB 3U36B 3PDOA 4OM0H 4MXVE 5D9SB 1QSFB 3QQ4B 2B39A 5E2UL 2JCCA 1KB9K 5EBLB 1T20A 5T5NG 3FL7A 4NNXB 5DHVH 4POZC 2MCPL 3PWUA 1BQHG 4WEBL 1T1WA 5IKCA 3MBED 1JN6A 1BEYL 3RGVC 2VH5L 3CNKA 1IM9B 2CJUH 4JFDA 1T7WA 3D48R 5TDOA 1T22B 1XF1A 3DIFA 4YHZH 1M1SA 1U3ZA 2HWZH 3L1OH 4XGZB 5D96B 2F54A 1AFVH 2FD6L 1KJ2A 1S7VB 1P5VA 3V5HB 1K5NB 3EYSH 4OLVH 3VMPA 5AAWA 5CHNB 4HUXA 1DFBH 5CILL 2NTSP 4X9BA 2CGRL 1JHKH 3QWRA 2AJSL 3MA9H 1S9XA 3EW3B 1N0XH 1IARB 4UINH 4MA3B 4YHKH 4PV9B 4DGVH 1U2CA 3IFNH 5DJYB 5M7QA 1JMXA 4S1QH 4JDVB 1M05A 4OGYH 4S2SB 4DQOH 1SBSH 3IF1B 3I75A 4FQIL 1H15A 1UADC 1WT5A 2H2SD 4KFZC 4CKVX 3U0TB 3HG1A 5DJDA 1IKFH 2WLZA 3CCHB 1KEGL 1XEDA 1QFWM 1ZOXA 4UQ2B 2ZG3A 1VFUA 3LKSB 5IJKA 3L3OB 3SE4A 2IADA 3PQYA 3TBWA 3VH8G 3IKCB 1C5CL 2XZCH 3FONA 5JIHA 5IHLB 1KIRA 1MAML 3CVIL 1AQDA 1XIWA 2XQBL 4F33B 2F74A 2ZUVA 4KDVA 3BIBX 4KRLB 2C4XA 1QP1A 3B9KD 3BPNC 3VG0H 3VGGA 2YPLD 1RAMA 4HG4J 3CDCA 5I1GL 4AMKH 3REVA 5GGVH 2D4FA 5CGYC 4HMCA 2HJKB 1NGQL 1N2RB 4YC2B 4Q9QL 1GYAA 3MRFA 4HGKC 5EFIB 4OF6A 3BPCB 3V79C 1SJHA 2CSPA 3HRZB 4JFOA 1WFNA 1AXTL 4JQXC 1PAMA 1GAFL 1EFXA 4J3WA 3LN9A 4MA8L 1U3HA 2JCCE 3K74B 1KCKA 4HWUA 4QF1B 5HHOD 4HBQA 2EYTB 3IYLW 2VDQL 4NQXB 1QO3A 3O6LH 5JW5B 4HJGA 4XPBL 1YC7A 3QULA 4DW2H 4PG2C 4WFFD 1BIHA 1I3RA 1HWHB 1RVFH 1TITA 3DMMC 4FZEL 3PIQB 3CH1A 3O0RH 2FX9H 2P24A 5C0BD 5D2LF 4JFDE 3MBEA 3QFJD 4MGXA 4DGYH 3DSFL 3RDTC 3A6BL 3PF2A 1OOAA 5I30H 1HH6A 2AQ3A 1WK0A 2CRYA 4KDTC 1X4ZA 5C0ND 4BZYA 1FL6B 2EXYD 1CFTA 4N0YL 2WP3O 5FV1L 3MACL 3CLEL 1PVHA 1FG2A 4O2CB 1IAII 4PY7B 1DVFB 2XTLA 4Y2DB 4C57C 1IJ9A 3HNVL 2XRAL 3BIAX 4M4PA 3ARDC 1IRAY 5KSBF 1JZ4A 3OL2A 3O6FD 4TSCH 1ZLSL 5K93A 3PXHA 5MEOB 4N8VG 1ZA6B 1LDPH 1DDHA 2EIZA 3D85B 4LCWB 2BOBB 4MD0A 1HN1A 4FFZH 4QT5A 4IRSD 1T2JA 4WW1A 3WDIA 1IBGL 3HG1E 3MREB 4C56D 1HZHH 5ICZA 1U6AH 2FJHB 3K8LA 5IOPB 5IBTH 5GRJH 4GW4B 2NXYD 2DICA 3GSQA 2BNUA 5IV2A 4ZAKC 4NM8L 1NLBH 3P2TA 5DLMH 1GGUA 5IJVA 3OX8A 4K8RC 3PWNA 5FB8A 1HHJB 4X4XA 4TOYL 4A2LA 4P23C 2BJMH 1IL1B 1HIML 4U05A 4YWGH 2I07A 2EEDA 3CXHK 4JO3L 2YWZA 4OD2A 4M93C 4QEGA 4P57B 2NY2C 3I3EA 3HS0B 2YPLA 1B88A 1M6OA 4I3SH 1BM3L 1KNOA 4I77H 4X98B 2HFGH 1PSKH 5C92A 1T7ZA 4NP4L 4YDJB 5HI3C 1QFUL 4J3OC 4ZDHA 3PWPA 3ZKXC 2YOCA 3ULUH 4YHIB 3VXTB 2DQIL 4DUWA 2Y72A 1N6VA 4OF3A 3N50A 4KJPC 2F53B 3UJTH 4P2QD 4GBXB 4JFED 3QDJD 1DLHB 4APQB 1U92A 3VWJB 5TDPA 3UJIL 1AD9A 1XF2A 4H1LA 1KPRA 4DCQB 1NJ9B 2X4UB 3TM6A 3T2OA 4X6FB 3IXTB 4EI5B 5D1ZA 1H3XA 3GSVA 2P8MA 3GBNH 1RU9L 5E9DD 2FJGA 4JGJA 1ND0B 1OB1B 3C08L 4RBPH 4E41B 4V1DA 3UTTB 4BZ2H 4FQHB 4F2MB 1KELH 4HWBA 5C8JB 4FTVD 4ZUUB 3ILQC 5C0BA 3QQ3B 3AMKA 5JQ6L 3QFJA 2IC2A 1CFBA 1RZFL 1MNUH 5GGQH 1FAIL 2ZOKA 4GKSB 5ITBL 1A02N 2QQKH 5DTFA 5DI8B 1HXYB 3FFCB 2C1PA 2R0LL 3MMEA 5DWUL 5MI0C 1D9KD 2CDGB 2G5RA 4NHCL 2Y5TA 3IAQA 3RI5K 5KW9H 5GRUH 3MV01 2GCYB 5HI5D 5LCVL 4QOKB 3BH9B 1AR1C 4XWOC 1IGJA 4A6YA 4XC1L 2ZOLB 4OF8A 2QQLH 3UPRB 1RZKH 2IQ9H 3SCMD 4M6MH 4KI5C 1UB5B 3DUUA 1R3HA 3H7LA 3RJQB 4B7LA 1MVUA 3BJLA 4C56A 4UIMB 1YEKH 4PRNA 2VQTA 3RKDC 1YY8A 4QRPB 1UACH 1I7ZB 1VERA 1VFMA 4KRPB 3DVNA 3GM0A 1IC1A 1ZA3A 1NQBA 3MGAA 1S5IL 2YPLE 3OKMA 5IP4A 4WJ5A 3VXUD 2P44B 3GHBL 1Q72L 4YQXH 1YECH 3G5ZB 1TCRB 1PEZA 3ZSSA 4NKDB 3LIZL 4GRWH 4AYFA 5I1IL 4KKLD 4U0RB 4DKEL 1J88A 4OIIH 4GAYB 3U4EB 1X4YA 1ACZA 1NCTA 3W9EA 3NFNA 4FFVD 5F1IA 5FCUH 5C07B 2FB4H 4NHUB 2AQ2A 3OGOE 5GS3A 4C58B 1S7UA 1VCAA 3OXSA 4NOFA 4ORZC 3QDJA 5SWZA 2IPTL 1AXSA 1WFTA 5HHOE 4FOMA 3MCLL 4RZCB 3TN0D 3O45A 5LGJB 4ZS6C 3MJ8B 2HN7A 2HMID 1MUJA 4WFFE 3LD8B 2PNDA 2ATPB 4M48H 5J13B 5E9DA 2IGFH 5GRYA 2GFBA 4PJFA 4IS6A 1WVZA 5C0BE 1W0WB 3E8UL 3MCKB 4NOBA 4P4RA 3KPSB 2B5IC 3QFJE 1TDQA 4P3CL 4XZUA 3EO0A 3T4YA 3LHPH 3DGCR 1UFUA 5ICXB 5ESAB 1ZLVH 4BSVA 2I5YL 1QNZL 1YEFH 3ZTNH 5KSUB 1MJ8L 2DM7A 4IRZH 3K3QA 3DGGB 4F7EB 2R8SH 5D7KD 2HG5A 4JFFD 3ZDZE 3QBTB 4NC1C 2R4RL 5IVZA 3CD4A 1SEBB 2R1WA 2EKSA 3AS2A 2WQ8A 5B38B 4I3RL 4Q6IC 4A6YL 3BQUB 4NKMB 2ICEB 1KJ3H 4F15B 5CJ8A 1D9KA 5T1LD 4L4JA 1AJ7H 3W9DA 2XYCA 3KPOB 5GHWH 4QXTB 3TCLB 3R0MA 4L8CA 1JHTB 4R0LA 4OSUH 4AZ8A 1D5IH 5F93C 5CD5C 2ORBH 3IJSA 4HZLA 4E0RA 4C56E 5CFHA 4LCUB 3SCMA 2BP3A 1T4KA 2H1PH 3IB4A 1V3KA 3GZKA 1V7NL 3H42H 3NPZB 3RWCB 5IQ7H 3VFVB 1ERNA 3KPTA 2XICA 4IOSD 4ZTPH 4LHJB 1S7SA 1RUMH 4OZHB 3SKNB 1MI5B 3IVKA 3TCXA 1CG9B 1NMCC 3EKCA 3WEXA 1U58A 5CSZB 1JNLH 3FZUC 3C5JA 5DJAB 2BRQA 2QBWA 4HUWA 3BX7C 3BZ4A 4CVUA 2BY3A 4QY8A 3SDXA 1ZHNB 4JVPA 1NBYA 1FO0H 1LO3L 2R0WL 3ESVF 5E0QA 3MGTA 1WAAA 2YPKB 4XPFH 4OZFB 3P3YA 4R2GC 2VLJD 3P9LA 3VXUA 1ZHLB 3R8QA 4UT7H 4ZUSA 2ADIB 2O5YL 5EPMA 1X5LA 5DS8A 3QP3A 5IB4A 3ROOA 5CD3B 4X7TB 2XZAH 4TSAL 4P2YA 2A6KA 4P2QE 4PJXB 1S7XB 4JFEE 1CZ8H 1KENH 3QDJE 4OZFG 2DJUA 2RCSH 4WU7A 4QXGL 5H35A 2B1AL 1FLRH 2R15A 3NCYP 4EN3A 4MQXC 2CIIA 2PF6A 3QDGD 1UZ6F 5FGBA 1X5GA 4HIHB 4MX7A 4YGVB 2DQCL 3TN0A 2NY6C 1HILA 4HV8B 5E9DE 3EYOB 4PJFE 2AGJH 5FDYA 1OY3B 1QR1B 3TVMC 5F7YC 5DJCA 1J0IA 4FTVE 4WHCA 3IFOA 4MXQC 1U8PA 1AGCB 4PTUA 3W82A 5IMLB 2DL2A 3MCG1 5BJTB 1T1ZA 5FYJH 2Y36H 4XMLL 3RHWK 1ACYL 4PG9A 4YDKL 5EU6B 1KIQB 2VXSH 3GB7A 5A3IC 2CKBH 1IEHA 4FQPA 1IMHC 1PZ5A 4HIXH 4OI7A 1B4JL 3RX8A 1MJUL 4NQVA 5CP3A 1JFQH 3O3AA 4K9EC 4O4YH 4XCEB 4YFDB 4XXDA 2HAZA 1O5DT 1MRFL 4LPCA 4BH8A 2H2PC 2B1HL 3QUZC 3TFKD 3VXOB 5FHAH 3S96A 1U2HA 2VDNL 2G9HA 1JMZA 5T1LA 1VGKA 1OCWL 1IGTA 5TE4H 4X6EA 4OZGF 1NUDA 2Q7YA 3EOAB 2DBLL 3IU3B 3L5JA 4BSWA 1QBLH 1LNUA 4PRBB 2BVEA 5FYKU 3FRUB 2C3VB 3TV3H 4EI6A 4JHWL 3QXVA 1U95A 3PHOB 3VA6A 3BMWA 1AP2B 1Q94A 1QKZL 2EDEA 1SM3L 5HGBB 3S35H 2EH8H 1NGYA 1JPFB 3QRFM 3SDXE 5ILTL 5F7FA 4H5SB 2JIXB 2E6PA 4RFEA 4K3JH 3LSOA 5J0BA 1BQHA 3KR3L 4LLMB 3VXUE 1K85A 5FM4A 3ZE1E 3QPQD 3P9MA 3U36A 3QYCA 4HX1A 4R96A 3LKNA 3U4BL 2VLJA 3NIGF 3JZ7A 2DF3A 5JHLH 5JR1L 3VJ6B 1QUNA 2VLRB 4YFLF 5DD1L 4RGOL 5EOQL 3U6RB 1B9ZA 2R2CA 3OKNB 5CZVH 4IOIB 3FO9B 1U9KA 5LGKA 4XNMB 4GO6B 3FN0L 5L8KB 4XNYL 4F7TA 3JBG7 2V5YA 3T09A 3C09C 1J87A 5E94A 4JLRB 4M7LH 4PJIB 4K7PH 1T22A 4X4YA 5L0QC 1U0QA 1QFWH 1F90L 3QDGA 4Q0XL 4P48A 5E1AB 4Y5YC 1A14L 4I4WB 1C12A 3WFBL 1R5IB 2WW8A 3HC0A 4TRPH 3STZB 4AIOA 2HH0H 2R29H 1NMAH 5I74C 4F7PA 3BRDA 3C8DA 1K5NA 1KC5L 1FYHB 4D3CH 1IC5L 2W0FA 3SKMA 1PQZA 4JRXA 1X5ZA 2VAAA 1VFBB 1CR9H 3O9WB 3K1KC 4HLJA 4H25A 5D2NE 3GSRA 3D85D 2DD8H 3KYKL 3DV4A 4LCWD 5D7KE 5CUSH 4JFFE 5IT2L 1W72B 1U8JB 3VXMB 1FH5L 4CVXB 4EQ3A 3VH8A 3RWHB 4A2MA 5ID1A 3B3IA 1KFAL 4XP9L 1AHWC 2F58H 1U8KA 5EZIL 4DKFL 3MJ9A 4YFLI 3PWJA 1NUNB 3I6GA 4JFYA 3U46A 1PY9A 1ZGLM 3T2NL 1YMMB 4LOUD 3CK0H 1RZGB 5EBWB 2AXGA 1MHHA 4KY1L 2HYMA 1LVEA 2R23B 1OGTA 4LAJH 1SQ2N 3O4LB 1TZGL 4LIQE 3RP1A 1S78C 4F33A 4KZEH 4ZUTB 4L8SC 3QO0A 2RJMA 1A1MA 1JRHI 4MS8C 4OQTA 5HJ3B 5ITFB 1M7IA 2RFXA 2D7PA 5KTEL 4GLRI 1ZGLP 1HOCB 4WHTB 2VN7A 3VFSB 5HHNB 1P1ZB 3FQNA 5DK0B 4CL7A 1DL7H 2VXTH 4S0TD 2NR6D 3FCTA 5FM5O 1CGWA 5ERWA 1TETL 2LU7A 5DZNA 3KG5A 4K3DL 4D94A 1BHGA 3U9PH 5FECB 1IGML 1JHLH 3TO4C 3RWJB 1RZIB 2JB5H 1G0XA 2KDGA 3K1DA 4YXHH 2ICCA 2VLJE 1QSFE 3RWEB 4EI5D 2H32H 3CAFA 5D7LD 5JW5A 5INCB 2DQEL 4FQ1L 3C8HA 4BK4A 3UTTD 2BFVL 2FJFB 1JPTH 4GAGL 1WCQA 1WWBX 1JGLL 4E42A 5D71H 1B0GA 1VFOA 2J88H 4YXKH 3VGAB 1TZHB 4O00A 1BZ7B 1EUTA 4QHKI 2X4PA 4U1SB 3U83A 3QDGE 1B3JA 2ZSVA 3MBXL 4ENED 1FBIH 2DOCA 4U49A 4RFOL 3S36X 5E6IB 1BFTA 1HHKA 2CLRB