5EEWA

Radiation damage to the trap-rna complex: dose (dwd) 6.45 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein MtrB
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eewA00
3AQDA 2ZCZA 2ZD0A 5EEXA 1GTNA 5EEVA 3ZZSA 5EF3A 1C9SA 5EEUA 4B27A 3ZZQA 1WAPA 1QAWA 1UTDA 3ZZLA 1GTFA 5EEYA 2ZP8A 5EEZA 5EF0A 2EXTA 2ZP9A 5EEWA 3ZTEA 2EXSA 5EF1A 5EF2A
chains in the Genus database with same CATH superfamily
2HT2D 4XBEL 3V55A 1OP4A 2VXUH 4F8TA 1AIZA 2Q3XA 4H25A 2A9BA 4GAYB 4A6YL 5I18H 3VU1A 3KGSA 1QFWL 3BGFB 3QQ9D 2JIXD 4O2EB 4OLWH 4LNVA 1EGJA 4LSSH 1JNLH 5IBUG 2XTSA 5ICZA 1QKZL 2NY2C 3GBNL 1CMOA 4IOSA 4ZW6A 3SKMB 3MLPA 2AZUA 5FF6B 3KW7A 5JYLA 2QGDA 1QRNA 3JV5A 3T0XA 4L18A 1JV2A 3EYVB 3SDYH 4TVPL 1RZGB 3BUYA 1FE8L 2G4EA 2EACA 2AK1L 1FAIH 1OQOA 1Q9WA 1GAFL 1VEMA 2ZUQB 4ZXBB 5C0BB 3RVTD 5TJWK 3D50A 4YAQA 1I53A 5D6CA 3WNJA 3C2AL 3NVQA 4K3HA 2P44B 5EORL 1KY6A 3BIKB 1JWSB 3STLA 5JW3L 4AGOA 2WBJD 1BBDL 3KXFE 3MCLL 3VSUA 4N3TA 1ANUA 5DUML 3RDJA 1U3JA 4UANA 2QADD 1YDPA 1MFBH 2EP6A 3K91A 3MSPA 4TSAH 2W59A 3T0DA 4MVBC 5ILTH 4XPTH 5DS8B 1FH5H 4GO6B 2B3IA 3BRDA 3EH5B 2HFFB 2HTLC 4XTRC 4JZOB 1E28A 1U8IB 1OLZA 3PFQA 3KPSD 2YBRA 4P3CH 2IAMD 2DJUA 4K23L 3NZ8A 4Y4FC 2LVEA 4OFPA 4ZUUB 5MENA 5KZCB 4KXBA 5CJOL 5LGKA 1JPFB 5EBLB 4V33A 2DI7A 4DW2L 3MRJB 2P8LB 4WJ5B 1P7KA 2DYRB 3BFWA 5ID0B 5AB0A 1HHJB 3MRLA 3TN0B 4XCNB 1B0WA 1BYOA 4QHUA 1JD9A 1W72B 1CXHA 1FG2A 2DQJH 3O3BA 4HIHA 4APXB 4PRDB 3ZTEA 4F9PC 3O6LH 2HVKB 3KVQA 3NFSH 3CSYB 4X5XA 4A04A 4PRPE 4HWZA 2RB8A 2O5ZH 4PP1D 4LSPH 1PL3A 1NIDA 1MH5A 2Q76B 3PDDA 1C5CL 2QSTA 5I75C 2Q8BL 3IJ8A 2XN9D 1S8DB 4L5FH 3IDXL 3NABH 3TV8A 4B53A 2GSMB 3ULSA 1WPCA 5HVWA 3GGWA 2EDOA 4K7PH 1WFIA 4HC1H 3SE9L 1MQ8A 2CDFA 1NAMH 5DSCA 3DDGA 4YHKH 1T04A 8CGTA 3KYMB 2BVQA 1FIGH 1I8KA 1P84K 3VXQB 2X89A 2K6ZA 1S5HB 4N0CD 3LQMA 3QH3A 2LOEA 1EO8H 4XOEA 3ZU8A 4PJ5B 1KJ2A 1Q94B 1RJLB 1L9QA 2K6YA 3LPFA 4X8JB 3ZL1A 4HOWA 3NSXA 3UH8A 1ZPUA 2VQ1B 3BHBA 4FQQA 1MDAA 4MA3A 4BDVA 5J9PB 2AV1A 5A6IA 3ZO9A 1OF0A 1VFBA 1DVXA 4UV7H 4OLYL 4UWQB 1DANT 4ELMF 4Y9CA 2WBXA 1KGYE 2J4WL 2MFNA 3NN8B 3GIZH 3BKJH 1YEIH 2GAZA 3HZ3A 4JPWL 3P69A 4OCYH 1U58A 5K9QG 4XRCA 1SBBA 4JDVB 4JNXA 3K1DA 1TLMA 2R1WA 4KTEH 4Y1AA 3WHE1 2ED7A 5IMMB 4POZC 4ZMAT 4IMKA 2EDQA 2DMBA 4JR9H 3HC4L 1YEGH 2YUWA 2ZG1A 3H54A 3AB0C 2VNCA 3LRSB 1A4KB 4KK6C 2YXMA 1AR1C 4B3EA 2XPGA 5CU9A 1VF5C 4WWNA 1ZXKA 1DQDH 4E5XA 1GJUA 1OPOA 2Z0BA 5DJAB 3HIZA 3ETBJ 3KDPB 4NP4H 4JG5A 4URTB 3CDGA 3BN9C 5I8CA 5IFJB 3W81A 1BREA 5EU6E 1D6VH 5F89A 1A3LL 4P2QE 3UYOD 3MXVL 3P77A 1UHVA 3IPFA 3KPRD 4KJPD 4KO5A 1QSFD 3V7AE 2CXKA 3EOAB 4S1DD 3VMPA 4O9HL 1IBDA 4WWOA 3S88H 5TF1L 4EUPG 1T1ZB 4NUJA 3VSQA 4UQ2B 1AKJA 4MXQC 3T1WA 1P1VA 1XGTA 1BZOA 3X11A 1CVSC 1CXEA 1T83C 1HWGB 2XG4A 2GBVA 2FLBT 3VFMB 3UPCA 3F58L 5T3XE 5FEBA 2JMRA 2ERJC 2F74A 5DHEA 8FABA 2ZXBA 4NEHB 3ARYA 5CJQH 3ZDZE 2XQYA 4XXDB 3HR5A 1DP0A 4N2AA 3GMNA 2B2XH 5LXVA 2NZ1A 1AFVH 4NZ8A 2EDXA 1FSKB 2HRPL 3SBWC 1ZV5A 3HUJB 2YQBA 4Q6IA 5JR1H 4Q14A 3RJOA 5IW1B 1ZIBA 3BVDB 3S3DB 1F6FB 1HCZA 5D7LD 4EKJA 1ZT4B 1BOGB 1CLOL 2NUPA 5JIDA 2JF1A 5GGVH 2NTFA 4G8IB 5KN5B 4D0CB 5BZWA 3ARRA 5TE6L 3RWIB 1K85A 5HSFA 3LPOA 3NAAH 4OZHA 3CU7A 3LZPA 4HS8H 1NFDF 2BC4A 1J1OH 2IPUG 3CC5B 3K1KC 1BQLH 1NC4B 3D30A 5JIHA 4IBSA 1TKWA 5BS0A 2ZXWB 3ZTDC 3R7RA 3KPQA 2BVOB 3SD5A 2IADB 3SODB 2W1NA 2AEQH 4BK4A 1F1GA 3DROA 4CW1A 1U8LA 1GOFA 5TFSL 3BVTA 3MROB 2P5WD 4TQEL 1BVKA 4G80A 4L8SB 1QSVA 3KPLA 5LUMA 4J6IA 4D7PA 5HDQH 2DIBA 2OFQA 4YVUA 2AXFA 2L8AA 3HRPA 3LV3B 2YPKB 1KV7A 4B9KC 3PWPE 2DOCA 5BZDA 1DUZA 5KVGL 2KERA 5EU5B 3LN4B 5LG1A 2V2WA 4EQ2A 2G5RA 2QFRA 1X5XA 1ZMYA 5ANMA 3IVKB 4P2RE 1N2RB 4PEEA 1KJVA 1EXUB 1GR7A 3QFJA 2Y3NA 5AOZA 2WLNA 4XN2A 5ES4B 2EDLA 3IFLH 4P4RA 3P0VH 4XMUA 1KCRH 3US1A 2OKMA 4Y7MA 1ITCA 4K8RH 4QMEA 2V2TA 2BVUA 5EOCH 3BXNA 1VHPA 4J3BA 2X70A 1U8CA 3QIWC 1CLCA 4AM0B 4QRTA 4FXKA 2J72A 1VACA 4CUCA 1BP3B 3BLPX 1L7IH 2DWEB 4L4VB 5EUKA 4D9QD 1XF2A 5CGYD 3BH8A 4PJBF 5EO9A 2A0LC 2FE0A 1ZSDB 4LGRB 3F12B 5LAPA 2LU5A 3CE1A 4PMFA 4I2XA 3C12A 3V4VL 3GKWL 1SGKA 1KCVH 4AIZA 5EIQA 3LQZA 2WWMC 2PABA 2WYIA 1K4DA 1HH6B 1OOAA 1ZT1A 4Z1PA 4UTBH 2GSGA 1YYCA 2ENSA 4OCNC 3UJIH 4AZ8B 3NSDA 2W0FA 5EIVA 2XIBA 3O4OB 3Q2LA 2APWA 2Y36L 3F6IA 3FU6A 2WTRB 3KLAA 2GJ6B 1P2CB 4MSWA 4N68A 3QCVL 4NAJA 4UQEA 1G1OA 2DBLH 2JKXA 2AQ1A 3VRIB 5L9DH 2FWOB 4JRXA 4YR6A 5IK3A 2AJSH 2F58H 2TRHA 2X4UB 2NY3B 3OM3B 2D0FA 5FYLL 3RUGF 3AGWA 1DE4A 1SN0A 5DMGC 1WT5C 3SJVD 4F24A 5JDSB 1S9WB 2YEZB 2OR8A 2ZTBA 3O45A 4H40A 2BXZA 4WTZA 3W2DL 1G7PA 4Y0GA 3FTUA 2VDQH 2XQ0A 1NGQH 5BMFH 1JZFA 5I0XA 4CN6A 1TJXA 2WCGA 1K4CA 3JVGC 5CJBA 2IBZX 3O9WA 2CLZB 2ADGA 3PHAA 4X9GA 1QTYT 1YPZF 2FUQA 1IM9B 3WFEH 3ZSTA 1KIUB 3NIGF 3TA3C 1TCMA 2WW8A 3QA3B 4FG6C 5EA0L 5G4NA 3WN6A 1OW0C 4A2GA 1F4AA 2ARJB 1KTJA 3QEGL 2JXMB 2FO8A 2ICWI 4YHPB 3L9EA 1JHKH 1B4JH 3LXBA 1WBXA 1I7UB 3MOBL 2QZ5A 5CNHA 2VLJD 1JK9B 2YAHA 5K39A 4LCCB 3TBWA 5AW6B 4RX4D 1MFEL 2ZWNA 3IXTA 4OIIL 3SQRA 3ZL4H 3LY6A 4ZODA 2BZ7A 1LM8V 4Y88A 5IM7A 3GDBA 4I3RH 1A7OL 3SGEH 1F00I 3C6SB 4TOYH 3VRLF 3HZMB 3UCQA 1QNZH 4LSVH 2FYVA 1QTSA 1D7FA 3GT6A 4F15C 4YSAA 5E8EA 5EC1B 4FXGB 1GCYA 2CDEA 1MNNA 4NC2B 1CDBA 5AW0B 4GXUN 3GEFA 3CZSA 5ALBL 1T2XA 5DJ6A 4CMMB 1YNLL 1TQSA 3D1MC 3CZNA 5D1QD 1GGIL 4N0YH 5FAAA 1KIPB 4DZBB 3CPLB 3W0WB 5JHAA 1MVYA 4HZLA 3CLEL 1KIQB 3TNMB 3UTSB 3FU7A 4B9CA 5DQJA 1MIEH 3TS8A 2JB5H 1UJ3A 1XIWC 4ZX4A 4FNQA 5HYJE 4FFWC 4LCWE 2ZYSA 3CC1A 2WUCL 1CZ8L 2D3NA 2D0HA 2OP4L 2WQAA 1SOKA 1DQIA 2DLIA 2ZP0T 3IDIB 4H0IA 3MPCA 4M1CD 4PWHA 2XBTA 3QR1A 3HG0A 3UIZA 1T3FA 4H8HA 4BE5A 2Y3AA 3CN0A 3FL7A 2ZOWA 2A9NH 3QDJA 4HHAB 3MLTB 4I0PA 4JGJA 1KELL 4Q8BA 4XNYH 1XCQA 4OFQA 1FNSL 4Y2OB 4FG2A 5HGAB 2H3XC 4ZMPA 3ES6B 3DTDA 4S1QL 1R9FA 2AJXL 2ZICA 2C9QA 5E23A 5TGBA 4MQTB 3KMDA 3GBLA 4I5BB 3B8YA 1MWAB 1NCNA 1FZOB 1G87A 2HPTA 5F0MB 4NI3A 2AQPA 3GRWA 3FCSA 2D9QB 5T33L 4KI5E 2ADJA 3GNML 5JOFA 4AQEA 4WEMB 1OD7A 1FYTA 5ITFA 3WTUA 4GSXA 1AHWB 4TULL 2Q3ZA 3QJXA 2IWGA 3P11H 1KLFA 1MUJA 5DURB 1NMBH 4HC1A 2NX5B 2KUTA 2FVNA 1NAMA 3VFWB 3DJTA 1WYJA 4DKTA 4UBDD 4WF7A 1M2OA 1E50A 3VQ2C 4FFZH 4XMKL 2WLLA 3U83A 2XHNA 1JFHA 1LGVA 1JJUA 1A6AA 3G9AB 1JZ4A 3O8XD 1EVUA 3ARDC 2Z31B 1U8MA 1C08A 1VENA 3AXHA 5J56B 4JFYB 1LYQA 2OJEA 5ESVB 3CFUA 4LHJB 5DS2A 3TU6A 2GYSA 5CILH 3WENA 1H8LA 3X2QB 2DQIH 1G4MA 1KLGB 2X4QA 3E8UH 3JUYA 1WLHA 3X3FH 4LLUB 1KEGL 3PPEA 4P46B 2YAFA 4K5OA 3FU9A 5HHOD 4J3OF 3UTTE 5DEZA 4ZOAA 4DGUA 1W8NA 3ABGA 2VTFA 1XXDC 2N4IA 5E03A 4P0DA 1IIKA 2AXGA 3LX9A 4N9GB 3SIKA 3BWSA 2AHIA 3FUJA 3NCYS 4X6EA 4X6BB 1MNUL 1ETJA 4FYSA 5J5EA 1RHHB 1T89C 4YXLH 1N8ZB 1JWUA 3JXAA 3RJDA 1KPVB 1LP9A 3NTCL 4ETYA 4GY4A 3T4AB 3RDTA 1I3VA 3WY1A 3FOLB 5LBGA 1TZAA 4OFVA 3K8KA 3N44B 1RIVH 1RZJL 1LL1A 3EO9L 1FZJA 2IPTH 1ZVSA 2H47C 3UBXA 5KVMC 3L3DA 5MEPB 4NKDB 3UC0L 2VQ4A 3NSCA 5JIMA 2QVTA 4NT6B 5IG7B 1QSEE 3GRGA 2OYKA 2YBRB 4LSRL 3OB0H 1GZQB 3EADA 4NO0A 2H0FA 4TTDC 3U4AA 1FNGB 2Q7AA 5MENB 4FZ8L 1ZJAA 2DWXA 3IAQA 5KYYB 3S3SA 3CCHA 5FA4A 1TYEB 1P7KB 4OLEA 5DEGA 4R0LC 4R26H 2B5IB 4BWUA 5EZJB 4EKXA 3MRLB 4P9HL 2I60H 3EBGA 4ENZA 1J8HA 1PFOA 4UOZA 2NY5L 4F20A 2I85A 2QL1A 2BSRA 4OGYL 3P0YL 5I1LB 3CXFA 4X5XB 4XC1H 5D7HA 5CMAB 1NEUA 4JRYE 3QARA 5DD3H 2CK0L 3L6FB 3S3BB 4Z7AA 4M7LT 2JCWA 4P23A 2VIRA 2VYRE 3VYNA 3R06A 1IGFH 4EIZC 4G6ML 1IO4C 4NOFA 3T1FB 4GBXA 2YWYA 4OCXH 5DHMC 2R15A 2J88H 4FZEL 1WC7B 2GTWB 3U2JA 5C7XL 3R1GH 3G5ZB 5I17A 2DJSA 5DMKA 1I8KB 3KXFB 1PKOA 2RQ8A 3VWKC 4FHJA 3L54A 4FQ1H 1TCRB 4ZMVA 1G7QB 1AY1L 3HE6C 4H20L 4RGND 2BP0B 1E4JA 3I75A 4OGZA 4R83A 1UD3A 4FQHA 4RRPM 3QCTL 4D94A 1SZNA 5CEZD 3RL2A 3SDAA 2CLVA 4OCWL 5ISZB 4FQQB 1KXQA 3P1VA 4WHDA 1NM4A 5ESQB 1BD2D 2AV1B 2EC9U 3ILPA 3WTYA 3S5LB 4XNUL 2R4SH 1L0PA 4WUUD 5F9JB 3FQNA 4X9HA 3KNBB 3X1GA 5CKAA 4OIFA 4L3AA 3GD1C 4NZDA 3CVIL 1RK0A 1FV1B 3GEWB 5INCB 4G6JH 3T0EC 2CKBL 2R56L 4HPOH 2W8CA 4IRSC 5HBBA 4ODXB 1U58B 2VDMH 5GGUB 1A1NA 3KL5A 2OR9L 3ZZ1A 2R1WB 3GB7A 2WKGA 3ULVE 2HN7A 4YHZH 3QZWA 3DOSA 3GXDA 1XR9A 4YUEL 3N9GH 3DUUA 4HJTA 2XA3A 1R5WA 2XJKA 2OQJB 1M2VA 5FUCE 4W4OC 1GGCH 3BE1L 4LF3B 3UG5A 2ZUWA 3VRJB 2LU7A 2R4RL 1NCDH 4XX5A 4OJCA 2ZOKB 4AQ8A 2D4FA 3SPHA 3AWGA 3SCMC 1OSYA 5FECA 4KH2A 3P3RA 4HUCA 3UJTL 1RURH 2K0RA 2DQEH 4AIEA 3PWVA 4U2ZA 2GB2A 3E1ZA 4HHGA 2ZWYA 1JL8A 3CQQA 4TLUA 3RIKA 1TTBA 1DCLA 3REWA 1NUNB 4PB9H 1EHKB 4TVPE 5KYUA 1G7MA 4MZIA 4ZFZB 3M7OA 4XHJD 1UWEH 2PCFA 3QDAA 4MHHI 2V9UA 1VGEL 2MH4A 2VQUA 3V6BR 2UY7A 3QJFA 4L8DA 3NDZE 3RJQB 2NY0D 2YEVB 1NZRA 4KHXL 3NJHA 1ND0B 2X9YA 1UCBL 4FQXC 4GLRI 3MGOA 4R4NC 1MWOA 1AKJB 4UTBA 2XG5A 4FXLA 3GSQA 1CBJA 4M7KL 1H19A 4P5TA 3RG1C 3MR9A 4H1LG 8FABB 2NR6D 3BZDA 1DJIA 1EX0A 5MEOB 3HR5B 5IGXL 1ILSA 3AY4C 1CU4H 5FM8A 5E51A 3UEZA 3BQUD 3MKGA 4KPHL 1NL0L 3AG1B 1J8SA 1I1AA 1G6RL 2V5SA 2K3HA 2NZ9D 2Z91A 2OM5A 5K1NA 3C08L 3EJZC 3MFGB 5E8PA 4GRWE 2MSPA 4LAQL 4I3SL 1PEZA 4O58L 5L8LB 5CFAA 3SYAA 1DLHB 2NTFB 1U8NA 5EG6C 4XN7A 2P48B 3W5NA 4WFGE 3IN2A 4GQPH 1J5OL 5BZWB 1R3HA 3P4OB 3DIFA 4J28A 5FYKD 4YK4C 3TT1L 6FABL 4M6NL 3JWDL 3N1PC 3MOAL 1M71B 3M46A 1FNLA 1MFMA 2Y06L 2EIBA 2P49B 4ZTEA 5FCSH 2DDQL 1RXLA 2VLLB 4GKNA 4XAWL 5EU6B 1KULA 3CXDL 4ZAKD 3SKJH 3VCLA 5B3SB 5D6DC 4P2QB 1HI6B 1K6QL 2QQKL 3ECVA 4FTDA 5E4OA 4PJFF 1FPTH 5FV2A 2AW2A 5K1VA 3MN8A 5DA4A 1SQMA 2Q5BA 4N2FA 2MTAA 4M7JH 3VI3F 4L3ED 1U8LB 3D18A 1K3ZA 2G2NA 5C07D 1M4KA 3UFIA 4IBUA 3P3UA 4GW5A 2B0SL 4JE4B 1ZHBB 1T66C 4TMPA 2BCKB 3T77A 2BNQE 1R3KB 2WNXA 4KTYA 3PP4H 4F9LA 4E0RB 2VRKA 3E8VA 5HPMA 5JORA 2GJZA 1MQKH 2WO4A 5H4ZA 5ANMB 5D5MA 3G6JA 2VDLL 3ZGHA 2QQQA 1JD7A 1GGUA 1RUPL 3APDA 1MCJA 5MHSD 3S36H 3O2DH 5KSAB 3HLAB 1B0GA 4LT7A 3TWCH 5JA9A 1I1RA 3FB8B 2XZCL 3RWJB 5HYEA 1U8PB 5F88A 2Y23A 3HZYA 2X70B 2UZYA 1FGVL 4FXKB 1RPQA 2VKWA 3B2VH 5C0BD 4ZXBD 3Q43A 3DOIA 5EUKB 4QXGL 5I1IL 4M4RB 1BF8A 5EEUA 2VC2B 5DMYA 1HE7A 1R5IA 1TEGA 5CP7A 4WFED 4Y4HA 4KKAD 5AFAA 5KBLA 1F4WH 3K72B 3L2NA 3MLSH 4JFFA 2B4CL 4NYLA 3TZVB 3A5VA 4JKWA 1VSCA 4FQLH 2JKNA 1P7QA 4L4TE 1Z0MA 1E6JH 3IRCA 3T0WA 2VXTL 3V0GA 2WXIA 1L3WA 2GSGB 1GKOA 4CBPA 2RAMA 3V79C 3FU8A 1LEIB 3MNDA 4EI5C 3N43B 2C1OA 5BUGA 1UOWA 5GS1B 3U6RA 3QG6A 3K5SA 4YX2H 4PQXA 3RIAF 3VXUE 5KZCD 3DV4A 4UDUB 4CVUA 4JRXB 4KX8A 4IS6B 1Z6JT 4WI0B 4MGXA 4N4YB 4JKMA 4XP6H 3DK0A 3BFQG 5C09E 3WLWD 4PRNB 4U1GB 3TN0D 5A1AA 1DE4B 2FRGP 3K6DA 4BQ6A 5ABZA 1ZTXL 2E0PA 4HA1A 3RE0A 2PYFB 4P2RB 3ASWA 1MY5A 1ORQB 3II2A 3KYAA 5TDNB 3QRBA 4PLKC 3S9DB 3QORC 1DQKA 4F7TB 3I2CL 2GJRA 3MNWB 3STZA 5J13C 2UX7A 3UZQA 5A3ID 1Z1WA 2AGJL 4YBLC 4S11A 5GHWL 1CIDA 1LNUA 2AEIT 3AMLA 3G3LA 1E5YA 1ZS8A 2AABL 5F3HA 1PZUB 1SMAA 2UWEA 4X7TA 4O5LH 3FUFA 1BIIB 1OAXH 1ZV2A 2VUKA 3HN5A 4J3OC 4Z5RA 5DO2C 3BSZH 2EXSA 4RWYL 3MV7E 1CCZA 3FOMA 1TU2A 1ROCA 2P47B 2A74C 2J6EL 3F05A 4FFZA 4MDIB 4BH8B 4GAAA 1BQUA 1WBXB 4PJCA 5K39B 4WI4A 4PJ5D 4KJQD 1K8IB 2EQDA 1CDCA 3AM8C 2H7WA 3N41F 3OR7A 4PV8B 3QDMA 2Y5QA 4PB0H 1JZ5A 1L9RA 1DVFA 4HCIA 3VSVA 2P52A 3WE6B 1ZDQA 1OEZW 2ZOOA 4MQ7B 3LYRA 4PJXE 2VLRE 4MJIA 3ARBC 4U4IA 5D2LF 2WZPD 3LEYH 1G1YA 2DTML 3QCUH 3G04A 5G5DA 4Z78A 1AGBA 1SJVA 4JFSA 5E8EB 1V10A 5B1JC 2HXAA 1AS6A 1D5XA 4H13C 2VLKB 3QNZA 4JFDA 1UXLA 1ZWIA 1XGRB 4CVZB 4CC0A 1I3RB 3MMEB 4QKTA 3E2HC 5DJ8B 3SE8H 4WO4A 4TTGA 2PYEE 2J8UA 5GGQH 3M7FB 3C60C 4UUJA 5E7FA 2F8IA 2CALA 3W37A 4ATWA 3CFKB 4DEPB 1G7IA 3T3PF 1R3IH 3WFHB 3CHQA 4HOMA 1XR8A 3EW3B 3QFGA 2Z0UA 5K1JA 3UO1H 1IGJB 1JZ2A 4N2MA 1F41A 1BV8A 3MV9E 2WANA 3SKOA 1WBZB 4LKXB 2LV4A 5JHMA 1KXTA 2N59A 4M5ZH 4L1BA 3P3TA 2BHYA 5LDSA 2YAQA 3ZHDA 3EO0B 2D7OA 2IQAA 3R0NA 3IFPB 3QUZC 5E2WH 2JELH 4B5EA 3WS6A 3RPKA 4A38A 4MXWL 4TVUA 1XCQB 3P0GB 2JLLA 4BSVB 1HOCA 4OCSL 5E8OA 1MCLA 4X6CA 4K3EH 5F7WC 2O61A 4M48H 2UYLA 3UTQA 5DDHA 5DUPL 5C8JB 2O6EA 4H0GA 5CSBA 3NA9H 5DC2A 3IM1A 3ARSA 2JKIS 2COVD 4PJHA 4PJIF 2JJUA 3R19A 4FF9A 2EH8L 1UWXH 1WTLA 5DMIH 3C5JB 4PWIA 3KZ8A 3SO5A 3QUKA 1NAKL 4R96A 3DETC 3I6LE 2WVSA 4Z3FA 3G6AA 9CGTA 1P4LA 3L5JA 2Q3AA 4PJ9A 1TEYA 1CLVA 1N0XH 1UEYA 5D8JL 4Y9GA 3WFBL 2UVFA 4JFPB 1WCBA 3VXOB 3FPYA 4HS6A 2Z8RA 4KXAA 4LSQH 2HMID 4H88L 1YECL 2DD8L 3BDBA 3S8WA 3IMVA 3O6FA 1YUHA 4WW2B 1RZKC 3QUGA 1E3ZA 3IFNL 5E9DE 1J0JA 4JZJC 4Q2ZB 4B9ZA 1Q9KA 1JI2A 4PWFA 2XY2A 5FYLE 3T2PA 4LCWB 3VJ6A 2QPSA 2Y1AA 3V7MA 5DI8B 4NRYA 1S7XA 2OCCB 1KF9B 4NQDA 3WL9A 2WGNB 4FCAA 4U1IB 1NC4D 1A3RL 3B9KA 5H35B 1CTMA 3WNNA 4OLUH 1CGXA 1V05A 4LL9A 2BJML 1BYNA 4XPHL 5JOPD 4OLVH 3LH2L 1CFNA 4FEMA 5T3ZL 4DUXA 2LFGA 2K3TA 4X6EB 4Y5YA 1YRKA 2AXWA 2K1MA 5C6TL 1IAOB 1G7HA 1JWUB 1PLCA 1HILA 4NS0A 3ULUD 3UBFA 4HK0B 5BJTA 5HGDB 3WI9A 4JFEB 3ZR5A 1EEZA 5DHVB 4HSCX 4PLJD 5ALCH 3X12A 4P4KB 4P5MA 4HD9A 3VXSE 3FAWA 3WXWL 1SRDA 1TJIL 3BYTA 3TIEA 4QUOA 2JQZA 4JHAL 4RGMC 2I9LA 3QNFA 3PGDA 4PS4L 5GGSY 4DHLA 3ZTJH 4QXVA 4R7LA 3IRZA 4AV0A 1GZHA 1QBLH 2P26A 2ZCHH 3DX1A 5I82A 3D06A 2W94A 2WKOA 4GW4B 4X5QA 5D7IF 1AO7B 5E6IB 4FFVD 5E2JA 4GP4B 4JKPH 3RX9A 2ORBL 2CRMA 3LCYA 4YHYC 3ILQD 4X98B 1KYDA 3U9PH 4L4VD 4CVXA 3RVXD 3Q3GA 5SWQB 4I9XA 3IJHB 1YC8A 3RBSA 5HYFA 1X5KA 2MOGA 3VG0H 3DX8B 4IHOB 5SWZB 1KBBA 4HUXA 5E5UB 5I1GH 2CLRB 4NQEA 3GSVB 4JJ5B 3UTTB 3X13A 3KCWA 1DR9A 3NQKA 4JGMA 5HTSA 1M3JA 1IQWH 4D9LH 1MKFA 2W60B 2PO6A 4U3XA 2PR4L 4E9VA 3LNEA 5EHFA 2GKIA 4LQFL 2GJ6D 4MB4A 3DXAA 2X4PA 3VB9A 4EN3A 2C34A 4XX1E 5IVNA 3S7GA 5PAZA 3EFDH 1CK0L 4DK5A 4XNQB 4ZS6C 1IFHL 3OLGA 4RAVB 1MVUB 4YDVA 4FQCL 2NY3D 1F56A 3PQYA 4N2NA 2YD4A 4TYUA 4YNYA 4DVBA 3QUYB 1I75A 3EJRA 4LEEA 1BQHG 4NN6B 4YSDA 5GPRA 5I8KL 4DETA 5KAQF 1C5BL 5HHQA 3F83A 4ZFOL 2X2IA 3K4ZA 1U4EA 3KPTA 3ZKNC 1ZHNA 4WFHE 5KBPA 2WLYA 4Z95H 3HG1A 3OKDB 3HI1B 1BQSA 4KZEL 4K5PA 4A37A 4D7BA 4EXPX 4Y16A 4PJ7A 1ZLUH 3UTZB 3V0HA 2V3DA 1RK0B 2CK2A 1Q9LB 1UZGA 5D2NC 2FLRT 3QJSB 3QDHA 1IM9D 5DJ0A 4FADA 2XYBA 2R9HC 4AEHH 2YRZA 5D71L 3RP1A 1DBBH 2AF2A 3I6SA 3VTTA 1D9KA 2C4FT 1XR9B 3N0PB 5DWPA 3DUUB 4ZS7L 1SM3L 3EYUL 2VR9A 1MG3C 3BKCH 4J3UA 2DN7A 1M2VB 1JI1A 1V5JA 5KYXA 2P9RA 2GY5A 1XD0A 1JRHH 2A9CA 5EZOH 1MFUA 5CZKA 4DP4X 3ZT5A 4E9XA 2QMJA 3KJ4B 3O2DA 5D7SL 4IGBB 3BCFA 4LP8A 2DJMA 3H9HA 3PWVB 4UZGA 4XXWC 4OF0A 4RGOL 1R5VA 2VISA 4ALAC 4XMTA 4R7DA 4AENB 4KXZI 2R59A 4RIRB 3DKHA 4AVJA 1B0IA 2OMVA 3F7KA 2EUXA 5FO9A 4FABH 1PDKB 5TE4H 1KTDA 2E4FA 4XP9H 4ZMXA 5JHDA 1MF2H 3LXCA 1NOFA 1JZ8A 4P2CG 2PCFB 1Y6MR 2X7LA 1NCUA 4OIAA 1IC5H 3W0WD 1IKFL 4PTTA 3D48R 1TOXA 4L3CA 3O6ML 3UTSD 4YBQD 2R0LH 1MCKA 3MGOB 1HINH 4KOBA 3HHMA 4HIIA 3JWNG 3QRGL 5HYSA 3HMWH 2PPCA 5JIKA 4WGVB 2XCMC 4GKZA 1SMOA 4N28A 5CKGA 5INDA 2F19H 4OGAD 4HKZB 3IDJA 3L13A 3ABLB 4LVHC 5KSVA 3REVB 2P5EE 3K6IA 4N2KA 5KYWA 2WD0A 2DQUL 2J1YA 4NUPA 3RVVD 2YO3A 4LU5H 5T1DH 2A6DA 2ESVA 5F7BA 3WTVA 2HFGH 3MO1B 4NDMA 5F0JB 1I8LC 4ODWA 1OPGH 2CJSA 1TZ8A 2QKIC 2WLZA 4D9RD 4W9ZA 4XPAH 5IQNA 4J12A 3QI9C 3ZL2A 3CLFL 2VZVA 2YMXL 3BUTA 1SYVB 3LHAA 5TF0A 4NUGL 1EXGA 2EUZA 1FUNA 1Z5LB 4DKAA 1T7XA 5F71A 3V6FB 3LN9A 4LB8A 4PWEA 5DURD 5KEZA 1WITA 5E9AA 4Z8FL 2NX5D 1NLDH 4G7SB 3BSZA 4G7VH 4FOMA 2ZUVA 3NIFF 5DUBA 3POCA 1G9NH 1MCOH 4OKVA 2CKNA 4QDGA 1AANA 5JUEL 1UZ8B 1XH3B 4NX0A 1KCSL 2FZ3A 3L8QA 5IFHH 1RUQH 4PS3A 2Z31D 2QPEB 3NA4A 2NMSA 2WXMA 2GJZB 4M6MH 2J2ZB 3LNDA 4UYQA 1OP3H 3RVWC 1WA2X 1K2DB 4KROB 2C3VA 4B5ZA 3V5DA 2BXYA 5TDOB 5GRYA 4P46D 2Y2YA 2GSIB 4IOSD 5JTWA 5DJZA 1WAAA 1UB5A 1ZRUA 1F11B 4F58H 3B2DC 4GOSA 4J2XA 1KN4H 1W0VA 2MQ0A 4XB3A 1OVZA 4EIUA 3TESA 4DKDC 1RUML 1UH4A 4GRWB 1OTSD 2ZCKH 4YBHA 3L5XH 2Q87A 1LEGB 2PW1B 1INEL 5E6UB 1D7BA 3CVCA 4ZW8A 1IFGA 2YC1A 1H6UA 5L4FA 2YKLL 3U0TA 1O7DE 4A63A 1JZJA 2DMGA 5DYOA 2EVIA 4PRIA 5L88H 4WW1B 1SEBB 1ITBB 4NO2A 3ZJAA 2O4EA 2NY7L 2C9UA 1SXNA 1T0OA 3CTTA 2NT0A 3NIDB 3Q01A 4JJOA 2KZKA 2Y72A 1OSZA 1KC5L 1GGBL 3MJ9L 4BWTA 1QNIA 2BSBA 1I7TB 3EJPA 1XMEB 4OBSA 4K5MA 1E8XA 1LO0H 3L16A 4QRRE 4OM0L 4OJDH 3TO4B 2WVVB 4LARH 4RMBA 2UY6A 4W81A 1CB4A 4M1GH 5EDXA 5F0LB 5LKNA 1JGLH 3QRFM 1P9MA 3UERA 3GBEA 1KDJA 2V8MA 1K5NB 5AB9A 5I1DA 1JP5A 2EIEA 2QHRL 4H8UA 5CLTA 4O2CA 4BSWA 3C09C 4KX7A 4M62H 4X6DF 5IB1B 4GIOA 3LRHA 1PNCA 3WIFA 5CR8A 1YYML 4Y1TA 1ZV9A 3AADB 2CO3A 3WG7B 4PJEF 3NZSA 4P57B 3MJ8B 1QPXA 3OGOE 3MNZB 3SBWA 3B2MA 3L3GA 4DO5A 2J5LC 1RVFL 3MA7A 4QD2E 3SPVB 4FYTA 1S9VB 5KG9B 2HVJB 4QJ4B 1CGUA 3WD5H 2G30A 3BVNB 4OZFG 4G6KL 5ICUA 3V8CA 3VGFA 5CFHA 2Y7SA 2DKUA 4U0QB 1TU2B 3F7LA 4NWUH 4UV4L 1FN4B 2CGZA 4ZFQA 3KXFD 3GHBL 3UJJH 4IK6A 1YG9A 1UT2A 3P54A 3ARGC 4LDLB 1CFSA 1F13A 2E76C 4MA1C 4Z0BL 5IVXA 5G4OA 4PBVC 2LHAA 4MKTA 5DC9B 1MRCH 4Y2DA 3A4EA 5ISZD 1QR1A 2JTYA 1KIRA 2NXYC 4PJGF 4RNRB 4BK8A 1A6ZB 4ODSH 3INUL 2NPLX 1J48A 3VI4F 2EXYD 4MNHA 3IPEA 2AEPH 3PL6C 3L4WA 4OGXH 3UP1A 2NXZC 1DQML 4P9HC 2XICA 3UG4A 3LKQB 1AE6L 4Z3JA 5I1AA 2BX5A 1A64A 4FTVE 1NCAL 3VX1A 2EDNA 1JAEA 2YRPA 1QUPA 4HK3J 3Q44A 5JW4N 1Z66A 4MFHA 4U4BA 3BKML 1ZT7A 25C8H 4JB9H 3EJTA 1FWXA 1UUSA 4YSUA 3RKDD 2H2SC 3VB8A 1T7YA 3CHRA 3N85H 3TO2A 1R24A 5C9JA 2DM2A 1QFHA 1QWUA 2R0WL 3D0LB 3MRDA 1L0YA 1UD8A 4JPIB 1BXVA 4M9OA 3OKNB 1HHHB 1XEUA 3QIWA 4FC3E 4HJEA 1T0NB 4Q9RH 1TVBA 1MREH 1KXTB 2M8XA 5F2FA 1DO5A 1IGTA 4TUOA 4UDTA 4KKZA 5L0QB 1GW0A 4ZSOA 1FYHB 1Z9LA 3SO3B 5HI5C 4PG2C 1LK2B 1ZE3C 5HHNB 5EH1A 2LAAA 1S46A 4EUPH 4X8GA 2VDNL 3KWVA 2R83A 4JHUA 4AM0Q 4E41E 5B8CB 1YMMA 1PFCA 3MLVL 5DDHB 4E9LA 5BRQA 3MGTA 4GQ9H 4BZ2H 2J56A 3S4SG 2FD6H 4OT1L 3BZ4A 1SN2A 4PJHB 3OHXB 2VLRB 4PJXB 4MD4B 1KPUB 1VKXB 4N8VA 2MNJB 1HJCA 4XGZA 1J05B 2AJUL 4DGVL 4CSSA 4Z3GA 4XH2B 4WI9A 5CBEA 3U9UB 3K6FA 1ZLSL 4PJ9B 4APQC 5FOBA 2AVGA 1MJJA 4O2FA 5AVYB 1RLWA 3QIBC 5J12B 4RFEB 3C6LC 5E70A 1MHCA 3C5ZC 3EHBB 5B39A 3LIZH 1IBFA 2VR7A 2OXGA 1NBVL 2PYEB 3MBEB 3H2QA 4ZMLA 4MJJA 4BZ1H 4M5YH 1LO3H 4N5ED 2FSDA 3UYPB 1WS7A 2F53A 4Q6YA 1D5MB 2WZAA 5HVHB 1YUHB 2E86A 3KPPA 5IEHA 2EEDA 2OW7A 2JK5B 2XXFA 2O5YH 2NY4C 3GS4A 4HDIA 5F7HA 3QHFL 2IGFL 3X3GL 4U3SA 4NRYB 1K72A 3QYCA 3FXIC 4GS7B 4OJYA 4K5NA 1NCJA 5FGBC 3B3IA 5HJ3A 2BDNL 1C5DA 3AFLA 1AOHA 2YD6A 3AQYA 5E0FA 1OW0A 4YOKA 5EU6D 5AZEH 4RAUA 4AL8C 5KVEL 2EE0A 2FUTA 1FNEB 2P3YA 3GLEA 4P2QD 3PNWA 5L4MA 3GZPA 5IW6B 1H5BC 2GW5A 1CFNB 4F80A 2OYPA 4Y1SA 3ZQ9A 2X09A 2JCCF 1YN7B 5ABDE 2I32A 5I6PA 2ZKYA 2GITB 1JDAA 4BFEA 2LU4A 1CICB 1QTPA 4XB8A 3UAJD 4BIKA 4QO1B 2Z65C 2OSXA 1C16A 2HWZL 2X6AA 3RZWA 3V5HA 1R0AH 4JUSA 1A1OA 2CIIA 5FX3A 2ARJQ 3X12B 5E5LA 5E2VL 1T5XA 5K59F 3GHPA 3IGUA 2XACC 3M8OH 4NSKA 4TF4A 3MX0A 4ZMNA 1S7WA 3MBWA 1UFGA 3NSFA 1ZANH 1RZFL 2OTWA 3GSUB 2WXFA 3MLUL 3FQYA 3EF4A 2MCPH 3MODL 5CXPA 2G4GA 2OMWB 5C08A 5KSAD 2H1PL 5D1ZB 1Z9SA 5CHNB 1AGEB 4MAUH 2DLFL 5HHVH 4ELME 5I74B 2BZCA 4NNXB 2WCSA 2IGLA 3BFOA 2NYYD 3IKCA 1U6AL 3ZTNH 3N06B 5E9DB 4D0BB 4F37K 4U1NB 3ARFB 5C0AB 3SYQA 1T03L 3JWDC 2H3NB 1XIWA 1OP5K 1FF5A 4P04A 5T1MA 3CFJA 3EYOB 4IMLB 2CA3A 3O3AA 2VXQL 2C7UB 2VR3A 3PWPA 1BIHA 3TZVD 2APFA 4ZD3L 3S97C 3DX7B 3F85A 4JM4L 4NQEB 2EDTA 5I8EA 1M3IA 1OTUD 1BMGA 1DLFL 4XBEH 1XL4A 2R29L 1IAIL 4A6YH 3EYQC 3I50L 2VN3A 1NBZA 1QFWH 2JFCA 4KKRA 1P5UC 3O3DB 3L4XA 3SDXA 2H2PD 3DLQR 2DQ6A 3QDGE 7PCYA 4JM2A 2QSQA 1QKZH 3V6ZA 3ECUA 3CSGA 4JRXD 5FO8B 4N2DA 4A7GA 3IWVA 1CG9A 4QR7A 5B1BB 4DVBB 3WY3A 4PTUB 3VXSB 4JDZA 4PRAB 3EKCA 3BPOB 3DSFL 4ZNEA 1FE8H 4P2RD 3ZUNC 1GAFH 3CZKA 1FA4A 4MD0B 4I48B 4HJ0D 5EORH 3TH4T 3RI5F 2J1ZA 3S3PA 1RSFA 5JW3H 4G70B 1BBDH 3CH1A 4PWGA 4UI2A 1RI8A 5AKVA 3MCLH 1HXYB 3QEQE 5DUMH 5F96L 2JI1A 1GC1L 4EI6B 4ONHB 3AW5A 4F7CB 4P05A 1HL9A 2WXJA 3VUAA 2LT9A 2FT7A 4PWKA 5CLYA 4A55A 4M03A 5I73C 2X53A 2ZUTA 3MUZ1 5KSBF 4LCUA 5C3LD 4LPVA 2ZSWA 3PUCA 2RR3A 4OB5L 4OCMC 5F6IC 4UQIM 1RK1A 4AQAB 4QCIA 3LHPL 5BVPL 1EMTL 1I1YA 4K0OA 4K23H 4X4KA 4KGLA 1NUDA 5DLLA 3TFKC 2NY2B 4EBQL 4DW2H 4XVJL 2C9XA 4WV1C 1GYCA 5IR1B 4LE8A 3CFBA 1MIML 4GO9A 1HQ4B 3I3BA 2OCFD 3HBGA 1ET7A 1NFDE 4GQZA 2C8NA 1T0MB 3EGDA 3H9HB 1NEZG 3OVUB 4G6AD 4XP4H 1HH9B 1OAZH 2ZSVA 4JRFA 2PTTA 2VISB 1JFQL 2G60L 2OMBA 1A4JB 1B6DA 5BPPA 2WXOA 1B0RA 4N2HA 2QVKA 2VLKD 1GPOL 1KTDB 2DQGH 4GMTL 4E5XG 5T3ZE 3WN5C 3RY4A 3IDXH 1BZQK 2EVHA 2FBOJ 4JRLA 3PGCA 5E1AA 1CL7I 1FRGL 2VDOH 3BPNC 4PTTB 1HXKA 3PS6A 2OXHB 1U8JA 1U93B 2EIKB 3DMMC 1NCBL 3LMJL 4LEOA 4QXTB 3SE9H 5E6YA 3T0AA 3NCWA 1FHGA 2G5UA 3OPUA 4ELDA 3MQIA 1WAEA 3L1OL 4G6FB 3N44F 2BOBB 2G3MA 3FT3A 4Y4FB 5I5RA 4RQQB 3SE3A 4TNWF 3JBG7 4KY1H 5INDB 3BCDA 2WKLA 3KM1A 3HI5L 1QMUA 1QW8A 1S7RA 1LILA 4ZDHA 1W80A 4R0LA 2DL9A 1TQCC 4WDIA 1GYUA 2WLKA 1XHHA 4NZRL 5ICYA 2ATKA 3VDCA 4M5SA 3RZCB 3FFDA 4TLTA 1E4XL 1O7VA 1LE5B 3VXPB 5I2IA 1T7ZA 3T0BA 1F18A 3GMLB 4HSAC 4PGEA 3US0A 2ESVB 4CGTA 2ZX5A 3L9RA 3ZQWA 1V3MA 1E4HA 3Q5YA 4O00A 2WLHA 4TKWA 3MVSA 3EDFA 4JPWH 4X5PA 1BG9A 1BQKA 5I5JA 5EZIL 3E80A 4Q4EA 3SDDC 1EAJA 1UWYA 3NYKA 3HC3H 5HYJA 1X5ZA 3BW9A 4LHUB 4AJVA 1Z3GL 1MLCB 12E8L 3WKNA 2DI9A 2OMUA 3L4UA 3VWKA 3HCVA 2FEDD 2FO4A 1DJSA 1NTDA 3IMRA 5HYQB 1OWWA 5C0FB 3BZEB 5DUBB 5I9QC 3ZIMA 4FG4A 5IHZA 3M07A 1SJXA 4X0NA 2XRAH 3MV8E 4LPWA 2HRGA 5JQ6H 4XMWA 43CAA 1N5AA 1UC6A 2R0KL 5AL0A 5EBWA 4G7QB 4LCWD 5GZOD 1PD1A 3NT0A 2KI6A 1JHLL 3S37X 4LL4A 5CEZL 4BFJA 3T0EA 3V5DB 4QJ5B 2DJ4A 4O02L 4O9HH 2IXQB 3D51A 3W57A 5HGHB 4IRSA 2EDKA 4MX7A 4A2FA 2P5EB 2NLJA 2HA1A 4YHIB 5KVDE 3R8BB 2XVGA 3L7EA 3GM8A 4MKMA 2CNZA 3K2KA 3V0VB 5F7YC 2FR4B 2X4SA 4OV6F 4V11A 1YPZE 5C86A 2J43A 2H1LM 4AV4A 1EPFA 2A6KA 3NIGE 2EC9T 5L4IA 4ILDA 4FA7B 4TPRH 5I1EH 1EZVY 1BEYL 5FDWB 4AOFA 5DHDA 1AR1B 1FFPA 5H4YA 1C8PA 3SCMA 1YEFL 4KRPB 3WKPA 2HRPH 1I8IB 4JFED 1GHFL 5EOTA 3RGVC 3D2UB 4P4KD 4G8EB 3QWNA 1MXDA 4G3YL 4KUCD 1F4XL 3Q6GH 1T2QL 3HAEG 3QB7C 4OFYD 3QQXA 5FK9B 4K4KA 1PQZB 1S9XB 4NQTA 1BZDA 2BRRL 4LLYA 4KH9A 2YPVH 4C4KT 4ERSL 1ETB1 3ZTCC 3QO0A 3RA7H 3HZKB 3ABZA 1LO5B 5TE6H 3ZXAC 2X28A 4M7ZC 2WQRA 1IL1B 1OXYA 3KR3L 4Z7WB 1AO7D 1S5IL 5E6ID 3UBHA 4PG9B 5AVTB 1NDMB 1TDQA 2V17L 4KKCD 4EUPA 1SDDB 5FA3A 4DN3L 5HDBF 3L4ZA 1KG0B 3K6NA 2DI8A 5I1DB 3IDMA 3DNKA 2FATL 3MJ7A 3ZPDA 4ZZKA 2AQRA 2O6CA 1MI5A 5TFSH 1HNGA 2ERJB 3LJ3A 4TQEH 4WLCA 5SWZD 2R51A 2WUBL 3EBHA 4X9YA 3AY4A 2IDTA 1TZIA 2Y7QA 3IGAB 4QF1B 3TBTA 2Q9OA 3FONB 3UTTD 3F7QA 3BYYA 2M2DA 1INDL 2R2EB 5IHUL 3ZMEA 4AMXA 3LKPB 5KVGH 3H0TB 3VMOA 3NCBB 3D33A 3LKOB 4U2YA 1S3RA 3LIZA 2GBAA 3Q9QA 3WMSA 1PG7X 5DJDA 1AD9A 4YFLF 4C4BA 3BAYA 2YGPA 1DFBL 4XOBA 4BZ1A 1XH2A 2P8MB 4HXAL 4WKZA 3BKYH 3VW3L 4JFXA 5AG9A 3QXDA 2IOOA 3QUYD 4JFZL 5CEXA 1FGNL 4GKLA 4OGQC 3CK0L 4DP6X 3C8HA 3ZKMD 2X2UA 4QRQB 4QRRB 5JW5A 5D6DA 1E9OB 2RMNA 3SKUD 5FYKL 1G5AA 3BEWB 3OKYA 4OZHF 5D7JB 3HN8A 3GKWH 1BLNA 4OJAA 3VFSA 1XGPB 4NUMA 2E6PA 2PTUA 2YD5A 3GMMB 1ZXQA 4QIRA 3A6BH 2APTA 2X2YA 4F1ZA 4JUTA 3B9AA 4YFLI 4KVNH 4XO8A 1HCFX 2WSKA 5DS1A 3VXTA 3I6GA 5I6MA 1HXMB 2Z4TA 3D9AL 4JCLA 2XN9E 5IB3B 3SYCA 3T2OA 3ARWA 4QTFA 3BJ91 1C12A 3PWUB 1OAYL 5M94B 4IRJC 1IBGL 1MELA 3QCVH 2TSBA 1HSAA 4POYA 1OP9A 1N6QL 1R24B 1SF5A 2R2HB 3MRDB 2ENQA 4L4JA 3VYPA 4FDWA 2EIMB 1KFAH 2I7OA 5GGTL 4UOJA 3D85B 2WTPA 3QIWB 5ABAA 4F7EB 4IGBD 3D3VA 5IFAL 4KJWD 2D2OA 3JV6B 4HIQA 3KJ6L 1PX3A 4LCYA 1VFMA 3FH8A 2YD2A 1IGTB 2AXHA 4UM8A 2F9BT 4P48A 1AJ7L 5D1XC 1MJUL 2FHCA 3ZN6A 3P4NA 2JB6B 3LNHA 3CJJA 4ONGL 3WIAA 4B9JA 4RSYA 3EJYD 3QUXB 4RRPA 3MRFB 5D7EA 2CO2A 5EEYA 1Y18B 4WUKH 4Z3HA 1V54B 3AVEA 4I88A 5EA0H 3WHXA 3K71A 4EI5A 4N8VB 3IDNA 4H1LH 1CF8L 4A6YA 1Q0EA 1OGAB 4XCCL 1KTBA 3NCYP 3MOBH 3QQ4A 4V2CB 5HD8C 4G83A 5HVFB 5KUMA 4LLMB 3TTSA 1IC4L 1U91A 4PJ8C 4OIIH 3EBIA 1BA9A 4HG4K 2HT2C 4R90L 1MAJA 4QNPE 1A7OH 3L4CA 3DO4A 3ULVD 1O75A 1NKOA 2BOLA 4ZBJA 2HYMA 2VE6A 4R4BA 1FO0B 4Y4KA 3B9EA 2X0UA 3VD1A 1UXSA 3VH8B 5IEHB 3QORA 4F93B 1J9CT 3U36B 1KB9K 3KBFA 5DZJA 1NM9A 4ZUVA 4YPJA 3MNVB 1W72L 4UT7H 5ELIA 3ZQXA 3VO0A 1AP2A 5ALBH 1QSFE 5A7EA 5I76A 3QO1A 3ZT6A 2EDYA 1YNLH 5DQDL 3DUSB 2FX7L 3LS5L 1T4KA 2VRQA 3C8KB 1C9SA 2BCMA 3RX7A 3TA3B 1YAZA 1C5DB 3CLEH 3VD5A 3ETTA 4YXHL 2A74A 5CIPB 2N0KA 3B56A 3BIAX 1NA8A 4YGVA 4U1KB 5DD5L 3RIFF 5HHPB 1JGDA 4E41B 4KTDL 2VWEE 2WUCH 4IOFD 1CZ8H 2PXYB 2OP4H 3UYRL 3O11A 1TTCA 4G2AA 2Y6SD 4UNUA 4GKSA 2W91A 4D0DB 1C16B 5HI4C 4YWGL 1WIUA 1D6EB 2LGNA 2CHXA 9PCYA 1A1OB 2CIIB 4PJ7F 1I9EA 2OSLA 5EZLA 3PDOA 4QT5A 2PWGA 4E68A 3SDCA 1JG9A 1FNSH 2OTUA 2LR4A 2BMKB 1E5UI 1IB5A 2AJXH 4DAGL 1ZHLB 2FIKA 4KROD 4F15B 4XNZC 4KZDL 4MTMA 1U4FA 5F7AA 4YHOH 3S0PA 3CVBA 3C9NB 2ADIB 3QULB 4WJG3 4NO5B 4GP8B 3OV6A 3VD7A 5T33H 2AV7A 3W11D 4EZMA 3DTUB 4BFNA 1PZAA 2YK1H 1CTNA 2NSXA 3O0RL 4TULH 4WFGD 1TJHL 5T5FL 1CLYL 3MRKA 4RLDA 1XIWB 1NGZA 4PP1C 3H3KA 5I6XC 3F7YA 3L3IB 3QR2A 5D72L 4NO3B 2J3SA 1CDGA 5DHYA 2J1KA 1AD0A 2DRUA 5KWYC 4U1LA 3U1SL 2BNQA 4Y89A 2WYHA 1CT8B 4XMKH 1DQQA 2YIHA 3UPAA 2W92A 1HX0A 4AKQA 1M7DA 4B96A 3TT3L 5CSZB 3X14A 4X8CA 2W88A 3TO4D 1QVOB 1KENH 2JQAA 4X7SH 2K9UA 2NNRA 3OAZH 4DTGL 3F8UB 2AERT 3BI9X 2BVTA 3FCGA 1ZVYA 4HUWA 5D70L 1KSRA 3L5WA 1CXKA 1UACL 3T6ZA 5FO7A 2B7DT 3IMUA 3FO9B 2XNAA 1IIIA 2FH8A 4NKMA 2FNBA 1RCYA 1T2JA 5H8DA 1J5HA 3MLXH 4WWKA 1UJTA 2PPFA 3UIYA 5MI0C 1KB5B 3F3HA 1VGKB 1BBJB 2CCLA 1GXEA 2WXQA 3F6JA 2E8ZA 1U33A 1MNUH 1IVLA 4OAWA 5F1IB 2KLRA 1D5ZA 2UXTA 1U92A 3D4ZA 3NTCH 4WSKA 1KJMB 1YNKL 2WINB 2YQGA 4L4TA 1UATA 4ELMB 3CH1B 5IQ9A 3B7RL 4R3SA 4HCRL 3CFCL 1XZ0B 4GRLA 5B7MA 4KXCA 5F7EL 1E8WA 3EO9H 4FNLL 3G5VB 1TXKA 1TG8A 3UTOA 4GXVL 1IJ9A 5ETUB 2B59B 5HDRA 3ARDB 4JZJA 4KZ0A 3UC0H 1J8RA 2L0DA 2EO9A 2FH6A 2ZSWB 3PREA 4Q9QL 5EPMA 3JWOC 5IB2A 1TFPA 3VD9A 2AJ3B 2RA1A 1U2YA 1S7QA 4LSRH 2CPCA 3MRHB 1UA6L 5C09A 3M1BA 1NGWB 1PD6A 2I25N 3FT0A 1TVDA 5IBUB 3LB6C 2F6AA 4NPYB 3RRQA 1YEKL 1J0KA 2YARA 4LGSB 2WXHA 1A2YA 3WIIL 5DJXA 2E27L 1IM3A 5HGBA 5I1HL 4P9HH 1JF5A 4NNYA 1QD0A 2B9BA 5TH2A 2OX5B 1JXGA 3L7FA 32C2A 2NT1A 5A7BA 3P0YH 3EGDB 2A7BA 4IMKC 5IUSA 3R8QA 3MKKA 4DQOL 2CK0H 5GGSA 4U1JB 5GRUL 4KJPC 4RMRA 2ED6A 4GNKB 4DFHA 1UOLA 1WH0A 4S1DC 3FZUC 2VZOA 1AXIB 4Z3EA 1XFPA 1EZLA 3AACA 4G6MH 4KVPA 4PJFE 4ZW7A 1AXSA 2WJ7A 3I84A 1YEWA 3BSHA 3VI3E 4WK0B 1T0PB 4XO4A 3MV7A 1HSBA 4CNIA 1NOLA 3A21A 2BS71 1LVEA 1PKQA 1CD1A 5CGTA 2ICWJ 3I02B 1KNOB 2XSKA 4FZEH 4LEOB 1B2WL 4JFOA 3ULUL 4IBYA 4PJAA 1LP9F 2BSSA 1T5WA 2SEBB 1U2CA 4N9OB 4ES8A 2DWDB 4EDXB 2YPVA 5GGRA 3VA2C 4Z3TA 3FT3B 3G08B 2RH0A 3VD0A 3HFFA 3EZJB 3L4TA 3U82B 4H20H 2SODB 4KV5F 4AG4L 1RPKA 3QCTH 3WJJA 4ZDHB 1ZE3H 4R0LB 3KG5A 4J6RH 3ZE2E 3DX6B 1H6TA 3VFPB 2DMHA 4X4XB 4BCZA 1N19A 4F1SA 3QQ3A 4ES9A 3CZUB 4XNUH 1P4IH 3WS3B 3L5IA 4IRZL 5I2IB 2X2JA 1SLVA 4XZUB 4GT0A 3J07A 2XTJE 3IF1A 5CN3A 2R56H 3LN5A 1DEEA 3NH7H 3MZTA 3ROLA 4AZUA 2VLRD 3FMGH 1FFNA 1NFDB 3PWNB 4IBTA 3V4PH 4Q6IC 3QXAA 2OJZL 1NDGA 3MDJA 1IILE 1S7VA 3CVHB 3UBXI 4YUEH 1ED3A 1N7ML 4PJ9D 4PGDA 2HTKD 3S3CB 3MV9A 3BE1H 2OMUB 1NJ9A 2R4RH 3EHBD 3IMBA 4E42B 5GRXG 1QUNA 4MYPA 2VKXA 3HE6B 4Z77B 2HLAB 2PYED 3MBED 3WBDA 3UACA 1E90A 2WYZA 5K69A 4PS7A 5AAMC 2ITDB 2IV8A 3ULAB 1KGIA 2XWZA 2VERA 3I6KB 2ZXQA 4OCRL 5DEJA 3U46A 1E4WL 5AOMA 1N5AB 1UWGL 3KLSA 1JIBA 3HPJA 3ASNB 1Y6NR 4LLQA 4M9PA 3WFCH 2YHGA 1EFXB 1WBYA 4LVEA 5AYUL 4AL8H 3T0EB 4IJ3C 5D2NA 3V4VA 2PCPA 4QGYA 1YQVH 5DRNA 1VGEH 3DYPA 5ICXA 2XV6B 3AU1B 3HRZA 3V9CA 5MEQA 1E43A 1MFCL 1OAKL 4JO4L 2JJWA 2EIDA 4KHXH 1UCBH 5ID1A 1EJ6A 5LNDA 5CGYC 2A6JB 3QZMA 4M3JA 5HDLA 1FIEA 4M7KH 1A5FL 1NSNH 4FG0A 1EH9A 3OKMB 4ZFGL 4H8WL 5BQ7A 3HMXL 4PJBB 5I1CH 1EK3A 3S5ZA 2IEPA 5C0EA 1CICD 2OMYA 2FQEA 3DRQB 1ID2A 2YLHA 4LNRB 1I9IL 4PN6A 2J44A 1I1CA 3DX9A 3BRGC 4KPHH 3EFOA 1WP6A 1G6RH 4PAZA 3FB5B 4POUB 4BEIA 2V5YA 3C08H 3RPIA 1KZYA 2F5AH 4NC0B 3RYMA 3H3BC 2E59A 4O58H 2CWRA 4LLYB 4TM9A 4F7MA 5IMLB 2HCZX 1ZHKA 5JO5A 1MN4A 3BP7A 1J5OH 2WXKA 1A7PL 2AFNA 2Y24A 2BFVL 5D1ZD 4IOIB 5E00A 5AVRB 3K5RA 1EERB 5D2LE 4PLOB 1E3FA 3P9MB 3TT1H 3MGAA 5EU7E 4M6NH 3JWDH 4AGNA 3FKUS 1UM6L 2JKSA 3MOAH 4KWUA 5DFWH 3G6DL 4EUPB 3SPCA 1BM7A 5E9DD 2DDQH 2B1AL 3WNMA 3ARFD 1OM9A 1EEYA 3CXDH 4FQXB 2ICWB 5B1KA 5C0AD 3RUGB 3SBPA 2OL3B 3BAJA 1K6QH 2QQKH 3IDMB 1A14L 1TJMA 1A0QL 3QSKB 4G1MB 3RWFA 1A6WL 2XVLA 1XB6A 3MYJA 4MAYB 4C4UA 4ZX6A 1OGPA 4GQQA 4H1LA 3AJ7A 5HHME 1FCGA 5FW8A 2B0SH 1FVEA 4NQED 3TBTB 1IC7L 5FYJH 3T3PE 1XB3A 2OSYA 2B1OA 3AU0A 2ZNWA 4LLVA 1NBYB 3KWWB 5E1HB 3GMRB 2GTZA 4K3DH 4KZCA 4LLDA 5DVLA 1S78C 2X3BA 3CFDA 1AXTL 1PX4A 3BGMA 1LDPL 4AYBA 1IBHA 1KY7A 3NIGB 4Q89A 3T6XA 1MFVA 3VTMA 2HX9A 2VDLH 3V9FA 3OLEA 4HEMA 2C1PB 2YD0A 4ABUA 3CDCA 1I8LA 3SBRA 4WKZB 4XCFH 5EF0A 3PV6A 1UENA 4FYRA 4YK4B 3VXSD 5AWNL 1QEWA 3VD4A 3QI9A 3W39B 1MWAL 3MFFA 4QXGH 5JW5B 1YSOA 3ESVF 5I1IH 4JAMA 3TV3L 4LO9A 4PJIE 3AGVA 1LLAA 4DKFL 4KKNA 5CCKL 4RCAA 1KTLA 1PY9A 3U4EB 1E67A 3OGCA 1DZBA 4XNXL 5J6HA 4C57C 1LQBC 3VXTB 5D1QC 3LRMA 2VXTH 2BOCA 2O72A 4K2UL 5H37G 4IW4C 1O6VA 5B38G 1GS8A 3LPGA 1XGUB 5GS0D 4PGCA 5FR3A 1WSST 2QFPA 3L3OC 1C12B 4LCIL 1IX2A 3AT8A 1QA9A 4B97A 5LGJA 4PM1A 1NC2A 1O9VA 2NY2D 2HT4C 2HJKB 5IMOB 1UT9A 1WGOA 2MQCA 4M1CC 4Z7NF 4ZMTA 2CAKA 1WE5A 2EECA 4FQIL 2VSMB 4F3FA 2VL5B 3FCTB 1ZTXH 4MQSB 5D5MF 3G6JF 3BP4A 3FRPG 1UEMA 1L9OA 1URLA 2YR3A 2APXA 3WN5A 3OJ2C 1LE9A 1UJ3C 2C9PA 5L2KE 3QYMA 2IDUA 5H94B 1FJ1A 4XXCC 2VABA 3PUUA 2AGJH 1DDHA 3P4NB 2MOQA 4HAFA 2EYTA 4Z7VA 4WI7A 4X0KB 4KXDA 2V33A 4MVBD 2ADFL 3ROOB 2OMTB 2VITA 1XVSA 5J89A 1IAMA 5FUOH 2GI0A 2OYLA 2X4TA 3JT2A 3JWNH 4GAJH 4I0PC 2HTLD 4XTRD 3SQOL 1JGVL 5BCAA 3ESNA 1KXVC 4RISL 4RWYH 4A7VA 1BZ8A 4MQXC 4HUUA 3W56A 5E9NA 4G6FD 3OF6D 5J1AA 5B3JF 4U6XA 3SGEI 3TEXA 4Y4FD 3WEAA 3NIDF 4GXUM 3LNFA 4HGWB 1MCBA 1R46A 5CZVL 2CUIA 4H26B 4LKCB 5AW5B 4E2OA 4F2ME 3BT0A 3OC8A 3Q5OA 1HNFA 1IKNA 4M61B 4KVCL 2YGNA 1CGSL 3CX5J 4FCHA 4KAQH 5D7IE 3QAQA 4PCKA 1ZLVK 5DJYB 4RAHA 3RZCD 3ZZLA 1E9PA 4XCEA 2H32B 3P4LA 2O6PA 1YEJH 4LDCA 2ZKHL 2DBJA 3TBSB 1A25A 5IVZA 3FQWB 1FFOA 2ESVD 1JXKA 5J13B 4HIEA 2BERA 4ZUVB 4YBLB 2JJTA 3MRMA 1AP2B 3RBGA 2CHNA 2C4XA 4ZQKA 4H7VA 3TBBA 2NNAB 1ACYL 2TRYA 3FJTA 4EZLA 4NERA 4LHUD 4OSUL 1OAUL 2NRDA 4URKA 3SN6N 5IMKB 1XH1A 2FQFA 2EDBA 2NZIA 2A74B 1X5GA 5DZAA 2W9DL 4RMQA 2EDMA 2GHWB 2CE6A 4QRPE 5F7DA 5GSVA 5IROD 2CUAA 3ARGA 4NQVA 1IEBB 3T2LA 3OPZL 2UWEF 3OMZA 3HKZA 5E7BA 2Z7ZA 2XZAL 5T1KA 2V3FA 1QI3A 3FTZA 4L29B 3K6SB 2D03L 3RILA 4OQTL 1RV6X 4OTXL 4N6RA 2KPNA 3ARBB 4MXWH 5DYFA 2V2XA 4PJCF 4I4WB 4JO8A 2O5XL 4OCSH 4MCYB 2QSCL 2CSPA 2XFXA 3GK8L 4WU5A 1HQRB 4GUQA 4DGIL 1A66A 4JANA 4F92B 4N0FA 2Y6TE 5DUPH 1TZHB 4PGBA 3RWHA 4XE0A 2P5ED 3RDTC 2VDKB 4AH2A 2XTLA 3V5KB 2QV2A 3GFUA 5F97E 2AJVL 2D7QA 1JZIA 3E2HB 1QATA 2IANA 4POZD 2QGBA 2R69L 4PV9A 1PZ5B 1JHTA 2N56A 3H9SB 3C60B 1NAKH 4RSVA 1ETZB 4ATTA 3EYSL 2F08A 4IBLT 4KHTL 5DRZA 5C0JA 6PCYA 3BH9A 5IESL 1XCWA 5AG8A 2VDOB 2MNWA 4OBRA 2DM3A 3HEIB 5D8JH 4DCQA 3WFBH 4KK6D 5IB5B 5C0CA 6TAAA 1AR1D 4HUVA 1CFTB 4HUNB 4YE4H 4KRPD 1UFUA 2DQDL 5C07E 1T80A 2FWLB 4GEJA 4WI2A 4BGLA 2VM3A 2XA8L 3D2UD 5GRJL 3TXAA 2J8UF 4QAMB 4JN2A 4H88H 3PHQA 2DD8H 2GHZA 2V3EA 1XF3A 3LD8C 3BN9D 3QUZB 2B9AA 3ZDWA 3IFNH 4BFIA 4AT6B 2Y2TA 2G2RB 2YN3A 1MFAH 1Y0LA 3F2LA 2E7HA 2MQGA 3JTTA 3O3UN 3T09A 4CAGA 4P23C 4RBPH 4CL7A 5MHSE 1N26A 1G1KA 3QNYB 4P9MH 4GBXC 4HH9A 1XH0A 1UH2A 2CKBA 4K7FB 2GJJA 5CLWA 4MXQD 2X4NA 2BNRA 3LH2H 4YDLC 2FJGA 4LOFA 4ORGA 2RFXB 5C0BE 3NEXA 5AVSB 3MJ6A 3ZKXC 3O3EA 4OZGA 4C83B 2W0LA 1MCCA 3ZGIA 3MOQA 2ED8A 1BJ1J 5C6TH 2RALA 3FB7B 1F3DH 3RWDB 3B7YA 3WELA 4PJHF 3WIHH 4BKLB 4N87A 1FL6A 5DMJB 4ZYKB 4K94L 3WFZA 2XKNB 3QHZL 4OZFH 1QLRA 3SDAC 3WXWH 1UM4L 3H42H 5FCUL 2NDFA 4DUWA 5ACLA 3G5XA 4JHAH 3AS2A 4JZJB 2XUWA 4PS4H 1SVCP 4IYKA 4U1SB 1U8OB 4NRXA 2P8PB 5DWUL 2I07B 3PAYA 1TQWA 4OZ4B 2E8YA 1S7QB 2MHAB 4YSRA 4U1MA 3DTXA 2Z93A 1DQJB 4X7FC 3WNLA 2R1XB 2ORBH 3QQDA 3E38A 5FWQA 4JPVL 4DQAA 3ATEA 1VEOA 3MRNB 3BAIA 3A6CH 4A7QA 1TMQA 2VGLM 3OKOA 4FMVA 1L9NA 4QRRD 2H5UA 5SWSA 4NKOB 1NCCL 4OLXH 4JQIL 4LASL 4DSYA 5D7JD 1UYWH 4QGTA 4BKSC 2DEYX 3U2SA 1OGSA 4IBZA 4PYHA 1KEML 4AYFA 4HT1H 4W4NA 3BMVA 3GSNB 2VN4A 3TEWA 1TTUA 2WP3T 2ZX9A 3NACL 5T1JA 1R3JB 3FB6A 4GRMB 1YYLH 5I0ZA 4AQ8C 1AI1L 1FVCA 3PF2A 3MRBA 3DJRA 4HCFA 1UM5H 4JLRB 1N67A 4K8RC 2PR4H 4JL1A 5FHBL 3NIFE 1WHOA 4ANXA 4CNIB 4HD5A 1AS7A 4LQFH 1G6RA 4P5KA 4MNGA 1IGCL 3EDKA 3L9YA 4JFOB 3TPUB 5GZNA 1H9VA 3ZY7A 1HHGA 2OBGA 3GJFH 4YLQT 4GUOA 4FQCH 3VXNB 3C2SA 5GGRB 1QLFB 3CV5A 5L7XH 2YLKA 3TASA 1JPSL 1NGXA 1UGKA 2NW2A 3D85D 4KKQA 5I8KH 2XETA 2NZ9C 3PLYA 4PRHA 1XZWA 4QHLA 4X5WA 1C5BH 2WIIB 4R6UA 4YHYB 2E9BA 3FO1A 1MJ8L 3CMGA 5ERWB 1MW0A 3V6OC 5KANI 2PCXA 2A0LD 3QEUA 1G9EA 1JMXA 4M8QB 1QFOA 4PREA 1DBKL 5EEVA 1U3HB 4AWJC 2B15A 2WKOF 4HGKC 4P5TC 1OK8A 4R2GC 2X0VA 2WWMD 1BVNP 3N5AA 3MU3A 3BP5B 3BN3B 3QUXD 1SJEA 2YPLA 3N0AA 3LN5B 3SY0A 4ZW3A 2VC2L 4MJ2A 1I1AC 1X5MA 1KACB 3EG9B 4OR1A 1JWMB 3KE0A 4K3JL 4M3KB 2C3XA 3RNKB 3ROLB 2UZXB 5D71H 4BUHA 5DA0B 1P5UA 1PLAA 4ZAKC 4QAWA 1CI5A 3VXMA 4MD5B 3F6LA 3BDXA 4ZOCA 5DQ9A 4C56A 1OGAD 1S7VB 1J0YA 4V1DE 1HHIB 4ZS7H 4P8QA 5DUJA 4GSDL 5J4MA 2ADYA 3EYUH 4AKPA 3A67L 1X5AA 4U3CA 1CWVA 1HOEA 3CIQA 2QQLH 4DP5X 4XMLL 4PJFB 1T22A 5LXGL 5D1ZI 4U31A 5IT2L 1FFRA 3HE7B 4RZCA 5IVOA 1D2OA 5DMGD 1XB8A 2V7NA 2QLVB 4U6HA 1BQHA 3Q6FB 3EDDA 4N2IA 5I26A 2C9SA 2NCEA 4ZPTB 3FTWA 3BPLC 4LIQE 3RIAK 1BHGA 3PG2A 5DD0H 2XWBB 1O0VA 4MJ6B 5JLZB 4NIKB 2OK0L 5M95B 3OJDB 2A4CA 3NJIA 2MRYA 4KQ4L 1RFDL 3VFOA 4UT9H 2V9RA 1V7NL 4X4ZA 5JYMA 4RMVA 4UAOC 3EH2A 3TA3D 1IKFH 4WHTB 4PJEE 2ATPB 4FG6D 4GJTB 4MDJA 1I8UA 2DLGA 2IALB 3O6MH 2VT0A 3WJMB 5JPNA 3W9EB 4HFWA 3RWEB 3FQTA 5FGCB 2VN7A 5C2BL 3D5OF 2Y25A 2XC8A 2XTJB 2IMMA 2ZONA 3B5HA 2XWCA 4KKAC 4PIBA 3GTTA 4R5XA 3GXMA 2PXYD 4M00A 4U05A 3SYPA 4J7RA 3JTSB 5KBMA 4WNSA 1JK8A 2ATAA 1FDLL 3PYCA 2VR5A 2VXUL 2J8OA 3DJZA 2WMPA 1S9KC 3ZMRA 3IXAA 3PHOB 3D39A 2EDHA 2UX6A 3CZFA 2HG5B 5CCGE 2XWTA 2VCOA 5EU3A 3RPIB 3UADA 3ZOAA 4LRNL 1RIUL 3DURB 3S37L 3E3QE 3OAWA 4Y4HC 3ZRFC 2A6IB 4HAGA 4PJGE 5IV2A 2F68X 3PWLB 1F58H 3VFUA 1JZDC 4XN1A 2W38A 3E1F1 3HN3A 4NCDA 3VI4E 4NQUA 3KLDA 2XBZA 4UIMB 1FL5A 1AIFA 5T1LB 1MW3A 3S34L 3ARTA 2HJFB 3WLWC 3TN0C 1CGVA 4N8PA 3OXRA 3DMMA 1MHHB 2YUVA 4W6XB 3CLFH 3OZ9L 2XN2A 1CE6A 1P69B 1O9ZA 2YMXH 3LDBB 4NUGH 2DQFA 4Z7IA 5JOPE 1XIWD 3WEXA 1EHXA 4FFWD 1KYOJ 4LBAA 4YSPA 3FQXA 1N0LB 5CM1A 3TBYA 5A3IC 1W16A 3DBXA 1SBSH 3OKEA 1Z5HA 5C3TA 5MERA 1MFBL 4A2DA 5JUEH 4LVHB 1O6SB 1SXAA 5DK2A 4TSAL 5EF1A 1KCSH 3CBKB 3H1ZA 4G8FA 4ZX3A 3P4MA 5F1SA 3N55A 2XLLA 4F5CE 4H0LC 3JV4B 5C9KA 1YA5A 2UZPA 4G5ZH 3KVPA 4GXFA 2WOBA 4X99B 2J21A 3A3YB 3VE0B 4KJQC 4HJGB 4UQ3A 3GLDA 3SE4A 4LK4A 4X4MA 3NCMA 4YDMA 1NDTA 1WICA 3B7SA 1E8ZA 2X10A 3NJLA 4G11A 4WRLA 5I23A 2QKIB 4KUZL 1T7WA 1RUMH 3IS1X 2HRLA 3S5LG 3QI9B 2OYMA 1GW6A 2WNWA 3N41B 3ZHKA 3MFFB 5TQ0H 4B50A 4U6YA 1QHOA 5AD0A 2O5ZL 3ME0A 2YKLH 1KT2A 4O51A 2JE8A 3DJ9A 4FI7A 3VDBA 3HZVA 4CA4A 4F2EA 3UAAA 3CSFA 43C9A 3IJSA 3OGCB 5CJXA 3JWOH 3R0MA 4PY7A 1WVZA 4CSPA 4HIJA 3BWAB 5FUZH 1MFDH 3MJ9H 2V6HA 3ARDD 2JQMA 3QDGA 5GQBA 4HC1L 2ZF9A 3OKKA 2Z8VC 4NKIL 1TQVA 4OM0H 1KBPA 4YHKL 1IGIL 1HZHH 1Z9MA 1AZZC 3NJFA 4KNQA 3CG8A 1KWGA 4JY4A 5HHMB 3KYNA 2VXVH 2YSSA 5H2BB 3TM6A 1MZZA 1IEAB 1TPXC 1LQSR 4Z7UA 5DR5L 5CD3A 3GJEA 4NQCA 3RTQA 1DCEA 3IFOB 3DGGA 4BQCA 2QHRH 3V4UL 5HHXL 1WGVA 4WO4C 5LDUA 5B3NA 5FS5A 2GK0A 1I1FA 1J9TA 1RJZB 4UV7L 3M17A 4F33B 5HI3C 2E75C 1LE9B 1YYMH 3FQUA 5CO1A 3CDZB 3FBKA 4DUVA 3BKJL 2J25A 1GTNA 2PWFA 3VXRA 4XNMB 1TUPA 1DDHB 5F3FA 4OCYL 1EEUA 2ZKWA 3WSQL 1RMFL 5IQ7L 1RVFH 3PWJA 1MHPH 2JCCE 2IQ9L 1R3LB 1SHXA 1OZUA 2K78A 2Y5TB 1HHKA 4NI6A 4GUPA 4HWBL 5D9SA 3FTXA 3ZKQD 1QBML 3Q13A 4PJIB 4L1LA 1YEGL 2DYPA 1TTRA 4UV4H 5F9DC 3RY6A 3E7JA 5FC9A 5J1AB 5K59E 4NQXB 3VNYA 1LD9A 4GG8B 2COQA 4WENB 2ICEA 3FK3A 4Y5VA 4LL1A 3QIUD 4LBEB 4Z0BH 3RFZA 5ACZB 4MB1A 2LLLA 3GPEA 2BSEA 3UL4A 5HXMA 1BAFH 1OSPH 4NP4L 5JZ7C 4CVWA 1UD5A 1JGUH 4BCYA 3CUPA 4J3TA 4Z7WF 5A2JH 1E9PB 4XCEB 4HU8A 2XWDA 1XGYL 5CEYA 5I8OH 1SFHA 5DGRA 3BO8A 1JZ7A 3CFTA 1P5VB 4QY8B 5DRWA 1AE6H 1GGYA 2EDDA 2UUDH 2OZ4H 3HPLB 5DJCA 1NCAH 4XPGL 5CAYB 3MXWH 2YXWA 2J5LB 3KPMA 3QS3A 3V0EA 1PX8A 2DQMA 1I8AA 4MCMA 5AQ0A 3GMPA 3RWCA 2VAAB 2X5PA 3HC0A 4PIRF 2Y7NA 3O6FC 4Q52A 1L0XA 2EKSB 5I19L 3MRIA 3KPNB 3V7AG 1YNTA 3BKMH 1WIOA 3QJHA 5L2KB 1OIOA 4JPQA 4OZFA 4QKXB 1I4FA 4JY6A 4XC3H 2FO1A 2I24N 3NGBC 3B7UX 5D1XE 4GLRH 2R0WH 1RZ8A 1QO3B 4G7YL 2CJTA 1D7CA 2AXJA 4WY7H 2I9TB 4YSEA 5ESAA 5IHLB 3HE6D 2IH9A 1INQB 1ZA3B 4MA1B 3B9KC 4PLJC 1HKLH 4FQJL 4X5LA 5JR1L 4EVNA 4OZIA 4ZFFA 4N6RB 4XMXA 3VD3A 2OCJA 3IJYB 3ML8A 5BV7B 1OGTB 3NZUA 3INOA 3PL6B 2WTOA 1ID5I 3L3JA 1EFXD 4HMDA 5I6NA 2VDNH 5IVXF 2XFXB 1PCXA 4WU5B 4F2MB 3T0ED 1MRFL 2WNKA 4WI5A 1BF5A 3MLVH 1A6VH 5BRZB 4YHML 4K3GA 4KQ0A 3B34A 3FYIB 1PYWA 1U30A 1I3GL 2X05A 4AQ1A 2CGYA 4D9RE 3RVXC 2IANB 4QHMB 1VZGA 3C6EA 1CGTA 3G5YA 1UXWB 2AJUH 4PV9B 4D8PB 2AEQL 1KPRA 4DGVH 4ODVH 1W9XA 3QZNA 1ET8A 2AQ3A 5G55A 3US9A 1EZVX 3JZ7A 2PWEA 4YGAB 5KVEE 4GEIA 5HDQL 1GZHC 1OAQL 1DBAL 2AJZA 3KBHE 2YXVA 3MV8A 5T5NG 1NBQA 3F7VA 1T1XB 1KLUA 3HAEH 3PP3K 3Q8EA 4UYPA 4DZ8A 1NBVH 3GJFA 1IC1A 5K9OA 1RY7B 2X1WL 5CR1A 5TE7H 1A47A 2EYSA 5E24E 3FSAA 4CC4A 1L9MA 1OCCB 1E2ZA 5J6GA 4P3DA 4L1TA 4M4PA 3ECBB 3DHMA 4QRPB 4QYOB 4B0MM 4LEBA 3OR6B 4ZFOA 2QBWA 3LSOA 1DJYA 2KH2B 3QHFH 2F61A 2IGFH 3NCCB 5FKAA 2VDRB 2D7TL 4CU6A 3AAZA 2LTQC 4R4FH 3AQXA 3JVFC 4ZMYA 3MACL 2BIIA 3B9DA 2CR6A 2PO6C 3S4SA 4HH9B 1T1WA 1MHEA 4FQXD 1ADQL 4HKXA 4R4ND 4HV8A 3KYOA 1EAQA 4LAJH 4QHNB 1BLIA 4EN3C 3ET9F 4IKKA 4Y5XA 1KCVL 4MAYD 1H8SA 1T6WA 1HWWA 3V4PB 4APQB 3VFNB 4X9FA 4AYID 4QXWA 1LEKA 1YCSA 3QIBB 5EWIH 3LQAL 1SY6L 4AXWB 3C6LB 4NZUL 4F8LA 3C5ZB 4C59B 2NW3A 4UTBL 2VJ0A 3II1A 1GJWA 1FL6B 3K3QA 2R1YB 2AKRA 2JIXA 1A9BB 3EJZD 3R4RA 1FBIL 5EN2B 2J6WA 2ROXA 2BNUA 4MJ5B 1RZFH 1BWMA 1S9YA 3MLUH 1HZKA 1GS7A 1W0WA 3HHSA 5L9DL 3WTXA 3ULVL 2H1PH 1FNAA 3ARZA 2DLFH 1WISA 3DTXB 3FHAA 2OMXA 5DVNA 2JKTM 2AANA 5MENE 3LEXB 3QQDB 1RZPA 2ROYA 5DHXB 4UT9A 4U0RC 3AS3A 1F4YH 3APCA 1GIGL 3GXPA 3OKOB 4TNFA 4G43B 1VFAB 1T03H 1D9KC 4W6WB 3UPRA 3Q8AA 1H5BB 2BO0A 4HXBL 4E9SA 2FJFA 1A9VA 2GFBA 2O26U 5D7KE 2EJ1A 1HL4A 2VXQH 3MRRB 2WBJA 4J3VA 3T8XB 3GWJA 1JUFA 3OKLB 4CDHA 1PLGH 3RQ3A 4ZD3H 3T9WA 4JM4H 4ZTOH 3CFIC 3B2PA 4S0HA 3KWXA 3WFEL 1WZLA 1AGDA 1H6EA 2R29H 1IAIH 3MRBB 4M1DL 2G9HB 3I50H 4HLEA 5F3BA 3MRQA 3SKNB 2ZJSH 1M6OA 3KPSA 3OQRA 4I8DA 5C0DA 4NENA 5HY9A 1KUMA 5AKSA 1CE1H 3DSNB 4OQ1A 4P5KB 2CUHA 1AGFA 1OT1A 3D69A 4WWID 3F5WA 3I9GL 5CN1A 1HL8A 1MG2C 3FU3A 3SGJC 1EWHA 3FT2B 4PJDA 4E9TA 4OGAC 2IDSA 1N3NB 3JT0A 4KK9C 3ZL4L 3DIVA 5I1JL 1FP5A 1P0SE 2O5NA 3U0WL 4KMQA 4KDVA 2X3CA 4LSVL 2H4EA 4XOCA 3EOBA 1OB1B 5ISZE 1ZSHA 2CO7B 5JXED 1T21B 3QXTA 4Z76A 4M02A 4R7VA 1PEWA 5AOKA 3ETSA 1U8KA 2C5DC 2XN9A 5F96H 1BJMA 1GC1H 3D05A 1CLZL 4AX3A 2ZOLB 1FVDB 4YSOA 5BVJB 4N0YL 4JG0L 2YD9A 2AQ2A 3Q8BA 3NEOA 1PNDA 4OB5H 1AHWC 1JRHI 1P5UB 2VXSL 4Y1AE 3U4KA 5DQ9B 3N3EA 2AQNA 2E5EA 5BVPH 3LHPH 1S3KL 4JS7A 3NRFA 1SNRA 3GRWH 2Z1KA 1JPTL 3TYFB 1YN6A 2Q0ZX 2FX9L 1EVTC 1MAMH 4EBQH 4NLAA 4XVJH 3BD3A 1T22B 3WLBB 3BPCB 4AEIH 4B9PA 4X6FA 1MIMH 1H3TA 1NGYB 3NIFB 4W70A 5AEAA 1HEZB 4HZ1A 3SDXF 3EJJX 4M43H 2Z31C 4U6HB 5FW7A 5IJVB 5KOMC 4U1HA 4JVWA 1X7QA 4JM2F 3J8F7 1HFUA 4Y19B 4PLKD 1JFQH 2FT6A 2VERN 2A83B 1PLBA 2F5BL 3JQOB 4A7GF 2NDGA 3QR0A 1CFVL 4XPBH 3DVGA 3NFPB 1SYSB 3Q05A 1GPOH 4GMTH 1KYUA 1CQYA 3A0OA 2EH7L 3TJEL 5EC2A 2BSTB 4Z7QF 4WK2B 1E5AA 2GUOB 1F3JA 4P5RA 5I73B 4E9WA 4J3OD 4PR5A 5DO2D 1NCBH 2DV6A 1OTSC 4HJ1A 5EUOA 4ZT1A 3S96B 4W9IC 3FHQA 3P11L 1BXUA 1U95A 1UASA 3EFFA 3L1OH 3MJ9A 1NMBL 2VZUA 5LGHH 4LPXA 2ZF8A 3NDYE 4RDQG 3BISA 3T4AC 5CBAA 4RESB 4NLHA 2A77H 5JW4R 4GH7B 3HI5H 4WV1B 1KCKA 5DVMA 4ELKA 5A2IH 1JK8B 4NC1C 3R4DA 3HG3A 4IU2A 3DVNB 3F01A 2CR0A 4NZRH 2WMPB 5CS7A 4J1UA 4N8CH 4S0SD 3ARBD 3D39B 2C3HA 2FYYB 3CZFB 4V1DB 5FXCH 1E4XH 4Y9EA 2E7LC 1NEZA 5CILL 5AOJA 3KPRA 2X1QA 1QSFA 4PU2A 1FZMB 2A73A 4XWOC 5L8KB 1DUYA 2ZAIA 1EDYA 5GJTH 2YS4A 1J12A 4IKLA 4R8WH 4KMTL 2DQTH 2ZX7A 1USQA 1ZKAA 3V0IA 2VZSA 4BFGA 2XOTA 3BPNB 2Z92B 1F2XK 2E74C 3C60D 3H9SD 5EO1B 1CE6B 1Z3GH 4RMSA 1IBBA 1FL3A 5CZXD 4AY0A 4HPYH 5BS0E 1N59A 5DD6B 1DN0A 3AITA 2CCVA 2ZXEB 1BPLB 1GZPB 2H26A 4WTQA 4X6DB 3WEXB 1ZVHA 5LN4A 4XBPA 5EIIB 3IETB 5DK0A 3TP4A 4A2MA 1P9MC 4GUCA 4JKLA 5IJBC 1RIVL 2E6QA 4KRMB 4PJEB 5SV3A 5DEFB 2UZIL 3HB3C 4KRLB 4OD3H 5DK2B 1JPGB 3THMH 1TQCB 1F3DJ 4WEUD 2MPAL 5D7LA 3TCLB 2C9VA 2YXFA 1F5WA 2E7MA 3QUZD 4JFQB 4QLRA 3VFGL 5EEXA 2AZAA 4J3SA 1N68A 1UA3A 1NUGA 5ANME 5BOJA 4TUUA 3QFJE 4DP7X 5CEZH 1M42A 4HOXA 4QOKA 4O02H 3PJSA 1JZEA 5IY5B 2IDCA 3MUGB 1PAZA 4UQ3B 5FGRA 2YEQA 3QP3A 4R26L 3P73B 4G42A 3SDDB 2BH0A 2OZ4A 4XCYA 4NQSA 3EAKA 4DIXA 3VAEA 4XC1L 1I82A 2FB4L 5JQHC 1EAPA 4J8RB 2CCWA 2P5WA 3NUKA 1IRAY 2G0KA 3CIAA 4PJGB 1BX2B 1GGTA 4I2XE 3VI4B 1BEYH 4MNQA 4YS4A 1OANA 1YEFH 2IH1A 2Q8AL 1S7SB 1NIAA 3FU0A 3RX8A 2QR0B 1J11A 1QG3A 2RGSA 3H9YA 5AAMA 1F4XH 4PRBB 2R2BA 1LO2H 1T2QH 3B2XA</