3PNWB

Crystal structure of the tudor domain of human tdrd3 in complex with an anti-tdrd3 fab
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
225
structure length
225
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFNLSSSYMHWVRQAPGKGLEWVASISSSYGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARTVRGSKKPYFSGWAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/immune system
molecule keywords FAB light chain
publication title CDR-H3 Diversity Is Not Required for Antigen Recognition by Synthetic Antibodies.
pubmed doi rcsb
source organism Homo sapiens, synthetic construct
total genus 49
structure length 225
sequence length 225
chains with identical sequence E, H, K, N, Q, T, W
ec nomenclature
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pnwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pnwB01
2NXZC 4NSKB 2GEEA 2H32A 2E7LC 1D5XB 1N4XH 2ENSA 2DF3A 5IIEB 1UJ3C 2QJDA 2D7TL 4ZDHA 1QNZL 1A3LL 2DQCH 1IAOB 3FB7B 3Q3GA 4NQCE 1UJTA 4LOUC 3FOMA 4P2OC 4OZFA 1RK0B 4MHHG 3VFOA 2PO6A 3I50H 2Y1VA 2WLYA 2W38A 2B7DT 3QDHA 5IQ7L 1A6ZA 3RWJB 3RL1A 1Q0XL 5EC1B 4JFPB 3D85B 5CBEA 5GS1B 1UA6L 2XPGB 2MHAA 4FQHB 4MX7B 3RNKB 1BVLB 1IAIH 1R5WB 5AG9A 5CWSB 3WXVL 1QP1A 5D7LB 4I0PA 1CBVL 1IC7L 4XP1H 1FO0B 2IBGA 4JKWA 5DMIL 4GKSB 4K7PY 1WCBA 4DQOH 1A1OA 2IWGA 4Z0XB 3KR3H 4NFDA 4DKEH 3PDGA 5KG9B 2XZZA 3KDMA 3SDCD 2BNQD 2G5RA 1FFNA 2NY2B 2XWBB 4YXKH 2HJFB 5TE6L 4JFOA 4KK5C 5BRZD 3BMWA 4J6RH 3PDDA 5LBSH 1J0HA 3T4YA 4NT6A 2BFVH 4NQVB 1N6UA 1HKLH 3EYSL 5HYSG 4KJQC 3NCFB 1ZA6A 4NO0D 1A3QA 4BQ8A 4XPGL 4XCYB 4GRWF 3TH4T 5D7LE 1FE8L 3MROA 5E56A 3P77A 4J8RB 1WWCA 3RGVA 3SGDH 3PIQB 4HFUL 4ONFL 5T1MB 4KKLC 1MRCL 3V0AC 2YWZA 4K3JH 1I9EA 3V95A 2R56H 1ADQH 3L7EB 3B9KD 5D6CB 1NSNL 4XVTL 1CQKA 2VLLB 3DUHA 4I3SL 4JM4H 1A9EA 5SX4H 3U36B 2MPAH 3W2DH 4NRZA 1GIGL 1ZLWK 3M45A 4R8WL 3VH8B 4IJ3C 5JPMB 2AKRB 1MCNA 1TLKA 1UT9A 5GGRB 2C3XA 1FQ9C 3OHXB 3CMGA 2GJ6D 1WZ1H 2YA0A 5ID1A 2NW2B 5LQBL 1H3WM 4F33A 5HY9A 3O6FC 5JXEC 3HZVA 3S7GA 3OAZK 4ORZC 4ONGH 4AEIL 1ETZA 1L9NA 3WEXA 3TIDB 4Q6IC 4GAYA 1I1AD 1J8KA 2EH7H 4QT5B 1CGVA 1N64H 1ITBB 5KAQF 5A2LH 4RFEA 4JLRA 2RB8A 1I8IA 4IIQB 3ARGB 4OCWL 4LCCA 2Q86A 1YYLL 1H8OA 4G8GB 3K4ZA 3FFCA 1UZ8A 5BVPH 2VZOA 2PXYB 3SQOH 1MNUL 4PPTA 4WUUA 5I2IB 4JM2D 1F4WH 3MLRL 4UOJA 5HVFB 4YGVB 2K7PA 1MCEA 3NN8B 1WGOA 4X98B 5DWUL 1XF5A 3V6BR 1T66C 3D0LB 1S7SB 3RTQA 3LN5B 2ICEB 2AABL 4XNMB 3T77B 2Y25A 3FONA 4LCIH 5BS0D 1MFEL 3AB0C 3FN3A 4K7PH 1NC4A 5F7KC 3BZDA 1PZ5B 3MV8B 1Q72H 1LP9A 3WHE1 5KZCB 3P9MB 2BRQA 4G8GE 4X7DC 5ECJE 3O2DL 5MEPB 2DM2A 3T0BA 5IQ9A 1ES0B 3QFDA 2I25N 4KHTH 1CVSC 4ZFFB 1G9NC 2KUTA 3P0YH 2DKMA 1FIEA 2OI9B 4ETQA 4Y4KC 3FCTA 2AJUH 3FRUA 1A21A 4LLWA 2HT2C 1IGTA 4Q9BA 1GVIA 5JW5A 2NY1B 3QIBA 5C0AD 1FH5L 5KVEH 5ID0A 4HXBL 1JFQH 3MJ6A 5EC2B 4GRLA 3TO2A 1MUJA 3ZYIA 3OAUH 4GT7A 3L1OL 5IVZA 5AUMA 1OLZA 5DZOA 2E7MA 3MJ9H 1RZ8B 3C9NA 3RUGF 3C6LD 3T2PA 3MV8E 2HTLC 3LZFL 4ZTPL 3HNVL 5E2UL 1T5WB 4Y5YC 1HSBB 1T1YB 3GSOA 1W8OA 2DM3A 4DN4L 5I1GL 5HDBE 5HHPA 4XC3L 5JLZB 3ETBF 1VENA 4K07A 3RVXD 4HUMB 1R3HA 2GYSA 4LAQL 2V9QA 3CPLA 1NGYA 1FZJB 5IB1B 1JF1B 2IBZY 4KTEL 3G04B 1EX0A 3QXAB 1FP5A 3WD5H 4HCRL 4XAWH 3ARED 4RBPK 3U79A 1Z9OA 4PB0L 3PF2A 4MSWB 4GKZB 3SKJH 1B88A 5E6IA 1NANI 2EDXA 2L0DA 3LQMA 4IOFC 4AEHH 4M62L 2W0LA 3GSNB 2NX5A 4PP1C 4DEPB 5GGVY 3OR7B 1NDMB 1KNOA 3CFKA 1D5ZA 1YPZB 1CDHA 2AP2A 4RRPA 4FNLH 3RKPA 1DDHA 1ADQA 3DPBA 1KJ2H 3G6JB 1IT9L 4PGBB 3TN0C 4RNRB 4LQ1A 5HYFA 2VABA 4TTDC 3EO1B 1MCPL 3ZKMC 1R3LA 4D3CL 3HC3L 2DWEB 5C71A 3UX9B 3TEUA 4ODTL 3LPFA 1RJCA 4MNQB 1EJOH 5F1NA 2YRPA 1MIMH 4LSSL 5C7XH 5EU7C 4X99A 1OLLA 4PGDB 2VE6A 4IBLT 4PJ8C 4WY7H 1GAFH 1F6LL 1ZGLA 3HCVB 3HI5L 4M43H 1OP5K 2QSCL 3B8SA 4E41D 3IDIB 1YPZE 1WTGT 2X40A 3SJVA 2IMMA 3X17A 2ZKHL 5I30H 3LEXB 3HMXL 1D9KB 2ADIA 2J8HA 2XTJD 2VJXA 3G6JE 4UQ3A 2HLAA 1M71A 5ISZA 1G9NL 3KJ6H 3IKKA 2Q76B 3G5XA 2YD2A 4LCWE 5EUKB 4EN3B 4OD1H 5LAXB 3VD7A 4GUPA 2X4OB 2H2PC 3NFNB 1ORQB 5CMAA 1TZHA 1VEOA 4V2CB 3LN4A 3Q5TA 2P8MA 1YC7A 1LEGB 3CC5B 4JCLA 5IKCB 4D0CA 1LE9A 4I9WD 3GMRB 4OIIH 3N1GC 3C60C 2AEPH 5DJ6A 3VGEA 3RL2A 3V6OE 5SX5H 3W39A 5AAWA 4Y4HB 3DBXB 4HKZB 2GTWA 4PY8J 5DMJB 5D7IA 3TA3D 3S37H 1CLZH 4OTXH 2PW1A 3RVUC 1FVDB 3VXRD 3DI3B 4K7FA 4HWUA 2R1WA 1G7MA 4KI5F 1ZE3C 4JHWL 5EBWA 1LILA 4TSBH 1ZAGA 2H6PA 5DQDL 2B1HL 4YPGB 1CFSB 5I1AB 3HLAA 4HQQL 5E2TL 1LNUA 1EJ6A 1WSST 4TRPH 1IGCH 1V3JA 3ARBB 2FJGB 5K9OA 2CQVA 4BSVA 3DRTB 4PJFA 3BKML 2AJ3A 4QY8B 1CLCA 1IFHH 2V7HB 3MBXL 5FGBC 5T3ZE 1U91B 3G08A 4PREA 4RQQB 5IJVA 4XVSL 4KMQA 2XQBL 5KS9A 5I1JL 4MMZC 5KW9L 1TPXC 4PV9B 1LEKA 2VLKB 4P4KC 4BZ1H 4WGVB 3SE3C 3G5YB 1IC4H 1I7UA 3FO2B 2IAMB 4HWZB 3EIFA 5IMKA 4RGMC 3BKCL 5D1XA 4UIKH 4X8XA 5E7FA 3HZMA 5FHBH 5GGVH 3DVNA 3MJ9A 1KYOK 5EU3B 4QXGH 4LPTA 1T2JA 3HRZA 2UVEA 3TYGH 1YN7A 5F8RC 4K71C 4WHYH 1LDSA 3DETD 3QCTH 4I8DA 1V8HA 2BCKA 3KPRD 4DVRH 3ILPB 1BJMA 5DRWA 3TO4D 4ZUUB 4LHUG 3E3QE 1EEUA 4MA8L 5C8JA 3LRSA 2LQRA 5DQ9B 2H2SD 1Z3GL 4JHZA 1IM9B 5DJ0B 3QCUL 4U1JA 3IFLH 1DQMH 4RAHA 5GS0C 2PTTA 1J05A 4OZHF 1H0DA 1MFAL 1VGEL 2OYPA 1KJ2A 3TBSA 4U49A 1J8HA 3NZHH 3SE4A 3GMLA 4YDIH 3N9GL 5F9WB 1ZT4A 3ALPA 3OKKB 1QFOA 1U58B 1GC1H 4Z7WB 1D6VH 2E8ZA 1A6PA 3CMOL 2GKIA 3SDDD 1B90A 1RVFH 4XB8A 5FCUH 4YWGH 3X11B 2O5YH 3IGAA 1S3KH 3OJMB 1MH5A 4WHYG 4ZAKA 1OWWA 3GHBL 2OXGA 1FAKT 4X0KA 3X3FH 4PJDB 3LQAH 3RWIB 2RJMA 4OF3A 1RIUL 2OQJA 1RZJL 2F19H 2DI9A 3EDFA 4NUJB 4UUJB 5E5MB 3BD3A 1RURL 3P9LA 2VQ1A 1XEDA 1P4IL 3OR6A 3LMJL 3I75B 1J18A 1SM3L 2BY0A 1KJ3L 1N0XL 5JUEL 2CK0H 2AQ3A 5EN2B 3STLA 1G9MC 1S78C 3FO0L 3S5LA 5HJ3B 4Z7WE 4LSVL 5EO9B 1L4IA 4Y7MA 3V5DB 5DC9B 3PDOB 4MLIA 2EDTA 4EOWL 1CZ8H 1ZHLA 5ADOL 1OAXH 3BWAA 2AEIT 3FN0H 1WBZA 4HIJA 2DQFB 3GO1L 3NGBB 3UTTA 2YA2A 4OSUH 4PJDE 3VGDA 1A6WL 4MA7H 1NC2B 4PUBL 4HIIA 3T04D 5HPOA 4RCAA 5EOTA 1A4KA 3QR2A 3RVTC 3U2SA 1U8QB 5DSCA 2VZ3A 1RMFH 4JFEB 4WFED 1IGJA 3T4AA 1A6AA 1V7ML 3L95A 5GRJH 3WJLC 4E5XA 1ZT7B 4PGCB 1AGEB 2I60H 5FKPB 3CVIH 1JPFA 4X80L 3DUUA 1ORSB 5ADPH 2WLZA 3GI8L 3K1DA 4LDEB 5T3XE 2UV3A 1WWWX 5BOPA 3RZCD 5J6GA 3LDBB 2YN5A 3PJSB 1NMAH 1U8LA 4ISVA 3A67H 5D93C 5HI4D 2JE8A 4FQ2H 4GFTB 4HS8H 1BLNB 4ZUVA 2WINA 3LEVL 2YEZB 4FQCH 4O2CA 4JFEE 4KI5C 3CVHL 3P4MB 1BAFH 3OPZL 2DJUA 1MFDL 1U8HA 1G0DA 4MHHI 3QCVL 5E8NA 3RWDB 3TT1L 3DUSA 1DBJH 5ITFA 4IMLB 1B4RA 1SYVB 2R9HD 3FO1A 4NN5C 1FNFA 2NY4B 3S6CA 1CICD 4XP4L 2D03H 3QFJD 4U6VL 1AKJD 3ZDZF 1NKOA 1NCUA 2FCBA 1YEFL 3PWPA 4LKCA 1WLHA 1SBSL 4U6XB 1VPOH 2OZ4A 4HJ0C 2VIRA 5D7SH 3IVKA 1WWAX 5H35B 1LO4L 2FB4L 3GBLA 2UY6A 2Q8BH 2XTLA 1MCWM 3ROLA 1NCWL 2DB8A 4X7SL 2J4WL 1DVFC 5JNYA 4CJ0A 1G9ML 1VERA 4G6KL 1FL3B 4PB9L 1AGDB 1AJ7L 4P59H 1UQSA 1BX2A 4NO5B 5DZLA 1F11B 5J6HB 4Y16B 3B5TA 2X4SA 4R97B 3MRFA 2G2RB 3ZKNC 4YHNA 1RJZB 4F2MB 4UILL 3WN5B 1NCAH 4PJ5B 2ZCKH 1W0WB 4N5UA 5HGHB 2MNUA 2P7TA 4JRYD 4NZJA 3ULVH 2ILLA 3MNZB 3GSXB 3JV6A 4NDMA 1G1YA 4X9HA 4PJEA 3IDYC 3ARFC 1CLYL 1GGYA 3GGWB 2JELH 2NY5H 4S10A 2FBJH 2NPLX 4CMMA 4M6OL 1Q9LA 5C0CE 4G6AC 3LVEA 3ZDXE 3KPNB 5MERA 1KCUH 4R0LA 2YK1H 5E4IA 2Q1EA 1YEHL 4OFYD 3REVA 2ZPKH 2V2TA 3PWNB 4O00A 1NCNA 3K3QA 4PJ5E 3O6MH 1U8NA 1IEBB 5EO0A 1X5FA 5ACZA 4YE4H 4OJFL 4LSPL 5CINH 3GKZA 4L4VD 3WCYA 1E4WL 3MXWH 2DDQH 3CZFB 2BSED 2AXJA 4OUOA 1Z9LA 2DBLH 4GAJL 4JKMA 5F7EH 3ARPA 1CXLA 1NGPH 3S8WA 1JWUB 3CCHA 4Y2DA 5TH2B 4OCMC 4P2OD 3NTCH 4Z7QF 5BXFA 4KZEL 5A1AA 3EYVA 1SJXA 3V5HB 5FGCB 2D0GA 3D1MC 5IHUH 4IRSA 3MRNB 5L0QC 4PRID 2VDOL 2CLRB 1LO0L 2A6JA 1FBIL 3V9FA 4NKIL 1CDJA 2VXTH 2Z8WC 3VCLB 3VWJC 3MRMB 1EVUA 5F9OL 1MJUL 2P49B 3F65A 4KRMB 1UG9A 3SCMB 4HUWB 2E3VA 4OAWB 4LHJB 3E6FA 4JPIB 2R39A 3QNZA 4OQTL 5FYLL 1RZFH 2B2XH 3WHXA 1U95B 4A6YB 5EZJB 3EGSB 4JZOA 2NXYB 4HWNA 1I7RA 4PJIE 3FAXA 3PP4H 4BKLA 1IAIM 2ARWA 2KKQA 3T0EC 4KK5D 3H8NA 2YSSA 1I3GH 1BFTA 4G9FA 5JW4N 1AGBA 4PJHB 1ZTXL 3IKCA 5FGCE 4WIQA 1QFHA 3O45A 3QHZL 4LDOB 4KJQD 1V3MA 3EDKA 2D7PA 2WIMA 1RIVH 4FABH 2GSIA 5AG8A 1CXEA 4XPBH 5FF6A 4UNTA 1AD9B 3O41B 4N1EA 1NCBL 1NCCL 2JB5H 3RVVD 3TT3L 4K8RC 3VI4E 2KH2B 1P7HL 4RGNC 4GKNB 4YXHL 3QDGD 2Q8AL 3SDXA 2ZG3A 4KKLD 1F8TH 4EDXB 2XY2A 3O2VH 2CPCA 4FQ1L 4AENA 2VWEC 2F5AL 2O26U 3EOTL 2EDFA 3MRKB 5ETUA 5HYEA 2VO5A 1G6RB 5IESL 1J11A 4YXLL 1YJDC 3M17A 1OGAD 1WTLA 2VSDA 2VLRD 4FP8H 4PJHE 4OV5A 4LPUA 1O7SA 4JPWL 3SOBL 1XR9B 3SGEH 1LD9B 4P3WA 1LVEA 2CD0A 2AXGA 2IC2A 3FKUS 5CZVL 5ICZB 1Q9WB 2JJTC 2RFXB 2SEBA 4ZOEA 5C6WH 1MLBB 3SDCB 4HH9A 2BNQB 4KRNA 2ZWLT 3O6FD 1JK8B 1I8LA 5BRZB 1JGVH 2OMBA 4M6ML 3BQUA 5GGUB 2QADC 3RWFB 2VXUH 2YN3A 2FGWH 1AQDB 4K3DH 1C08A 1XGRA 1T89A 3U30B 2BVPB 5C07D 4NO0B 2EDOA 4DVBA 3BUYA 5LVEA 3B5HA 1ZKAA 3VRLE 1QEWA 3VDCA 5IG7B 5E5RB 5I66A 1RZ7L 4OLXL 4Z77B 2I9LA 5D96B 5HGDB 2HFGL 2YUVA 4H0IA 3VFUA 1NLDH 4R26L 3B6SB 3LD8C 4NZRL 4ELMB 4H0HB 4KK8C 2CO7B 3NCYP 3B9KB 3GMOB 2BNQE 3GB7A 5BZDA 1A7OL 1YYMH 4ZUSB 4TNVF 3BKYL 2XA3A 1A7NL 5BRZE 4IRJA 3NCJH 2O5ZL 1HZHH 1OCWH 1T66D 1RUMH 5KSAC 4Q2ZB 2WP3O 4K55A 3WDIA 2J3SA 5I1IH 1HHKA 4JFQB 5FYKL 3G6AB 4N0CC 5DQJA 1K85A 4JRXA 3EDDA 5L8KB 1NBQA 1HH6B 2CLZA 2OL3B 3EO0A 5KSBB 4QLRA 4ORGB 2VN4A 1FORH 4XNUH 1H3GA 3WIFB 1BIIA 4JY6B 5F7WC 4KC3B 4OLWL 3SEPA 2IG2H 4LARH 3ZE0F 3NCEB 1S7QA 2HVJA 4PJGF 1PGRB 3BP5B 3PGCB 4I77H 4Y8AA 2OJZL 1YA5A 3X14A 4U1IA 1UM6H 4Y4KD 4ODXA 1KB9J 2HT2D 1OARH 1UYWH 5EIIA 1I1AB 2QHLA 1PDKA 2AEQH 3F5WB 4FXKA 3QUYD 1G7QB 4UINH 3CFBB 5DYOA 4X6DF 4P48A 2LE9A 3D0VA 1QFWL 3HA0A 3LIZL 4U1GC 3MGTB 4N9GA 1Z0NA 1BD2D 1HHJA 1MRFH 2XA8H 4JM2B 4KGLA 4NM8H 4NRXB 2GJ6E 4YHMH 3U7YH 5GISH 5TQ0H 3OKLA 4OV6F 4YHYB 1KF9B 1VGKA 2FH8A 2UZXB 4F15C 3D18B 3WDJA 1I4FA 3ZDYE 4EDWH 1S5IL 2AW2A 3VDAA 4AH2B 5H94B 3GK8H 4X83A 5C1MB 1I9RH 5BS0B 5E8PA 3DV6B 4NC1E 3QUZA 4IOFD 1FRGH 2ZUQC 5SWZD 3SE9L 5TDNB 1EMTH 5ESVA 4I2XA 1C7SA 3GUTB 1VFOA 3OTTA 4K94C 2C4FT 1OQXA 3OKOA 4JDZB 5CEYB 4EKXA 5FKAA 2GSGA 3MO1B 2ZNWA 1SY6L 1ND0B 3QHTC 3TN0D 3IT8D 2OMNA 4FFYL 1T1XA 3KLAB 5T5FH 4TTDD 3LY6A 4KK6C 3SHSA 3QYCA 4UT6H 4ZO8A 2JKXA 2OX5A 1TZGH 3L3GA 4J3OC 4HMEA 1L7TH 1QACA 2HYMA 4FZEH 5C0AB 4CVWA 5DLMH 4APQC 1W72B 2X4RA 4NC2B 4X6EB 1UM4L 3LS5L 4XHJC 4PJ8D 1HYRC 1JUFB 5EBMA 1MFCH 4FFWC 4UAOC 4Z7UF 3C6LB 2X89D 4LP5A 4ZO6A 5BJTB 2HWZH 4HG4J 3VJ6A 1K6QH 5ICXB 5JO5B 3IDGA 4NJAL 5I8EA 1KT2B 2ZJSL 4G9DB 5TDPB 4NQXA 5CLTA 2DKUA 4OD2A 1EO5A 4WENB 5JHDA 2LVEA 3AREB 4NQSB 1CFVH 1JE6A 3PL6A 3C8HA 3BEWB 3KJ4C 2H2PD 4GW5A 1OB1B 3ZYZA 3QQ3A 4HUVB 1A3RL 5C0AE 1I9JH 1FDLL 2NTFB 1ZLUK 5GSRB 4YBLC 1X6NA 5CAYB 1JTTA 1OPGH 5DUPH 4YUEH 1HNGA 2R0WL 4DZBB 4ZFGH 3C60D 1K9TA 2ADGB 3BAEL 4NFBA 1KBGH 2NR6C 3CDFA 4HAFA 3CXDH 4UOW0 4XWOC 1LK3H 4TOYL 3V6ZA 5GGQL 3RVUD 4V1DD 2HMIC 1EO8H 5E2JA 2UUDH 1Z5LB 3VW3H 5I8OL 3BYYA 1SVCP 5I1KH 3TIEA 3MYJB 3I6KB 3N50A 2BX5A 4XMKL 3MR9B 1UFUA 1FZOB 2ARJA 2YPLA 5D1ZD 1PG7W 3VXSD 4QCIB 1T2QL 4G42A 3ME0A 1S9YA 5IMOB 2X70A 1UWXH 1N5AB 4E41B 1WEJL 4K94L 5IW1B 1UM5H 5MEOA 5I15H 5IBUG 2B39A 3WIHH 2XTJB 5I0DA 3MCKB 5D5MA 4UDTA 3VXOA 1A1NB 2JCCA 3LKNA 4PJFF 4MDIB 4KKAC 4J3SA 3WSQL 1IARB 5DZNA 4R3SA 2C7UB 1UCTA 1V3LA 1KYOJ 4M61A 2LFGA 2Y7QB 1HHGB 4YFLI 1X5JA 4YQXL 2AQ1A 3HAEG 5FM8A 5B38A 5TGBA 1NJ9A 3QRGL 3VWKA 5C0JA 1H3UA 4XPFH 4U1LA 3CX5K 1NBVL 5I71B 4UNUA 1P7KB 4GSDH 2OSLB 4LF3A 5JMRA 4J1UA 2ZCLH 1CE1L 4LLAA 1FL5B 1NEZB 4ZXBA 4E41E 4YEFA 3B83A 2Y06H 1MREL 3TA3B 1M6OB 3WUWG 4QHNB 4Z7VA 1JGLL 2LABA 4U6YB 3RZWA 2XTJE 3ZTNL 3VFTB 1T7ZA 2V17H 1N7ML 3ZTJG 4GG6B 1AXSA 3FHAA 1LE5B 3VFSA 5BO1L 5T1LA 3G6DH 2V2WB 2IAND 3AS0A 4BSWA 3EOAB 5I6XB 3RWHB 5B8CC 2CJUL 1MCBA 1S9WA 1QR1A 2OTWA 1YMMD 2CDEA 3PWJA 3R06A 1C12A 1MHEA 5JR1L 2VXSL 1FVEA 4I9WE 2WWMC 4XNYL 2FJFB 1B3JA 1QLFB 1KLGB 5MEND 4IDJH 2YHGA 5IGXH 3IETB 4YHIB 1EUUA 5EOQL 5DJZB 3PUCA 1WUNT 1Q9KA 3TESA 1DUZA 1KENH 3VXRE 2LAAA 3T1FA 4JDVA 1SBBA 1T0NB 4JZJB 3GMQB 1RK1A 3QG6B 1MHCB 4GG6E 5C9JA 3C5ZA 1KN2H 4PIRF 5FOBB 4Y4FC 1DBBH 3EKCA 4TVPH 4D0DB 2X1QA 1U2HA 3QPQC 4ZUWA 3IAGC 1AP2A 4HS3B 1KTKE 5BW7C 5IVXA 1JRHL 4RISL 4M5ZH 1TIUA 2FEDC 4YO0A 3O6KL 2Y07H 2OP4H 4S1QH 3F12B 4ZMAT 1QSEA 3KPRB 4EUPB 3MBEC 3TO4B 4S1RL 1Q9OB 1S78D 4TSCH 5DGRA 5C0DB 3HUJA 3FQUA 3MGAA 2GAZA 1OWRM 3P4LA 3R8BB 2VAJA 2QL1A 4B0MM 5E2WL 4QHUA 3V5KA 4MA3B 5EG6C 3VFMB 4P0DA 3BIBX 5IBLC 2R1XA 5D70H 1HINL 4I18B 3CFCH 3C6SA 2BY1A 3QO0A 1N4XL 3UJJH 3TVMA 3MRCB 2BNUA 3IF1B 5IB5B 3RVTD 1CFNA 1HQRB 1TCRA 4Z78A 3TBVA 4POUB 1INQA 1GH7A 3SDDB 5ITBH 2DQCL 2YMXL 3KPRE 5FO7A 5F3BA 3U0WH 1WAAE 3HE7A 4HUUA 4XGZA 2XNAA 1T1WB 3L9RA 4Y5XA 3GHEH 2F8XC 4NQDA 5SWSB 3MRJB 5EBLA 3F58L 4F58H 3I50L 4LLVA 2D4DA 4PJ7A 4ONOA 3OF6D 2EIDA 2HJLA 3QJFB 5CIPH 2A9MH 4WFGD 5CSBA 5KN5A 1IAIL 3WIHA 5HVHB 4XP1L 3VA6A 5CZKA 3T08A 5JIKA 3A6CH 5BV7H 1KIRB 2EXWC 1MFBH 4DQOL 1JNHA 1YEKL 3KR3L 4KK9C 1NUDA 4S1SL 3KWWB 5M7QA 3QDJA 4OZGA 4GO6B 4KI5D 4JQXC 3I6LD 5KSVB 4LVOB 4GBXD 5DD5L 5HHXH 1FNAA 1RSFA 4NZUH 4MQXC 1UKQA 1T5XB 2CUHA 2UZIH 4J6RL 3MJ7B 3V7AG 5GGRY 4O2FA 3D48R 4MB3A 1H9VA 3OXRA 4CVZA 5IFJB 3C5SB 3V52H 1HKLL 3MCLH 3RY5A 3E6HB 4NFCA 4Z76B 2BHUA 2Z9TA 4Y5VA 5I8CB 5DA0B 4NCC1 3BZ4A 5DMKB 1BOGA 2I9TA 1IM3B 5HYQB 1H5BA 2AJYL 1WFOA 2DMBA 4KI1A 2ICCA 2FYYA 1R6VA 2C3WA 4F37F 1DVFD 5FYLD 4K3JL 3E0GA 4NIKB 2R56L 1ADQL 2OK0H 2NW3A 4Y88A 4JM4L 3NFSH 2QHRH 3RJQB 2O61A 3ARUA 5BQ7B 3W2DL 4HUKB 3RZCB 3M1BA 3AY4A 1FFOA 3TBWB 2FSEA 2EIZB 4P5TA 4NNPH 1ZS8A 3MRDB 5B22A 2ED8A 1WBYB 1GGUA 3C5JA 4PGEB 1MVFA 1R3KA 5CEZL 1NGZA 3PWVB 3NPSB 4JVUA 3BD5A 4PLKC 3D39A 5TFSH 5FK9B 4HSQA 1WZ1L 4WFEE 4HWEH 2X4TB 4O5LL 4DJMA 4YFLF 5IMLB 3CDYA 2J6EH 1KPRB 1FO0H 5MEQB 1DSFH 2X9YA 2Z31C 3ARFD 4OCNC 1QBMH 3EHBC 1X4YA 1IAMA 5F96H 3KPLB 2QQQA 4G6AD 5F6HJ 5HHNA 3CFJA 1T3FB 4NYLB 1CICB 3QFJB 2VQUA 3TNMA 3B2VH 1GGBH 5FV2A 1N64L 3WYRA 3PP3K 3RI5F 1TNMA 1K8DA 3X13B 3NOIA 3VXMA 4BM7A 2CH8A 4G7VH 4ZFZB 1E4XI 2NY2C 3QQNA 4PJXA 3MRIA 4LGSB 3SQOL 5E9DA 1F4WL 3SE4C 2AJVL 2HFFA 1W0VA 1W0YT 3BZEB 4UNVA 3HC0A 4KKBC 5J9PB 4OM1H 4EJ1C 1R3JA 4OI8A 1T1ZA 1FG2A 3JV4B 3ISWA 3QFJE 3VFGH 1JMZA 3WE6A 3CUPB 1ULVA 3MOQA 3N85H 3RDTD 3OL2A 4WUKH 3U6RA 1PAMA 3MV9A 4JRYB 3ESVF 2F9BT 3W5MA 1Q72L 1SQ2N 4PRPD 3U48A 2D7MA 2X4PA 4QXTA 4LSTL 5JIHA 4FFVC 4G8IA 5J11C 1IKNA 4KHTL 3RGHA 4GAGL 4QRQB 3OMZA 4YDKH 3P0YL 4JO3H 3SDAA 4TUKL 4F8TA 1MJ7H 5CIPA 1Z9MA 4P23A 3S97C 1B0WA 4JFDD 1TFHA 5L2KB 2IADA 2N7AA 5C0BA 4AMKH 1BVKA 4URTB 3T0ED 2DWDB 2IFGA 1BMGA 1TDQA 5KVEL 2E5EA 4P46C 3WIIL 4MNHB 4R7DA 4PP2B 1JFQL 2NXZB 1P4LB 3D69A 1S8DA 4NWUH 5FYKD 3OAUL 3FOLA 2BSTA 4OB5H 3HS0B 3MJ9L 1S7TA 4RX4D 5DJDA 2NLJA 4JRYE 4L4VB 5DUBB 3O3DB 4JG0H 5DHYA 1U92B 2DS4A 4CW1B 1UJ3B 4N0FB 2VDKL 1YN6B 1WFNA 1AC6A 4NQCA 3EFFA 1MELA 3FN9A 4RGND 4FXLA 4N8VG 3IFOA 3MUGB 1L6ZA 3SKOA 5HYJB 1TVDA 4P2OB 2LU3A 1F3RB 4JR9H 3WD5L 4XAWL 2GCYB 5T5NG 4Q7DA 3L3JA 2NCMA 3IJYA 1EFXA 4U2YA 3SKJL 1CFTA 4HGWB 1RFDH 4NSKA 2PXYC 4PRIB 1BM3L 5IEHB 1D5XA 4LCYB 4K3GA 5LWYH 2G75B 1FNEA 2A73A 5JZ7D 1YQVH 4FNLL 5DVKA 4GRMB 1NH6A 1KJ2L 2DIJA 4L4VE 3KPMA 4GJTB 3GM0A 2DLHA 2N7BA 1IAOA 1N8ZB 1X44A 3FB6B 2YR3A 4GG8B 4MWFB 3CH8A 2VLMD 1RK0A 4PRAA 4G3YH 5INCB 2XV6B 1MIML 2BC4B 2R4SL 5C7XL 3RWJA 1LO3H 2QADD 5EC1A 4JFPA 3D85A 3VGFA 5F7FA 1K5NB 1QPXA 4WY7L 2XPGA 4FQHA 3RNKA 1GAFL 5F70A 1R0AH 1R5WA 4KVCH 2VZTA 3SDYH 1JGDB 2HN7B 3VG0H 5D7LA 2J6EA 5EZLA 1FO0A 2P8LB 1YEGH 3D6GA 1JBJA 5D7JC 4Z0XA 1OW0C 4HJJL 3QDGB 3KJ6L 2OM5A 4M1DH 5KG9A 4ZG1A 2J1KA 32C2B 1WFUA 1HDMB 4BFIA 1KGCD 2HJFA 4OD1L 1NAMA 1CD1B 2ZCHL 4U33A 3D9AH 2YKLL 3GSWB 2VISB 4LNRA 3FHQA 3D87B 4NQVA 5KSAD 5L88H 2VLRB 1U8OB 1CG9A 5IT2H 4UTAL 3MA7A 3KLHD 4YIQA 4N0CD 4IJ3B 4XCYA 2AEPL 5D2LB 4ZS6C 3QIUC 1BZQK 1DZBA 12E8L 1MLCA 3T65B 3GSNH 3GNMH 1CLZL 5T1MA 3FMGH 5MI0C 3H9HB 3QDGE 3O6FB 5D6CA 2AK4D 3ULUF 3THMH 3FO9A 2XWJB 2VLLA 2Y5TB 5DJ8B 3U36A 4ODUB 1AY1H 4N8VA 1JZ6A 1MI5D 4KAQH 5EUOB 4Q6IB 4TRPL 1IGCL 1KC5L 5C07B 1OGAE 4M6NH 2VLRE 3VH8A 4KXZI 5JPMA 2AKRA 1IFHL 5I74B 1EA9C 1WFTA 3ARVA 4N0YL 1X5YA 5GGRA 3U4BH 4F9LA 4Z7NF 1HEZA 3B2UC 3BWUC 3LKOB 4LSUL 1IC4L 4M1CC 4K7PX 1ITCA 4X9BA 1F5WA 3V6OC 1S7UB 4UIKL 1D5MB 1K8IB 2ID5A 5FHBL 5GGVL 1KFAH 4Y2DC 3FT3B 1A14L 4XMPH 1BF8A 5EUOE 4DGIL 1J0JA 3FRPG 3SE8L 1K3IA 3BPCB 2PO6D 2IQ9H 2GK0A 5GRUH 2L7JA 4J3VA 3AB0B 5C07E 1JZ4A 2I5YH 4IIQA 3PWUB 3ARGA 5EOCJ 4QOKA 3TYGL 1S7VB 2X1OA 4IRSC 3CSGA 1ZEAH 4XCEA 1TTUA 1JCKA 2OZ4L 3VFWB 2W59A 4NBYB 5T3ZH 5ESQB 2A6IB 3MRLB 4XWGH 4OZIB 4YGVA 4YH6A 3HN3A 1RJLB 1CWVA 1NGXA 2DLIA 2YD5A 4X98A 4Y4KB 4KK6D 5AYUH 4G8FB 1AE6H 2QTEA 4GW1B 5CJQH 3LN5A 2X4QA 3ES6B 2ICEA 3FL7A 1SYSB 3H7LA 5J1SC 3T77A 1G0YR 2ADFH 4K9EC 3QUYB 1CL7H 5E08L 3U9UA 2E6JA 4XCNA 4RMUA 2ZUXA 1A7BA 3NZHL 4HT1H 5D8JL 4YDIL 3K2UH 1BD2B 2PW2B 1GC1L 3P9MA 4NBXB 1RJYB 5MEPA 1CFBA 4XP9H 1ES0A 1RVFL 4Y5YB 5FCUL 1XF4B 2JJWA 4YWGL 4ZFFA 3NVQA 3MRBB 2O5YL 1S3KL 4IRZL 3TFKC 1YC8A 1RIHH 3OKDB 4W6WB 2FZ3A 4MCZA 4ZS7H 3G5ZA 2DIBA 4LLMB 3NIDF 3S4SB 2F19L 3DXAA 1I7TB 2BY2A 5DK0B 5IJKA 1KXVC 3E3QC 2BSSB 5EC2A 5SWZB 1KPVA 1OSPH 1RZ8A 1Q0YH 1QFUH 1BD2E 4OGXH 1FAIH 1T1YA 5AZ2H 2C4FU 3ZDXF 3DHJA 1I9IL 3LKSB 3TN0B 3JTSA 2EIBA 1UC6A 4UI2A 1CZ8L 3OJDA 4XWOD 4ODVH 1KPUA 1P2CB 4YR6A 4UQ2B 5IB1A 1FZJA 3MRQB 2HMID 2D0FA 3FN0L 4QHKI 3G04A 4B53A 3QXAA 4M8QB 1I3UA 2VITB 4GKZA 4OSUL 3GMMA 1IC1A 4ZQKB 4YK4C 2KPNA 3QQ4A 2XKSA 4RA3A 1FPTH 3MACL 1DLHB 4GRWB 5FXCH 5K59F 3GSNA 4PJ8B 2ITDA 3OR7A 5F1KC 2F53A 2V6HA 5SWZE 1RMFL 1T89C 3ABZA 5BMFH 4JN2B 4OZ4A 3KNBB 2R0KL 1XAUA 2I60L 2ZUWA 4JPKH 4RNRA 3CVIL 2EDBA 1NFIB 3EO1A 2VDLH 3FFCD 2DWEA 5CD3B 4BK4A 3O81A 3SKNB 4MNQA 2JJSC 4OI7A 3RJDA 5D5MF 1NMAL 3O4LA 3MJ8B 4NOFA 1U2CA 2JCCF 1H3XA 1LDPL 4PGDA 4P2RA 3VMPA 5EU7E 3S37X 5JORB 4RMRA 5SX5K 3SO3B 4GRWE 4FQ2L 3HCVA 4HS8L 4FQIH 3C60B 4U7SA 4R7NB 3UTZB 4FQCL 2NY3C 4NHCH 3F6IA 1T4KB 4PJIF 1BAFL 1EHXA 1D9KA 1HHHB 2P24B 2W07A 3BSZH 3ULUC 5IVOA 4V1DB 5CJ5A 2PCPB 3O6LH 3GSRB 4HX1B 2Q76A 2LAGB 5EUKA 4EN3A 1U3ZA 5LAXA 2QEJA 3MLVH 5E95B 2PNDA 1CDYA 2D03L 2FX7H 3F7VA 5DC4B 1MWAB 4Z7VF 5T3XH 3DX9B 5D1ZB 1MPAL 3QJHB 1H3TA 3R0NA 4LEOB 1C5CL 3CC5A 5L6YL 4F8QA 4XZUA 2N1KA 4ODHH 1KV3A 5I8KH 2IBZX 2D7QA 4O02L 4S2SB 4I1NB 2WWMD 2XQYK 4NZDA 4Y4HA 3DX6B 4HKZA 4QNPE 5C09A 5BZWB 5HI5C 4JREC 4ZNEA 2AQ2A 2FATH 1RUPH 4P59L 3RHWK 1TPXB 2OR9L 1A5FL 4V1DE 2HFEB 3VXUA 3IXTB 2CMRH 1CFSA 4YPGA 5I1AA 4RGMB 3GI9L 4GS7C 5HHQA 1MF2H 4Y4FD 1NCAL 1CTNA 5CJXC 5EWIH 5GS2H 2ZCKL 2XY1A 3VXSE 4ZODA 2YS4A 4OF0A 4QY8A 1IE5A 3PV6B 2V7HA 3OJVC 1JNNH 1MCFA 1U91A 2BVEA 4K71B 4WI4A 2E9IA 2WUBH 4RQQA 1YDPB 4UIMB 5JXAH 1XGPB 2HFTA 2NX5D 1KIUA 1GL4B 3LDBC 1F3DJ 2JELL 2NY5L 3MBED 1FZKB 2FBJL 2VLKA 2XYCA 3ECBB 3HZKB 3T0VA 4BFEA 2NYYC 4LPVA 3FO2A 4HWZA 2IAMA 1DQLH 3IJSA 1G7HB 3MNVA 2IANB 4PG9B 4DWHA 3MRHB 1JHTA 2YK1L 3JZ7A 3VXQB 5GGSB 3EYUH 4KMTH 4W4OC 3HUJF 3HTLX 5IBLD 1YMMB 5DRZA 5EU3A 2RQ8A 3MA9H 3O6ML 5IEKA 5FM4A 3BH9B 3RUGB 4W68A 2IH1A 3NACL 5CEZD 4J3WA 2W9EL 3GBML 4HHAB 4M6AA 1P6FA 2A6DB 5MENB 3MXWL 1E27B 1JJUA 1TMCB 2P46B 2DDQL 1T2XA 4LCUB 5D9SB 3ILPA 1WZMA 2DBLL 3WJJA 3CVHB 2NY4C 4M9PA 5F7EL 1KB5L 1NGPL 1FLRH 3L5WB 3ULUL 5IF0A 4CNIB 1MCRA 3BGFC 4C4KT 5DQ9A 1V3KA 3SJVD 4OLZL 3NTCL 1OTTD 1IM9A 5DJ0A 1U8PB 2IANE 5FO9B 1U9KA 3WV0A 3S36H 2P47B 5F7NC 1YMME 5ELIA 3V0WH 3RUGE 1CD9B 5I1DB 2AV7A 5DEFA 4N5EC 1JPTH 1U58A 3QHFH 2EXWD 1LO5B 2F5BH 2EYTB 5MENE 1RZFL 2B2XL 2UVFA 2AJSL 3MLTB 3X11A 3BW9B 2P5WA 5HYIA 4OBSA 4U7KA 4NZTL 5K93A 3PP4L 4Y19A 3P0VH 4WI6A 5HI3C 5F89B 4PJDA 3RWIA 1P69B 1I3GL 2BSRA 3MXVH 4OZGF 3TBTA 3L3HB 2PR4H 3QEUB 4NUJA 5KVGL 2K7QA 2JIXA 1DTUA 4LIQL 1ZV5A 3F7YB 1RIVL 5CJBA 4XPBL 2YWYA 3I75A 5LXGL 4U1HA 1KCRL 1AR1C 1NAKL 4CL7A 3DGGB 2V5RA 4RSVA 5EN2A 1JWSB 5HJ3A 3SY0B 5EO9A 3BDYL 2DLTA 2EDRA 1RZKC 2GW5A 1F8TL 3PDOA 3QPXH 3BP6B 2X42A 5E00B 5B3JF 2AVGA 4N90E 4AG4H 2R2HB 2OJEB 2DQFA 1JIBA 4LLQB 3IDJB 4JY4B 1UCBH 4A2MA 1NC2A 3MOAH 4HK3J 2R4RL 1T7VA 4L5FH 2GHWB 3GMNB 4FRWA 1WISA 3IAQA 5D93B 1SEQH 3UTPD 1F4YL 1WT5C 5DJ2B 1JL8A 4JFEA 4PLKD 1ZT7A 2VDPH 2DQGH 1AGEA 5FKPA 5TE4L 4OLEA 1ACZA 1DQQB 3EBAA 1UWGH 4GBXB 1ORSA 4UDUB 6FABH 1FFQA 2Z31D 3BT2H 4YBQD 1JGVL 3IRZA 3EHBD 5L9DH 3QNYB 4WJ5A 1ZA3B 4FQXC 4NN5B 1G7JB 2VXUL 3QDAA 4NO2B 2FGWL 1RD6A 1JNLH 4JKPH 3T3MF 2IPKB 4EZMA 4WFGE 4PTTA 3LS4H 3N0PB 4MB5A 2FX9L 2FD6L 4BSJA 1BLNA 4L9LC 1OF2B 5F6IC 1H8NA 3OKYA 3CGTA 3P4MA 1DVFB 2BJMH 4PJBA 3WNNA 3MOBH 1KTDB 4U1NB 4NQEA 4KUZH 4MAUH 4KI5E 4DFHA 3I6LE 3RWDA 4PJXF 1A64A 4IMLA 5IR1B 3PV7A 4KKBD 5DO2C 1HZHL 1OCWL 5I1IL 2LV4A 2DAVA 4H1LB 3KS0J 4ZAKD 3SGJC 3U0PA 1I75A 2VZSA 3WMSA 3UC0H 3ARDC 3W9DB 4L4TA 5H35A 1BQHA 2W1NA 1JPST 1MQKL 2ZOKB 5DJYA 4JFFD 4FFVD 3NPZB 2BP3A 2BERA 4GXUM 3CH1A 3NH7H 4EXPX 3IDYB 3ARFB 4G43B 1RZKL 1AGDA 5FYLE 1CDGA 4I77L 3CDCA 3QG7H 5IMMA 1F11A 1UM6L 5J6HA 2HP4A 5E1HB 4BFBD 4Y16A 1OARL 4OZHB 1QA9B 4M00A 1FL6B 4F2MA 3DRQB 4JZNA 4FZ8H 4F80A 2AEQL 1LEIB 4UINL 4P46D 2BOBB 1B6DA 4WCYL 2J7LA 2MJWA 3VI3F 2Z91B 5HGHA 3KPOB 5L7XL 3UTTD 1PKQA 3MNZA 3GSXA 1IQWH 1Q38A 1MRFL 2IH3B 4NM8L 2XRAH 4YHML 2CXKA 5CGYC 5FGRA 3TVMC 3U7YL 1KLUB 3ALXA 5EU4B 5TQ0L 4PJAE 1QLRA 4QHMA 3QISA 2H3NB 4NO3B 4EDWL 1DN0B 1CDIA 4MCYB 4OFKA 3GK8L 4OZHE 3BH8B 5GJTH 1N2RA 3RDTB 1DQTA 5L0QB 1QSFA 1JZ3A 4N8CH 1DUYA 1EMTL 5IB4A 2CK2A 4PRPB 5IBTH 4F7TB 3STBA 4I3RH 3B9KC 3HG1D 4ODSH 5ALCH 2OL3H 1T04B 3CZFA 5C92A 4OCYL 5T5FL 1JWUA 5B39B 5JPNB 5L2JA 4X8JB 3DIFB 3OXSB 2I27N 4JFDB 4O2EB 4UT6L 3KYOB 1E28B 3RA7H 1NGWB 1TZGL 4NOBA 1L7TL 2HVKA 3T0EB 4AL8L 4FZEL 4ZUTB 5K9JH 2KQMA 3V5HA 5JDSB 4ZSOA 5JW3H 3MRNA 1FC1A 4L8BB 3EYOB 2VERN 3MRMA 1FSKC 4GMTH 2E9WA 3SCMA 4OD3L 4PRPE 2EEDA 4ZOCA 4XP6H 4ZTOH 4ZPVA 5D7JD 4RGNB 5C0IB 1U95A 1KG0A 1E4KC 1K6QL 5EZJA 3EGSA 1HI6A 3GIZH 2V9TA 4X5WA 1CGTA 1IGMH 4QXWA 4MD5B 1CFVL 4JFDE 4OFVA 4LLUA 4LASL 3T0EE 2Y72A 2ICWI 4PJHA 1I9JL 3AY4C 4HZLB 4JO4H 1K2DB 1CD8A 4P5TC 5FYKE 4RMVA 2EEAA 5DUPL 4RGOH 4YUEL 1HILA 3O41A 4YHYC 1UEMA 4PBXA 1WV7T 3H42H 5TPWH 1I8MA 1CI5A 4ZS6D 3QIUD 1KCSH 2CKBL 3QIWC 4XPTH 1HWGB 1TZIB 3CXHJ 4MLSA 2V5YA 3E8UL 3T0WA 2Z4QA 4RGNE 1EO8L 4M4RA 5LCVH 3QXUA 4PJCE 3UAJC 3K8LA 3VW3L 1CFQB 5I1KL 3MLSH 5DJXB 5FAAA 2LU4A 3UJIL 2QADB 2VWEE 5D2NA 2QQNH 1QVOB 3L5XH 4R90H 4X4XB 3TNNB 3WXWL 4WGWB 1R3IL 3HRPA 1ED3B 4MZ3A 5EIQA 2C1OB 4ETYA 2CKNA 1C1EL 3RNQB 4NJ9H 1W72H 1XR9A 1HOCB 1NPUA 1LD9A 4Y8DC 1UM5L 1K4DB 5I15L 4W4NA 3WIHL 4HBQA 2FEEI 4QF1B 5ICZA 5T5NF 1Q9WA 2P43B 2RFXA 1F6AB 1MHHA 3B2UD 3BJ91 3NBNA 3Q48A 4PLJC 3SDCA 4ALAH 3JUYA 3LD8B 4NUGL 8FABA 4P3CH 1JK8A 4XPHH 1FNGB 2VLME 1MAKA 4M1CD 1TVBB 5GGUA 2EH8H 3C6LC 5K9KB 3ZDZE 1WZKA 3NAAL 2E7CA 5KSAB 5EZIH 4Y2DD 2NNAB 2FGZA 4NO0A 43C9B 2CXGA 4GSDL 1FG9C 4DW2L 4WDIA 5DGQA 2APBA 2IF7A 3RQ3A 3DWTA 3MMEB 4PRBB 2ZCLL 4G6JH 4LQFH 4JFYB 5IG7A 4TPRH 4IRSD 2W0KA 5DURD 3X12A 5EU5A 2MFNA 1FHGA 3AREC 2D31B 2EYSA 4B7LA 1CIUA 3B6SA 5F71A 4ELMA 4HC1H 2LTQB 1VB9A 2V17L 4H8WC 1YMHA 3L3OB 2AK4B 3GMOA 3L3KA 4OUUA 3HMWL 1KGCE 3G6DL 4G80B 1A1MB 3SDAC 1MI5B 1TNNA 4HH8A 1L7IH 4Q2ZA 4KFZC 1YUHA 1AO7D 2DYPA 4JFQA 4Z5RB 3G6AA 3MJGX 4HUNB 4HXAH 2YZ8A 2OL3A 5KSBA 2NY6D 4ORGA 4G9FD 4S0SD 1J88A 4JY6A 4U1GB 3O0RL 3NA9H 5IGXL 5DTFB 1KCKA 4EBQH 3WL9B 4KGJA 1ZANH 3BP5A 3FJTA 4ZDHB 1Y0LA 3D3VA 2QR0A 3MREB 3TFKD 1L0YA 4X5XA 1FVCB 5DFVC 5A2FA 1KN2L 4F15B 2AK4E 1FJ1B 4XP5H 3Q3GB 5EZOH 2DOCA 3WFBL 1CXHA 1KXTB 1MI5E 4OZFB 4M3KB 3BHBA 4XBPA 1XZ0A 1CVRA 1QPPA 2A77H 1G7QA 2PO6B 4M5ZL 3CFBA 2XTJC 4DAGH 2J8OA 3IFNH 2ZUQB 3AXLA 2YD8A 2OP4L 4P5MB 5CBEB 4O9HH 4J3XA 1B4JH 1PYWB 3RAJH 4HPYH 1QO3A 4JM2A 3MSPA 4TSCL 2QKIB 2CUIA 3DO3A 2H26B 5FOJA 1A1OB 5A3IC 1UXWB 3L5JA 4YHLL 4KVNH 3HNSH 1JHKH 4Z7QE 5JDJA 3CSYA 3BDBA 4BZ2L 3KDMB 4AH2A 4NC0B 3GDBA 1CU4L 1JN6B 2EKJA 2GUOB 5BS0A 4JFOB 1JVKA 4WFFD 3BQUD 3JWDH 1U93A 2QSTA 2JLLA 1QLEH 4NT6B 3T4YB 3GUTA 4Z9KB 3J8F7 1RQ5A 3K7UA 1ZA6B 3OJ2C 4JDZA 5KVFH 3QZWG 5ITBL 5DXWA 2E27L 3MO1A 1J86A 1ND0A 3U0WL 2Y36H 3KLAA 2Y6SC 3P77B 2G9HB 2VH5H 3DO7A 3EFDH 5GSVA 1RI8A 3H2WA 4XH2B 5GGTH 3KJ4B 3JBG7 5EA0L 2A83B 1A9EB 5KOVC 1C5DA 1T22A 3VGAC 4IRJD 4M93B 3RVWC 4NRZB 1KEGH 3A6CL 4YBLB 1MFBL 4XTRC 5DMGD 1NQBA 5CKAA 1MEXL 2C1PA 3P9WB 2NY3D 5BJTA 5EBGA 1DE4B 3LB6C 4PG2C 4PLNC 2UUDK 3QULB 5ICXA 5DK3A 3ULUD 2JF1A 2PUQT 4KKCD 5HHXL 1HCFX 1U8JA 4Q9QH 4NZUL 4EUPH 5TDPA 3VG9C 1GCFA 5ID1B 2UZIL 4LPYA 2M1KA 4NQSA 3V4UL 1HH9B 3S98A 3BEWA 4HUVA 3B3IA 1NBZA 3UZVB 3EDJA 1UWXK 1ETZB 4BH8A 2ESVA 3KYMB 4YHOH 4XNXL 3SPVB 2O93L 5HD8C 3PNWA 4G5ZH 2WUCH 3EO9H 3QBTB 2ADGA 4HFWB 4RFEB 5FFLA 4JLRB 2J8UA 1WBXB 4POYA 5HI5D 3FFCB 1UZ8B 3PGDB 3DTXA 3NFSL 2QHRL 1Z5LA 2B4CC 3GRWH 3QO1A 5F8QC 4KHXH 5C0FB 3VGBA 3BPNB 3I6KA 5MHSD 4NNPL 3WLWC 3MR9A 2V9RA 4G7YH 2IALB 4JPVH 2ZZUT 3SDDC 4X6FB 3IDMB 2B8OT 4HMCA 3I3EA 2F54A 1AD0B 4LSQL 1A4JB 4U2ZA 3SBWC 2APFA 1BZ9B 4LL9A 5IW1A 4HWEL 2DQUH 2FL5A 5KTEL 3QUZD 4PJGB 2J6EL 5DFTA 4H5SA 1FO0L 1CGSH 1DSFL 1WITA 1NUNB 3FFCE 2VC2H 5F96L 4OI9A 5IQ9B 5J3HC 1SMAA 5A16B 2NYYD 2Y7QA 1HHGA 3N1FC 5HVHC 2YPVH 4ELKB 5JQ6H 1M4KA 2IPTH 5CJ8A 1QRKA 4ETQB 1GGBL 3FRUB 5JMOC 1NAML 4X6DB 5B8CB 2FR4A 4UB0H 2P4AB 3GM8A 5I17B 3IU3B 4OT1H 4G7VL 2OSLA 1HYSD 3Q6FA 1KACB 1YY9C 1ZWIB 5ID0B 3UYPA 2JK5B 4R4BB 1A7QL 1FL5A 3MNWA 1NEZA 3LKPA 4DN3H 3TO2B 1MUJB 3TA3A 5E99H 4U6YA 3ZE0E 5IVZB 3C9NB 4PJGE 3TLRA 2W9LA 2Z93B 3BVNB 1LP9E 1UGNA 3BIKB 1LE5A 3ET9F 3MLWL 4OM1L 4KPHL 3BXNA 2ATKB 2R0ZH 5HHPB 2FECL 4N0UA 4AIZA 2HKFH 2O5XL 4Y4FB 3VFGL 1R3HB 4XMLH 5DHXB 3RWHA 1NGYB 4K2UH 2J2ZA 3N85L 4U1SA 5C9KA 4AM0B 5C0CD 2FJFA 4BJLA 4ZNCD 3P73A 3G5VA 2NX5B 5I19H 4N5ED 3IETA 1KNOB 4LKXA 5DJZA 4YDKL 2OLDA 2X09A 3MBEB 3VFVB 4MQSB 5IW6A 3ZYJA 1MCIA 1MJ7L 1BBDH 1DDHB 5GGTA 2D7TH 3T8XB 3DMMC 4JZJA 4WTZA 3O9WC 3GMQA 2B4CL 1Q94B 1QBLH 5HI3D 1YEDB 3CIQA 3TPKA 3HR6A 1R5IB 1H8SA 3AS1A 4J23A 4I4WB 1SJVA 5J12C 3DURA 3EYQC 4Z7UB 1QQDA 5IQ7H 4OB5L 2YPLD 4JG0L 1GHFL 3F12A 1OAUL 1AR1D 2VE6B 5JHLH 1WIUA 3KPRA 1RUQL 35C8L 2KDGA 1WAAA 3TO4A 1ZGLB 1Q9OA 3I02B 2NX5E 1V5JA 2YZ1A 1HK6A 1CBVH 4FXGB 1P7QD 3JVGC 4HJGA 3RWEA 4QRUB 3OKNB 3SJVB 4EI5A 1V7NH 1TITA 2UYLB 2ADIB 4KUCF 4XT1C 2HLAB 4MA3A 5CSZB 3TZVA 4J3UA 4E0RB 4F7EB 4XBEL 1IGYA 3BUTA 3I3BA 5TE6H 4UT9H 4PS4H 4WW2F 5LWYL 1KJVB 4XXCA 1SHMA 1XT5A 4Z7UE 2ZP0T 3OB0H 1UZ6F 3IAPA 3IF1A 5CEZE 2P8MB 3QXDB 2EC9T 1U8MA 1NMBH 4P9HH 4D0CB 3GRWA 4XPGH 1JGEA 4WNQB 2VKWA 3U4EB 3W39B 4NNYA 5D6DA 4I3GA 4ZXBD 2GTWB 4G3YL 5SWSA 2DQTH 1AGCB 2ENYA 4CN4A 2IQAB 2VDNH 3SJVE 2X41A 3MV11 4I13B 1F6FB 4PD4J 2I26N 5EBWB 3QJFA 2H6PB 1Z2KA 1ZVYA 4ZD3L 3QXVA 15C8H 4I3SH 4XVTH 3QWOA 4KVCL 1HSAB 1YECL 1TVHA 3VG0L 4PLOB 4B5EA 4LMQI 2ZOLA 1JP5A 4AY0A 5ENWB 3KAAA 4PJFB 4LVNC 2AJ3B 3KWWA 2RGSA 4LLDB 2X05A 3UDWA 4PREB 5IJVB 1I7ZB 4N1CA 5KVMC 3MV7D 4C4KO 4PJ9C 1OHQA 5E0QA 4PRNB 1T5XA 5GZNC 1LEKB 1NUFA 1BQLH 2GJZA 4PJBF 5DO2D 3TPUA 3GMPB 1B6UA 3C5SA 1I7UB 1IGIH 3KYKL 2VL4A 5IMKB 3BPLC 3C5ZD 4CU7A 5I1CH 1HQ4A 2JTDA 4YDJB 1XIWA 3OGCB 2R2EB 3DVNB 3ARDD 4WWKC 5HYQA 1I85A 1INDL 3GSNL 4P2YA 2BDNL 1NCDL 3VMNA 4OCWH 5JOPD 4PJFE 3S34L 1YYLH 1I1YA 4X6BA 3SGKA 4FQLL 2Z31B 1PEWA 3OG4B 3THML 1MNUH 3RBGA 2DD8L 3TH3T 1AY1L 5DD6B 5BQ7A 3RZCA 1CXKA 3TBWA 2EIZA 3JXAA 5C8JB 5KS9E 1IBGH 1CT8A 1QYGH 2ATPB 3MRDA 4JG1H 2R69L 4M6NL 5EORH 4A2LA 1WBYA 5DWUH 4PGEA 5F9DC 4U1JB 5FDYA 2PTTB 3I2CL 4JO2L 3PWVA 1HN1A 5D4QA 2AABH 3UTPE 5FK9A 1KJ2B 3ZSSA 1XCTA 1KCLA 5IMLA 5D71L 5MEQA 5CGYD 3TVMD 4LRIC 4WI5A 3WJJC 5TJWK 3KPLA 4C55A 4EVNA 1QKZH 3OZ9H 1AIFB 1T3FA 1CICA 1NL0L 3RVVC 1JTPA 3K4DA 3KXFD 4MAYC 5I18H 3TF7C 4XMPL 1OAKH 1XGTB 3MUY1 3X13A 5GRUL 1SEBB 4AEEA 1EBPA 1YZZA 2I5YL 4ZFZA 2E9BA 1ZEAL 3QQ9D 1FH5H 4HXBH 1ZLSH 3TM6A 3QEQD 4JFFB 2CDGA 4NKMA 5T3ZL 5LKNA 5J11B 1E6OH 3I9GH 3UYRH 1EEZB 1MAMH 2WIIB 1VDGA 1X6LA 4HEME 2QQLH 1KLFA 2K9UA 3BZEA 5E1AA 3HNVH 4QWWD 5E2UH 1M7XA 1PSKL 5AYUL 3ZKSD 5C0NC 1S5HB 5J9PA 1AE6L 1F2XK 5CJQL 4XC3H 2ADFL 3JV4A 4HDIB 3PABB 5FUZH 4P46B 4L8SC 2FEEL 4QNPF 4FA8A 3OV6A 1WBZB 2V2XB 3KYAA 4HIJB 4HT1L 1X5HA 4XNQA 3V4VH 4PB0H 3K2UL 5H37H 3AC0A 4HIIB 1JHLH 2C5DC 4JFFE 3W82A 2CLVA 4QRQA 5CEXB 4F7CA 3QA3A 5INDA 3DYOA 5CUSH 3KPPB 1RIHL 1DBAH 4EIZC 3T4AB 2ZUSA 4RRPG 3DYMA 1TJHH 5L2KA 4U1KB 5I74C 4J2XA 3DUUB 4XX1E 5D7KD 1RHHB 2Q6WA 3P2TA 2EDQA 4D3CH 4MNHA 4WW2C 4ODWB 4ODTH 4PP2A 1ZVSB 3MRGA 1P4LA 4LHUB 3QI9C 1OSPL 1MQ8A 4P5TD 3HS0A 1U8LB 4CVUA 1Q0YL 2J12B 3VFRB 4L4VA 4RA0C 3UTTE 3HG1B 3O3DA 4DZ8B 4OGXL 1NMCC 1UJ3A 3B5GA 4J4PA 4ISVB 4N0FA 1QRND 4J7RA 4Z7OF 4FQJH 4NWTH 5EIVA 3QIWD 3MUGA 3D39D 2WINB 4KQ3H 3U46B 1BEYH 3QEHA 4JJHA 4O2CB 5HYJA 4P2OA 1CK0H 3UAJD 5A43C 1YEIL 4LFHG 3HMXH 1XGYH 4WU5B 1XF1A 5HDLA 5ALBL 1G9NH 4HGWA 5IFHL 1U8HB 2PTUA 3O3EB 3DUSB 4PRIA 5ITFB 5IEHA 2E7HA 2DLFH 1RAMA 3FQXB 3JWOC 4WU7A 3BESR 1X5GA 3WS6C 4LSRH 4XCCH 4LCYA 4QYOB 5FB8B 3S35H 4K3EH 5BMFL 5J89A 1ZOXA 1P4BH 2HJKA 4JHAL 5HPMB 3HG1E 2ZUYA 5D7JB 1NLBL 1N8ZA 2OTUA 3FB6A 3QUYC 5CD5C 3PE9A 4GG8A 4PLJD 2IGFL 1K3ZA 5INCA 5E9DD 1AH1A 2MMXA 2XZCH 5DUMH 4HLZH 2R1YB 1UQSB 1BX2B 1BQSA 3AM8C 4JHWH 1OVZA 4WEBL 4X5LA 2B1HH 2X4SB 4HQQH 3O3AB 3DI2B 3PXHA 1JGDA 2C9AA 2WWKO 4O51A 5CHNB 4FQIL 2P8LA 3DROB 5T33L 3QIUB 1PX3A 3ARRA 2P7TB 2VXQL 2XOTA 2DQIL 3ALWA 3MV9D 1FIGL 4WV1A 3MBXH 3QDGA 3JV6B 1E6JL 5MI0B 32C2A 3UBXA 4NDMB 5AD0B 1HDMA 1AHWC 4XVSH 4MD4A 2BHYA 3MLVL 2FLRT 2XQBH 5MP6L 2HRPH 3REWB 5I1JH 5KW9H 3L7FA 4HPOL 1WIOA 1GOGA 3GSWA 1I1FB 3SDAD 1U3HC 1U8OA 5JTWA 5TQ2L 2VQTA 1T7WA 5MERB 4ODHL 5C0BD 3GSQB 2X4UB 4UV7H 5D2LA 3FT4B 4LCWB 3REVB 4P9MH 2V2TB 2Q7NA 3T65A 2IMNA 4QRRD 5GGSY 1WK0A 1RUPL 4HULB 3H9HA 4M4PA 5J0BA 3FB5A 1EV2E 3ARSA 2W0FA 3MUHL 4UBDC 2KZWA 3ZHDA 5JXEA 2DI8A 5DFVD 2YD1A 2A0LD 1S9KC 2UWEA 4KV5F 4TUOB 5EUOA 1MF2L 4Q6IA 1TJGL 5ICYB 4Y2DB 5EWIL 2BOCB 2Y23A 1Z3GH 2Z8VC 5C07A 5KSUA 4JGJA 3JWOL 5BXFB 3EYVB 3QCUH 2YD4A 1EFXD 5GXBB 1JNNL 1ODAA 1QFWI 4GLRI 4IRSB 4N1HB 5DURB 2WUBL 5ERWA 2A6JB 5IROC 1KJMB 3P30H 3LKOA 1DLFH 1UB6B 4L9DA 5DK2B 4FTVD 1J1XL 1JPGB 5BVJA 2ZG1A 2HT4C 1DQLL 4MJ5B 1PBYA 3E6FB 3QNZB 4X6CA 1RULH 3P4NB 4M7LL 5A3ID 3SO3C 1S7UA 2PYED 1D5MA 3OG6B 3UCRA 4YJZL 1K8IA 4JZOB 3EYUL 3FT3A 1AO7B 3S3JA 4BKLB 3QEGH 3MA9L 2A9NH 3BPCA 4QGTA 3ZKQD 1HHIA 3GHBH 2YSSB 3PWUA 1MWAH 4G9FB 1S7VA 1VEPA 5C86A 1B0RB 3BMVA 4X9GA 1QHOA 4XHQA 3BP7B 3HMXA 5ESQA 5FF6B 2A6IA 1FLRL 5D1ZC 1MCOL 1U8KB 4OZIA 1A47A 1N0XH 3LSOA 3VD9A 1RZJC 1RJLA 1T7XA 2A6KA 1P84J 5JUEH 5BOZG 4RAVB 2ORBL 2Y6SD 5JA9A 3U1SL 4L4JA 5E8OB 4LSVH 3S5LG 3ES6A 1SYSA 4XX1G 4EOWH 4TUJB 3S36L 3N06B 5ADOH 3MV01 1AO7E 2EO9A 4HKJB 4LU5L 3WFCH 1OL0A 4OLYH 4JFXA 4Z8FL 1BD2A 5CP7B 2CR6A 4WW1B 4G9FE 3RVWD 1JPTL 4O4YH 4OGYH 3G9VA 4CVXA 2F5BL 4OV5B 1FGVL 2W9DL 4XTRD 1LHZA 3S88L 4Y5YA 3D2UD 2CGRH 4MJ6B 4KY1H 3V8OA 1XF4A 2FHBA 2XXCB 3MRBA 3LB6D 2RR3A 5IM7B 4QRTB 4NPYB 3OKDA 1GGCH 1V7MH 1P53A 3FQWB 3V0VB 3KPTA 1HIML 4G8EB 3MXVL 4WO4A 3V4PH 3S4SA 1Q8MA 1I7TA 1G0XA 2EXYC 4KDVA 4YK4B 4UT7L 1ONQA 5EH1A 2F74A 4AEFA 5GS0H 4KZDL 4PYHA 3H7BB 4PJAF 5HD8D 1C08B 1XGRB 1J7VR 1IJ9A 4NBZB 4HF5L 4DVBB 5FIEA 3BUYB 1T03H 3HI1B 3GZKA 3TN0A 2XQYG 1QEWB 1SVZA 2ZSVB 3QPXL 2AV1A 2I9LB 3LEVH 4K23L 4U6HA 3MRQA 5H2BB 5GRXG 3CVHH 5SWQA 4Y1AD 3OPZH 5JOFB 2VITA 2BVUA 1MFDH 4ZQKA 5BZDB 4W70A 3WLWD 3TT1H 4DK3A 1DLHA 4GQ9L 3ZHLA 4QHKJ 4WFFE 4IRJB 4MNGB 4M1GH 4PJ8A 1SEQL 1ZHKB 4XP4H 3LAFA 2FO4A 1HHKB 5E2VL 3IDNB 2X89A 5DQJB 4JN2A 1S7XA 3KNBA 3TWCL 3ZKXC 2NY3B 2CLZB 1AI1H 2DQGL 4QOKD 1BIIB 3IDXL 1KB5B 3LH2L 5HHVH 4FMFA 2B5IC 2X9XA 2J4WH 5D1QC 1Z9SA 3BN3B 1G9MH 3FQTA 5J3HD 1EXUA 2HVJB 4G6KH 3H0TA 1JZ2A 3A6BH 1S7RB 1JNLL 3F8UB 5F88A 3X14B 4U1IB 3AU1B 3U0TB 4WI3A 1P1ZA 5JORA 1VADB 3C2AL 4MNGE 3C60A 1AQKL 1IEHA 1YY9D 4R7NA 3UTZA 4JCMA 2WBJC 5DYOB 1T4KA 1T0MA 4NN7C 3EJYC 1IILE 2P24A 3MOBL 4JREB 1D6EB 4UTBH 4KUZL 2DN7A 4MAUL 1HHJB 4IOIB 2PCPA 5TF0A 3ULUE 1MFNA 2VLJA 3F7PC 1X5AA 2RIKA 4KDTC 1U8IB 4X7TB 3QXTA 4M7KH 5F7DB 1MWAA 1GZPB 2HAZA 3QJHA 4GS7B 5JQHC 1MY7A 4M6OH 3EYFA 1I4FB 2NTSP 3X3GL 5HGBA 4JQVC 4OCRH 2B0SL 1PVHA 3IFPA 1GPOL 4D9LL 4NM4L 3DXAD 4QKXB 5E8PB 5FGBA 3INUL 4PJCF 4Z7NE 5BZWA 4WRLA 4JFHD 2PN5A 4HS6B 3TBYB 1OT1A 3NH7L 5CCKL 4LSPH 4NP4L 2VUOA 3QG7L 3WS3A 5F1IB 4P4KA 5HVWA 3SE3A 2HFEA 3L5HA 5FKAB 3IXTA 4M7JH 4AIOA 1GXEA 1XCQB 3DMMD 3O9WD 1FN4A 1T1XB 5MHSE 1O7VA 4IMKC 4FZ8L 2NZIA 4WHDA 3VGGA 4XXDB 1OAQH 1UH4A 4Q0XL 1QSZA 3UXFA 2V7NA 3K81A 3EYQD 4KZEH 1JRHI 1X4XA 4OIBA 3FQRB 4GBXC 4LIQE 2EKSA 3K80A 1CDUA 2H1PL 1INEH 2VDOH 4Z0BL 5ANMB 1XGPA 3WDHA 1FBIH 5C2BL 3I6GA 4AYFA 1N6QH 5EBMB 2F53D 3GKWL 4YLQT 5SV4A 3AS3A 1FZKA 1M7DB 1CE6B 3S36X 4I2XE 4M48H 1MCSA 5FYJL 3BGFB 4MJIA 2CO6B 5FO8B 1G7HA 7FABH 5LGHL 2IANA 5FYLH 4PG9A 2YC1B 5EOCH 3MRHA 4PBWD 3OKMA 5GGSA 4XNZB 4RMTA 5C3TA 4CADB 4MNQD 4EXKA 4N8CL 3RUGA 3P11L 5IBTL 3O4LD 4P2QA 5C0EB 4I3RL 5C0CB 4H1LH 3QQ3B 4Z95H 5C08D 2MKWA 1OP3H 4RIRA 2A6DA 3W0WA 4P2RD 5ALCL 4QGYA 2OL3L 3QHZH 1EHLL 2MTPA 5ANME 8CGTA 1FNHA 3C08H 5JW4R 1NCBH 1NCCH 1R5VB 3QUXC 3RP1A 1T83C 4TQEL 1PY9A 4PYGA 4OGZA 1UB5B 3RA7L 5DT1L 3UTQB 4YXHH 5K9JL 1U8PA 3C2SA 4Q97A 3NIDE 5JW3L 4FQ1H 2CDFA 3WNKA 2F5AH 3KLSA 5DMYA 1IAII 3AFLA 2ARJB 2YPLB 2DQJL 4GMTL 1EAPB 4XP6L 4YDLB 3PG2A 5FGSA 1LO5A 4G42B 4MQTB 3RWCA 1S9YB 1H3VA 2X70B 3MLTA 1P7QB 3SOBH 3BISA 5C09D 5MEOB 1IGML 2BVQA 2OR8A 4PJ9D 5D5MB 2MCPH 5C3LD 2JCCB 5GZND 2XN9A 1D5BB 3PGFL 3W9EB 3FT2B 3QEUA 4R3SB 4JO4L 3VXUD 4M61B 5F1SA 5K59E 4M6MH 1VKXB 4Q58C 3F7YA 1UVQA 4RGOL 5CILL 2B1AH 2XIDA 5TGBB 5CBAA 4P49A 5C0JB 4PJIB 3AMKA 4WWKD 5TPWL 2YPLE 1KCSL 4H0GA 2EC9U 3MLYH 1JWSA 3VMOA 2EEBA 3SY0A 3WJLA 4D8PB 3AUVA 2NY7L 3SGDI 5LCVL 2BRRL 3BP6A 5E00A 4J12A 2VR4A 4KRPC 3RDTC 1G7IA 4DUWA 2VL5B 3MLSL 4Z7VB 5SX4I 4DKAA 2OJEA 3GSUA 4NZRH 5D5ME 2VLKD 4FQXB 4LLQA 2QQNL 1NANH 3IDJA 4JY4A 4AT6A 3L5XL 3U7WH 2JCCE 4R90L 1GZQB 3VFSB 2VZVA 3K2MC 3GMNA 2O5ZH 1JZ8A 2A1WH 5DJ2A 1QR1B 2OTWB 4L9LB 2CDEB 3QUML 1C12B 5F6IB 1MHEB 3F62A 3WNLA 1F58H 4L29B 3HFMH 3ZLQC 1DQQA 4ALAL 4P3CL 1TJIH 1DR9A 3MV7B 4UDUA 4P3DB 3BRGC 1N3NA 4K8RH 1U0QA 3LKRA 3O8XC 1ZA3A 1G7JA 4Z7VE 4NO2A 1N59A 5EZIL 3HNTH 4MAYD 1RK1B 3DJ9A 3RRQA 1FCCA 2IPKA 3JWDC 5C9JB 3C5ZB 1IM9D 1WCQA 4G6JL 4LQFL 2F15A 4OM0H 3ARDB 3IS1X 3HR5A 2EE6A 1WQVT 1JPSH 4F3FB 1YJDH 1OF2A 2Y4SA 2M8XA 2VXVL 3PXJA 3LIZH 1YEEL 2ZG2A 3MRRA 4C59B 3MV7E 5IR1A 1D5IH 5C0ND 5JZ7C 2BHZA 3WKMH 1L7IL 2WV3A 4S0TD 3HUJB 3FQUB 2P5WD 3QUKB 2MQ3A 4H1LA 5IBUB 3E2HC 4OGAC 2W65A 4Y19D 4HXAL 3NFPB 1URLA 4PY7B 5EFIB 9CGTA 3HC4L 1S5IH 2R1XB 3QB7C 3TCLA 3VU2A 5HHOD 3CFDA 4XC1H 3C6SB 3ZSTA 3QO0B 2JIXD 3HAEB 5IVXE 2AGJL 2CKBB 4EBQL 4JKLA 1DEEA 3BI9X 5AZEL 3TVMB 3VXNB 3ARFA 2BNUB 4G43A 1ZANL 1O0VA 1CFNB 5HTSA 4UV4L 1TCRB 5JOPE 4Z78B 1ZHNB 4L3ED 3RPIB 1JV5B 3NABH 4KUCD 4JEGB 4XP5L 5D72L 1AXIB 3ZT6A 1SY6H 5FO7B 5F3BB 5EZOL 1QA9A 1DANT 3KXFB 2XNAB 4FFYH 4ODBD 3MTRA 4EI5C 4NKDB 4KTYA 3HUJE 3LQZA 3WUWB 2A77L 5JW4Q 1LEIA 2BOBA 3T3PF 4JE4B 4XBGB 3TZVC 4DAGL 1F3DH 3IFNL 1MOEA 25C8H 3KPOA 4X4MA 3QI9D 4YZFF 2HJLB 4O9HL 1B4JL 3QEQB 4HPYL 1LWRA 3UJTH 1UM4H 4HUXB 5FM5M 3LS5H 5IVNA 1NUGA 1ZT1B 1KLUA 1KSRA 3HE6C 4HV8B 5IWLC 3KLHC 1SJEA 1BFOA 1HNFA 2H3NA 3HNSL 1JHKL 3KPSD 5GQBA 4NO3A 1DN0A 4LHQB 4OZGB 3QDMA 4MCYA 1H15A 4CKVX 4JFZL 1ROWA 3BH8A 1TTFA 3KXFE 3J7HA 2H8PB 5GS2D 3LHPL 4NQDE 2GJ6B 3JWDL 2LTQC 3OXRB 3HZYA 4CVZB 1QLEL 4LP4A 4PRPA 1NBYA 3VWJA 4L8CA 4XVJH 1VFBA 1FSKB 1LP9F 2ED7A 1FDLH 3QEQE 4W6XB 3U82B 3IDUA 4ZPTB 3BZ4B 2X9WA 1BOGB 2NY0C 2I9TB 5E8DH 1FC2D 5B39A 4N8PA 5DC0A 4X8JA 3BAEH 3DIFA 5CD5D 4O2EA 3P4OB 2C3VA 3CU1A 3T0EA 4UMGA 4NQED 4ZUTA 4OZGE 5GGQH 5JDSA 1CXIA 2O61B 1JGUH 5I8OH 4WI9A 4P99A 2FSEB 4L8BA 4P5TB 3LKQA 4XMKH 2VAAA 4RX4A 2EECA 4PBVC 5C6PB 5T1DL 2J88L 4F57H 4D9RD 3ZYOA 3UTSD 1QRNB 1CF8L 3C5JB 1IGFH 5C6TH 3DECA 4G6MH 3QIWB 4E42A 4QTHB 4L4TD 3D39B 5FEBA 2XZAH 1T0PB 1WEJH 2PO6C 3O3UN 1DQJB 4K94H 4Q9QL 5CS7A 5B3JE 4EI6B 3R8QA 4I48B 1A9BA 1DL7H 1RZGA 1T6VN 3WSQH 4U3CA 5D7KE 1MHPH 1U3HD 4MGXA 4HZLA 3MYZA 3RIAK 3L3IA 4I0PC 4YHOL 5KVDH 1ZK9A 2WUCL 3QRGH 1KXQE 2ICWJ 3EOYG 3LRGA 4DTGL 1K8DB 5B38G 3GJEA 3ARZA 3AAZB 1QRNE 4P5KB 3KHQA 1TZIA 1CE1H 4D2NA 1A6TB 4PJXB 3MRIB 5E6YA 2YRLA 1PFCA 3D39E 1T6WA 2ZUUA 2OXHA 4JJ5A 5E9DB 5DJXA 1MREH 4KHXL 2HFFB 1F3JB 4UBDD 1JGLH 4NHUA 4P57A 3NIGF 1W0VB 2M2DA 3H3PH 1FV1A 4DKDC 1N7MH 1QVOA 4JPVL 5DHVB 4X4XA 3TNNA 1HCVA 3T3ME 1WICA 1F13A 3VFNB 2PYFA 1FG2B 2C1OA 1DFBL 3DX8A 2HRLA 4HIHB 2UWEF 3WUZA 3HKFA 3RGVC 3STZB 1K4DA 4U7MA 3H9SA 3CK0H 3U6RB 1NFDA 2OCFD 1QSFD 4QF1A 3RX5A 2WSKA 5A40E 1CGSL 2RCSL 3PHQB 2GIYA 1S9XB 3QH3B 2X4PB 4QXTB 2R8SH 1EK3A 4G8IB 2VC2L 4NN6C 4PJXE 3OAYH 1RZIB 4JVPA 1M05B 2HT4D 2BNRA 2WBKA 4M93C 5E9DE 4LBEA 1KOAA 3SDAB 5K9KA 4YAQA 1ZSDB 3IU4L 4X4YA 1J1OH 5DRXA 2AK1H 2NNAA 2LVCA 3T2OA 2D9CA 43C9A 5C0BB 4OT1L 4U1MA 4MJ2A 4X6CF 4WWID 4I5BB 4MZ2A 4HKXB 4AQOA 1CGXA 1S8DB 4P9HC 4NRYB 3PHSA 4QRRB 2D31A 4ZOBA 1EEQA 3FOLB 3V7AE 5J06A 1B0GB 3ZT5A 5D7IF 1S7TB 3MV9E 4KWUA 2AAVA 2GITB 5DHYB 3KS0H 3CD4A 4F7PB 2AK4A 1HE7A 5CJOH 3GJFH 3EFFB 4G80A 1A1MA 1MIEH 1MI5A 3IFOB 1EAJA 5I16A 3RWGB 2F8OA 4XMLL 4K2UL 4JVWA 5FA4B 3VI3E 5E2WH 1CD0A 4LCCC 4GW4B 1EFXB 2EC8A 2P5ED 1CFTB 5C0BE 1HINH 2VDRL 3ZL4H 4GXUN 1N26A 5I19L 5DTFA 1R24A 1VEMA 1FZMB 3TGXA 3BPNC 2DTML 2XKUA 3DOSA 4V2BA 4FTVB 3WL9A 4QRRE 1CGUA 1FNEB 2A73B 5KS9F 2WAHA 4J4PC 1BBDL 4YHKH 1REIA 3KPMB 3FAWA 3MREA 1FVCA 1QBLL 3B8YA 3RTQC 1FJ1A 2PYEB 3UZQA 2YMXH 5A2IH 2P48B 2H41A 2FJHB 2EO1A 4H88L 1J0KA 1MJJB 4HW6A 5LJYH 4PRAB 1DBML 4KQ4H 5EU6A 5EPMB 1XF3A 3F58H 2HTKD 5C0GB 2EXYD 2CUMA 2WP3T 3VXRB 4PRDB 1BBJB 4JY5H 4P5MA 5I73B 4HIXH 5JHLL 1PYWA 5J1AB 1A22B 3CLEH 1PLGH 3TV3L 5EZLB 2QKIA 3EUUA 4GXVH 4FTVE 4ZFOA 2H26A 3PHOA 1UXWA 1V7NL 1YEKH 2CRIA 4UOW1 4S1SH 3PQYA 3QIBC 1BFSA 3CZJA 2PYEE 5DD5H 4BFIB 1JN6A 4HKBB 4UT9L 2GUOA 4DCQB 1NAMB 4Q9RH 4GRLC 2L4OA 4PS4L 4APQA 4C57C 3VGAB 5C70A 2R0LL 4LNRB 3SQBA 1MRDL 1V05A 3PWLB 1CG9B 5DRNA 5CZXD 3MA7B 1NMBL 4JB9H 4P9HL 4YIQB 3D2UB 1F42A 4KROC 2EDLA 4QTIL 2YRZA 4WTWA 2AJYH 2G9HA 2XZQH 4R6UA 1DQDH 1MLCB 2DQTL 5FYJD 2VDNL 4WV1C 5DJCB 3VG9B 5D1QD 5E6IC 4XH2A 1CR9H 3BO8B 1DEDA 2GY7B 3FO9B 4HWBH 15C8L 3WHE0 2A83A 1JF5A 4N8VB 4OFIA 2DQDH 4G6FD 5ESAB 3MUJA 2DYPD 4C56D 4N90D 1UKSA 1C16B 5E94A 2WBJD 1DE4A 5CEZH 3EJYD 4D0BA 1QZ1A 3QULA 1QHPA 5B21A 1W8NA 2YD9A 1HEZB 4O5LH 2NQCA 4Y1AB 1BQLL 5E8EA 1HH9A 3GSVB 1M1SA 4LPCA 4YDVB 3UO1H 4HIEA 1VFAA 3D3VD 1IGIL 1KIQB 5I1CL 2Z35B 5IOPB 3KYMA 4FFZH 3SPVA 3CLFH 1FYTA 2GK0B 4HFWA 1OTTC 2HT3C 1WBXA 3GJFA 4QOKB 4MS8C 3T0AA 3HPJB 2XICA 4XCEB 3ROOA 3PGDA 1UENA 3ZHKA 2AJVH 5C0FA 2GTZB 1BFVH 2FH6A 3RIFF 1IBGL 4Y1AE 1QYGL 3HB3C 4JG1L 1NGXB 2IALA 5EORL 1VSCA 4LLYB 4X6FA 2X6MA 3IDMA 4DKEL 2X4QB 3AMLA 4XRCA 3BFOA 3M8OH 1AD0A 1WJ3A 4YNYB 3U7AA 4YXKL 1A4JA 3U9UB 1BZ9A 4XCNB 5KANG 4OLUH 1YNTA 5GRVK 3O4OC 3RHWF 4PJGA 1IL1B 3MZTA 5LBSL 5HYSA 4QOKE 2BFVL 3RX7A 4LSTH 3DSNA 3QNXB 1IEAB 2R2BA 4LRNH 2E8YA 3VFPB 5I75C 2YBRB 5A16A 1QKZL 1A0QH 3OZ9L 4GAGH 3I85A 4OKDA 5EULV 1XGQB 4ELKA 4WI7A 1CTOA 5I18L 4TUKH 3UTOA 1Z6JT 1OAKL 4X6DA 1G9EA 2FZ3B 5B8CA 4C83B 4IEFB 4MCZB 4U0QB 3G5ZB 4WHTB 3IU3A 5I17A 2F58H 5FDWA 1ZWIA 4MQ7B 3WIIH 3DXAB 4PGZA 2JK5A 4R4BA 1ZLSL 1KB9K 3BP4B 3LN9A 4BQ6A 4W81A 2MPAL 1E6OL 1KPVB 3I9GL 3UYRL 3OX8B 4CGTA 1MAML 2QQLL 2BVTA 3KPQB 5T1KA 3WLBA 2Z93A 3BVNA 1WZLA 3DV4B 4Y89A 3QUXD 3BIKA 2VDKH 3DMMB 5D1XC 4OKVA 3O9WB 2ATKA 3JTSB 5H8DA 2D2OA 4IHOB 1G7LB 3OJDB 4Y4FA 4YR6B 1KPUB 5FUZL 4LK4A 2ERJC 2GFBB 2W0PA 5J12B 5BW7A 5DF0A 5I76A 4WO4C 3V4VL 3GMMB 1ACYH 4AM0A 3EOBB 1BF2A 3QQ4B 4YBQC 4J3TA 1HXMB 1BM3H 1PQZB 2ADJB 3DXAE 1JHLL 4ONGL 1QTYT 2ITDB 2ESVD 2VB5A 2VDQH 2F53B 3MBEA 3Q2CA 4JFHE 3VFVA 4F7MB 5F7UA 4PJEF 1AKJB 5CUSL 3CJJA 4OZ4B 1DBAL 2EH7L 5J4MA 2AXHA 3T8XA 1TJHL 4HWBA 1LK2B 2DLGA 1Q94A 5I1LA 2YPKA 1ZLVH 1QBAA 1YEDA 1R5IA 3T0DA 4I4WA 5BVPL 1FFPA 5DI8B 4ONHA 4Z7UA 3OB0K 2R4SH 4YHPA 1MJ8H 2MOVA 2VKXA 3O4LB 2X5PA 3FQNB 5C08B 4QRPA 4P2RB 4FQJL 1X5XA 3NIFF 4NWTL 4DOHB 1ZGLP 3I02A 2ZSWB 2F54D 2Z92A 4FXGA 3ARYA 2F53E 2ICWB 4KQ3L 5DS8B 4QRUA 4ZAKC 3T09A 1QUNA 4M8VA 1BEYL 3OKNA 4LCIL 1GGIH 2D9QB 1CK0L 1AGFB 4K7PL 4UU9B 2UYLA 2WBWB 4KRPD 4IM8A 1XGYL 5CSZA 2XWTA 4HJJH 1OAZH 4E0RA 4F7EA 4QXUH 4BFGA 2DQEH 2YA1A 1LMKA 4HG4K 1QOKA 3UPRA 2DLFL 4MD0B 5DEZA 3WFHB 2ZCHH 4LSRL 4XCCL 4MNQE 1KJVA 3F7VB 2YKLH 3S35L 5DDHA 4K3EL 3O4LE 3QXDA 1P4BL 2AJUL 2EZ0C 5C08E 1X7QB 3S96B 5LGJB 1ZHBA 4UTAH 3SGEI 1JI1A 4XZUB 2A74A 4P2RE 2QSQA 4H20H 4WNQA 3G9AB 2E9JA 4LVNB 2RBLA 2FHFA 3U4EA 4DOHE 2VNCA 4JQXA 5IK3A 4CAGA 5C09B 4HMDA 3CNKA 12E8H 1AGCA 2IQAA 4PJ9B 2XZCL 2I24N 5DUML 1YY8A 4N68A 5DD0H 3BGMB 3NCMA 5L8LB 3KG5A 3O8XD 1JYWA 1RU9H 3CFEB 2APXA 3VRIA 3VXUB 5J8OA 4IDLA 4RFNC 3TYFB 1HSAA 3BPLB 5HHQB 1ZXQA 4WWKB 1KC5H 1L0XA 5ENWA 4S11A 5IFAH 4LLDA 3VH8G 5IB2B 4WTXA 4N0YH 1F2QA 1NFKA 3SDXF 1I7ZA 4AEHL 4MXQC 2HRPL 5C09E 4PRNA 4ZNEE 4KTDH 1IVLA 4JO1H 4LSUH 5FUCE 5IIEA 3GMPA 5CGMA 4OQ1A 2W60B 4M03A 2QQKH 3IJSB 3MNVB 4KJYB 4OGAD 3VXUE 3LPGA 4CDGC 4YDJA 1JHTB 1QFWM 4UV7L 3OGCA 1XH3B 2R2EA 3FB7A 4M5YH 1A14H 3MGOB 4P9ML 4PRHD 3JSSA 4DGIH 5DRZB 2CIKB 3SE8H 5IEKB 1EJOL 2IH1B 4MVBC 4O58H 4LGPB 4OCSH 3JWNC 2Z31A 1XR8B 5GS1A 2Z0BA 1JYXA 2OZ4H 4MX7A 5DD6A 1BVLA 1OAYH 1OD9A 4M43L 5CWSA 2HG5B 4IOSD 5IF0B 2ATPA 2VLKE 4MAYB 4GKSA 4EI5D 3ULVF 1IZKA 2EDYA 4M7LT 4C54A 4DGYH 5I30L 4QHLB 3TZVD 4XI5D 2VRAA 3ZE1F 3BEVB 4Q9CA 2XWBA 5E08H 3P30L 2EICA 1DLFL 3EAKA