2WGXA

Human p53 core domain mutant m133l-v203a-y236f-n239y-t253i-n268d
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCYSSCMGGMNRRPILIIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Stabilising the DNA-Binding Domain of P53 by Rational Design of its Hydrophobic Core.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wgxA00
4MZRA 3WTSA 3D05A 5G4NA 5BUAA 2X0WA 4AGOA 1HU8A 4HJEA 2J1YA 2IOOA 1CO1A 1EANA 4G82A 1EAQA 4IJTA 2AHIA 1IO4C 4L18A 2BIMA 1LJMA 5AOMA 3VD2A 4GUQA 3WTTA 1TSRA 2X0UA 5A7BA 2H1LM 2J1WA 3WU1A 4L0YA 4AGNA 4LO9A 4IBUA 2BIQA 1H9DA 2J1ZA 4QO1B 4MZIA 3ZMEA 1TUPA 5AOJA 2BIOA 2RMNA 2J6WA 3IGLA 5LGYA 2BIPA 3TS8A 2P52A 2YBGA 1HJCA 3KMDA 2XWCA 3D0AA 1E50A 3D09A 1T4WA 1YCSA 2AC0A 2OCJA 4KVPA 2X0VA 3WTUA 2IOIA 5G4OA 5AB9A 3QYNA 1HJBC 1CMOA 2GEQA 4IBQA 3WTYA 3WTWA 2ADYA 1UOLA 2IOMA 3IGKA 4G83A 4IBZA 2BINA 2XWRA 5AOKA 2PCXA 2J1XA 4AGQA 4A63A 3WTVA 5AOLA 3US1A 1KZYA 4XR8C 2VUKA 3D08A 4LOEA 3D07A 3KZ8A 5ECGA 1GZHA 5AOIA 3Q05A 2MEJB 2WGXA 4IBYA 4AGMA 2J21A 3D06A 3QYMA 3VD1A 5G4MA 3US0A 3Q06A 4AGLA 4IBSA 4LOFA 2ATAA 2J20A 3Q01A 5KBDA 3VD0A 3WTXA 4GUOA 4L0ZA 5LAPA 4IBVA 1GZHC 4IBWA 3EXLA 2FEJA 3EXJA 5ABAA 1EAOA 4AGPA 4IBTA
chains in the Genus database with same CATH superfamily
4JFTA 2FGWL 3CFUA 1AD9B 5F1NB 5HGAA 1UM5L 1J0KA 4HJ0D 3S5ZA 1VKXB 1IZJA 2H6UA 4HSCX 1YNTF 5BXFA 1QI5A 4OCNC 2XRAH 4RMRA 4OFPA 5BOPA 2ZUWA 4MQTB 3F2LA 1S7UA 1QUNB 2WO4A 3QI9C 1AZZC 5F97E 3S34L 4G59C 2QGCA 5K59E 5IQOA 2R1YA 4OCXL 3UO1L 1P5UB 3N1PC 5CAYB 4X7DC 3RHWF 3WNJA 3CQPA 4WWKC 3WXWH 1WWAX 2WWMC 4E5XG 5KYNA 3HHRB 4N2IA 1CE1L 2CUMA 2DWDB 2JLLA 4PWHA 1QA9B 4QOKA 1M3IA 2R4RL 3IDYB 4M7ZC 4TUKL 1JP5A 3WV0A 3QIUA 3VG0L 4W9CC 2YBGA 1MI5E 1RULL 1LEIB 2X4NA 3UXFA 1SOKA 4X99B 4TL4A 5I6LA 5MP6H 3UOAB 4NO3A 3LH2L 3C9NA 3CD4A 4PJBE 4BK8A 4OJFH 3F04A 8FABA 4ONGL 4K5OA 3BO8B 2P46B 3M7OA 5LNEA 1SLVA 1L9TA 1NANH 2UV3A 4HK0B 4AC4A 3RPBA 1WS8A 3LKOB 4I48B 1C7TA 4M6OL 1F11A 4RIRB 3EJUA 3IAQA 3SZKC 3P2TA 1IEBB 1DJXA 2V5TA 1C9SA 1UKQA 3BQUB 1IKNC 1VEPA 2C3GA 2BINA 5TE7H 3LPWA 1NCDL 1W0WB 4X2UA 4TNFA 4PY8J 3EJQA 2QBWA 5E2WL 3MLTA 1NGYB 1F02I 1N4XL 1BMWA 1I1AB 1A66A 2DMGA 3AQYA 1BPVA 4WI8A 4H2CA 4ERSL 1N3NB 4GS7C 1Z5YD 3RPKA 1CYGA 2NX5A 3C5JB 4KTDH 2GT9A 1G7MB 1YEKH 1N8ZA 3QWOA 4JGJA 1AO7A 5IB1B 3QIUD 3D85A 1FPTH 1KNOA 1LO4H 3GMQB 5I1CH 1SDYA 4X5QA 4RMWA 4P5MA 3V4VH 3KJ6L 1P6WA 2WM0A 1CFNA 2CIKB 2CHNA 3EFFB 5ESAB 3LRSA 3SKUD 2VDKL 5KEZA 5C6TL 1CPUA 5F7MC 5DI8A 5JLZA 3ARYA 1RCYA 4KVCL 4NM8L 1UKTA 2E7DA 3IMVA 1XAUA 4GMTH 3QG7L 4LSPH 4LU5H 1GH7A 4I3SL 5F6IB 1Y6NR 2VRKA 1U33A 1V3LA 4M7LT 4BD4A 3DBXB 2GB2A 5CLWA 4OBSA 4LLYB 4D0BA 4DUWA 4TRPH 4ETQB 1XV8A 5F7BA 4UMGA 4GSXA 4AT6A 1I31A 3MYJB 4L5FL 2NX5D 4Z7WB 4UF7C 3GHEH 1AO7D 5ICYA 2CM6A 4F2MA 2DWEA 4K94H 3ZE0E 5TQ2L 1A9BB 3IDXH 1S6NA 4E9TA 5DT1H 4Q58C 2OZNA 1CGTA 2I07A 3O11A 4AYID 5KUMA 1QNZH 1SXZA 4MSWB 3E9UA 4NZRL 5EOCJ 1S7QA 1BQRA 1BVLA 1IGTB 1LXMA 3RAJH 2HX7A 1U21A 1D7DA 1C08A 4FULA 4TN9A 4O4YL 3DIFB 3HCVA 4FJZA 2DWSA 2ADJB 4AEEA 3T1FB 4IRSA 2AC0A 2Q6WB 4B95C 2A74C 5T5FL 3DGGA 2VDNH 4QDGA 1HI6A 4HUWA 5ISZA 3WFZA 4BZ1A 3TIDA 3ELQA 3ZGIA 2PXYA 4HZAA 3GMOB 3VXRB 3IFLL 1KY6A 3BVTA 1LD9A 2PUQT 4NO0D 4WO4B 4MA7H 4J39A 1O5DT 1E40A 4HMEA 4XCEB 4UM8A 1T0MB 3TPUA 2BNUB 2XN2A 4I3GA 5ERWB 5I1JL 4WVRA 3B5TA 2AK1L 1BJ1J 4ZO6A 5FPIA 3LVEA 4ZD3L 3ZZ1A 1PG7X 5E03A 1D5MA 2VDRB 1FV1A 2GK0B 3DV4B 1QRNA 3D4YA 1VESA 4KUCD 1OHZA 1OGPA 2E7BA 4XNAA 4LGRB 4YXKL 2KLTA 5I15H 2HRPH 4FF9A 4CKQA 4J1UB 4PSPA 2B5IC 3GRGA 1GZHA 1NIAA 2VMDA 3EH4B 1EHLL 3CFJB 4GG8B 3U79A 2FATH 4OIIH 1E7UA 2DQDL 1PGRB 4KC3B 2Q86A 3AWFA 5IMLA 3UPRB 2NY0C 2LTQB 4DEWA 2DQUH 2ZYIA 3B2UD 1FHGA 2Y5TA 4IRSD 5BQDA 4MD0A 2UY6B 5EFIB 5ISZD 3OKEB 5IROC 2ZKXA 3TL5A 1FYHB 1DANT 1KJ3L 2IADA 3FONB 4XNZB 5E8EB 4LSRH 4BK4A 2JB6B 2YAMA 2OL3A 1T89A 1ZEAH 4M56A 2NW3A 3RNKA 3UPAA 4A37A 4AQ8C 1NFDF 4K94C 1CDUA 2HT2C 4YSCA 5FHAH 2OMVA 3LVTA 1INEH 3D6GA 2ZKWA 4PMEA 5AZ2L 5I16B 2AV7A 1WO2A 4LPTA 4EF3A 5I18H 1A25A 3BZEA 3C6SB 4O51A 3L5JA 3NZSA 5FLVA 3GIZH 3HR6A 4IIQA 1ACXA 1XGUA 1YMHB 2YPVH 1U6AH 5C9KA 1TTCA 4YMPA 1MAML 2OR7A 4PW3A 4F5CA 2EECA 4JZNA 4XPAL 3AQZA 3WTSA 3PPSA 5AVZB 4JG0L 2H6PA 5CMAB 4IYKA 2XX1A 2GCYA 3A0OA 1FNGA 4C56B 4RGNB 3QXWA 4PWIA 2EC9T 4H1LH 4HCIA 5BJTA 5L2JA 3FF8A 3MJ9H 1T21A 2BVOA 2I26N 5AW5B 2WOBA 3CFCL 4Y4FA 3WLBA 4ANWA 4EZMA 4N0UB 3PWNB 3QZOA 4AEHL 3VFPA 3ZKXB 5BVJB 1HTYA 2NX5E 1JGUL 2W60A 4MWFA 5IEKA 2BHUA 4L4VA 4DW2H 3BVVA 2D4FA 4LHUA 3SN6N 5T5NF 4P5TA 4AJVA 4OTXH 4Z7AA 2QEJA 3NJHA 1TJIH 3NSDA 1MWAL 3QDJD 3WY4A 5E2VH 2XZAH 1KCVL 5GJTH 2ITCB 5JNYB 4Y0GA 3WHE1 3QEQB 2VDLH 3L45A 4Q8BA 1E5ZA 4HIPA 4FQ2L 2QHLA 1KJMB 2HG0A 2JJTC 2A5UA 3TO2A 3I6KA 3KPMB 4MJHA 2HH0H 3VJ6B 2AJVH 4AVIA 4L37A 2QKIB 1JN6B 4OAWB 2CR6A 4YDKH 3CQQA 5EBMA 3FQRA 3GK8H 4HUXB 4TULH 4XP6L 4CNIB 3KDPB 7PCYA 4Y4FD 2CBPA 1PZDA 4HISA 1I75A 2RCSL 3LHAA 4PJDB 4MA1B 1PKOA 2ZICA 3KPLA 3L1EA 3QNZB 4TSBL 4UOW1 3O3AB 5A6MA 3D07A 1N18A 1D9KD 5I30L 2W0LA 2VLLB 4LHUD 4P9ML 2F19H 3PHQA 4N3UA 3BN9C 4NQED 1DHKA 1GPOH 4XRCA 4WW2A 2XG4A 3GJEA 4PU2A 1OW0C 4ODHL 3QCTL 2A7BA 2QV2A 4NHUB 5C0FA 3RNQA 3UBXG 3EOTL 3KW8A 4EE2A 2DBLH 2O6PA 2IAAC 2OYMA 2PPDA 1MJ8H 2X10A 4EMZA 5C0JB 2HWZH 1JPTL 2A83B 1UT9A 2XX0A 2GC4C 3FPYA 3GQFA 5DS1A 3VRJB 3CX5K 3M46A 4AV4A 3ZSSA 1GJUA 2PWEA 3RJQB 4PJHB 1HH6B 2AEOA 3OJDA 5ISZE 1EDYA 2G9HA 5DUPH 5GSVB 4HWBA 3VFWB 2GUOB 2CXGA 3CZKA 2WUCL 2V17H 1K3ZA 4UILL 1NDMA 2X4QA 4PY7B 4A39A 4D0DB 4K7PL 4X7TB 3HAEG 4NN6C 4L1DA 1G9MC 2X4TB 1BJMA 2K8QA 2DM2A 2OTWA 3FH8A 5F3HB 4RAHA 2BRRH 4JHWH 3W11D 1BEYL 2PTUA 2GSMB 4DP1X 5KG9A 1B0RA 2CUHA 4GBXB 1HILB 3HE7A 4NKOA 4EIZC 2YUXA 4OZHF 5DLML 5E8PA 4ZMZA 3EIFA 4WFFE 4NOBA 4ZFZB 3RI5F 2O5XL 4M6MH 1NBYB 1U9KA 2FD6L 2EDLA 2A1WL 4KAQH 3TA3A 1AGBB 4FFVC 1HCYA 1WWWX 1GZPA 3SDDD 1OSZA 1U8KB 1XCQB 3NIFF 3ALPA 4BELD 1IKOP 3EO1A 1LP9E 4M9OA 4X6DF 3LPFA 2G0KA 3QEUA 5E0FA 1N2RA 1NCTA 4U3SB 3ZU8A 3RDJA 3NP4A 3OLDA 3AG3B 4MCZA 4R5TA 4OLZH 1QLEH 3UJIH 2ZPKH 2J56A 1ORSA 1YVLA 2ZWZA 3VFGH 1SGKA 4GKSA 1PY4A 5DVMA 4CC1A 3EO9L 1BG9A 1OT1A 2BCKB 3ZE1F 2IOMA 1MN4A 4MAYB 2VW6A 5F0MB 3PWJA 1ID5I 5EOTA 5C09A 4UBDD 5J1SC 5KSUA 3HE7D 3WDHA 4ENZA 2C9VA 1E27B 3NEEA 3QDJE 3MRMA 3ZSTA 1JV5A 3VFTA 3KXFD 5D2NE 1F0LA 2ZOWA 4NN7C 4GAAA 3NIDF 1RU9L 1XVSA 3TA3D 4OZIF 2FLRT 3OLIA 4DGVL 4HK3J 2WK2A 2CZNA 2NOYA 1AD0B 1IMHC 2DIEA 1ZS8B 3UZVB 1WTGT 4BKSC 2HFEA 5K1NA 1MCHA 1RPQA 2KZKA 3MXWL 2JCCF 3BE1H 4N2LA 2FHFA 4YSQA 5LVEA 3FB6A 3VW3H 3QUGA 2NQ3A 3KH3A 1HEHC 3LHPH 5FUCE 2M83A 4K5MA 4LASH 5HDLA 1N67A 3HC3H 4R7NB 5F0PB 3IDMB 5CBEB 4E5XB 4G6JL 4JDZB 1VPOL 1EEYB 1GL4B 3GINA 4M9PA 5E8OA 1DFBL 2ZCZA 3SQOL 3D51A 3QZWA 1KN2H 2FHBA 5GRJL 1XSIA 1FORL 4UT7H 5C09D 3KE0A 5JORB 4NQEE 1BBJB 2YD4A 4D9RD 1MFUA 1S7SA 4GO6B 4XWGH 2EIEA 3VM5A 3UFIA 3Q0HA 3MPCA 2YAOA 3BPLC 1F3RB 1EAOA 1IEAA 2HCZX 3ISWA 3RHWK 1A6ZA 2ESVA 2IALA 3HG3A 1PLGL 4W9GC 1Z5HA 4HHGA 1A4AA 3S36L 4O2FA 1KY7A 4LL1A 1IGYA 2FJHA 2OX5B 2CAKA 1JNJA 4S0HA 1A7QH 2HPOA 4GSDH 3BP4B 4QXUH 1A22B 3EKCA 5IFHH 4M48H 1TZGH 5DD3H 3V0WH 3OXSB 5HYSG 1OY3B 2YD2A 1KG0B 3BAYA 4ECNA 3L5HA 2FBRA 3B34A 2EVGA 2EDWA 4GKZB 3DJRA 2PCFB 4H2AA 4H25A 4GP8B 2OFQA 3E0GA 1OAJA 3ZDWA 5C0NC 3IXTA 2HLAA 1CQKA 3FO1B 2CKBH 4ORGB 5HHVH 1A6VL 5H37H 3ZO9A 4DVBA 1JMXA 3C5SA 3DPBA 1T0NA 3GB7A 4PJFB 2BSBA 1WUZA 4LAQH 1YN7B 4OQ1A 4NZUH 4WSKA 5HDBF 3EYSH 1PDKB 2ESVD 3WO4B 3OZLA 4UNTA 2AEPH 2OW7A 5C0IA 3Q43A 4DN3H 1BVKA 3MV8D 3K6SA 1FA4A 1CXHA 2FECI 4XH2A 5HBBA 1C16B 2VMEA 3RWIA 4MMXB 2ZSVB 1ROCA 1Q9KA 1X5HA 2CCLA 2DLFL 3KPRB 3MREA 3OR7A 1NLBH 2WNGA 5CILL 1NMBH 3SCMA 1T7XA 4Z3JA 3C09B 5FYJH 1LO3L 2H2SC 3HZVA 1CE6A 4PJ7F 3MA9H 4Z18A 5I19H 3HJ0A 1H0DB 5EDXA 1JSYA 1NZRA 4GW5B 1MHCB 1JI1A 4J3TA 1I53A 4ZSOE 4BYHA 1BD2A 1FSKC 3W57A 3DSFL 2C3XA 3L16A 1URZA 3BPOC 3S4SB 1P7QA 3L4VA 4FNLH 3KXFE 3UTSB 3S8WA 4OQTH 5I8CB 4M5ZL 3Q5TA 4TMPA 3JZYA 2WD0A 1ODAA 3B2PA 2J3SA 2OMWA 3G3LA 3VXOA 2ZCKL 3U0WH 5KVEH 4OZ4A 1RAMA 2Z8SA 4YLQT 1ADQH 4KTEL 4MTMA 3VD0A 4KHXL 4IRJB 3FT3B 5DF0A 2AJYH 4HIJB 4W9EC 3AW5A 1IGFH 4J3OG 1J9TA 3O0RL 5IP4A 1FBIL 5J6GA 1HAUA 3IF1B 1KTLA 4EZLA 3CN4A 4J6RL 1DQDH 4OB5L 4PRPD 1ZA3B 3SCMD 4Z76B 3X1NA 1KPVB 4D0CA 4U6YA 4JFFB 4W68A 3SO3B 1KCRH 5DK0B 2UY7A 3NA9H 3P3RA 4PJAB 1NEPA 4AC2A 4U1LB 4Q6KA 4JY6A 4NRXB 4OKVA 2YD5A 4PJIA 5C09E 3C5ZC 3KDMB 3CPLB 4DZBB 1WICA 5CEXA 1OLZA 3FO9B 4JQIL 4ONFL 1T1YA 4D9RE 3P3UA 4QTHB 5I1HH 2QZ5A 2NXZB 1T1ZA 2QADD 2Y69B 2BY2A 3LTVA 4NAMA 4F7TA 5FYJE 5J0BA 1XGQB 2H0FA 3QWQB 4GT0A 4P5KB 1OP3H 5A7BA 2QQNL 2J1WA 5TH2B 4LCUB 1F4YH 1JK8A 2YRZA 3HNVH 2WXJA 3L7EA 4UUJA 4BSWB 5JHBA 3AAZA 3E7JA 3MR9B 2W80C 3MBXL 4NKIL 2R4SL 4YXHH 5GS0L 1YEFH 4G8EA 4NFCA 2RMNA 5I71C 3ZBMA 2AF2A 3ZE2F 5B3JF 3DO7A 3RWHB 2NUTB 4LVOC 4M8UA 1YQVL 1Z0MA 4GAFB 4NWTH 1MFEL 4BFEA 3GZKA 4ODBD 4XP4H 1P6AB 3UJJH 4APQB 5KVEE 3X14B 2EDRA 3O0LA 4XMKL 2D7MA 3HUJB 3SDYL 4Y2LA 2DQTH 3LH9A 2P24A 1V5JA 1KIQB 4OGZA 3WXVH 3EJSA 2A6DA 4HT1H 4YDMA 5SV3A 4XO5A 4WI6A 3SJVB 3WIHH 1A65A 3P3TA 5FKAB 4MA3A 2BX5A 4QNPF 2IXQB 3I9GL 1YEDB 1KUMA 1FAIH 4X9FA 3H9SA 2Y7QB 4JM4L 4XBPB 1LEKB 3K91A 1CYWA 1R17A 1EMTL 2ESVE 5INCA 1RSFA 2OLDA 4N8UA 1NCNA 1W0VA 3BH9B 3MV8E 4ZMNA 4XPTL 1KV7A 1QBLH 2TRYA 4G6KH 2AJSL 4I2XA 1GYAA 2W0FA 4BSJA 5C0CA 1LDPL 3C8KB 4ZNEA 1EZVX 5I0YA 1EZSA 5D1ZB 3CC5A 4YLCA 4NCC1 3NYKA 4FTDA 2HJKB 3WY3A 4NERA 3EDJA 3A6OA 3TVMB 4NRZA 1TQCC 2NQCA 4HIEA 3CVIL 1P4BL 4M43L 1CFSB 4P5RA 5SWZA 2IV9A 3P77B 4XVOA 3KJ4C 4U6HB 1UWYA 3MUJA 2DQEH 1DQLH 1BW8A 2Z4QA 3EJRA 4MS6A 2FGWH 1FZKA 3KPQA 3LZPA 2J5WA 2E4TA 4L2LA 2GAZB 2ZOUA 1UM5H 1UOVA 3JT0A 3H9SD 4K5NA 4QRPD 4BIKA 1RK1A 2VDOL 4JLRA 3KH4A 4Z7UE 4I7ZC 1R3KB 1J5DA 1XSKA 3HTLX 3HI1B 5AW7B 2MH4A 3UH8A 4ELME 2R29L 4Y1AB 3BAJA 5EF2A 3QJHA 2XV6B 3KG5A 3FU3A 4JDVB 3S34H 3UO1H 4OCXH 1IAKA 4EUPG 1VZGA 4MJ5B 5C0CD 4QT5B 3H9ZA 2JE8A 3U0PA 4L29A 1CXIA 3MKGA 5DK3A 4JL1A 4PEEA 1CE1H 5FGBC 2GI7A 4B0MB 3T0EA 1PZSA 1SFDA 1XGPA 3GSWB 1P7BA 4L18A 4PRPE 3P4OA 4UTBA 2R4RH 4U05A 1PFOA 3VG0H 3MV9D 5IVZB 1RULH 3KL0A 4UIMB 1TNNA 5SWZD 4AGNA 3CSTA 1MJUL 4KRPC 5I6OA 4ZW3A 4AJWA 1MCIA 4YHIA 4K71B 1FJ1B 1A3LL 4NUJB 5CCKL 4ONGH 4R90L 4XBGA 1S5IL 3QIWA 4WW1A 1BFSA 3U36A 5KYYA 1KB5B 5SWSD 1NINA 2NYYC 1MUJB 2A4CA 4M3HA 3FCSA 3PDGA 3UBXB 3B7UX 3QIBC 6CGTA 1NCDH 4EIUA 1HEJC 4HW6A 3IPEA 4U1SA 4XMVA 5E2WH 3QA3B 1KLUB 9CGTA 3AUWB 1N4XH 4URKA 3F65A 2RA1A 3MRJB 5CINH 4ERSH 3D69B 3GTTA 3OKMA 4XXDA 3UROR 3WS3A 3KPNA 2VO8A 4JJ5A 2L8AA 4W4OA 3FB5B 2QTEA 2WYZA 1U8IB 2C9AA 3QXDB 3KJ6H 3HAEB 3MBEB 1ML0A 4TOYL 1JZ7A 2VDKH 3IXAB 4MBRA 5C6TH 1DDHB 2BO0A 5CP3H 4KGJA 2FLBT 4BFBD 2IMMA 4KVCH 4O2EA 3CZLA 3HNSL 1CZ8L 3T8VA 1FFPB 2XQYK 3QIWD 1MCJA 2GSGB 1GZQA 3QG7H 3V7AG 4FNTA 4AUYA 4E9WA 4I3SH 4NQVA 3I6GB 4RFEB 4XXCA 1RUAL 1K2DB 4ZK8A 1JGVL 2WBXA 4QRRB 3VD1A 2ZG2A 1EERB 4DJMA 5C0BE 4LOFA 1M2VA 1FGVH 4KXZH 3U9WA 3BD5A 4DPAX 1OE1A 5LAXA 4GSUA 3S3JA 4DPBX 5JMRA 4EDWL 5AEAA 4HKJB 4ODVL 3ALXA 4GUOA 1ACZA 1T4KB 1U2CA 3GMPA 1J9CT 4YDNA 4GEJA 3TEUA 4L2YA 3RI5K 1IQWL 2EILB 3HS9A 1DLFH 3IDJB 5ABAA 3SZ6A 1YQ2A 2PP7A 3QK0A 4XVSH 2AVGA 4KK8D 1JRHI 4UB0L 1L0PA 5TQ2H 4JZJB 3L3OA 5FIEA 3KLHC 2BSEA 3FXIC 4BZ1L 3ZTJG 3L3KB 1B0GB 4YDIL 1A7BA 4NZRH 1JS4A 4LZKA 4XGZB 3GMMB 3MCLL 4QRPE 4LKXA 4PV1C 4P46D 3JUYA 4FZ8H 4YUEL 4XPGH 3G9AB 4ZTPL 4B96A 3WUWG 4O4YH 1TIUA 1CJYA 1FI8C 2NY1B 5I2IB 4JFPB 5AAWC 1E2WA 4IBLT 4P2AA 4PFEA 5FM5M 3UTZB 1H5BB 1OL0A 1O0VA 5D1ZI 5T5FH 4Z23A 4I2XE 5J12B 4G42B 1JL8A 1IAII 5C0CE 4FAAB 1ZAGA 3NSXA 4HKXA 4JAMA 3JT2A 4G3YL 4AJ0A 1CXKA 3IFLH 4DGWC 1DVXA 1WYJA 2B39A 3QDAA 1VFOA 4U7MA 4E36A 4RDQG 5I1JH 2UZIL 4DGYL 2AK1H 2W1NA 1A3QA 3MV9E 2HB0A 5SWZE 3Q5YA 4P23C 1M7DB 4ZD3H 4RGOL 5D5MB 2MPVA 4N9GB 2BSED 4P2OB 2Z31B 2DMCA 2ZX5A 4PJGB 1UEYA 2AV1A 2AK4B 4M00A 3HR5B 4YXKH 5BZWB 2JK5B 4A04A 3DX4A 1D5ZA 3HC0A 1D5BA 3VGDA 2Z91B 1B4JH 1JAEA 1E6OL 5SWSE 3NFPB 1EHLH 2YEVB 5DMIL 3II3A 1JXJA 2VB5A 3NCCB 2H32H 2DQDH 5DURD 3HZKB 5GRYA 4Y89A 4DP0X 5BW7C 1NEZA 1YY8A 1JXGA 1ZSDB 3AM8A 5DLLA 4M4RB 5HJ3B 2WQAA 5FO7A 3GUTB 4OI8A 1KJ3H 1YNTA 2BM3A 2OS7A 1E9PA 1FWXA 4ZUSA 1R34A 1KLFA 1JWMB 4U2ZA 2VITB 3PV7A 2YR3A 5E5MB 2BOBA 1JBJA 5CEZD 3QUXC 1JPFA 3VI3B 3RB7A 5HYSB 5AZ2H 1RHHB 4BCZA 2O1AA 2DOCA 1CD0A 1FZOB 5MI0B 4PWGA 2ZYRA 5D1XC 4DK6A 3BKYL 3MRPA 2G75A 4HZ1A 1G4RA 4EDXB 5BRZB 1MAMH 2ICWB 1QKZL 5LXGL 3VFMB 4XPAH 3N91A 3IU3A 1OP5K 2BZCA 4HKBB 3UBXI 2E9GA 3FF7A 5JOFA 2WSKA 4WEUD 2Q76A 4Z78A 3T2NL 3MFGB 4WI0B 1NBZA 1IBZA 1WFUA 3KD4A 3K72B 3DX7B 4B5ZA 1FVCA 1RZJL 2NY4B 3CFCH 2XWDA 3M8OL 4Y4KB 1XF3A 1DVFC 2AAVA 3CHPA 4JVUA 1ZLWK 3VG9C 1RFDH 4FNUA 4PJDF 2AQ1A 4G5AA 3W9EA 5ITFB 3U6RA 3MRNA 3RVWC 5KBLA 2P28B 5GS1B 1UGKA 2HJLB 1TKWB 1U2YA 3OPUA 3O3EB 1MIML 2YO3A 1MWAH 5EU3A 1A6UL 1HINL 2P8PB 2Z7WA 2ZCLL 3X11A 2XPZA 5BCAA 1TVBA 4KV5E 1KCVH 1QR1A 4UYQA 4TTDD 4Y2NA 2JQMA 4LPCA 4FQ2H 2EDOA 5E1HB 2RB8A 4NN5C 3K3QA 2J5LC 3VD5A 2WTRA 3WSQL 5CEZH 1MXDA 4PJXB 3GXDA 5D2LF 1QSEA 3CDCA 3HLKA 2Y7NA 4IOFD 4GT7A 4XP6H 4PJHF 2I24N 3SE6A 4DN4L 2AI0H 2IBZX 5K1JA 1K72A 5IVXA 1ZPUA 1JZ3A 1KGYE 4DZ8A 2RCSH 5C8JB 1EX0A 2D73A 3IJYA 3LIZA 3QRFM 4ESKA 4AIZB 4TSBH 2NW2A 3O6KL 4KBPA 3F83A 1R46A 4MNQA 1RERA 1RURL 5I30H 2GJZB 2ICEB 3QXTA 4OH2A 4TNWK 4K5LA 4P9MH 5TDPA 5DJXB 4JRYD 1A2YB 1N5AB 2YFOA 1SDAB 2GK2A 3HJEA 4RZCA 4N2AA 1SLXA 4BFIA 4UQ3A 1E9OA 3QORB 3QCTH 4RFNB 1HSAA 3T6WA 4HUUB 4PJ8B 4U1IB 2H0EA 3EOTH 4MJIE 4ZOBA 3R8BB 2HTKD 3HBQA 5K5YA 1Y0LA 3JWOL 3RX8A 4CMHB 2Y06H 1JPTH 5GRUH 3U2SA 2IFFL 4G1MA 3MRIA 2FSDA 1GYUA 2R59A 1QSED 1MCQA 2D03L 3F84A 4DO6A 1Q94B 2OCCB 1J0JA 3E8VA 2FT8A 4HH9B 1HOCB 5E6UB 1OGAA 3CDZB 3VYNA 4A2GA 1CLYL 2WUCH 4LBEB 2Q2LA 4NJAL 4UILH 3VD9A 2Y9RT 1FFTB 4K7PH 4MNQD 5CEZE 3KYAA 1HHJB 5EB9A 4FI8A 4W81A 5EBGA 4DNLA 2R8SL 1BEYH 1DVYA 1QFUL 1R24A 1FZJA 1X5IA 1VRSA 5DLMH 1LK2B 4HHWA 3IPFA 3LEVH 4KKLC 3ELAT 5E6YA 5I1DB 2O5XH 1DEEA 3O9WA 4MMZB 2FD6H 2A1WH 1NCUA 4QY8A 1H15B 1ZGLB 4N2GA 2GW5A 4IU3B 5TD4A 4WHCA 5DJDA 4JDEB 4L1SA 1B6UA 3H7LA 3OG4B 2FBOJ 3DETD 2HVJB 3WTTA 1WAAF 3TCXA 4F8PA 4FXKC 4PI2A 2H1LM 5DHXB 1KBGL 1HNFA 1LWRA 2CMRL 2OXGA 4MDRA 4LOUD 4Z77A 1AIFA 3DUSA 1OGAD 1L6ZA 3ZHFA 2EDQA 1IRAY 3KLDA 3PWPA 43CAB 1DN0A 3PAYA 2EDYA 2N0MA 4JFDB 2WZPA 3EO9H 1B4TA 5HGHB 4CSTA 4LSDA 2P8LB 2EE9A 4FFWD 3EJCA 4R4BA 4B7LA 2EDKA 1F3JA 3BEWA 3U1QA 4FERA 3DROB 4W9KC 3ZKMD 4X4YA 4N26A 5JIIA 1NFDA 2X4RB 3LZLA 2P5EB 1QYGL 2B08A 2WZAA 4W9IC 4B9YA 5LG1A 3PL6C 4LCCA 2G5BA 1J1XL 1VIWA 3FNKA 3CSYB 2K8MA 3KGSA 3IAGC 4PJ9B 3LEXA 2XJLA 5CZXD 3UGEA 5BV7B 3BXNB 4M4PA 4FQXA 4LSUL 2PKDA 3MNZA 5JPMB 3MXWH 2P7TA 4BK5A 4JHUA 1JNLL 4DF9A 1BFOA 1W72A 1WE5A 4W6WB 4BFGA 4R26L 5G55A 4EUPB 5ICZB 5AOIA 2E7HA 1IQDA 1MCOL 1Q9OB 4GNKB 5K9QG 3OQRA 4N28A 2MQ3A 2LAAA 4G6JH 2WZPD 1VPOH 4QHLA 3SQOH 1QTYT 1PYWA 3SQBA 1HYSC 1DFBH 1S7VA 3IKCB 3RFZC 1HXYB 1MJJA 5GRJH 1FORH 3LNEA 4JRYE 1IAOB 4WGVB 1UACH 4A2MA 5AD0B 3GMRB 4QCIB 3W9DA 2Y22A 5JW3L 3QE5A 4PJFF 1BLNA 2A38A 1QTPA 5C9JB 1PLGH 4WY7L 1HE7A 3L3DA 3K0YA 2FQGA 2NTSP 5IZ7A 3S98A 4H8QA 5L6YH 3M1BA 3BSGA 1T04A 1CDGA 3AS0A 1FLTX 1U8LA 2EDTA 1QSEE 2EIZA 2R56L 3E9TA 3ETBJ 3SD2A 1BZDA 4LDEB 3ABMB 4G80A 4M6NL 3VTMA 4PS3A 2CE6A 2YC1A 3AG2B 5T1KD 1UCTA 3O2WH 1WD8A 4ZNCD 3RTQA 2UVEA 4WI5A 4YFDB 5IHZB 4RH4A 4ES9A 4LLUB 2N4IA 2VQ4A 3V4PA 3IDNA 4ILDA 4MNQE 2PYEA 3BT2L 4X6BA 3MX0B 3CVHB 4B97A 5BS0D 1JE6A 3RWFB 3ZQXA 1FVDB 4AH2A 1A6VH 4G9FA 1E2VA 3T65A 5GZNC 3NGBC 3UERA 1JGDB 4AIXA 1LL1A 2VLJA 5KZCB 3OV6A 5FECA 1DJIA 2WLJA 4EN2A 3OAZH 5IG7B 4AOFA 4QO1A 1JDCA 2GITB 4FMVA 1R19A 5E56A 3V79C 2EXWC 2DKSA 2J8OA 1QFPA 3I6LD 1C12B 2DLFH 3U9UA 4NZTL 2CJSA 3AY4C 4JKWA 5CILH 1OGAE 2HX8A 3NA4A 5B7EA 5IQ7L 3B6SB 1MLBB 4NSKA 4YZWA 3GGWB 5E2TL 5GS0D 5MERB 4X4ZA 3RL1A 4HZLB 2XQYA 4XVTL 5I0DA 2BMKA 3TBVB 1UASA 4PJAF 4JRLA 4OF7A 4QHUA 5I26A 3D48R 1SBSL 2AJ3A 1HIML 2CXKA 5L9DL 4BFRA 5C92A 1V54B 1TQWA 3DSFH 1MCKA 2FYYA 4KI5C 3VGHA 3AS3A 2IBBA 1ED3B 3AS1A 2VLJD 4G6FB 3VE0A 1ZIBA 2WXLA 2D7TL 2ZCKH 3KYKL 4OZHA 5CM1A 3EDEA 2VZSA 2Y5QA 4KTEH 3DTDA 3FQ4A 4OZGE 4KHXH 5A3ID 4KGLA 1XH3B 2Y6SD 5IF0B 3TH2T 1X9RA 2ORBL 1H9VA 3WUWB 2Q8AL 4HGKC 2C7UB 3O0RH 1J1OL 1FBIH 1NCIA 7CGTA 5CFHA 1KIPB 4KTGA 4F58L 1QFWM 3IU4L 3TF7C 5KBNC 3PV6B 4J6RH 4OB5H 4NDMA 5E8DL 5LGJA 1BIIB 5I74B 3LQZA 3Q01A 3PXJA 1VFBB 2WIIA 5F1SA 2CRZA 4RMUA 2MIZA 3CFIC 2F53D 1I7ZA 4G6ML 4LCYA 4NZ8A 1S9VA 5LAPA 3ARGC 4NC1C 4HEPA 4NO5B 3SKOA 1VCAA 2KT6A 2JCWA 4XZ4A 3FN0L 3KCPB 1Q4NX 1QMUA 1U91B 2XPGA 5KVFL 2J4WL 3F3HA 3L6FB 4JQIH 1T6BX 2P45B 2RAMA 2CUAA 1K8IB 3CHRA 1N59A 3GZPA 4F9LA 2XFGB 4J4PA 5I1AB 2PO6D 2B4CL 4JDTL 4N1EA 3GKWH 5I76B 2JJVA 5E9DB 1YUHA 4Q74A 2QQNH 2G3XA 2ZWKA 4I18C 3PUUA 4OLYH 4DHLA 4G7RB 1CGSL 2CA3A 2XN9A 4NENB 2DEYX 4NKIH 2XI9A 3MBXH 4YC2B 2R4SH 5MENA 4GXVL 1D2OA 5GS0H 4H1LG 4XO4A 1MFNA 2GTWB 5EU6A 2ZNXA 3ARFB 5ITBL 5BMFL 5F7DB 1X5LA 3QNYA 4XMWA 3PHSA 3AVEA 4XNUL 1AC0A 1YQVH 3NIGB 3TFKD 1MFEH 5DJ0B 3CIQA 3C60A 1TR7A 5L8JB 1HC1A 2MRYA 4F7KA 4XMKH 3BWAA 3SDYH 1RZQA 2JCCA 1HS6A 1F00I 1N6UA 1WT5A 2G9KA 4ZFOB 4AYGA 4R0LB 3JV6A 5A1AA 2HP4A 1AGFA 3ECUA 1ND0A 2NY6C 5J11C 3TZVC 5BS0E 5IIEA 2VM9A 3C6LB 3RY6C 4YZFF 4R8WL 5LNGA 2HAZA 4G2AA 3WTUA 3I9GH 1IIIA 5IK3A 3MMEB 1CFTA 4JM4H 3ATDA 4V1DB 4XVJL 3HOGA 1EMTH 1P84J 2R2HB 3N04A 3NTCL 4ZW8A 5JTWA 4FZEL 5ID1B 2YXFA 3EAKA 2IAMB 1SN5A 4XPTH 4QXTA 5MEND 5EU6D 2Y7MA 2AJSH 1LNUA 1UHVA 1YNLH 3FQXB 4N8VA 4JFQA 5D6DC 3QQ3A 3I6LE 4IHOB 3U4EA 3O41B 2GJ6A 2IPUK 1LDPH 1WSST 4R83A 3NBNA 4I5BA 3WFHA 5IR1B 4KJYA 3ET9F 1P4BH 4M43H 4ZAKA 3KYOB 3AU1A 4W4NA 1ZGLP 2BS71 1ZSHA 4L9LA 5TK2A 3UIZA 1P9MC 4LDCA 4M8QB 2FIKB 1PKQE 5DHVA 1LILA 2GVYA 4HH8A 4U7KA 3TCLA 5CJXA 4NKDB 1N7ML 3VDBA 3ARDC 4OIFA 5GZOA 2VDOH 2AXJA 3EOYG 4JY4B 1JG9A 2GG1A 5C0AA 2CRMA 3GMNB 5F7LB 2R2EA 2R29H 1V7NL 2RGSA 3BSZL 4ZO7A 1XAKA 4WQOA 3WAKA 3CAFA 1B0WA 5CWSB 4M1CC 5JHLH 3WN6A 2GJ6D 3FYEB 1WGVA 3D2TA 2C4XA 2VZUA 2AKRB 4Q52A 1XXDC 2XFXB 4BH8B 3EDKA 3V4LA 5F7YC 4KFZC 2ADFL 4DEPB 3HS0C 4KO7A 1RZ7L 2F53E 4ZAKD 5FYKL 3VGGA 1DBAL 1MJUH 2BDNL 3QI9B 4PD4J 5ESVB 5LBSH 3STLA 1CO1A 5KSBB 5E6IC 3GMLA 3OMIB 3I74A 4JO3L 3JV5A 2H26A 5CCKH 1A3LH 4I0PC 3K74B 4WWKB 2XV3A 1TSRA 4R90H 2ZOTA 1A6AA 1UB6A 1S5IH 2NR6C 2X0UA 4JRXB 4XOBA 4EAEA 3VH8A 1J9SA 3L3HA 4C8XA 1OB1B 4M7ZB 2QPSA 1SMAA 3V6ZA 1Q0EA 2RTTA 4JG9A 5KTEL 5E7FA 3L5WA 1DN2A 2NNFA 2Z65C 2V7HA 3HI6L 5IREA 1A4KB 2B20A 3N1GC 1AH1A 2BOLA 3DRTA 1UTDA 1WC7B 4AL8L 4ZUVB 1GSKA 3IFOA 2EIBA 4EI5C 3NIFE 1H8OA 4L8SA 1HWHB 3EGDA 3RLSA 4F8LA 2IC2A 4X6DE 5EIIG 3CVDA 5JHAA 3TN0D 2FWOB 5C0RL 1Q0XL 3VRIB 2GSIB 3U83A 5AW8B 1XDTT 5D7JA 3ABLB 2D8KA 1T03L 1DVSA 3ZUCA 1VFMA 1M71B 4DH2A 3N40P 3QGVA 4S0SD 4GS7B 4NS0A 1XIWA 5I66A 2F54A 1HWWA 3CSFA 4DWHA 2JKSA 3FTGB 2R0LL 3REWB 3ZE1E 2YEZA 2ZE0A 5HYIA 5L7XH 4LDLB 3CH8A 1JGVH 3TV3L 3WCYA 1WISA 1RHFA 4R7DA 3VU1A 4EIBA 1SQ2N 4Z5RB 1OIOA 1YN6A 1P7KA 5GSRA 3A5VA 3R7RA 5EU6E 3HE6D 1GJWA 1FL6B 1J0YA 2K0RA 4ODVH 3V8CA 3L4ZA 5B8CC 4OZIE 1MCFA 1Z2KA 4KQ0A 5EO1A 2DLTA 4XCNB 3HZ3A 4IMLB 1TVHA 2WLKA 4UQ2A 5HJBA 1P0SE 2SEBA 2OBGA 1ITCA 2ZUSA 1IQWH 1VDGA 3ETBF 4PP2B 2NSXA 4UB0H 2VH5L 4P59L 3JSSA 3VD3A 2YMOA 4G43A 1T5WB 1CICB 1I8MB 5JQ6L 2W95A 4WI9A 4JQVA 3FSOA 4YDIH 4PJGF 3IN0A 3MCLH 3FL7A 2AEIT 4YUEH 2HKHL 3PIQA 5T1DL 1AQDB 3ULAB 4PP1D 3AREC 5DJ8B 1F90L 2WWKO 1NGQL 3AXLA 2EC8A 5DD0L 1MIEL 2G5RA 3V0JA 5EU7E 1SYVB 4DPCX 2M8XA 4QJ5B 1E9QA 5DFTA 2D7QA 4B53A 1S9KC 5IHBA 1VKXA 1L9NA 1H3TA 3B3BA 2AEWA 2VW7A 3HN5A 3PWVB 4ZUTB 1NJ9B 3MJ8B 3P73B 5DHMC 4CU6A 3IMRA 3DUUA 4P3DB 1RZKL 4MQXD 3U0TA 1QUNA 2UZIH 5J9PB 3FCGA 4XMTA 2PWHA 3A22A 4O02B 2EO1A 1P5UA 4KU1A 1NGWA 1AXTL 4RGOH 2A74B 4KX7A 4KZDL 4JHVA 3IBEA 3GO1L 2OV0A 1Z0NA 4Q2ZA 2DWDA 2F8OA 4Q9CA 3BX7C 1QFWL 5CLXA 3D09A 4OJEH 4Y4HA 1CD9B 2OYKA 5EZIL 3HN3A 5H37G 3V4VB 3SBPA 1UT2A 3LKQB 4YK4C 1HAWA 1IVLA 4K9EL 4LEOA 1KZQA 1N70A 1HHIB 1E6OH 5MEPB 3NK4A 5DMIH 3IGAA 5IQLA 3QJVB 4ODSH 1DVZA 3N44F 1E65A 4UT6L 4M7LL 4GRLB 4G83A 4GLRI 4RWYL 1G4MA 3LKOA 4I48A 3L1OH 1RJYB 4U7SA 3QC5X 4YSUA 1WP6A 3DGCR 1WITA 1YMMB 3AITA 4MNGA 4TSCL 3FRUB 1ZLUK 3S35H 4P2CG 2EDEA 3D2UB 2B5IB 4JO1L 1DQQB 1W6WA 4WU7B 1W0WA 3OB0H 4IKLA 2PXYC 2NY0B 5BOJA 5DJZA 3G5ZB 3NJLA 4J3XA 3GSNL 4A7QA 3BKYH 4J3WA 3JZ7A 1UWXK 1N3NA 4CW1A 3F7QA 4Y4HD 4MS8C 1QKZH 3C5JA 5LXGH 2IGFL 4NT6B 2DW5A 2PWFA 2OMZB 5IB1A 4EXKA 3GMQA 2LLNA 4HMCA 4FJYA 1AOHA 4PJ7E 3SPGA 3WEXB 3AWGA 2O4EA 5EBLA 5ESAA 3VXMA 5AVRB 1K5WA 1WZ1L 3LCYA 3T2NH 1AGEA 5CCJA 3EYQC 3H6JA 1RZJH 1QO3B 4P0DA 3M8OH 4PB9L 2X4PA 1GZHC 5JIPA 4KI1A 1NUNB 3WJJC 3VFSB 4H8HA 4WKZB 3WFDL 1KBBA 3MRLB 2HT3C 3MUGA 5DRZA 2WXHA 3F8UB 5KAQG 3H3KA 5IBLD 4GQRA 4J3OF 4QTFA 3QJFB 5FCSH 1UZ8B 1HK6A 1DJHA 1G7QB 1CWVA 3GS4A 1AQKL 3QFJB 4KPHH 4G8GB 1MIMH 1VENA 4IU2B 5EO9B 1A6UH 1HINH 3NJNA 2ZCLH 4YPGB 1TTGA 2IH9A 1DSYA 4FNRA 3SYOA 2V5MA 2IDTA 2V3DA 3DA0A 4KNSA 3IFNL 2CK0L 2XBDA 4OD3L 4GI8A 4IM8A 2MSPA 4IIQC 3ZHDA 4B50A 2ZAGA 1ZCRA 2F5AL 2FUQA 1S78C 4QXVA 1Z9MA 3VXSA 3WSQH 1LE5B 3NZ8B 4YSDA 3PF2A 3MLUL 1UOKA 5G2NA 3VX1A 1BQKA 4TF4A 4DN4H 4GEIA 2CLRB 2AW2A 1IGTA 5KBPA 1YAZA 4HUMB 5DTFA 3K0WA 4MMYB 1S3RA 1JI2A 3DOIA 3O6KH 2IANB 4P4RB 1RURH 3QQDA 4F3FB 5C0EB 3IKKA 2UWEF 1RZ8B 5B3JE 3GBLA 3RZCA 5FDWB 5AVWB 2QL1A 5DC4B 3SDXA 1XB3A 1GHFL 2BXZA 2FBJL 2P80D 4WO4A 3PGDA 3UYOD 3PWLB 4A1RA 1K5NA 2R1XA 4P5TC 1MRFL 3E2HC 5CGBA 3JVGA 2WQRA 3SEPA 1NANI 3JWOH 4E9LA 1RZJC 4Y9FA 1R0AL 4HFWB 3K2KA 1V3MA 3KYNA 2IFFH 3TJPA 5C71A 2WJ5A 2BSDA 2Y36L 4FOMA 4RRPM 4CVXB 4PW9A 4JKKA 4HULB 2D03H 4GKNA 2R0KH 8CGTA 2VE6B 4DERA 4XP9L 5G5DB 4QNPE 3X1GA 2OMTB 1RK0A 2MCG1 1RV6X 4H1LB 3ILQD 3OHXA 2DB8A 1CLYH 4J1UA 1BM3L 1NTDA 2DD8L 3MRQB 4NJAH 4GG8A 3WGVB 2EIKB 4E0RA 1LVEA 5K9QI 4N22A 3X13A 32C2A 3OKYA 4WCYL 2UY6A 2Z35B 4V11A 2VL5B 3OKEA 4XBMA 1KXTA 1HDMB 4FQJL 4LL4A 1Q90A 3B2MA 4ZS7L 3CSPA 2X3BA 2JB6A 3VXRD 4Z3EA 1AYOA 5BZDB 4YEEA 1WAEA 8PAZA 4WO4D 4L9DA 1AAJA 4HWZB 2CLZB 2XWTA 1R5WA 2TSAA 3D8MA 3REVB 1BX2A 5AFAA 2JTDA 1QLRA 2LR4A 4NHCH 1PVHA 1SUJA 3T0DA 5JDSB 4L8DA 4PRIA 4WW2C 1BCIA 4X9IA 3WHXB 2C5DC 2WBJB 4OCRL 1F18A 2VDLB 4KKNA 4JM2A 2DL2A 3T4YB 5DWUL 1KBGH 5DZJA 2CMRH 1IBDA 3FAXA 3MN8A 4U1KB 5CJBA 1GYVA 4PGDB 5CMAA 1N0LA 1SF3A 1UD8A 1ZT7B 4XN1A 3WEMA 4QXGL 4QIRA 4F8NA 3IBOA 1MH5A 3BWZA 3IGFA 4X5WA 4J8RA 5IV2A 2VCOA 1WA2X 4PGCB 2YMXH 4IJ3C 4NQDB 2E7MA 3SPVB 1HHGA 3ULUF 3PABB 4CN1A 4DFIA 2EYSA 4YBQC 1BOGA 2I69A 3BOVA 3F7VB 3T6ZA 4Y2OB 4ZYKB 4WNSA 3JWOC 5FEBA 1JDDA 1XGYL 3DLQR 5D4HA 1W72L 3DXAA 4GQQA 5CZVL 4JFOA 1QYGH 1I8IB 3VWKA 4GG6B 4TQIA 2YWZA 3HE7C 2EEBA 3V5DB 4JCWA 2QVTA 4PRID 1I1AC 2QV4A 5I75C 3ULSA 5HTSA 4LSUH 4XBEL 4WRLA 2YGVA 3N40F 1QWNA 5JOEA 1U8CA 1OSPL 3AT8A 3C08L 4X4MA 4IK6A 5IB3B 2WPGA 1JNLH 3T6QC 3QEQA 4ZMPA 5B4MC 4FFZH 4NN7B 3ZMNA 1KJMA 3STZB 2N01B 4FQCL 5A2AA 4C56D 2EDDA 2WW8A 4RGND 1DJZA 1MCOH 1T2QL 2B14A 1FAKT 1OF0A 1PLAA 4QAWA 1NC4A 3PAUA 4FKHA 3PHOB 4BE5A 4IDJL 2DF3A 3MNMA 2Z1PA 5GS3A 1QSZA 1RUQL 1E4KA 2EVHA 1EEUA 5T1JA 4X8CA 5AALA 3BDYL 2GFBB 2OA9A 2EO7A 2VRQA 1I9RH 2OR9L 5JW3H 4AGMA 3NFNB 4LVHC 3SE4A 4Z7WE 3OZKA 4WY7H 2VLLA 1YDPA 4GW1B 3O3BA 1WEJL 4PVBA 1KXVC 1CGVA 4N5ED 4IMKA 2ATAA 4KK9C 3MRBB 1ZTXE 2R56H 4GIOA 4DOHB 4YHPA 4A55A 1RSYA 3QEQD 4TQ8A 3UC0L 4Q56A 5J1AA 1BQHA 4HOZA 3BPLB 2WYHA 2FUTA 3KW7A 4JFYA 2YPLB 2RIKA 2CLVA 5D2LA 3VRJA 1A1MB 2EQDA 5I5IA 5AKSA 4A2HA 1NC4D 3BEVA 3BT2H 1QLEB 4PJHA 5DEGB 3VFVB 5DMGD 2XACC 4WTXA 5D1QB 2GUOA 2KZBA 5DO2D 3TBWA 3O3DB 5DR5H 5DEFA 1JHTB 2J43A 4WEMB 4KKAC 3VXRE 5EEZA 1NCJA 4GSRA 3IJSB 3NMEA 1FUNA 3IMWA 1OOAA 3MLRH 2XWXA 2VDML 4NPYB 1BFVL 3TBSB 2NT1A 1PZ5B 3CFKA 4CVWA 6PCYA 4YE0A 4JPVL 5F9OL 3L7FB 4HU8A 3CSGA 4QRTB 2C9XA 3PY9A 1VHPA 4OM0L 3ZMEA 4ZFZA 3TESA 2VR3A 3SE8L 2F8XC 4KDWA 2ZUYA 4NI3A 4PN6A 4AYEC 1JTTA 5FGCB 1IE5A 4KNUA 3LZOA 1U8KA 5IQ7H 4MXQD 1E50A 1OM3H 3WG7B 4RSYA 5E2TH 2E7CA 2HKFL 2JKLA 2XKNB 4GRWB 4KKBC 4OJCA 3OGCB 5FCUL 4XVTH 4EOWH 5KSAC 3RWEB 4PCTA 1CFQB 4ZPTA 1JYVA 3Q5OA 1FDLL 1Y6KR 4P3CH 2MOGA 1WH0A 1UXMA 1EQWA 2FH8A 4PYHA 5DDHB 3DIVA 1JUFA 3FT2A 2C3HA 5A2IH 5L9DH 4RDQF 4H5SA 5JA9A 1MKFA 3NSYA 3QUKA 3K6IA 5DEJA 4AYDC 1X5JA 2JIXB 4BXSV 3F6LA 3VFUA 1EJOH 3FOMA 3QUHA 1YEIL 2D7TH 4FADA 4GBXD 1M4KA 3S5LA 3EJYD 1GMIA 3S8FB 2L7EA 4WNQB 5FF6B 1TZIB 2ORBH 1XCWA 3QEHB 1R3IL 3BPOB 1J1OH 1PPIA 3ULVL 2QPEB 4F58H 4HC1L 1TTBA 2AXGB 3IU4H 3MUHL 5EN2B 5E8DH 4W6YB 3UZQB 2VXVL 5EU5B 3VCLB 1BYNA 4ZX5A 2Y25A 1HESA 1QEWB 4RGNE 1CTNA 4V33A 4PG9B 3SPHA 4C56E 5K9OA 5KVMC 2E47A 4G6MH 2Q3XA 3EJZD 3FB8B 2F1BA 3D30A 3MUUA 3N0AA 5AVVB 2R27A 4HS6B 3FN0H 4XI5D 4YR6A 4DKFL 2ROXA 4FQLL 4WEEA 3CDGB 5KVFH 2ZOKB 4N0UE 5C3IA 5CJQL 3VQLA 3OXRA 2ZXCA 1KF9B 4JDTH 35C8L 4CC0A 5ACZA 1D6VL 1WIPA 1ETB1 1EEYA 3O8XA 5TE6L 1ASPA 1E4WH 3GRWA 1TZHB 4ZFGL 2ITDA 2VAAA 3ZDYF 4PS8A 1CGSH 3WIFB 4FXTA 1G87A 3FRPG 4GXVH 3U7YH 3HG1A 3OD3A 3TBYB 2X4OA 3C5ZB 2IO5A 3N9GL 5ITBH 2B77A 5BMFH 4BBWA 5BVPH 4X4ME 3B2DC 2BSSB 3QEQE 4PCYA 1KBPA 4LLDA 3O2DA 4LQFL 4XNUH 2X2HA 4JG1L 2YSSA 2ZG1A 4I88A 3VSUA 1I7TB 3BRGC 3OLEA 1P4IL 2L7JA 2AHIA 1U8JA 1OAYL 4XNMB 1FNLA 2Z0BA 4WV1B 4JPSA 2JJWA 3F12B 5HYJB 5B38G 1AHWA 2A73B 3NCWA 4F9PA 1SJEA 3UDWA 3WMQA 4NLAA 3Q2LA 4M62L 1T83A 3T0AA 4HOWA 4R8WH 1MLCB 1RUML 3KPPB 1R75A 4LVOB 4M29A 1U3HC 3GJFB 3IE4A 3IDIB 2VIRB 4PJDE 1F6AB 4H0HB 5FYJU 2EZ0C 2PCFA 4XVJH 4D3CL 5AG9A 1CGXA 2D9CA 3O8XD 1IM9B 3NTCH 4FZEH 2D2CC 4JPKL 4RNRB 1G6RA 4BRJA 5GGRA 1G7LB 2J44A 4R2GD 1A21A 1E3ZA 2VR5A 3NH7L 2JB5L 2NQDA 1R5VA 4K9JA 3SE9L 3B3IA 3MHZA 4HS8H 3X12B 1PDKA 1L5GB 1HZKA 3H4HA 3GSRB 1ZWIB 3SGDH 3OPZL 4YIQA 3U30C 4MDJA 3G5YA 5D7LB 1FNFA 4R7LA 1NGZA 1IKFL 5DC2A 5GGQL 2MJWA 4MMXA 5HVGB 4PREB 4Y2DA 2D3VA 2DKUA 2ZWNA 3VFOA 1BZ8A 2XNAB 3OAUL 4JGUA 1UZ6E 2J7LA 4PJHE 2B4CC 4XAKD 1PG7W 4UM9B 1QG3A 1S5HA 4WJG3 4P05A 1CT8B 3DYOA 1LO2L 1N7MH 4N0RA 5FKPA 3IJEB 3GS0A 4PTUA 3F7YB 4F1SA 5E95B 1AZRA 1R1CA 1TQCB 1UVQA 5D7IB 5K9JL 4PGBB 2I60L 2YHGA 3KLQA 3MSPA 4ZX4A 4HF5H 3KJ4B 4ELKB 3FT4B 5FW6A 5K59F 4PRHA 5BV7L 1NFIB 1MHCA 3BSZH 4FNPA 5DFVC 5F88A 2WUBL 1KGJA 4Q6IA 4XNQB 5D7EA 1NKGA 3UTSA 3WOVA 1HL5A 2WY3B 4DKAA 3ROLB 3ECWA 1S7TA 4ICXA 4KZCA 1X9LA 2NY2C 2BNRB 1MHEA 2R69L 4UNIA 2ADFH 4P06A 4ACPA 1HX0A 3EXJA 1FIGH 2ZWSA 1G7PB 2C1OA 5FYKH 2APSA 2BDNH 4OVVA 2XWJB 4AI7A 2E74C 3KPRD 4JO3H 1TYJA 4FE9A 1I3GL 2WKLA 4N0YL 2JELL 1X4XA 2GIYA 3G6JB 3SKJL 4HIHA 3L2MA 3MLZL 2HTLD 3HG2A 1IV8A 2H8PA 2EXYC 2LW3A 1P84K 2NNRA 1X5FA 4P57A 3B37A 3SDCA 4KRPB 4PIRF 5AVUB 1JD9A 4R4NC 5KTEH 1TYEB 4K8RD 3P54A 4PRHD 2E5EA 4XN2A 4DZBA 4MJ6A 5I8EA 1KDIA 4MYPA 3HI6H 3WNLA 4ZMWA 3KWWB 3UTSD 4FNQA 4EO5A 1BF5A 5FUZL 4Y19A 1W91A 4IRZA 1QTSA 1CDIA 1XGQA 4AL8H 2BVTA 1TCMA 3EJTA 1KPRB 1O7SA 1P53A 4LCUA 4MAYC 4YSEA 4GAJL 5DUBA 4IHBA 5AW0B 1DJWA 1PD1A 1U58A 1WAAE 2R1WB 2AXFA 3TV8A 5C0RH 4W1TA 5PCYA 2ZQKA 2H7WA 5KVGE 3RWHA 1DCEA 1MVYA 1KTJA 4YDZA 3T0EC 2CQVA 1VSCA 3R0NA 1MVUA 2XSKA 5T3XL 2VXQA 1CYXA 4PRBB 5H35B 3SE3C 3NSCA 1A9EA 3KWVA 4JFFD 4N2OA 1FZMB 5FM5O 3S37L 5C3LD 4HFUL 1IL1B 3TJHD 4CVUA 1UXSB 2R0LH 3RUGB 1E8YA 5FYKE 3H7BB 4F7EB 4JM0A 4YOKA 3TV3H 4OCYL 5F89A 1NUDA 4GUPA 3E6HA 4LF3A 4HAGA 3SJVA 3LOWA 4M1GL 4C57C 4QWWD 1PZBA 1DR9A 1N19A 5C86A 4WGWB 2G4EA 2A9DA 2YXMA 2ZOLB 4UZUA 4NNXA 3MYZA 4Y19D 3PWUB 1H3XA 1XEDA 2H41A 2OTUB 1UQSB 1UURA 2AMGA 3DI3B 1I8AA 3P30L 4KDVA 1BVZA 4U1HA 5GISL 3V6FB 4DP9X 1F4WL 5ADOL 2QFPA 1E30A 5F2FA 3WFBL 3UTQA 3LRKA 4POZD 3ZE0F 3LXCA 2DEXX 4G70B 4YO0A 3W0WB 1CDCA 4X4XA 5E51A 4PD4K 3A67L 4BH7A 1CIUA 2VH5H 4P59H 2YAFA 1JWUB 2Y72A 4LGSB 4XAKE 2HN7A 3C8KA 4K8RH 4RMSA 5KN5B 3BP7B 3E6FB 5JQ6H 2X6VA 2OW6A 4HXBL 7TAAA 2LLGA 5DJ2A 3ESMA 4MQ7A 3BAWA 5EBWA 4OVUA 3NSJA 3P77A 1IM3A 2HKHH 4K15A 5T1DH 3GZQA 1F90H 3MRHA 1NGQH 4E42B 3SJVD 2GJJA 5EEUA 2OYPA 5E24E 4AL8C 5DD0H 1J8HB 1MIEH 3ILPB 4Q9QL 3C75A 3L08A 3GLAA 4PJFE 1LE9A 4PTTA 2H2PC 4H44C 5AENA 2J73A 3LKSA 3DRQA 3FFOA 1EHKB 4HCFA 5CHNA 4H8UA 1MG3C 1RZKH 4Y1AA 2X3CA 5F7UA 1ZV2A 3BZ4A 3Q8AA 4JDVA 4N2BA 4FLHA 2J8HA 3ES6A 1I4FB 5HI4C 2XY1A 4HALA 3SBRA 1AXTH 3KPRE 4ZQTA 4CL7A 1NIBA 4KZDH 2C9SA 5D1ZD 1IX2A 2NY5L 2V2XB 3GO1H 3QB7C 5IHUH 2VTFA 4MCYB 4JE4B 3ME0A 4MKMA 4XWOD 1MNNA 4F1ZA 4HCRA 5EZIH 1MCLA 4NYLA 5E4OA 2PCPB 3LPOA 2QQLL 1TUPA 4K9EH 5IVZA 2CO7A 2E7LA 4PIBA 5I17B 5CIPA 3DGDA 4KK6D 2IWFA 2UYLB 4YN3A 4P23B 5EZJB 1CD1A 1XB8A 4Y7OC 1FCGA 3Q6FB 4PRHE 2I27N 2GIXA 3EYVA 3V55A 4UT6H 4KZ0A 4NP9A 4M7LH 4L4TA 2FWLB 4RWYH 3KLKA 3MLVL 1KIUB 2VR8A 3PCYA 1KB5A 2HFFB 3UTSE 4TSCH 4QRUA 3HPLA 2GTQA 1VLXA 3QNXA 3ZTDC 4JO1H 3FT1A 4GIAA 1JERA 1R3JA 3NDYE 4NI6A 3UMTA 4Y1AD 3TBCA 1Q9WB 4BWWA 4WUUB 2BSTA 1KLUA 1UA7A 2X7LA 1WGOA 3U82B 1WA0X 3GSNH 2L7UA 3EUDA 1QSFB 5KSVA 2B2XL 3DYMA 3WKNA 2QPDB 2ZCHL 2NCMA 1XFPA 4LP8A 4U4BA 2IGFH 2RBLA 4JFFE 4L4JA 5I1GL 2YBRA 4HPYH 5GJSL 3EOAB 3QXDA 3QUXB 4PJAE 1OQOA 4MCMA 1BP3B 5I1EL 4WTWA 3GSXA 5HI3C 1WZ1H 5KJ7E 2JI3A 5D1XB 4ZPVA 1EXUB 3VWJA 3BMWA 1FFPA 4PB9H 1L6PA 3C8DA 4WTZG 1CVSC 4QGTA 5TF1L 3QULB 1WFJA 1JHLL 3WFDH 3I6GA 1BMGA 4RFEA 2RD0A 3L4UA 5J5EA 3TPKA 5CCGE 4JBSA 1UD4A 2QPUA 4HUKB 4U6VL 1VFAA 2ED9A 3AM8C 3Q6GL 3QR0A 3V0GA 2WTOA 1J05A 2OXHA 2MQ0A 2GBVA 2WVVA 1AQKH 5ILTL 5LCVH 3ZR5A 3THML 3EO0B 4PRDA 4E9YA 3W37A 2PYFB 4HKJA 4K9EC 1EFXA 1YNKL 3CU1A 4RMQA 1DVFB 1X5ZA 1GR7A 3MJWA 1NGPL 1YPZB 3VG9B 3LDBC 3BHBA 2KDGA 3EZJB 5E8NB 2SODB 1K4CB 3VDAA 2VGLM 2JKXA 4MD5A 1HU8A 3HUJE 1JGEB 2XIIA 2CK0H 3K2IA 4OD3H 1BA9A 2HKAA 3MBED 4B3EA 3KHOA 2F5AH 4KVNL 4KX9A 1S9XB 3RJDA 1ZV9A 4ATTA 3SJVE 4ZFFA 5JUEH 4AQ1B 3VWJD 1U8NA 3MLUH 4G72B 3L3KA 1EGJA 2J88L 5F7AA 5ID0B 3NFSL 5HDRA 4A6YL 3GMMA 4APQC 3WU1A 2H32B 3IE9A 4NQCB 3HHSA 5EULV 4NQXB 2FSEA 2ZYHA 2XPYA 4BZ2L 5EZLA 2QSVA 4QRRD 5IBUG 1XGTB 3JXAA 2ED8A 4E41B 2J5LB 5DD5L 2EUZA 3RKDC 2DQMA 3KCWA 2CPUA 1H5BA 4FLQA 4ODUA 5ABZA 4JZOB 1I8KA 3P02A 2H1XA 4AM0A 2X0VA 3FHQA 1GHFH 2WV3A 2FBJH 3PLYA 3LY6A 2OPCA 1CU4L 1ZRUA 2YUVA 1AY1L 4PV9B 3SHSA 1MRFH 2Z93A 1HJBC 4HIIA 1WFNA 1ET8A 1PG7L 3T0WA 2X1PA 1UOLA 2LFGA 2VWEE 4PJEB 4CBPA 1TTRA 1ZKAA 4O9HL 2Y36H 2ZXDA 3GLZA 4N9GA 1S3KL 1NLDH 1ZLEA 2F0CA 2Z31A 4X6FA 4YZFE 3D50A 4XP9H 1PLCA 5BZWA 1U8QB 3QUYA 3UYPB 3TVMC 3EDFA 5IM7B 1UGNA 1WBZA 3MRGB 1CLCA 4KRLB 1UFGA 1IGIL 1BM3H 2DD8H 2W9EL 4P2RB 4RZKA 2QR0A 1KZYA 5C2BH 2KC0A 2QELA 5GS2H 1FO0A 3UAJC 1L9QA 4HJJL 2CO6B 3JTBA 4PGEA 2NY1D 4NNYB 1U8HB 4V2BA 4Y1AE 3B83A 1L9RA 2P5WA 5CLTA 2OSLA 2XDHA 1ZSDA 4Z7NB 1YY9C 3L17A 5D6CA 4UMSA 4FQJH 3F62A 2BERA 4RA3A 4Y16A 4YHLL 3GUTA 5DS8A 3LJ3A 2Z6FA 4ZS7H 1CR9L 4RAUB 2XU9A 1J1PL 2VITA 5F1OB 3I75A 4UNUA 5EG6C 4OU3A 2J2ZA 5E1GA 4EXPX 4X42A 3T9WA 1WD9A 1HEZB 4IQHA 4M61A 1ILSA 5HYSA 4OUUA 2EACA 1MWAB 2WNXA 2X4SA 4IGBC 3HA0A 1J18A 3Q8FA 5I0ZA 3FTZA 1U4FA 1D7BA 2UZYB 4JFVA 1JZGA 3A4EA 2QDWA 4P2OD 4L8CB 2Z31D 2CGZA 3FULA 2EKSB 3R4RA 3CFDA 1NH6A 4NGHL 5E5UB 3CN0A 2X88A 1UB5B 1AHKA 3VFMA 3FOLB 4KXZI 4C83A 4QXGH 2PWDA 1J9QA 2FIRT 4B9PA 3QH3A 4L3CB 1ZK9A 4X50A 1WV7T 4UT9L 4NM4L 3LKPB 4Z8FL 2P5WD 3LS5L 3SY0B 3BJLA 3DIDA 4OZFB 4XE5B 3D7PA 1FFOA 1LO0L 4Y16D 1AG0A 3I9IA 4MNHB 3QPQD 5HI5D 1TJGL 3WELA 4F80A 5IOKA 2NSMA 3ASOB 4EI6B 3V0IA 4AZ8B 1XGYH 4BGLA 1R3LB 1W72H 1XSJA 2D9QB 4FQHA 1I9EA 4OFVA 5CZVH 2VQUA 3P2DA 1AIZA 4BEIA 3FMGH 3FU7B 4TUOB 5GGSA 3RL2B 4G7VL 4JANA 3MRDB 3F64A 1TKWA 3RGVA 5HDOA 2J6WA 1OOWA 2KQMA 3C2SA 1P4UA 5TDOB 2YAHA 3O9WC 4XBEH 4I4WB 4LKCB 4RCAA 4APXA 1OSPH 3C08H 1OGSA 4AV5A 4H7VA 3WLWD 5CGYD 3B7TA 1AR1C 4PLKC 2C4FT 2XBTA 4ANXA 4FQCH 1ZXQA 2IBGA 3FQ1A 2HA1A 3PL6B 3AZUA 3P4NB 1G84A 1T2QH 2YQBA 1T80A 4Y5YA 4QRRE 2AFNA 1L0YA 2PPCA 3KGRA 4C58B 3D0LB 3QDGB 2ALAA 3S3SA 2DWTA 3EGSB 5FA4B 2J8UB 5JW4N 4IDJH 4O02L 2NY4D 3F5WB 1M7IA 1Z7JA 4HLZH 1L6XA 3HS8A 5DUML 4Y4KD 1RUQH 1D5XB 1KPUA 2A9ML 2MFNA 3N1FC 3VFNB 1ZA6A 5C8JA 3H85A 3BDYH 4LEEA 1HE8A 1SMOA 2OR9H 4RGMB 5CBAA 1BF2A 2JJSA 2D2OA 5GRZA 2GJZA 2ICEA 3BUDA 5DXWA 3MO1B 5EU4B 2X70B 1MCBA 1ACCA 3OAYH 2FNBA 1ZMYA 3V5KB 1TCRB 5C97A 3BUIA 1WEJH 1IZKA 2N7SA 3D4GA 3FUMA 3OSVA 3B9DA 5IB4B 3RFZB 1S9WB 3RVXD 3QORA 1FF5A 3DX8A 2MTPA 2A9NL 1S9YA 4LCCC 1L9SA 3UC0H 2VLMD 4U1IA 4YFLI 2HSIA 5ACLA 2L0DA 5D7SL 4ZQKB 3DDGA 3ECQA 4ZO8A 2P43B 3MRKB 5FO9A 2IH8A 4FQXC 5K93A 5FXCH 1NAMA 4BK5C 5I82A 1J8RA 1FG2B 2BHZA 3L95A 1RZIB 3D3VB 3ZKND 2B16A 1UD3A 2KDYA 4PWFA 2XTSA 5LBVA 3UZEA 4TVPD 4LOVA 5E4AA 1XBRA 1AKJB 1L9OA 4G1EA 5TE4H 4MQSB 1B3IA 1F45A 1U41A 3OKDA 4EN3A 2R2BA 4WDIB 4HJTA 3P3YA 5EUKA 3VXNB 1D3CA 4XODA 2UWEA 1HHJA 4ODWA 1BFVH 3R06B 1JF1B 1CDYA 5D5ME 1W8EA 4BSVB 5HHOA 4LSTH 2GUYA 5T33L 5F9OH 2IOOA 4JPVH 2P1YA 3QORD 1AC6A 5CJOH 4OM0H 4G82A 4PJGE 5I1DA 4JQXA 2AK4E 3K8LA 1XX9C 1ZGLA 3K71B 5ADPL 4CBZA 2IPKB 2PTTA 3PFQA 5I6NA 3DURA 4QRBA 2HKFH 1UD6A 1DCLA 5JA8B 1FDLH 3TO4C 2X1XR 4AVKA 3DVNB 3VRLE 4OBRA 4EKXA 1RJLB 4F7MA 1IC4L 5FB8A 4LESA 5C6PB 4HGWA 3RTQC 1OHQA 3WJMA 1M1XB 3CV5A 3OR6A 3V0FA 3NJGA 5AYUL 2WP3T 3DX9B 1F8TL 4O5LL 4XN8A 3D25A 5D55A 4EN3D 4LIQL 4PR5B 4TXVB 5I24A 5HGHA 1W9XA 3CZFB 3L3IB 3PJSB 3VI3E 2LE9A 2JXMB 2CGRL 1YEIH 4NOFA 3CSBA 2BH0A 3QO0B 5KANG 4XOCA 1SJVA 3FCTB 1S7XB 5C3TA 3DMMA 5BRZE 5AG8A 4I89A 1KXHA 2NMSA 3LN9A 3ZYJA 2P5EA 3ULVH 5D4JA 4HC1H 1J86A 3QUZC 1NKOA 3RJOA 3A6CL 2VXVH 3FUDA 3CSYA 1SXNA 3VFRB 3UIYA 2WYIA 1KJVA 4RA0C 3GRWL 3OG6B 4NC0B 5JPMA 1JVLA 3MZGB 1WAPA 2MEJB 3NG5A 1CLOL 4ZUUB 4D9LL 2AAAA 4DKFH 4FQLH 1TQBC 3QDHA 3Q48A 5CJQH 4J23A 4EUPA 1Q9OA 2EIJB 35C8H 4AMXA 1UA3A 1D6VH 1HQ4A 4JFDD 3LV3B 1YEHL 2K4WA 3H9HA 1I7RA 3BZDA 4D7PA 1AQMA 4KH9A 4ZFGH 3TIEB 3MNWB 3OWRA 1F42A 1HXYA 3PQYB 3ARGB 4LPXA 4FHKA 4HX1A 3CHOA 1USQA 2BVPB 1YC8A 4ZT1A 2MQCA 5JO5A 4QCIA 5L2KB 4NO2A 4NUQA 3P1VA 3N9GH 5E08L 4AYMC 5JXEA 1NDGB 3RU8L 1VCBC 2P5ED 2LU5A 4TS6A 1CF8L 5C9JA 4LQFH 3CLWA 5DJCA 3FO2B 4HD9A 4XZUA 5IB2B 5ELIA 2V7NB 5CEYA 1XMEB 4I18B 3EG9B 4XMPH 4PJ9D 1JCVA 1OAYH 2B7DT 4H4NA 4QUOA 2E4FA 4ZW6A 3SD5A 1OM9A 4PJXE 4ETYA 1JHKH 3KR3L 2PW2B 3TCTA 5J8OA 3SDAA 3BFQG 5KAQF 3RVTC 4TVPE 4Z95L 4XNDA 4PS7A 1QFOA 1XF2B 1BXUA 4M62H 3ZIYA 3FUIA 2FH6A 2YJQA 5IW3A 4KQ4L 1OCWL 3JV4A 4Y5VC 3WENA 1G94A 4OF6A 1IC1A 3A6BL 5D93C 4KNTA 4D3CH 3FSAA 4NQUA 3DOSA 3RVUD 5FLUA 3ULUD 3QXUA 4JPKH 5B22A 3DJZA 4XX1G 2ADGB 3T4AC 3FYIB 2DN7A 2WLIA 2DJMA 5T1MB 2DY2A 1OP5H 3NH7H 2JB5H 1FVDA 2NY6B 4J4PC 3ULVC 5J11B 5CJ5A 5DHVH 3SE9H 5JXED 2NUPA 3PNWB 4BA0A 4JPQA 3GTNA 1JGDA 2OK0L 4LNRB 1QQDA 1ES0B 2V9RA 3OPZH 3UL4A 5HVHC 4I87A 1JZ4A 2FX7H 1G1CA 3KEDA 1PLBA 1IKFH 1NKRA 2GITA 5GGQH 4XTRD 4G9DB 1NCHA 3IWVA 1ZLWH 4XB3A 3OAUH 3Q3GA 4YEFA 4H0LC 5HYQA 2JFCA 2V9TA 4MGXA 2IDUA 4RFNC 2UXFA 3C60C 4PJ8C 4OF8A 3H2WA 1KULA 1P7HL 4HUVB 2UX6A 3QFDA 3UEZA 2Y3AA 3G6JF 4O00A 1LO2H 4JFUA 3RWDB 4MRBA 1WT5C 5BUPA 4P4KA 1CXLA 2DYPB 5ETUB 1CFBA 1THAA 4ELMF 4PJ5A 2F1AA 5K9JH 2I60H 4LEXL 5BV7H 4Q6YA 3ZHLA 3IVKB 2WUBH 1XGRB 2VLRB 2HFTA 1DBKL 3MRCB 3UTTB 1WZAA 2WGXA 3POCA 4HDIA 2X9XA 2O6FA 1OT2A 3DX3A 3ARDB 1AGDB 5KZCD 2D31B 4XP5L 4ZRGA 2R69H 2DIAA 2YKLL 2KZ1B 1AZUA 2OQJB 2XOTA 4UOJA 3QDMB 3QG6B 5K39A 2JKWA 4MXVE 5JZ7D 1AGCB 4RWHA 3NRPA 1XZWA 1WFOA 3LB6D 3MV7B 2KPWA 2DM4A 4MMZC 1I3GH 2BVUA 4N0YH 2JELH 3SKJH 1YSOA 1BIIA 3GXIA 4IRZL 5K9KA 1P5VA 1N8OE 4OFDA 1SFHA 3VXTB 1FL5B 3EF4A 1LK3L 2FO4B 4YH6A 5K69A 4JFDE 1WHOA 4N0CD 4L9LC 2O61A 1NCAL 1U91A 5E6IB 5CJXC 5BUAA 1K8IA 5GZOC 4I0PB 2VXQL 4DP6X 4KDTC 5DYOB 5FUZH 5I76A 3CHXA 2P5EE 4G6FD 5JHDB 2DBJA 2LAGB 3BRDA 4GAJH 1SPDA 3K6OA 5F71A 2CK2A 1X7QA 3CBKB 3H0TB 5HGAB 5SWQA 3CVHH 5HP5A 1DVTA 2VC2B 3VSQA 3BIAX 2ZX9A 5CKGA 1O6SA 2Q8BL 1DE4A 1V10A 2JSFA 4XHJD 4BKTC 5BXFB 5T3XH 4UOQA 2B0SL 3OJVC 4HJUA 3RYMA 4C47A 5CD5C 5IW1A 5F7FA 3ESUF 3GD1C 4LCWA 2OSXA 3S37H 4HFUH 1O7DC 3WS6A 4BM7A 3CXDL 1DL7L 1IGML 3EBHA 2FEDD 2ODHA 1V27A 4EPSA 3O6LL 4JPIA 4S0TD 5INDA 1QLFA 1M05A 5JW5B 4M1GH 2OMUA 2VDOB 4QOKB 1GAFL 3JTSA 4LLAA 4R97C 2B1HL 3MMEA 1KC5L 3QIUB 5E9DD 2C9UA 3RPIA 2X4NB 4NIKB 1ORQB 2P48B 5F70A 2P4AB 3O6FA 5GISH 1JXDA 3OKOA 5ADOH 1F4WH 5EEWA 3C9NB 3T77A 3WFBH 4ENEC 1OARL 3M88A 3T08A 5J4MA 2J6EA 4NCDA 2ATPA 2OMYA 3FQXA 1N9PA 4URTB 1NBVL 1B6DA 4P99A 5LO7A 1N68A 4L8SC 2E3VA 1B3JA 4HXBH 3FTXA 5IR1A 3QRBA 4W9LC 1P4LB 1S7RB 2J21A 1J11A 3CFBA 4LCWD 1HKFA 2YA2A 1URLA 3MLTB 5DZLA 4P2QB 5D7JC 1NL0L 4LSQL 5EC2A 4X8XA 4M8QA 3C6LD 1XIWC 4Y7MA 1PNCA 4NKDA 2XC8A 4X98B 2GT9B 1TG8A 1TQUA 1N8ZB 3QWOB 1AO7B 3D85B 5AVTB 1KMGA 1KNOB 4V1DD 2R7EB 4P5MB 4PP1C 1DYZA 3V2AR 1CFNB 3O6FD 1WCBA 3BLKA 2WSPA 1A7PL 1CGUA 3LRSB 3GMNA 3G6AA 2IAMD 2ZSWA 4N2HA 3AREB 4NRYA 3N55A 1NQBA 4FCHA 4QRFA 3LNIA 5CWSA 5DQJA 3QQXA 5LDUA 1K85A 1X7TA 4M5YL 2WQWA 4XNYL 1G9EA 5E1AA 2XFXA 1NIEA 3NACL 1EANA 2QQLH 5DFAA 2WB7A 4U0RC 2CJTA 1PZAA 3MRFA 3QI9A 3OQ3B 1D5RA 2Y4SA 3J27A 2BP8A 43C9B 4D0BB 3MNVB 5D72L 4ZW5A 1CK0L 4A7SA 1KTBA 2FDBP 4AT6B 3GXFA 1M1SA 4JRXA 2BIOA 3MLVH 1IBHA 3D39B 4UV7L 1OB1A 3UC2A 4YK4B 2Y7SA 5ICYB 4HKZA 4F2MB 2DWEB 2XQ0A 1KGXA 5BO1L 2I07B 3O11B 4KITB 5FO8B 1WCQA 2W9DH 3VYOA 1U8PA 1BVLB 1KTCA 3QQ4A 5EA0L 5FA3A 5FYLD 1WC7A 2B2XH 4ZTEA 3GSOA 3L5XL 5IQNA 4FXGA 1LHZA 1MI5A 3R1GL 3N43F 3MODL 2NY3C 4WNJA 3DVIA 3HCVB 3UMNA 1YPZF 1XWVA 4JKPL 5I1GH 3NN8B 4IRSB 5GJSH 1ZANL 4PJBA 3DGGB 3QI9D 4HUWB 2EP6A 5F44A 3T09A 5F6HJ 3TIDB 5C0DB 2PXYB 5CSBA 3ZN6A 3CNKA 2EJ1A 4JNXA 4Y4HC 1AS7A 3U48A 2CM5A 3CUPA 4W9FC 1JOIA 4WWKD 1M71A 2WWMD 1MNUL 4JRXD 5DUJA 4TQHA 4UM8B 1TO5A 4JFEB 3TPUB 1R5IA 4YQXH 2YD8A 3NT0A 4NLHA 5BRQA 5E9DE 1JHLH 3QXVA 1JWSA 3I50L 5JR1L 1D5MB 2FJUB 2XIDA 2CIIA 3H8NA 3C2AL 4Z5RA 5LQBL 4YFLF 4U6VH 3Q6GH 1QRNB 2NY5C 4FG6D 3WDIA 2Q10A 2PF6A 1MEXL 1YJDC 2C4FU 1CDBA 1YA5A 5ILTH 5HD8C 2V2WB 1M9SA 4JY5L 3EYOA 1YEGL 1YNKH 1QRKA 4XOAA 5KBDA 1A8ZA 5EC1A 1NGPH 5FWQA 4IOSA 2Q86B 2XA8L 4LCWE 1W16A 2Y5TB 4MD0B 1G43A 2CDFA 2Z4TA 4N2DA 3ARFC 4HWUA 4PJEF 2BP0A 2GEEA 4KVNH 2IADB 2DI9A 5B7MA 2J1KA 3ECBA 2OL3B 5LDSA 3RNKB 4QTIL 3S35X 2J88H 2X89D 2GKIA 3NFSH 3G5VA 1X9QA 2OMVB 4A6YH 1GTFA 5CR1A 2XXGA 5F7WC 4V1DE 1LQBC 1GMEA 5LB1A 2BFVL 3O6ML 4BZ2H 3BZEB 1MFBL 4O51B 1BYOA 3I3DA 4IJTA 3E3QE 4IIQB 3CJJA 1XGUB 4KX8A 5DD5H 1BMZA 1SYVA 2ATKB 4JZNB 4TNGA 4Z7NF 3NCEB 5AL0A 2H6PB 2GCYB 2XN1A 3ZZLA 3P4MB 3GXTA 3P73A 5JIHA 4X7CC 4IOSD 3GNML 3GIVA 3T2PA 2BIPA 3ZT6A 2OZ4L 4WHTB 5L2JB 1KWKA 1FO0L 1PG7H 3H3PL 1T21B 1UA6H 4CSPA 3D0AA 2ZAHA 5D7HA 4WI3A 4UU9A 5DRWA 1NWOA 4ABUA 4O9HH 3J8F7 1S3KH 2Y1AA 1OLLA 3VFPB 1JXKA 4GAYB 2BHFA 3JWDL 3MROA 3LNDA 4X7SL 4NZDA 4KK5C 2D7OA 2W60B 4MWFB 5IEKB 2Q1EA 2KQNA 4L4VB 1FL3B 3IWUA 4LHUB 1CXEA 1DDTA 2W8CA 2EXSA 1IGIH 2W9EH 4P5TB 1TPXC 3ERXA 3N2JA 5M94B 1IBYA 5KVDE 3TNNA 4FLSA 4ZMQA 2K45A 2VQTA 4N4YB 3VQ1C 3BGAA 4CA4A 2LVCA 3AG1B 4X5LA 3SGKC 4YHLH 1KCUL 5FYLE 1CR9H 1JIBA 1J1PH 1KBVA 5IQMA 3I6KB 1TZAA 5E1QA 4L37B 4UANA 4B9FA 4JN2A 3RZCC 5EBMB 3FQRB 2J71A 4AE1A 3VMPA 4OV5A 3G5ZA 5KSBE 2Y5EA 1EA9C 5IROA 5IFJA 4LLVA 5EO0A 2F7RA 1SJHB 5JPNA 3KPLB 3MCKA 3ESVF 4FL4B 4NGHH 5KYXB 1WIOA 3JVGC 1KELL 2OCFD 3Q8CA 4JRXE 4NT6A 2OMZA 3DJTA 4QHPA 4W9HC 4KY2A 4A2LA 1OWRM 4DEPC 2NPLX 3LIUA 5EIVA 3PHQB 2ADIA 1V3KA 1WTLA 1T1XA 3WEXA 4XP1L 1KGUA 4UT9H 1IJNA 4NM4H 4WW2B 2XG4B 4F2EA 4Z8FH 3LS5H 5C0FB 4YSOA 2NXYC 1QO3A 3L3JA 3OHXC 3RNQB 2W9LA 4BUQA 2JMRA 3FO0L 1LO0H 3B9KC 1BQSA 1YMMD 1ZHBA 2YZ8A 3K80A 4XOEA 2EE2A 3LRHA 4YXLL 2QFRA 2FEEL 3D2UD 3M07A 3PYCA 1JVKA 3H42L 1OP3K 1VFUA 1TXKA 1QPKA 3OJDB 2TAAA 4IJ3B 1IGCL 1U93B 1LTXA 5IROD 1CG9A 2VQ1B 4Y8DC 1NDMB 2X4QB 5CD3A 1YUKB 1PW3A 2KBGA 1EHAA 4LLWB 4R3SB 5CXPA 4NAQA 3FUEA 3KYMA 3WJLA 2XUWA 4PQXA 2OTWB 2HT2D 4M3JA 3BVNA 5FGSA 3TBTA 5HXMA 2FWUA 2O6EA 3QJUB 1QACA 1T6VN 3WE6B 1B0RB 4L8BA 4BA8A 4NKOB 3HE7B 1E28B 1G7JA 3QQNA 5F9DC 1LE5A 4JM2C 1CBVL 4GH7B 1USZA 3JWNH 5I75B 1ZLVH 1RJZA 2EYTA 5KS9B 4O02H 1YEEL 2F61A 1WBYA 5DUMH 4GAGL 3FT0A 5DEZA 1EO8L 3QPXL 4AG4H 2A9MH 2VZ3A 1OSZB 4PG2A 5IESL 5IMMA 3N41B 3EO1B 4MMYA 4G8IB 5H4YA 5DMYA 2JJTA 1OAZL 2IANA 2XTJC 2YK1H 3QEUB 5C0EA 4KJPC 1N2RB 1KB3A 3UP1A 2JKNA 3BKMH 4N8CL 1NAML 2G3NA 3C5XA 4G8GD 2Q7YA 2WCPA 1XD1A 4MCZB 4HV8A 4JO2L 3HMXA 2E9BA 1NCBL 4AENA 3DX6B 3I85A 5KANI 2Z9TA 3VWKC 2VKXA 1NEUA 3ZQ9A 4BFJA 3FAWA 3PWLA 2K6WA 1H19A 2VO5A 3QJXA 4LVHB 3TP4A 3VO0A 4K3JL 5D7SH 4YHZH 3L4YA 1YO4A 3PWJB 3EUUA 4WSGA 4OV6F 2YPVA 5EOTB 5KSUB 2NT0A 2AERT 4CVXA 1MCDA 1I8UA 1CICC 1UM6L 3MRMB 1JV5B 2NZ9C 3G5WA 5BZXA 2QQKL 2EDBA 4K7FA 1X44A 5F3BA 3BW9A 4NO0A 4H1LA 3S88L 1NCGA 3GLEA 4OCSL 2VSMB 3HW7A 4PVNA 4HQQL 5EV7A 3WL9A 3MOBL 3MJ9A 2X6UA 4G6AC 2IAND 3V4UL 3S4SG 5SX5H 2HFEB 3RY5A 2YGNA 3FB6B 1E4KC 4WWID 2Q87A 3TNMA 4PBDA 1RZFL 4YVUA 1WBXA 5T33H 2WOYA 2V33A 1KV3A 3CCHA 3FFDB 5CN2A 3QWRD 5BZDA 5IKCA 1IFRA 4WU5B 1NA8A 1GGCL 1CD8A 3O4LB 5E8OB 3JWNC 3HPJA 3QZWB 1UWGL 5EDSA 5ADPH 3ESPA 3O45A 1ADWA 1IT9H 2IMNA 1S7SB 3BN9D 4ISVB 2OM5A 4N2KA 3K2UL 4JG5A 1IEAB 2N59A 1IC4H 4OLXL 1A6ZB 1UD5A 2IALB 2VMFA