4Q2ZA

Fab fragment of hiv vaccine-elicited cd4bs-directed antibody, ge356, from a non-human primate
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
224
structure length
224
Chain Sequence
EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGQINPKTGGTNYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAIYYCARGGQRLLLLRNYYFYYWGQGVLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of Fab fragment of HIV vaccine-elicited CD4bs-di
publication title HIV-1 Receptor Binding Site-Directed Antibodies Using a VH1-2 Gene Segment Orthologue Are Activated by Env Trimer Immunization.
pubmed doi rcsb
source organism Macaca mulatta
total genus 45
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q2zA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q2zA01
1XGPA 1R3JB 3JUYA 2CGRH 3P4MA 4R3SA 4XI5C 2V7NB 5E4IA 1MFDH 3IJHA 2K7PA 3WHXA 1ZHKA 3IDXH 1J7VR 5D7LE 4ZFGL 3UAJD 5TF1H 1YNTA 3TIDB 4OIIH 4Y1AB 2QADB 5B22A 5ID0B 3C2SA 1NCBL 3GJFB 5F71A 3LS5L 5CSGA 2EH7L 1QLRA 3ZE2F 2R1YB 5KVFL 4FXKB 5C0RH 4NQCD 1D7FA 2NY3B 4PJ8C 3QHFH 5IHZB 1MF2L 1FYHB 3MREB 2Y5TB 3S37H 3W5MA 3AMLA 4M1CD 5I1KH 5HVHC 5GGUA 3SKJH 3T3MF 5LQBH 3WEXB 2EYTB 3DETC 3HE7B 5F1NA 3VI3E 1WGOA 1KV3A 1G9EA 1T5XB 1KYOK 4YBLB 4W6WB 4H8WH 4XGZA 5KSUA 4J8RB 4KPHH 2DJ4A 3I85A 1NBZA 4HC1A 1ZVHA 4FP8L 1CE1H 3I75A 5HYJA 5GS2D 3FQUB 4P3CH 3BE1L 4NUJB 1C12A 3MLVL 3FO9B 5I19H 4M4RA 1WBXA 2P7TB 4S1SH 4G5ZH 2FBJL 1QTYT 2WLZA 4FNLL 3S35X 5IMLA 3RPIB 4JREC 1I85A 1XR9B 4Z7UE 3K8LA 4JHAL 1CDJA 5E5UB 3B9KC 1TZHA 4XC1L 3WYRA 2P24B 5IMOA 1YA5A 3GSUB 3GSNB 4P2QB 1BOGB 5I1IL 1FH5H 1HQRB 1AXTH 4NQVA 4HD9A 4LPYA 2DTMH 1QA9A 4G7VL 1IL1A 1XR8B 1GGTA 3LRGA 3D3VE 1MQKH 4K3HA 2BMKA 4XNYL 4ZDHB 2ESVD 2PYEE 1I9EA 5EBLA 5C0CE 1HHHA 1LO3L 1I7ZA 1K6QL 4MA7H 1Q9WA 2VLRA 5HJ3A 4HHAB 3TPKA 1G6RA 1E6OL 4I8DA 3B9KD 1FV1B 2VXTL 1SBSH 5A16A 4C56E 3L3OA 4CDGC 3SY0A 1KJMA 5D96C 1BQUA 3I84A 2D3VA 2ZUQB 3FOLA 5AYUH 4HWBH 1NCAH 2V9RA 3STBA 2ZZUT 3B2UC 2AEQL 1D5XB 4JRXB 4NZUH 2ED9A 1QSVA 4XNXL 3MBEA 4YPGA 1N6QH 2V2XB 3IXTA 2V5YA 1KFAL 3VU2A 4F33B 3M17B 3ARPA 2N7BA 4QF1B 3QFDB 1TITA 5E00B 2X1OA 1AD9A 1S7UB 2XYCA 3BDYH 1I8KA 5JLZB 4DN4L 1JUFB 4JPIA 5IW1B 3UC0H 1T1ZA 5KAQG 5IW6A 1UB6A 2NY5L 1CDIA 1J0IA 4Q0XL 3HG1E 3MFGB 1Z9MA 4G8FB 1TFHA 3MROB 1CIUA 4G43B 2GJZA 1AFVL 3VD5A 5I1JH 4JFFE 3GFUA 3RBGA 4WEBH 1T2JA 4PRBA 2GJJA 4HK3J 4JQIL 1G9NC 1CD1B 1HOCB 3LQAL 3GZKA 3R8BB 1IGMH 3G6JE 1MNUH 3GRWA 4DUWA 3QI9C 3HS0B 3BN9C 3CH1A 4KFZC 1VSCA 1LVEA 2F54D 3MRNA 5GGTL 4PLKD 1IKNC 2P5WD 1ZHLA 1EEZA 3LRHA 4L8DB 3KPRE 4RMRA 1LGVA 1CTNA 1A3RH 2X09A 1T7YA 3RJQB 3QUMH 1T80A 4NN6B 3OPZH 3K46A 1OAZL 3BN9D 4MDIB 4FQHB 5DJ0B 1QVOA 5E8EA 3TJEL 1EGJH 1U93A 1N64H 3RIAK 2YUWA 1NJ9A 3SDDA 1CG9B 1MUJA 2ZUUA 1LO0H 4ORZC 4K3GA 1T3FB 4HFWA 3GMPB 3O9WD 3QO1B 3OMZA 4LPVA 5EB9A 3O3BA 2D7NA 3NA4A 4PRAA 3MFFA 3WLBA 2BHUA 2EDQA 5I1GL 3QA3A 43CAA 2P46B 4DGYL 3TJHC 4F57L 5KN5B 4K3JL 2C3WA 4MD5A 3PHQB 4RISH 2HN7A 2OR9L 3WFBH 1I7UB 2WBJB 5E0QA 2RQ8A 1M71B 3D39E 2BVUA 2WUBH 3MUGA 5HPMA 2UWEA 4P4KC 5GS0C 3IU3A 2GJ6D 1HZHL 2M8XA 3F58L 4HKXA 2P5ED 4NO0A 3TJHD 2Z8SA 3NABH 4GAFB 3MRMB 3QDGA 3EO1A 1SEQL 1Z2KA 4Z7QE 4PJHF 3NZHH 5GS1A 1D5IH 4P4KD 1JZ5A 3N9GH 1KENH 1FPTH 5T3ZL 4U1IA 3HCVB 4YH6A 4F8QA 2C1OB 3MR9A 4R0LC 4Y2DA 5F7HA 4WFHD 4M6MH 3JZ7A 1HSAA 5KW9L 1JI2A 4YXLH 1QRNE 2DQFB 3NFNA 3ZSTA 1ZAGA 4X8JB 4BK5A 4G6KL 1MJUL 4XBEH 4OF7A 2BP3A 3PGDA 1NGYA 1X7QA 1U2HA 4YIQB 3BWAB 2A2QT 3T2NH 1IBGL 3LEYL 4X6CE 2EKSB 5JW3H 4XMLH 5DT1L 1FO0L 3CLFL 2I5YH 4XWGH 1UCTA 3UJIH 4PRHD 4DAGH 1MJ8L 3AUVA 2DDQH 3P0VL 2JLLA 4LSVH 1GGIH 4BFBD 3ULUH 4RRPG 4OF8A 3NA9H 3LPWA 5GGRB 3QH3A 1MI5B 5T1LB 3NPSC 3VFMB 3MLRL 5TE7H 4RX4D 3CXHK 2G60L 5CJQL 1T6WA 1IT9L 2FD6H 3D6GA 2DD8H 5I8OH 5GISL 3RUGE 1KCUL 3L6FB 3WIHA 2NXYB 4KI1A 4GRLC 1J8HB 4GSDH 4RSVA 5DURB 3NIGF 5T3ZD 4JY6B 2CO6B 4YHOL 1UH4A 4HMDA 2Q3AA 1F90L 2CDGB 5EU7E 3DWTA 1MFAH 2DF3A 4EIGB 1S9VA 3TH4T 4IM8A 4UAOB 4NJAL 1BMGA 4GRLD 3SE3A 5IBUB 1MRFL 4O58H 4LDOB 5FF6A 3HR5A 3IRPX 3LKRB 5EN2A 3RWDB 5B39A 1RHHA 1IC1A 4LSSH 2HKFH 4KVCL 3DJ9A 4L4VA 1OM3L 2JIXB 4YXKH 3ZHKA 5IQ9B 3SQOL 4PJ8A 4Y4FC 5I76B 4M1GL 2CKNA 2QQKH 1F2QA 2F8VA 1RZGA 3FQRB 2ENSA 5C0EB 1WAAF 1T0MA 2NZ9C 4HXBH 1M7XA 3CFKB 2B8OT 4I4WB 4HUVA 2BOCA 3D69B 3OKEA 2R1WB 5EZIL 5IM7A 4X7TA 1UWGH 3BPNC 1JTPA 5IEHA 4Y4FD 2RR3A 3S4SG 1N8ZB 2BDNL 1OHQA 5DJ8B 1VFOA 2VB5A 4HUNB 3ZDYE 5DUBA 4HGWB 5KOMC 5FM8A 5JW4Q 3DVGA 3PGCB 3OX8B 1AHWA 1SJEA 4GG6E 5GRJL 1KTKE 5H94A 3SKNA 4Z7VB 4I3SL 1PYWA 1I1RA 1QLEL 3BGMB 3VFVB 1EHNA 2ESVA 4BH7A 2FL5A 5I30H 5TFSL 1PX4A 3LPGA 35C8L 4M93B 1J18A 4M6OH 3C8KB 4NGHH 3C8HA 2A6IA 2X4RA 4N8CL 4UBDD 4TUKL 3MMEB 3HNVL 5T1DH 3LEVL 1A6VL 4LOUC 3BUYA 1WBZB 1HKFA 2YZ1A 2A1WL 3BAEH 1U3HB 1D5ZB 3IYLW 2VDKL 4ZSOA 1EBAA 1UA6L 3C08H 2C26A 5L88H 3PWJA 2XQBH 2O5YL 1B9ZA 3RVVC 4LCWB 3C87A 2A0LC 4R8WH 2R9HC 5C0JB 4P9HL 1J0KA 3W9DA 2H26B 5JO5B 4Q6YA 2GY7B 4LOUD 5L7XL 4OV5A 4UTBL 3THML 5ADOH 5EUKA 4KK9D 3IDYB 5L6YH 3EJYC 2ICES 3RVVD 1U3ZA 2A0LD 1GGCL 2VC2H 4WO4B 2ZSVA 4N8PA 4YHPA 2X4SA 3LKQB 5KZCD 2LTQC 4NRXA 3MGOA 1EJOL 3VFGL 3UYRL 2CIKB 2HMIC 3BI9X 1A2YB 1P7QA 4XXDB 1L6XA 4M61B 3MA7B 2FB4L 5IK3A 1RUQL 3EJYD 2A6DB 2Y72A 1JFQL 1DUYA 2XWJA 4ORGA 1YEKH 1F2XK 4UIMA 1G7LB 2BVOA 2XT1B 2O5XL 4JJHA 4JN1H 5E9DA 2VAJA 4X7FC 3QI9A 5FA4B 1UM4H 2HMID 2P48B 4NZRL 4YHNB 4GKNB 4PV8B 3RVTC 15C8H 1N0LA 2I60H 1G1YA 2EDNA 4X4ZA 5C6PB 4Y5XC 1N0XL 2PNDA 5F7FA 4LCCB 1IM3A 1A7NL 4BELD 1ZGLM 5B38A 3P4MB 4JR9L 1SJVA 4OM1H 3U9UA 3G5XB 3LKOA 4LRNL 3IJHB 3WHXB 1GL4B 1ZHKB 5FUZL 2AQ1A 3KHOA 4WHCA 2J6EA 5H37G 4J6RH 1Q72H 1YNTB 4LARH 4M6AA 5F9OH 2LABA 5DS8A 4ZO9A 1NFKA 2H2SC 4NWUL 4P2QE 2ORBL 2DI9A 4NFBA 4YDJA 5D2LA 2Y1VA 4JB9H 1N5AB 1QLRB 4Q9QH 4WGVB 4I77H 2RGSA 2PN5A 3WD5L 2P5EA 4MNQD 2X89D 4PJIA 3HC3H 1HKLH 2XZCL 4RWYL 5I1LB 1EHLH 5DLMH 2H2SD 5HHMB 1F42A 1IVLA 1LWRA 1KN4L 5IFJA 3O2DH 2E7CA 3FT3A 4PRPA 3RDTC 4P4KA 2IPKA 5CCKL 1EXUA 4XGZB 1FNFA 5KSUB 4ODTH 4LDEB 1NBZB 1WC7A 2CKBL 2JB6A 4JRXE 3I75B 1JNHA 3H0TB 5DXWA 1R3HB 3F65A 3HUJF 1LDPL 1WJ3A 5FYKD 1NMBH 2JTDA 3PUCA 4MQTB 1ZKAA 2HVKA 3RDTD 3VXRA 2H3NA 1GHFH 4A6YA 1QHOA 2EDBA 1KPVA 4LP4A 4R0LA 4AEIL 5J1AB 4UTAH 5L8KB 1KXTB 1OWRM 4TNWF 1T7ZA 4XHQA 5SWQA 5IMOB 5D5MB 5CBEA 1T5WB 2VUOA 3WFDH 5JXAH 4TTGA 1PG7W 1F97A 4XVJL 4NQVB 2XZQH 1QA9B 4MWFA 1IL1B 1H3XA 5EBLB 2ADIB 4ALAH 1HHHB 1I7ZB 5IHBA 5D7KD 5HHVL 3S88H 4L5FL 1G6RB 1EZVY 4QWWC 5ANMA 4WNQB 3TT1H 1U8MA 3TV3H 2DLIA 5A16B 3L3OB 4PJEE 4YQXH 3SY0B 1KJMB 1XH3A 5ICYA 1CF8H 3L5XL 3FOLB 4R7NA 2V2WA 5DHVH 1C1EL 4DVRH 4OGXL 1CU4H 3WNMA 2VDRH 4HIIA 1UWEL 2Q7YA 3O3AB 3ZDXE 1JMXA 1P6FA 2CDFB 4QWWD 4YPGB 3TBSB 2PCPA 2W07A 4JPVL 4JO1H 2Z91A 3IXTB 1Q94A 3FQWA 3UPRA 4GRLA 1KXVC 4MA3A 1IKFL 1QRKA 4OUOA 1AD9B 3SCMA 5JHDD 1I8KB 2OJZH 1YQ2A 4GBXA 4DKFH 1SJHA 4JPIB 3BEWB 3L3HA 2PF6A 1UB6B 3UROR 1YNKL 3BZFB 5E6YA 5E2UH 4LLQA 3E2HC 4JZJA 2EDRA 2GJZB 3HLAA 5KSAC 2NY2B 4PRBB 1UACH 1U58A 1VGEH 3PV6A 1J12A 2VDLL 1I1YA 1A22B 1BGXH 1BP3B 5J9PB 3HPLA 1N4XH 3OKDA 1EO5A 5IG7A 3D0LA 4PTTA 5T33H 4NPYB 3BDXA 1QSFB 3QIBD 2YA2A 4QGYA 2QQLL 4QRTA 4K2UH 4KJWC 3RVXC 3HZVA 1V3MA 3ULVE 4HWZB 4NN7C 8CGTA 2NY6B 1RZKL 5DYOB 5IB5B 3AU1B 4J23A 2E3VA 5IKCA 4QO1A 5E8EB 1U93B 4LHUG 2OJEA 3GHEL 3BHBA 3SDDB 4L3AA 1MRCL 1U8KA 4KJWD 3RVXD 4HFWB 1EJ6A 1S5IH 1S7WB 3O3BB 5KSBA 4PRAB 2BNRD 3WLBB 1Q9OB 2NXZC 3QA3B 43CAB 4WHYG 1A7OH 2IBZY 3H42H 3BZEB 4HMEA 3B3IA 4X9HA 3H6JA 4DGIH 5I0DA 1HCFX 2GITA 2HN7B 1MCLA 3W39A 4N90E 3N85H 4TNVK 2DQEL 1INDH 1VPOH 1WZKA 5KVDL 3MUGB 4L3ED 5KJRL 4KXZI 2UWEB 4PUBL 2R0WH 1MWAH 3LHPH 5TDOA 4RMSA 1JPGA 2R29L 1FVCA 2NXZD 5IFAL 3AGVA 3QDGB 2G5RA 2Q20A 4UUJA 2FDBP 2CK2A 4S11A 3EO1B 5FK9A 5HTSA 3CX5J 2WK2A 2YC1A 3REVA 4ELMF 4EQ2A 4LCIL 5FM5M 3BPLB 2E6QA 5GS1B 4XP9L 5HBBA 1SYVA 1J8HE 1ZWIA 5ITFB 5EU6B 2BSSB 4KQ4L 3FO1B 4PJDE 3KLDA 4U1IB 3EOYG 3UBXA 4MZ2A 3MR9B 3REWA 4MD4A 4KRPC 4ODVL 1HSAB 5CJXC 3SDXE 5T3XH 3H3KA 4G6JL 4JO4H 4CKVX 4CADA 1MCRA 3CSYA 5HY9A 3TA3C 3UJTL 4JFDB 4HH8A 4NQED 3VXUD 1AO7E 3LN5A 1NGYB 3WL9A 4RCAA 2AJUL 4MX7B 5DGQA 3KXFD 2DLFL 5IVXF 4LSPH 4KRPD 3CJJA 1DSFL 2JJWA 2WWKT 5JMRA 4NM4L 5HDBF 1LO2L 1JNNL 2AVGA 5K9JL 1S7TA 2XNAB 4ZFOL 4OLZH 3O8XA 3CVHH 1NFIA 3MRLA 1FNGA 3MRCA 4CGTA 3MJ8A 4EUPH 2VZTA 1RY7B 2CIIB 5BO1H 3QH3B 3D0VA 4XNMA 1IMHC 1AE6H 1JHKH 1FN4A 1A14H 2EO9A 1FP5A 3SJVD 2OL3L 1QSZA 4J3SA 3QDMA 3BT2H 5KG9A 2BX5A 2X1QA 2R2BB 3U6RA 3ESVF 4G8EB 1JV5B 3AAZB 5ESQB 1VFMA 1TZIA 4KV5E 2MCPH 2VLKB 2DQTH 2EDKA 1IC7L 4MNQA 3NIFF 3WUWG 4IHOA 1JYWA 4JO3H 4WI5A 3O2DA 4O51B 1CLOL 5D93B 1FGVH 1WQVT 1IAII 2C7UB 4HZAA 5D6CB 2F53D 5B39B 1RHHB 2FYYB 2FR4B 1RJYB 3QEQD 1DQLH 1GIGH 4L4VB 4XB7A 3SKOA 3D5OF 3AFLA 3F7VB 3MV9A 1LE5B 3TGXA 4PJ8B 1YN6A 5HHXL 1RZGB 2VR4A 5D1ZB 1T0MB 5IVXB 1KCRL 2BZDA 4F9LC 3TN0B 1JRHH 4FZ8H 4HUVB 3EOTH 4LCWE 3OWEA 2BOCB 3OKEB 2DN7A 5F1IA 4GS7C 5IM7B 4X7TB 2B1HL 5DEZA 3WBDA 3RUGF 3EIFA 4D0CB 2CK0L 2CR6A 4MCZA 3CFBA 2DI7A 2XN9B 2YD2A 5DEGA 5CEZL 1NCCH 2A74B 3Q5YA 5EO0A 1N3NA 3QRGL 3QXAB 4U33A 1AHWB 1RHFA 2E27L 5E24E 5H94B 4PJCA 3SKNB 5IB3B 2EH8L 1PYWB 5D2NA 4M3KB 3SDYH 2QBWA 2IBBA 4WUKL 3DUUA 4R9HA 4IJ3C 4BH7B 2FL5B 4ZO8A 2HJKA 2ZG2A 4I18C 4PYHA 4OCWH 1FYTD 1K3ZA 3QUYC 3MNWA 4YHKH 2K1MA 5JOPD 5DHVA 4ZFZA 3VCLA 4N8VG 5BV7L 2VXVL 4JG1L 2A6IB 3S34L 5JNYA 2IJ0C 2APVA 4LRIC 3L7EB 4RQQA 2JB5H 3BUYB 4N0UE 1OP9A 1UWXH 4X0KA 4WRLA 3QUYD 2J8OA 1A9EA 4ZSOB 2WSKA 1MCCA 1XF5B 4KUCF 3PWJB 7FABL 3SGJA 4AEFA 1TXKA 5JQ6L 4LEXH 2X4UA 4MXQC 3O2VL 1R6VA 3W9DB 4ZUUB 1Q38A 4YDVA 3KPOA 5I6XB 1KNOA 2WW8A 5F7KC 3SKUD 1R5VA 5CEZD 5IJKA 2VLJD 3DRQA 4GG6F 1GPOH 2X4OA 1EAPB 3H3PL 1V3KA 2BY0A 5EO9A 2P1YA 3J8F7 3KWWA 2H32A 4YHPB 2X4SB 4NRXB 3MGOB 1REIA 3OGOE 1F4XL 3BGAA 1BZ7B 1XIWC 5GGSY 5J11B 3FRPA 4WWID 5SWZA 4W81A 2VL5A 5IK3B 32C2A 3ZT6A 5HHME 3QUMB 1DUYB 2XWJB 1CVSC 5KSAA 4Z0BH 5FYJE 4ORGB 2VWEE 4UIMB 5F6IC 1QR4A 3MXWH 1RZ7H 2BVOB 1A6ZA 4HWEL 3T8XA 1MFCL 5DQ9A 1XIWD 3GUTA 4LKCA 2H41A 3EO0B 4LBEA 5HI5C 1LK2B 1QYGL 3GBMH 1NCWH 5HYJE 3P4OB 4XWOC 1G0DA 1U6AL 2XZAL 5D7JC 2FH8A 4JHZA 4KMLB 3IRZA 5DMKA 3O4OB 5GZNC 4GT7A 5AG9A 2UY6A 1IM3B 1U8NB 1F45A 5GIRA 5B38B 1MIMH 4QXGL 3ULUF 3U9UB 1PEZA 3LKOB 5E6IA 5TQ2L 2Q8AH 4P2RA 3T0EC 3HAEG 1KB5A 1NEZB 5DS8B 4XWOD 5CS7A 4FQIL 4IOIA 4YDJB 3EO9H 4F7CA 2DKSA 1T04A 3INUL 5EO1A 5IB4B 4NUGH 4P2OA 5C0BA 2EC9U 4HWNA 4PJIB 1J0HA 2VLRE 3T0ED 3HE6C 4EN3C 4YDKL 2DQHL 4FABL 2GSIA 1GH7A 2NY1D 5F9DC 4Z78A 1BBDH 2OSLA 3NCYS 3HI6H 5IFJB 1NAMH 2DWEA 4PRPB 3B5TA 4URTB 5EUOF 1EXUB 4M62H 1RIVL 3HB3C 4IEFB 4QTHB 1WC7B 1NCTA 3HE6D 4NZDA 4EN3D 4OQTA 4N0CC 5F7YC 1JJUA 1JNHB 1YEGH 2DM7A 1CFNA 4KI5C 5CINH 1M7DB 1WICA 3U7WH 1IQDA 5TDNA 2V17H 4ONHA 1K8IB 2HVKB 2H3NB 5CEYA 2VR5A 5A2KH 3BMVA 1CLYL 4ONGL 3HB3D 1WFNA 5BZWA 1KPVB 4P23A 5E2JA 4OCYL 4E0RB 4N0CD 5CJXA 3CVHA 1HXMB 4PP2A 1HE7A 5SWQB 1A1OB 4XP4L 3PJSB 4KI5D 4UNTA 1MHHA 5T1KB 4ZXBC 3TA3A 3X3FL 3U0WH 5GGVL 4JPKH 2OX5A 4HLZH 3JVGC 1MIEH 3RAJH 2VDPL 3S3PA 2G2RA 5ANMB 3HMXL 2R2EA 3GNML 4DN3H 1KCLA 3UP1A 5CKGA 5J06A 4ZXBD 2QR0A 4R7NB 1OCWH 2V2WB 1X5XA 1IGFL 1OAXH 2VZSA 4OCRH 2OK0L 4HIIB 5I74C 2Q7YB 2AGJL 4F58L 2KQNA 5HDQL 1IFHL 3K7UA 5EUOB 2IPUK 3V5HB 1F02I 1Q94B 3L1OH 5HDOA 3C5ZB 2VABA 3FQWB 2GSGA 3WUZA 3UPRB 2OTWA 1KELL 4LIQH 1OD7A 4JE4B 3TEUA 1RULL 5GS2H 3BPOB 3VRIA 1UKSA 4RGOL 1U8QA 3SCMB 3CFDA 4GBXB 4OZFG 1GC1C 5LBSH 1SJHB 3L3HB 3GMRA 4U05A 3KPSB 3R06A 1KJVA 2EE9A 4JZJB 5SX5K 4ZFGH 4YHLH 3VRLF 3O6ML 2NX5A 2VXUL 1H8NA 4JGUA 2UWEE 1NCBH 3SOBH 1D6EA 1X3DA 5FKAB 3KYMA 4XX1G 3OKDB 5F44A 1OF2A 4M4PA 5IG7B 3D0LB 5D72H 1FFRA 3I3DA 4G8GD 3EFDL 1OQXA 1F3JA 2X4QA 4LK4A 3BWUC 5CIPH 4CMHC 3BH9A 3QXDA 4JY5H 3VGDA 3DSFH 1OP3H 3X14A 3ZMRA 2WMPA 4HFUL 4PY7A 5IKCB 1WWBX 4JFYA 4GRWE 1FYTA 4J3VA 1CFQA 3BHBB 5F3BA 1H3UA 1U8KB 3AB0C 3FFDA 4F7EA 3DV6A 1QFWH 1IAKA 4NSKA 3LS4H 4CVZA 1FVDA 1X5KA 5KSBB 1QBML 2HVJB 5E8OA 1R5IA 2HTLD 1AGEA 3DUHA 1VADA 1JHTA 4XNZC 5J3HC 4JHWL 1R5WA 2Y07H 1X5YA 4JQVC 3GSRA 1A1NA 3P73A 4I18A 2GITB 4FNLH 1C5CH 1E27B 2WWMC 1NC4D 4HS6A 2Z0BA 5DUPL 1F3DH 4XC1H 2H9GB 1MCQA 4EBQL 1KEML 3LN9A 5TDOB 1JPGB 3V0VB 1T1YB 4LRIA 4H0GA 2YD4A 3AXLA 2EYSA 4HBCH 5KANG 2GTWA 4Y16B 5J3HD 2NYYC 4UUJB 1JBJA 2VLJA 1LO3H 4WTZA 3REVB 2YC1B 3S98A 2FWOA 5C0GA 2WWMD 1E6OH 1SYVB 5GSVB 5I1EL 3MRJA 1I3UA 3SE8L 2A83B 1ORSB 1MLCA 3REWB 1KG0A 4MD4B 1EHAA 2Y36H 2IH3B 2NYYD 2AEQH 3WFHA 3AY4A 4O5LL 1MFEL 3ARZA 4YHYC 2PXYC 5C0AA 3VXOB 1NL0L 1EUUA 3O41A 4XNXH 5EOCJ 5HY9B 2EE3A 2DJSA 1FBIL 3LN5B 5HHPA 1KEGH 2VQ1B 3W0WB 5D4QA 1X5HA 4ODHL 1IGCL 2MTPA 4L4VE 3C60A 2VDMH 2GY5A 3O6KH 4Y8AA 4TTDC 3HN3A 3QAZC 3RKDC 1S7TB 3F7YA 4YC2B 2PXYD 1CDCA 4DN4H 4UV7L 2DS4A 3EDKA 3O8XB 2NY5H 2W91A 3WN5A 3MRLB 1KLUA 1YC8A 1FNGB 4G6FB 5INDB 3D85D 3MJ8B 4K7PY 4LLMA 4Y5VC 3VGFA 1AFVH 5KS9F 3VDAA 4RA3A 2XV6B 3PDOB 1HNFA 4JQIH 1FN4B 1EVTC 3EOAA 2CSPA 3BRFA 3JTTA 1RSFA 4TTDD 3RKDD 5KG9B 5E99H 3U6RB 4PJDF 1ZHBB 3EAKA 4L1DA 5JPMA 5D7JA 2ICWA 5GGTH 1R24A 1TZIB 3SDXF 4M7ZB 4MJIA 4CUCA 2ESVE 3CFIC 3Q2CA 4IHOB 3T0EA 4Q2ZA 1Y6NR 3DVNB 1NKOA 1WT5C 5F9WB 2F15A 3SKMA 3TJEH 3U4AA 3O2WL 4KRNA 1NAKH 4GH7B 5C70A 4D3CL 4LCYA 3SKOB 4M5YL 5I8EA 5C0DA 1YN6B 3HI1A 1Q9KA 4K3JH 4UNUA 4ZSOE 4IRJD 1RURH 5DJ2A 3RL1B 4ERSL 4ENEC 4PJGF 2NTSP 2OR9H 5K9QG 4JDTH 1RZIA 5F1IB 4XVSL 1HEZA 4HIEB 1OAYH 4MCZB 1AGFB 1A3LL 3CFBB 5DFVC 5I2IA 4JGMA 5GS3A 5DEGB 1BQHG 3NGBC 5E6ZA 4CVUA 5KS9B 2QLVB 1CXHA 3QHTC 5EO0B 1N3NB 4G7YL 1VFAA 4XAKD 4HT1L 4OGYL 3A6CL 1BIIA 5D2NB 3RIFF 3SO5A 3UXFA 2P45B 3DUUB 4HZLB 4PJ7A 2XQYK 1KOAA 5T3ZH 1J11A 2ERJC 3MNWB 4S1DC 3F5WA 4RDQF 5DHVB 4XP5L 5KW9H 4F37K 2F58L 4R6UA 4ZFZB 3VCLB 3CDFA 2IMNA 4RMTA 5JNYB 4XP6L 2WINA 1IAMA 4G6KH 4EIZC 4XCYB 2BSED 2IBGA 2Z35B 5E9DE 2JJSA 1DEEA 3JVGA 1JTTA 4XPBL 5AAWA 4X0KB 1JL8A 4DEPC 3OAZH 2J8UB 4PY8J 4S1DD 1IBGH 1OARL 3LEYH 1YEDA 4OZIA 1CLCA 3V4PL 5HGDB 3S9DB 1FO0H 4NIKB 2O26U 2VNCA 4KUZH 4I3RH 2X4UB 1NGQL 1F6AA 3P0VH 3KPOB 1KNOB 2IQAA 5BW7C 5IJVB 3RL2A 1YPZB 1R5VB 3EZ8A 4R96A 3TO4B 3DRQB 2XPGA 3G5VA 4U0QB 3DI3B 3PG2A 5HHQA 3MLRH 5EO9B 2OXGA 4JM2A 3FQNB 5A1AA 1IT9H 4HF5H 3QUZC 1EX0A 3KWWB 3LMJL 5GISH 1F6LL 4KDTC 2H32B 4I0PB 3QQ9C 4U1SA 5D2LE 3RTQC 4R2GB 1W72L 1E4JA 2BNQD 4XPTL 4POUB 1UYWL 2P5EE 5ETUA 2D9QB 3ARBD 1G0YR 4PJIE 4RIRA 4FQ2L 4U4BA 4YHOH 5L8JB 1BD2D 2VL5B 4Z7WA 5IVNA 1F90H 3LY6A 4F15C 2CRIA 1NC2D 2OTUA 3NFSL 5HI4D 5BS0B 3QUZD 3DV4A 5KSAB 3RTQD 4OAWA 3LEXA 5K59E 4PRPE 3ILQC 3MLTB 4Y4KB 3T8XB 3GI9L 5DQ9B 1CICD 1GGYA 4LKCB 3VXMB 2SEBB 3P9MB 4G9FA 4KVCH 3WKML 3RNQB 1RV6X 4OJFH 3QWRA 3SQOH 2ZNXA 3I2CL 3RVUC 5CP3H 2X70A 2HRPL 4FQXC 4MQ7A 1WFTA 3PXHA 3V6ZA 3GKWL 3VXRE 3ILQD 3G6DL 2AEPL 5EZIH 1KCKA 4TYUA 3MUHL 5E6IB 1MY5A 3KAAA 3G5YA 2JCCA 2FX7H 4JFPB 2ADGB 1EFXD 1YJDC 3RVUD 1MWAB 4E42A 4FQXD 4F7CB 5FB8B 1TTUA 2LFGA 2QQNH 1J0ZA 5EO1B 5GRJH 4P2OB 5C0BB 4PRIB 1QLEH 3CU7A 2AV1B 1P69B 4M7JL 5ANME 1DN2A 2DIAA 1G7PA 2AXHA 2GSIB 3P40A 1C5BL 3PGFL 5TFSH 4Z78B 4RBPK 2EEAA 4KK6C 3SGEI 2DWEB 5I1CL 4PPTA 4OZ4B 2VLME 4AENB 1J8KA 4YUEL 2IF7A 2HH0L 4XXCC 3TZVA 3GM8A 3V5KA 1U8OA 2FHFA 3HNVH 3IDJA 3U2SA 2CLZA 4BQ9A 4HDIA 1S5HA 2DIBA 4KK6D 1DQTA 2EXYC 1BPVA 5DD6A 3WLWC 5TDNB 3E8UL 1UA6H 3PP4H 4ONHB 3VG0H 2O5YH 4FQLL 4IIQB 1RVFL 5BZWB 4NQUA 4P9HH 5J6GB 4NN5C 4P23B 3QZWA 1R3KA 2CGRL 3JV4A 3VH8A 3L5IA 1ZEAL 3CVHB 2PYED 4NNYA 1MFDL 4C83A 5C0CD 1F4HA 5L7XH 5IWLA 4PP2B 3IDXL 4UTBH 1SVCP 5DJDA 4Z5RA 2EXYD 5TF1L 3OL2A 3BW9A 3TA3B 4C56D 3TO2A 3WKNA 4QXUL 3UZVB 1DLHB 4ESKA 3CFCL 3IB4A 1EJOH 5F7DA 3UEZA 5C0RL 1HWGB 4I2XA 2R2EB 4JVPA 1N6UA 1YQVL 5ITBL 3QHFL 1JI1A 1WITA 4P49A 1CXLA 2BERA 2Q7NA 4D9LL 3KVQA 2PW2A 2PTVA 2FB4H 1JWMA 1RUQH 2CH8A 3FFCA 5FUCC 2F19H 2OR8A 3U30C 3OKKA 4X4XA 1X5LA 1UM6H 1WIPA 1JFQH 5SV3A 3T77A 3QWQB 4PBWD 1J88A 3FT4A 5C0FA 3KG5A 3RIAF 1JWUB 4XBPA 4H0HB 2O5XH 4G9DA 4KPHL 3QO0A 1T2QL 4RAVB 4KROD 2VABB 4LLAA 2GSGB 4NZRH 4P3CL 3DHJA 3ROOA 4BJLA 3HG1D 1B0WA 5I19L 3VRIB 2XTJB 2VZOA 4JFFD 5KSBE 5A3IC 1A7PL 1IM9D 4S1SL 3CFDB 4HV8B 4PD4K 5DJYB 3BXNA 1ITBB 2CXGA 3AS0A 4G5ZL 3CXDL 4MJ2A 3GMRB 4CU7A 1H0DB 3R06B 1KJVB 2BSRA 5DVNA 4HSQA 5FUZH 1L4IA 2NX5B 2O5ZL 4L4TD 3PL6C 4UINH 1BFTA 1Q0XH 4XNUL 5BVJA 4ZQKA 5HD8C 4NWUH 3RP1A 1HSBB 1WWCA 2Y7QB 1D6EB 4BH8B 5A3ID 3KPPA 3KPRD 1I8LA 4APQD 1MQKL 1I7TA 1OF2B 1XCTA 1QEWA 4XRCA 2VR9A 1WIOA 1J0JA 4FTVB 4P46A 5JDSA 1FL6A 2NY4C 3LPFA 4MMZC 4X6DB 4WV1A 2ADFH 2XZCH 4RWYH 2X4QB 1AC0A 4D0BA 1Z9SA 5HD8D 4MAYA 1OAUH 1S7VA 4I5BB 3MJ9A 1KN4H 3X14B 4HWBL 1GVIA 4P3DA 1NCAL 1TTFA 3EDEA 4PY7B 3H7BB 5CCKH 2RFXB 4JFYB 4NDMA 3PWUA 3CSPA 4Y7MA 2IANA 3V7MA 1N6QL 3DHMA 1ONQA 1JGLH 2OLDA 1F4WL 1TQBC 5JOEA 3LCYA 5E5MA 3DV6B 4GQ9L 1IAKB 4NSKB 4CVZB 1LDPH 4LHQB 1R5IB 3D39D 4OLWL 2ICEB 1OP5H 4L9LC 3U46B 1FGNL 1OGAA 5HYIA 1JHTB 4FMKA 5IHLB 1ZHNA 3D25A 1RAMA 1R5WB 3GSRB 1A1NB 4X4MA 1QR1A 1NGWA 2YPLD 1H15A 4L8BA 1MCNA 3G5ZB 4AEIH 1PJ9A 4YDLB 3MUY1 5E1HB 5DJZB 5JQHC 3AC0A 5SV4A 4YFLF 3VDBA 2HFFB 4K9EC 4XVJH 3HC0A 2PW1B 3AXLB 4Z7OF 5SWSA 2GTWB 1MCDA 3OG4B 1IGML 1E4XH 4PJXF 3X3GH 3EGSA 3IFPA 3QDME 1JYNA 5I75C 3RNKA 4J3TA 4L5FH 3IAQA 3UZQA 5DUML 3C6LC 3QXVA 1A5FH 1B0GA 3PP3H 1QRND 1VFBA 4WI4A 4DVBA 3MRJB 1PKQA 4GRWF 2CDEA 1MLCB 2BNQA 1LQSR 1C1EH 1JPTL 1KG0B 4R26H 1U3YA 2LVCA 1WBYB 4MNQE 4QRRA 1UWEH 3U83A 3FCTA 5C0AB 1I1AC 3O41B 3C6LD 1EGJL 3SPVA 1N64L 1KIUA 3L95A 4JPVH 2X6MA 5E8NA 1H3VA 4KDTA 1JNLL 5HHPB 3RTQA 3ULSA 3BQUB 1LO0L 2QKIA 2PR4L 3WSQL 1A7QL 1LILA 1OGTA 3C60B 3MV9E 1ZLSH 5DD3H 4HULB 5JR1H 3MX0A 1JZ4A 3AS1A 3F7YB 5DHXB 5EOCL 1I1AD 4UB0H 3WN5B 3RI5K 1KLUB 3V5DB 3WFBL 1V5JA 4LLMB 5E4EB 5FYKE 2C1PB 2GTZA 2F8XC 3EOAB 2DIJA 4MA1C 3VE0A 2Y23A 2N1KA 4B5EA 2CUMA 5H2BB 4WW2C 3RX5A 3FZUC 5BJTB 1A0QH 5JPMB 1KYOJ 1EFXA 3G04B 3NZHL 3QRFM 4PJCE 2APTA 1PY9A 4TUJB 5D2NE 1P9MC 4MJIB 3N9GL 1NFDB 5E70A 1R0AL 3CCHB 3QWOA 1U2CA 2EKJA 4NO5A 3FMGL 1GAFL 1NAMB 3FZUD 4M6ML 2G9HA 6CGTA 2EIBA 3GJEB 2E8ZA 3BISA 4DFHA 3EDDA 4NQDB 4QHNA 4TPRH 4NRYB 1G7QA 3CSBA 4ZAKD 4FN0A 1MRCH 2E9BA 3QIUC 3K74B 1JWSB 1OTTC 3NZ8B 1M1SA 2O61A 2IGFL 5C0DB 1KB9K 4PGBA 2YUVA 3UO1L 3HI1B 5DRXA 3PWVB 4XCNA 1P7KA 1Q9KB 1AP2B 3T09A 5JW3L 4QGTA 1S9XB 4XMLL 3FN0L 5DJ2B 1JZ7A 1U91A 2XWBB 4Y4HA 4XWGL 1M7IA 4LKXA 2VSDA 2A6KA 4OCXH 2HJFB 4LSVL 1HEZB 43C9A 1GGIL 5KVDH 5DVMA 5KJRH 1OTTD 4GKOA 4PUBH 4PJFB 5I2IB 2R4RH 4XXCA 1NBYA 2OZ4L 2HFGH 2R23B 5TE7L 5CD3A 5M7QA 3HTLX 5EA0L 3RHWK 2FD6L 2WV3A 1VFAB 3WJJC 1YDPB 1TCRB 2YD3A 3VWKA 4LCIH 1BIIB 1BAFL 3FQXA 4FFYH 3MLUH 3T2QA 4XP9H 4PJ7B 1T7XA 3HZMA 1UVQA 1RU9L 2CXKA 5HYFA 5SWZE 4JHBA 1EBPA 3F5WB 3VFRB 4ODVH 1MFAL 4GKZA 4G6JH 4LU5H 2HKHH 3SBWA 1LE9B 2WINB 4YX2L 4KTDL 5DRZB 2P4AB 2QADC 3UJTH 2P8LA 1KJ2L 2ADJA 1UB5B 1DEEB 5GGQL 1HNGA 1UEYA 1F13A 2HKFL 1G7IA 2AJUH 3FAWA 4YXKL 2DLFH 1YEDB 4CNIA 4Q9RL 3N06B 4NM4H 1LO2H 2DRUA 2NY3C 1HWHB 3K4ZA 5EBMA 1F6AB 1OPGL 4AIZA 5CP7B 4U6HB 1OT2A 4Y1AD 1A9BB 2HFEA 2IQAB 1HH9B 3HE7C 3BMWA 4RDQG 3RL2B 1A64A 4R96B 1UWGL 4Y2OA 4U49A 5GJSH 2XPGB 3QXUA 4P2RE 4YBLC 5FYLE 2XKSA 5SX4H 4JM2B 1KC5L 2L0DA 2NY3D 3V0AC 5J0BA 1RJZA 4YFDB 2FIKA 4U1SB 2J3SA 4L4TA 5FCSH 2EDFA 4NKMB 3HE7D 3G6AA 4PJ5B 1MLBA 5C0BE 4EKXA 3C6SB 4RIRB 2DQIH 2HFTA 3O6FA 2AI0H 1ZGLA 5L2JA 4JFEA 4JFHE 3IJYB 5CIPB 4DFIA 3MRRA 2OTUB 1ZT7B 4MNGA 4LVHB 3DUSA 3DV4B 3TBTA 5EZJA 4OCSH 3CPLA 4OAWB 4L4JA 3LEXB 3PL6A 1V7ML 2N4IA 4M6OL 4N0FB 2DOCA 1E0OB 3QCVL 4H1LH 2CKBA 4B7LA 1P4LA 3QEUB 4G9FB 1WLHA 3RJDA 2GK0B 3CMOH 3JV0A 3QDHA 4P59L 2X70B 5GRZA 1XZ0A 3U4EA 5IIEA 1NCDL 2VUYA 5A43C 4R8WL 3M1BA 4P2QD 3OXRA 3WIFB 3HZYA 1J1XL 1IGTA 2ZUQC 3WJLA 5D2LF 2KZ1B 4NP4H 2JCCB 1FAIL 4IS6A 4K55A 2YPLA 1BREA 3R0MA 4E42B 3E6HA 5CEZH 3C9NA 1QPXA 3OR6A 1G6VK 4BQ6A 3QRGH 2B4CL 2E27H 2VC2L 2IFFL 5EIQA 1W2KT 4DKAA 5I1DA 2EH8H 4L9LA 4U1HA 3L7FA 4U31A 3MSPA 3ESUF 4WUKH 3RBSA 4EQ3A 4H5SB 3ZTNH 4CDHA 1G7PB 1YN7A 2XY2A 3SGKC 4JRXD 4B0MM 4EUPG 3EYQC 2P5WB 2I9TB 2VDQL 3OJ2C 3U48A 5HXMA 1WIUA 4HS3B 4PGZA 3CFJA 4MB3A 5I16B 4MHHG 2NR6C 3S34H 4RRPA 3TZVB 5IW3A 5DZLA 3V5KB 1OTUC 4U3XA 4YZFF 3NCYP 1YEIL 2CLZB 4HDIB 4DZBA 3EYQD 4JKLA 5DD6B 5JA9A 15C8L 4YHML 2C4FT 3O9WB 5JQ6H 4NFCA 4MXVE 3CXHJ 3FO2B 3O2VH 3DOSA 3QCTH 3QZWB 4CU8A 1R3KB 1UJ3A 1WWAX 5IV2A 1OTUD 2FJFA 4NN6C 2W1NA 4GW1A 4NO2A 2HLFC 3DX8A 4HUXA 2W9LA 4YBQC 1I1AA 4Z5RB 4ZOAA 3NBNA 1XF2A 1U8JB 4NOBA 1HH6A 3H3PH 5F9OL 3BW9B 3ARUA 5DVOA 1TNNA 2NX5E 5TPWL 4BFGA 1T7VA 5E2TL 2GJ6B 4PREA 1F58L 2Z92A 3IAPA 1BVKA 4MJ6A 5FO7B 3MGAA 1F4XH 2MOVA 1FFNA 2HLFD 4FHBD 4YBQD 2I07A 4IMKC 2PW2B 3BD5A 3FFCB 5DLML 4AEHL 2WBJC 4S1QL 3T77B 4XC3L 5D1QA 5C0FB 3JWDC 2HT4C 4MB5A 2HAZA 2FBOJ 5KVEL 3ZSSA 4XBPB 4G9DB 4HWEH 1MFCH 4L8SB 1VGKA 2P43B 3QO0B 4PJAF 5ERWB 1FYTE 3BDBA 3ISWA 2ITDB 1QYGH 1Z5LA 5BQ7A 3ROOB 2ZJSL 2WBJD 4LQFH 1U6AH 1UXWA 2VIRA 1YZZA 2BJML 1YC7A 5FOBA 3ZE1F 2HT4D 3UJJL 1GHFL 3JWOC 3ULVC 4TNVF 4QXGH 1RI8A 3S36L 1ZK9A 5ISZB 1B90A 2BSRB 4KAQL 1NGPL 4N0RA 3WIIL 1INEH 2PKDA 5EDXA 3WFDL 5JXAL 4ZQKB 2Q6WA 4K3EL 3LD8B 3OKMA 2YD8A 5FYJU 4TVPE 1NCUA 3QIUA 4MDJA 4OD1L 3ULVD 1G9MC 4ZUVB 1J10A 1JGUH 1I7TB 1MCPH 4ALAL 1G7HA 1QEWB 5JPNA 1DQJA 2VLJE 3L3KA 4P46B 1MCJA 4OIBA 3BO8B 4X7SL 3QEHB 5E8PA 4WV1B 4F80A 4YDKH 4JDZB 2DQHH 4FABH 4MAYB 5C7XL 3VXPA 3IETA 4YNYA 2IADB 5F7MC 1PLGL 2X42A 2HT3C 2VDRL 4BSWB 4WFEE 1Y0LA 4WHTA 3NGBB 3PWUB 2X7LA 1RIVH 2IANB 5C0AE 1X4XA 4O9HH 1ONQB 4DTGL 3CUPB 2WUCH 3GDBA 3WJJA 3KHQA 4N90D 4OBRA 3TIEA 5DQDL 2J1KA 2NXYC 1OGAB 3GO1L 4HPOL 2HT3D 3C2AH 3D25B 1I1FA 1KLGA 1QR1B 4DKFL 2OJZL 4ZFOA 4L8BB 4OCYH 1MI5D 5T1LD 2V7NA 2OP4H 3GMMB 3OG6B 1NBQA 3UTSA 4XP4H 2AS5M 4UAOC 3TIDA 4PG2C 1ZMYA 2NXYD 4XAWH 1WTGT 3HC0B 5MP6H 4Y1AA 1J8HD 1T1XA 2MQ0A 5SWSB 1UACL 3GJFA 5GGVH 1U95A 1BGXL 2OL3A 3EGSB 3NCEB 4UNVA 2VDPH 4MCYB 4YBHA 2R1YA 1GC1H 3RNKB 4FXKA 4BK4A 3HR6A 4KGJA 3HMXH 4OB5L 5F88A 1B0GB 1G7JA 2B5IB 1VFBB 4MSWA 4ZNCD 1O5DT 4Q6IA 2MHAB 3L3GB 2YEZB 4MJIE 4RBPH 3WEXA 2EYTA 1IGFH 4Q74A 2DYPA 4QRRB 5FM4A 2D03L 4X5XA 3T0EE 1I8MA 1QACA 2AGJH 4HGKC 4KJQC 2JIXD 5HDQH 4J8RA 1A6WH 1IFHH 3JBG7 1YEFL 5E8NB 1PW3A 2BHZA 3MJ6A 4M7LL 3F12A 2MNUA 2Z8VC 1KELH 2QKIB 1S5IL 1F3DJ 1RULH 4NUJA 2OXHA 3KYNB 1CQYA 3TYGH 3FO9A 3NCCB 5C92A 3SDCB 5ALBL 2GAZB 4RGOH 3HHRB 3OXSA 4POYA 4KJQD 5C08A 4M7LT 4H25A 1PSKL 1AXIB 2WIMA 1FC2D 1INDL 5BZDB 1OSZA 4ZPTB 1ZANH 3OF6A 3GJFK 2P24A 4M93C 2R0WL 2GTZB 4U6VL 1FJ1A 3LHPL 1BOGA 3IGAB 3B9EA 4J3OC 3LKSB 4QHKJ 3V0WL 3WDHA 2M2DA 3Q5TA 3VMOA 1FIEA 4ZDHA 2X10A 5C6TH 2VO5A 1N5YL 3MRGB 3CMGA 1U3HC 4HHAA 4KI5E 4K94C 4ODBD 1FV1A 2Y25A 3L9RA 4HCRH 4Y5YB 4PJ7E 2OTPA 1QP1A 3ALPA 4KTEL 5IVZB 4OFYA 4NO5B 4HFUH 2G9HB 3NCMA 5T3XL 4JO4L 1U3HD 3MRQA 1O7VA 3A67H 1JHLL 4HLZG 4KJYB 4RFEB 3IDYC 3FQTA 2V2XA 3OJMB 1T2XA 1RZ8A 3QULB 4LCWD 3ARQA 4NC1C 2UYLA 4WO4C 1QBMH 4PGBB 4FG6C 2C3HA 2DLGA 3OKNA 3QFDA 1P7KB 4XCNB 5DRXB 1EAJA 3GSOB 4OZIE 5E00A 5E8DL 4O00A 2BFVL 4JHWH 1S7UA 1U91B 4GAJH 4Y4HB 1M7IB 4QHUA 4OLZL 1IEAA 4TOYH 3EYVB 3RZCD 2OMNA 5TDPA 1PAMA 2RAMA 3V6OC 3K80A 4EBQH 2B20A 2GI7A 4WO4D 1KEMH 1ZT4A 4FG6D 4HX1B 4PGEA 1AE6L 1CD1A 1HOCA 4JY4A 3UPCA 5CD3B 3QXWA 4TVSa 5DGRA 4OFVA 4ETYA 5DTFB 3VWKB 3CFEB 3GIZH 1FG9C 3IKCA 3I3BA 3QSKB 4MYWB 3QNZB 4NC2B 1X9QA 3HMWL 2AJVL 4AY0A 1H3GA 4LCCC 5FYJL 4Z7WE 1F4YH 1V3LA 2ZCHH 1CL7L 4G42B 5LCVH 3DO7B 1MFEH 4MDIA 4FQHA 2R4SL 1B4JL 1GOHA 1NL0H 4RA0C 2AV7A 4CVWA 4GUPA 3WMSA 2P8LB 4ODXB 1FBIH 2RCSH 3SO3B 1GIGL 4G9FE 5JIIA 3P0GB 4ONFL 2WLYA 4MMXC 5K93A 4X6FB 5IBTL 5IT2L 4IMKA 4F8TA 5JDJA 4AIZB 1JRHL 4FZ8L 1FLTX 2YRPA 4LLYA 3LZFH 1I7UA 2WBJA 4WTWA 4YEFA 4XTRC 4V1DA 2EDHA 2D7TL 4OQ1A 2VWEC 4XH2A 1AGDA 5HSFA 5K9OA 2W38A 2HP4A 2OQJB 1RZJL 2VQTA 2JCCE 4MAUL 1NCCL 3MLXH 1RJZB 1TJGH 3MRMA 3RWHA 2FIKB 4LHUA 3HNSH 1Y18A 3UTTA 5HHMD 4QRSA 3I6GA 1YYML 4EDWL 3SDYL 1CBVL 5FYJD 4QRPA 4MQSB 3O6FB 4RFOL 1PG7X 3ZDZE 4JFEB 3GSWA 4DZ8A 3MRRB 4OCWL 1CDYA 5ELIA 4QOKA 5DDHA 1I85C 2QV2A 4J7RA 5EZJB 5HYJD 1P1ZB 3FN9A 1P7HL 4EVNA 2DQFA 3HAEH 2ZKHL 3MYJA 3O2WH 3VI4F 4HJJL 4HW6A 2CKBB 12E8H 4KJPC 5EIIA 5C3TA 3GB7B 3MTRA 4Z9KB 4NCDA 4LVEA 4M5YH 2JB5L 5DSCA 4YIQA 1SVZA 1IGYA 2IG2L 2PUQT 5C3LD 4B7IA 3VFNA 3IF1B 4ISVA 3U4EB 5IIEB 4QNPF 2R8SH 2MSPA 4ERSH 3M1BB 4LEXL 2FNBA 3OXRB 3MGTB 5JA8B 4KJPD 4NKOB 2ARWA 3QEGL 2NY0B 4PV9A 4NNPL 5GGRA 3RWEA 2VLRD 1MI5A 5D7IB 1ETZB 3VFMA 3C9NB 3OR6B 4OZHF 4WU7B 1BJ8A 3UDWA 3S37X 4LVNB 4U1GB 4G7YH 3L6FA 3D2UA 5I1DB 3N1PC 4HT1H 4L9LB 3T4AA 3VFOA 4K7PL 5AEAA 3LSOB 1YEHH 3D9AH 2BC4A 1YN7B 4I2XE 4JY6A 3BFOA 2QSVA 1LP9F 5BMFL 4PRDB 1S7XB 3QIBB 5TE6L 5DJ6A 3FFCE 4HIXL 4E5XA 2DQGH 5HYQB 2EXWC 3CK0H 3MXWL 4XP6H 1FG2A 2BVEA 5BRZA 3LKRA 1FZMA 4G3YL 1K8DB 4XPBH 3MOBL 3P30H 3GBML 3GHBH 3VWJC 1LNUA 1OARH 5IQ9A 2APBA 3V4PH 5I76A 1J1OH 2EDJA 3PWPA 2EXWD 5C0EA 2BNRB 2BK8A 4OTXL 3TBYA 4XPAL 2NY2D 1UJ3B 1NLBL 3D69A 1CCZA 1MFNA 4HIJA 5C9KA 1I7RA 2NY6C 4HJGA 4NO2B 2Q8AL 3DX8B 4HUXB 1MVFA 1XF2B 3WUWA 1PZ5A 2VKWA 5DJ8A 5JZ7C 4L3EB 3EO9L 1QSFD 1YMMA 3SDDC 2A9MH 4PREB 3OX8A 2Z92B 1W72H 5C71A 5CJ8A 1BVKB 4MJ6B 4XPTH 4D9RE 4Z7VA 4I13B 1FFNB 2NY6D 3BGMA 5FO9B 3VFVA 4FXGB 4P9ML 2I07B 3C8DA 3BH8A 5TQ0L 2BXZA 2E7LA 3HI6L 5E94A 1LP9B 2FGWH 3SDDD 5D1QB 4OCMC 3MA9L 4M62L 3GI9H 3IFOA 3SE9H 2B2XH 2FHCA 5GSRB 2UVFA 3MMEA 2IANE 2VISA 2XG4A 1YEGL 1Z5LB 3S4SB 4MXVF 2FH6A 4IMLA 5BQ7B 1QLFA 1WBZA 1UXWB 1D5ZA 3I2CH 1H3PH 3U7WL 2Q8BH 2V17L 2HRPH 3BP6A 4LFHD 3BPLC 3HRPA 5FOBB 5KANI 1OGAE 4OM0H 1PFCA 4N9OB 3IAGC 3G6DH 2AEPH 4X4ME 2H26A 1WAAA 1OQOA 1OWWA 3QDGD 4XVTL 4HLJA 1WZLA 2Q6WB 2IALB 2XICA 2I9LB 3RGVA 5BCAA 2WBWB 4N8VA 1CGUA 3WIHL 2J12B 2X9XA 1BIHA 5SWSE 1FNLA 5EU6D 1G7HB 3KYOA 4S0TD 4WI8A 5JPNB 1DQJB 3L3KB 4J2XA 2IPTL 2F9BT 3HI5L 4Y2DD 4X6EA 5E8PB 4M7JH 4DN3L 5IB2B 1H3TA 2KL6A 1A2YA 2YZ8A 1V05A 4DCQA 1PKQE 1AY1H 2XWTB 1OCWL 1QO3B 3IETB 4YNYB 1V3JA 4BFEA 4D8PA 4NT6A 3V6OA 2BNQE 4OCRL 4JFDD 5C2UB 3DX7A 5C09A 1Y0LB 4QRRE 2X7LB 4YUEH 1G7LA 5KVMC 5CKAA 3QBTB 5ILTH 4X9FA 3ECBB 1DVFA 2KUTA 3KJ6H 5FA4A 2APFA 2VDNL 4IRSA 2GT9A 1X5GA 3TIEB 4RFNB 3BYTA 3E8UH 1BHGA 3VGHA 1LO5B 4FXLA 1N2RA 4FQLH 1RVFH 5LBSL 4ZFOB 1JN6A 1NMCB 5HGHB 1ZEAH 3G5XA 5F70A 4U0RB 1EUTA 5L2KA 2EDWA 3UTSB 3WNKA 4J4PA 1X4ZA 1P2CA 4YHLL 1TPXB 1SBBA 5D93C 5EFIA 3SE3C 1T1XB 1DTUA 2BHYA 2QHRL 1BBJA 4H8WC 3SOBL 4BFIB 4Y8DC 3U0PA 1U95B 4QXUH 1N5AA 2OL3B 3H9SA 1II4E 2XA3A 3CFCH 5FM5O 4XI5D 5D72L 2R15A 1BF2A 5F88B 1QFWM 1YQVH 5I17B 1H5BB 1G7JB 5ITBH 1E28B 4MSWB 4D9LH 1EZVX 4ZUTA 5I1LA 5D1ZC 4Q6IB 3T2PA 3W2DL 5GJTH 3TN0C 5LVEA 1BQLL 4RNRA 3BIKB 1C5DA 3E6FB 4JY5L 4X99B 2DYPB 3DSFL 1ZLUK 2AXGB 4X5XB 1BZQK 1I8MB 1BFSA 4L4VD 5A2FA 2W0PA 4Z77A 4PJ8D 5K9QI 4N0YH 1T2QH 3LQMA 3F12B 4LSQL 3HNTL 3H0TA 5D1ZD 3PHOA 1QFWL 1AHWC 1R3HA 1DBAL 3TN0D 3LS4L 3DETD 1J86A 1O7SA 3UBXG 3SE4C 2ILLA 1A7PH 4WEMB 4JFOA 3OXSB 6FABL 5IOPB 2Y07L 5C08B 4JN2A 4H25B 3CXDH 1C5CL 5C0NC 3E3QE 4OZGF 4XVUC 5J1AA 3VA2C 1X5JA 5EH1A 1VHPA 3LKNB 1VACB 4JANA 1OSZB 2AK1L 4K7FA 3AREB 5HDLA 5D5MA 2O5ZH 4G8IA 1T5WA 4XNUH 1FJ1B 3MLZH 5AWNL 2A9NL 1YEEH 4HBCL 3ES6B 4KY1L 2ZUWA 3JTSB 4YFEA 5HYSG 2ADIA 3CZFA 4OFKA 5GRVL 5ENWA 5C0ND 4LCUA 4XVUD 1CGYA 4WNQA 3L9RB 1URLA 1CFSA 3G9VA 5EPMA 4FQPA 1OOAA 4YDIH 3CSGA 4F37F 2Y36L 3FOMA 5I6XC 4PP1C 1G9NL 1AIFA 2H45A 3VFUA 1I3GH 5BV7B 3O3AA 3MRQB 5D8JH 5FO8A 1Z6JT 2CDFA 3FQTB 1NUNB 3TBSA 2AJZB 1RZ8B 1F4WH 4NM8L 1AKJA 1BX2B 5FA3A 4GQ9H 1KEGL 3R0NA 2UYLB 4UDTA 2RBLA 2LAGB 1ADQH 3Q6GH 4OLWH 3MLSH 3OKNB 1FGNH 2VQUA 4PP1D 2VDML 4XNQB 2P49B 3B2UD 3O6KL 3HUJA 2KH2B 3BOVA 2WZPD 4QHUB 5J11C 2ED8A 3BEWA 3QB7C 3VGBA 5I15L 1IEAB 3MRFB 4PLJC 4AQOA 1R3LB 1QSEA 5FUCE 3G9AB 3MRHA 5MEOB 5TDPB 3BZFA 1I1CA 5FKPB 1QNZH 2R0ZH 4GAYA 4ZYKB 1D5BA 1ZT4B 3EW3B 4PGEB 4KI5F 4JY4B 3KPMA 2QSQA 5ICXA 3DURA 3NFPA 1FQ9C 2DI8A 3VWJA 5J9PA 1Q8MA 5E99L 1P7QD 1VEMA 4OIAA 4PLJD 3I02A 3IKCB 5DUMH 3ZKSD 2W0FA 3OB0H 4L4TE 4NPYA 5K9KA 1CS6A 4NO3A 1QSFA 4FFZH 1M6OA 3O4OC 3QG6B 3GI8L 3QUKA 3MACL 1UZ6F 1JPTH 4HWZA 4JFEE 5GS0L 2V5MA 4OZFA 5E9DD 4Z18A 4NC0B 3ZE0F 3QI9D 4CAGA 1OTSC 2H6PA 4MNGE 4LSUL 5DYOA 5IB5A 2NY1B 3KDMA 3ELAT 3AU1A 5I73B 4KZDL 4LLWA 1IGIH 2AV7B 4GUPB 1NAKL 1LO4H 5FHAL 1JNLH 3OQ3B 2PR4H 3WSQH 1S7WA 1A7QH 3OAYK 4GMTL 4QXTA 1SHMA 3ORJA 3BP7A 1I9RH 3NCJL 4A6YL 1Q9OA 1OTSD 1ZA6B 4EXKA 2MKLC 3BZEA 3OV6A 1RURL 1FZOA 5EOCH 4LLYB 4V1DB 4JDTL 4LGRB 1OAYL 2PETA 4FFWC 4ONOA 4LLDA 4XH2B 1AGDB 5K9OB 2WQ8A 3OZ9H 1SJXA 4K71B 3FB5A 5EWIH 2IAMA 2YPLE 1DDHA 5ALCH 3RWHB 4LHUB 4ZS7L 4A2LA 1Y18B 3UTTB 4Z7WF 4QRSB 3VG9B 3I6GB 2DLHA 3S8WA 2VOTA 4QRPB 2MPAL 1XGYL 4KKLC 4PRPD 5ITFA 1T66C 5EU6A 5GS0D 3RY6A 2BSSA 3GSWB 3W5NA 1R0AH 3FO1A 4WDIB 4DZ8B 1OW0A 1BF8A 2ZCKH 4QOKB 4X5LA 5FGBC 5DDHB 2L7JA 4R90L 3FMGH 1GAFH 4CMMA 3ZYJA 1C08B 4DQOL 4EVNB 3VJ6A 3ULUC 3FTGB 3MYJB 1BJ1H 1UXSB 1ZLWK 3ARDA 5FYKU 5JW4N 2J7LA 3T1FB 3EDJA 4KKLD 5EIIB 4JFDA 1T66D 5T5FL 3VXRD 4G80B 1F3RB 3Q6FA 3DMMA 5DSCB 4M48L 1IGYB 2IGFH 3OKLB 4MX7A 4UDUB 4UIKH 5JIHA 3UO1H 1JYVA 3VFNB 1TVHA 4ISVB 3FN0H 4OLYH 2DWDA 4KUZL 4I3RL 1EIBA 2XNAA 1RIHL 5FV1L 5T1KD 3U9PL 4MD0B 2FLRT 4PJBF 3JV6B 1JF5A 3LIZL 2CIIA 4PV9B 4Q7DA 3RWEB 2OZ4H 5HHNA 2JF1A 4CW1B 4UQ2A 4AYFA 1ZOXA 4PY8I 5EA0H 4HF5L 1MQ8A 2R2BA 3C5ZC 4KHTL 2JJTA 3D2UB 1UC6A 4G8EA 3T4AB 5FECA 1BAFH 1JV5A 3VFOB 2FCBA 2AW2A 3ET9F 3TT3L 3AAZA 4UMGA 3BPOC 5ESQA 1G7MA 2VLMD 2BC4B 3CZJA 4ELMA 4PJHB 3RY5A 1RU9H 4YEEA 4YHZH 3SCMC 2VLKA 4GBXC 4NKQB 2D7MA 1I4FB 5DJXB 4X80L 3DO3A 1X44A 5DJ6B 4E5XB 4BSJA 3C5ZD 3OBAA 4JZJC 3MRBA 4NFDA 3BKCL 1FFQA 4O51A 3RGHA 5J1SC 1FG2B 4KTDH 4YX2H 1DUZA 4ZOEA 5BRZB 1FZMB 2C7UA 5D6CA 3WO4C 5IQ7H 2O93L 2FYYA 1KJ2H 4P0DA 3SCMD 5GGQH 2FR4A 1RJYA 3OB8A 4GBXD 3S36X 5DWUL 1P6AB 3H7LA 1LNUB 3F7VA 2Z31A 4OJFL 1LE5A 4Q9RH 1MPAL 4D0DB 3MCKA 3QUXA 3KPSD 3S97C 3PWPB 5D1ZA 5IVXA 1OPGH 1QOKA 3TBYB 3TN0A 1TDQA 2E7MA 2QSCH 1PEWA 4TQEH 4HIJB 4L3CA 3GSNH 1I7RB 4HJGB 4K8RC 4ZNEA 4D0CA 4WJ5B 3WUWB 1DFBL 1S9KC 2FX7L 2XN9A 1PZ5B 2A74A 1KC5H 4U7MA 1YMMB 4HQQL 4N1CA 2NZ9D 3QXAA 2QQNL 3DRTA 2Y06H 4X83A 5J12B 2F74B 4JRYB 3O4LB 5IB3A 1MVUB 3SE4A 4K8RD 3T3PE 1NMAL 2MQ3A 1AQDB 4GXUM 4FQJL 3BH8B 3DPBA 3T2OA 5E94B 4K3DL 1DQQB 4HWBA 4WWKA 1V7MH 5C2BH 5ACLA 5HVWA 3IFOB 3QCVH 3QYCA 4JO2L 3QJFA 2VISB 4OKDA 3L7EA 4P5KB 1BQHA 4Y16C 1FC1A 4IMLB 1QLFB 2CUIA 4P59H 4TRPH 3BP6B 1TETH 5C86A 3PP4L 1XF5A 4KKAC 3VG0L 1NCDH 3P77A 1OB1A 3VXTA 3STLA 1SEBA 2ICWJ 4ZUUA 1QFHA 1J1XH 4OF3A 3ALXA 3NCFB 4Y16D 1EO8L 3KGRA 2VXQL 1FAIH 3UTSE 4HBQA 1DBKL 1EAPA 3RGVB 2UV3A 4W70A 4N5EC 4N8VB 4KKAD 5AZ2L 5EU4A 1XMWA 4Y1AE 5IVOA 4F7PA 2B4CH 4DGVH 3KYOB 1JNJA 2IFFH 2R9HD 1U92B 3STZA 2KBGA 1MHCA 5JUEH 3CX2A 3MLWL 4X6EB 1T03L 1RFDH 1BZ7A 1ND0A 2GYSA 3RWGA 4DCQB 4DOHB 4Y19A 4YC2C 1ED3A 5FOJA 4NQTA 5FFLA 3O8XC 2F19L 2VDQH 4D8PB 4NT6B 1UM6L 3QUMA 3CLEH 4PJ9C 3DGCR 3DX7B 3IDGA 5C09B 3PQYA 2BVYA 3E1F1 3LKPA 2J88L 3W0WD 2D7QA 1WFOA 3UZEA 4Z0XA 4ACPA 5FDWA 3W11C 1EGJA 1DVFB 4GOSA 1YEIH 3EO0A 2DM3A 4IRSB 1LK2A 1DBBL 2GT9B 1MY7A 3O8XD 3P4OA 3IJSA 3TVMA 4G6FD 1X5IA 4PBVC 4YHMH 3U7AA 3ARRA 3ARWA 1N2RB 4MS8C 2KZWA 3RI5F 5FYKL 2FEEI 4M7ZC 1NGXA 1U8NA 1JN6B 4UZGA 3W11D 5C08E 3QT2A 2AABL 4IRJB 3DVIA 5L2KB 3QDMD 1P2CB 1U36A 3QXTA 3ARFA 4HH9A 3B5HA 5F9WC 3RVTD 1NEZA 4E9LA 5EFIB 4UINL 1Q0XL 5TPWH 4H1LG 2H8PB 3V52L 1BBJB 4B41A 3U0PB 5E2TH 5ESAA 4MS8D 3H9SB 4GXUN 1F58H 1ZE3C 4BQ8A 5E2VH 5IB4A 1EVUA 4LAJH 5JORA 3ULVH 4AG4H 3R1GL 2IQ9H 2YWZA 2ZUVA 4LNRA 2IH1A 4I0KA 2BVQB 3GIVA 2WQRA 5C07A 2ADFL 4ZUTB 3B43A 2OI9B 1OAUL 3VFPA 5DJCA 4AEHH 4RNRB 4S1QH 1C5DB 2LV4A 3F62A 4FQ1L 4XC3H 1BEYH 3P9LB 4QTIH 1FZKB 4FZEL 3T3ME 1G9MH 5KVEH 3QCUL 3MV9D 1R3IH 4WTZG 4Z77B 4QTHA 3HAEB 5TF0A 4WUUA 3SEPA 1JGLL 4M9PA 4P5TB 1GGBH 3PHOB 2UUDH 2ZJSH 2V7HB 3EOBA 1M7DA 2BJMH 2AK4A 5ABDE 5D2NC 4JFOB 1K8IA 3UJJH 2D7PA 4I0CC 3FJTA 4JN2B 3S36H 1ORQB 3QQ4B 1ZGLP 5FGBA 4GXVL 4E0RA 4KAQH 1NGPH 4JANB 4DKEL 4X98B 1HXMA 3WIIH 4K7FB 1LK3L 4Q58C 1A1OA 4G8IB 3PJSA 3L3JA 5IFHL 3GSXB 1HN1A 1NSNL 4K3EH 4K23H 2Z8RA 5T1KA 1FE8L 4OD1H 1E4XL 3CZFB 3X3GL 5C8JB 5IR1A 1X5AA 3L3DA 1IEBA 1DEDA 2R1XA 5ENWB 4LCUB 2Q1EA 4X7SH 3VI3F 2V5SA 4ZOCA 1A5FL 4I9WE 1CFSB 4TSCL 3SGJC 1U8IA 5C7XH 2ZCLH 5EPMB 4HPYH 5EG6C 5MENA 5J57B 3MV7B 4XPGL 1JCKA 2HG5A 3ARBB 5B8CA 1PLGH 4R26L 3FOMB 1BD2B 1AIFB 4P4RA 3VFUB 3WS6C 4LLVB 1PZUB 2NZIA 5DD0L 3TO4C 5IJKC 3PF2A 1S7RA 4LMQE 4NOFA 4PGCB 5FO8B 4LLUA 3BESR 5EUOA 2ITCA 1AJ7L 4DTGH 5HPOA 3V5HA 4XBGB 1AKJB 3C5ZA 3E0GA 5FA3B 4UDTB 1CTOA 4I0PC 1CICB 4R2GC 5DQDH 5LXGH 4XPHL 3GO1H 4HPOH 4Z7UF 2XQYG 3HUJB 5IUSA 5CAYB 1ZLSL 5DD3L 1YECL 5JR1L 3TO4D 5JOFA 1A02N 1A6AA 5D7LB 4UB0L 3K8MA 1QSEB 1KB5L 2DMBA 3MRHB 1TJHH 1DE4A 1RJCA 4P3WA 3KPSA 4V1DE 4GAYB 1DCLA 5I66A 1D5BB 3IU4L 3NTCH 3KPMB 4Y4KC 5ICXB 5ID1A 3DURB 2EDLA 5FKAA 1W0WA 1CFVH 2YRLA 3NFPB 3VWJB 2HLAA 5SWZD 1LD9A 2J5LB 1A0QL 3I02B 3K3QA 1HIML 1FORL 3H3BC 2YSSA 2W0FB 4OB5H 5K9KB 3UTTE 5BS0D 3G08B 4NO3B 4C54A 1KIRA 5KSAD 5JIKA 4QRPE 1M6OB 3QUKB 3F7RA 4OZFB 3KPTA 2D03H 2H6PB 5E6IC 3HRZA 3VXMD 3KDMB 3VXSA 4QOKE 3NH7L 1TCMA 4LLWB 4OQTL 5DQJA 5J13B 1YEFH 4TPRL 4M7LH 2D9CA 2N56A 4K94H 2AEWA 4MA8L 5IHUL 4QXTB 4P2OC 2HVJA 3BP7B 3NOIA 5CSZA 5ALBH 5E6ID 4POZC 4P2RD 2V9TA 5FYLD 3VRJA 1FZOB 2FJHB 3PABA 1ZVSB 1PSKH 3ARXA 1E27A 1CXKA 4OCXL 3G6JF 1UEMA 2LVEA 4LLDB 5ICZA 2H9GA 4U6VH 4Z7NE 2R4RL 3D3VB 3QNXA 4P2OD 5E56A 5C0BD 3FB5B 3V0VA 1T1YA 3QG7H 4LVOB 2IAMB 1DDHB 3BKMH 2HFGL 4POZD 2QEJA 3V0WH 1MI5E 1W8NA 4Y16A 5A2LH 1GYAA 4JFHD 2IFGA 1EV2E 3IT8D 4JPWH 1KUMA 3DARA 4MHHI 3V4UH 1N5YH 3WS3A 2VN7A 4FFYL 3MLUL 4P57A 3QDJA 1AI1L 5GSVA 2VITA 4AMKL 4PB0H 2A83A 4IIQC 5HVGB 1ORSA 4KTEH 3FB6B 4P23C 2IH3A 4CMMB 4C57C 1BM3L 3MC0A 1IGJA 3QDAA 3VJ6B 4LU5L 2HKHL 1QFPA 3ARDB 5INCA 1JHLH 3VXOA 4TULH 3QFJA 5BRZE 5I0ZA 3Q6FB 3DMMB 2VQ1A 3W0WA 1FZJB 5F7NC 4HK3N 4P23D 4KU1A 5HHOA 4BSVA 4KROB 1JGVH 1Z9LA 1TVHB 5E8DH 2BFVH 2DWDB 1U8LB 1J87A 3PWPE 2HRLA 1IM9B 3TA3D 5INDA 3BJLA 4PJ9A 3B9AA 4NKIH 2KQMA 5JIPA 1Z3GH 5GJSL 3VMPA 1JRHI 3PDOA 4Z7QF 2A6JA 5HHNB 3O45B 4UQ2B 3U0TA 4CN4A 2MCG1 1P4IH 2Z9TA 1YMME 1HILA 3MRDB 4TSBH 5FECB 1ZHBA 1KT2A 2E5EA 1ZA3B 3KPRB 4AEEA 3U1SL 1G7MB 2XTJC 4M8VA 3PNWA 4Z7VE 3IFLL 3HMWH 4H88H 4ELMB 2AJVH 2DQIL 2AI0L 5FYJH 1Z0NA 1JZ3A 3D48R 2EIZA 4PGDA 1IAIL 1CL7H 2F5AH 3O3DB 3NIGE 3QIWA 1FFPA 4OCSL 4M7KL 3DVNA 3MRBB 2EZ0C 2R4SH 1B4JH 1DBJH 2V5TA 1DUZB 3TWCH 1QD0A 4X6CF 3KJ4B 2CO7B 5DMGC 4U1NB 3KPNA 3BZ4A 1FSKB 3DNKA 1XF4A 4LPWA 2Z31B 3CMOL 1ZTXL 4ONFH 4LAQL 3MCKB 5I8KH 5IBTH 3QUXB 5FUOL 5IT2H 4N1HB 1QHPA 3BIAX 2NX5D 3RL1A 4OSUL 4L3CB 5EBGA 1KTLB 1T20B 2D7TH 4KZEH 4HIEA 1A7BA 1WAAE 4TVPL 4GRMA 4NP4L 1AGFA 1ROWA 1RZJH 3PDDA 4FTVD 4MAUH 5KS9A 3NN8A 1IAOB 3DRTB 1G6RH 3S96A 4NC1E 5GHWL 1YYMH 3FB7B 4EDWH 1CBVH 4HZLA 4PJDA 1C7TA 3OGCB 3ZTNL 4XMKL 4C4KO 4RFOH 4UI2A 3EKCA 3I9GL 1NQBA 1U8HA 3VFSA 2CMRL 4F9PC 1CGVA 3VD4A 3VXQB 1KB9J 4YDLC 4WWKB 4WW2F 3OTTA 3V6OE 1P4BL 2ATPA 4L9DA 4JKPH 2ZKHH 5BXFB 5C09E 2BCKA 1DN0A 5E5RB 3LOWA 4HJJH 1EFQA 4V2BA 2HTKC 3QJFB 4XCYA 2Z35A 1BQHB 3P4LA 5GRYA 5EOTB 1DLFH 5GGRY 1BFVH 5GGSA 1JYXA 3OAYH 2IG2H 1MCEA 3OAUL 2J8UA 5FGSA 3KYKL 3BD3A 5F9JA 4R4NC 4CJ1A 5HGDA 5EU3A 3P77B 1T21A 1OB1B 3VXTB 3T0DA 2OCFD 3O0RL 3STLB 1E4KC 1QBAA 1SEBB 1YY8B 5I71B 4TVPD 3QCTL 2HTKD 1UADC 3ZDYF 2WM0A 4PJGA 5IJVA 1YPZA 3WS6A 3QEGH 3TO4A 3AY4C 4NNPH 4J3XA 5M94B 5L2KE 3VGGA 2X5PA 3BSZL 3GRWH 2Q76A 3RUGB 3P11H 1VENA 4R4ND 3WHE1 3EJJX 5EU4B 4U7KA 4F7PB 3FQNA 4L29B 3ROLA 4MXQD 3DGGB 5FHBL 2HJLB 5MI0B 4I0PA 3STZB 4YFLI 1MHCB 3BQUC 3H9SE 4K7PH 3VDCA 4MQXC 2FATL 1XCQA 3C60C 4RGNB 4WFED 1ND0B 3UMTA 1BWMA 3RWGB 5T1MA 5BMFH 4Y19B 5C0AD 3CDGA 1ED3B 5CILL 3H2WA 2NY7H 3WN5C 1T0PB 5TE6H 3CVIL 3U4BH 4HIXH 5BS0A 1E6JL 1A6PA 3IDGB 3PQYB 4OD3L 5DD5H 5LG1A 1HHJB 3LKPB 4U6YA 5E4EC 3BQUD 5DK2A 4Z0XB 4MQXD 1V7NL 3MLTA 4Y4KA 5FDWB 3C60D 4G3YH 4RAUA 3BKYH 1SY6L 3VXMA 2SEBA 3P9MA 3MOBH 3B6SA 1MSPA 3RNQA 2J4WH 2X4NA 1HHKA 3H9HB 3IJSB 3TVMB 5DFTA 4LQFL 3ZKXB 4ODSH 4AIXA 1MCKA 4X4YA 1NKRA 3TF7C 1NGZA 2VLLB 2YBRA 4OTXH 4XPAH 1NGXB 1NLBH 4RGMB 1L9MA 2COQA 3MV8A 5HI5D 4UT7L 3L5HA 3ARFB 3HZKB 4HH9B 1INEL 4JFPA 4JJ5A 2ADGA 5D5ME 4IBLT 5D7JD 4P2CG 1MWAA 4GG6B 3BRDA 5FB8A 5ESAB 5GZND 2D31A 1JGUL 1IQWH 1MCPL 4MJID 2GFBB 1DJSA 5JORB 4PRIA 4LNRB 5CBAA 2IH1B 4ZODA 3RIFK 3R8QA 3GIVB 2AV1A 3ME0A 5BVPL 1YY9C 1ZV5A 4P9MH 5C07B 1RK1A 3VFPB 1HQ4A 1FIGH 5DJCB 5TQ0H 4UILH 4GRWH 4NQDD 4PRNA 4OZ4A 4R97B 3TNNB 5MHSE 3MA9H 2V2TB 4AENA 4WUUB 3U36A 1YY9D 1TTGA 1PX3A 4O9HL 5F7LB 1HXYB 2W59A 3VMNA 1OAKL 2WUCL 1CD9B 3IDUA 1S9YB 3SDAA 3EOBB 2XY1A 3UTZA 4EI5B 3T0XA 2AK4B 5LGJA 2RHEA 3C2AL 1KSRA 4NWTH 2BRRL 3HUJE 4IIQA 4DK3A 5J6GA 1KCSL 3K2UH 5EOQH 3A6BH 4MLSA 2OP4L 3V95A 4QRQA 1QSEE 4XVTH 1C16A 4EUPA 1JK8A 4M1CC 2BSTB 3L3JB 3B2VL 4XAWL 4UOW0 5HVFB 5MP6L 2ICCA 2B39A 3WIHH 1YUHA 5IR1B 2Y4SA 2JJSC 3L3DB 1DLHA 1IEBB 2AERT 2R1XB 1GC1L 2IPTH 4QRUA 3ZKMC 3HI5H 4XPFL 5M95B 1U8IB 1QSFE 4ZTPH 5FCUL 2FX9H 4U1MB 3RA7H 5MENB 2HG5B 5B8CB 4S1RL 3PWNB 5D1XB 1VFUA 4U3CA 5KVGH 4P4RB 1LEGA 3DSNA 4AIOA 3EYUH 3F7QA 1FRGL 1S7RB 3ZKMD 1JWUA 1A6WL 4LLUB 2PYFA 5KOVC 2ITCB 2WNGA 4RAVA 4JM2C 2UZXB 2VDNH 1FLRH 5GRUL 1UG9A 3KS0J 1KJ2B 5DK3A 3TYGL 2VAAA 2DICA 4QLRA 4QT5B 2PO6B 4XX1E 1QFWI 5JOFB 3NAAL 4HV8A 5JMOC 5DJYA 1A6AB 4FMFA 4HKJA 3JV5A 4JM2D 1DE4B 4YAQB 5ESVA 2R56L 4KGLA 1H0DA 4LVHC 1AQKH 4U1JA 1ZANL 2D0FA 5I66B 3KYAA 2BVPA 4JKKA 3L3IA 3WO4B 3L5WA 2QHRH 2YMXL 1HSBA 5ID1B 2Y7QA 4BH8A 4PJ5D 2OS7A 5E2WL 1W0WB 1S9WB 2G75A 4PJEF 2HLAB 2YA0A 5CWSA 3RX7A 1LD9B 3T0VA 5C6TL 3QDGE 1DBML 4FTVA 2YSSB 4Z8FH 3WXVH 1KIRB 4X6DA 1L7TL 4HCRL 2APXA 1T89C 3LRSA 5D70H 3W2DH 2VYRE 3ZDXF 5L0QB 1CT8B 2MWCA 5EU6E 4I5BA 1BQLH 2YR3A 1S7SA 3IS0X 4F7MA 3TH2T 5CZVL 2YK1H 3HRZB 2ENYA 3VXSB 4G9FD 3H7BA 4QHKI 2RFXA 5DQJB 5FEBA 3QWRD 3DXAA 3A67L 3VW3H 3MZGB 1KTDB 2FSEA 2DQCL 3OSKA 3HNTH 4LSQH 5I8CA 3B4NA 4JFDE 1DBAH 1NDGB 1UFUA 5CSZB 3U46A 2F5BL 2ICEA 3TBWB 1EO7A 2DQUL 3VRJB 1E4WL 6FABH 3PABB 2DB8A 4GAJL 5F8RC 2X4PA 2MFNA 4F9PA 3BRGC 4O2CA 2W65A 3G5ZA 2ZOKB 4TOYL 4XMPH 1WFUA 1J05B 1CLZL 3GKZA 4PLKC 4HJ0C 2AK1H 5L9DL 5DJZA 5ICZB 5J4MA 5AWNH 2HFFA 4WCYL 3K2MC 3QNXB 2A9NH 2PW1A 1Q9LA 4KY1H 3TZVC 1MEXL 5EULV 2R39A 1ITCA 2HWZL 2VDOL 3ULVF 1SYSB 3WS3B 4PJEB 3GIZL 4P57B 4HJ0D 2YD1A 3QDJB 2RIKA 4GW5A 5GXBB 3T04D 2VITB 1E4KA 3O9WC 4ELME 4NHCH 2VLKE 4JZOB 3TZVD 5CZKA 4LEOA 1B88A 1F4YL 1RIUH 2ZCHL 4U3HA 2V6HA 1WBYA 1G9NH 2NY5C 5LCVL 5IWLC 1IGJB 5INCB 3F6LA 3ARGB 3I3EA 4E41A 3QFJB 5JXEA 4HUUA 1OL0A 4NM8H 4WFGE 1UWXK 2RCSL 3LQAC 3BQUA 4JDVB 3GEWB 1LHZA 1A4KB 5HHOB 2D0HA 3GK8L 4BSVB 2HA1A 1TENA 3ARVA 3T08A 4Z7NF 3S5LG 1HI6A 5I15H 5IVXE 3LZFL 3V5DA 2J6EH 2BRQA 4PJ9B 5HDBE 5A40E 3WDJA 4WY7H 1WCBB 3LH2L 4U6XB 2C1PA 1WK0A 4ZNEE 2A6JB 1NCNA 3U0TB 5GZOC 1CE6B 2XN9E 3VA6A 4L8SC 3MLXL 1G84A 2K9UA 1P84K 5H2BA 5DO2C 3T0AA 1TJGL 2Z8WC 3MBXL 4EDXB 3HC4H 3UTPE 1HILB 5BJTA 3HNSL 1KT2B 3FFCD 2OM5A 3IXAB 3G04A 2FX8L 1UH2A 4PJXA 1BJ1J 5GRWA 3PNWB 4NJ9H 1TVDA 4M00A 4TUJA 5B4MC 3MJ9L 1NFDA 1ZSDA 3GI8H 3MACH 5HI3C 1WCQA 5GZOD 1P5UA 4FQCH 2EIZB 3CCHA 4PGDB 4X9BA 4GFTB 5GS0H 2A77H 3RFZC 3QIWB 2DKUA 1VERA 4RAHA 3N0PB 5DO2D 4LSUH 1FFPB 1NAMA 1QKZL 4ZTOH 3GJEA 4KZDH 3NIFE 3O11B 4NQDA 4NRYA 3BP4A 3LD8C 4NZTL 5FHAH 3GBLA 12E8L 3KPNB 5B4MD 3BZ4B 2ED7A 1I8LC 5HI3D 5J1TC 1JWSA 3NZ8A 4GMTH 4BZ1L 1XF4B 1A6UH 3V2AR 3NCJH 5ISZD 2C5DC 2EDEA 4P46C 4A6YH 3PWVA 1D9KA 1AP2A 4L1HA 2QL1A 2AJXH 1S9XA 1F11A 4WI9A 4BKLA 2R8SL 4WV1C 2XWBA 4MAYC 4ETQA 3M07A 5J8OA 3K1KC 3D18A 2HJFA 2XXCB 4GRMB 3DX6A 2DBLL 5F96L 4D9RD 4PJFA 3ARSA 1J5OL 1NH6A 4P46D 3S35H 5CD5C 1EEYA 3NN8B 2XFXB 4Z7VF 4KV5F 4OF6A 2R23A 1DQDL 2B1AH 4ENED 4ZS7H 1VCAA 3S96B 2KKQA 4MAYD 1YDPA 3U7YH 1TCRA 2W9EL 2XKUA 2MPAH 4PJDB 1KPUB 5EC2A 1XGYH 1YEHL 3D9AL 3ZL4H 4KKNA 1WEJL 4X6BB 1YYLH 5DFVD 4RGNE 1UCBH 2DJUA 4NQCA 3SDXB 5CD5D 1U8HB 3VFSB 2IAND 4NKDA 4TUOB 4Y19E 3VFRA 1FFOA 4R90H 4XCCH 2DQGL 4DQOH 5JW5B 2ATPB 3FO0H 2BCKB 3PQYE 1LE9A 1AO7B 1DN0B 3CK0L 5LGHH 1KCVL 5DRZA 1OGAD 3MCLL 5T5FH 1UB5A 3MLYH 5GGSB 4C58B 1QFUH 4M48H 3P30L 2J8HA 3GHBL 4N5UA 5F9JB 3KR3H 5EU3B 5ADPL 2VZVA 1J1OL 3UTQB 1T21B 5LAXA 1OVZA 2B5IC 1RIHH 2ZUSA 5F89A 1CXEA 3FONA 3LDBB 4M3JA 5CP7A 3U9PH 4U6HA 3OJDB 1A9BA 5SWSD 4PJGB 1HH9A 4JQXC 2VSCA 1PKOA 3LIZH 2DKMA 4LASL 2Q76B 4FQQA 5EU5B 1G1CA 3MV01 3AS3A 2E7BA 3ROLB 3QHZL 5AD0B 2A9ML 4LSTH 4KHTH 4KHXL 1AGCA 4UBDC 4OLXH 3X12A 1UGNA 5FV2A 4KRMB 4ZUWA 5IGXH 3TT3H 1XCQB 4NKMA 4PJ5A 1T6VN 2VZ1A 3C6SA 3SDCC 4QRRD 5T1MB 2X40A 4K8RH 1JMZA 2FECL 3CDGB 2EE6A 5C07E 1MHEA 3IJYA 4Z76B 5CHNA 5CIPA 4X80H 1H8OA 2AXFA 3B9KA 1ZT7A 1JVKA 4EJ1C 2FGWL 1YJDL 3UBXI 3QQ9D 4U6YB 4JFZH 3BKCH 2BY3A 4MNHB 5DK2B 4N0FA 3T65A 5F6HJ 4RAUB 3SE9L 2B2XL 2CPCA 3SDCD 2GK2A 3QEUA 1B6DA 4WUUE 3B6SB 5DWUH 2Q86A 3DX9B 4HKZB 5DMYA 2X4NB 1HHKB 2GK0A 2EDYA 4H20L 4JGJA 4KK9C 1MPAH 2KDGA 2KPNA 3BGFB 1H3PL 3BZDA 2Q8BL 4X4YB 3DLQR 1NGZB 1T89A 4QKXB 2AK4E 2YBRB 4OM0L 4ZOBA 1FL3A 4Y5YC 3WIFA 3ZYZA 4OGZA 1MREL 3SGDI 4QY8A 3MV8B 1OSPL 1DFBH 4JJ5B 2YWYA 3ULUE 3RZCB 3GSVA 4HQQH 3RWCB 2D31B 3GBNL 4PYGA 2P8PA 3HFMH 2W9DH 4FRWA 1V8HA 4KKCC 4AQ1B 5CBAB 4UT9L 5EIVA 1JPSL 4CJ0A 4H5SA 5LJYH 3DI2B 4BZ2H 2CLVA 1NMAH 4WFFD 2F54A 1BZ9A 1RK1B 1B4RA 4FQJH 4Y4HC 3FAXA