1YEJH

Catalytic antibody complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1998-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejH02
5CBAA 1G9NH 4OLVL 3VXNB 4DQOL 4L8SA 1G6RA 5SX4H 1KEGL 1RJYB 3VI4E 4RWYL 4WW2F 2OLDA 4PB0L 1AO7A 3VG9B 5K9JL 1TNMA 5IQ7L 2BRQA 4ZAKB 5T3ZL 5INDA 1UYWL 3VCLB 1K6QH 1GGBL 3B9EA 3P77B 4EUPG 1HH6A 3FT4A 3TVMA 2X4PB 2FB4L 4APQC 1CF8H 3REVA 3GMMB 3DX6A 2AABH 1NSNH 5B3JE 3QNZB 4ZUWB 1DN0A 4CGTA 1X5FA 4GAFB 3FN0H 1A6UL 2M8XA 1ZS8A 1DSFH 1Q0YL 5ID0A 5E94A 3C60A 5FYLH 1P7HL 1IAIH 1BQHA 3X3GL 1N7ML 3RUGE 4AH2B 4JQIL 3FRUB 2F8OA 4C83A 4N8PA 2EYSA 1T66D 3PABA 2BMKB 1CFTA 1KEML 4KZEL 2XN9A 4XX1E 4CNIA 4XGZA 4XVSL 3RKDC 1IJ9A 3B6SB 3MNWA 5F6IB 1IGJA 4YDIH 4FTVA 4R0LB 1BVZA 3VRLE 3QPXL 1QSVA 1ZSDA 3KPOB 4XVJL 4KJYB 1R0AL 1DLHA 2B5IC 3O3DB 1CE1H 3X14A 1P5UA 3EDDA 3QHTC 5GGVY 1W72A 3T65A 5EZJB 4GBXB 1NFDE 4Y19D 1M4KA 3HC4L 2AJZB 4OSUL 3J8F7 2WM0A 2OSLB 3MOAH 4QT5A 4LPYA 3E3QE 3ILPB 3C5ZA 4HH9A 3MA9H 1PAMA 2Y6SC 4NZRL 4K71C 3AS3A 3VWKB 1XIWC 1ZEAH 3T3PF 1P4LA 1NAML 5HI3D 2AQ3A 1VFAB 3AM8C 3AS2A 4OKVB 4S1QH 4XP4H 5CLTA 4L9LC 1IAKA 1MWAL 2JELH 3D1MC 1JFQL 2YEZA 3GIZH 3F5WB 4BM7A 4DUXA 4ORGB 3BMWA 4AIZA 1T7VA 4DK6A 4GMSH 3WS3A 2P5ED 2WP3T 1RIHL 5A16A 3BPLC 2XYCA 1NKRA 1NGYA 5T1LB 1T1WB 1KFAL 4JFYA 4MZ2A 3HZYA 1S5HA 4RFOL 4BZ1H 3RKDD 1I4FB 4R4FL 1WFOA 5JPMA 1CDBA 4H5SB 5J12C 1PLGL 4OZFB 4OAWA 3L3DB 4QHNB 3QUYA 4H8WC 3RIFF 3FQUB 1KCRH 4KGJA 3SDYH 1HINH 4UTAL 4CN4A 3BDXA 3JV6B 3MRKB 4KDTA 3WJJC 4YWGH 2P5EE 3HN3A 4WCYH 4D9LL 4LLUA 4GW5B 3STBA 4YO0B 2Y6SD 2EO1A 4ZNCD 4WFFD 4UOJA 1LEIA 4WI5A 5D7LA 4N1EA 3S35H 4WWKC 4K3EH 1FCGA 4X4ZA 1ZT4A 5DD3H 3VGBA 5EO1B 4LLDB 4YHNA 2BVQB 5KSAB 1PKQE 2CK0L 1SJHB 3PV7A 3QDJB 4IMKA 3F7VA 4NO5B 3BZDA 3WXVH 5EH1A 2ITCA 3UTSA 1JF1B 3UTTA 5D8JL 3T2OA 1R6VA 1TTFA 3DX7A 4WFFE 1Q9OA 4PJEA 3SDXB 4MA3B 3RX8A 4ODVL 2R1YB 2BC4A 1YEFL 3H7BA 3V79C 2ADJB 5K59F 2PUQT 2NW3A 4ZODA 4F7EA 1S7SA 3MLPA 2VLKB 3FT3B 3UTZB 3RP1A 1B6UA 5HJ3A 3ARBB 1NC4B 1MFAL 4MLIA 5JPNA 5EU6D 1IM9D 1KIPA 3VMNA 1XF4A 4JZJA 4QXUH 1H8SA 2VDLL 2P5WA 4I2XE 4RIRA 1EXUB 4ZTOL 3SO5A 2X4NB 4WWKD 1A6VL 1AXSA 3RNKB 1K4DB 1KCSL 3X11A 3C09C 2DQFB 4S1SH 2BVPA 4XNYH 1NL0L 4QXGL 2F53D 3IDNA 3T1FA 1YDPB 3REWB 3DUSA 1D7FA 2FLRT 1RUKH 1QFUL 4Z18A 3WEXA 3OF6A 1PJ9A 4DKFH 1VFMA 4NPYB 5EU6E 3L95A 3FT2A 1QPXA 5DEZA 1QSED 3TH2T 1XGTB 5AG8A 4NUJB 5FYJD 1T1XA 4KHTH 1IC5H 2V5TA 4G42A 3GJFA 1DBKH 2F53E 4LSUH 2ICEB 2W60A 4CU8A 3IU3B 2J88H 5IMOB 4PJIF 2F54D 4M6NH 1PGRB 2XFXB 2XZAL 5GGRA 1F3DJ 5B38B 4Z7UF 4HXAH 5D7IB 3V8OA 2VLJA 5AWNH 3GSNB 3RI5K 3PWPD 3QDHA 4KI5F 1M05B 2JB5L 2D7PA 3G6JE 5KVDH 5FYJE 1NBZB 3ZTJH 5IW1B 3ARPA 1NAKH 3L3HA 4R8WL 1E4WH 2EECA 4XXDB 1BVLA 3NIFF 1AO7E 4KKCC 3QZWG 2F8VA 2OXHA 4LCYA 5CIPH 3MV01 1BFVH 2P42B 3SBWA 1BD2A 3UROR 2NY3C 1EJOL 2EH7H 5KOVC 3IAPA 5DJ2B 4OFYD 4WNQB 5A2IH 5DI8A 2GEEA 1ZHKB 2EDWA 4IRSC 2H41A 4NQEA 1CTNA 4D3CL 4GQPH 4Y89A 4XPBH 1D5BB 3CSYB 4AENB 4X7CC 4N8VG 2V7HB 3J7HA 1S9VB 3X12A 2K9UA 3VFSA 3MRDA 1HI6B 3DXAD 3O0RL 4R96A 3FQRB 1GYAA 4P5MB 1F58L 4WV1C 4XBPB 2CIIB 4X7DC 2Q8BL 4PJ7A 2ZCHL 3HI5L 3FB7B 2AJVH 1ZMYA 4IS6A 2V5YA 2JLLA 1YMHA 1IGMH 3ETBF 5DVKA 3F7YB 3BQUC 4K55A 4NDMA 2XG5A 3O2DL 4YPGB 4PFEA 2E9IA 5FDWA 1QG3A 4KKCD 3QEQA 3V6OC 5J6HA 1KBGH 3DXAE 4C55A 4ZMAT 4EI5C 4ZXBA 3VXRD 5D71L 3UC0H 5BVJB 5D96C 2H2SC 3ARTA 3WLBA 3BXNB 4OI7A 4OCMC 4WI2A 3RWGB 2NY3D 5GGSY 2FO4B 1B0RB 1MCRA 4WFHD 2HLAB 4ZQKB 2X5PA 3V4VL 3NPSB 3T04D 1EERB 5E8EA 2R23A 3SOBL 3RGVC 4PJ9A 5JHDA 2WBWB 3MRBB 3RBSA 3NGBB 5IKCB 1A1OA 2IPKA 2X42A 3VXRE 3IJYA 1RZ8A 4HKBA 3VA2C 4GO6B 3RFZC 4RMSA 1R3HB 1WZ1H 1C5CH 3R1GH 1MCOH 1WEJH 3MSPA 4X0KB 3JVGC 3WIFB 4FQHB 4JHAL 3R4DA 3OXSB 2IPTL 3HZKA 3BQUD 1KLGB 4HIXL 1EAJA 5ADPL 5CD3B 4WENB 4F58H 5K9QI 1V3MA 2DIAA 2H8PA 4Q7DA 5LAXB 4EI5D 5L8KB 1D5MA 4GSDL 4OF0A 2H2SD 1H3PL 1NH6A 4JY4A 3OKOA 5CP3A 4UOW1 3WL9B 1A4KA 3AMLA 4FP8H 3CVHA 3PWVA 5C2BH 3BZEB 3ROLA 2XOTA 1OSZA 1UA6L 1RZJC 2GTZA 2H32B 3GMNA 3O2VL 3ZHDA 5IT2H 1U6AH 3RGVD 1WC7B 3K4DA 2D4DA 3CSBA 3VRIA 4G43A 2O5YH 5FUZH 1HHIA 4NWUH 3D18A 3ARFB 5HYJD 1AQKH 3MREA 5TPWH 4X6CF 2CXKA 4X9HA 5EBMA 3FMGL 1I3GL 4NC0B 3R8BB 2FATL 4L3AA 5LG1A 1R5VB 2IAMB 4NNXB 3T0VA 3RJDA 1E28B 1J86A 4CVZA 5J1AA 5JA9A 4P3CH 3S7GA 2MPAL 1M6OA 3T4YB 4JN1L 1RJZA 2CJUH 4PJEE 1KPVA 2FEDC 2APTA 1OD7A 3BWUC 3QFJD 4NKOB 5HI5D 4LNRA 1I8LC 1I3RB 1ZGLP 4NKDA 5KAQF 4G80A 2WIIA 4URTB 5GSVB 3VA6A 1R3JB 4OGXH 2X89A 3S3PA 5FK9B 1N8ZA 1TTUA 2X7LB 4E41D 43C9A 1TCRA 5DEGA 1X5YA 1FP5A 5IB1B 3KPRA 1G7MB 2ICWB 3RWEA 1MOEA 1C16A 2VNCA 4PV9B 5ESAA 1HHJB 2I27N 3QFJE 4MYWB 3OBAA 1WIPA 1Y18A 5DMIH 1J8HA 4WVRA 4EQ3A 5ISZB 2V2WB 4JY5L 2D7OA 4MZ3A 1I3VA 1EHLL 4DGIL 2H6PA 4PP2A 5I15H 1GGIL 1AKJA 1JZ2A 3FCTA 2ZCKL 3ORJA 4LHQB 4Z7WB 3JWOH 4K9EL 4MJIB 3O3AA 4TSBH 4E41E 1A7OL 4X6FA 1UJ3B 1JPSH 3QQ3A 4OZFH 4PJXE 1IQDA 5EU5A 1CCZA 5C0RH 4P99A 1S8DA 2NPLX 3FFDA 1KXTB 1YEHL 2FEDD 3BP7A 1GGTA 4YXHH 4O4YH 3S9DB 4P9HC 3MRQA 2DMCA 5DRXA 2ATKA 3LY6A 1KB5L 5C0GA 3LHPL 2R39A 4X7SL 2CD0A 3DVNA 5ERWB 5ICXB 5BMFL 1MSPA 5FYJL 3FTGB 4ZO9A 1JRHI 2I26N 4DZBB 4HULB 2YKLH 1CGSH 1G9ML 3LKSA 2HH0L 3D69B 5LWYL 1VHPA 1FNGA 2GAZA 3V9FA 3BX7C 4C59B 1FGVL 3O2WH 2WSKA 2VZ3A 5ITBL 2RCSL 2AEPH 5IBTL 4EXKA 1FSKB 3G04A 4LCWB 4V1DA 1RK0B 2B2XH 1BEYH 3LD8B 1NUFA 1K8IB 1U8OB 4LEOA 5ESQA 4NO0D 1ZGLA 4L9DA 3V7AE 2R1WA 3RHWF 4OZIA 4LLMA 5J6GB 2E7LC 3MODH 3CFKB 3P4OA 2ICWI 3LOWA 1CE6B 4FFVC 2B4CL 3EO9H 4RAHA 5I1CH 3PGDB 1LNUB 2W38A 2UY6A 1F6FB 3H3PL 3QUXA 3FL7A 5AZ2L 4PJ7E 5CGYD 3K4AA 3FB6B 4XP9L 1UH2A 4F7TA 5DT1L 4UQ2A 3V5KB 4NQSB 1AJ7H 1MIEL 4ZFGH 3QH3A 3SE4C 3MC0A 1JTTA 4BQ8A 2MHAB 2XA8L 1PY9A 4GQ9L 2LTQB 3QEQE 5TE6L 3WE6B 5IB2A 3FO2B 1GIGL 3Q2CA 4YXLL 3SGJA 2IANB 3T4AB 1W72L 2VDRL 4X99A 1KPRB 1D5XA 2E27L 1A14L 3E0GA 4JRYB 4JVUA 2V2XA 3JXAA 3MCKB 4NFCA 3VFMA 3U7YL 3BPOB 3LIZL 1K9TA 1BQSA 4KJPC 3VXMA 4ZFOB 1A6ZB 3QG6A 4PJAF 5IFHH 4LVOC 2HYMA 4YC2B 4UBDC 3TYGH 1FO0A 1NCTA 2C1PA 2V6HA 3GSNH 1N26A 2C3XA 3V52L 4UDTA 4FXLA 3HUJA 3SDCD 3BO8B 4FFVD 1QEWB 3HRPA 1ITCA 3GMQB 1FVEB 3V4PH 2XQBH 2FSEA 4XCEA 4A6YL 2JCCF 3VU2A 3BVNB 2QADB 2HN7A 1TQBC 5JW4Q 4NQCB 1EEQA 1A1NB 5FA4A 4H88H 4L3EA 1Y6NR 4U6VL 1M7IB 3P4NA 1F5WA 3JV0A 5EFIB 1ND0A 3TJEH 4G9FB 5KW9H 3D6GA 5F44A 1EGJH 1LE5B 3GI8L 2VLRB 4PP1C 4PJBE 4U2YA 4LLAA 2MCPL 3NCFB 2VDQH 3OKMB 1JHKH 3OAYK 4GRMA 4KJPD 3PDOA 5L2JB 1PX4A 1JUFB 3PGCB 1FVDB 2ZCLL 3LAFA 1INDL 4OZ4B 2DI9A 4UBDD 3PL6A 3F8UB 1IM3A 3EOBB 1RIUH 2Z31B 3AVEA 3MNVA 1Q38A 3BIBX 3FN9A 1JPGA 2YA1A 3DBXA 3D2UD 3IU4L 4WW1B 4MWFB 3IJSB 1DQQA 3TCXA 1FC1A 4XP5L 3QJHB 5FYLD 4Z7QE 1S9KC 5EOQH 3FB8A 2VXSL 5J3HD 1NGWB 3P40A 4HUXB 3FRPG 3I3DA 3LV3B 4HZLB 4BH7B 5BXFB 3VRJB 4X6DF 5EBLA 5I75C 3WO3B 3I6GA 3ECBA 8FABA 3OX8B 1ZLVK 5BO1L 4JRWA 4UQ3B 1CIDA 4FQXB 1OL0A 3RTQB 4ODBD 1A7BA 3TBWA 1U95A 2PTUA 3KJ4B 1QBLL 5BS0D 2ED8A 4RRPG 4MQ7A 4G6JH 4PP1D 5DJXA 2NY1C 5FYLE 4UT7H 3SKUD 3KGRA 1G7JB 1XCQB 4HAFA 2AERT 4I0PA 4HV8A 2DQHH 3QIBB 2IF7A 2MFNA 5D6DA 5TF1L 1ZTXH 2P1YA 5IHUH 3D3VB 4P57B 2P24B 5L7XL 2I9LB 3I85A 1CU4H 4AEIH 2BNRA 3IXAB 3VFRB 1F4XH 3LKOB 4G8FB 3KPRE 2EDQA 1I7ZB 1L7IH 2EE9A 5EUOB 3NPZB 3QIWA 1IGFL 4QXWA 4OCXH 1YN7A 4OUUA 2BHYA 3G5VA 5J7CC 4NKIH 1BOGA 4WHTB 4MLSA 4R2GB 1G7QB 2V5MA 2JF1A 2CLZB 2XTJC 1A1MA 3S96B 1OLZA 2JKXA 3CGTA 5CJOL 2YPLD 1JE6A 4PYHA 5KSBE 1TJGL 1BAFH 3SGEI 5DJZA 1PX3A 3LS4H 3I50L 5FB8B 2H32H 5TDPA 2A6DA 3M17A 4BFBD 3DLQR 1BBJB 1MCHA 2R4SL 2NY1D 3VXNA 2R0LH 3MXVL 4N9GB 5IB5B 4JPVL 3D85B 1JRHH 4G8IB 3PWJA 4GG8B 2N4IA 4OF7A 2F58H 5D2LB 5JHLH 1I1AC 4WU5A 3G08A 4Y5XC 4UUJA 2QQLL 4EIGB 2QQQA 1PG7X 1RJLA 2X4PA 2YOCA 4Y16D 4LF3B 5DRNA 1NUGA 1AC0A 4YNYA 2Z91A 3QFDB 2Y36L 3EKCA 5HVWA 4ONGH 2BNQB 1CXHA 4J4PC 4KMTH 1I7RA 3GSQB 4WUUA 3GSRB 1QBAA 1CGUA 2XTJD 1YEIL 2UWEF 1WTLA 4ZOAA 5HYSB 1NCDL 4G7VH 4FQIL 2FJHB 4JFZH 5ESVB 1TTGA 4AH2A 3ULUC 4HEPG 1IAOB 3EZ8A 5EO9B 3BW9B 3WNOA 1F4HA 2ZSWB 4JLRA 4ZFZB 4DCQA 4OZIE 1DQLL 1K4CB 3TPUA 4BQ6A 1IARB 1T5XB 1OM3H 4KDWA 4G8GA 1FGNH 3QUZC 1MCIA 1UWGL 4JFEA 1MQKL 1QD0A 3T3ME 4QF1B 2BY0A 1BJ1H 4KKAC 3JWDC 3OXRB 4TNVK 2X4RB 4TPRL 1MUJA 3S5LG 1A02N 3UJIH 2WLYA 5ITFA 3G5XA 2PW2B 1I1AD 1S7XA 5CUSH 4KJYA 3HNTH 4ODSL 5FO7A 3RU8L 2DMBA 1OAXL 1J5OL 3OPZH 4GBXA 3F12B 4UIMB 1NDGB 4P2QB 2AJZA 3O9WA 3V0WH 1G6VK 2C3VA 4J4PD 5H94B 3AU1A 5TFSL 5I30H 3B2VL 1XF1A 4QYOB 5CINH 4QTHA 4NKMB 2PKDA 5C6PB 5E2UH 4X7FC 1W2KT 3D9AL 3VXME 4YIQB 1ZVSB 4OKVA 3ULUD 2FZ3B 1Q0XH 2AP2A 2NY4D 1LGVA 3TA3A 4HBCH 35C8L 1LEKB 3F5WA 4RISL 2VABB 2VIRB 3HRZB 3QUZD 5D5MA 4TULL 2FD6L 3QAZB 3WUWG 1T1WA 4L8CA 3R06A 5MEQB 4M4PA 1JHLL 5HGBB 3KYNA 2ED7A 4ELKA 2DLIA 4LKCB 3VFUB 1DFBH 4QHNA 5TE4H 3OKDB 3T77A 3OB0H 3RL1B 5C1MB 1X4YA 2K3TA 1F11B 1MIMH 3LKRB 5GJSL 5C0NC 3O45A 2OTWB 5T1DL 3GJEB 2C4FU 1KJVB 3RGHA 3ZKNC 4G3YL 4KJWC 2NR6C 3ULUF 1G9NL 2P8LB 2CQVA 1N5YL 4OIIH 1VEMA 2AQ2A 3F7QA 1EHXA 3VE0A 4U6XB 2Z8VC 2Q86B 5EO1A 1DEDA 2I07B 4LLDA 1CFSB 2BVQA 4IRZH 4AG4H 2VQUA 1AD9A 4PBXA 1J05A 5L0QC 4OV5B 1OGAA 2BOCB 5DFWH 3ISWA 1FFNB 4MAUH 1GL4B 4D0CA 2UV3A 1CF8L 3OHXB 2AABL 5JA8B 8CGTA 1G7PA 3OAUH 4MA3A 4JQVC 4QOKD 1NSNL 3L5WA 1ORQB 3L3OA 5C0BA 2R1YA 5IHBA 2ADJA 5F8RC 1NJ9A 2CR3A 4Y4FB 3VG9C 4IJ3B 1HH9A 1IAIL 1Z9LA 1BWWA 1ZWIB 5FGCE 1V5JA 1YNLH 2VLKA 5TQ0H 5SWSB 3ULSB 1J11A 3F58H 4RX4D 3ARBA 2DWDA 5DVNA 1MI5B 4J3VA 3ZKND 3W39B 4KJWD 1MCCA 1BZ9B 2ADGB 4XPHH 1YEJH 4QOKE 2J5LB 3PUCA 2AK4D 5T5NG 4KRPC 1FG9C 1EXUA 3BSZL 3FO0H 2X4NA 1HKFA 3RNKA 3QI9A 2DQFA 2J8OA 5ETUA 1JPFA 2UZIH 5E1AB 2YA0A 3ALWA 5J06A 2Y25A 5E5MA 3H7LA 4WGVB 5BV7B 1QSFD 5DJYA 1CE1L 1D5ZA 4YHIB 3TT1H 1MHCB 2AK4E 5I66B 5F9OH 1U36A 1T1YB 1WSST 1XCTB 4YBQC 5EWIH 2BCKB 2P49B 4MJ5A 4PGDB 3MOAL 1J88A 4U7SA 3MA9L 1TENA 1ZEAL 2CO7B 5F1NA 4ZAKD 5F6IC 4HMCA 4QCIA 2DQIH 3SGEH 2AJSL 2V5SA 2XFXA 4R0LC 4S1QL 5B38A 3MBEC 2JELL 1QSFE 5DJCA 1JZ6A 5LXGH 4JHBA 1KPUA 4F3FA 3BISA 1H5BB 4OLEA 4KRPD 5HHNB 2X4OB 4XXDA 5K9OA 1A0QH 4UI2A 4BZ1L 1U3HC 1CT8A 3S8WA 1FZOA 4J7RA 1JGUL 3VWKC 2ZUUA 2PR4H 4Q2ZB 1MHHB 5CS7A 4UV7H 4J1UA 5KS9B 3O81A 3B5GA 3RWFB 5BRZA 2YSSB 1KTDB 1MCDA 3SPVB 3ZDZE 1KCRL 3MRNB 1S9XB 1YEDB 3SDYL 3LN5B 4WNQA 1CL7I 5DA4A 4NQXA 4YWGL 2EO9A 4WCYL 1EGJA 3K8MA 2Q3AA 1D5BA 3CSYA 4KK5D 4XNZC 5CSGA 1KENH 1CICB 4AENA 2M1KA 4O51B 5EUKB 4Y2DB 1FFRA 1F3RB 2GCYB 5I16B 5LCVH 3S35L 3WS6A 4JZNB 2WBJB 5DD3L 3IKCA 2CIIA 1FORH 2ICCA 4KRMB 2EDDA 4LVHB 3VDAA 4Z5RB 3S88H 3RX7A 1KN2H 1LP9A 2FHFA 3B9KA 3VGAB 1JNLH 4HUVB 1R5WB 4C57C 4Y5YB 1QFHA 2J8UB 3TESA 4CMMB 4PRPB 4JRXB 3F7YA 3WXVL 1KXVC 1RHFA 3BZ4A 3L6FA 3ULVH 1XGYH 4O2CB 3KYMB 4NJ9H 5IMKB 4RWHA 2VZOA 4LGPB 3VWKD 1AP2A 5FIEA 3TC9A 4F9LA 4NO3B 3BXNA 5EU7C 3RWGA 4LHUB 1B0RA 3L5JA 5K9KB 1ZT1A 3KG5A 4J6RH 4ZQKA 1CVSC 1QACA 1VCAA 4P2OC 4GT7A 2HFFB 4PY8J 2Y06H 3MV9B 5DQDL 1ZLWH 2DYPD 4L5FH 4P4KC 3TT3H 2JJWA 5T1LD 1FFOB 3O4LB 1OB1A 2OM5A 2DS4A 2NX5D 1LEGB 2YC1A 4LCCB 3MRPA 1FN4B 3EJYD 4NYLA 1XF5A 2H2PC 4S1SL 4XNYL 5C0IB 3QO0A 5GSRB 3OXSA 5TDOB 2AI0H 3MRFA 1RUKL 4XX1G 4V2BA 4DKFL 1BQLL 1DUYA 3K7UA 4Y5VC 4JCMA 2XXMB 1C12B 1SBSH 3ARDA 5LAXA 1NFIB 3H8NA 4OLYL 3TBSB 4KHTL 5KANI 3NIGF 1IC5L 3MXWH 3WL9A 4P9ML 2KZWA 1DBKL 4LSUL 3WLWC 5KSAD 3BZEA 4LARH 4M7ZB 4MCZB 4P2OD 1MRCL 1XAUA 4F80A 3P2TA 4TNWK 3QDJD 4HXAL 3VXTB 3TEUA 4U33A 3K8LA 4HIHB 1WCBB 5AWNL 1WC7A 3MYZA 2QV2A 3VFVA 3DRTB 3CDFA 4OLWL 5KVDL 3ZE2E 5JW5B 3ARFA 4PJGF 1VESA 3SQOH 1PG7H 1JN6B 1NAKL 2Y07H 1E4WL 1NGZA 5ID1B 5CEZH 3N9GL 1RFDL 1NQBA 2H2PD 4ZPTB 4G8EB 4YH6A 3KPNA 3O6MH 1M7DB 3O8XA 2R2HA 4NNXA 2KKQA 5F7YC 3QDJE 4U1HA 4OTXH 4AZ8A 1AXTH 3IYLW 3B4NA 3U7WH 1NC4D 2WIMA 5CWSB 1MLCB 3HC3H 1SMAA 1VPOH 3SDXE 3RDTB 5EU4B 1HCFX 4NKOA 5J56B 1A5FL 4XPBL 1V3LA 1TQCB 4PLKD 5EZLA 3WD5H 1XR8B 4YHKL 3WLWD 4RMTA 4AY0A 1P1ZB 1T4KA 1NPUA 5F7KC 5HYQA 2X7LA 4NBZB 2D7TL 3W5NA 1HYSC 1AGCB 2AJVL 5FHBH 4L8SC 5CSBA 3DGGB 3VI3F 1HHJA 4GG6B 4MJ4A 4IRJB 2P45B 4K7PX 4ONFH 5ISZA 2V2WA 1JTOA 4GAYA 4MXQC 1IT9L 4PREA 5F9WC 3UC0L 4HH8A 4KTDL 5C9JA 3RNQB 4I18B 3TVMC 4I77H 4OCRH 4LFHG 1MF2H 2XRAL 2I24N 4JFPB 1G7LB 3G9VA 1UCTA 4KTEL 2F74B 1X3DA 4Y4KA 1KYOK 2APBA 5H35A 1T03H 1IFHL 3WO4C 1J0ZA 2WAHA 3C60C 1LO3H 4G5ZH 5I1JL 1ZLUK 1T21B 5ERWA 1N5AA 2XA3A 5DMKB 5HDOA 3FO9B 2DQUH 4DOHB 3CUPA 4IMLB 2WUBH 1WZ1L 4PJHF 1C5CL 3R1GL 1SY6A 4NIKB 5D7IE 1WEJL 2B1AH 5EIIB 1IILE 5D1QB 5IG7B 2BY1A 4MJ6B 2IWGA 4GUPB 1A3RL 3DX8A 3SKMB 3NPSC 2P8PA 4D9QD 3BZFB 2HVJA 1P9MA 5KJRH 1YYMH 5EIVA 3KVQA 4U3XA 4Z76B 5JMRA 3SEPA 3ESVF 4R9HA 1I7TB 5HPMB 1RK0A 2QTEA 1ZHLB 5IP4A 3V4UH 1RZ7H 5F89A 3MLRH 5JORA 3BOVA 1J1XL 1LO5A 1K8IA 3HCVA 3KLHC 3GMRA 4MB3A 5DD0H 5C2BL 1L9MA 2ZUQB 1CL7H 5JOPE 2COQA 3EFDH 2HWZH 4XCFL 5DUML 3SY0A 5IT2L 1U6AL 4WI9A 3HS0A 1JGVH 4QHKJ 5J6GA 2O5YL 3CFKA 4NWUL 3ZYOA 5IFJB 1TZHB 1AQKL 5TPWL 4MVBD 3EUUA 4L4TA 4S1DC 4O2EB 4ISVB 5HGHA 5EO0B 2ZWLT 2AJXH 3QCTH 5DS8B 3GMPB 2DF3A 5F88B 2SEBA 1DTUA 2AQ1A 4HJ0D 1FNLA 4MXVE 2NTFB 1R24B 3O3BA 4KK9D 1S7WA 4P3CL 2DM4A 4XCYB 3GB7A 4LSQL 4N5UA 3HE7B 3LPWA 4Y1AB 5BV7H 2MHAA 2CJUL 4R4BB 3PGFH 4M8VA 5KTEH 3UMTA 1DLFL 3IDJB 3QUYC 3T4AA 3UBXI 3MGAA 4CKVX 2A6KB 3AREC 5I6XB 1I1RA 3U48A 5FUOH 5HD8C 3KLHD 5C09A 3GUTB 4OGXL 1NKOA 4JG0H 2EDOA 1HOCB 3HPJB 1C5BH 4YK4B 4ZFOA 1A6ZA 1UM4H 3IGAB 1H15A 5GGRY 3CZFB 3HNVH 1Z5LB 4NSKA 1BQHG 2WZPD 2IADB 4Y4HB 1UC6A 1SHMA 5DMIL 4S1DD 2R9HC 3GMQA 5F93C 4L1HA 3GM8A 3QWRD 5I73C 4PRAB 5I15L 1N0XH 3BVNA 4U6YA 3VFWA 3IFOB 1U93B 3ARGC 3JWOL 2IMNA 4UTBL 5TQ2H 3CCHA 3IDGB 1JPSL 3RWJA 4PJDB 3WIHA 4NQCA 4U6HA 2HG5B 5C0RL 1BQUA 1P84K 4HS6A 1A3QA 1P2CB 4LKXB 4RMRA 2L0DA 4O5LL 5DFVC 5EFIA 2EXYC 5BZWB 4G9FA 4KVCH 5JO5B 1ZA6A 1KTRL 2Z35B 1LE5A 4HKXB 4OJFH 2FDBP 2Z93B 3ARED 5E6YA 5JQHC 3VDCA 5HD8D 1RMFH 3OKMA 1JPTL 2Q76B 1ACYH 1Q1JL 1UXWB 2IAMD 1OP3K 4JGMA 1FL6A 1VACA 3U46B 4EEEA 4JZJC 5ACZA 1R5IB 3EHBD 1CGSL 3ROOB 1B4RA 1CR9H 4QHMB 3ZDYE 4EBQH 1BJ8A 4YJZL 2JK5B 1FZJB 2YD8A 2W0FB 2AEPL 4QKXB 3T0EB 4BA8A 4QRTA 3K0WA 3L7EA 1NGWA 3ARGD 2B2XL 1QO3A 1BEYL 3LV3A 2BOBA 3VRJA 1Q9LB 5GGQH 4CW1B 3UYOD 3DX9B 5EZOH 3RA7H 1YPZB 1WFUA 3OX8A 1P53A 4LOUC 5C08A 5E4EB 4FQXA 1JYNA 4LSDA 4OIAA 2I9TA 2EXYD 1WBXA 4RFNB 2B7DT 3QISA 4OLZH 5IB3A 4PJFB 4Q58C 1IEAA 1N59B 1FHGA 3MODL 4AIOA 1VFBB 3IDXH 4KK8D 1G7JA 1XCQA 4NN5C 4JM2A 3QIBA 5I1CL 4N0CC 1LO0H 1KSRA 1GOGA 1OQXA 1S78C 3PJSA 4MJID 4JKWA 4P46A 3D3VA 4P57A 2P24A 2OZ4H 1MJ7H 2EZ0C 2QSVA 4MD0B 4TQEL 3I9GH 1U58A 4G8FA 2MQCA 1JWUB 4DUWA 4W6XB 4KV5F 3B9DA 4LU5L 5SX5H 1BFOA 1J10A 1RY7B 1UCBH 1ODAA 5EUOA 3TBVA 1KNOB 1K2DA 1AJ7L 4ZFGL 3DVIA 5ISZE 2R69H 2PYEA 1P7QD 3O41B 4PJEF 2ARJB 2GSIB 5DJAA 5M94B 3MROA 4YX2H 4Z7WE 4HS3B 4MJIE 1R3IL 4WHTA 5IGXL 1ED3B 4JO3L 4XMKH 1QYGH 1G7QA 4F7MB 5HYEA 1S5IH 4Z6AT 3S96A 2ITDB 1OGTB 2IMMA 1OAZH 2CIKB 2I25N 1UACH 4LOUD 5LGHL 1U8HA 4MX7A 4CU7A 2EDNA 2HRPH 3JTTB 1N2RB 5GS1B 4OCLC 3EOAA 4CN1A 1JCKA 1PEZA 1BBJA 5D70H 5DD6A 2X4TA 3X3FL 1DBBL 4NRZA 2EKJA 1CLYH 2JIXB 2MJWA 4N9GA 1PZ5B 1VGKA 1IMHC 4LCWD 4AM0B 1KT2A 3BGMB 2XQBL 1A9EA 4KJQC 3U79A 4JFDA 3AFLA 1U2HA 3D85A 1NCAH 4KKNA 4P2RB 4HF5H 2EZ0D 1DVFB 1WF5A 1Q9KB 3QUKB 1S3KL 1LWRA 1GC1C 2OQJB 3LKNB 4Q6IB 3E8UH 4H88L 3S37X 4LF3A 5I8KH 3EZJB 3VH8B 3QFDA 2BSED 4N0RA 1I7UA 4NZUH 5FOJA 5KW9L 4LCWE 4ZOBA 2MQ3A 1EGJL 2EKSB 1NGQH 2O26U 4KZDH 2VDQL 1JHKL 2QADC 4MCYA 2R0WH 1EA9C 5ESVA 4EVNB 5DJDB 2VL5A 4KRLB 1W0WB 1OSPH 3MZTA 5DRZB 4YDJA 1QTYT 4Q0XH 1K4CA 5DFTA 4YEFA 1RIUL 4GRWB 3MRHB 3QZWA 1NCCH 3O6LH 2IAND 4P5TB 5JOFB 1LDPH 3ARWA 4KJQD 3ZE0E 4JRYD 5DZLA 1A3LH 2C4FT 3IVKA 2X4RA 3OL2A 1ADQH 3MFGB 3FONB 4POZC 4OFKA 4YHYB 2DMKA 2C3HA 7CGTA 3SQBA 3VWJA 4JG1H 1EH9A 3MMEA 2DN7A 2IBBA 3F12A 1NDGA 4LLWA 3BEVB 2IANE 5C07A 4X8XA 2E8YA 4WW2B 4DK3A 4QYOA 4G6JL 4JRYE 3MGOB 1YY9C 4UT7L 2E6PA 3QDMB 3GSVB 4C58B 2PW1B 3PNWA 2DQHL 2QADD 1A6WH 4NOFA 5J0BA 1ZTXL 3C2AH 4YIQA 1S7QB 1ZVSA 5FGBA 3EYQD 4Q9CA 3OB0K 3OKKB 4WIQA 3PQYB 1CU4L 4GAJH 1F4XL 3AC0A 3TCLB 3SGDI 2VIRA 1L7IL 2XQYK 4MHHG 1EFQA 1J1OH 4XPFL 5FM4A 4CMHC 4XCCH 2ID5A 2VLRD 4OCXL 5D1ZB 1RD6A 1CXFA 5IB4B 3VFUA 2O5XH 2R2BA 2BFVH 4NKIL 3WXWH 4P49A 5F3BA 2F19L 3U0PB 4NQCE 3RL1A 4M6OL 1BGXH 1BAFL 3GKWH 3BP5B 4QHLA 5D2NB 1D9KC 1T5WA 4YDVB 1ZVYA 5EN2B 1W8OA 1RPQA 2Z31D 3LS4L 2R0ZH 3CC5B 3WHXA 3GJEA 4G9FE 5LGJA 3ULVC 4PJ8B 5T1MA 4CDHA 1HEZB 2VLRE 2CXGA 5GISL 1YY9D 5GRWA 2R0LL 5JLZA 2CDGA 1GXEA 2KQMA 2J6EA 1AY1L 4UU9A 4TRPL 1GZPB 4WU7B 5E7FA 1DANU 1JRHL 5CCKL 1NMCC 1CFSA 4B0MM 1EAPB 5EC1B 3E1F1 5JHLL 1X7QB 1MCBA 4BK4A 4KROB 1FFNA 3QIUA 2IPUG 3K80A 4K3JH 3MQIA 4JANA 3RTQD 5B39A 3FB5A 1X5AA 1HXMB 4X6BA 3AY4A 4POUB 1FBIH 2VJXA 4ONGL 4E42B 4NGHH 5LQBH 1XF2B 5J4MA 1ORQA 2XWTB 4LHJB 12E8H 5EZIH 4JFOB 4KAQL 3DSFL 2PETA 1RSFA 1DCLA 1YNKL 5HGGS 4KWUA 4G7VL 1X4XA 4JFZL 1D9KD 3TBTB 3N1PC 1YZZA 4N68A 4Z9KB 4HMDA 3ULVD 3W39A 1CGTA 1BZ9A 2ADGA 2OL3B 1TVHB 2W9EH 4S2SB 3T0AA 1FGNL 2APXA 4APQB 3OMZA 1AGEB 2V7NB 5JXEC 1DQMH 5DEFA 4KXZI 3GSOA 4Y19B 3ZYIA 4GKZB 4R2GD 5E1AA 1QLFA 5E6IA 3UJIL 4BQ9A 1AGBB 5EUOE 4HWBH 5CUSL 5IIEB 4ZUUB 4WTWA 3ULVE 4JPIA 3FQNB 1NGXB 1QP1A 1MHCA 5FCUL 4HWEH 5I66A 4D8PB 1T1YA 1XCTA 2CLVB 3V0WL 4JDZB 2BCKA 5E2JA 3B8SA 3HR5B 4PGDA 3JV5A 3U0WL 5I30L 3IF1A 4YDKH 5HVFB 3E2HB 3OR7B 5JXAL 4J2XA 2AV7A 5E2UL 1JHTA 5FM8A 1MHPH 3BN9C 5HVHC 4LSPH 4ONHB 4GXVH 3V5DB 1Q0XL 4HBCL 1ZA3A 2H9GB 3DYMA 3OGCB 4S0TD 1SJEB 1H5BA 2B5IB 3EGSB 3B8YA 1PKQB 4ZOEA 5JXED 2XKUA 2BNQD 3PXJA 3ZE1E 3IETB 2NXZC 5GZOC 2GJZB 2L7JA 2Z8WC 5D2LE 4K71B 4ODWB 1XIWB 1DFBL 4HIIB 2ZOLA 4JEGB 1U8KB 4F7CA 1IZKA 3C8DA 3D25B 4U7MA 3SPVA 4PR5B 3MRNA 1FNEB 4JFFA 3UJJH 3G6AB 1OY3B 2FIKA 3GSXA 4L9LB 3WSQH 1PFCA 4HUNB 2DQCL 2BNQE 2VDKL 3QAZC 2Z92B 1I1FA 1HQ4B 1YN6B 5CEZD 4O51A 3QP3A 4Y2DA 1WBYB 3T2NL 4HT1L 4JZNA 1CD0A 4JJHA 2HVKA 4NKQB 1EMTH 3BN9D 1GGCH 1CGWA 5DF0A 1HWGB 5J12B 3N06B 4PRIB 3MRIA 3E6FB 4OLUH 4Z5RA 4IRZL 4AG4L 1UWXH 2V9RA 1RZIB 1T2JA 1AR1C 1R5WA 2J8UA 2QQKH 4CMMA 5J13C 4U1NB 4JRXA 1U8MA 4B53A 1JZ8A 4P2QD 1ZLWK 4MAUL 3IDMA 1U8JA 2AV1B 4ALAH 1FG2B 4HDIB 5I74C 3KYMA 2HJKA 5IMKA 3OAUL 5GZOD 1IM9B 2GIYA 2DKSA 4PJIB 2P46B 3VJ6B 4FHBD 4Z7UB 3IAGC 5HPOA 2A6IA 2GJJA 4RSVA 4WWKB 3WYRA 1SEBB 3QBTB 5C2UB 5K9KA 4X8JB 1YNLL 2A9ML 5HHMB 1RZKH 1HSBB 4P2QE 4ZS6C 4ZFOL 2CKBB 4YR6B 1G0XA 4OZHA 2WQ8A 1JGEA 3MJ8A 3RVVC 3ZKQD 5J1SC 1V3JA 3WDIA 4KDVA 2I60H 3FO0L 3PIQB 4Z7OF 2PO6B 3PHOA 1QSEB 1V3KA 2VAAB 4U1KB 2YUXA 4N8VB 1JI1A 1ZANL 1WAAA 3MLVH 5MP6H 4Y4FC 4LRNH 4ZD3H 5C0IA 4JVPA 1CDIA 2DDQL 3TJHD 3I02B 1AR1D 3SGDH 1CD1B 2W0PA 4HLZH 1MH5A 5IJVB 2ZUVA 2F54B 4Z0BH 2BNUB 3WIHL 3D39A 5F7EH 1F4YH 2DWEA 5DK2A 2FX8H 3TT1L 4DWHA 2OYPA 5F1SA 3U4EA 5F9OL 5EWIL 3PWPB 3K1DA 2J5LC 2D0GA 1DP0A 1HDMA 4KKBC 4H1LH 3CMOH 4JDTH 1MVUA 4Z77B 3C09B 4U7KA 2F5BL 3TNMB 4MDIB 4RMVA 4ZS6D 2CRYA 4HIHA 3VFTA 5LXGL 3HC0A 2IG2H 4I3SH 3DRTA 4H25B 3K2UH 1NEZG 1J0YA 1EFXD 3NFPB 3JV4B 3S37H 1FL3B 3HUJF 1IEHA 3VD5A 3WUZA 1REIA 3RWHA 1QHPA 4G8EA 1F00I 1WQVT 4Y4FD 4R3SB 2AJ3B 4UV7L 3QIWC 3C6SA 3ZL4H 4MD4B 4BSJA 3T0DA 4H20H 1WT5C 5JIKA 5SWSD 1U91B 2OJEA 2OXGA 1MI5D 2XZQH 1KJMA 1T89C 5CWSA 1MLCA 4RAVA 3RVXC 1QLEH 4XC3H 5EU4A 4L3CA 3UPRB 3BWAA 5FO9A 5IM7B 2MWCA 3DECA 5FYKU 1KENL 4EUPH 2P7TA 1NBVH 2IH3B 1IKNC 2WQRA 3HHRB 1XR8A 3UEZA 4D94A 5INCA 5TE7H 5SWSE 3MLSL 1GOHA 3DMMA 1AGCA 1MI5E 3S88L 1KN2L 5HY9A 4I48B 1EVUA 1KLUA 1JNLL 4LCIL 4LLYA 5D7SH 5FOBB 4KXZH 2A83A 1XGYL 3CSPA 2DJ4A 4IRSB 4NJ9L 3MJ9A 1NCBL 3P4MB 3RNQA 4JPKH 2BVEA 1C1EH 3KPQB 3UTPD 3ZDXE 1I1YB 1PYWB 1G7LA 1S7TB 1HIML 2X4QB 1TITA 4WV1B 5DJ8B 1AIFB 4J6RL 2BSTA 2EIBA 4RRPA 4YUEH 3RVXD 2Y06L 3PV6B 4X6CB 3NFSH 3H0TA 4L5FL 3TT3L 3BMVA 4D0DB 1KIRB 1XZ0A 1Z9SA 5T1KB 3T0XA 3QEUB 3FO1A 1IE5A 3NA9H 5GGUB 2WUCH 2RHEA 4IMLA 3UTPE 4EI5B 1YMMA 2VERN 5D96B 3CMGA 2C26A 3KJ6H 3OKLB 4J8RB 1IGCL 3OR6B 5JDJA 2GJ6A 3MFFA 4Q9RH 5IG7A 4LSSH 4N9OB 1GGUA 2AI0L 4IHOB 2FYYB 4V2CB 2PN5A 2BXYA 1RAMA 3MRMB 2FWOB 3JSSA 1BJMA 1CICD 4Z76A 2MOVA 4MA7H 1SBSL 2C5DC 3BKMH 1I7TA 3SE3C 5KS9E 1ZHLA 4LCCC 5HYJB 3MXWL 2WBJD 1K5NB 2Y7QB 2B0SL 5IBLC 1A64A 3O9WC 3C5SA 3L5IA 4LARL 4NQDD 1GRWA 3SCMC 4PRPD 3HI1B 4LVNC 1OW0C 2XZCH 4U3CA 1K8DA 4UAOC 5C9KA 4B50A 2OL3H 1XGUB 3DNKA 4E0RB 1PG7L 5I1AA 2Y07L 3F62A 5FKPB 3TA3C 3OKYA 4DN3L 5DS8A 4LHUD 5F88A 4IBLT 3B9AA 5F1IB 3NABH 3ZYJA 1VFUA 3INUH 2J8UE 3W2DH 4F9PA 3O3UN 1TIUA 3LRSB 4JRXE 3O3EB 4PRPE 4OTXL 1SVCP 2FR4B 3P4LA 1AXTL 1CGYA 3HNSH 3MV9D 3GSUB 1R3LA 4UNUA 3U7WL 3I6KA 4ZUVB 3RWIA 1AGDB 3UPAA 1BVKB 4XB8A 1N64H 3QG7H 5GGTH 3O4LD 1IGIH 1MFNA 2QSQA 4C4KO 2A73B 3Q0HA 1GAFH 3OB8A 2C4XA 1UB5A 5L2KA 1UVQB 2ATPB 4NM4H 3WD5L 4BSWA 3SJVD 1MREH 3WN5A 4HKZB 3TIDB 3GUTA 3MR9B 3BUYB 1HOCA 4P23C 2N56A 3SDDA 3SCMD 3MV9E 3MUGB 1JK8A 25C8H 5FHBL 1XGQA 3W0WB 3CZFA 4QHKI 3O4LE 1IGYA 4DKEH 1Z5LA 5DHYA 2GT9B 2IADA 2XZZA 4I5BB 3DROA 5GGSB 1CDHA 3BT2H 1EEYB 5FA3A 4PRAA 1WWBX 3SJVE 1WAAE 3U2SB 1WZKA 1U93A 1U8NA 3SKNB 3BJLA 1AFVH 1HNGA 3MYJB 4HWBA 4I77L 4OCRL 1I8MB 4PJDA 2OR8A 4R97C 4K94L 4NJAH 2DKMA 5MENB 3LEVH 1P7KA 1UKSA 5KVEH 3UZEA 2VISB 5BQ7A 1QPPA 5BZWA 2PTTB 1T83A 5CMAB 3G9AB 1CD9B 4Z7VE 3SKOB 4IRJC 1YY8B 1LO3L 1NC2A 4G5ZL 4HHAA 1WZMA 5HXMA 5GXBB 4UIKH 4JDVA 5C0EA 5KSUB 3DRQA 4R90H 2BK8A 4FQLH 2Q76A 2DQUL 2GK0A 4P23D 2WUBL 2J12B 4I18C 3C6LA 3MLZH 5KZCB 4ELMA 3MLXL 3U83A 3HE6C 1U8PB 2B1AL 4QHMA 4OF5A 2W07A 4PTTB 4YAQB 5D5MF 2NW2A 3QI9C 3RDTD 3BI9X 1FZJA 1QBBA 5KJRL 3ARZA 5IJKA 4QRPB 4KVNH 3TO2B 4HQQH 3VFPB 4POYA 4N90E 1FPTH 2BXZA 1MLBB 2CLRA 3QWOB 1Q9LA 4PJAB 3MLRL 1FL5B 1BX2B 4YE4L 4CW1A 4ODUB 4E5XB 3DX9A 3DURB 4GKOA 4HGWB 5KVFH 5DD0L 3DO7A 1CL7L 2RFXA 4N1HB 2FEEL 2HWZL 1T7ZA 3EFDL 4OZGF 5IVOA 1CI5A 4M7LL 3Q5TA 4TTDC 4OZFG 4DAGH 4PJFA 4XVUC 4IRJD 4M3JA 1JGVL 1N59A 3HPLB 5CLWA 1L6ZA 5JIHA 1VFBA 1QLRB 3UYRH 3NZHH 5CFHA 4OQTH 4D2NA 3VXQA 1KC5H 3HZVB 1NAMA 2AJXL 4XNMB 3QCTL 2IBZY 4XBGB 3HE6D 4O02H 1JWUA 4XRCB 5GGVH 3VG0H 3AXLA 3MRJA 4PGCB 3D87B 2Z4QB 4JHZA 4O2FA 4GG6E 1HNFA 5BV7L 3SE9H 3EDFA 3RL2B 3JBG7 1T6WA 3DUUB 2NZ9D 4XWGH 2ARJA 2GSIA 2DI7A 2L4OA 2VITB 3EBAA 4DEPC 5ANMA 4ODXB 2NY7L 3BHBB 5IVZB 4F7MA 4RZCB 2NY5H 5FUOL 3MBXL 3VFOA 5E8PB 4QRRB 2N1KA 3TZVC 3S36H 5IV2B 1CIUA 4XC1H 4UNVA 1FE8L 1H0DA 4JG0L 4PRHB 1C5BL 5D1QD 2PF6A 4NWTH 2JB6A 1UM4L 4TTDD 1MCWW 4U1MB 5GS1A 3QDGA 1WWCA 2E7CA 3CLFH 4NRYB 4XVUD 5DJ0B 3KWWB 5F1OB 1XGPA 3LQAC 5SWZA 1J7VR 4N1CA 4AM0A 5CJQH 4DOHE 3BGMA 5DC9B 3TN0A 3QEHB 4LLQA 3DVGB 4X6DB 3TYFB 3I2CH 4PRNB 4CN6A 1YQ2A 4F57L 1X4ZA 1UWEH 2R2EB 4TN9A 4OI8A 3MRLB 5BOZG 3FJTA 5TQ2L 3T0WA 3ZSSA 1YQVH 4YK4C 4RQQB 2DBLH 1ZHBB 4Y8AA 1T0MB 1DBAH 5DK0A 3TBYA 1WWAX 5IQ9B 4LVOB 3VH8A 1E4XI 5BZDA 1VGEL 4Y4HC 1F8TH 4NC1E 4JQXC 2YUVA 4OJFL 3H9SB 3WDJA 4LPCA 1A9BA 4P5KB 3NA4A 5DRWA 1J12A 1RMFL 3TZVD 1N3NB 2EDEA 4HJJH 1ACYL 2X70A 1T2XA 4P2YA 1UM5H 3IS0X 3CPLA 2Q7NA 3K8KA 4IIQB 1TQBB 4JN2B 1FFQA 1RIVH 2LQRA 1DQTA 1B2WH 2XWBA 3HE7D 4Y1AD 3L1OL 4EBQL 3CVIH 4P5TA 5B38G 5JOFA 4MNQB 4ZFFB 2W0KA 4JAMA 3A6OA 4G6KL 2XG4A 2JJTA 5BS0B 3FONA 2ZJSH 3KXFD 1ZHNA 3RY6A 4W81A 5GGQL 1NANI 5IEHA 4KUZL 5EZOL 3NCMA 4HSQA 3ARDC 3V5HB 1EEUA 4Y1AE 2AKRB 1DANT 2EDFA 1II4E 4Z7NE 1DBJL 4OLZL 4Y4HD 3RWDA 1H8NA 1CLCA 4PJ5B 2DD8H 3UAJC 2WWKO 1FYTB 4CUCA 3IDXL 5CILH 5K9QG 3GSVA 1KJ2B 3ZT6A 2VZ1A 5JUEL 1LO0L 5B8CC 5FXCH 3OKKA 2RB8A 1DE4B 1MFDL 1MJ7L 3WFZA 1L0YA 1LP9F 1WIOA 4OD2B 5I75B 3P0VH 5HDQH 1UCBL 5EPMA 5AD0B 2XNAB 2YPLB 43CAA 2X1XR 4F2MB 3O8XC 3X13A 2R69L 4Q9BA 2H1PH 3FN3A 5E7BA 2UWEB 4QRQB 4YX2L 5TH2A 2NY1B 3EOTH 5D72H 4WI7A 4XMKL 1QYGL 4LSTH 2ZSVB 5F7HA 3MACH 1P4IH 3U0PA 4RAUB 1BPVA 4PGBA 1OAZL 1UACL 3CFDA 3Q3GA 4YDVA 5EN2A 2CDEA 1L7TH 4K2UH 1ERNA 2AXFB 5KN5A 1V05A 3UAJD 3RUGA 1MFCL 5D70L 1DEEA 2GUOA 1CXLA 1UB6B 4UINL 1CLYL 5F7FA 3T0ED 1FAIL 1I9JH 3QO1B 1MCLA 2KPNA 3GBNH 1GZPA 3KNBA 4WU7A 2Q7YA 1NCAL 3N0PB 5GIRB 4HF5L 1EAPA 1OF2A 3HAEA 4IDLA 4OFIA 2XTJB 5TGBB 3B3IB 1D6EA 3E8UL 3EJZC 1NMBH 3I75B 3VFNB 5IOPB 5I8KL 3U0TB 1RZJH 3QUMB 1Q9WB 2XI9A 3T0EE 2R56H 1XF2A 4RNRB 4LQFH 1RVFH 1G7IB 4ZYKB 4JFOA 2PTVA 4Y4KC 1NFDA 1NGQL 5E56A 1U2CA 1CYGA 1HN1A 1YPZE 4PBWD 4U31A 4MQSB 2R0WL 1DVFC 3GIVB 2YRZA 2YWYA 3RVTC 3TBTA 1QOKA 1F6AB 3V0AC 3LVEA 2FBJH 5AEAA 4Q0XL 1EBAA 4Y5XB 2OL3A 1QQDB 3MCLH 2NY2C 3O6LL 5CEYB 4ZS7H 1X44A 4OF6A 4Y19A 1LDPL 3QCUH 4GKZA 2VDMH 1A3LL 1ADQL 4BH8B 5AYQA 5D6CA 4NZDA 1AGBA 1P9MC 4HWZA 3S4SB 3MPCA 2HAZA 3VXUB 2VWEE 2P48B 3EJZD 1NGXA 1DBMH 1KCVL 2PXYC 5L8LB 4NOBA 1UG9A 4D8PA 1N6QH 1JMZA 2JIXD 4JZOB 1F4WH 4XPGH 1U92A 2VXTL 5MHSD 3NZ8A 4CJ0A 1MWAB 1MCSA 2HLFC 2P5EA 3K3QA 3QUZB 3OR7A 2AEIT 3ZKMC 1C8PA 1JNNH 2HJFA 2BVTA 2VOTA 4K7PL 5FHAL 4L8DB 4P2RD 1DVFD 4YHYC 3C2AL 3MV8B 3V6FB 2YZ8A 3V5DA 1FFPA 2Z8RA 3A0OA 4GAJL 4HPYH 2DQGH 5E2WL 1EO5A 4ZUTB 3LKQA 4XMLH 3IFPA 1PKQA 4PD4K 3WNNA 5F3HB 3MRGB 1FZMB 3PP3K 1AHWA 5JNYB 4XCCL 2VKXA 2EC8A 1YYLH 3MV11 4JHWH 4P9HH 4P2RE 1UGNA 3LKPB 2BFVL 4ODWA 4HIIA 3HI6L 4PR5A 4EOWL 2ERJB 4FFZH 3FQWB 1UWXK 1BGXL 3PWUA 2PXYD 3GKWL 1E4XH 4JFHD 4KFZC 4Z78B 2R0ZL 2WANA 4HX1A 2JJVA 3WFEH 3ARRA 3GHEL 2Z92A 4XI5C 2IH1B 4ZDHA 1HQ4A 2DTMH 3EYOB 2HLFD 2IJ0C 3WNMA 1YECH 2BSSB 5D1ZC 1MAJA 1WBYA 3ZKMD 3VXOA 3OJMB 2EXWD 4DTGL 1ETZB 1Z3GH 2A9NH 1EO8H 4BJLA 4M7KL 4I9WD 1RJCA 4D0BA 5ADOH 2VLLB 5HHVH 4JFHE 4QXTA 4FMFA 5HHXH 5FGSA 3DHJA 3WJJA 4K3JL 4JJ5A 4U0QB 2NY0B 1FBIL 5EU6A 1IM9A 2HFGH 5LQBL 4M4RA 3P30H 3QDMD 4NGHL 4R4NC 5IEKB 3VJ6A 2FO1A 3EAKA 5EZIL 3GO1H 1I8KA 1KJ3H 4J3SA 1KULA 5HYFA 1NANH 4WWKA 3QXAA 4LAJH 1TPXC 3SHSA 1MRFH 3PQYD 2OCFD 3L3IB 3NN8A 1KUMA 4N8CL 2F53A 2H3NB 5ALBH 2EE3A 1HSBA 1AGFB 4KROC 5E8NA 3U6RB 2CKBA 4YR6A 1G1YA 2X10A 3UXFA 1FCCA 1IRAY 3CFCL 2W9EL 5CP7A 2XQYG 5D1ZD 2VE6B 1KB5A 3QDME 4U1JB 2BHUA 3G6JA 2R1XB 4BKLB 3KYOB 4OM0H 4U1KA 3WFHB 5DQJA 5HDLA 3AS1A 2VH5H 1BIIA 4JY6A 3PQYE 1R3KB 2Y23A 3I02A 5MEOB 3CZJA 5IJVA 2BZDA 4HWBL 2F54A 2PYFB 2DM7A 1IZJA 4DN4H 2XKNB 4OM1H 3AAZA 4PJ8D 2HRLA 1FNSH 2BY3A 1JYVA 4HWEL 3PWPA 5HSFA 5JIIA 1A7QH 4R4ND 4EJ1C 1UQSA 3AROA 3OG6B 4KRPB 15C8H 4YDKL 4PY7A 5C0CB 5E9DD 4Z77A 2YD7A 4HXBH 5DHXB 4ZO6A 2W59A 3GFUA 2VC2H 3A67H 5FECB 5D2NE 3PWLA 1MHPL 2EEBA 4LSPL 3OJ2C 1DN2A 4MDIA 4TVSa 3LN4B 4KROD 4GXVL 4IOIB 2G5BA 1FV1B 2JJSA 4FQ2H 3CXHK 3FFCD 3UTQB 1XF3B 4P59L 4OFYA 1UZ8B 1INQA 1BFTA 3NFPA 5AAWA 1FL3A 2AXGB 4FQCH 1TVBB 3HA0A 2D03H 4S1RH 2EE2A 2G2RA 3O6FB 2YRPA 4JKPH 4C56B 3E2HC 1LE9A 1JWMB 1MEXH 3C5JB 3A6CH 3PWNA 3DXAA 3BJ91 1BZ7A 3U30C 4WRLA 3UJJL 3MBEB 4NO2B 5E8DL 2GFBA 3NMEA 1ZT7B 2ZOKA 3WSQL 4FQJH 5FV1L 4AEFA 3T3PE 4APQD 3UPRA 5ACLA 4P3DB 2EYRA 2I5YH 5IMLB 5C0FB 3H9HB 4FOMA 2BVOA 3NACL 5I8EB 4W70A 1U3HB 4ZTPH 1KJ2H 1MCPH 1EMTL 3VXRA 1GGCL 4BFIB 1A6AB 5DHVB 5C71A 4I48A 3UZQA 1LK3L 3NIDF 4MDJA 1LK2B 2YK1H 5ALCH 3UO1H 2NNAA 2EDYA 5FOBA 5KSVA 3QEGH 1T1ZA 3O11B 1JWSB 4ALAL 4Y19E 5GS0L 3HLAB 3KPSB 2DYPB 3ES6B 4XNZB 4LBEA 5DR5L 4JFXA 4A6YA 4YFLF 3U36B 5IW3A 2ADIA 4OLXL 2NX5B 1ONQA 1PYWA 1S7TA 1NEUA 4GOSA 3QXDB 1NDMA 4EI6B 4H0HB 4OV6F 3L3KA 1V7ML 4PJGB 2G9HB 1RZKL 3PV6A 4X6CA 2CDFB 4ZUSB 1DQJB 1AI1H 1KG0A 3BQUA 1LD9A 2VQ1B 3STZB 5K9JH 3OSKA 5CAYB 3FOMB 5HGAB 5IQ7H 1JVKA 2I60L 4X4YB 3NCCB 4JM2F 3V6OA 3EYVA 1F45A 1QFPA 1TJIH 4EI5A 5KG9B 1XIWD 5IR1B 5MP6L 4LRNL 5D9SA 5DWUH 5C0AB 4KI5C 1Q94B 5DYOB 4Z0BL 4P2OB 2YR3A 1F4YL 3MRMA 3VGEA 2FX8L 1G7HB 1WBZB 5K59E 4DZ8A 4GKSA 4CJ1A 1Q0YH 4M02A 5E99H 2A74B 2ZNWA 3RGVA 4DKDC 2LAAA 3QUMH 4P4KB 2X41A 5D7JC 4WJ5B 5EOCL 2PO6C 1MJ8H 4LASL 4LSRH 5DDHB 5HYJA 1N7MH 4JDTL 2YPKB 3RIFK 2UY7A 2EIEA 4N0UB 4PRID 2EIZB 3IXTA 3C8KA 4U1IB 2CRMA 2G75A 1MJJB 3V6BR 4ETYA 5BVPH 1RU9L 5JMOC 3UPCA 3Q5YA 5IK3B 2IG2L 3C87A 1T3FB 5ICZB 1M71A 4I3SL 3K2UL 4XVSH 3BGAA 2CK2A 4PG2C 1OLLA 3S37L 5JW4N 4HCRA 1J8KA 4Y5VB 5E2TH 1CDUA 1P6AB 4QY8A 5DD5H 3ZT5A 1KIQB 2NY5C 3QFJA 4DGVH 4PRIE 3LEYH 3L3GB 5F1IA 3ZL4L 5E5RB 2ZG3A 3QHFH 4KI5D 3CH8A 3HC4H 4OSUH 5HHMD 4E41A 1WFTA 4WFGD 2XZQL 5EC2B 1AGDA 4PJXA 2OMNA 3T1WA 3KLAA 5MERB 4AL8H 3ULUH 1XR9B 4U6TA 1QLEL 3ZYZA 4XC3L 5D7JD 1I8IB 4PJIE 2PO6D 4M5YH 5GHWL 3ZHLA 4PJHB 4Z7UE 1NBVL 1MWAH 2ATPA 1JFQH 4MNHB 5HHQA 5JW3H 4KI5E 4TOYH 3S97C 5IHZA 3JWDH 1E6JH 5HHME 2WINB 3OKEB 4WFGE 1KFAH 4ETQB 1OTTC 5F7WC 4RFOH 2FX7L 2XACC 3NIFE 4BSVB 1H3GA 3A6BL 3SDAC 5HYSG 2GT9A 5D7SL 2A77H 3OJDA 5TF0A 1PLGH 1QSEE 2HJLB 1EEYA 3LDBC 4HBQA 4XP6H 5T3XD 1MVFA 4YZFF 4GLRI 4GKNA 2IQ9H 2V2TB 3QIUC 3BPCB 4JPKL 2FHBA 5L6YL 1C5DB 4U3HA 1C1EL 1I85A 4PLJC 2F54E 1J18A 2X09A 3KAAA 5IW6B 4R7DB 5E5UB 2VDOH 3S34H 1T22B 3U9PH 3VXPB 4CADA 5CBAB 4RDQG 4FQ1L 3PWPE 3R0MA 5FO8A 4L8SB 1G6RB 2ICES 3NFSL 3DUHA 4JM4L 4HKJB 1YY8A 1UT9A 1UM6L 3JUZA 3NA9L 5T33H 5INDB 2E9JA 2CK0H 2WUCL 2X1QA 5GJTL 2BRRL 3DYOA 4MAYC 5F9WB 4NRXA 4WTZG 3KJ6L 1RUQH 1HH6B 1HWHB 3TVMB 2M26A 1U8PA 1X5HA 4PV8A 1OTTD 3REVB 4LSSL 4DGYL 3SDAD 3W5MA 4YAQA 4NO0A 5DMGC 3RIAF 1DN0B 1DL7H 4ODVH 5J57B 3LPFA 1ZS8B 4HD9A 5E6IC 4G6AC 4X7TB 3WO4B 5ID0B 5JQ6H 4H0IA 3C60B 4XBEL 1HHKA 5JOEA 3BKML 1BQHB 3CXDH 4YHOH 1FQ9C 1MLBA 4OCYL 1P69B 4PLJD 4E5XA 1PSKL 1MFAH 2FX9H 4C83B 2EYSB 5I1HH 4CVXA 3PABB 1CFTB 5ICYA 2XN9B 2YPVH 1HILA 3L3JA 1P4BH 1URLA 1J87A 3HPLA 4N0FB 1NL0H 4IRSD 4JR9L 2OL3L 4QXGH 1IGJB 2K7QA 2VRAA 4HIJA 4XNUL 4MAYD 5ACMA 4QRSA 1H3XA 1B3JA 4XBGA 3NABL 3INUL 5D93C 2Z4QA 3W2DL 3P0YH 4K8RC 4WFHE 2GQHA 1EDQA 3BP6A 4UNTA 3HNSL 4QT5B 3WDHA 4HH9B 4G6AD 1N64L 5GGTL 3KYKH 3DUUA 1IGIL 3GKZA 3CLEH 5T1KD 3NAAL 1KN4H 4OT1H 1WTGT 2E7LA 3AB0C 3BIAX 2VITA 3T8XB 1GAFL 2XZAH 4ODXA 2X2YA 3BHBA 5IVZA 3SDCA 4BFGA 5B39G 3W82A 1IAKB 5LKNA 1ROWA 4RZCA 2YEZB 4X80L 5IV2A 2EDKA 2JB5H 4PJBA 4AIZB 1NBYB 4MXWL 3WS3B 3BEWA 5A16B 2XY2A 3CX5K 4J3TA 5FUCC 1NGYB 4X6CE 25C8L 3KWWA 4JFYB 4QTIH 3HZYB 1CFBA 1S5HB 4LP4A 2UZYB 3SE4A 5JPMB 3EIFA 1QRND 5D4QA 3V6OE 3BT2L 3QEHA 3QUYB 3THMH 3GNMH 3TYFA 4PRNA 1EJOH 1OPGH 3QYCA 2VZUA 2M2DA 2PCPA 5T5FH 3AREB 5DUPH 1BP3B 1AFVL 2NXYC 5GRYA 3E6HA 1T20B 1W8NA 4H26B 4NFBA 1WWWX 4D3CH 4LLUB 3U9UA 1ZHBA 7FABH 4KK6C 2K7PA 3GEWB 3LEVL 2AJUL 5KVEL 1LEIB 2R2CA 5B4MC 5D7LB 5FKAB 3C08H 4M7JL 5JW4M 1F58H 1YEKH 5HYJE 2Q8BH 4UIKL 4RGNC 2ZCHH 3D2UA 4YHNB 4FQLL 1N3NA 5I73B 3GSWB 1UENA 1YNTA 3F7VB 1RZFH 3MLYH 3ARGB 2DOCA 3MLZL 4LGSB 4M1CC 4JN2A 3O2DH 2N7AA 3UTSB 3UTTB 5DHVH 4W4OC 3HMXH 4H8WL 1I3UA 4C4KT 5EOTA 2V17H 1SJXA 1Q8MA 3IFNH 1I9RH 3V6ZA 4NCDA 2BC4B 2GTWA 3H7BB 2HT4C 4ZFFA 3RY5A 4KVNL 5BS0A 4F7EB 3LEXA 4HQQL 3Q6GH 3W9EB 4X5WB 5DLMH 2XKSA 4PG9A 3V4VH 3KPLA 1U3JA 1ORSB 1KYOJ 3L5XH 1A8JH 5KVFL 3BGFC 5JPNB 1KIPB 4EIZC 1HKLH 2E8ZA 3W0WD 4JZJB 4KUCF 2P5WB 4RIRB 2YMXH 5KSBA 2LAGB 1AXSB 2CKBL 4FXGA 4FNLL 3X11B 1QR4A 3UYRL 2VZSA 3IDNB 3T1FB 1P7QB 3HZMA 2BVYA 4NHCL 3NZHL 3H3KA 1NLBH 5KANG 1KC5L 3QB7C 4HIXH 3WEXB 3JZ7A 3MA7A 3L95B 3FT2B 1TJHH 1BF8A 4O02L 5GGVL 3KHQA 3VG0L 3W0WE 2YD9A 5MEND 1J0HA 1HCVA 2XNAA 2YPLA 4YFEA 1CDCA 4GSDH 4GW1A 2QBWA 3ILQC 2HT4D 4EN3C 3G6DL 5E00A 3GJFB 5E70A 4HC1H 4HWNA 4GLRH 4QRQA 1YJDC 1FDLL 2J7LA 3IJHB 5GGRB 4NN5B 3O2VH 4YBLC 2O5ZH 2NY5L 2VLJB 1BF2A 4QWWC 1FVCA 2YA2A 5KZCD 3S36L 4MSWA 5JIPA 4XC1L 5MENE 1BWMA 3VD7A 1NCWH 5FF6A 1T04A 4QGYA 4Y8DC 1Y0LA 1MY5A 3QXWA 5AUMA 2AXFA 2ILLA 3MUY1 3CLFL 4OZHF 4XNQB 2H26B 1BVLB 1XH3A 1RK1B 4OCSH 1I3GH 1UB6A 4LCYB 2FATH 4Y16A 4QRPD 4DVRH 3C9NB 1BD2B 5CJQL 1WV7T 3I2CL 1E4JA 2ENYA 1MCEA 1SJVA 1UWEL 4JN1H 1IQWH 1CBVL 3NFNB 4JFQA 5DI8B 32C2A 4DJMA 1FNFA 3W9DA 1YQVL 3B3IA 3CFEB 2XIDA 4XPTL 1S9YB 4NQEB 4EDXA 3I75A 5IOPA 3ILQD 4EN3D 2GY7B 3X12B 2D31A 3ALPA 1MHEA 3VFSB 3MRDB 4QRPE 4R96B 4RNRA 1EV2E 5I1EH 4OD1H 5I71C 4PJAE 3SO3C 1ZV5A 4QWWD 1IEBA 3FOLA 4HJJL 1F97A 2P8MA 4IS6B 1YMHB 1F6AA 1NEZA 4S11A 1UM5L 1O7SA 1YUHA 4F37F 2HT3C 4NDMB 1I1AA 4NZJA 5FCSH 3RHWK 3UTOA 4P4RA 4XCNB 4Y5XA 4FXKB 1U9KA 2ZUXA 5J6HB 1LO2H 5HHPB 2GK2A 1GGIH 2JCCE 2NZIA 2D7NA 1D5IH 2ZCKH 5CEYA 3SE8H 1EPFA 2DLTA 3WLBB 1B9ZA 1A7OH 4YHMH 3N1QC 1N4XH 4YHLH 4J4PA 3K2MC 2O61A 4BH8A 4ORZC 1MAMH 3KR3H 3MV7D 4QRRD 3LH2L 3U1SH 4PRHD 3AUVA 3Q1SL 4RMWA 4UT6H 1P84J 2R23B 4IIQC 1TZIA 4MB4A 4YHPA 3BH8B 3GMOB 5JHDB 5I76A 1CWVA 5IMMB 5C6TL 4WEUD 4PS4H 3R8QA 2MMXA 3KLDA 3VMPA 3IJYB 3SN6N 1ITBB 1GGYA 1BOYA 4HKBB 1G6RH 4BK5A 2DD8L 3D0VA 3QUZA 4RBPH 3LB6C 5DK3A 3KS0J 5CILL 1T0NA 4QRRE 5DQ9A 4NQVA 4PRHE 2DM3A 2YBRB 3LQMA 1IC7H 5GRVK 3V6FA 1IC4L 4OB5H 3RVWC 1FGVH 5IBTH 4ZUTA 2H8PB 4HLJA 2Q6WB 3FQTB 1D5MB 3CU1A 1FZMA 2AXHA 1KTLB 4JY4B 3OKOB 1XGRA 4KPHL 2VXUH 1FZKA 4X6DE 3H9SD 3VDBA 1DR9A 4ERSH 3CVHB 5HGDA 3PWVB 4F9PC 4MHHI 3ROLB 5IF0A 4BELD 2FJFB 1OSZB 3EOTL 5CIPA 2GTZB 5I19H 5D72L 4LSTL 3EOYG 1P4IL 3FQWA 1NCNA 3VRIB 1E27B 4G43B 5KVGH 3MTRA 2XTLA 3D18B 2YD4A 3MREB 5HHOD 5EBMB 3EYOA 3H9SE 4LVEA 3LB6D 4MNQD 3VFGH 1ULVA 5AZ2H 2BSSA 4ZOCA 4CMHB 3SDDC 4XP9H 1MCFA 1G1CA 4GW4A 4X5XB 4QOKA 5IFAL 4HCRL 5J1AB 1QR1A 1MIEH 3S3SA 1M6OB 4HUMB 2JTDA 2VLLA 5I18L 4GQ9H 4YXLH 1KPVB 4UB0H 5F8QC 1W72H 5HHOE 3I6LD 2VDRH 3C8HA 1B4JH 1D9KB 3EO1A 1NMBL 1A14H 2E27H 2WWKT 4FN0A 3H9ZA 4RX4A 4MNQE 4PJ5D 1RZJL 2NY6C 4MB5A 4TVPH 1VEPA 4NKDB 1FYTD 2X4SB 3QHZH 5BS0E 2R56L 3BAEH 4WO4A 5IEKA 4Z0XA 4LQFL 1RVFL 2AK4A 1N8ZB 43C9B 1TCRB 5DEGB 3HMWH 1HHHA 4WEBH 4GMTL 3FAWA 1U0QA 5CHNB 5TDNA 1QVOA 3P9LA 3RWEB 3L3IA 4KGLA 1NMCB 4PTUB 2A6JA 2YWZA 5ESAB 2FBJL 3TH4T 1AGFA 3U6RA 2W0LA 1Y18B 1J8HB 1TXKA 5JDSA 4PJ5E 1CG9A 1QSFA 1FYTE 1AKJB 3FCTB 3ZZ1A 2X4UB 4WY7L 3C6LC 2R1XA 2RR3A 4JQVA 3QCUL 3WFHA 1F2QA 1OHQA 3QQ3B 1RUMH 5EU5B 4OCWH 1R3KA 1RJYA 3LMJL 1ZGLM 1AR2A 1S8DB 5MEOA 3FFDB 3OTTA 5I1KL 4ZG1A 4ZAKA 2YPLE 4YFDB 1P6FA 3BP7B 6CGTA 3VCLA 3MRQB 5IJKC 5DRXB 1DBML 2XKNA 2ATKB 2BDNH 3P77A 5FYKH 2NY6D 2DLFH 2KZ1B 5HDBF 2MCPH 3DVNB 2UWEE 1N6QL 4XPGL 2J2ZA 3GMMA 1BJ1J 2ORBH 2AJYL 2WLZA 3QNZA 4ZUWA 1JNNL 3MOQA 2X1WL 2ADFH 4XAWH 1L4IA 5IHLB 1FV1A 4HPYL 5CEXB 2V5RA 4HGKC 2DQGL 1XF3A 3FRUA 4XP5H 4XMLL 1OTUC 3G04B 5IVXF 2R8SL 4V1DB 5MEPB 1KXQE 3WJLA 4TSAH 2BMKA 4Q97A 4HFWB 1OARH 2BERA 2C3GA 4JHWL 2DQJH 4P9HL 1UEMA 5ESQB 4WI3A 1A7RH 2XTJE 3B6SA 4PJDF 3LS5H 2R1WB 1OP9A 1QBLH 4LLMB 2WBKA 4R0LA 5HVHB 4NO2A 3KPOA 3TO4C 4OD3H 4WUKH 1K3ZA 4I3RH 3O3DA 3TFKC 4XTRC 3WFEL 1A47A 2XY1A 5H8DA 5EZJA 5L7XH 2CO6B 2OSLA 4TUKL 1C08B 4DFHA 2IFGA 3ILPA 2NXZB 1Z3GL 3VWKA 4UQ2B 5F7UA 1JTPA 4TUOB 5CGTA 1XEDA 4X4ME 3QH3B 4J3OC 5DHVA 3VXUD 4CAGA 4ELMF 5ADOL 2ERJC 4GRLC 1VFAA 5HHVL 1OT2A 1LK2A 5IB2B 5HHXL 3TN0C 3TWCL 3VD3A 5DO2C 4X99B 1D5XB 3BD3A 4M9PA 4ORGA 3CJJA 1JWSA 3GI9H 3O11A 3N1FC 2XWJB 2DYPA 3VFMB 1CXEA 2KH2B 5T1LA 2HFGL 2Q1EA 3P30L 3GJFH 4KKAD 3GO1L 2NX5A 1KJ3L 1I4FA 3I50H 3QG6B 4LDLB 3VXUE 4H5SA 3MV8D 1E4KA 3HG1D 4OZFA 1FO0B 2C1PB 3L3DA 3TO4D 1FC2D 3ULUE 4R6UA 4L4VD 2CPCA 4UDTB 3FQUA 4XPAH 3BP4B 2AVGA 2G9HA 1H3TA 3HUJB 2CDFA 3MRKA 1DQJA 3JV6A 4PB9L 4XTRD 4ZUSA 4PJFF 5J13B 1LDSA 3FOMA 5HGAA 4GW5A 3PE9A 2NY0C 2HN7B 5I74B 4FZ8H 4YO0A 4O58H 2QHRH 2ARWA 2ZNXA 2D9CA 4OM0L 4YXKH 2Y1VA 1BECA 2VH5L 2QQLH 3MV8E 4L3EB 2OMBA 4GRLD 5SWZD 3WNLA 1FAKT 2QJDA 3P4NB 5DYOA 5KSAA 4P2OA 5DO2D 3QQNA 1SJHA 2JJTC 1K6QL 3QDJA 4DN4L 1G7HA 4NO5A 2Y9RT 1FNSL 1J0KA 1I9EA 2A74A 2BX5A 3RY6C 1A7QL 1JF1A 1NCDH 1GJIA 5ABDE 3PDOB 1EFXB 3G5YB 15C8L 3SDXA 5I9QC 2YPKA 2LE9A 4N0UA 4HFUH 4HXBL 3FN0L 1A2YB 4U1IA 2ESVD 1DSFL 1OAKH 3MNVB 4LRIC 3MCG1 5FYLL 1UWGH 5T5NF 1MQKH 1JPGB 5C0ND 1CLOH 1T3FA 3FT3A 3UTZA 1GC1H 1S7RB 1PKOA 1NC4A 3FB8B 2NY0D 4TPRH 3OAYH 2NR6D 3LRGA 3IS1X 4FQCL 5GZNC 1YC7A 4S1RL 2D03L 3OJVC 1WZLA 1KIQA 1MELA 3GM0A 3FQXB 4ODSH 3I6GB 1KCKA 3ECBB 1IBGH 1OAXH 8FABB 1MEXL 1SM3H 3L3GA 1CDYA 1K4DA 2ESVE 4LDEB 1P5VA 4CDGC 4X9BA 5I1GH 4YDIL 1YDPA 3TBWB 3REWA 1U95B 5EC2A 5CJ5A 4MQ7B 1XR9A 4FQJL 4NPYA 4HLZG 2YZ1A 1CXIA 1I8IA 1EZVY 2I5YL 1XGTA 4NUJA 4WTXA 2BNRB 3O6FC 4MNHA 3TF7C 35C8H 3RZCC 3VH8G 4ZTPL 1MCPL 1U8QB 4JE4B 1BFSA 2ICEA 3QIWB 2FD6H 5IMOA 3IU3A 3CDGB 1T7YA 4XP4L 5D7IA 4GRWF 1YN7B 1WVZA 3N85H 2YK1L 5ALCL 4OUUB 3GSNA 1B0WA 3GIZL 2NLJB 1M05A 1BOGB 3QEGL 4Y7MA 2C3WA 5GZND 3RRQA 3BPNC 1NBZA 4GMSL 5IW1A 5C0CD 1A1MB 3RBGA 4U05A 3CVHH 5GQBA 1C5DA 5DJZB 1UZ6F 5TDPB 5IW6A 3M17B 4R7DA 2RBLA 3ELAT 3VXPA 1T66C 1N5YH 5DJ2A 1HINL 1F90H 3QULB 2AEQH 1AI1L 4HKJA 3F65A 3E3QC 1ZHKA 3D5OF 4YBQD 5C0CE 4DFIA 2YD5A 5DTFB 3PWJB 1MCJA 4MNGB 3O6FD 4C56D 3RZCD 1QSZA 2V7HA 3FHAA 1S9VA 4IM8A 4LNVA 5DZNA 1TJIL 1LMKA 5DC4B 1HI6A 4WU5B 3G08B 4UUJB 3FQRA 1RJLB 3CFBB 4K3EL 4P5MA 4FG6C 5DWUL 3VI4F 5DRNB 4XBPA 1KCUH 4YNYB 3MBED 2Z91B 5KVMC 2X9XA 3FB7A 2R4RH 4NQDB 4HS8H 2CUIA 1I7RB 4WUUB 3QNYB 2E5EA 4X7TA 5E99L 2HKFH 2MSPA 4C56E 4YPGA 3QUML 5F96H 2LV4A 1MJ8L 5HI3C 1U3HD 5DVOA 4LSRL 5C86A 1MRDH 1S9WB 3MRCB 5B3JF 5BVJA 4DCQB 4JLRB 3LPGA 5F21B 5FM5O 3TPUB 3QQ9C 1F42A 4LEXH 3PDDA 2FO4A 4G8GB 5BVPL 2AW2A 3BSZH 2HLAA 3KLSA 3PXHA 4JFEB 2MTPA 3RUGF 3T09A 4N0FA 4FQPA 3KPSD 3LZFH 2Y5EA 1LO4H 4RGOH 3P11H 1MUJB 3MRBA 4IOFC 5E2TL 5ITFB 1IVLA 5IKCA 4QXUL 3G5XB 4C54A 4YDLC 3CU7A 1S7XB 5DD5L 4DGVL 5FO7B 3LEYL 2FGZA 5DGRA 4FG6D 4NC2B 1TZGH 1OWWA 3QHFL 1R3HA 3SJVB 3EYSH 1AHWC 2HFEB 4ZNEE 3O9WB 1TMCB 2C3VB 4X0KA 2AXJA 4KU1A 5D1XC 3VRLF 3AU1B 3NIGE 4FQHA 4QHUB 3WIFA 3MUZ1 3SCMB 1V7NH 4QTHB 3S6CA 3ME0A 1KLGA 4LVNB 4AL8L 3ULUL 3KPSE 4NCC1 3HAEG 1G0YR 4M8QB 4I8DA 4UAOB 5CD3A 3TH3T 5CZVH 4HUUB 3T8XA 2AJSH 4M5YL 5LJYH 1JIBA 2NX5E 2YRLA 1NFDF 4KI1A 3U4BH 3TIEB 4Z7VB 3TA3B 3QWRA 3VD4A 3QQ9D 5JW3L 4TOYL 3QSKB 2RJMA 5C0AD 5GRJH 3JWDL 1NBYA 4PJGE 1E6JL 5D5MB 2J88L 2V9TA 4M6AA 4M6NL 3I84A 4L8CB 4FRWA 3R06B 1FLRH 2H32A 4NN6C 4R7NB 1YEGH 4Q74A 3KYNB 1JGUH 1DUZB 4ELKB 1F4AA 2A77L 4P4KD 4IOFD 5E2VH 3T77B 4XP6L 5EU7E 3AREA 2IQ9L 5F9AC 3VXSD 5GS2H 5C0AE 4OZGB 1T20A 3BFOA 3O45B 4H26A 2OTPA 1R5VA 1BFVL 4LFHD 2IAMA 4YGAB 4P23B 1SYSB 5D1XD 3SKJH 1KB9K 2VDOL 3S34L 5HTSA 3U9PL 1E28A 2QQNH 1FRGH 2EH7L 4HG4K 3T4YA 4M1GH 1B6DA 5FKAA 4K9EC 3VE0B 1RUAH 4AT6B 3V95A 4N0UE 3OWEA 3GSWA 1AD9B 3K1KC 1J05B 3B5HA 3VXSE 5T33L 4FS0A 1I3RA 4ODHH 2APVA 1OGAB 3VI3E 2RQ8A 3ARGA 5GSVA 1QA9B 1RUQL 1R3JA 4D0CB 5FK9A 4RCAA 4R97B 1G7PB 1X6NA 5IB1A 3L5WB 1G7MA 4JREC 1G84A 3L3OB 2ICWA 1DL7L 5C0BB 1IGML 1NJ9B 4PV9A 5JQ6L 1HH9B 1G9MC 4GS7C 4KQ4H 3W9EA 3CXDL 4X5WA 4YHOL 1VFOA 4UV4H 1MNUH 4XH2B 4R26H 1KBGL 2DWDB 1ORSA 5DQDH 4Z7WA 2FX9L 4MJIA 4W68A 5I1HL 1UJ3A 2IC2A 1FO0H 3NCEB 3RI5F 1RUPH 1FIGH 3HE6B 1QFOA 5DD1H 2YPVL 4UILH 4ZO8A 1P4BL 1MAKA 3UBXB 3QI9B 4PJHE 5ETUB 1JPFB 2LABA 3MJ6A 1X6LA 2HTLC 1P7QA 3MX0A 4NBXB 2JJSC 3ARXA 5ICXA 5E5MB 5AZEH 5DJYB 1BQLH 5FEBA 3MNZB 1D5ZB 3FTGA 2EDTA 4NN7C 2GI7A 4WDIB 4DZBA 3P0YL 1MCOL 1HYSD 3GRWH 2B4CC 4I3GA 1FLTX 3QXVA 4OLYH 4MJ5B 3V8CA 3D69A 1KIUA 4P9MH 1JL8A 1AO7D 3KYKL 3WHE0 3CLEL 1EHAA 1KN4L 5F1NB 4OT1L 4QCIB 1MRCH 4FABH 4F58L 3IJHA 5C7XH 2GSGB 4MXQD 4K23H 2WWMC 2RAMA 4LCWA 5DJCB 3H9YA 3Q5OA 3MUHL 3TVMD 1KPUB 4F3FB 4OLWH 1EUUA 4FP8L 1U8OA 4NQTA 2OS7A 1INEH 5K9OB 4XNQA 4QTIL 2H26A 1O5DT 3N9GH 1RFDH 1CT8B 3C5ZC 1RK1A 4B7IA 1FZOB 4D9QE 5DZOA 3C60D 2HTLD 4J1UB 3C9NA 3G6JF 5FUZL 5BRZB 3WKMH 3THML 3GNML 3OQ3B 1MJUH 1OPGL 1CE6A 4OF8A 4DEPB 3OV6A 3PGDA 1LNUA 3NFNA 5T5FL 4Z8FH 1BLNB 4P2CG 5DUPL 3GGWB 1F3DH 5HI4C 5C3TA 4NQXB 5DJ6B 3TZVB 3CFEA 3LRHA 1S9YA 2FH8A 3FB6A 3RPKA 2C9AA 5E1HB 7FABL 2XN9D 1FNHA 1A5FH 1DDHB 5A2FA 3V5KA 1TETH 4NQSA 1HZHH 2XPGB 4YHKH 2Z0BA 1ES0B 3QR2A 5FAAA 3C08L 3AGVA 4FTVD 3WE6A 1YEKL 3FO2A 3IKCB 2WWMD 2IANA 2D7TH 5I17B 3HFMH 1KPRA 1LP9B 5GS3A 3B9KB 4JRYA 4KDTC 4ONOA 1RZFL 3MCKA 3KXFB 2HA1A 3MLYL 4AQOA 2XN9E 3BZ4B 2AK1H 4IEFB 3L6FB 5F6HJ 2VN4A 1NMAH 6FABH 4XCNA 4FXKA 3HMXL 4LMQI 3C5ZD 4TVPD 4X98B 1OTSC 5HHPA 2VUYA 1IT9H 2V17L 2IBZX 1AP2B 2PNDA 1QBMH 3DV4B 3IFNL 1I9RL 5J8OA 4KTDH 4FTVE 4A2LA 3EDJA 4RBPK 4MS8C 2DQDH 2XRAH 1A7PH 4KTEH 3BO8A 1QEWA 1FVEA 1ZT1B 4W6WB 3Q6GL 4NCC2 5DLML 1L9NA 5HI4D 4IMKC 1IFHH 3EFFB 5I1LB 3L5XL 3BH8A 3GMOA 4WHYH 4TSBL 5I1JH 4TVPE 1HKLL 3P9MB 5IMMA 1A1NA 3QRFM 1OB1B 2YMXL 2D0HA 2YC1B 3MRPB 3JTSB 1L0XA 1M7IA 4NYLB 1XF5B 3C2SA 2BHZA 3QUYD 4YXHL 4O4YL 1LQSR 1F6LL 2GITB 2VLRA 3QO0B 4M3KB 2RGSA 1NLBL 4LDOB 3MRFB 3ZHKA 2YBRA 1A3RH 5K33A 2OI9C 2FJGB 3GHBH 4FFWC 4OBRA 1DUYB 5L2JA 1TJHL 2DJUA 5FYKD 1JUFA 3PGCA 1FVDA 1OTSD 3ARDB 4OZ4A 2Q6WA 3FQTA 2YKLL 3EOBA 1F2XK 5D7LD 1KTLA 2Z31A 5HI5C 3TM6A 4MS8D 4HZAA 1J1XH 4HC1L 2R9HD 4RA3A 3N1GC 3O2WL 4WW1A 4MWFA 3DETC 3IJSA 2HKHH 4G9DB 4LIQH 2FJFA 3WKNA 4XCFH 5DUMH 3QJHA 2QHLA 2O5ZL 4HUXA 5B8CB 4HZLA 5FYKE 3VFVB 4BH7A 5BXFA 1E27A 3UTSD 3UTTD 2VUOA 1NCWL 5D7LE 5I1IH 1NGZB 5DFVD 4UQ3A 2NQCA 3RTQA 3ZKXB 4OCSL 3KPNB 2LU3A 3O8XB 4DVRL 2R2HB 4MGXA 2Q8AH 4X5XA 4KV5E 4U1HB 3MJGX 4FA8A 2QKIB 4LSQH 4U1GC 3EO9L 4FFWD 1IQWL 3UTSE 3UTTE 4HK0B 2I9LA 1DLFH 2P5WD 3IXAA 3VFRA 3DOSA 3LKOA 5EIQA 1D9KA 3K81A 1I7ZA 1QHOA 4F15B 5EZLB 1I85C 2X4SA 1CK0H 3NCJH 5C0DB 5I1EL 1T4KB 5IBUG 3DETD 4K3DH 2VZTA 3SBWC