2WGXA

Human p53 core domain mutant m133l-v203a-y236f-n239y-t253i-n268d
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCYSSCMGGMNRRPILIIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Stabilising the DNA-Binding Domain of P53 by Rational Design of its Hydrophobic Core.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wgxA00
2RMNA 2IOMA 5ABAA 1EAQA 2WGXA 5AOMA 4AGOA 2AC0A 3QYMA 4LOEA 2VUKA 3IGLA 3Q06A 5G4NA 5AOLA 3ZMEA 3D09A 3WTTA 5LGYA 4IBZA 2P52A 2YBGA 4MZRA 4L0YA 1CMOA 3US0A 2IOOA 4KVPA 2ATAA 1GZHC 4IBYA 1HU8A 2J1ZA 2X0VA 4IBSA 2OCJA 2MEJB 3VD2A 3Q05A 4GUOA 3WTVA 2J6WA 1UOLA 4LOFA 2J1XA 5AOKA 5AOIA 2BIMA 1LJMA 4IJTA 1T4WA 2BIOA 5KBDA 2J20A 1HJBC 4A63A 1IO4C 3D08A 2X0UA 2J21A 2BIPA 2BINA 3Q01A 3WU1A 1TUPA 4G82A 1KZYA 2IOIA 2GEQA 1YCSA 4G83A 4AGPA 3VD0A 2J1WA 1EAOA 4IBVA 2XWCA 4AGLA 5AB9A 4IBTA 2ADYA 4IBQA 5LAPA 3D06A 1GZHA 2BIQA 3D05A 2FEJA 5G4MA 3US1A 3WTWA 1E50A 3EXJA 3D07A 4AGNA 1CO1A 2H1LM 3QYNA 2XWRA 3KMDA 3TS8A 5ECGA 3EXLA 3WTSA 4HJEA 2J1YA 4XR8C 4LO9A 5AOJA 4MZIA 2AHIA 1TSRA 5G4OA 4L18A 4AGMA 3D0AA 4AGQA 4GUQA 3VD1A 4IBWA 3WTYA 3KZ8A 3WTXA 4QO1B 3WTUA 5BUAA 3IGKA 2PCXA 1H9DA 5A7BA 2X0WA 1EANA 4L0ZA 1HJCA 4IBUA
chains in the Genus database with same CATH superfamily
3PFUA 4K8RC 1KFAL 3SKJL 5EPMA 3AMKA 2QPEB 5FUZL 2J73A 4L3EB 2EE6A 2ZYRA 1R3JA 4XN1A 3KPTA 4AUJA 1HYSD 3M88A 2N0KA 5BS0E 4HMCA 4EDXA 4HEMA 4XP1L 2WQXA 5KSAA 2BS71 4FLQA 4NUJA 3UAJA 3UZQB 2GUYA 2WQAA 1BFSA 1EJFA 2I07A 4G7SB 4M4RA 3RWEB 3WNOA 4KO6A 4WY7H 5A16A 5FPIA 1N9PA 5KSBB 1T66D 3MRJA 3MA7B 4PS4H 5DYOB 3MRRA 4KMQA 1A02N 3GSXA 2Q7YB 5B39A 2XC8A 1WICA 3U4EA 5GRXG 2ENSA 1G5AA 3WKQA 4L4TE 3IGUA 5DQDL 2VZ1A 3MPCA 2YEVB 3QUXD 3DETD 3UPRA 1SJHB 1TTBA 3UC0H 3ZKNC 1AQMA 4GW1A 1SYVA 1WC7A 3OAUH 4MBRA 4A7VA 5HDBF 3ZTEA 4E5XA 1TT6A 3VH8B 3WU1A 3HLAB 5JDSA 5I71B 1VA9A 4UT7L 3TT1L 4DO6A 3LN4A 5IIEB 3UDWC 4EQ3A 3VWKB 2CPUA 4YDJA 2F5AL 1WWWX 2PF6A 4N5EC 3JXAA 5IUCA 3S2CA 1FCGA 2XN1A 3ARGD 1EVUA 4Z78B 1N19A 4NERA 2GHZA 4KFZC 4NRXA 4QDGA 4W4OA 4MJJA 4JG9A 4MKTA 2B7DT 1DJHA 4ZFFB 1XH3A 1P7KB 1PD0A 4EI6A 3AT8A 5IW6B 3G9AB 5C0JA 1C5CL 2FYVA 2JV6A 3FUMA 4YSQA 3LRHA 3QNXA 3U9PL 2QQKL 2FD6H 4JREB 5D2NC 3OLIA 4EUPB 2F15A 4QNPF 5BV7L 3P02A 4MAYD 1B2WH 1UH2A 3MRPB 1DCEA 3TTYA 4EAEA 2WINA 3F3HA 4UB0L 1I7UA 5DJZA 4IRSB 3SDCD 4JFDE 3VA6A 3CFJA 2OTUB 4MMXC 3NFSH 1V54B 3KLSA 3ESMA 4NM4H 4NSKB 1KYAA 5DO8A 3UBFA 2MKWA 1URZA 2BP5M 3HUJF 2L7EA 5TDNA 1NDMB 2CRIA 1RPQA 1SYSA 2K7PA 4NHUA 2VN7A 5F1KC 3NJMA 1JD7A 3R1GL 3AWEA 4GAYA 5LLIC 4Z7WE 1IAKB 1OF0A 3TPUB 4N0FB 4UNUA 3H2WA 3AADB 3RWJA 2HVJA 2MJWA 1XZ0B 3K6NA 1EAPB 1YPZB 1EZUA 3T71A 5ILTH 2HLAB 4CAGA 2HCZX 3ARTA 2XQBH 4QYOB 3QDMD 3ZT5A 5IMMA 3W11C 5AFAA 4PJBB 5DD0L 2PYEB 3ZYZA 4ODSH 1T2QL 1ZRUA 2OJZH 3CZFA 5HDRA 2Z35B 3IJSA 4F7KA 2FX7L 1A7NL 1E5BA 5JPNA 3KBFA 4JZNA 3TBTB 3HS0B 2G4GA 1R3HA 2BP8A 3ZL1A 2F0CA 5B1JC 8FABB 1K4DA 3O4OB 3HI1B 4GOSA 4XMPL 3D50A 4FDWA 4N3TA 3CHSA 4LEXL 4X7SL 1CE6B 2R0ZH 4A7QA 3DV4A 2APTA 2ZOLB 4PGZA 4WO0A 3B7TA 3WJMB 1E2VA 3K3QA 1UT2A 1G9HA 4GSDH 1KIQA 1KBGH 4ABUA 4CKQA 3PWJB 3DWTA 2PCFA 1ID5I 4HUWB 4K0OA 2DWXA 3Q1EA 3BYTA 5SWSD 2KDGA 5HHXL 1AXSB 4TKWA 2N1TE 2CO3A 3U2SB 2K4WA 4WHYG 4W9ZA 2LAAA 4HUXA 3CXHJ 3WGUB 2P48B 2NR6C 3DXAA 5D1ZD 3QUYA 3IDIB 5C08D 5B7FA 3IS1X 1CD1B 3E8VA 5C07D 4BZ2H 4DKFH 4N6QA 2OMWB 4FQHB 1ZWIB 4Y5YC 4Y9GA 3RURA 1QYGL 3CVHB 4I7ZC 5HSFA 2W65B 2DJUA 4RGND 1H6EA 1D3CA 3CN0A 1A25A 4S2SB 5AAMA 1VHPA 1DQQA 4AM0B 2JJVA 5JMRA 3FF7A 3KLDA 3RY5A 1EEZA 1GZHA 2ZJSL 3U4BL 3VRLE 2FEDD 4FNLL 4XZUB 3EXJA 3KLAA 1NGPH 5I1GL 1OK0A 2CO6B 2MHAB 2XKNA 3ARBC 1YYLL 3BO8A 3QULB 1MWOA 3BMWA 3H3PL 1TCRA 2F68X 2VLME 4FHBD 5LBSL 1IBHA 2JI1A 4X4YA 1LNUA 5DJ2A 4FA7B 1FE8H 4LHUA 2ZUTA 4YXLL 2NNAB 3MREA 1G43A 2VKXA 4FQIL 5FHBH 5LBGA 1BYNA 3HE6C 4FG6D 2AJVH 2DLIA 2NLJB 1KYOK 3GZKA 1UJ3A 2AJUH 4PCTA 2VERN 1R3KA 1D6VH 1XXFC 4UM9B 4HWUA 3C8KA 4YHZL 1TNNA 5A7EA 5E08L 1KY7A 2DWDA 1PDKB 1PZBA 3QO0B 4I0PD 3M7OA 5JXAH 3IDNB 3LKQB 2P5EB 3H56A 2EDKA 3K6DA 2CM6A 4HW6A 2F74A 2VLJD 4Y2LA 5IEHB 4AW4A 1QTYT 2P8PA 1MAJA 4G2AA 1FNSH 3T8VA 1P6AB 3MV9A 4F15B 4LIQE 4N0YL 3LV3A 1TJMA 5F89A 3WIIH 4PUBL 1TJHL 2WWKT 4G7YL 4N9GB 4PRID 1PNDA 2X4NB 3NA9L 3E3QC 4X7FC 2VC2B 3NSFA 3FT2A 4XN5A 4JQIL 4ZOBA 3VD7A 1MAMH 1CDUA 1INDH 1EIBA 2IG2L 1D6EB 3HUJB 5KVEH 4HLJA 3BAJA 1U8QB 4H25A 1TQUA 2CDGA 2GAZA 2MEJB 1UACL 2XTJE 1JF1B 1RQ5A 2DQGL 5H94B 2QDVA 1EZSA 2HYMA 2YC1A 3QG7L 4U7KA 5T1LD 2ZWYA 2EYRA 2XLLA 2EKSB 4N28A 4NQXB 2NY1B 3TEXA 1XGQB 3CN2A 5JIPA 3MYJB 4KKBC 3MUUA 2AXFA 3LXAA 4P2RA 3DOHA 4JM2C 3SYCA 1ORQA 3ATDA 2BIOA 5EPMB 5KUMA 1UEMA 2VXQH 3MLXH 3SBQA 1EK3A 3W0WD 5TQ0L 5AYUH 5H2BB 2PTTA 5DRNA 4TTDC 1DBJL 4KJWD 3UGXA 3ZHNA 1F2XK 3JZYA 4ZW7A 4EDXB 1O7VA 2OZ4L 3QPQC 4Y0GA 5KSAB 4AH2A 4LU5H 4GQPH 2Z8RA 2Z1PA 4NUJB 5LUMA 2V2XA 4HP5A 4R83A 4OM1L 1AZRA 5ADOH 2AJYL 5KS9A 4MXWH 2I07B 1X9LA 4M4RB 1XDTT 5KYXA 4C54A 2WBJD 5A16B 2WWOA 1AKJA 1G9MH 3MRJB 3UTPE 4AIXA 4HF5H 3MRRB 4NFCA 4Y19E 5T33H 3GSXB 5B39B 3U4EB 1HOCA 5GRVK 1N2RA 4P3WA 3UPRB 2AF2A 3MC0A 2HVBA 4GW1B 1SYVB 3P3YA 2C5DC 4XNZB 2JQMA 3CDYA 4BK5C 1WC7B 5ANHA 4E5XB 1C7TA 1SMDA 4ZS6C 1N59A 4NUGL 3M6DA 5JDSB 2R2HA 3QPXH 3VI4A 5ISZE 4PRHA 1KCWA 4O58L 1NCCH 3LN4B 4KV5F 5J6GA 2VM3A 3VVVA 4YDJB 4G8GB 3NIGF 4JG0H 4LHJB 5K9OA 5J13B 4AK1A 2ITCA 4FXGC 1DSWA 4NRXB 5L9DH 1H8NA 3H53A 1XH3B 4EI6B 5GGTL 4X50A 3OWRA 4PJHF 5C0JB 5BRQA 2NCMA 4GO9A 1CJYA 3QNXB 4FX5A 4G9DA 2BFVL 4LP5A 2YSSA 1FGNH 3BGFC 3FKUS 3GSRA 4H8WH 3UIZA 4HULB 2AQ3A 4AQ1C 3P3UA 4P07A 2WINB 3PV6A 4N2DA 1I7UB 2VL5A 5DJZB 3K0YA 4FEMA 2VCOA 3CFJB 3FQ4A 3EGXA 4YXHH 3ET9F 4Z95H 4JFYA 3T0AA 2IGLA 5IJKA 2AEPH 2XHNA 4P2OC 4YHIA 4QJ3B 3L4VA 5FYKD 4N0CD 5FM4A 4IOFC 5TDNB 3MXVL 1SYSB 5ADPH 4NHUB 2UV3A 3SN6N 3MUGA 2CUHA 3FBKA 2IIJA 4DP2X 4GAYB 2WBWB 3WNKA 3W38A 4OZHA 3WS6C 1OGAE 3N5AA 3RWJB 5EU3A 2HVJB 3TVMC 2EUXA 2XN2A 4ZSOE 4L3ED 5GGVY 3KHOA 1DJIA 3QRBA 1NOAA 4ZFZA 2XZQH 3K0WA 3VG0H 4PIBA 5FA4A 5IMMB 3AG4B 1QBMH 2ZNXA 1MFBH 5GS2D 4TNFA 2GSIA 2X3BA 1QO3A 3CZFB 4JBSA 3IJSB 2J3SA 4WW2A 5JPNB 1GJIA 1EJ8A 1T1WA 4GXVL 4XPBL 1FV1A 3WHE1 1RK7A 3MOBH 1R3HB 1U8NA 2BP8B 4PJDE 4HLEA 3FB6A 5FFLA 3BWAA 5EUKA 1RLBA 2D9CA 1K4DB 2YQGA 4KJPC 4Q6KA 4TPRH 1CLOH 2LE9A 4BWWA 1V55B 3LAFA 2GBAA 5C3TA 5KS9F 1IB5A 3DV4B 3PV7A 2EYTA 4IW4C 5E2TH 3P73A 3JWDH 3DOSA 1KIQB 1HHGA 3O3AA 4PJIA 3W1ZA 2PCFB 3KBPA 3F5WA 5D7LA 3THMH 3L8QA 4GRMA 2Y0SA 3P0VL 4AXWA 3PQYE 4BE6A 4GP4B 4HUXB 2ZOWA 4K7FA 4GUCA 3CZNA 1FNAA 3DXAB 4HCRA 4MJ2A 3QUYB 3LEYH 1Z5LA 4Y1SA 4LOUD 3T3ME 2EDEA 4QF1A 1RZGA 2PN5A 5D7JB 5DJDA 4ZMPA 1ZHLA 3VI4F 2LU3A 5D72L 3B2UD 3GI8H 1CL7I 1X5HA 4NWTL 1ZAGA 3HNTH 1WHOA 1HHJA 1ZXKA 3FT0A 1DQQB 4PWFA 5F9WC 4KKPA 4MSWA 3GXFA 1MF2L 3DA0A 1DQDH 1RP9A 4IMKC 5BOZG 4RMRA 5GZOA 1EEZB 3HTLX 4G9FD 1Q38A 1PD1A 3KLAB 5I1LA 3PDOA 1D7BA 4Z3GA 2XKNB 3VXRA 2CHXA 2R1YA 3BO8B 2CUIA 3QB7C 2VNCA 1TCRB 5L8KB 4X4YB 3IGLA 1LNUB 1JXJA 5DJ2B 4TRPH 4X5QA 25C8H 5LGJA 4AYMC 3ARWA 2BDNH 3APFA 1DO5A 3MREB 3AGVA 1EZVX 4HGWA 1F58L 3QEGL 3NIGB 5EF2A 3MV01 3PGCA 5CIPH 3UTTA 3W2DH 3KPMA 1UJ3B 1GYCA 3C2SA 4H8QA 4B41A 1R3KB 3D7PA 4ZAKD 2YUVA 3CSFA 2VR7A 3C8KB 4NQEA 5DEGA 4GUOA 2OI9B 4PRNA 2DWDB 3RVVC 4JCMA 1PZ5A 1F02I 4CDHA 4PJHB 4PBWD 3DMMC 3U46A 1UZ6F 4A7SA 1GC1L 2BVOA 4OZHF 2F74B 2XIBA 4R0LC 4B9FA 3ULUH 1UB5A 4TSCL 1FZKA 1V7MH 9PCYA 2EVIA 1VKXA 4IRJA 3MV9B 1DBKH 2QQLH 2ENPA 5F7EL 3LV3B 4ENED 5F89B 3V0AC 2O5YL 2V7NB 1XVSA 2F53E 1UT9A 2IWFA 2QLVB 4G82A 2JKIS 4U3HA 2P5WE 4WW2F 1AG6A 3FT2B 3EG9A 1DR9A 1MKFA 4H25B 2CDGB 2GAZB 4DEPB 1ET8A 4W6YB 4HIHA 5DEJA 2NX5E 2YC1B 3AROA 5BNXD 2EYRB 4Y9EA 4EMZA 4KHTL 4DW2L 3TBYA 4AVJA 5JNYA 5FGSA 2AXFB 5ANMA 4P2RB 5JIDA 1B9ZA 1ORQB 4PTTA 1G4MA 4PJIF 3DRQA 2WXNA 3HC3L 2EXSA 2VDOL 1SF3A 2BC4A 1VCBC 3CMOL 5DSCA 2PTTB 1AQDA 1M6UA 4O9HL 5DRNB 4FAAB 4OFYA 3RUGE 4FTVE 3ECWA 2DZEA 4AH2B 3VFPA 2VMEA 4KAQL 2V2XB 5CEXB 3ZXAC 1L0QA 5FV1L 5EOCH 1BQHG 1J86A 1OB1A 5KS9B 2R0LL 4F8LA 2NY3C 4FI7A 2O5XL 4Z3IA 2JI3A 2YMOA 4X6CF 4F80A 5I6MA 5KYXB 1VPOL 4W9JC 1AKJB 4P59L 1IQWH 2D03H 2N56A 1SXAA 2BSDA 4I18A 4U1LA 1OP3H 4HU8A 4XNBA 1HYSC 1S2EA 3ETBF 2LLLA 1N2RB 2I60L 4Z7VF 4CJ0A 3WCYA 1FC2D 4FD0A 4JG5A 4KQ4H 4YSDA 4RQQA 2WV3A 1AZCA 3MQIA 2LQRA 4Y16B 1N59B 3D09A 4F9LC 3KEHA 2R2HB 3VI4B 2ED8A 4WFED 4PRHB 2GYSA 1XL4A 5J6GB 1T66C 2XX1A 3LNEA 2DMBA 3GSQA 2AITA 5K9OB 4UM9D 1D5XA 5EA0H 3FUKA 4M7LL 1YEEH 2ITCB 3FQRA 5BOPA 3P4NA 3KWUA 3QUXC 5BUPA 3E9TA 2HT2D 5IFHH 2KS0A 3GHBH 3WEMA 3IWUA 1JHLH 1YQVL 3RVTD 4WO4D 4G9DB 3CHPA 3UO1H 2A9CA 2YSSB 4X42A 3GSRB 2YARA 4BZ1A 4NUMA 3CVHL 4OD3H 4FQLH 3PV6B 3L7EA 3EDJA 4DAGH 3GMQA 2VL5B 1BFOA 3KDPB 4G71B 3ARGC 7FABL 1F6LL 4HISA 3EGXB 1KPUA 2G9KA 4JFYB 4FYQA 3CFCH 4KC3B 1F1DA 4YHIB 3WUWG 3FTGB 4YFDB 5E4AA 3U79A 3MLUH 4ADIA 4DKDC 3QS2A 4OLUL 1CGYA 1T5XA 2NYYD 3DIDA 1U8MA 4X5PA 1LO4L 1NZRA 2D4DA 3O11A 4MAYC 3O4LE 4KDVA 1I3VA 4Y1AA 4UYQA 4OZHB 1KXVC 2XIDA 1MFCH 4I3SH 3ZN6A 1ZTXL 5EU3B 5FV2A 3EOBA 1U93A 1KTDA 3SDCC 1NEUA 1IC7L 4ZFZB 1RXLA 2LLNA 5FKPA 5FA4B 1EJOH 1TTGA 3JWNG 4BHUI 3OSKA 5EUOE 2J1YA 1TLMA 2ZUUA 1YEGL 4AQEA 5KSAD 2GSIB 1QO3B 1TETL 2OMNA 4CSSA 1G0DA 2KZBA 4WW2B 3QZNA 5D71H 1T1WB 5FGCB 1FV1B 4LAQL 1U8NB 4AIOA 3UTQA 1JWUA 1N0XH 3FB6B 3CLEH 3BWAB 1HSBA 5EUKB 3BKJL 3I2CH 2G5UA 2XBDA 4Y4HC 4XP9L 4BQ9A 5FWQA 4CMHB 1XBDA 1SGKA 3HHSA 5CJXA 4FJZA 4MA3A 2EYTB 2AEWA 4L9LA 2AGJH 3C09B 3DOSB 4JFFA 4KNTA 5D2LA 2NOYA 1HHGB 1QRNA 2PP8A 3LZNA 4RISH 3O3AB 4PJIB 4WCYL 4X8CA 4XX1E 1GMEA 4QIRA 3F5WB 5D7LB 1TZOA 5JQIB 1NIBA 4GRMB 1M2VA 4UILL 4JPWL 2FQDA 4AXWB 1ASQA 3B37A 2YPVH 2M8XA 2VC2L 3GBNL 2J8UA 3E8UH 3U82B 4IGBD 1JZ8A 5FS5A 4I4WA 1Z5LB 3QXTA 3Q5TA 4QF1B 1RZGB 5DJDB 2RALA 3QDAA 3SE4A 1FFNA 1ZHLB 4YJZL 2UWEF 5C9JB 3M86A 5DZLA 4LSVH 2WO2B 1QEXA 4O5LH 3SE8H 5HDOA 4DO5A 1HHJB 5J0BA 1BIIA 2VH5H 4P4RA 3A6CL 5L4IA 1O7SA 3HNSH 4X4MA 5T1DH 1E9OA 3ZZ1A 1QWHA 4BEIA 4K94L 2QT6A 5JORB 5GGRY 1KGYE 3T1FA 4PRPE 5DQJA 3ECQA 5D1ZC 5I1LB 1SOSA 1JPTL 1OSEA 4NBYB 3PDOB 3SPHA 1QBLL 3VXRB 3O6FA 3DSFL 2R1YB 1PF3A 2MCAA 5E5MA 3LZLA 4APQD 1TZAA 1A7OL 1WA2X 1ULVA 1XFPA 1A7RH 5I0XA 5T8IA 5LGJB 1H3VA 4N8CH 4JX0A 3BZEA 3EDDA 4MAZA 3PGCB 3KH4A 5F44A 4LSQL 3UTTB 3TIDA 2NY6B 1NEZG 3KPMB 1L7TL 4B0MB 2UXFA 4S0SD 1CF1A 1TFPA 3HBPA 3SB3A 1P9MC 2FEDC 4AQ8A 2YEQA 3OHXA 4J3OG 4NQEB 5DEGB 5HHMB 2FRGP 1PZ5B 4WV1C 4BKSC 2DLGA 1JP5A 2Q76A 4OD1H 1QSEA 4UV7L 1PFCA 3U46B 1XGZA 1J48A 4KO9A 5H37G 4ZW3A 1GYAA 2BVOB 43CAA 4WWPA 4LLUA 3D51A 2Z6FA 4KZEL 1FDLH 1UB5B 3GRGA 2B14A 3NYKA 2QQNL 4FG6C 4O02A 4V2BA 4R4ND 1VKXB 4IRJB 5FUOL 1T6VN 3VE0A 2ZAHA 5JHBA 5FO8A 3BD5A 1NPNA 5DTFA 1QD0A 1QFWL 3WFDL 4A6YA 2OSYA 4ODXA 2VLRA 3MLZL 3P3SA 1HN1A 4A2HA 4A2MA 1CPUA 3VFSA 3EG9B 1TTUA 1LM8V 3OG4B 4WQOA 1JNLL 1RU9L 3NPZB 1KJMA 4I0PC 5CLYA 5KEZA 4HIHB 4H1LH 3DX3A 1G7PA 2FUQA 2LW3A 1W16A 1FL5A 4I88A 5SWQA 4PQXA 1CIUA 2HG5A 3WTYA 1TO4A 4MA7L 1YECH 4HJJH 2O5NA 3VFOB 4ZQTA 4Q7DA 3TBYB 3DX1A 5JNYB 1ZT4A 3FQUA 5ANMB 1CGSH 2F8VA 1E27A 5D2LF 5HHPA 1BVKA 4PTTB 1E6OH 5LNEA 3QZLA 3C12A 3DRQB 5FYLH 5EO1A 2CO7A 4OUOA 3MJ9L 4QJ4B 2BC4B 3IE9A 3PWPB 3FH5A 4UINH 4CUCA 3DXAD 4HJSA 3D9AH 3QUYD 2EVGA 3KLQA 1AQDB 4ZDHA 2QSVA 2R0KL 4YSAA 3OKNA 5AOLA 2J8UF 4H8PA 5T5NG 3N0AA 2IAMA 4HETA 3VFPB 2OAAA 5MP6L 4AKQA 1KWGA 1KCUL 4BD4A 2VZVA 3HIZA 2YPVA 4HV8A 4QT5A 3BESR 4EEEA 1E8ZA 3FFCE 4YS4A 1OB1B 1FNFA 1GPOL 4KZ0A 4MQTB 4AENA 1KGUA 1NCHA 3FT9A 2FBJH 4KXZH 3LH2L 4ONFL 4NZRH 1SEQL 4I18B 4U1LB 4JR9L 5IQOA 1DQLH 4GO8A 4XBEL 1JUFA 5CZXC 2AANA 2EICA 4KJWC 3LRLA 5JIMA 2Q8BL 4JNXA 2FSDA 1IJNA 1WS8A 4LDCA 1A6UH 4B9KC 1YJDC 2V0AA 1DQJA 1L0YA 3ZE0E 5IZ7A 4LHUD 4RQQB 3VXPA 1ZXQA 3KVQA 4HG4K 1PW3A 1P84J 3FQWA 1L5GB 3N6YA 1RZKL 5C09A 4UAOB 1KYOJ 1ASOA 4BUGA 2ALWA 4GXUM 1CXKA 3U0TA 3T3PE 3K80A 3Q6FA 3GSQB 3AGWA 3BPLB 3BH8A 1Q72L 2QPFA 1D5XB 3DJ9A 2CUAA 2ZYHA 5KOVC 5EEYA 4MRCA 3FQRB 1G7JA 2HT4D 3BSZH 1QW8A 3P4NB 5CJOH 1U41A 5IJDC 4LLWA 5KYWA 2CKNA 2KC0A 1XSKA 3G5VA 1VGKA 1JXFA 2OCCB 1F4XL 1OXYA 1OVZA 3MV9D 4JRXA 1X5GA 4F57H 3Q6GL 1CI3M 3L7EB 3HZYA 4X9GA 3ME0A 4UZSA 3GMQB 1SFHA 2Y23A 1BFOB 5CP7A 1KPUB 3QEHA 1J8HE 2CLVA 2D7MA 3HAEA 4YPGA 1A64A 2X4SA 4QEGA 1EFXD 4XPGL 4DK5A 2XDHA 4LVHB 1OT4A 2IQAA 4X80H 5EB9A 1T5XB 3WSQL 5I19L 4F7PA 2DWSA 1U8MB 1JE6A 3O6LH 2WBXA 4CC4C 2O61A 4N2MA 1RFDL 3O11B 4JY4A 4QRRE 4P2RD 4Y1AB 1OHQA 1QFWM 2DQJL 4G42A 2X2JA 3OKDA 3EOBB 1JGEA 1U93B 1KTDB 3MLSL 5ICUA 1A7QL 4AIZA 4K3GA 5DS8A 5FKPB 3MZGB 1S6NA 4MDJA 4LE8A 4Z7OF 1GGBL 1V10A 1FG9C 3D39A 4G5ZL 4BM7A 4XC1H 1NMAH 5C7XH 2PWHA 1HESA 1NIFA 1BQSA 5D8JH 4FLSA 4FHJA 5I6PA 1JWUB 1XH0A 4ONOA 4PY8J 3UTQB 2V9QA 1HSBB 3JWNH 5LO7A 1EO8L 4FQ2L 5IB3A 2GJRA 2OCJA 4MCZB 1CTOA 4L4VE 1AKJD 3TJPA 3HHSB 5C0NC 1ZHNA 1MHCA 4YSRA 5CZRA 2G3MA 4OF0A 3FCSA 4L9LB 1YAIA 4JFFB 3D3VB 5D2LB 1QRNB 4M43H 4J8RB 4W81A 1G94A 1Z9LA 1TJIL 2IWGA 3TBCA 4OCWH 3N40F 3OXSA 1M2VB 4N0UA 1E5AA 1CGUA 1EHAA 5JIQA 3CLFH 2ARJA 5KWYC 2J71A 2IFFH 2J8UB 2WNGA 1AR1B 4B6ZA 1Q9LA 3OAWA 4I4WB 3AS2A 4GQQA 5D93B 2Y36L 4HAKA 3Q01A 3KW8A 4M3HA 2EH7L 3S3BB 2QVFB 3IDXL 3L4YA 1I8UA 3V8OA 2X4TA 1A1MA 1HT6A 4J23A 2GPZA 2IDFA 2XQYG 1AG0A 2AJXH 5IQ9A 4KX9A 1BIIB 5C0EA 2VLLA 4P4RB 3SDYH 2YMTA 1TVBB 4YXKL 4JZJA 1FH2A 5GGSA 5T1JA 4XXDA 2IH3A 1E9OB 5I23A 2NXZC 4XWOC 3SZKC 2YXFA 4OF8A 2D73A 3ASOB 3Q2NA 2H2SD 3DYMA 3T1FB 5GS0C 1DN2A 1UD8A 5DQJB 3S34H 4HWBH 1IEHA 1HE7A 3C5ZB 2FIKA 4H26A 1U8HA 3KWVA 5H4YA 3RIAK 4M1CD 3DTDA 4R7DB 3X1EA 5EF0A 3O6FB 4MXQC 2J57A 3SDAD 5FHAH 5DEFA 1N6QL 5E5MB 1C1EH 3L1GA 3B2UC 2GJJA 3BAEL 4BQ6A 1Q0YL 2VISA 2DMGA 2E0PA 3B9KA 3FO0H 1UCBH 1IC4H 2BZ7A 1F1GA 4GMTL 3LS5L 4W93A 3ZE2E 3QJSB 3BZEB 4WKZA 3TIDB 5D7HA 2VXSH 4R4BA 3V2AR 3J8F7 5FECB 2CK0L 2R4SL 4QHPA 4L18A 3FUJA 1E9QA 4IBWA 4MKMA 2Y5TA 3OHXB 1PIFA 1QI4A 4NIKB 3P11L 1SOXA 1B4JH 2Q76B 4OUUA 5BUAA 2L7QA 4OCSL 2AS5M 2FR4A 5LGHL 4FQQA 4ODTL 3WNLA 1I9IH 43CAB 1XCXA 4LLUB 4HIEA 2KH2B 3OL2A 4FXLA 2DPKA 3DX0A 1JZEA 3C2AL 3P40A 4O02B 1KCSH 1IM9A 3JV6A 2FB4H 2FH6A 1NCWH 3VE0B 5B8CA 3PCYA 5FO8B 4OLYH 2APSA 5H37H 4FG4A 4N2EA 2QZQA 4A6YB 5CF3A 1DVZA 4ODXB 4ZAKC 2VLRB 1JRHH 3VFSB 3H3KA 2BSBA 4UF7C 4ZTPL 5ES4B 3VB8A 4IBYA 5MEND 1KJMB 1MRDL 2ZCHL 1JZ7A 4N24A 2A9BA 1G7PB 1FL5B 4WI3A 5SWQB 3I50L 2HG5B 1N4XH 1XCTA 3V9FA 3T2PA 4HOWA 4M8QA 4WNQA 5C0IA 4M8RA 3T6WA 5D7LD 4IMLA 3FQUB 5HHPB 1CFMA 1E27B 3OAYH 1BVKB 7CGTA 5KBDA 2WUBH 3AUVA 3C9NA 5EO1B 2CO7B 2Y2WA 4Z7OB 1PLAA 2AXGA 3TWCH 1SN2A 4LQFL 2D9QB 4ZDHB 5I8KH 1KEGH 3OKNB 1E4XH 2YZ8A 3ARDA 2ADGA 1I8KA 2IAMB 4X7DC 3GZPA 1E8XA 4M7LT 2EVJA 3J07A 1AP2A 2WTOA 2DICA 2WCPA 4MJ4A 4HV8B 2IMNA 3WXWH 4F27A 2LGNA 4GO6B 1A6TA 1MAML 1INDL 5CU9A 4AENB 4OJCA 3B3IA 4XTRC 2XYBA 1RMFL 1J9SA 4U1JA 5T3XD 1XHHA 5FYJE 1AMXA 2OM5A 4JHZA 4AEIH 4KTYA 1XF1A 2WC7A 1EERB 4EN3A 2XV3A 4PJFA 1B6DA 3N04A 2EC9U 2DS4A 3U6XS 2IV8A 4F7CA 2JJTA 2RGSA 5AZ2H 3V6OC 3VXRD 1NPUA 1DQJB 4NOBA 3VXPB 2DQ6A 1HNFA 3FQWB 3ML8A 4JE4B 1D5IL 3UTTD 5ID1A 3S37H 3U0TB 4EOWL 3LXBA 5AOJA 3WL9A 4YDVA 1A7PH 2BNUA 3BH8B 5C0DA 2A4ZA 5EDSA 3KPOB 3ROOA 1MJ7H 4NQED 3O2DL 5HHMD 4EE2A 3L1FA 2OW7A 3UG4A 5IEKA 3RL2A 4GW4A 1TVHA 2BP3A 3MJ8A 4NPYB 5JLZA 2R29H 3AQZA 4LLWB 5KYWB 1JFQH 4JJOA 2VRQA 4N2NA 1OTUD 3ZTNH 4PG2A 3G5VB 1IGFH 4HCRL 4QUOA 4AJYV 1VGKB 1DSYA 1CLCA 3ZDYF 4A55A 1OSPL 1ODAA 5EOCJ 4IRJD 4OCYL 3K7UA 3LKOA 4JRXB 3Q1SL 1OANA 1T03H 1S3KL 1NEZA 3ZLQC 3H9SA 3HZYB 5JIIA 3ME0B 5BW7A 1ZVNA 4LLAA 1NFDA 4ACPA 3PWVA 1BF5A 5CP7B 1JGIA 3RP1A 5LGYA 5KAQF 1AR2A 3QARA 1TTCA 3WJLA 2GJ6E 3QEHB 3V5DA 1ADQH 4YPGB 2CLVB 1OT1A 2Q2EB 3HAEB 2X4SB 1WE5A 2A74C 2QV4A 4ICXA 3GSWA 3LPOA 5T3XL 1V5JA 2V6HA 2QKIC 3G6DL 4IBSA 1ASPA 4U7MA 4ZYKA 3N06B 2V5RA 5BVJB 2XFXA 3RVTC 1A0QL 4WO4C 2FLRT 4X83A 1INEH 2DF3A 1O7DC 2O61B 3GNMH 4UMSA 3VGBA 4JY4B 1OCRB 3ZMRA 2N1KA 1B0RA 1MCKA 3LZRA 3REWA 5I5MA 2ZUYA 5JYLA 4G42B 4ODVH 1SDYA 2IWEA 3OKDB 1JGEB 1XH1A 3V4PA 3Q8EA 3GJFK 1DVFA 4I13B 4AITA 3MLPA 1MLCA 4MDJB 3NP4A 2WNWA 4YSOA 4OFYD 3D39B 1HK6A 1YEJH 4E9XA 1EDQA 2NYYC 3T2LA 1IJ9A 4FXKC 1U8LA 2VR5A 4JFHE 1T7YA 2K7QA 4HXBH 5JHLL 3EHBD 3IJEA 1AZVA 1G9NC 3N1GC 2I69A 4AEHH 5IB3B 5DVOA 1P1ZB 2WLZA 3BEWA 1ZHNB 1MHCB 5F7KC 2E4TA 4B9GA 3FCSB 2B2XL 2XWEA 3SQOH 1DDHA 1L9PA 5CINH 4FLHA 3A67H 4PJFF 3EBIA 1HL9A 1KV3A 4ZS7H 3X14B 1JGVL 3OXSB 3LH9A 1G84A 1JL8A 4N0UB 5AVQB 1Z3GL 3EBHA 2WWNA 2ARJB 3NIDE 1WS7A 2WWKO 5E1AA 1Q9LB 1TQVA 2AJSL 3WHE0 1YNKL 4JPVL 2EO7A 4DGUA 3P0YH 1VERA 2QHRH 5DHDA 3IBOA 2LVEA 2YJQA 3N50A 2X4TB 1A1MB 3QQXA 2R2CA 4IIQA 2R69L 3P2BA 4FFVD 5IQ9B 4DP8X 3DBSA 5HJ3A 3P3TA 1I85C 2H45A 1G4RA 5C0EB 1J5DA 2VLLB 5I0VA 4M29A 2B16A 5GGSB 3RLSA 4XXDB 1UGKA 3MLYH 4YGVA 2CDEA 4LCYA 3ZYJA 2FGWL 3EYOA 4POYA 5CEZD 1Q8MA 2WBKA 2VZTA 4IGBC 1LWHA 4H26B 2FIKB 1U8HB 5BPPA 1OCCB 4S1RH 2CK2A 1ZD6A 4HIQA 3U30C 1MN4A 3RHWK 3TL5A 3WOVA 1V3KA 4WUUA 3IKCA 3ILQC 4BUHA 3SOBL 3ERXA 3NCJL 1R5IA 5DEFB 4LCCC 3VSVA 2AXHA 1TQTA 2LABA 2R29A 3QUMH 4XPFL 4YLQT 3SO3C 3TESA 1G87A 2L04A 2VISB 3B9KB 1OTSD 5DR5H 3EYSH 1NFDF 2X1XR 3O9WC 5L8JB 4MZRA 2PPAA 4J3OF 5DMGC 1UM4H 2KI6A 4R4BB 2FUTA 1HINH 4KUCF 4LSTL 2YD5A 3KH3A 1UXSA 4IKNA 1E9QB 4FCHA 5GGQH 1CFBA 3QQ9C 1P5UC 2Y5TB 5TF1L 3UERA 2NTFA 2UYLA 4KI1A 4Y1AD 3NFNA 4JPKH 3ARZA 4OUUB 2FR4B 3N43B 3RYMA 1CGTA 1OY3B 3ZDYB 4APQC 4FQQB 1T89A 3F7RA 3VXMB 3RFZA 4HIEB 1T20A 8CGTA 1IAII 1SLUA 1A3LL 1IM9B 2DJMA 5LN4A 3JV6B 1BYOA 2XA8H 4N68A 2WZ0A 5B8CB 3HEIB 5KTEH 1G5GA 2BDNL 2VDNH 1JIBA 1SBSH 1FYTD 4C4KO 4FNSA 4TSAH 5AVTB 3A23A 3ILEA 4OV5A 4L8SA 1CXIA 1XX9C 4JKPH 5D7KD 4J12A 2RH0A 5CEZL 2FWUA 3T04D 1XCTB 1QRND 1ROCA 1ZJBA 1EFQA 2RHEA 1A9BA 2A1WL 2VR4A 4M8QB 4WNQB 4G7QB 1VGEL 5E99L 4IMLB 4R4NC 5IB1A 4B0MM 4BZ1L 5BZDA 2HRGA 2FNBA 4HIPA 2R27A 2X4QA 2AQQA 1FL3B 1CE1H 3C9NB 2AXGB 3L3OA 5T5NF 2DQTL 4DSYA 3T09A 1KN4L 1A6VH 5AL0A 4PWJA 4A04A 1UYWH 2VAAA 3HMXL 3ARDB 2V5YA 1UOVA 4LBAA 1IUZA 2ADGB 1I8KB 3BMVA 2Y07H 3ESOA 3S5LG 3MI6A 3GM8A 4HZLA 6FABH 4XAWH 3R8BB 1AP2B 4R90H 4M4PA 3VX0A 1FJ1B 1TCMA 1BZ9A 3D25B 1A6TB 2NY2B 4I9XA 3B3IB 4KGLA 1X5LA 4U1JB 1GS7A 3BPNC 4LAJH 2TSAA 1NC4A 2BCKA 4KKNA 4EN3B 1U2YA 2ZWNA 3GBML 4JKNA 4PJFB 4OLXH 3GMPA 3CZKA 3D2TA 1LO5B 4KKQA 3VXNA 3NAAH 4F7CB 1E28A 2AK4A 5KYYA 5TK4A 3VG9B 4RSVA 3O6FD 2YUWA 4A38A 3U25A 2X70A 3O2VH 4UWQB 1B6UA 3MV7E 2BVQA 4YWGL 1PBYA 1JOIA 3AQYA 4F5CA 2KPWA 5ID1B 2F8XC 2MPAL 2PTVA 4NBZB 3US0A 3GKWH 1AJ7L 1GZHC 3WL9B 4YDVB 2BNUB 5C0DB 1NCBH 5HGGS 4ZD3H 3ROOB 1YUHB 1J1XL 3QWRA 5D1QE 1T1XA 1SUHA 1F90H 4G6JL 1Q1JH 5IEKB 3RL2B 3V8CA 5D6DA 1QLFA 1KF9B 1QSED 1TVHB 3MJ8B 4GW4B 2H0EA 2WWMD 2WJ5A 3MLRH 5JLZB 1FIGL 2NY0D 1UJTA 3WD5H 4YSCA 2FE0A 4UBDD 1PG7H 3LKOB 3X1NA 2CGRH 3VSQA 3M8OL 1IO4C 4PGDA 3W37A 3H9SB 2V7HA 3NIFF 1NFDB 3PWVB 1BJ1H 2VLRD 2AV7A 2NT0A 1LO2L 1MW0A 2LTQB 2FGZA 3T0VA 1HFUA 5DYFA 4OKDA 5C0BA 2PUQT 3V5DB 2HT4C 3ZKXB 4NFBA 2BHFA 3GSWB 3CDFA 2A38A 2F7IA 4LGPB 2XFXB 2E46A 4KMTH 4R4FL 4E41E 1YEEL 4BCYA 3SE6A 5HGBA 1B0RB 1IAOA 1KXQA 3GM0A 4KZDL 3PHSA 3REWB 5BQ7A 1CC3A 3AC0A 1MHHA 5I9QB 3HG1E 2C4XA 4X6DE 3V4PB 4QTIL 5ELIA 1DVFB 1E0OB 1IEBA 4LARH 1E4HA 4HIIB 1KCRL 1RP8A 4DTGH 4OZIA 1JNHA 1ESOA 1NBYA 3F04A 1IBYA 3EBGA 4XPAH 1U8LB 3IT8D 3MJ7A 1ZHKA 4YVNA 3CC5B 1IC1A 2LHAA 2O4EA 3IJEB 4P46A 1BEXA 4FQ1H 4N8PA 5I18L 4P5KA 3BEWB 1XF2B 1JS4A 2K0RA 1CURA 3C60A 1S7QA 1IE4A 4M6NH 1DDHB 4O02L 3VD4A 2X0WA 4L5FL 1BZEA 3HFFA 4K7PY 1XL6A 4PJ7E 4XO9A 2XKUA 5IHUH 3UEZA 3DX9A 3S98A 3ZKSD 3KJ4B 2C3WA 5LWYL 3RI5K 4GSRA 4MVBD 2RJMA 4HLZH 4A6YL 1I9RH 3Q2VA 2WGXA 4ZMZA 5INCA 2XTLA 3EOAA 4N1EA 3UGUA 1RVFL 5E1AB 5C09D 1KTKE 1MW2A 2JB5H 3NFPA 1PKQE 2V4LA 5E9DE 4F7EA 1HZHH 3UROR 4D9QE 4IIQB 4C59B 2B1HH 1HHKA 1X4ZA 1ML0A 5HJ3B 1DBBL 1OCWH 2HKHH 2NMSA 1ETB1 2ZP0T 1ID2A 1M57B 2QHLA 2Q9OA 4UOJA 4BDVA 3AM8A 1CLZL 1HTYA 3GXIA 4YGVB 2CDEB 4LCYB 4ATWA 4CJ1A 2FCBA 3EYOB 4UT9H 1BVNP 1GR7A 3L4CA 5B7EA 3OKYA 5TFSH 4K5NA 4JRXD 1SQ2N 5L2KD 4MNHA 2VOTA 5EDXA 3HVNA 5B1BB 2VXTL 4WUUB 3IKCB 2WVSA 2BZDA 3QCVH 1R5IB 4F1ZA 4KHXH 3LQMA 3N2JA 4UQCA 5I6KA 1NWPA 2BVEA 2EDBA 2UZXA 3WKMH 2E7HA 3E8UL 4X8XA 2BJMH 1CGWA 5FK9A 1U4EA 3H55A 3H42L 3LZFH 4J39A 4L0PB 4ZUVA 2XUWA 5AW0B 1Z3RA 3GLDA 1UXSB 4GBXA 2H2SC 3QIUC 1HEZA 1T7VA 2NTFB 2UYLB 3NZ8A 4W9FC 4O2CA 5D5ME 1WTLA 3NFNB 5I5IA 1CBVL 1J5OL 3SDAC 3BUYA 5G4MA 3JVGA 5D2NE 1E8WA 3RWDA 1RURH 4BFJA 4P9HH 3RFZB 3E80A 1T20B 4KU1A 3F64A 3R0MA 4AT6A 5IJKC 3NIFB 5IY5B 1D2PA 1RZ8A 3WTSA 1J0HA 3TF7C 4QKTA 5FYLD 5J12C 4OZIF 3EO1A 5IWLC 3T2OA 4R96A 5F7FA 4IJ3B 1QFHA 3DV6A 4X6EA 2ODHA 4OV5B 4RFEA 1HE8A 4L8SB 1U8IA 5BS0A 1VIWA 5IUSA 3MMEB 3D85A 3DKHA 3KYOA 4N9OB 5ITBH 2CO2A 5C6PB 1K5NA 3TV3L 4TXVB 2LAGB 1G7MA 4LDEB 4PMEA 3KZ8A 1I1RA 3S88L 3O81A 1A9BB 1QX1A 5IB1B 4HPHA 4FL4B 4U6XA 5BZDB 5HHOE 2ADFH 3DO4A 3T6QC 1IGML 2X4QB 4OD1L 5CGYC 4D2NA 2MCPL 5C6TL 2IOMA 5DRXA 3P9MA 2C9PA 2VITA 3L3OB 3FSAA 3GIZH 4OB5H 1SHMA 1OAKL 4LSRH 1OARH 5J7CC 3BGAA 2VAAB 3CC1A 4A1RA 3W57A 2PR4H 4L4TA 2V9RA 1TLKA 5HYQA 4PLJC 4WWID 4DCQA 2ZCLL 4HZLB 4M7KH 4P99A 3MLTA 3WFEL 4JB9L 4KVNH 2YMXH 1NM9A 4JFUA 2E9WA 3ZDZF 1BZ9B 3VXSE 4M5ZH 2CIKA 3N9GL 1MHPL 4MNQE 1H5BA 1ERNA 1QSFB 3MACH 3NEOA 4LP4A 3WXVH 3PDGA 1G9MC 1NC4B 2BCKB 2APFA 2J7LA 3I75A 3L1OH 3OAZH 1C8PA 3MU3A 3GMPB 2OJEA 3B34A 2F1EA 3VXNB 3V0GA 1E28B 2AK4B 5KYYB 1OM3H 5BVPH 2NW3A 4FC3E 3RZWA 2H0PA 3QFGA 1FNHA 4DZ8A 5L4JA 2X70B 5DK3A 1HWWA 3B9KD 1UG9A 4YX2H 2BVQB 5JIKA 4OF5A 1KLUA 2EDTA 3LMJH 4HUUA 4D7BA 1V7NL 4Y88A 1FO0H 4XMLH 1UTDA 2HP4A 2F8IA 1WFJA 5IQNA 2ZXQA 1G7QA 3HOGA 4JRYE 4WSKA 3VD0A 3CVBA 4JFDA 1T1XB 2CO1A 2PABA 3OMIB 1AS7A 2QPDB 1EO5A 3CXFA 1QLFB 4PM1A 4K2UH 2L7JA 5D7IA 4WTXA 4LB8A 4FKEA 5EEWA 4CSPA 1FPTH 5DWUL 1WQVT 1IM9D 4H8WC 4NI3A 1CICA 4GKSA 3ZUNC 4Z7WA 2VT0A 3QJQB 3EF7A 4PGDB 3Q8CA 4NQDE 2V7HB 2WKOF 1NL0L 1S3RA 5E8OA 4BK4A 3BKYH 2DL2A 3RILA 5C0BB 2OKMA 2PW1A 4NN6C 3EO0A 2CCLA 4HEPA 4U1GB 5AW6B 1JGDA 5EZIL 4NQVA 4OFQA 3BN9D 4ZODA 1URLA 2PYFA 4UQAA 3HG2A 4Q9QL 1DCLA 5TTRA 5HGBB 5A3IC 3IVKA 3MRLA 1IAOB 5BQ7B 1M7IA 1FFPA 3V4VH 1MHHB 3TT3H 1NLDL 4ZUTB 2F5BL 1X44A 2CWRA 2W07A 3AUWB 1HQ4A 2CLZA 4MZ3A 3G5ZA 5DJ0A 1IEBB 4S11A 2DM2A 3VYNA 3ARDD 5CS7A 4ZOAA 4OZIB 1JNHB 5FYKU 3E3QE 4ZO8A 3O6ML 4KXDA 4AMKH 4OKVA 3WLWD 3BKCH 1ZHKB 4DKAA 5I15L 4QXWA 1ZVYA 4PB9L 1J12A 2PR9A 4P46B 5DUPH 3X11A 3H4HA 2YOCA 5E70A 3BDYL 4P5KB 4X80L 2YPKA 5EMYA 1OLZA 3RX8A 2P9RA 3CK0L 3C60B 4YHYC 1NCJA 1S7QB 1UOLA 3JWDC 1ITBB 4AIEA 1L9QA 1FH5H 1QVOA 5DHVH 5AOKA 4I3RH 2YA1A 2VLKE 3DX9B 5K1NA 1HL4A 1BGXL 4QHKJ 3S5LA 4HHAA 1MCOH 3IGFA 1MVFA 1RZ7L 1HHHA 1TG8A 1FZOB 4HFWA 5HI4C 3EHBC 3BPOC 3QRGL 3EOAB 5INCB 4DVRH 4UOZA 1XT5A 3ULSA 4G70B 1L3NA 1CUOA 1Y0LA 1EEUA 4PJGE 2FO1A 1T4KA 1WIUA 3CN1A 1TYRA 3OKLA 3M1OA 4YSPA 3ZDZB 1MCBA 1AO7D 1L0XA 1HHKB 1NBQA 3HI5L 1JFHA 2XXCB 4WNJA 3UTZA 2VWEC 4GKZA 3O3BA 2OYMA 4J3TA 4LCWD 4OIAA 1DVYA 4KTDL 5I1JH 4HPOH 3FQ1A 1AKPA 3QR1A 3IU4L 5CJQH 4BDVB 4Z7QB 2A6KA 3PNRB 2F61A 2ZF9A 1D9KC 1BLNA 3ZO9A 2HPTA 3TXAA 3HG3A 1G1YA 5JUEH 3GTNA 2W94A 2YBRA 4MNHB 2Y3NA 2DI8A 3S35L 4BCZA 1QTSA 3H9SD 4PJAE 3EXLA 1S46A 2WQWA 3BPLC 2Z7YA 5I1HL 1NTDA 3VMOA 3TLRA 4Z7WF 4K71C 2EDYA 4J3OD 4N2OA 2UZXB 4E42A 3NZSA 3GUTA 4M48H 4KUCD 5FK9B 1HAUA 2WOBA 2W60A 1DVQA 2V3DA 4MHHG 4ZUVB 3A6BL 1NAMB 4FG0A 1BD2E 4AL8H 5SWZE 1BXAA 3RY4A 4PJ8A 4MNGE 3BFWA 4GBXB 2ZICA 4NHCL 3G5WA 1A2YA 1HEZB 1KT2A 3NZ8B 5KVDL 2O5ZH 5FDYA 4U05A 5LAXA 4O2CB 1QI3A 3U1QA 4ORGA 2YKLL 2YA0A 4EIGB 5E24E 3MNVA 1XQ4A 3BUYB 1QG3A 3CSPA 4HIXH 2HKAA 1EANA 4ZRGA 5MI0C 2DQDL 5AKTA 3RWDB 2I5YL 3N85H 4X5WA 1DVFD 2XVKA 4BH8A 1KV7A 1OAQL 1AQKL 1OTSC 3MBEC 4BIKA 5I30L 3ULUC 1ITCA 2CE6A 5KVGL 6TAAA 2CO4A 1RZ8B 5T1MB 1FF5A 5BQDA 4NQCD 4Z8FL 2JCWA 3EO1B 3AXIA 4R96B 3ESPA 2DYSB 3B43A 4JG1H 4NM8L 1E9PA 3DV6B 4U7SA 4X6EB 4IBLT 2FX9H 2Q3AA 4WWKC 2DBJA 2JLPA 4RFEB 1JTOA 1VFBA 3FN9A 4XX1G 1U8IB 5BS0B 3HE7A 3ML9A 4PJCE 3KYOB 1KELL 4L23A 1WZLA 3L9YA 1K5NB 3MBXH 1TPXC 4PLKC 2W91A 5HI5C 1RV6X 4ADJA 4YE4H 1SVCP 4HCIA 4U6XB 5C0CE 2E27H 5I0ZA 3MTXA 5INDA 2KL6A 5DRXB 3P9MB 1QBBA 2VITB 4LSSH 3D5OF 4MZ2A 4ZMAT 1KB5H 4BFKA 2X44D 2H2PD 3UACA 4NT6A 2FQFA 3O2WL 4JQVC 4J7RA 5LCVA 3VRLF 4L4TB 1QATA 2VJXA 5CJXC 3H9YA 5HYQB 1DQML 4NQSA 3LQAL 4L9LC 1Y07A 2VSDA 3MLTB 3UBXI 5EOQL 4G83A 2G9HA 2DQIL 3F6IA 1ETJA 2EXYC 2CIKB 2WQSA 2MTAA 3LN9A 1H5BB 4OR1A 1R47A 1ZLDA 5ISZA 4YFEA 5AB9A 3ZTJG 1PVHA 4LCIL 3CVDA 3R7QA 3V4PL 5I16A 3I75B 1LVEA 4FNPA 5HGAA 4ELDA 2YGNA 1JI2A 2CBTA 1N4XL 2OJEB 2E76C 2GHWB 3CNKA 4FLRA 1E50A 3KPLA 3AB0C 1PX8A 3INOA 2NW3B 5F7WC 3SE4C 32C2A 1H6TA 3U0PA 1RUMH 2GABA 3VA2C 4DZ8B 1UM5L 4FFTA 2EDOA 3JQOB 1E6JH 1NLBH 1DTUA 3FU9A 3RY6A 1AH1A 3CFTA 4HUUB 3FFOA 3D1MC 1E4XL 3NCMA 1TNMA 3Q2LA 4GT7A 5CUSH 3FAWA 5L2JA 4X6CE 2JKXA 2BMKA 5DC9B 2GUOA 1G7QB 4X6BA 3H2QA 5HVHC 3QEUA 4AGQA 4GG8A 3GFUA 4R5XA 4OQTA 4JFDB 4IRZA 2FZ3A 3O6FC 4L05A 4DERA 1MJ8H 4FFWD 3X3FH 3L5XL 4Z7VE 3SKNA 3ZHLA 1OAXL 4TQEH 3FQNA 4FABH 1ZCRA 2IH8A 1CICB 4GKSB 4Z7WB 1WAAE 4M93C 1KXTB 4WEBH 2ZUVA 2ZSWA 5DO2C 1U8OA 3O0LA 4NOFA 1OGAA 3S8GB 3Q06A 1H8LA 1FNEA 1XR8A 5E8OB 4XNDA 4UV4H 4AQ8C 4ZSOA 2YK1L 5IVOA 1KB9K 1ZGLP 2PW1B 4M5YL 3GTTA 3EO0B 2ZYSA 4HWEH 1FZMA 4JMNA 1SPDA 3OHMB 3S37L 1JGDB 5K5YA 4QYAA 4JFEE 5DURB 4NQVB 1UD4A 2NY0C 2YXMA 4JHWL 4PW4A 2PYFB 4RGOH 4PJDA 2J6WA 2X9ZA 2BXZA 2YD7A 3GF8A 1GGCH 4FXTA 4UBDC 5I1CL 3MRLB 3IVKB 4M6OL 4KMLB 1M7IB 1FFPB 4NN7C 2IDQA 4TF4A 1JFQL 4PYHA 2N7SA 4TQPA 3EOTH 4K9EH 2W07B 2DRUA 1HQ4B 2CLZB 1EJ6A 3G5ZB 5DJ0B 3O0RL 3SPVA 2ZUQC 4M8VA 3CBJB 4X6FA 1ZPUA 4NAJA 4G8FA 3N44F 2B4CL 3WUZA 1J0ZA 4XNUH 4OKVB 5CLTA 3AABA 5BRZE 2TRYA 2X2HA 2RACA 2YOAA 5HBBA 3PQYA 3CVIH 3BN3B 2X6CA 3FQTB 3X11B 4WF7A 1J1OL 1JZ6A 1BAFH 3I3BA 4XVSH 1K72A 1KTCA 1NC4D 2XWDA 2YPKB 1U3HD 3MYZA 4DKEH 4ZUUA 2C9VA 3PIQA 4JGUA 4Z3HA 2OCFD 1BJ1J 1MPAL 4M6ML 2AK4D 2Z7WA 4NN5B 1QVOB 3RE0A 4DH2A 1L6ZA 4YBLB 1ACYH 1MG3C 2DQUL 1U95A 3MDJA 3ZY7A 1IGIH 3QJRB 3BD4A 4GRWE 4HHAB 3U4KA 3HN3A 4HFWB 3IEAA 4RFNC 4BQCA 4TL4A 1I75A 4YC2C 3L5JA 1WTGT 2HWZL 4BWTA 3ULSB 1RJCA 3SEPA 3F01A 1Y0LB 5TGBA 2X4UA 1T4KB 3OKLB 3WNMA 4F7TA 2QVMA 3FJTA 3PUUA 1BZ7A 4JVWA 2HX7A 3UTZB 1L9RA 2RR3A 3QJFA 1DSFL 3O3BB 3MX0A 2WCGA 4AG4L 3G6AA 2ZCKH 1PZ2A 3FT3A 2A6KB 2EUZA 4KZCA 1PU0A 5K33A 3GMRA 1BLNB 2WK2A 2A2QT 5EH1A 5L8LB 2AQTA 4ODBD 3LIZH 1A5FH 3KVDD 4R7VA 2X1QA 1OD7A 1DLHB 3RL1A 2YBRB 2EIDA 3T2NH 1H0DA 3PP4L 3TA3C 1SVBA 3FU0A 3GI9H 3AXLA 2NY5H 2ZCZA 1VZIA 2NYKA 2UWEE 1WFUA 5C0BD 5H35A 1Q0XL 3UZVA 3GUTB 1DZBA 3QQ4A 2W60B 4WFGD 2QTEA 3UX9B 4J3VA 3SBRA 4LP8A 4JPSA 3SJVD 3STBA 4PJ8B 4WDIA 1UEYA 4JO4L 1A2YB 1KT2B 2EDRA 2F53A 4U2ZA 1I1AD 2P5WA 2QJDA 5LAXB 4E9TA 4ORGB 4YK4C 3MNVB 4PJDF 5KVFE 5LNGA 4DEWA 2H1XA 1CK0H 4EZMA 5I0WA 3FTXA 4XZ4A 4D8PA 1BG1A 4UTAA 2XTJB 4H20H 4X5WB 2NX5A 1T4WA 2KLTA 3KM1A 4BH8B 2ZP8A 4FP8H 1J11A 2HT3D 3VFRB 3AG2B 2D7QA 5AVSB 2X0UA 3ARVA 3HRZA 5F0MB 3OG6B 4BFFA 1AZZC 1RZJL 6CGTA 2WHVA 1AC6A 2F7PA 2VJ0A 4AI7A 4DN3H 1DJYA 1VFAA 4N2LA 1CL7L 2WLNA 4TSBL 2D7TL 1ZT7A 4P46D 3TN0D 4YDKH 1E9PB 3ULVF 1WWAX 5CILH 2X5PA 1VFBB 5I8OL 3DX7A 5D4HA 3HE7B 2HJKA 4IYKA 2XV6B 3RUGA 1D5BB 2X2IA 1HINL 4FTVA 1J9TA 2VRKA 1PX4A 5HJBA 3EJUA 3DI2B 3T3MF 2FEEI 3QPKA 2Z7UA 2AKRA 1K4CB 4RSYA 2BERA 2V5TA 3HC4L 4WZ9A 3UP6A 4JPKL 1UWEH 5CN1A 1U3YA 3FPXA 2V9UA 1I3UA 3QHFL 1PAMA 2CA4A 3BT0A 5INDB 4U0QB 2HFGH 3UTSE 3N44B 4KXBA 3VXUE 4NZTH 1SXBA 4NT6B 3FUHA 4X0KA 5E2VL 1FCCA 1CTNA 4YLCA 1MW1A 1PY0A 4Q89A 1I1CA 1MEXL 4NQSB 1OPOA 1GGUA 3L6FA 3MLWH 2G9HB 3G7TA 1UD6A 1QABA 4PW9A 2EIKB 4RX4A 4TSAL 4UNVA 1JNNH 2Q86A 3D18B 3UJTH 1OZTG 1WHPA 2K9UA 5ISZB 4WUKH 1F6FB 2R1XA 5I16B 3BVWA 4JHAL 3QHZH 4FLOA 5HGAB 5I1KL 1MCQA 4FQJL 4BINA 1L9NA 1OAZL 3T77B 4XO5A 2J55A 3KPLB 1BMGA 2ICWI 2XZCL 4QRUA 3BJ91 3FCTA 3EYFA 3ZTJH 3U0PB 4HT1H 2PWEA 5E2UL 3M1BA 1AFVL 4PRDA 5TDOA 3S48A 4O51A 1MCLA 3FHQA 4HDIA 1GCFA 1AMYA 3T0DA 4JZJC 5K9JL 1LK3L 3GLAA 3LD8B 3PWUA 2K1MA 5GZNC 5L2JB 1PIGA 3IMTA 2BMKB 2GUOB 3HN5A 4X6BB 1I9JL 4G3YL 2J1ZA 3OPZL 2EE0A 3KWWA 3QEUB 4GG8B 4GQ9L 4OLVH 3DC0A 3WO4B 1DFBH 4FFZA 2VW6A 4PJEA 4DVBA 2WYHA 2FZ3B 4NJAH 5EORL 4AJVA 3C08H 2OMYA 2D4FA 4MLIA 3SKNB 5C07E 3WEXA 3EKCA 3TZVA 2MQ0A 2VDLH 4MD0A 3FQNB 4P04A 1RULL 3OC8A 3ASWA 4YDIL 3VACA 3SKJH 1KFAH 3ESUF 4CL7A 3TFKD 1XIWD 2G60L 3CN4A 3O4LA 5FUZH 4AYDC 4JHBA 2ZSWB 3T2QA 1OGAB 4HX1A 3UC2A 1FNEB 4XVJL 4ZSOB 2BINA 1LE9A 2AAAA 4HK3J 4QR7A 3DJTA 4NC1C 4XP1H 1FZMB 5I1IL 5BS0D 3RRQA 3KW7A 4AGPA 3D85D 3QXWA 5JR1L 3TYFB 3EJTA 2G3XA 5F7UA 4W9HC 3KWTA 1N8ZA 4EZLA 1BG9A 2YGOA 3RUGF 4PJDB 4R97B 3ZZLA 5BUGA 3V10A 1A1NA 2WJ7A 4R7XA 3AG1B 1MCHA 1L9TA 1F2QA 4FEIA 5FW6A 3UYRL 5AW9B 5B8CC 1F42A 1R0AL 3P30L 1AANA 4UU9A 3HHMA 3PU7A 4LF3A 2E8YA 4N20A 4Q8BA 1QQDA 4LLVA 1JCKA 3SPVB 5DQDH 1XD0A 4X6FB 4CVUA 4G8FB 2YD1A 1MVYA 4J5VA 5DCCA 1NAML 4NCDA 3PXJA 4Q0XH 3BN9C 3GBLA 3VJ6A 1E4JA 4ZK8A 4FMVA 3PQYB 4U0RB 1J0KA 5A40E 1S7UB 3R8QA 3JWNC 4UT7H 2WO4A 4UUJA 1GGTA 4G1MA 3TT1H 2E59A 3CHQA 1QPXA 1E5UI 1UC6A 2XJLA 2VLJE 1XAUA 3T3MB 2F5AH 4F91B 3MRFA 4LFHG 1EBPA 2E7LC 4XHJD 4N5UA 4TLTA 4ZUUB 1NGZA 4IKLA 3TYGL 4XE5B 3OJDA 2Q6WA 4FJYA 5FCUH 1C9SA 2MFNA 4GH7B 3ARDC 4OF6A 1CXHA 1U95B 4D3CL 2AP2A 1ZDSA 3UAEA 1BZQK 1C5CH 3WLWC 1U8JA 1JGUL 3ENEA 3U9PH 2QQKH 3TEUA 1BM3L 5BV7H 2YAQA 4PRPA 3MRHB 3ALPA 5JXEA 2WLMA 1H3UA 3ZR6A 4CN4A 3X12B 5TGBB 6PAZA 4OGAD 4UB0H 2X4UB 5HHQA 4J2XA 4YZWA 4F7TB 3MROA 4B9IA 4F20A 1OOWA 5IR1A 1BZ7B 2G2PA 4JFDD 2OPCA 2JJTC 1TTRA 3QJFB 2RCSL 3MX0B 4L2YA 3G6AB 3AT0A 3FT3B 4OT1L 4IU3A 4CSTA 1GZPA 1N67A 4LOFA 2BOBA 3GMRB 3R1GH 4GS7B 2O6EA 2WVUA 5IROA 2GBVA 2X1OA 3JV0A 1AOZA 5CJBA 3L4WA 3RL1B 1CICD 1J5IA 2Y72A 3LN5A 1OCZB 2QMKA 3AXLB 4G6FB 5J3HC 1UZ8A 4G72B 4HS3A 3RKPA 5H35B 2BIPA 3UZVB 5DD0H 2VE6A 3MV8E 1T2QH 3E6HA 3QQ4B 4KK6D 5AB2A 2FX7H 1A7NH 4ZMYA 3UH8A 2IGFL 5DURD 2ZUWA 4QHMA 3SCMA 1JTPA 4H88H 4WDIB 4TLKA 2OMBA 1I8MA 1KENL 1MDTA 5EUOF 3ES6A 4R2GB 4RA0C 2F53B 4N26A 3MRQA 5EIIG 4TULL 4XMPH 1NDTA 2IH9A 2P5WB 4UDTA 5DZVA 2ZX8A 4LEXH 3GT6A 5LAPA 4OVUA 4X7SH 1WIPA 4MYPA 5E8NA 1VEMA 2BHUA 4A66A 4D8PB 1ZV5A 3ARRA 3FB7A 2LTQC 1YEFL 2A9DA 2NX5B 3GXMA 3AG3B 1C08A 4DKTA 2EUVA 1MCEA 4OIBA 4KX7A 2E9GA 5CGMA 5HHXH 1T80A 3HRZB 2J5LC 3IAQA 2UXGA 5C97A 2F1BA 1U92A 1JPSL 5EG6C 4BSWA 4LMQI 1VFAB 4LNRA 1O9ZA 1ZT7B 3EDKA 4J28A 2RQEA 5CFHA 3F7LA 2BPBA 1QYGH 4YSTA 4OF7A 2DKSA 1IX2A 3DX7B 2HJKB 4RFOL 3RUGB 1AHKA 4FTVB 1AGEA 2ICWJ 4KI5C 5AVVB 3RIFK 3SBWC 3TNMA 1EPFA 2AKRB 1OT2A 5AW7B 5JOPD 1XGRA 5I5RA 1I1YA 2XN9E 4JW3A 1ZANL 1J9QA 1KCVL 4KY1L 3ZIMA 4XC3L 3U4BH 2ZJSH 5E9NA 2FL5A 4PWIA 3BAYA 4FNLH 5I1GH 4RZCA 4YGAB 2JQZA 5FYKE 1DQTA 1PMYA 2JELL 1YYLH 4X0KB 4PSPA 5LBSH 3H3PH 3FQXA 2IAND 5AKSA 2X9WA 4PREA 3ELAT 4YXLH 2J6EA 2VLMD 3TCXA 1W15A 4X4XA 2C9XA 3L6FB 3UG3A 3OGCA 4WJ5A 4ZMQA 2Q87A 4Y8AA 1NSNL 5FGBA 2Q86B 4ZX3A 5K1VA 5C3IA 1W8NA 2R1XB 1BSIA 3DUSA 4PVNA 1A6ZA 3DHJA 4PI0A 2WQRA 4YHZH 2WXIA 4OV6F 4P2QE 5E08H 1MFMA 2XG5A 1GJWA 4GSXA 4LL4A 3BWUC 3LB6D 3L9RA 1ZVHA 1F3JA 2H2PC 5J1SC 4IJTA 3GJEA 5T3ZE 4QRUB 3FCTB 3QJUB 5HVWA 3EYFB 3FUEA 4OU3A 4YDZA 3M1BB 4G7RB 4PRDB 2NY4C 4IIQC 1AZUA 2B9BA 2E9IA 4O51B 3SGKC 2DIBA 4HDIB 2OTWA 3CDZB 4JDVA 5FIEA 5GRUL 4N0YH 4PUBH 1TJHH 5FR3A 1U9KA 3PWUB 4G7YH 1AI1L 4HPYL 4RMUA 4LGRB 3NA9H 1M7UA 1V8HA 1W8OA 2A3TA 3PJSA 3QIBB 2M83A 3KWWB 2QADC 4JQIH 1BFVL 2IG2H 2JE8A 4PJEB 4DVBB 2BSED 4LLMA 1X6NA 3RKDD 1J8HA 1UACH 2DQGH 4GFTB 5GGUA 3QG7H 1TZIA 2ZXBA 1F56A 2O1AA 2OMYB 4Y8DC 3VMPA 1LP9A 3WEXB 3VWJA 3CZGA 1MDAA 4XPHL 3SO5A 3TZVB 1T7WA 2DOCA 4MD0B 5AVUB 1TQBC 1OTTC 4M61A 4G43A 1DBAL 2ARWA 2W59A 3O4LB 1E7UA 1HCZA 1MIML 1KG0A 1BWMA 4HX1B 2DDQL 1ZE3H 1AZNA 5TQ0H 3VCLB 1JDDA 4CGUB 4XMUA 2AV1A 1LE9B 1DBJH 3FL7A 3PE9A 2OZ4H 3GD1C 1GZQA 2ZXWB 3HE7D 4IOSA 2CIIA 4G9FE 5EUOB 5AD0A 1VADA 2CLRA 4XN9A 3KCPA 4OM1H 3QK0A 4Q6IA 4QRQA 1SJMA 2AJYH 3PFQA 2EEDA 4WLCA 1UH4A 1OPGL 5GJTL 3BH4A 3T4YA 1JNJA 1MUJA 1PEZA 4M62L 4J3XA 4PGBB 3V52L 3RVXD 3VRJA 4G8IA 3UTPD 2XACC 4UU9B 4LF3B 4R8WL 1QQDB 4LLVB 2QMJA 4IJ3C 4RRPA 1BLIA 1IC5L 5DUBA 4K4KA 5CSZA 2I9TA 4LIQL 5KZCB 1MREL 4G59C 5AVWB 3VJ6B 3SYAA 3MRGA 4NUGH 1KBWA 4UUJB 4O58H 4G1MB 5DA0B 3ZE0F 3L2LA 3N55A 5ISZD 1OD9A 4JRFA 2APWA 3MRFB 2AERT 5FYJH 1BA9A 5A2BA 2UVFA 1MFDL 3VAEA 2C3GA 1NGZB 3OJDB 2Q6WB 3T3PF 3AMLA 4DIXA 2J1XA 4DGIL 3MGTA 1ILUA 1IC0A 3IDGA 2GK0A 3CBKB 3W9EA 2WM0A 1YEIL 5GGTH 2ICEA 4XVTL 2NDFA 1U8JB 4P9ML 1DBML 2BFVH 1SZNA 2ZQKA 3HG5A 3UO8B 4PRPB 2WXOA 4TVPE 2YQ2A 3MCLH 1NMBL 4OZGA 3GJFA 5HHQB 1ILSA 5CWSA 1A14L 5CSGA 1U3HC 1ZLUK 3MROB 1YY8A 3ZJAA 3MFFA 5IR1B 1JYXA 3CXHK 2E47A 2CAKA 3LXUX 1AIZA 1LO3L 1E8YA 1IGCL 4DP5X 4IU3B 4JM4L 3IMWA 3MXVH 1GZPB 3H8NA 5E51A 1MFEL 4F8TA 5I73B 1UWFA 4D9LL 5J4MA 2BOBB 5CSBA 3V6OE 1JF6A 1ZLSL 4FZEL 2CJUL 2BSTB 4ZXBA 1AY1L 5KOMC 2KKQA 1J88A 3BUQA 3LN5B 5LCVL 3NDYE 4XNMA 2ATKA 4WWOA 3PNWA 5CZVL 3RWCA 2CBOA 3APNA 2GJZA 3C6EA 1UZ8B 2DLTA 4HS3B 4RGMC 4XN8A 5KVGE 2XWBA 4IQHA 3IMSA 5DC0A 4Y5VA 1U8CA 2ILLA 4LDLB 1CD8A 3MRCA 5D6DC 4GXVH 4XPBH 4QHMB 5HHVL 3SCMB 3VGFA 4NS0A 2P7TA 4MB4A 1I8MB 3VD1A 3ES6B 3IRPX 3MRQB 1QFUL 4UDTB 4XT1C 5DZAA 2A9AA 3Q48A 4UQ2A 2OZ4A 1NGYA 2XY2A 5E8NB 2DD8L 4LEOA 4JAMA 5ETUA 1COBA 3FB7B 2FX8L 5F1IA 1C08B 1J10A 3K5RA 1AVAA 5IT2L 4Z6AT 2WXMA 1RKRA 4HCFA 3P0VH 1FBIL 2X6AA 2VAJA 1U92B 1ZTMA 3D6GA 4BSWB 2XWJB 3PQYD 4XN2A 4I77L 4LNRB 4OQTL 2OSWA 2A77L 4IRZL 2Q7NA 1N6VA 3T6VA 1I1AC 4NEHB 1M71A 4A67A 3WFHA 1CI5A 1OAUL 1I7ZA 1J87A 5D72H 4KKAD 1A47A 1O7DE 1BQ5A 4NWTH 1AGEB 3VD2A 5I75B 2I32A 3C6LA 3QIWA 1Q94A 2W0LA 3TNMB 1T1YA 3VTTA 1GH7A 1UOKA 5DMIL 2HT3C 4YDLB 1XGRB 4I89A 1I1YB 2L7UA 3L4XA 3U9WA 1JPGA 1MF2H 1PNCA 3TEWA 3P4MA 2FL5B 5HVFB 5E6ZA 5IQMA 1CVSC 1N70A 2DI9A 1BVZA 2VR6A 4K5MA 3RTLA 1G1CA 3K4ZA 4RZCB 2HVKA 4P46C 4FQXA 5DUML 3TN0C 3WIHA 5GS2H 1M9SA 3B83A 3U83A 1GMIA 3KPQA 4NX0A 2XY1A 2GTZA 4ALAL 2MOQA 4PREB 5B39G 3NP3A 2XZAL 2B77A 4X4XB 4AYSA 1FC1A 2A4CA 3OGCB 2Z1KA 1F58H 3QEGH 4WJ5B 3L3JA 4EIUA 4ELME 1FA4A 3SGEH 2QVIA 5J9PA 2CHWA 3WFCL 3DUSB 2HX9A 3T3PB 2DLFL 1SFDA 1A6ZB 1ONQA 2X89A 1WFMA 5AYTA 3ZE2F 2XG5B 3L9RB 5DRZA 1F3JB 2WZ5A 3ARYA 3PL6A 4MQ7A 3GJEB 3FO1A 3SGJA 3W5MA 4GRLA 1U33A 1IIIA 1GC1H 4G6FD 3ULVL 3FBQA 1GIGL 1IGJA 3MZTA 4S0TD 4TSCH 4DGWC 4XR8C 1XCQA 2OTWB 3QJVB 3CZJA 4JDVB 4JQXC 4WI0A 3RZCA 5F7EH 2D3VA 1JI1A 3I84A 3BLPX 2HTKC 3SE3A 5BO1H 4PRBA 1B88A 5AZEL 2NZ1A 3SDDC 3WENA 3PJSB 4NFDA 3WKYA 2VTFA 4YHLL 5MEPA 2BWDA 1EHNA 4KK5D 1VDGA 2VDQB 2GJ6A 4LLMB 1JBJA 4NRZA 1J8HB 1DVSA 5GGUB 3ARUA 3QA3B 1CTMA 1TZIB 1UQSA 2EO9A 2NX5D 3K46A 2AVFA 4YHPA 4Y4FC 3VWJB 4EUPH 2J4WL 4KHTH 2PKDA 4DW2H 4M61B 4G43B 3MO1A 1N6UA 2YSTA 3ZKMD 2EXWD 4QRRB 3TC9A 3HC3H 1CR9L 2VDOH 3L3DA 1KG0B 1XF5A 4J4PA 1BQUA 4EVNA 4PGEA 1S5IL 3CMOH 1DJWA 4O9HH 2AV1B 3CPLB 4OCXL 5EIIA 3BW9A 2YLHA 3WJJA 1WZ1L 3RHWF 1GZQB 2MH4A 5EU7C 4ZMNA 1JYWA 3RX5A 2CIIB 3F12A 2LU7A 2ZE0A 5AD0B 1VADB 4FTVD 2CLRB 5EEZA 1B2YA 2XWTA 3KCPB 4GLRI 4OI9A 1P7BA 4Q6IB 3NN8A 1FUNA 4QRQB 3FU5A 2R0LH 2WZPA 3H6AA 3VXQB 3I6SA 1IARB 2O5XH 5IMOA 4KDTC 4NO0D 5KANG 1VPOH 3ASNB 1KBBA 1MUJB 3TFKC 1X5JA 1XIWC 2PO6A 5CBEA 1HQRA 4L4VB 4NNPL 3RTQC 3VRJB 4G8IB 4KVCL 3L4ZA 5AG9A 1ACXA 4JFXB 4NGHL 5CLXA 3WY3A 5EWIL 5DUBB 1J7VR 3D08A 2WLHA 3S8WA 5CSZB 5E5UB 2JSFA 4CBZA 5ENWB 5C92A 2I9TB 2BY2A 3PABA 2X2UA 2MKLC 3MRGB 4WI5A 4J6IA 2EIEA 4RX4D 1QSVA 4Y4KB 2EQDA 3CFQA 3LVEA 2C9RA 3HZMA 3QAZB 4OJEH 4H5SA 4UTAL 1UA6H 4XCNA 4M7LH 2IQ9L 4DP6X 2CG9X 4MS8D 1EGJL 3BFQG 4LVOB 5CU5A 2XKSA 3JVFC 2JJSC 5B1KA 1CF8L 3P77A 1XB6A 5JW3L 1M7DA 3OZ9L 3IDGB 2GK0B 3W9EB 4KROB 4XXCA 4WHDA 1CO1A 4P57A 1YQVH 2F08A 2ICEB 3BQUA 3KYKL 5D1ZI 5AW8B 3BSHA 5JPMC 2R1WA 3WG7B 1JZ5A 2X38A 2BRRL 3CVHH 4HJ0C 3GJFB 5CWSB 2FATL 4ABQA 1YNLL 5EN2A 5KYNA 7FABH 1WT5A 1AHWC 1YY8B 3MFFB 1OWRM 4NO2B 4C56E 3WN5A 4N1HB 2GTWA 3HLAA 5FA3A 1XR9A 1ZT1A 5IIEA 1PKOA 4OLUH 3VWKA 3ZE2B 5GSRA 3K1KC 1L4IA 1CLYL 1KN2L 5F7BA 5A2FA 3LDBB 1LO4H 3NMEA 2J12B 3VFWA 4IBUA 2ZWSA 3VGAB 5AAWA 3SKUD 1ACYL 1ZTXH 1AC0A 3O4LD 4XNMB 2ATKB 5HVGB 5KBPA 3PNWB 1JPST 3RGVB 3H9HA 3RWCB 5MEOA 4RVBA 1IC7H 2E75C 3LS4H 2GJZB 4EDWL 5AQ0A 4ZMTA 3D52A 2XWBB 3EF4A 3W9DA 2QSQA 5T1KA 1YEGH 1U8CB 1TETH 2ZSVA 3UAAA 2H1PL 1YAZA 4JDTL 4ZNEA 4IRSA 4LAQH 1EAJA 1H19A 3G04A 5FFOA 2CKBA 2P7TB 1DL7L 4NCC1 1OGSA 4ZW6A 4GNKB 5LHDA 3BKJH 4BXVA 4QOKD 4U3CA 1CICC 4XP9H 5IESL 4KXCA 4UQ2B 1NGYB 5DJAA 4WI2A 3FF8A 4OFDA 4Z3JA 4LEOB 2BY3A 4JAMB 5ETUB 5EIVA 1LJMA 4JN2A 4P9HC 5F1IB 4WCYH 3KLHD 3WMQA 2PPDA 2Q8AL 4L4JA 4KK6C 2VXVL 4UILH 1THAA 4JPWH 5KZCD 4BXSV 1YPZA 2VC2H 3GBNH 3KL5A 2CR0A 1KLGA 2CR3A 3LYRA 3NBNA 2O6CA 3QJTB 4X7TB 5ESQA 4FFZL 2IC2A 2JVUA 2ENJA 1J1PL 3FH7A 1M71B 3NSDA 2GEQA 3WFHB 3SSGA 1I7ZB 3INUL 3NIDF 4TLSA 1QMUA 3RPBA 3KR3L 3I3EA 1Z9SA 3OQRA 7TAAA 3C6LB 3QIWB 1Q94B 4M3JA 1OHZA 3RBGA 1A6AA 3GMMB 1T1YB 4LQ1A 2UXVA 3A6CH 1I31A 1XMWA 3T0ED 4BGLA 5A6LA 2OFQA 1JJUA 1JPGB 3O3UN 1KC5L 1CE6A 4PN6A 3QRLA 4K94H 1ZIAA 3P4MB 4X8GA 4AQAA 3U7WL 5C6WH 3TOPA 1H3WM 1JPTH 1W0VA 2HVKB 4PRPD 1NH6A 4FQXB 1QBLH 4TN9A 1OSYA 4HUWA 4AY0A 3VSTA 5B3JE 3KPQB 3DSFH 4DETA 4MQXD 4RIRB 1T2JA 1IZJA 2F7QA 3B2XA 2B15A 1BWWA 1A7OH 3RWGA 5ERWA 5GS1A 2VL4A 3N1MC 1Q0EA 1HWHB 4ES9A 1A6PA 4WTQA 3L3JB 2OMTA 4LSQH 3MV7A 4TNEA 3DVGA 3FU6A 1VZHA 3A4FA 3EYUH 1L7TH 5J9PB 3CH8A 3WKNA 1IFRA 1ONQB 3T4AA 4R3SA 5IROD 3B6SA 3NH7L 4G6ML 1NQBA 4NC2B 1IAIL 5DRZB 3DHPA 5D1QA 3PL6B 4MQ7B 3FO1B 4UV7H 3PHQA 4PS8A 1WAPA 3FN3A 3OR7A 4GRLB 5IVXE 4X99A 4FRWA 5JHMA 4KZEH 1IGJB 3NK4A 3UP1A 3APDA 2QQNH 2DBLL 1XCQB 2ED9A 1I8IB 2CHNA 3FN0L 5FX3A 4WI0B 3UZEC 3RZCB 4IBZA 3K8MA 4BFGA 2D2OA 3DGCR 4RAUB 3RI5F 4PRBB 2HLFD 1QFWH 2FECI 3SCMD 3WFDH 5HYEA 5L6YL 3MLZH 3EH2A 4TUKL 1DFXA 3ARED 2H5UA 3LB6C 3CFBA 4WENB 3IGAA 5MEPB 2WQ8A 1JNLH 1RU9H 1Y18A 2GJ6B 4NRZB 5F6IB 2CHDA 5ESAA 1UQSB 2KZ1B 2QVKA 3ZL4L 1E4KA 5AOIA 2CXKA 4YHPB 2N7AA 3AU0A 4MA7H 4OQ1A 4P23B 1UWGL 4CN1A 1MFAL 4IEFA 4XXWA 1HJBC 1YN7A 3MO1B 1EX0A 2P8MA 4HT1L 3MJ9H 2UZIL 3L3DB 1XF5B 4PGEB 3SD2A 2VJ8A 4EVNB 5JQ6L 3IJ7A 3HG1A 4KKCD 4X6DA 4YUEL 2AXWA 5EIIB 3BW9B 2R0KH 4BKTC 4DHLA 1E3XA 2PTUA 2B9AA 5MP6H 1HIML 2K8QA 2MNJB 1Q9KA 3F12B 1KCUH 2X4NA 4TNVK 3NN8B 1KTRL 1ZKAA 1GPOH 3IPBA 3P4LA 4WU5A 5E95B 3VFVB 5IMOB 3QISA 1YDPA 3TFBA 3D0VA 4W9IC 3LH2H 3LPWA 2PO6B 4ONFH 5GGRA 5CBEB 3WS3A 1HQRB 4QXGL 1WP6A 1SEQH 3JUYA 3NCWA 5B1CA 1GTNA 4JR9H 2E7BA 3QORA 4XBEH 4BFIA 4QXVA 2Q8BH 4DP7X 5GRJL 5J11B 3FK3A 2ITEA 2GW5A 4MA8L 3L48A 3PABB 4PJ7A 2BM3A 1CDCA 2FHFA 2HFFA 4ZI8A 5KVEE 3TO4B 4AKPA 3U1PA 2P5PA 5H2BA 1G0YR 1RZKH 3NIDB 1SY6L 3S97C 2WZ6A 3FT4A 3LJ3A 1IVTA 2QSCL 4OTXL 2N3JA 2D0GA 2YD0A 2WO3B 3HZMB 4J2QA 5IW3A 3RVXC 4AUUA 4F7MA 5IHLB 4L1BA 4WTWA 1Q72H 4H5SB 4JN1L 3GS0A 5E9DA 3UXFA 4XCNB 2R2EA 2VDRB 4R26L 1N18A 1CQKA 4RESB 4YNYB 4NLAA 3P77B 3MRIA 4KJQD 1M7DB 5CLZA 3BEVA 1WEJL 4A2FA 1RUPL 3BQUB 2W81C 4P57B 1NKOA 2MSPA 2OL3A 3TWYA 2R1WB 3NCFB 1F4XH 2ZAGA 5FLUA 5MENE 2PP9A 5K9QI 1LD9A 1RI8A 1PLGL 2XV2A 3RA7L 3LNIA 5CD5D 2DWTA 3Q6GH 3POCA 2YD9A 4GKOA 4WJKB 1FHGA 2UX6A 1Y6KR 3FONA 5EN2B 1BJMA 4Q0XL 1IAIM 4PJ5E 1EMTL 2D7NA 3QFJD 4QKXB 5SX4H 3WN5B 5FA3B 2GTWB 4XPGH 5JQHC 3HI6L 5J1TC 1XR9B 3P3RA 3RWFB 2OS7A 1CLVA 3UDWA 1J8HD 1ZT1B 5E4EB 3WSQH 3RB5A 1J0YA 4G8GA 3BAKA 5GSRB 5I19H 5D1XE 2BNQD 3F8UB 3VWJD 5IV2A 2WLKA 2IPUK 1M7XA 1RFDH 4NQTA 3VFWB 1RZQA 1KSRA 3RY6C 5FCUL 3O6KL 1AQHA 2XQ0A 2DQJH 5D5MA 1IKNA 4BE5A 1EZLA 3H9HB 5MEOB 3MLSH 2J6EL 1A7QH 3PRZA 4LPYA 4WFFE 5D2NA 4MMYA 3QXDA 3QHTC 3N42F 5F7YC 2NSMA 3WO4C 4F92B 2X40A 1SHWA 2WNXA 1GGBH 5F72S 3W9DB 5HYJD 3H54A 5T1KB 2EH8L 3RGHA 4ZX6A 4G5ZH 4X6DF 4IOSD 3EJSA 2ZSVB 2OR9L 1XGYL 4FNRA 3KM2A 1WF5A 4YFLI 5FOJA 4AL8C 2P43B 2VDOB 3MJ9A 3BIKA 3G04B 2CKBB 3KJ6L 4MMXA 5IW1A 3FPYA 2QZ5A 4S1SL 1EO8H 2AQ1A 3SY6A 4FQ2H 1N3NB 2Y7QB 5D7EA 3RVUC 2J2ZA 5DJAB 5FLVA 4OZFG 4JN2B 2BVYA 4K23L 3V55A 5IB5A 1FORL 1TJIH 5HHME 5HHOA 4HSAC 2EVFA 3IM1A 5J6HA 2ROXA 4NLHA 1KLGB 2E86A 1G7HA 4OGQC 4PJ7F 5ESQB 2Y36H 5L0QB 1QLEB 2VDQL 3DDGA 1A4BA 3PAZA 2EH7H 1LEIA 3FXIC 3IDXH 3U9UB 1PJWA 2RD0A 2R59A 4JKMA 2EZ0D 1Z9SB 1MSPA 4H88L 5B1JA 4GKLA 2HX8A 1A6AB 5KJRL 2XX0A 4WI8A 4YXKH 4JKWA 2GI7A 4WW1A 4HKZA 1M05A 3OC5A 5I74C 3VXSA 4KROD 5A7BA 2QQQA 4IKIA 3FDWA 4MNQA 5E8DL 5JW4N 5GISL 4AQAB 1TYEB 4GT0A 4U0RC 1W0VB 4Q9CA 3FB8A 1JZ3A 5CN3A 2OXGA 2EADA 5D7SL 5E6IA 1RZFL 1WFTA 3WGVB 2EINB 1N6QH 2VQ4A 1ETZA 4GYBA 4BCXA 3BAEH 4G7VL 3RWGB 1Q0YH 2NR6A 2X10A 1ECZA 5ERWB 5GS1B 4YEFA 1NFIA 1Z7JA 5FFGA 3ZHDA 4GMTH 2ZX7A 3LS5H 4GW5A 2OMTB 3MV7B 2BXYA 4MA1C 4YSEA 1Z66A 3DVGB 5D7JA 5JW5A 5MHSD 1L9OA 4CSZA 1HXYA 2J25A 2R4SH 2CK0H 1HX0A 1JZ4A 4KNSA 4W9EC 5CGBA 4M1DL 4R3SB 3T4AB 4N6RA 3B6SB 2WXQA 4JRYA 5F21B 4ZXBD 3P11H 3A24A 3QDJA 1X5FA 2YFNA 2LU4A 2G0LA 5D1QB 4OCSH 3S96A 4ZFOA 5LGHH 2DQHL 3PHQB 4M03A 4X9IA 3BLBA 3OR7B 4DQAA 3R4RA 3EJQA 4ODTH