5EEWA

Radiation damage to the trap-rna complex: dose (dwd) 6.45 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein MtrB
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eewA00
5EEUA 3ZZQA 2EXTA 2ZD0A 3ZZSA 5EEWA 1WAPA 3AQDA 5EEYA 5EF1A 5EEXA 2ZCZA 1GTFA 3ZTEA 5EF2A 5EEZA 4B27A 1QAWA 1GTNA 5EF0A 2EXSA 3ZZLA 1C9SA 5EEVA 5EF3A 2ZP9A 2ZP8A 1UTDA
chains in the Genus database with same CATH superfamily
1A14H 3AROA 1KEML 4IGBD 2YA1A 3PIQA 3DV4A 5DJCB 5F9JB 3KZ8A 1IQWL 4FMFA 3S5ZA 2LTQB 5ITBL 3RUGB 1OAUL 5AZ2L 4AL8C 2Q8AL 4AYFA 2H26B 3KPSE 5CBEB 4JGNA 3BAJA 1OL0A 2EUXA 1KN4L 2LFEA 1ORQB 3FTGB 2MHAA 4IKNA 1OTTC 1GKEA 3O2VL 5CP3H 5CBAA 1EAJA 4AQAA 2MEJB 4N0UA 4P46A 4PRHB 3MRLA 3WE1A 2LHAA 3I02A 1IC5H 5B1BB 3MRJA 3B2XA 4XHQA 3GSXB 5ANME 3W0WA 4D9RE 4O4YL 4NUJB 4U7SA 3SZKC 2WANA 4XPAL 2ILLA 3L3JB 4PW9A 4ZT1A 4WJKB 5E2WH 4HUMB 3LRHA 2QKIC 2WV3A 3QUZB 3F5WA 5ID0A 3NVQA 5F71A 5LBGA 4N2HA 4YJZL 2BS71 1CFBA 1UC6A 2QLYA 3ET9F 2BIMA 1EHNA 4TPRH 5C3LD 4PVLA 4YGVA 4QI3A 4CN6A 4IIZA 3I84A 4MA8L 3MRQB 2QQNL 2IXQB 2MKWA 3HKZA 4QOKE 2IALA 4H0LC 1PZ2A 4F93B 4NCC1 4KY2A 4W6XB 1RULH 4HF5H 5E2TL 2QHRL 4Y4KC 43C9B 5BS0B 1QSZA 3IE9A 4BQBA 1M7XA 2V2WB 3QIBD 3OPZH 1MH5B 2QPDB 1UB6A 2JCCB 2X87A 3CX2A 3LD8B 4RGNE 5DVPA 3PHQB 1T7ZA 3CVHA 3L95A 1ZK5A 2VN3A 5D2LA 4JQXC 5GISH 4O58H 1O75A 2NY4B 3I6SA 3L4XA 4B27A 5D5MF 2I07B 3NH7H 5CAYB 1ZXQA 5JW4Q 4PMEA 3AXLB 3NPSB 2B4CC 4WRLA 2YO3A 4WFFD 2ATKB 2CDGB 1QRND 1JWSB 2ZYIA 2EDYA 3GXIA 1DQQA 5ITFB 3S5LB 4WI0A 3MMEA 1SJEA 2Y5EA 2X6MA 3IKCB 4UIKL 1R17A 3GZOA 4CILA 1SN0A 1XXDC 4KXZI 2W88A 1YYCA 4NCC2 2YWYA 3L3DA 4ZRGA 1T1YB 3FYIB 2WQVA 3PWUA 5C0CE 4ACPA 1FYTA 3QIUA 2F7QA 3OPUA 2G9HB 4MXWH 5E9AA 3VXSA 2XN9B 1EHLH 4Z7UB 3VB8A 3WS6A 2J5WA 4ZD3L 5GS0C 3V4PH 2VAAA 2X9YA 3DOSB 1Y6MR 3B7RL 1NLDH 2A9DA 5DC4B 5KSVA 2PYEE 4F2MA 4RCAA 3B9AA 4PJHF 1FSKB 3DURB 4ZMQA 3D0LA 3A47A 4RWYH 4HFUL 2A83B 4N9GA 2G2RA 2PXYC 4QIRA 1ZS8A 3P0VH 1LJMA 2XWZA 5DJXB 3U1SH 4A1RA 4N20A 4BZ1L 2GPZA 1FJ1B 3FB5B 3ZE2F 3BRFA 5F9JA 2H32B 1WA2X 1CLZH 1T22B 2OMVA 4M5ZH 3I9GH 4NQVA 3FMGL 3LOWA 5D1XA 2H26A 1PLGH 5CBEA 3TPUB 3KG5A 4A7QA 3T3ME 1F4WH 3WE6A 1PLBA 3SDAB 1D5BB 1J8HE 1SXAA 2H6OA 3FTGA 4RRPA 4G6JL 4MYPA 4P23B 2HH0L 2VWEE 3CLFH 3PGDB 5DUMH 3T8XA 1CVRA 3HI1A 2GTQA 3FSVA 3OMNB 4ODHH 3T8VA 3UTSD 3SJVD 5C3TA 2EXWD 3T0DA 1TQCB 4O5LL 3SPGA 1AGCA 5AOJA 5ABZA 1JYXA 4NUJA 1JGUL 3L3JA 1E7VA 5I2IB 5AW2B 3FFDA 1R1CA 2R4SH 4MXQD 3I74A 3QJSB 2XZCH 1A5FL 3QUZA 1AD0B 2G3ZA 2KZ1B 3SKUD 4LLVA 5AW5B 4WO0A 3RX9A 4F24A 2Z3FA 5DI8B 5D7KD 5LNDA 4G7RB 2DMHA 4XMTA 4ZMTA 4YXLH 2YXMA 4KROD 1ZEAL 1AO7B 1EHAA 1JZDC 4X4KA 3RNKA 1XX9C 4KQ4H 3MRQA 4PR5B 4BZ2L 4YX2H 5IVZA 4HWEH 2XTJC 5GGVH 3EYFB 3SDDD 4FQ1L 4K94H 3RWIB 4NAQA 1QLRA 1YYML 2XI9A 4A2EA 1XB8A 2IGFH 3RDJA 43C9A 3VXPB 1GAFL 1GRWA 4L1LA 2V2WA 4GIAA 1NAMA 1MH5A 1BYPA 5LXVA 4NS0A 1I4FB 2WKLA 3O4OC 3PHQA 3MZTA 5J7CC 2VSDA 2I07A 2IAMC 3BWZA 4LSTL 3RLSA 3JWDC 3BWUC 3WJMB 4X2UA 2EADA 1XDTT 2ATKA 2CDGA 4M6OH 4ONHB 3S5LA 3CVIL 5ITFA 5HYQA 5DUBB 3ATAA 5GXBB 4HBQA 1AY1H 1QW9A 1SLWA 1VERA 2VERN 5CR1A 1O5PA 1ZTXH 2NW2A 2ESVD 1TCRB 2ZPKH 2A3TA 1YAZA 4CNIB 2N56A 2MPAH 2QSVA 1T1YA 2ADYA 4UANA 2NY0C 5FGBC 5L9DL 1A65A 1L5GB 5DJAB 3K6SA 2G9HA 4TXVB 5EPMB 3TO4C 1AR1B 5JIDA 3TV3H 4AEIH 2XCMC 3LQZB 3NUKA 3OLGA 4DO6A 4TS6A 1BM3H 1UENA 4H1LG 5E7FA 1NUNB 1OTTD 1X5IA 4KK6C 1QHOA 3V55A 4ERSH 4MJIA 3DURA 1PZDA 4F8QA 3KDPB 3P11L 2WVVB 1N0XH 1QSEA 3ABGA 4MJ5A 4WI2A 4F91B 4Q2ZA 4LBEB 3RGHA 2J56A 5AWNH 2ZT9C 1IC7H 1RVFH 1FIGH 2D7MA 4ZK8A 1HL5A 3AAZA 3KNBB 5L2JB 4G7YL 4K2UL 4WWOA 5DURD 4JRXB 4Y1TA 2EQDA 4K0OA 2XBDA 1MJ7L 1N9PA 3SPHA 3DSNB 2FBJH 5TDOA 2PR9A 1VFOA 4RVBA 3TPUA 1MREH 2WUBH 4I0PB 4OLUL 1OTSD 1NC2A 2DL9A 2HVKB 1J0IA 2LLGA 4P23A 5T3ZH 4PJBA 4JS7A 5JIIA 4OZHB 5D6DA 5KBPA 1T5WB 4MLIA 4N2FA 5IB5A 4JO4H 5E2VH 4BUGA 4U3HA 3AS3A 5FB8A 3V4VA 4CN1A 4Y4KD 2WQSA 4ZW5A 2AJYL 2D4DA 3CFDB 4AI7A 4Q9RL 1FV1B 3I50H 2JELL 2IF7A 5I2IA 2X4OB 5D2NC 2EEAA 1PL3A 1MFCL 3K3QA 4DEWA 3PNWA 5BVJA 5GS0H 4UV4L 1IBFA 1R47A 3Q2CA 4X6CB 4E0RB 5IB1B 4IM8A 4HAKA 5L0QC 2XWBB 1FF5A 5DJYB 3F00A 3BHBA 4LCUA 3OKEB 4YXKH 3F62A 5FW8A 4HISA 3T0EE 5E0FA 3PWPE 1NM9A 1HCYA 1M05B 1BPVA 3T4YB 2DQUH 4JDVA 4K7FA 3TT3H 3P4OB 4KZCA 2UUDH 2VL5B 1JG9A 2V2TB 1M9SA 1ZVNA 5KSAC 1E30A 1G7PB 3GPSA 1M9WA 3FCTB 3VXPA 1AZZC 5SX5H 1TQWA 3NK4A 1I4FA 3NFPA 4AYGA 4NI3A 1YEHL 4OLVL 5GS0D 2VDNB 3MLTA 4P3DA 3VXUA 4YSAA 1XH3A 1MFNA 3GIVB 2ZCKH 3D39E 4NIKB 3WJMA 5JPMB 4ABUA 1USQA 1MKFA 4NKDB 4ONHA 4GS7B 1ZXKA 2P8LB 1FPTH 4LIQE 5DUBA 4GRWE 1GW0A 1XD1A 3BWUF 4AQ8A 4QHMB 4XVTH 5TD4A 2OPCA 2PXYD 3QEQE 3MLWH 1TCRA 5F7FA 3BZDA 3V7AG 1UCTA 1QASA 4ZSOE 3INUH 2ZX7A 1Q9KB 5EZIL 1OGTA 2AQQA 2DQJL 5EPMA 3ZTCC 5I15H 3O41B 5E6IA 1YZZA 1CMOA 3LQZA 3EZ8A 4Z7QB 2EDMA 1G6RH 1TIUA 1P7KB 3MV9B 3VXRE 4OCLC 1NGPH 3VSUA 2Y7LA 5JA8B 1T4WA 3MJ9A 1GH7A 4Y5VC 3H9HB 2TRYA 4IMLB 3FUJA 4PREA 3PXLA 4Z0XA 2UYLB 3AUWB 4CJ1A 3IJEB 2DTSA 5L2JA 5ISZA 3PL6C 2NNXA 1IGFH 3F8UB 4JRXA 4QRPD 2J71A 2PWHA 2I5YL 2Z8SA 1RUQH 2WZ0A 1G0DA 5EIIB 4K15A 2ED6A 3D4GA 4LMQI 1A0QH 2JKJA 3T2NH 1CR9L 3U2SB 4I0PA 1O7DC 2MJWA 1GYWA 2HVKA 1NCDL 2H2PC 3DPDA 3POHA 2Y7MA 5E6UB 5FO9B 5FECB 4OZHA 5J89A 1CBVL 2IH9A 3A5VA 5A6MA 1L6PA 3I6LD 4P2QE 4UIMB 4FJ6A 5T1KB 3LPWA 4EVNB 1M71A 4OR1A 4OQTL 3O6LH 3UIYA 3CFDA 4L37A 4P57B 2X4OA 3GHBL 2ZKHH 5DR5L 1F1GA 3UTZA 3HMXH 3O3UN 5T1MA 3BN3B 1WBZB 1T21B 3RIFK 1B4RA 4E0RA 2IAMD 2XWBA 3L1FA 1CT8B 3OKEA 5DGRA 4J3OH 2BW5A 2VO8A 4ICWA 4DESA 3SCMA 1MY7A 5BZWB 3KWWB 1WEJH 2J57A 1KDJA 3KGUA 2O61A 5MI0C 3BPCA 2LVCA 1ACYH 4ANWA 1E7UA 2OL3H 4IOFC 3QHFH 3QA3B 3WHE1 2NY0D 4AEFA 2OV0A 2NOYA 3FCTA 4N8UA 3T0VA 3LXUX 1U91B 4ZO9A 2ZXWB 4R83A 2OQJB 4Y1AB 5I30H 5DHMC 3CXHK 2A74C 1YEIL 3TO4D 1CTOA 1U8PA 3CVDA 3QCVH 4KTEH 3WMQA 1P9MC 2N0KA 5DT1L 5FR3A 4DQOH 5JPMA 5HVHC 1RLWA 2P8LA 4XN4A 4KK6D 5IGXL 1CWVA 2EYSA 4A04A 3QS2A 1RUAH 3AZUA 4FCAA 5HBBA 5JMOC 4CGTA 3W11C 2Y69B 2IOOA 4KUZH 1SEBA 2AQSA 2WLHA 3VFSB 3S6CA 3LKNA 2XG4B 4F8NA 1IV8A 5FW7A 1XL6A 1G94A 1NGXB 4FFYH 3PV7A 4BH8B 3K8KA 2EDXA 4CVXA 3ES6B 4QGYA 4BSJA 3OR6A 3BH9B 5AQ0A 4Q6KA 3SBQA 4Z7WA 3VGAC 5AKVA 2JB5L 5GGTH 3TJEL 3HA0A 4HPYH 1BGXH 3DRTB 3O3BB 3IFLL 3RB5A 3FQUB 3DVFA 4XPHH 4XWOC 5F7EH 4ESKA 5KS9F 1DBML 1AFVH 1AZUA 3H9HA 2HCZX 1JD9A 1G5AA 2DICA 1UWEL 2VZTA 5DD1H 4FHBD 2UYLA 2F7IA 2WW8A 2ICWI 3BKML 2FLBT 3AT0A 1EUTA 4XP5H 3LH2H 3LKSA 2DM2A 3HVDA 3EHBC 4JRYA 1H15A 1TO4A 5EIIA 5JOPD 4J1UB 4V2BA 2HKFH 5E8NB 3MV01 3U2SA 1INEH 1HXYB 4Z3TA 1QATA 1DVZA 3QJHB 3GSRB 1DJIA 5IFJB 5FO9A 2VDQL 1RPKA 3T6XA 4CSTA 1P4BL 3S88L 3O3DB 4G9DB 1N5AA 4XBGB 1FE8H 1M4KA 4B9ZA 5IHZA 2AV1B 3L6FB 1QG3A 1YEKL 3DYPA 3IJHA 2ZP0T 3E2HC 5FHAH 3MYZA 4P57A 1KB5L 1NICA 4JFDB 5DD3L 5TK2A 3RL2B 3HOGA 4CKVX 1RI8A 2ZQKA 3ULUE 3MX0A 4GBXC 5C6WH 5LNGA 3B6SB 1A7OL 4AENB 1WBZA 1F13A 1WG3A 3EO9L 4EQ3A 4JFTA 3HI5L 3OAWA 4XNUH 1S8DB 1XBRA 1OP4A 4DKEH 4LPWA 1RK1A 1O7SA 4BELD 3P1VA 1YLBB 4OFIA 3TTSA 1PZSA 1KYFA 5BZWA 2XPGB 2R0ZH 1NBVH 2QGDA 3HW7A 3MOBL 1A8JH 1JF6A 4JUTA 3WHXB 3QDJB 3B5TA 3BRGC 3TA3A 2WVSA 3UERA 4S0TD 2CGYA 4Y1AA 3DGDA 4DN3H 1PNDA 4KO5A 2Z91B 3CPUA 3Q2NA 5FYJD 1J1XL 5I1IL 3ZZLA 4PRPD 1HNYA 4JQIL 5D7SH 5ENWB 5IJKA 2DLIA 1KIRB 4X7TA 4U6VH 4MD0A 3UBXA 2Y1YA 1OAXL 3REWB 1NCTA 1AQHA 3N1PC 3FCGA 1EO8H 1DQIA 5HGDB 1U95B 3KH3A 2CPCA 2WB1A 3ARGB 2P9RA 4BFIB 5IJVB 3GK8H 3ZPDA 3VFSA 2GY7B 1U92A 3WFCL 4RH4A 2XG4A 3HLAB 3PL6D 3SGEI 3Q01A 3OKOA 5JHDD 3LQAL 4F58H 3VH8G 4LARL 4DGIH 4IOIB 2I27N 4UI2A 1QLEB 4H20H 4GKNB 2VITB 3OAUH 1TVBB 1BQHB 5DJDA 1HHIA 5I75C 4KKBC 4WFED 4E68A 1L7TL 3KS0J 3FUEA 3RYMA 4JZNB 4H8PA 3EG9A 3SQOL 4HEPA 1N7ML 3BKCL 4IIQA 1KXVA 5KOVC 4ZMLA 3U30B 1ZE3H 3S7GA 1MCCA 4BSWA 4OI9A 4ODWA 5IY5B 3L08A 3WN6A 2VDRL 3LPFA 3STZB 3ULVC 1RMFL 2YEZB 2YQBA 4FYRA 1C9SA 5IHHA 4PQXA 1XF3B 4M7LH 4J1UA 5E5MA 1MUJB 1E2ZA 2XG5B 4OM0H 1HXYA 1QO3B 2H45A 2YZ8A 3DIVA 1Z5HA 2RD0A 2Q76A 1A6WL 2FZ3B 4B9JA 1X9UA 2Z1PA 1M7UA 5CIPA 2PYFB 5F96H 4NNYB 1EZUA 5TDNA 5B7FA 3QYMA 5EO9B 4HGMA 3O3DA 4RGNC 4U7KA 1MXDA 4G9DA 4IOFD 5F1NB 4KI5C 3L6FA 1FNFA 4JFDA 5I71C 3GMPB 1K8IA 5HYJB 2OP4L 1MI5B 3VTTA 5IKCB 1DFXA 2BIQA 2F68X 2R9HC 2YBRA 4PJ7F 3WNMA 2QKSA 1P4IL 3NA9L 3APCA 4YUEL 3QCUL 2OMWA 3NBNA 1DSYA 2YUXA 8CGTA 2Q2LA 2IG2H 3BVVA 2OM5A 1BZ7B 2MOQA 3NN8B 2IANB 1F58H 4OFPA 1U3HA 4ZAKA 3T0XA 3W11D 4MD5B 5HPMA 4GMSL 4PGCB 1SFDA 3QNXB 1FWXA 1D5IL 3PNRB 1JWUA 4DP2X 1R3HB 2Q2EB 3WAJA 3G5ZB 1QI5A 1N67A 2PWFA 5GRWA 4AKQA 2ED7A 1IAOB 4ZG1A 1OARH 1WF5A 1KCVH 4NAJA 2KDYA 4YFLF 3M8OH 1DL7H 4H8WC 4KKLC 4B3EA 5GRJL 4NNXB 2XA8L 3OSVA 1RURL 4RSYA 5C7XL 5IROA 5DO2C 4D2NA 1FCGA 1J9QA 5EN2B 1D5ZB 3SOBL 2UXTA 1OLZA 4FTVB 4L05A 4PS7A 5TDPA 3C9NA 4UU9B 1I85C 5HGDA 2VLJD 1ORSB 1AS8A 1U95A 2LVEA 2WC7A 4HOWA 2ZNWA 3ARGA 3GI8H 1C12B 4N68A 4PJGB 4BFIA 5IJVA 3MLPA 1NCWL 1WIOA 3QVAA 1DBJL 2UZYB 4A63A 2PNDA 3HG4A 2Y2YA 2BIPA 4A67A 1R0AL 4BXVA 3EBHA 2PR4L 3BAWA 4YDMA 1H3XA 3EHBD 3G6JF 3MRGA 4IOIA 3ZL4H 4WIQA 2L7QA 2WLIA 5EU3B 1MAJA 4KH9A 4P5SA 4Q6YA 4TQ8A 1LEIA 1ADQA 4P5KA 3TIDA 2AEQH 5KVMC 1MFEH 3C87A 1EJFA 1BQHA 3OKMB 4P3CL 1J86A 2EE9A 4R7XA 2J1KA 2ATAA 2Y6SC 2P52A 3FF8A 1KGIA 3BPOC 3R18A 4LEOB 4OCXH 4NM4H 1SQMA 4H0HB 3O9WC 4KTGA 3VSVA 4B3VA 3EH5B 1SEQL 3HMWH 1HYRC 3BJ91 1NL0H 4N2BA 3ZDZF 4NZJA 1JZ3A 2JKTM 1KGJA 1ZHKB 4GBXD 4OQ1A 3STZA 4Q97A 2YEZA 5FHBH 3BPNC 1TU2B 1C5DB 1QEWA 4KKNA 5DDHA 1XF3A 1TJHL 2J4WL 2A4EA 3DX2A 3HUJF 1IAIH 2A9BA 4P5TA 2XG5A 1ETB1 3KVQA 4ZXBB 3SY6A 3NRPA 3ULVF 1QO3A 5EEYA 4GMTL 2YEQA 3F7PC 5GS2D 3V5DB 4ZW3A 1NJ9B 4NRZA 4XN1A 2PYFA 4NNYA 1BREA 4KBPA 3MRBB 5EO9A 4OZFA 3FOLA 3QJOA 1CLYH 2NCEA 3QUMA 4PRDB 2EEXA 4X6DF 2OYPA 3W2DL 1O6SB 4Y16B 1N59B 2A7BA 5CJQH 3NCEB 3WELA 5J06A 1WCBB 3AMLA 3FONA 4MHHG 1TQSA 2G75B 2EJ1A 3ARZA 3L4ZA 4HT1L 4WHTB 4JM2A 1OAYL 5HYJA 1G9ML 1MI5A 3LVEA 4KI5F 1XHHA 4MQSB 4YDZA 4Y5YA 4Z9KB 1QBLH 5IOKA 1IGIL 2ENSA 3BD5A 4OSUL 2QVMA 2GK0B 2LFGA 2VYRE 2YQ2A 2GKIA 1U2CA 4XN7A 5K9JL 4PJ9C 3DYOA 5I1DB 1H3UA 5E8PB 3KPSB 3QJZA 5B38G 2H8PB 3BFWA 3NN8A 4Y4HC 3TIEB 2GY5A 4HH8A 5GJSH 1IGYA 4MD5A 2OKMA 4X9FA 3ZKXC 4XCFH 4PGCA 3ZO9A 1ZS2A 5C0BB 2OMNA 4JFUA 1QTSA 3WTXA 2OSWA 1KCBA 1S7VB 3I85A 4YSPA 4APQD 2BXZA 3G5ZA 2IPKA 3PYCA 2EIJB 4E9SA 5ANMB 1XR9A 1OGAD 1AGBA 1IAOA 3AC0A 4HH9B 5CINL 4JFHD 1NEPA 4ELKB 5JXEC 5J1AB 3GGWB 3B1UA 3HN3A 3RU8L 2R56H 2JJSC 3N43F 1VDGA 4FZ8H 5LCVH 5EN2A 4KZEH 4PD4J 4LIQH 4KKBD 4GRWH 1N8ZA 5FGRA 2G9KA 1MIEH 4PG9B 4OI8A 3EFFB 3CSGA 4CSZA 3WXWL 1MJUH 2A77L 4ONGL 1C12A 3QYNA 3C6SB 4M7KH 2W0KA 2WQUA 2O6PA 3QJVB 4G1MB 2CHXA 5D4HA 4K71B 5GGRB 1HJBC 1CDYA 2UX6A 4KX8A 3U9PH 4QOKB 3ESVF 1S7UB 3GSUB 5J12B 2EKJA 4UV7H 2NUTB 3WDHA 1SUJA 3ULVD 4L2LA 1T5KA 4GSXA 4TOYL 1C8QA 4X7CC 1TKWA 2IWFA 3RZCC 2JJVA 4JKLA 1E90A 1KPVB 4NAMA 4Q14A 1XVSA 2Y23A 5IJDC 1TOXA 3OKMA 3SO3B 5D96B 1KY6A 4Z5RA 1F8TL 2BSRA 8PAZA 4BKSC 3Q8CA 5B3JE 3HG5A 4KI5D 4MBOA 4HC1A 3OR7A 1I8LA 5CN2A 2AJVL 2FQDA 1IFHL 1GS8A 5C0AA 1QR4A 4W4OC 2R9HD 3BP5B 4LGRB 5C0CB 1C5DA 1OF0A 2VXUH 1NGZB 4XBPB 2R2EB 4JB9H 4ZFOL 1EPFA 5AAWA 1XIWB 3V5DA 3L2LA 3U2JA 3PJNA 4RIRB 2MQ3A 4W9ZA 3IPFA 3Q1SH 2PYEB 2CO1A 3MRBA 5ESVB 4YN3A 1OAQH 3RWFB 3L1OH 4FHJA 4OZIF 3WO4B 1O6SA 4Y16A 5J6GA 3ZMEA 5M7QA 1AE6L 2GSIB 1RZFL 4QRRA 3UC0H 1J0YA 2J73A 1WCBA 3GKWH 1MFDL 3FN3A 3VRLF 1RZKC 2X1XR 3VD0A 1IGML 3MAWA 5EORH 1W72H 2F19H 4HIQA 4NOFA 3MLYH 1KSRA 1CF1A 3DTUB 1JNLL 4PLJC 1K4DB 3TOPA 4Y5XA 2E4TA 5ELIA 3EF4A 2NW3B 2V0AA 2X09A 2QVTA 4O02H 5DO2D 3OMAB 1QAWA 2GK0A 5EU6E 1T0PB 2XV3A 5I1DA 1OANA 5H2BB 2B9BA 2H8PA 3T3MB 1LM8V 3ZVVA 5C70A 1HSBB 2LR4A 2XQBH 4JFED 1NBQA 2QGCA 4LEBA 4AEEA 1BFSA 4DWHA 2XV6B 3FQTB 4P2RD 4UOW1 5C0BA 1FNHA 4M93C 4FLOA 4NN7B 2F53E 1KCUL 1MN4A 4KVNL 1S7VA 4R6UA 4PGEB 3LX9A 3SE4A 5TPWL 5JOPE 2DH3A 4ANUA 4M7ZB 4HH9A 4ZPVB 2VZ1A 3FTYA 2ATPB 3GGWA 1IBDA 2V4LA 4LCWA 4P49A 1RUKH 1IBGH 2X6CA 3EJRA 3LIZH 1KB3A 2P5EA 3OKKB 3NSYA 1JHLH 3V6OE 3V52H 3H7LA 4A68A 1YEEH 1UACL 2WLMA 3CSPA 3EFFA 4PG9A 1U2HA 5K59E 3LKOB 1R19A 2ZD0A 2EVIA 3KHOA 1DLHA 1BZEA 3C6SA 3BGMB 5HGBA 2QBWA 2O72A 6CGTA 3O9WD 4PRAA 3UG5A 1WFMA 3QORB 4KKPA 5GJTH 2EO1A 2VQ4A 1P5UA 2NUTA 1OAZL 3RIFF 1QNZH 5FW6A 3V0DA 5KSBB 3OKDB 2EECA 1ASPA 4L3FA 4OZGF 4ZDHB 1NEZG 1GGTA 4G5ZH 3Q8FA 5DJ6A 5F7UA 2JJWA 2VE6B 1FFQA 1MHCA 5I8OH 3UBFA 1I1YB 4KHTH 3TJPA 2X9XA 1SXCA 2BNQE 5AZEH 3K2UH 5C0EA 1AJ7L 3FAWA 4AGPA 2PLTA 1KGXA 4TTGA 3ROLB 3T2OA 2VLMD 1XAKA 3LKRA 3MRCB 1D6VL 1HS6A 3CFKB 1T1XB 2XICA 2VLKA 3GBLA 3QG6B 4JDEA 1MWAL 2GTWB 5I1LA 3BZFB 5FLVA 4FL4B 3TBSB 1XF1A 3BP5A 1WFJA 3HZYB 5E5RB 4YEFA 2ZE0A 1C8PA 3BSGA 3RWEB 1NGZA 3CDFA 4F3FA 5FUCC 2HG5A 1XIWA 1TQBB 1F0LA 4PJ9D 4MQ7B 4G8IA 5GS1B 3C8HA 4JO8A 1U4EA 1ZA6B 2AJSL 1PY0A 3NIDF 5ESVA 2X89D 4XXCC 5I74B 3KM2A 4QHLA 2YS4A 4KHXL 5EZOH 3A6BH 2V37A 2GSIA 5AW0B 5C1MB 4PRNB 4PV1C 5LLIC 3TFBA 3ARBC 4MJ4A 5C9JA 3U46B 4EJ1C 3ULUH 3ZDYB 3ZN6A 3HVNA 2Z31B 1HKLL 5JXED 1A7PH 1YN6B 2XN2A 2XZQH 2BDNH 1Y07A 5AB2A 5SWZB 1IGJB 2NDGA 1O9WA 3WSQL 2QLVB 2N7SA 3UGEA 4EN3C 3ARXA 2BHZA 4A6YA 1EFXD 3F05A 3WEAA 2CA3A 3PV6A 5H2BA 1PQZA 4CC1A 5KVEE 1HSBA 3GS0A 1O6TA 2MOGA 1WRFA 2IFFH 3RIAK 3HRZB 3FQTA 3FSZA 1QWHA 1G4MA 4KV5F 2ADFL 3D07A 2EAEA 5JW3H 3IB4A 3NCFB 2W91A 5C0JB 3MRHA 2CKNA 2NNRA 1S3KL 3FQ1A 1ZPLA 12E8L 2BP0A 3FCUB 5D7IE 3UMTA 2BNRE 2P48B 4RAVA 4ZPVA 4UUJB 1FGVL 1KGYE 2CLZB 4FMKA 2XWTB 1UM4H 1JGVL 3JWOL 3RZCD 2FT8A 3CTTA 1JPTH 2ATPA 2J72A 2B3IA 5IVXE 3B9KA 4EI5B 3M88A 4U1IB 3N91A 4JZJB 3O3AB 2VXVL 2X5PA 3AS1A 3LNHA 4WEUD 3OKKA 4MX7B 2BLFA 2YXVA 1UA6L 2QPEB 4NQSA 4LF3B 4DVRH 3FTSA 3JV5A 1TZAA 2EE3A 5C09E 4H88L 3FT1A 3V0JA 2E9IA 3LKOA 2PCPB 4M1DL 1EAOA 2OJZH 4ONFL 2Z0UA 2DQEH 3PWPB 3DMMC 4NPYB 2VQUA 5GZNC 3QORA 4LQFH 3HZVB 3FQRB 3NJGA 1BHGA 2C7FA 2P5WD 3HE6A 1KEGL 3EOTL 4JREC 1DQMH 5KSBA 4LRNL 3P4NB 1NFIB 3P02A 3QEHB 3OKDA 4ZDHA 1T6BX 1CK0L 3EYQC 3TM6A 5INCB 1KJ3H 1QNIA 4XPTL 3SPVB 1X7TA 3O2DH 4N8CH 2WBJB 3TFKC 1I1YA 4AQ1A 2WZAA 2E9WA 1S9VA 2XRAL 1CIDA 5I73C 1KLGA 3BEWB 5KJ7E 3RDTB 1G7IB 4EUPG 3CC1A 3PFUA 4G11A 4RGMB 2IPUG 4GRWB 4HGKC 4APXB 5C3IA 5L2KB 5D1ZB 4W93A 5EO0A 3SPIA 1T1XA 4P5MB 5JXAL 3QG6A 4DP4X 5I23A 4XPFL 1VIWA 3QJFA 3EYUH 1SUHA 4B96A 4ZSOB 4PLJD 5SV3A 3L5WA 4ENEC 3D2UA 1CXHA 5IHWA 2VDPH 2ENJA 4KY1H 4N0FB 2E9GA 2SEBA 2VLJE 4H44C 4U3XA 4AJWA 2B1AL 5GS1A 5TQ0L 5J1SC 4HUKB 4ZPTB 4JEGB 2WPGA 4FF9A 3L7FB 5CGYC 3VXRB 3ZTJH 2HJFB 1MPAL 2B59A 2OSXA 3K5RA 4MAUL 4UNUA 4NWTH 3C5SA 35C8L 4CBPA 5CEYB 5D71L 4PJEE 2W80C 4S2SA 2BVYA 3WNKA 2GUOA 2YJLA 4JFOB 5L88L 1DLFH 3BYYA 2Z31A 4XP9H 3LKQB 3FTWA 5T3XL 2OZ4A 1DN2A 4YVUA 4MD4B 1BBDH 3C60C 1IGJA 4RGOH 5SWZA 2ICEA 1FFTB 2IADB 1KBPA 1AI1L 3EXJA 1VLXA 2Q5BA 5DQ9B 3NIGE 2L7JA 3QDMA 4IJTA 2CHWA 2OZNA 5E00A 5SX4H 5FA3A 4HKZA 5JIMA 1UFUA 1DVFC 4P4RB 2EINB 4B6ZA 3H4HA 2VGLM 5DUPL 5C0JA 3BP4B 5FFLA 3S37H 4F7PA 2HX7A 5BOZG 4P2QB 1J10A 4N5EC 2WCPA 3O4LD 1CXFA 4M02A 4UUJA 3L3OC 2XWTA 2F8OA 1EIBA 2BOCB 4EI5A 2DN7A 5J9PB 4U0RB 2MWCA 4U1IA 2PPCA 5TF0A 2VRKA 3WJLA 4FNRA 2AFNA 4LF3A 2C9UA 5EEZA 4O02B 1U8QB 1OB1A 5AYUL 3VMOA 3GLDA 1A7QL 2C26A 2FQFA 2FAUA 2OR9H 4IS6A 4GXVH 1S9KC 1JXDA 3F58L 1EUUA 3L2MA 2QZQA 2MH4A 1EA9C 1F6FB 2F7RA 4XXDA 4YBLB 2F58L 2AEPL 2UWEB 4J6RH 3FFCD 3PREA 1CGWA 2KERA 4ZW7A 5TF1H 3C2AL 3U83A 1DZBA 2WWKO 3T4AC 3MXWH 1MQKH 1NFDF 1ZWIB 3QG7L 5KYWB 3GINA 5GGQL 1IIIA 1A9EB 4UAOC 5E99L 4PJCB 1REIA 1CS6A 2D2CC 5AVSB 3BEWA 3RDTA 3QDGD 1G7IA 2DWDB 4WUUD 1IAIM 4QRFA 3QRGH 4JHAL 1NIAA 1C5CH 3BEVB 1Q72L 3V0AC 4AIEA 3BSZA 5D1ZA 5K9KB 5L2KA 4TSBH 3MXVH 1GCFA 3ARBD 3GJFA 2WQWA 4KQ3L 2PABA 4JM0A 1XGTA 4K9EL 3BJLA 5A2FA 4GLRH 3RKPA 4OIBA 1SMAA 3G3LA 3BQUC 4H8UA 1TMQA 3MO1B 2IQ9H 4N0FA 4EN3D 3HS0C 2YJQA 4PG2C 5IVOA 3WNLA 1JRHI 2EC9T 2DB8A 2VC2H 1OGSA 5EU4B 1PTZA 1GC1C 2WYIA 1U8KB 4YR6A 3ZRSA 2RMNA 1T83C 1KZQA 5AW6B 3X1BA 2UY7A 1NCJA 5ESQB 1O5DT 3AS0A 4HCRA 5I16B 1BW8A 4LCCA 3RGVD 3P9WB 3OHXB 3T2QA 3N5AA 1ZOXA 3CN3A 3TBVB 3QIBB 3GBMH 4L8DB 4K5OA 4B9CA 4EZKA 5DD6B 1OSPL 3D51A 1ZLUK 5E24E 1BXUA 3ZYZA 4OCWH 2DJMA 1YNTB 2ZSWB 3X3FL 2GIYA 2CR3A 5JDSA 4JN2A 4NHCH 4X99B 4BKLB 4YLBA 4HJGA 3CXDH 1T1WA 3I2CH 1OK0A 1A66A 1ZT1B 3D12B 2E6PA 5B39G 1AQDB 15C8H 4WWKC 4Y2LA 5J56B 1QYGH 1XMWA 3HNTH 1BQRA 1X5YA 4GAJH 4QRBA 4X8JA 4FS0A 3DMMD 4GIPD 3LHPL 4H0GA 4AGOA 2ZP8A 5CEZL 1WSST 5GZND 1XH2A 2D7NA 5EWIL 3BP4A 3QEGL 3MA9H 3L4TA 4KAQH 4OCRL 4WU7B 3B3BA 4XNZC 4WW2B 3U82B 5AKRA 3QQ3B 3GRWA 5LHDA 5F9WC 1U8MA 5JW4N 2BOCA 4U6HB 1WC7A 1GL4B 5IM7A 5J9PA 1RCYA 2CGRL 1VJSA 2DYPD 4K7PH 5H37A 2LGNA 4AYSA 3NJMA 1RZ7L 2ITEA 2ZCLH 3AGWA 2ZWKA 1GY1A 4C4KT 4MTMA 4U1GC 4E9TA 2K8QA 2NY5L 2DMCA 2J5LB 4TUJB 2CK2A 4XVSL 3U9WA 2ZTBA 5E2UH 4IRZA 4A7GA 1IKFL 1HL8A 2UX7A 1R6VA 3APNA 3AMKA 4IGBA 4IKLA 4NB7A 3NCWA 3U6XA 4HJUA 1H19A 1QFUL 3KPRE 2UWEA 1LQSR 2VNCA 4PY7A 4ENED 5C6PB 1NCIA 4QYOA 1A4KB 2BJMH 2IDQA 3HAEG 4IYKA 3IPEA 4S1SH 2EDFA 4JPVH 4FXGB 5KYWA 4YDLB 4K8RC 3O45A 4UTBA 4N9OB 4PJCA 3VX1A 4HG4J 1IZKA 5CGYD 2DWDA 3SJVB 3DSFH 1PF3A 3JVGC 4TTDD 5CU9A 4O9HL 4OCMC 5SWQB 5IW3A 3BEVA 3H9YA 2EDEA 3CXHJ 4KITB 4PJXE 1A3RH 4YHIB 2E7MA 3DI2B 4JKNA 2D0HA 4G6KL 3VG9C 5E4EB 1P4UA 4DAGL 5CILL 2D7TH 3OB0K 3X1GA 4OVUA 5I0XA 1PG7H 3BD4A 4M6AA 4L5FE 1WUZA 1NBCA 5BCAA 3OD3A 5CJ8A 4X4MA 4KROB 3CE1A 2V7HB 1KN2H 4M5YL 3QFDB 1B6UA 4ISVA 5ESAA 3MLVH 1BOYA 2ITFA 4XC3L 1OD9A 4X7DC 1DVFD 5ESQA 4AOFA 5I16A 1JHKL 4LVOC 3ZZSA 3DX7A 3SDDB 1HESA 2VXTL 3CH1B 3HB3B 1MNNA 2WWMC 3FB8B 3OHXA 3K6DA 4IHBA 3IMTA 5JPNC 1Z0NA 3TBVA 2R0KH 3QIBA 1IM9A 4F92B 3G5YB 4RMSA 1I1AD 4GAYA 3BO8B 1FC1A 2GW5A 4OD1L 3ZW3A 4YDKH 1YNTA 2QADB 4AQZA 4TNEA 6FABH 1BAGA 4Q8BA 2VRAA 3TC9A 2VH5L 3ARDB 1R46A 2FWSA 2KYIA 3PGCB 1QRNA 4DK5A 1A14L 1FG9C 2DBLH 3DYMA 2VDPB 1PZUB 1ZT1A 3FUNA 1AQDA 1TITA 4FQIH 5DD0H 2ZCHH 1MCNA 4GG8B 3W81A 2BRQA 2MKLC 1ONQA 3KEHA 4M43H 1TYEB 4JO5A 3SQRA 3TF4A 3KBFA 3UBXI 4RNRB 1QABA 4UB0H 2ZG1A 2BM3A 4HWNA 4K5PA 4DIXA 3S3DB 2DM3A 4D8OA 3QQ3A 2ZYSA 2VZSA 4M00A 1FZMB 2EKSA 1GR7A 2IOIA 4PWKA 5EOCH 5HI4C 3T71A 1AGEB 2A6DB 5CLYA 2OJEA 1IC5L 1HXMB 2G5RA 1WZ1H 4XOAA 3N04A 1S46A 3BDYH 4Q6IB 1L9RA 1Z3RA 4PJAF 1I1FA 2BHFA 3MCKB 4EZMA 5E2WL 3STLB 2F74B 3FU7B 2OSLA 4TUJA 3DV6B 1RHFA 1HEZA 2OR8A 4OF0A 1MZYA 1KTJA 2BHUA 2NTFA 3V79C 4NC2B 2YLKA 1JF1A 2JF1A 1YVLA 5F7MC 2HTLC 4NUMA 4TPRL 4YPGB 4XCNB 5DURB 2Q86A 2QKIB 2WJ7A 1P7QD 1A6PA 2GVYA 1A4KA 3BQUD 4U2YA 3QWNA 4WO4C 3NQKA 5FKAB 4ZW6A 4LLQA 1ZRUA 1RULL 4HF5L 1UEYA 4MMZA 5HHME 1F42A 3L7EB 2CUAA 4XBMA 3BDXA 4LOVA 3UTSA 3SJVA 5ICUA 1I1RA 3OPZL 3ZIYA 1E6JH 1TVHA 2DQCH 5KYYB 4NP9A 5TE6H 1WS8A 4MXVF 5GISL 5SWQA 2VIRB 4O58L 1KCKA 4Y4KB 4YHIA 3U6RB 3NH7L 3GJEB 4HU2A 1XCQB 1J48A 3CSTA 3MLZH 1MCWM 5D5MA 3TS8A 2E4FA 1J05B 4HLJA 1MFMA 2E9BA 4MYWB 3HC4H 4NQCE 2VN7A 4X7FC 3K0WA 1BZ9A 2AKRB 2CU9A 1OCCB 3QIWD 1NWOA 3QO0B 3QFDA 4WWKD 2AV7A 5AG8A 1C7TA 2HLAB 4MXWL 3OHMB 1EHLL 5ACMA 3QNYB 3SDDA 1FORH 3CH1A 4PMFA 4ZMWA 3MJ6A 3FB8A 3V4PL 5IQMA 1LQBC 4FI6A 1NLDL 2AERT 1WZMA 4E9QA 1MWOA 4OGXH 2A73B 3G5YA 3CVBA 1EHKB 1MCFA 1B90A 4YZFE 4AX3A 2MCG1 4PJHA 1DP0A 2O6DA 3U0PB 5EU5B 3STBA 1BIHA 2OMZB 4RWYL 1RZQA 3GI9H 5IWLA 4I77H 4BZYA 3PGCA 3UZEC 2ORBH 4HKBA 4LPXA 5D4QA 3P0VL 3BAEH 5FEBA 3QFJD 2RIKA 3U1SL 3C8KB 5HXMA 2UXGA 4DGWC 5L4JA 4EDWH 2PXYB 5JUEH 2VC2B 1CLZL 3EDDA 3P4LA 4XVUC 2ESVA 4ORGB 5CZXC 2FUTA 4M5ZL 2F61A 2A6IA 3I9GL 4IJ3C 4RNRA 5K9QI 4WI8A 1PLGL 1A2YB 4G3YH 3U25A 1F4WL 1HVXA 4BGDA 5IB3A 1BX2B 3UJJH 3K72A 5DUML 4BFGA 2P8PA 4ODHL 1GYCA 5HDBF 1AGEA 2A6DA 2AZAA 1I53A 3KCPB 3WI9A 4MNGB 3HG1E 2EVFA 2JMRA 4K8RD 3T2PA 1RERA 1WO2A 2Q3ZA 2IAAC 4FNTA 1CURA 3NFNA 2R4SL 1CU4H 1TQUA 2FO8A 2QDVA 4C54A 2Y25A 3O3EA 3FU7A 3WGVB 2XZCL 4U1SA 4C55A 2EXYD 1DANT 3COOA 3P3SA 3EH2A 4GAGH 5DJ2B 3DETC 3KW7A 4B9PA 4XNXH 1WQVT 5EIQA 5BZDB 2QKIA 3NAAH 4YXLL 3H42H 1OAJA 1EFQA 1QQDB 2XQYG 4EI6B 4KQ4L 2FDBP 4NQDD 3T1WA 2JQMA 3DX3A 4YX2L 4IOSD 4XCYB 1WGVA 5L7XH 4HWEL 2GAZB 5GGVL 4K94L 1XCWA 3LRMA 1A4CA 5ECJE 2IGFL 2OW6A 2K3HA 1HQRA 3L7EA 5KVFE 2VRQA 4ODSH 1K5NA 3VD3A 2B1HH 4KFMA 5K1JA 4Z7AA 4UZSA 3E0GA 5CZKA 3M1BA 4F2EA 2WWMD 4Y4KA 2F6AA 2DQFA 2Y2TA 2W92A 3GJEA 4FKKA 4S1QH 3MI6A 4EMZA 5EUOF 2L3BA 2J44A 4AWJC 3DX8B 4M6OL 2FBOJ 4ETQB 5FYLE 4R26H 1J05A 3SGDH 3PQYD 2WY3B 4JQXA 3PE9A 2VT0A 4WJ5A 1XGUB 4DVBB 1AY1L 3VM5A 1CDGA 2CG9X 4HKXA 2Y7OA 1ZTXL 4IKKA 4OJCA 5DTFB 4IKJA 5B8CC 2ZPKL 2MPAL 1RZPA 2NY6C 3SDCB 3NJJA 3QO0A 3IN0A 1SMOA 2ENPA 3DBSA 2HLAA 3F83A 4HEME 3B4NA 5HJ3A 2CGZA 5IMMB 3NCJH 3EF7A 3CFIC 3TV3L 4ICXA 3AWGA 3NG5A 2OMTA 5DK3A 4AEIL 3L48A 4FG2A 4BQ6A 4HP5A 1BM3L 2HFGH 2Q7NA 2WGXA 3WFHA 3EH1A 3SDXF 5IQ7H 1L7IH 2VLRD 4NFBA 3OQRA 3MUY1 1P7HL 5HI4D 4ERSL 4X83A 5KYXB 5I6XC 1EX0A 3DECA 4MQTB 2AQ2A 1KUMA 1N0XL 1UOWA 1MW0A 2CDFB 3PJLA 1IC7L 4XHJC 1E43A 3AREC 3LDBB 3RVUD 1FIGL 3KYKH 4PEEA 5D93B 2DQGH 1YPZF 2FTAA 3NSCA 4JGJA 4X6BB 5FKPB 2PXYA 1MCBA 1DVYA 1INQA 2FBJL 1A2YA 1MREL 2HTLD 1S7QA 1JPSH 2J88H 2WUBL 1S9XB 3B8SA 4NXSA 3WY4A 4WWPA 3IRPX 3K1KC 5CGMA 1NPJA 1ZJAA 5T3ZL 1Q1JH 4ZFGH 1CGSH 1BX2A 2DWEB 5B7MA 3MFFB 3OKLB 2APSA 1HL4A 3IE4A 2X28A 3FU6A 1E8YA 1WAAF 4WO4D 3KCPA 5G5DA 4O2EB 3VA6A 4JO4L 5E2VL 4MNGA 2Q87A 1BD2D 3C75A 2WSPA 1M7IB 5EU6B 3VXNB 1G43A 1U6AH 5A2KH 4LHUA 1LNUB 2NXZC 3HC0B 4IBZA 4XMZA 5HI3D 4YDJB 5DJ2A 1NFAA 1CICC 1ID2A 3H2PA 2Y5TB 3NGBB 4QRPA 4YXKL 3FTVA 3OB0H 2RALA 4JFFE 4M29A 4NHUA 2X4PA 3RA7H 3DLQR 4GQZA 4NQED 1A3ZA 2DQUL 2XQ0A 3TT3L 2MMXA 4L4TE 2GAZA 4TUOB 3G04B 3QAQA 3FF7A 3V2AR 1JVLA 1HWWA 4LMQE 5JIQA 2WXJA 3IXAA 1TSRA 5ALBH 3UZVA 4BRVA 5A3IC 3UPAA 4UT6H 1ULVA 5IESH 1AD9B 1Z2KA 2EUZA 1CL7I 2BSED 4NBZB 1BQSA 2XY2A 2LT9A 4K3EH 3FSAA 2LE9A 3ZMNA 1N19A 2ZCKL 4KZDH 4X0NA 4KUCD 3APDA 2QEJA 2A99A 1FPTL 4NN6B 4ETQA 3SKOA 3OZ9H 1JZFA 4PWGA 2K6ZA 1KBKA 1XGUA 4DVBA 2IAMA 2VDKH 4XVTL 3GXPA 3WTSA 1VFAA 5DMIH 1UH3A 3D25A 3MLWL 1A02N 4MKMA 4Z78B 5I1HH 4Y2OB 2E7CA 3A22A 3TL5A 3NFSH 1HINH 5HYSB 3INUL 1J5HA 4GJTB 3SD2A 3J27A 2BSSB 4HJSA 3RX7A 4NFDA 5J11B 4L18A 1AQKH 3UTPD 5I15L 2V5YA 5IMMA 5DHVH 2BNQB 5CZXD 3VGEA 3UEQA 3BWAB 5FGBA 2GHZA 1V3KA 2ZKXA 3H2WA 3N40F 3F7QA 5EZLA 3G6AB 1G6RL 4N0RA 5DHYA 1PX3A 5AB9A 1U8NB 4WFGE 2GBAA 3BQVA 3TO4A 1CGTA 3TBWB 1CFNB 3FN9A 5FO7A 3FW6A 5JOFA 5KYXA 4HLZG 3QYCA 1OP3H 4PRPB 3BVUA 5EFIA 3ZK0A 3VW3H 3ZDWA 2NNFA 2CDFA 1ROCA 1OD7A 2K70A 5KUMA 4WI7A 1VF5C 3WJJA 2WO3B 4JG5A 4W9DC 4UOQA 5D1QC 1IGFL 1R3JB 1RUQL 5AEAA 4YZWA 5I9QC 3HHSB 4NI6A 1ECYA 4ELMF 4YDIH 4LNVA 1A0QL 3T2NL 5J8OA 4W9GC 3PL6B 4LPUA 3CX5K 2EVJA 4FNLH 1S9XA 3IPBA 4CDGC 2X40A 3JWNG 4FYQA 4HS6B 1MRFH 2KLSA 4AVHA 2F5BH 2CO2A 2KPWA 4X8CA 3MNDA 2C4FT 3E3QE 1J88A 3PWNB 1SXBA 3MFFA 3MOQA 3VXME 2R51A 1JXJA 2WM0A 4O2EA 2KLRA 3CZNA 5KSUB 4ALAH 3O6LL 4PJDE 4X9BA 2ZWZA 1M7IA 5BNXD 2BH0A 3WNNA 1CLOH 1DO6A 3LSOB 2ZKHL 3M17A 1ZHLB 1TQTA 3HMXL 1SFHA 4GAAA 1LNUA 1MLBB 1CPUA 4NC1C 3ZQ9A 1Q1PA 4X9IA 4TQIA 5D2NA 2VUOA 4HS3B 2PETA 5EUKA 4ZZKA 2WNKA 3OL2A 4ODTH 4D0BA 1D9KD 1DUZB 1T7WA 5DLMH 1WEJL 5CD3A 2VJXA 4IBQA 3CZLA 3GTNA 1JZJA 1ACYL 4ZOEA 1ZIAA 1LO4H 3JZ7A 2OL3L 5IVNA 3QHFL 4ZJ9A 4WEBH 3MGAA 3G04A 2NY6D 5IVXB 1ZGLB 3FU3A 4Z7NF 3RILA 3FU5A 5I30L 1AD9A 2B0SH 3QCVL 3W39B 4KTEL 2EEDA 3UPRB 4ODBD 4IU2A 4DQOL 3CC5A 3R8BB 5DMGC 2NSXA 3DPBB 2KDGA 3IAPA 4G8GD 3EDKA 5E2JA 1U3NA 3TWYA 1DVUA 5FYKD 4P99A 1RUAL 3GD1C 3ARFB 2IQAB 2ARJQ 4LOUC 4KUZL 5GRVK 3L4VA 1FFPA 4AZ8B 5DZAA 4Z78A 1GKOA 2MSPA 1Z3GH 3ARED 3G08B 3D5OF 3L4WA 3EGSB 5A2LH 2MOVA 1BFVH 3UTTD 2I9TB 3N0AA 4H5SB 2BSSA 2FCBA 4FFYL 2BFVH 2ZOUA 4TN9A 4ENZA 2H3NB 2Z64C 4HUWA 4GB9A 2PKDA 4A37A 5CCKH 2EDJA 3BWAA 3BMVA 3O6FC 4FXKB 5BRQA 4LVNB 4YWGH 5FYJU 4B5EA 3V0GA 5GGTL 2F1EA 2G30A 3LCYA 4IRSC 2FLMA 4ZMNA 4HPYL 1BGXL 3CU7A 3KLAB 4FFZA 1G7JA 4XPHL 1WTGT 5F7EL 2ADJB 3GXTA 4Z7OF 4CGUB 1Q90A 1AFVL 5KS9A 3CFEB 2EUWA 3DVGB 4PRPA 3E80A 2NMSA 1I7ZB 1R3LB 1BOGB 1HAUA 4PLNC 5DD1L 3D8MA 4KJWC 4OLWH 4TQEH 2VMCA 1JXGA 2B9AA 4MAYC 1RZJH 5KOMC 1THAA 4Y5VA 2VLJB 4P4KC 1RK0A 4BEIA 4GT7A 3LH2L 4XP5L 4NXKA 1F97A 1R3JA 2M1KA 1G1YA 2QPUA 1QVOA 1JUFB 1WS7A 2NXZD 3KWUA 1NGYA 1QUNB 2HKFL 2O30A 4DGUA 1CICD 4MCYB 5C92A 1INEL 3SYOA 1G6VK 3PL6A 1NIEA 1Y18B 4JO1H 4HS6A 5BQ7B 5JHDA 4LLDA 2LW3A 4PJEB 5CCHE 2ADGA 1MDTA 9CGTA 3EYVB 1SBBA 1H3WM 1QSVA 2Z4TA 2NQDA 2WQAA 3PWNA 3N44F 4QPEA 4CADA 1FE8L 5C0FB 4V1DD 3CDZB 5FHAL 4DNLA 5A3ID 4AV0A 1F11B 1NANI 3NIGB 3LSOA 2ZXDA 3MNWB 5C08A 5K69A 1ZHLA 2BS9A 3LV3B 3PWLB 3FHAA 1MLBA 3IU3B 4QCIB 3S98A 4XNUL 1FNAA 1PPIA 1U3ZA 4DKEL 2Z7UA 3CDGB 1KACB 4HS3A 1JZ7A 3RFZB 1PCXA 2DQTH 3WS3B 3KEDA 1RJZB 2AMGA 3IMBA 5AKSA 5C0IB 1A6ZA 2R0ZL 5KANI 1NBVL 3VDBA 1TFHA 2IVFC 4DZBA 4N5UA 4ILDA 5DC2A 3PHOA 1J0HA 1ZGLA 4PYGA 4XNYH 5DS1A 4JHUA 2WZ5A 1UOKA 1PAMA 3LTVA 2FD6H 5D7LE 1S4IA 4DN3L 1A1NB 3VMNA 5D7SL 1OZUA 2F8XC 4JPWH 3VRJA 1VKXA 4U6VL 1TQVA 3DPBA 3CDCA 2Q7YB 2GI7A 1FCCA 2IWEA 2WJ5A 2NZ9C 3BDBA 1EO8L 1P9MA 4N2MA 1S9YA 4I18C 2IQAA 1I7UB 2KZKA 2LU3A 4G42B 4PJIF 3X11A 1EDHA 1YN7B 5AOIA 1ERNA 3GK8L 2XVKA 4L3EE 3Q0HA 2ZXCA 4MJID 3K71B 5DEZA 1R4XA 4NFCA 4H5SA 5D1QD 4F58L 4QHPA 4AYDC 4DGIL 5B4MC 3B7SA 2OXGB 3QUKA 3G6JB 3CN2A 3QJXA 4H20L 4APQB 2GT9B 2X10A 2VB5A 2O1AA 5DJ8A 4HJJH 3TGXA 3X1EA 1OGAB 3OAUL 5LAXB 2XSKA 3VI3F 4HHGA 4L4VE 3WXVH 4P2OC 3RVTC 3ERXA 4QNPE 2A6JB 1R3LA 1BOGA 2V9RA 1FNGA 1BWMA 1AYOA 3VFRB 1ZLDA 3GIZH 2E3VA 2VDKB 4OCSH 3CXFA 4KNUA 2VLJA 5CSGA 3ATDA 4ECNA 4W1TA 2E0PA 1UASA 1JUFA 2BSTA 4M7LL 1QEXA 1WGOA 2X6BA 1QUNA 4URTB 3PQYE 2WMPA 3N9GH 4MCYA 4OM0L 2AEIT 3ECVA 5BQ7A 1KJ2A 3L5HA 1BJ1H 2YEVB 4PJEA 1AACA 1S7TB 3MLXH 4OCYH 5F96L 3T0BA 1YEFH 2BZCA 2PTTA 1HHGB 4PWEA 5CUSL 5ICZB 2B2XH 4UINH 2WXNA 5C9KA 1PYWA 3IF1B 3RPBA 4I0KA 4G7SB 4DP0X 1SMDA 3ESMA 4G9FE 4JG1H 4GXUM 3QQ9C 2CLRA 3D85D 3MNWA 5CWSA 3QH3B 3LV3A 4RLDA 3PWLA 2IEPA 1O0VA 3C5JB 4PJ7A 4MS6A 4HX1B 5KVGE 3IU3A 1UUNA 2WP3O 1OW0C 3VACA 3AB0C 5DMGD 1KF9B 2JV6A 3FRPB 4B41A 4GBXA 1M7DB 2IG2L 2XT1B 1RJZA 2Z7WA 2VABB 3KL3A 3VXUD 2VXSH 5T5NG 1F58L 5C0IA 3P40A 4YHMH 3VD9A 1EZSA 2Y24A 4LOUD 5D1ZI 5L4MA 5IT2H 2EIKB 4UQ9A 1DSWA 3BUDA 2GQHA 2QMJA 3TPKA 3IS0X 5KVFH 1C08B 5M94B 2DWSA 1EO7A 3L5IA 4R97C 4XT1C 4IW4C 4BFJA 4FEMA 2HJKB 3NP3A 4ZUSB 1OARL 1KCVL 1E5AA 3M8OL 1F3DJ 1DL7L 3GRBA 3SPCA 2IV9A 4IRSD 3UJIH 3UEZA 2O5NA 3Q13A 2K9FB 5FYLH 3T65B 5K33A 4D7BA 2UXFA 1UD4A 3WEMA 1QBBA 1TMCB 4GNKB 4MB5A 1IB5A 1J87A 3KPRB 3SKJH 1YN7A 3GI8L 1PY4A 1S7SB 2XQYK 4MZIA 4LPCA 2WNWA 3FPYA 4NUGH 4KJWD 3WIFB 5FO8B 2FECL 3K71A 2DS4A 4MAYD 1JAEA 2NXYB 4P4KD 4JFEB 2J8UF 3U4AA 3CWGA 2FR4B 3AADB 1HC1A 3ZL4L 3G6JA 3PAVA 4APQA 1CXIA 2GT9A 3UAEA 4AH2B 2AEQL 1BA9A 1MFEL 1MFVA 2VMEA 1OGAA 2XC8A 5LAXA 3REVB 2FL5B 3DC0A 4PJXB 1FLRH 3EYOB 2DH2A 3ELQA 3HBQA 2BNUB 4C57C 2YPVH 5HDLA 2CDEB 5JW5B 1XT5A 2XIIA 2QPSA 1VGEL 4NO5A 4OCXL 4NM4L 3EO1A 3RJDA 2OMUB 2B77A 4ZI8A 3GLZA 3HMWL 1NL0L 3F12A 1J9RA 3V9FA 3OSKA 1GGCH 3VDAA 4YHLH 5FHBL 1DBMH 1P7BA 2JJTC 3O9WB 2G3MA 1IAIL 4XBEH 5L4FA 1ZIBA 1UXLA 3P73B 2QELA 3U4EB 4V33A 3ZR5A 1FN4B 2XACC 1S7TA 4ADIA 2YD4A 5C8JA 3TNMB 1HXKA 5KYUA 3VFGH 3IF1A 1CLYL 2F54E 4GXUN 5LBSA 2AJ3B 4KJPC 5CJQL 4X6DA 4X5WB 4FKHA 1E4XI 3AWEA 4JR9H 4XP6H 5SV4A 3QH3A 3QQDB 4WW1B 2G4GA 3KLKA 1NOAA 2TAAA 4XNQB 3HRPA 4QO1B 1QBLL 2OCFD 3BFQG 4HIHB 4HX1A 3QRLA 4J2XA 4QF1B 1HHHB 3DOHA 2DF3A 1PKQA 4X7SH 3VB9A 2NZ9D 3WIIH 2VABA 4AC2A 2Y0SA 2DLFH 1T3FB 4N0UE 5GJSL 4XCFL 4XGZB 4BDVB 1W0WA 4PJ9B 3ZDXE 3W0WE 1CI5A 4NRXB 2AJXH 2YPLD 1AZCA 3FN0H 4KJYA 4AQOA 4IBVA 1TSHA 4DEUA 4QRSB 3ZKXB 5CS7A 3JYCA 5E8EB 3R7RA 5EZJA 2FJSA 5DK2B 4BUQA 3E1ZA 2ZXEB 2R56L 3H9SD 4LLWB 2HFEA 4I1RA 3CUPB 1DZ0A 3MROB 4M61B 1NCBH 4FZ8L 5EMYA 5LCVL 1KPRA 3E1F1 4Y89A 4KZEL 3PU7A 4LIQL 3SGKC 1IJNA 3CZSA 4P2OD 4YE0A 4ELDA 1BPLB 1MIEL 3RVTD 1MJUL 1MCOH 4JFXB 3U1PA 4M7KL 2X4SB 1E65A 2V2XA 1GOHA 2CRMA 3QWOA 2P45B 1JS4A 3U9PL 3IGLA 1I85A 4FN0A 4WHYH 4JFEA 4UV7L 4PBXA 3F6IA 4P2RA 5SWSD 4EDXB 1BF2A 5D2LE 1BVLB 2WN3A 4PBDA 4YXHL 2F8VA 1NMCC 3CHSA 3REVA 1UATA 2FL5A 3G7TA 5E8OB 3TBYB 3ECBB 3I75B 4MDJA 1E0OB 4L1DA 5JW5A 1RSYA 3LN5B 4RFNC 3KPOB 1AOZA 2OMUA 5F7NC 2J1YA 3QQ9D 1S2EA 1FYTE 4YEEA 2HT2C 4UTAA 3VXSE 1UZ6E 1JZEA 2HTKC 1JTPA 1HZLA 1MVUB 4Z7IA 3O9WA 3V6ZB 4G8GE 3V9CA 4X6EB 4GUPB 2VXUL 1NWPA 2ZXBA 3BKCH 4Z3GA 4HWBL 1XR8A 4JB9L 2P5WB 3P73A 3THMH 1NKGA 4F2ME 2I60H 1J5OH 3U4EA 1FN4A 1XF5B 3Q1SL 5ICYB 5I66A 1OAQL 2B16A 3NIDB 3W1ZA 2G5BB 1RMFH 1X5ZA 2C7UB 3L1OL 1I9EA 1GSKA 4NYLB 4WKZB 5BZXA 5CEXA 3SKNB 4RFOH 5I8KH 3UC0L 5KTEH 4OZIA 1GTFA 3GSWB 3GKWL 5B1KA 3TT1H 1PAZA 1FVEB 4XOEA 1QFOA 4AV4A 4DP5X 3B2MA 4YK4B 5EORL 3VXTB 4R7LA 1W72L 2F19L 5I8CB 3MLYL 5DEFA 4XNQA 1JMXA 1LLAA 4HIHA 2JKXA 4DETA 5D1XE 1QRKA 4BCZA 4YHYC 3SO5A 4O02L 4R5TA 4Y2NA 2ICES 1IBYA 4CUCA 2YAQA 1BYOA 4BHUA 3KYNA 5AVQB 4WDIB 1SOQA 1NGWB 2XQBL 5IZ7A 1T3FA 3KPPB 1UWYA 4FEIA 1X5XA 4FYSA 3IDIB 5D55A 4BDVA 4PJ9A 2J2ZA 3IDUA 1KJMA 4WI4A 2HA1A 4J7RA 2OAAA 4PJ5D 4QRSA 2X89A 3QI9C 3S4SG 3FTUA 3JTTA 4OI7A 2DEYX 5E8EA 1S9WB 3BAKA 4WCYH 1IEHA 3N40P 1WZLA 3OM3B 4KKCC 3A67H 1JTOA 3FL7A 1DN0A 3GXFA 1BZ8A 3LQAC 3CUPA 3MROA 1IBGL 2JKNA 2ZUUA 3AM8C 3QK0A 3LIZL 4M61A 3TO2A 2YAMA 2C9AA 4POZC 4DP1X 1JHLL 5DEGA 3ZKND 5JXEA 4KVCH 2DW5A 4S1DC 3V52L 3KPTA 4BWUA 4DF9A 1YEEL 4XAKE 3ZE0F 2JJSA 5LKNA 4JFXA 3F7VA 1G9NH 1HKFA 3HJ0A 5T1JA 2HT3C 1EFXA 1VZHA 1FZJA 5INDB 2P3YA 2Z93B 3TF7C 5GJTL 2Y3NA 2NCMA 5F7LB 5ACZB 2V9TA 1QNZL 3A6OA 4BM7A 3E8VA 3BT2H 4EDXA 4RMQA 3MJGX 1UCBH 4G5ZL 4OZGA 3UX9B 2VDMH 5T5FA 1XXFC 3BH8B 3MPCA 5IQOA 3NPZB 1KYOJ 1GTNA 5I8OL 1PLCA 2F9BT 4KHTL 3RZCA 1R0AH 1B0WA 3A4AA 4KVPA 5AZEL 4JKPH 3AY4C 3K2UL 3P0GB 2JLLA 3AUVA 2CKBH 3VFOB 3TNNA 2BFGA 4KJPD 1GZHC 4NBXB 1LP9F 2AJUH 2AMUA 3RJOA 4PN6A 1I3VA 4GSUA 1U8OA 4HIIA 4HIPA 5JA9A 2NZ1A 4F33B 3INOA 2J1ZA 2BIOA 2X0VA 1MY5A 5LGYA 4PFEA 3UG3A 4BXSV 4YS4A 1KIQB 4JFZH 1UGKA 3ARWA 4GUPA 5I5MA 1E28B 3QCTH 1JYWA 2Z4QB 2BPBA 3HNSH 1E40A 2P5WA 4HV8B 4W4OA 5DK0A 5DSCB 4M5SA 1KCRH 4Q4EA 4WFHD 4HS8H 3SGEH 1XF5A 4NSKA 2KZBA 4MJIE 1AZRA 1URLA 2EH8H 2WQRA 4NYLA 2C7UA 2CD0A 1QSEE 4HQQH 4J8QA 5EZOL 3LEXB 2PTVA 3A6BL 4IHOA 3SKNA 3GSWA 4J8RB 5HHVH 2FX7H 2Z6FA 2COQA 3QDGB 1RHHA 1BEYH 3C5ZD 3ULUL 2GSGB 4WUUB 3VXTA 5KBDA 1A7PL 4B9FA 2BMKB 2XZQL 2BDNL 4L1SA 3VVVA 1YDPB 2AJZB 2QDWA 3ARBB 3QZPA 5E1AB 1H5BB 1SN5A 4FG4A 4HAFA 4NM8H 4AC4A 3N42B 4Y7MA 1IL1B 4LDEB 2L7EA 3DUUB 2WUCH 3OG6B 3Q8EA 1F4YH 5IJCC 3FJTA 4PJBE 4PRID 4UAHA 4WDIA 2Q7AA 1QD0A 1X5MA 4QKXB 2IFFL 4PJFF 4PP2A 3KPLA 3IDIA 3MU3A 2GJZB 5JW3L 3MUJA 1SJHB 2BP3A 4AIZA 1U93A 1UD5A 1UHVA 3VNZA 3QUYB 5E6ZA 1S9WA 2CO7A 4FLHA 2ZKYA 1IBHA 3RGVB 1UM4L 4MB3A 4GFXA 5GRUH 1JPTL 4GQ9H 4LSRH 4Q52A 4QHUA 3IFNH 2R69H 3LS4H 2VQTA 3EFOA 3DX1A 2ZONA 3N85H 3QUGA 4F7EA 5HHQB 2XN0A 3LS5H 1UEMA 2JQZA 4DVRL 1EH9A 3NACH 4FQXB 1TYJA 5ALCH 1U8LB 3ZYJA 3FQNA 1Q9LB 3NK3A 2DQEL 2D0FA 1GPOH 5EULV 4NQTA 1SDYA 4U3SB 3MBWB 1EJOH 4PV8A 3GBNH 2FT7A 3U6XS 3CFUA 2NQCA 1DQML 1ZD6A 1ACXA 3L45A 1T89C 3DMMB 4QKTA 5F89B 4PHZA 2EDTA 1UJ3B 4BFEA 4L9DA 1SPDA 1R24A 3QR0A 3VXUE 1KJ3L 5F6HJ 2XWJB 4L1TA 4N8CL 2VW6A 3O4LA 4XC1H 1Q0XH 1ZT4B 3LNIA 3ZTDC 2GJJA 2PN5A 3BH4A 4LDCA 5DZ9A 2VUYA 2YA0A 4J3TA 3DJZA 3AFLA 1BVNP 2NY7H 2HG0A 2ZOWA 3N1QC 4N85A 1JGLH 5FDYA 4MB4A 4FFVC 2WQ8A 4QRUA 5I73B 3DWTA 5E94A 4AUUA 3ML8A 3FT2B 5C71A 3UZQB 1CZ8H 3CN0A 5DD5H 1ETZB 2D3NA 4F33A 2GJPA 1HCFX 1TTFA 1TEGA 4ELME 3EYUL 1D5MB 1KIQA 2VDPL 3GMRA 1NCGA 1E28A 1G9MC 5I1AB 4KY1L 2FB4H 3LEYH 2NY2C 5DSCA 3U1QA 2ODHA 3QPXH 3HZKA 3FFCA 1TZIB 3DOIA 2A9ML 3LNFA 3POCA 4Y2DB 5FGSA 4L9LC 1NUFA 2X4RB 4NWTL 1EEZA 2XNAB 3LEXA 4CC0A 1R5VA 5JHAA 1BFTA 3TZVC 1Q38A 1B0GB 4Q9BA 4J8RA 1KNOB 1A1MA 1OF2A 3QDGA 3QI9D 4NOBA 4O2CB 5ID1A 5ISZE 1DLFL 2GSGA 4WUUA 4JRXE 4XP9L 3EOBA 2FJGB 4X4XB 4ZYKB 1U8HA 4OKVA 3RTLA 1J9CT 2WZ6A 4KKCD 4TNVF 2BMKA 4Y19D 1BBDL 2KUTA 3D6GA 4ZOCA 5KVGH 1SGKA 4RGOL 3ARBA 4FD0A 4UDUB 5E1AA 1YMMD 2D73A 4I9WE 3EBIA 2J43A 4POZD 1IL1A 4XPBH 1FAIH 4Z3EA 1DQJB 4S1DD 5HGHB 1ZSHA 4KTDH 4XCCH 2CE6A 4OZHE 4XAWH 1Z9LA 5B1CA 5IHUH 4UT7H 3WYRA 3MJ8B 4EN3A 5GGUB 2YD6A 1M1SA 2HT3D 3VXMB 4XH2B 4OV5B 2MNWA 1SJHA 3K91A 4ZTPH 3S37L 1A7NH 1KFAH 3P30L 1PBYA 1FFRA 5F7BA 1XZWA 1A7BA 4D9QE 2AABH 3GMNA 1FO0B 2YQGA 3MCLH 4PJDB 4I5BB 2E6QA 3HC3H 2A38A 4FGMA 3CHPA 3GSNB 4QAWA 3RY4A 4JAMA 2E56A 3IDYC 4PH8A 3KHQA 1IVTA 2X1WL 4GKZB 1MF2H 3IDMB 1KCWA 1XGZA 5HHQA 4BINA 1N6UA 2FHFA 1I1AB 2ZWYA 2IO5A 2G0KA 1SF5A 4H1LB 5MHSD 2K78A 1HNFA 3RL1B 2CPUA 2ICWB 1WK0A 4OIFA 3ARRA 1Q9LA 2MPVA 2F7PA 2OR9L 5BV7H 1D2OA 3EJQA 4U3SA 5KG9B 1SY6H 4GXVL 1FH2A 2NRDA 2MQCA 1JPGA 4EE2A 3EJUA 3EIFA 1U30A 2ZOKB 5F89A 2NYYC 1ZV5A 4MZRA 3DMMA 4J6RL 5JYLA 5GZNA 1W0YT 4YGAB 4JVWA 5HI5C 4Y5XC 3JV0A 5TF1L 3ZO0A 1QTYT 5C0AD 5ADPH 5AOKA 2XWJA 43CAA 2EACA 3MXWL 1QHPA 1MQKL 2FATH 4YOKA 4AGQA 3Q6FB 4X50A 1ZT4A 1NFDA 2JE8A 4MCNA 4J3OG 4N2CA 4CMMB 4TLKA 1IX2A 1PD1A 2HT4C 3C6LC 3D87B 1I7TA 3AU1B 2BCKB 5DFVC 2DYPA 4BSVB 4LGSB 4W6YB 3CGTA 5DWUH 3QRGL 2R29H 1C5CL 3GSQB 4LLMA 3VWKB 1MRDH 1SHXA 3BXNA 4TSBL 3MXVL 3Q6GH 5CO1A 2WKOF 3FT2A 1KGUA 4KMTL 4N3TA 3UZQA 1ETZA 4URKA 5KYNA 5L6YH 1HHJB 1P53A 4OF5A 4UT9A 4DN4H 1P84K 4MMXB 1ES0B 3IETB 4ZMVA 4Z7WE 2X7LB 2ERJC 4G5AA 5I1AA 2IQ9L 1GZQB 1QKZH 3BGFB 1CVSC 3AACA 3BUIA 4B9YA 2VC2L 1P7QB 3L4UA 1L0YA 1JHTA 1TZIA 3BQUB 2VDMB 4XX1G 2DQ6A 4HSAC 5IOPB 3HS0B 2X4RA 2ZXQA 1OK8A 1A6AA 1ZPUA 3MODH 1Q0EA 4IEFA 4EIGB 2GIXA 1Z5LA 2JCWA 5TH2A 3U4BH 1HWGB 1BV8A 5D7JB 3GBML 2FJGA 1JNNH 2CCWA 5EBLB 4JRYE 1A1OA 4OCWL 1N4XH 1YEJL 3WFDL 4UDUA 3B7UX 1PIFA 1G1OA 4NHCL 1I8IB 3QULA 4MNHB 2HZHA 2WLKA 1AXSB 3CXDL 3OGCB 2GUYA 4UM9D 1DQJA 3I2CL 2QR0B 1FNEA 1XSJA 5HHNB 1BQKA 2P24B 1Q8MA 15C8L 1NDTA 2Z7YA 4QTIH 1QYGL 5HHOA 3HNTL 1EK3A 3MJ8A 4IRJB 4GAJL 5GGUA 2FIKB 3VWJC 4HHAB 3US1A 3X14B 5DHEA 2CBTA 5CZVH 3QO1B 3UFIA 3QIWB 3QQ4B 3MA9L 3RVVC 4WWKB 4KAQL 4EQ2A 3ILDA 4R90H 4TLSA 5DRNB 4FRWA 1DVFA 2PW2A 4Z76B 5B3SB 2YAEA 3Q3GB 1FO0A 3UBGA 1E8XA 4I5BA 4JY4A 3GSNA 4YDVB 2VXQA 3KJ6H 2NUPA 1N6VA 4GKZA 3IDMA 4XB3A 1LWRA 3O2DA 4K7PL 1I1AA 2CM5A 3L3OA 2ZCLL 4H1LA 5IB4B 4FQCH 5DC0A 3QEUB 2W59A 2KQNA 4KZ0A 3NSJA 1QW8A 4HZLB 2H47C 4U4BA 5E2UL 3ZE1F 4FFVD 1WFIA 3TH4T 2DLTA 3Q44A 4RBPK 1J5DA 3VI4F 3ZT6A 3FO9B 4GXFA 5KG9A 3HCVB 4G7VH 1TLMA 4ANKA 1GS7A 2J6EA 2ZOKA 1QA9B 1N18A 3CVHH 2VLKD 3JWNC 1SVBA 2BJML 1TF4A 5IF0B 3RVXD 3FXIC 1GCYA 2V7NB 4WV1C 3FB7B 4R3SB 4S1SL 4LGPB 5K9OB 4JPVL 2NY2D 3SBWC 3Q6FA 3S37X 4F9LA 3DARA 2AVGA 1U41A 4MZ3A 5JTWA 2IDUA 3FRUA 3DSFL 3AU1A 2BCKA 3ECQA 1JDAA 3T4AA 4J3VA 3GSQA 3HE7C 1CGVA 3TZVD 4U7MA 1A3RL 2IH3B 1QZ1A 1KYDA 3U9UB 3GSVB 2D3VA 4MRCA 2GC4C 1AKJA 2AVFA 2FX8H 7FABH 2D7TL 1FL5B 2D03H 1ES0A 3IETA 1PG7L 5HVGB 4D0DA 3L8QA 4ZBJA 1GZQA 4UTCA 3VRIB 1M6OB 4G43A 3HPLB 1P7QA 4LLYB 4GH7B 1AP2A 1JK8A 1PY9A 1KN2L 1Z32X 3FH5A 2IDSA 3VTAA 3BQUA 2ARJB 2GJ6A 4R5XA 4DKAA 4QJ5B 4G82A 3MLVL 4NQDB 1B4LA 4HD9A 3HS0A 4L4VB 4PG2A 3WKMH 1JZ4A 3AABA 5D70H 5ERWB 2I24N 2WWNA 2X42A 2K7QA 4ABWA 1CE6B 2F1AA 1T83A 2CUIA 3SYAA 3TXAA 2R0KL 3TESA 1UWGH 2CZNA 4JZOB 3CFTA 4H2CA 1CCZA 4X9YA 3I3BA 1SDAB 4YDKL 2C1PB 3ME0B 1A3LH 4OUUB 5EU7E 2MCPH 5E08H 1FG2B 1HILA 2FSEB 2DLGA 3S97C 1I8IA 4L8SB 1PZ3A 5DYOA 1AXSA 1PZBA 3JWOC 3MV7D 2DBLL 4PVBA 1AIFB 1P0SE 2E6JA 3PQYB 5GPRA 3PRZA 2P24A 1AGDA 5DEJA 4FQIL 5DD0L 2ZCHL 1BVOA 4ZO6A 2WVUA 4ZFQA 2FIKA 4HHAA 4XB7A 4M43L 3BWSA 2YFOA 4UB0L 3QIWA 1RPQA 3QQ4A 3AG1B 4WWKA 1JWMB 4JFDE 3B7YA 5DRNA 5LN4A 5EEXA 3CJJA 3IDGB 4P07A 1FVDB 2NYYD 3QB7C 4G9FB 4B9GA 3UDWC 5EOCL 2I69A 5IBLC 2R1XB 3CMOH 5HI5D 3RWJA 5L8JB 4GEIA 2B5IC 4HJ0C 4GKSB 1HFUA 5HDBB 4XN5A 1ITCA 2BC4A 2H3XC 2X4QB 3P9LA 1WZ1L 2VLRB 4WGVB 3BDYL 4R96B 1F5WA 3C2SA 2HT4D 3C6LD 4PJAA 2WWKT 3FK3A 1UXSA 1RXLA 2WBWB 3CFBB 1XCTB 3QISA 5DFVD 5G4OA 5IMKA 3T3PF 1X4XA 4E2OA 4HZLA 1MIMH 4R0LC 3QFJA 3WEXB 4KOBA 1E8ZA 3FO9A 3HG2A 3MFGB 2ZOOA 5CMAA 1N0LB 3HCVA 1UKQA 1WBXB 3DO7B 1NAMH 3FB6A 1I8KB 4YSTA 1QA9A 2OYMA 4KX9A 2HFFB 1Z9OA 2NZIA 3IMUA 3T08A 2YRLA 4POUB 1WA1X 3LH8A 1A7QH 1EV2E 1F1AA 1HOCB 3DBXB 1KBGH 1LD9A 3D2UD 4TVPE 1J1PH 2D8KA 3BLKA 3KXFD 3WMPA 1NTDA 3A0OA 4YHZH 4PLOB 4LZKA 4WO4B 4ATWA 1E6JL 5F44A 2DMKA 2DQCL 3ZUCA 2CMRH 3CSYB 3M7OA 3FO1B 2LTQC 5TE6L 3B2DC 1BD2B 2EVGA 2A5UA 4K7PX 2CCVA 1VENA 1QLFA 3U9UA 3PFQA 3FOMB 3ZLQC 1ACZA 3MLZL 3NCYS 1ECZA 5C86A 3JVGA 2XOTA 5BV7B 1TEYA 1JF5A 5FF6B 1TCMA 2D9QB 4R5VA 5AAPA 1FL5A 2EYTA 3CCHB 3LRKA 2YGPA 3HC4L 3MTXA 1M6OA 1NLBH 2VMFA 4CSPA 3HPLA 5D6CB 2VL4A 2F15A 3S96B 1F4XH 3QWQB 4K23H 4NQEB 3RWHA 2ARJA 4M7JH 4FNUA 4NQDA 1TLKA 3MRPA 2FJHB 5LGHH 3ULSB 4GINA 4IOSA 5HYFA 2X0UA 3ZKSD 3M6DA 2TRHA 1FORL 2UZXB 3VWJD 3OKNB 1CQKA 1CE6A 4M7LT 3RVVD 1S7WB 2GIMA 4P9HH 4OAWB 1F3JB 4OGXL 2X4NB 1K9TA 3SDXB 4CBZA 1PZCA 4NKIH 2C1PA 3S0PA 5JPNA 3BLBA 3GI9L 1FG2A 4I77L 3QPQD 4LP8A 2ORBL 3ZXAC 2C9RA 3GM8A 3BAEL 1QP1A 3D33A 1AIFA 4AIOA 3FUKA 2CXKA 4L29B 3NJKA 4JO3H 4LDOB 2L8AA 4E5XG 4EDWL 5JUEL 3LD8C 1H6TA 1SYVA 1PG7X 3VQMA 2WB7A 3V4VH 2NY4C 4Q56A 4BCXA 4G3YL 3HG0A 3BUYA 4LSUH 4M8VA 5DCCA 1X5LA 1O7VA 3T6WA 3BX7C 4Z77B 5JHLA 1E3ZA 1MI5E 1WIUA 3NJHA 3S3PA 3WMSA 3UJJL 3PIQB 4IBTA 3DV4B 3RBGA 4A2LA 4JM4H 2CWRA 2F8IA 4KRLB 2X4QA 2VLRA 4CRPA 5EWIH 4R96A 3CHRA 3CN4A 4YHNB 2FIRT 1CQYA 5HHXH 2Y22A 1CU4L 4BA8A 5I19H 2MHAB 5D72H 1JFQH 4BFBD 5CBAB 3HE7D 3WEXA 2FUQA 5MEND 1TTAA 5JOEA 4N0UB 4P46B 3VD7A 4GAGL 2QSTA 4HUVB 1VPOH 1ODUA 1T0NA 3I02B 1WBXA 4XNXL 4POYA 4L3AA 3W0WB 3ZDXB 4JG9A 4D94A 1I8KA 1D7CA 3NAAL 1TZGH 3HBZA 2AI0H 3H42L 1FSKC 2AITA 2J7LA 2O6CA 4KQ0A 2FK9A 4CAGA 4MGXA 1OP9A 1HOCA 3DBXA 5L7XL 4K9EC 3CMGA 3WIHA 4GPVA 2YZ1A 3LYRA 3J7HA 2YMXH 5I1JL 1SHWA 4ODSL 2P42B 3JYBA 2B1HL 2AK1H 4WO4A 2N59A 1DUYA 3CSYA 2QSQA 3ENEA 2WLLA 3FO1A 2QVIA 1BD2A 2O4EA 1EZVX 4S1QL 5HSFA 3FOMA 2IALB 1XL4A 2XY1A 3SDAC 2HWZH 3Q43A 5EUOA 3RUGF 2QV2A 3TWCH 4LCYA 4R26L 5FF6A 4CSSA 4AE1A 3EADA 3CCHA 1CXKA 5F72S 4U1LA 2FEEL 4OFQA 1TQCC 3KGSA 3EW3B 3CVHB 5D2LB 5D6CA 2XVGA 3MJ9H 1D9KB 1JPEA 3IWUA 4LHQB 3VQ1C 1F3RB 4NQEA 4ZW8A 1E4KC 1LE5A 3CPLB 1UH2A 1Y0LA 3D30A 4BK5C 2YUZA 2FJHA 4HK3N 2BY2A 1YMHA 5IREA 1SDDA 1FFNA 2UZXA 4WI0B 3NCJL 1SJEB 1EJ6A 3OKNA 2NY6B 3F04A 4F7CB 3TCXA 1UXWA 1S7WA 3CHOA 1VZGA 1NGQH 2HFGL 2VO5A 3NEEA 5C0AE 1NIBA 4FG6C 3L3DB 1L7IL 5IQ7L 3ULUF 5IJBC 3SDXA 3PWUB 2BSEA 5B1AB 4AW7A 4D0CA 5IBLD 4PS4H 1FYTB 1X9RA 3QIUB 4M4PA 3RNQA 4GG6F 3VXSB 4HJ0D 4ZMOA 3I6GB 5SX5K 4G8GB 1K4CB 4HFWA 1U0QA 2L04A 3KYKL 2DQGL 2KLTA 1G7MB 2BO0A 4OF3A 5KSVB 2EC8A 4WI3A 2WVTA 3D52A 3UBHA 4K4KA 1G5GA 4BJLA 3GPEA 4W70A 3UZEA 5TE4H 1DDHB 5AALA 3BYTA 4QRRE 1TJIH 2NLJA 3D0LB 2H6PB 2NY5C 4XP1H 2JCCF 2KS0A 4KDVA 3GF8A 2G2RB 1JRHH 2J88L 1JPSL 1ZS8B 4G1EA 4N9GB 4TMPA 5GGSY 4Z77A 3W3BA 2FH8A 3SQBA 2FRGP 2XETA 1D5XB 3KJ4B 1FZKA 1VZIA 1MCDA 1Q1JL 1CGSL 4ZFGL 1JTTA 3VH8A 2HN7B 2Q1EA 3CSFA 5DJZA 4PW3A 1TZOA 1Y6NR 3PABA 3QXDA 1WAAA 4UDTB 2ENYA 2E5EA 2F0CA 2OMVB 2HJLB 4N2KA 5E6YA 3WU1A 3M45A 4NQVB 1HTYA 5D1XB 4YHNA 3RWGA 3WE6B 5F7KC 1U6AL 3FTXA 4BQ8A 4N22A 5C0BE 5D7HA 1AR1C 3AT8A 1KJVB 1W0VB 3T8XB 3HI1B 3PPSA 4HUVA 2ZWNA 2KZWA 3HFFA 4Z7UF 3KLHC 2HB0A 1AGCB 1XF4B 5F21B 1K6QH 1L0QA 2NXZB 2VDNH 3RA7L 4PRHD 3FFDB 1CB4A 4N2IA 3EGDA 3IXTB 5T3XD 4LCWE 1SF3A 2Z65C 3NA4A 1MW1A 1EVTC 2P5EE 1YUHA 4E9XA 4LLVB 2C5DC 4Z7VB 3N41B 5ALBL 4MS8C 4RMBA 1ND0A 3WTWA 2WIMA 4UT6L 3X1FA 1MCLA 4FG0A 4KKRA 3IMVA 5IESL 4UOJA 3UMNA 4DP6X 2OFQA 3RNKB 4K3EL 4ZODA 4NC0B 3RI5K 1CYGA 4ZTEA 1MHEA 4I0PC 3ILPA 5IVZB 1VGKA 5DQJB 4KZDL 2OTUA 1QLRB 4R4FH 3OZ9L 4QY8A 1ZV9A 2VDKL 1LTXA 1PG7W 5AB1A 1NAMB 1IM9D 4HIXH 5DMIL 3DIFA 2E8YA 4GP4B 4JFQA 5BO0D 5I1HL 5BS0D 4KO9A 1D9KA 3NFSL 1HINL 3CPLA 4XB8A 5T5NF 5L8KB 2JLPA 5B38B 2YUVA 2YOCA 2PPDA 1AQKL 3TCLB 4GRMB 5LG6A 5B8CA 5HYQB 1EGJA 1HOEA 3CH8A 5H4YA 2NY4D 3MYJA 4F7CA 1OWWA 2E7LC 4BHUI 1T20A 2VLKE 4LL4A 2NW2B 1CE1H 4BRJA 3OF6D 1AAJA 1BYNA 4FKEA 5DVOA 5EOTB 5FYKU 5I6LA 2YR3A 2WYZA 3BCFA 3K6SB 1JNHB 3VW3L 3I6GA 3G5VA 4G8GA 1K4CA 3BISA 4Y88A 3SEPA 1G7MA 4ZS7H 3WLBA 4F15B 1T03H 4N2OA 4K3DH 2XN9D 3OLDA 2BINA 4N2GA 2N0MA 3TN0C 1ETA1 1DDHA 4G6AC 1XGRA 1KV3A 1L4IA 1ML0A 3AREA 4MJIB 3RPKA 2H6PA 4YDIL 4DH2A 3UTTA 5JPMC 1QSEB 4MJ5B 3QC5X 4FNLL 4Q2ZB 5GIRA 1GZPB 3FCSA 3T0AA 4GS7C 1NQBA 1MRFL 1D5XA 2F5BL 5I9QB 5E9NA 2VQ1B 5JMRA 2COVD 3AAZB 1LL1A 2WXPA 2HN7A 4LSQH 4XMKH 4PGJA 3N44B 4UDTA 1JV5B 1Q94A 4K3JH 2HJLA 4ALAL 2LU5A 5TDOB 2IGLA 2O5ZH 1L9OA 3P9MB 1NC2B 1HSAB 1CLOL 4JKKA 1DJSA 3UL4A 1GXEA 4XVJH 4PJBB 4X6FA 1G7HB 5D4JA 1KJVA 1W0VA 1YY8A 5GSRA 2H0FA 5A2IH 3T0WA 3LPPA 5IB5B 4OKDA 3SDAD 5FB8B 3V4VB 5I82A 2XZZA 1XF4A 4ODTL 5DLML 3FBKA 1CD8A 1CICA 1TNMA 3IXTA 1GSMA 5DZOA 4CL7A 2RQ8A 3PNWB 1LO4L 3NABH 5BVJB 5IQ9A 3LB6C 4WEBL 3ALWA 5E1HB 3MGOB 5LG1A 4Z7VA