1Z6JT

Crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
207
Chain Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Structure-based design and synthesis of pyrazinones containing novel P1 'side pocket' moieties as inhibitors of TF/VIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 207
sequence length 211
ec nomenclature
pdb deposition date 2005-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT02
4X7TB 5JOFA 3TZVC 1IC5H 2GCYB 2JB6B 3T0ED 5JMOC 4P23C 4NBYB 2XWTA 2VLME 5EZLB 1OAUH 3UYRH 3QUMB 2A38A 4I18C 4WFEE 3GMOA 3RAJH 2GJZA 2BSED 3BWAA 4K94H 3WNLA 3CDFA 5DWUL 2WINB 4YHYC 1KLGA 4IM8A 4WI3A 4P46C 3IXAB 4RFEB 3NIFE 3K4DA 1UEYA 3WNKA 2L7JA 4L4TB 2EKSB 4M8QA 4EDXB 2FCBA 5KVGH 1JPTH 5FOBA 5F1NB 3TYGH 1HHIA 1F42A 1U8NB 5LGKA 4J3SA 4Z8FL 4PRPA 3IU3B 3PDDA 2HKFH 5E2WL 5GQBA 1D5XB 1VHPA 4XNMA 1MJ8L 1P4BH 2HVJB 4PGEA 2EDWA 4AEIH 4NO0A 4HAGA 5DFTA 2ITCA 1MHPH 1N2RB 2BSSA 5J3HD 1DEEA 1F90H 5EU3A 1JPGB 2HT2C 2VLRE 4YDKL 3X14A 4LPVA 2DWEA 4NQCA 5HYJE 4KUCD 1MCFA 3MLSL 1YJDL 1Q72L 3DUUB 4MVBC 4XNUH 5E8EB 1DN0A 1NBVH 1JRHI 1A1MB 5IBTL 3EYFA 1Z6JT 4Z0BL 3PF2A 3NN8B 4X80L 1INDL 4ERSL 2VDPH 2AJZB 1QSFB 4YBLB 4GQPH 2I9LA 4H8WL 1O7VA 4YBQD 2DMKA 4FQ2L 4HIJA 1RZ7L 2Y4SA 2ZG1A 3WNOA 3UZEA 3KPQA 5FYKH 2Y23A 1ZVYA 4UT9L 3VGDA 4PJIB 2FL5B 4FXKB 2B20A 5L2KB 3QDAA 4ISVA 2VQTA 5EBLB 4RFOL 4XMLH 3T3MF 4GRLA 3KNBA 4R2GC 3OAUL 3ZKND 5IQ7H 1KTDA 5SX4H 4ODTL 3SPVA 5E56A 5C07B 4RGOL 4ZUTA 1A9EA 1TZGH 1I7TB 2NXYD 1CK0L 2Y07H 4LEXH 5K9QG 1I1YA 1WQVT 3VXQA 1IFHL 2ADFL 3QCTH 3V7MA 2F8VA 1YNLL 3QJHA 5T3XH 2XV6B 3SKOA 4ODWB 1U8KA 4FABL 2ZOLB 1NEZB 1OSPH 4KJPD 1KJ2B 4HXAH 3ARBB 4MQ7A 3PP4L 4LSTH 5C8JB 5HDQL 4PY7B 3MA9L 1ZS8A 3TV3L 4DTGL 5CD5C 4E41E 4H0IA 4ZOCA 4J4PC 2APVA 3MV9A 3O6MH 2NX5B 2X1PA 3V79C 2AERT 4K7PY 2PNDA 2IQAA 3O9WB 4I2XE 2BVPB 4H20L 4KK9D 1FL5A 4M5YH 4A2LA 2H8PB 1RZGB 4F80A 1VCAA 1DL7L 2MQ0A 5A3ID 5KVDH 4PS4L 5C0DA 2PR4L 3O6LH 4F9LC 1OY3B 2CRZA 2V7NB 4YZFF 3UAJC 1UM4H 5CINL 3KLHD 5ENWA 3FO0L 3TLRA 2XTLA 4YFLF 5DO2C 5MI0C 3HFML 1DBMH 3FOMA 5CILL 5HGDB 3TVMA 3RNKA 1EFQA 1R5IB 3OKOA 5GRVK 3IU4H 1AP2A 1NC4B 2EE3A 3VRJB 3WSQL 2H2PD 3NGBB 4AMKH 1U8JA 4LCCA 1NL0H 1J0YA 2FJHB 3KPRD 2J1KA 5CEZE 4NKOB 1J86A 4OM1L 3TZVA 2R29L 2VE6A 1OGTB 1AO7A 4P23A 1BBDL 2ZUQC 3GJFK 4AQ1B 4I18A 1A4JB 4F2MB 3P9WB 1K8DA 1IGTA 1KT2A 1I7UA 3C6SA 2JB5H 1F2QA 2Z8WC 1ZT7A 1OW0A 3HMXH 4OF7A 1F02I 5B38B 3TO2A 3G08A 2XZCH 1N59A 4LP5A 4N0FA 3IDIB 5IESH 2R69L 4LSRH 2DF3A 2NY1C 3MNVA 2FX8L 1T1YA 4ZPTA 3ARQA 1P84J 3VXTB 3QIBB 3F8UB 4F7MB 1YEJH 4ZAKB 5DQ9B 3CSBA 4UB0L 2WK2A 2OCFD 2X4QA 3MRPB 1MRCH 4IRJD 4NYLB 3LKSB 2Q86A 4XNXL 3JTSB 3HI1A 2X7LA 4ETYA 2MOVA 3N85H 4WUUA 4YNYA 1MJ7H 1NMBH 1UQSB 3GRWH 2KDGA 3QDJD 1RZJL 2Y06L 2AP2A 2X9YA 4G9DA 2D03L 4UMGA 2PYFB 4O2FA 5T1KD 4NGHL 5FCUH 1EAPA 3QEHA 4ESKA 3VE0B 2H26B 1E6JH 2A6KB 2VXTL 4OM0L 3D2UD 4LF3A 5CD3A 2DM2A 1MJUL 5D2LE 2NR6D 2OL3L 4QF1B 2AI0H 1RIVH 4CMHB 1ACYL 4JPVL 4O58L 2DQJL 1UG9A 4R8WH 4UV7L 5MERA 3OQ3B 1JP5A 3PABA 2O5ZL 5FKPA 2BY2A 4CKVX 3O2WH 4MB5A 3KR3L 2WWKO 2M1KA 3O8XC 3MA7A 4HQQL 4U6TA 3ZYOA 3RWIA 5TE4L 3R0NA 3LKQB 4ZUUA 4XBEH 4ELMA 3CXDH 1G7HA 5D2NB 3RQ3A 1DANU 2CJUL 3S96A 1K2DB 4JQIL 4OCNC 1LO5B 4PG9A 3P73A 4NZRL 4Y2DB 2PO6B 3OBAA 2V6HA 5HYQB 1F3DJ 3ALWA 4GAYA 4QOKE 1G0YR 1H3WM 4O2CA 2Y6SD 5HYEA 5IWLC 4N90D 3TJEL 1DE4A 1CQYA 4Z7UA 1N64L 4JM2C 1BD2A 3GSNL 3WL9B 3KLAB 4IHOA 3MPCA 3AXLB 3HPJB 1NBQA 4IJ3B 4M61A 4WGWB 4FFYH 5ITFA 1Q9WB 4LPYA 3WCYA 3JV5A 4ZS7L 1N7ML 5CGYC 4J4PA 5D1XD 2HMIC 5J12C 2F54B 1HHHA 1R3IL 2YN5A 5EU5B 2CK0H 2DQGL 3VXMD 4DJMA 3MCLH 2ESVE 4YXHL 4F9LA 4G8EA 3MLRL 3NBNA 4C4KO 4PJBF 1F58H 1EBAA 2ZKHL 4OCWL 3NABH 3JBG7 2DLFH 4OTXL 5L2JB 2C3GA 4JO4L 4PRHB 5T3ZE 4UBDC 12E8L 2F8XC 4JFQA 4JANB 3V4PL 2DKMA 4A6YA 3OJ2C 1TPXC 2EIZB 5B3JF 2R56L 1E6OL 4DW2L 5ID1B 4NO5B 5AEAA 1B6UA 4KY1H 5CGTA 3RVWC 1EEYA 4NRXA 1Q0YH 3IETA 3MTRA 4B53A 3T2NH 1SHMA 3T0EC 3IKKA 5E8PB 3MODH 4LCYB 4ZTOL 1JF1B 4P48A 1IQDA 1TCMA 1AE6L 1KV3A 2VDLH 4OCYH 2F19H 5LJYH 4MJIE 4OF5A 3FB7B 1JGEB 5I1JH 2XWBB 1R0AL 5GS1C 5J7CC 5EBMA 1IC7L 4L4JA 3BRGC 3WD5H 2P4AB 3DGGA 5BS0D 3OKKA 4PLOB 1RK0B 4OZGE 5J6HA 1UC6A 1MI5E 1UZ6E 4DGYL 1JGDA 4XVSH 2EYRA 5FAAA 2FX9L 3P4NA 5EU6A 1CGSL 1N5YH 2B4CL 1FRGH 4XC1H 4FQIH 3DX6B 4OIAA 2NY2C 3W0WD 3U79A 4JO2L 4AG4L 4OF0A 5DMGD 3G5YA 3SE9L 4MD4A 2YPKB 5F6IC 2RCSH 4QEGA 4L4TD 4GO6B 4QRUB 2OK0H 5ISZB 3JXAA 3RDTB 2WIMA 1NCDH 5ABDE 3BJ91 4K9EC 1OOAA 5FYJU 5I1DA 1TQBB 1T1XB 4DN3L 4BSVA 4J8RA 4HMCA 1CIDA 2F53A 4L8CA 3IAPA 5IVNA 5AZ2H 3BPNB 4XCCL 1Y6MR 1RPQA 4F7EA 5IW6A 1KIRB 1UJ3A 3HZMA 1FH5L 3BEVA 4UI2A 3DXAD 4NM4H 4PBWD 4F7PA 4P5KA 5DF0A 4YBQC 1JGLL 5EZJB 1UWXH 1M7XA 3FFDA 3QFJE 1WTGT 4FFVC 3HE7D 1UYWL 3QUMH 2LQRA 3V6OE 1YYMH 4AEHL 4P2RE 1BPVA 1VENA 3VI4F 1MFAL 1KCRL 5DJZA 5ITBH 5C6PB 1WEJH 5KG9A 1P1ZB 4PRIB 4P0DA 1CDIA 1QSFD 4K3DL 2BC4A 4HGKC 1VGKA 3F58L 5E8NA 3HZVB 1LEGB 3X12A 2NXYC 4XCEB 1CXIA 3QDME 1LNUB 1T22A 5L2KD 3WYRA 4ZO6A 3DSNA 2P44B 4JM4L 2I5YH 1CTNA 1K4CB 5CBEA 2E7CA 4WEUD 3KJ6H 2CRYA 4JM2A 5E5UB 1HQ4A 2XQYG 4XBPA 1YN6B 4MYWB 1A14L 2JF1A 1I7ZA 1XGRB 2WBWB 4U1NA 5C07D 5BO1H 3LKRA 4RNRB 1AXSB 5E1AB 5LGJB 1JGVH 1J87A 1HXMA 5JW4Q 1OB1A 3U1SH 3EO0A 2VZVA 3EAKA 5F1IB 2DWDA 1AGCB 3SDXB 1UEMA 3IT8D 5CEYA 1G7LA 4QRRB 1A1NB 5FV2A 4C55A 3U7AA 4D3CL 5C9JA 2EDEA 2VXUL 4UILL 5TDNB 3PHOA 4JFOB 2IADA 4PJIF 4CADA 2W9EL 2WANA 3NAAL 3HI5H 2R2BA 3ARFA 4LLWA 3DX7B 2AGJH 2OP4L 4JDVB 5JZ7C 1ZHKB 3B9VA 4Z76A 2IALB 1CGWA 4WRLA 4J12A 2A6IA 3SJVA 1JZ5A 3WN5A 2J5LC 3BZFB 4PJ7B 3CFDA 4JFEE 1J05B 2H2PC 4S0TD 5HPMA 4Y19D 3CPLA 2R0LH 1FIEA 5KVFL 2YUXA 3LEXB 3ZE1E 1ZA6B 4WU7B 5CUSL 4ETQA 5IOPB 3VFUB 4YIQA 3HZYB 3T0EA 1HE7A 2WBJB 1RZ8A 4PTUA 4ZTPL 3K7UA 3VFGL 2J8UB 3BAEL 3T0AA 2CO6B 4WWID 1AC0A 4I9WE 2W65A 3NCYP 4M7KL 4Z7OE 3MJGX 3QP3A 5LKNA 1JYXA 5FIEA 3HC4L 4ODXA 3ZT6A 4NC1E 2HVKB 5IB4A 2QQKH 1KJ2H 3IDXH 4N0UA 1EO5A 3H9HB 4NOFA 3L5WA 2R39A 3IJSB 4Q2ZB 1IM3B 2BNQB 4FQLL 4DZBA 1RV6X 4JZNA 4HMDA 1U8PA 2HFEB 1S5IH 4LARH 5ANMB 3UYPA 2YRPA 4JVUA 1R3KB 3BQUB 1A6WL 5CJQL 4BM7A 4C54A 4IRJC 4JY5H 2D9QB 3A0OA 4E9LA 3EO1A 5L6YL 5GJSL 4MAYB 5DLML 4NN5B 3VH8B 5C0BE 5ACMA 5J11B 2DQDL 2VISA 3QIWC 4MA1B 3PV6B 3UBXG 3LRSA 3QIUB 4X9GA 3WFCH 2KUTA 5GRZA 3DO7B 4LGSB 3MGTA 5F21B 3UXFA 4PJDE 3I2CH 4HWBH 4BZ2H 4PJGB 2BX5A 2D0HA 1GRWA 4NOBA 4U6XB 5FYKU 3QIBD 4RA3A 3AU1B 1I1AB 3BH9B 3FQRA 4ZAKD 1PY9A 1MEXL 4MMXC 2A0LD 5KVMC 1X5FA 3TBVB 5DMJB 3KPLB 5DDHB 1C5BL 3VXSE 1RAMA 5A43C 1A6AB 5HVFB 5IV2B 3I75B 3I85A 3O4LB 1MOEA 1EDQA 2R1XB 1A6PA 1Q9KA 1G7QA 1DCLA 3NPZB 3MNWA 4YHKL 8FABB 2VABB 2CGRL 3EOBA 4DVRL 3VJ6A 4JGUA 3T8XB 1DQQA 1ORQB 4RZCA 4QLRA 2ZPKH 2MJWA 1RHHB 4LSQH 1F4YL 4IIQC 5EFIA 1A64A 2D7MA 4V1DB 4HT1H 4GOSA 2FO1A 1U8HA 2DM3A 3Q2CA 5CEZL 1DBJL 2JJUA 2W0KA 5BZDA 1KIPB 3GO1H 2PTVA 3MUJA 1MCOL 4RX4D 5H37H 4KTEL 1OHQA 1N6QH 1B2WL 4OCRL 2Y6SC 2MCPH 3L9RB 5JR1H 4XP6L 2HTKD 3FQXA 3HG1D 4M1CC 3M07A 1KG0B 4PB0L 3SKMB 4M1GL 4UINH 3KJ4C 1JYVA 2YPVL 4PFEA 5D7LB 3JV6B 3GMPB 1LEIB 2VC2H 3BN9C 3RX7A 5B4MD 1MCKA 2IC2A 4YH6A 5D1XC 4Y2DD 3BKYH 4OCLC 2PO6D 1HINL 5DHYB 2AV7B 4LKXA 1EGJA 4S1RH 2ICEA 5C08B 3SGDH 1QD0A 3TIDB 2ICWB 3I3DA 3X3FH 4OJFH 4UOW0 1OWWA 4C56B 3ISWA 4Z7QE 1MCIA 4YK4B 4NO2B 5EUOE 3QHTC 1SM3H 5MENA 1CL7H 3DJ9A 1CLYL 4G7YH 1BJ1H 1HSAB 1I85A 2P49B 3MBXH 3D87B 1OCWL 5IW3A 3BIKA 4JKKA 4DFHA 1FGVH 4Z95L 1YMHB 1D6EA 1ED3A 2F54D 3QBTB 4KDTC 4QHKJ 5SWQA 5F6HI 1YC8A 3BD3A 4Q9RH 4YHOL 4R90L 2VKXA 1DBKH 3GJEA 4Y0GA 3GNML 4H0HB 2NTFA 3DRTA 2Y72A 2W9LA 3LV3A 3VD9A 3KPRA 5EU4B 4K7FB 3T3PF 4GAFB 3HC3L 1EERB 4F37F 3GIVB 2ED7A 1JV5B 4J6RL 3VXPB 3CSGA 1BX2B 4ODVH 4PRHD 2NY6B 4RMRA 3GRWA 3H9SD 1KCVH 2FBOJ 2EC9T 5TF1L 2A77L 2CK2A 5TPWH 3RA7L 5DQDH 3V0VA 3EYSL 2DBLH 1J18A 4G8IB 4LLUB 4PRPE 5IM7B 4KMTH 3HUJE 1WCQA 2CXGA 2ZOKB 4H88L 5DD1L 3FONA 5A16A 4N5ED 1DQJA 3FCTA 1A6VH 5D1ZC 4YWGH 1BM3H 5DJ2B 3H42L 3HPLB 4H5SB 3RU8H 2A9MH 4OSUH 1Q38A 1REIA 3UMTA 5FM5O 4FRWA 5DUMH 3S4SG 1FE8L 1PG7L 2GQHA 3S34H 1ZSDB 4MCYB 1IKNA 1J1XL 2FJFA 3LVEA 2CQVA 4UDUA 3H2WA 2AJYH 2CKBA 3BW9B 3MRMB 2HWZL 2XQYK 4IRJA 2RBLA 3MMEB 4PB9L 2QKIB 5EOCH 2DLHA 1H8SA 1QA9B 5KANG 3V4UL 4QXTB 3RZCB 4RDQF 4FQPA 3WUWG 4Q0XL 5DRWA 3QDJA 5GJTL 5DD5L 3P0YL 4O02H 1R5VB 4CMMA 1TVHA 2PTTB 1T83C 3TA3B 1G9NH 5MP6L 3SQOL 3B3IB 4OD1H 4XH2A 1I8MA 3D2UA 2P1YA 3O6KL 2XZAL 5LXGH 1RULL 1V7NL 4G9FB 4CGTA 4Y1AD 3KYNB 4LLVB 2GY7B 3W11C 5A2FA 5ISZD 3RDTD 5ID0B 4ODHL 4WFGD 5EULV 1XH3B 2YWYA 4O9HL 3U30B 3ULUD 5DS8A 3RBSA 1C08A 4XPBH 2YD5A 3DARA 2G5BA 2OL3B 2H3NB 3OJMB 4KTDH 5H2BA 2KKQA 5DJXB 4AQOA 4YBLC 3MLWL 3HAEG 4IIQA 2IANE 5JQ6H 1XMWA 3EFDL 4ZD3H 4EOWL 1RY7B 2BCKB 1J12A 3THMH 1T0PB 3CK0H 3MV9E 4PJBA 4BZ1L 4WW1A 1ZHNB 1KF9B 3F12A 4YXLH 4UU9B 3PIQB 5IJKC 3RY6A 4LLDA 3IJYB 4S1QL 5HI4C 3STZA 3UJTL 5FO9B 1A7PL 5IG7A 4PRID 4U1MA 3TFKD 4R0LB 2NMSA 4PJXE 2AVGA 2P42B 1YEIL 4NNXA 1BQUA 3I9GH 4QTHA 5D1XA 3HS0B 4NDMA 2Y5TB 1JNLH 3GSNB 1OLLA 2CRMA 3OAYH 3RVUC 1JHKH 3VXMA 3LPWA 4AT6B 3U7WL 2VLJB 3ARBC 5I8EB 3TH3T 3BJLA 5IB2B 1VGEL 3ULSA 2R23A 4PBXA 1T6WA 3G6DH 5TGBA 3ALXA 5BXFA 1G7MB 4QHNB 1XF4A 4MDJA 3RVVD 4KJWC 3O9WC 3QG6B 2QSVA 3BYYA 3RTQB 1RQ5A 4PJEE 4Y5VB 4MSWB 2VDMH 3K1DA 5JMRA 3Q6FB 2APTA 4N0YL 4PREA 3NVQA 4M7JL 1X7QA 5ACLA 5ECJE 1OLZA 1FCGA 3BHBB 5INCB 4AH2B 5IMKB 2O93L 5K59F 3NFPA 5FDWA 4I3RH 4M62H 4NCC2 2WIIA 4HS8H 1GGIL 2DS4A 1D5MB 4DQOH 4PJ5B 1V3KA 1MWAL 4HKXB 4JCMA 3CLEH 1FFPB 1AH1A 1WVZA 5EPMA 1BLNA 4G8FA 3QDGA 1JI1A 5TDPA 4N0CD 5K9OA 4K55A 3MRFB 1S8DB 2UZIH 4X7TA 3SDXF 2JB6A 4GRWB 4QHMB 5BS0A 5CIPB 2D3VA 3HC0B 5EZLA 3CUPB 3O2DL 3HRZB 3JSSA 3QUMA 5AUMB 1AGBA 1AC6A 4QNPF 4OQTA 2W07A 4J3UA 4QRSB 4RFNB 3OG4B 4N1EA 4LFHD 5ESAB 1V3LA 2IBGA 1RIHL 3CH1B 4M9OA 4NFDA 1RUPH 4NP4L 2WINA 5L8KB 3FJTA 1GPOH 4L9DA 3IXAA 1BJ8A 2DD8L 1DANT 2BNQD 4Z78A 3ARPA 4L4TA 1AI1L 4EDXA 4N9GB 4HHAB 4PJ7F 1H9VA 1QP1A 4MZ3A 4XAKE 5F1NA 1U8NA 3QIBC 4PJHE 5HD8C 3FMGL 1T83A 3VRLF 3CCHB 4X5LA 5DRNB 4S10A 3C08H 1D5XA 2D9CA 3P11L 4PJCE 3FO1B 2HVJA 1DBAH 1F45A 5EA0L 4ELME 1DLHB 2J8UF 1UWEL 1EHNA 4U3CA 4TUOB 3QXUA 1AHWB 4LU5L 1N2RA 4KUZL 2YOCA 2A6JB 1JPGA 3HE7A 1DQDH 5CSZB 2C4FU 5C7XL 3DUUA 5E8EA 3QQ9C 1A1MA 1SBSH 3ZHDA 4Q9QL 1WTLA 3NN8A 5DD6B 1BJMA 1QSFA 1KNOA 3ET9F 4HS3A 4ODUB 4CMHC 2WZPD 1J1PH 3D3VD 3TN0B 1A3LH 3QZWA 3TGXA 1DVFC 1LO0H 4UIKH 4PJIA 4DKEH 2FL5A 3EYUL 4FXKA 5L2KA 2HTKC 5DWUH 1JJUA 3S8WA 2LVCA 1NAMH 1S7WA 5EBLA 5KSUB 1FVCB 5IJKA 5DJ8B 3JWOL 3PDOB 4R3SB 5D71H 2AXJA 3KPMB 5EOQH 4ORZC 3UO1H 4HGMA 2QQLL 3MOAH 4V1DD 4PLKD 3RGVC 5JHLL 1E4WL 5E00B 1QBML 4PJGF 5C07A 5B4MC 2YA1A 5E94B 1P7QB 3H9ZA 1K3IA 4Y2DC 1I7TA 2ICES 2PO6C 2F58H 2GSIB 4W6XB 4G6JL 2MKLC 3MLZL 4ODWA 2GT9B 2ZOLA 1NEZA 1LP9E 5GHWH 1LDPL 1X6NA 3VMNA 5AD0B 4IJ3C 4AIZB 1A1OB 2G60L 5D7LD 3VDBA 4PY7A 3ZKMD 1FZOB 3LCYA 3F7RA 3P4OB 1Q72H 2VYRE 3OG6B 2NX5A 1KEGH 3TT1L 5CHNB 5D7IA 1CLOL 3O9WA 2BVPA 2ARJQ 3ZYIA 2BHUA 5DJ6B 3FKUS 2BVEA 4C56D 2H8PA 1RZGA 4KRPB 4PR5B 3O2VH 1GGTA 4LLQB 4FTVE 4DFIA 4Y19A 1YYLH 4WO4B 4OF8A 1I9RH 3IF1B 2V7NA 4D94A 4IOFD 3NFNB 3OWEA 2VLRB 5EO0B 5I1HL 4ZOEA 4HPOH 4DGVH 5FYJE 4NT6B 5IHBA 1CVRA 1JMZA 1OSZB 1T03L 4E5XB 2C1OB 4UT7L 5HGDA 1ZMYA 1T1ZB 3MLVL 3WLBB 5IROC 3D69A 1G9NC 1MELA 1R5IA 1C12B 1Z9LA 1UCTA 5J6GB 5EU6E 3VRIA 3VRJA 1PLGL 4EN3C 4N5EC 5F7NC 1YEHH 2FJHA 1KCUH 4NKOA 1OGTA 1J5OH 5EUKB 2NY7L 2NY6D 4XNZB 1P2CB 1QBLL 3LN9A 4X8JB 4YX2L 3PXJA 4YDIL 1A4JA 4F2MA 4CDGC 2F53E 2NY3B 4CDHA 5LVEA 1TLKA 3BIAX 5B38A 1FL3B 2WWMD 1QO3B 4TRPH 5EZIL 2ADJB 2CMRH 2VXSL 3ME0A 2NY4B 1WZ1L 5I1GL 3FQWB 3HNTL 3IDIA 1T7YA 2XZQH 4KFZC 5EC1B 5FECB 3QEGL 4BFBD 2J2ZA 2E7BA 3N1MC 3EUUA 3VCLB 2UV3A 3VXTA 3QIBA 1KB5B 4F7MA 3B9DA 4ZAKA 5DQ9A 4G5ZH 1JPSL 1IM9D 3ULVH 5CINH 1H3XA 1IZKA 3IRZA 3MRPA 4NYLA 3LKSA 1X5YA 3AS3A 3JTSA 4F9PA 5I15L 4ZFZB 2ZUSA 3RZCD 3REWA 3RDTC 4ZFOL 3K46A 5M7QA 1QSVA 2ZCKL 3OGCB 4XVUC 1TQBC 4KHXL 3P30L 2PYFA 4OFPA 3ECBB 3B2UC 3VFRB 1L0XA 3BPNC 1B9ZA 4HUVB 2ADGB 3VE0A 2KZWA 3EIFA 1F6AB 2A6KA 2H26A 2IFFL 3BZEB 4FA8A 3CFIC 5F44A 1HK6A 3QISA 3ZDZF 3L3JB 3T04D 3IKCB 4G9FD 1HIMH 4G8GD 2VXQH 3A6CL 1F13A 1ZANL 3C5ZB 1OGAB 3QWOA 4QF1A 4FQCH 4KKLD 1MFBH 4QHLB 4JPIB 1GIGL 3M45A 3CFJB 1P5UA 3TBWB 5AYUL 5HHOE 4B41A 3QCUH 2HH0L 5E95B 4TNVF 4UT6H 5GRVL 5D2NA 2F8OA 1W0WA 1WAAF 2H2SD 2CR3A 3HI6L 3CFKB 4NHCL 4Y2DA 3NPSB 1TZIB 3D39E 2PO6A 3P0VL 3DNKA 2B0SH 5HYQA 3QXVA 5JXED 5I8CA 5HI5D 4JKPH 3VFOB 2BOCB 1N4XL 3WL9A 3KLAA 4TOYL 5F88B 2XQBH 1CE6B 3AXLA 3HPJA 3U7YH 1HHJB 3QUZB 3CMOH 1MHEA 1Q9WA 3NIDF 3OHXB 1LGVA 2H32H 4WU5B 4NKMB 2Z8SA 4NBXB 4JB9H 4Y4KD 2QHLA 5A40E 1FZJB 5D72L 3C2AL 2F54A 2LU4A 4CRPA 4ZFFB 2HTLD 4BQ8A 4HX1B 2O5YH 1KPUB 2XY1A 5EU5A 3VG0H 3U0PB 4R4FL 1ZEAL 4OCSL 3K8MA 4OD2B 2VLJD 3CIQA 2FATH 4P57A 2H9GB 1V7ML 4JPVH 4JFZL 3T1WA 4D9LL 1IJ9A 3QFDB 5L2JA 2EO1A 4G7VH 4DAGL 2EXWD 3GGWB 4PRHA 1K4DB 5JXAL 2P5WB 3NIGF 5FYKE 3H9SA 4JANA 1K5NB 2ZUUA 5F9DC 2XT1B 5IROA 2EIZA 5D2LB 3ARYA 1VESA 4OGXL 4NO5A 5ID1A 4NZRH 4N0CC 4JFFB 4TSCL 4HKJB 4KROC 3T3ME 2WBJC 5E8PA 4LOUC 1JF1A 2FLBT 5DD0L 2BERA 5I30L 3UTPD 1YNKL 4TSAH 3O6FB 1PKQE 3ZE2F 4PJ5D 3ROOA 2AQ2A 3QUKA 4JQVA 2Q8BH 3VXRD 3WXVL 4NQSB 4YDVB 1BZ7A 3ZO0A 5T3XE 4LBEB 2C5DC 2OXGA 3HN3A 3LQAL 3FB7A 1JGEA 5IHUH 2XWBA 3PQYE 3WIIL 4GKOA 3X13B 1CFSB 3ILQD 1CXHA 4MXWH 5F8QC 4Y5YB 1EPFA 1RK0A 3NCJH 3S98A 3LRGA 4MA8L 5BV7L 3AS0A 4KQ4L 5CJXC 1PGRB 3BQUC 4NRZB 1WFTA 4RGND 4MAYC 3DX6A 4NN5C 4PP2B 4LVEA 1EZVX 5J11C 3V0WL 4HCRL 2NW3B 5CJOL 5GZNC 4MA1C 5IHZB 2XNAA 5GRJH 2YPKA 3QIUC 4JRYE 4XVJH 2VH5H 5ISZA 4YHLH 4DEPC 3RDTA 4NWTL 1N3NB 3TPKA 1T1XA 1U3HB 3PWJB 3QPQD 4OLZL 5ACZB 4YZFE 4LCUB 1I1AC 5J06A 4F37K 2WW8A 4HK3J 3TP4A 4GRWF 1NCNA 2ZCHH 4ZTOH 3HE6B 1KIRA 1PZUB 2D7TH 2F5AL 3L3DB 3RVXD 1WZMA 4GRWH 5CIPH 5CMAB 1RUQH 3F7PC 1IT9L 3BT2L 4OCXL 2ZZUT 4IMKC 3O3EB 4YXKH 4PRDB 1JTOA 2Z93B 5FHAL 1BP3B 5EOCJ 4OZHE 1MCCA 1R0AH 3X3GH 3MV8E 3BUYA 1P1ZA 1QPXA 4KK8C 4PRIA 5MENE 1JNHB 1MLBB 4XC3L 3RIAF 3HZVA 1LEGA 5DUBB 3MLUH 4XCEA 5CKGA 3D85B 1J1OL 3SE8H 4DKFH 1LNUA 1N5AA 4TTGA 4FZ8L 4W4NA 3V7AG 5EORH 4MJIB 1NMCB 4AG4H 3Q5OA 4DOHE 4BZYA 5DFVD 3TIEA 2O5XH 1KC5L 1YN6A 2EH8H 4ZOBA 5I18H 1XGRA 1NFKA 1T0MB 2VLMD 3WLWD 5IBUB 1RFDL 1BQLH 3W9EB 1MVFA 4WFED 2A73B 5E1AA 5LGJA 5CEXB 2RFXB 4JFPB 5E2UL 3V5KB 3ZTJH 5F1IA 3ARRA 3OTTA 4HS6B 3SDXA 5E2JA 2DN7A 4RWYL 1A1NA 1FGNH 1T20B 1NUGA 4YK4C 1UM6L 5FO7B 1EO8L 3ZTNH 1EJOL 4JFOA 4IOFC 3MV11 1WC7B 5M94B 4MS8C 5JPMB 4ZNEA 4YHPB 1X9QA 1EUUA 3SKJL 3C5JB 5I76B 3DX7A 4ONHB 2QSQA 1ZHKA 1NC2D 3DV4B 2Y36L 2IALA 2J6EA 3SDAB 4M6OL 2YD7A 1D3CA 2A9NL 3BZFA 4PJ7A 1J05A 4KRPD 1M1SA 4HD9A 2LVEA 1HCFX 4WO4D 3NFSH 3B2VL 4JGMA 3LEXA 1Q94A 1ZA6A 4WU7A 5HVGB 2VLRD 3UJIH 1FDLH 1FC1A 3QT2A 4POZC 3HZYA 1MWAB 1L6XA 3ETBF 5HYJD 2WBJA 4QHKI 5EBGA 4XPGH 1DDHB 2J8UA 4W6WB 1ES0B 5TQ2L 4M1DH 1A6TB 5IT2L 2EIEA 1XR8B 4C57C 1IARB 2ZNXA 3OAYK 4JPKH 5B21A 2DB8A 2HVKA 3IRPX 1BEYL 1QFPA 4LASL 5KVEH 3TO4C 1NBYB 4KQ3L 3H9HA 1UFUA 3IJSA 4Q2ZA 3QDMB 1IM3A 2BNQA 5L8LB 3E0GA 3RL2B 4K3GA 5F9OH 1J8HE 2SEBB 1MHHB 4OZFH 4RRPA 2EDTA 5HYSB 3ROLB 4YE4L 1EHLL 3EYVB 3MUY1 5ANMA 1H3PH 5CJXA 1R3KA 1XGQB 2AJSL 3BQUA 1OF2B 3MRJB 3MROB 5FA4B 3VH8A 4OAWB 2NY4D 1AXTL 3V5DA 1IC4L 4X5WB 3PV6A 4EUPB 3G04B 5I8KH 5DJDB 3TBYB 3DO7A 1Y18B 3LHPL 5J0BA 3PV7A 4CUCA 3UTQB 1S9VB 4LCIL 3MOBL 2CXKA 4KK6C 4PJBE 4PJGA 3TA3C 1QRKA 2E27H 4U6XA 1T2XA 3QAZB 3AU1A 1I1AA 3BH9A 2EDBA 3FN9A 3FO2B 1BECA 4ZPVB 3TBVA 4E41D 3V6BR 4LQFH 3SY0B 4LIQH 2NCMA 4YFLI 1JNNH 2IPUG 5IV2A 5B3JE 3O4LA 3D3VA 3WO4B 3RIFK 2R1XA 5FYJL 3LB6C 2KH2B 2Q6WB 3S5LG 4S1DD 1WBXB 3HCVB 4F15C 3G5XB 3IJHA 2VABA 2YPLE 2VLLB 4JFEB 4DGIL 4PJ9D 4MNGB 1IGML 3UPCA 5KOMC 1ORQA 1NQBA 2X4UB 2BY1A 3VXME 1S9KC 3ZT5A 4MJ2A 3MXWH 1RHHA 5HGBB 2IPKB 5CBAB 4V1DA 1LD9B 2FYYB 4X4XB 5SV3A 1NDGB 3QEQE 1S7RB 3BDXA 5FB8B 3C5ZD 1KIPA 1P69B 1FC2D 1TJHH 2X4RB 3VWKB 2OSLB 5F9JB 1FVDB 2DBJA 3MOQA 3L9RA 5E6YA 3IGAA 1KB5H 3LKOB 2GUOB 5HI5C 3LIZH 5FYLL 1EHXA 1KG0A 4WCYL 5CEZD 4XHJC 4PRBB 2XN9B 4R0LC 5D7LA 1LEIA 4FQXB 3DETC 1PX4A 1PYWB 5IK3B 3EOAB 2W9DL 2AQ3A 4G42B 3W9DB 1OTUC 4NQVB 3SBWA 1MIML 2HTLC 4RGMB 1Q1JH 5DHYA 2AV7A 3BEWB 4GQ9L 3FAXA 3F7VB 3VFSB 2ICWA 5DRZB 4HGWA 4C56A 4AM0B 2H1PH 2OX5A 4NO2A 1W72H 2YRLA 4K71B 2YK1H 1XR9B 3QDGE 4GKZB 4PYHA 4YHKH 3QUZD 3P0GB 1X5AA 4HPYL 4ZS6C 4G6AD 3GKZA 4TVPL 1S7XB 1TZHB 2ADIB 1OPGL 3RTQC 1YMHA 2R4SL 3VW3L 4HF5L 4NHUB 2BJMH 2CIIB 4HWZA 5I2IA 1IGJA 5E08L 3VXSB 4L3EB 5D5ME 5LGHL 1IE5A 5HDBF 1MCOH 5C0IB 4HUXB 1NCWH 3VI4E 5EU4A 5KSBB 2OTUB 5KSAB 3Q6GH 5F71A 3UTSE 3GIVA 1JV5A 3O4OB 1BX2A 3GMLB 5E70A 5ETUB 2QBWA 1IC5L 1MFDH 2I25N 3BE1H 1OAUL 3UYRL 4JN2B 3MBEB 2C4FT 2PTUA 2NNAB 3NA4A 3MFGB 4G8IA 4LLUA 5IM7A 3RAJL 2ZOKA 4X7FC 5C0EB 4JFFD 2E3VA 5CP3A 1QR4A 3KPPB 5EIIB 4HKBA 4K94L 2C1PB 3ILQC 3CLFH 2IBZY 3UPRB 1JTPA 1A0QH 3HPLA 5DRXA 1HYSC 4OLUH 3MRGA 5KVGL 3DECA 3SKUD 1JPTL 2GJ6B 4LRIA 1ZSDA 4MCYA 3TYGL 1WUNT 2VAAB 1IM9A 3MRMA 1T6VN 3BW9A 2OMBA 5T1MB 3T0DA 3MMEA 2HKFL 1QA9A 4Z7WB 1A3RL 5BQ7A 1P4BL 1XIWC 3KYMB 4G80A 5H35B 3BMVA 3RZCA 1QQDA 1R3HA 4X7DC 5D2LF 5I73C 1SYSB 1MHPL 1VDGA 4QOKD 3ARSA 2RHEA 1WAAA 1F90L 1NBZB 3GNMH 5L2KE 5EUOB 4WTXA 4HK3N 3B3IA 4PLJC 4BA8A 4XNUL 1YEEH 4ZFOB 2CUMA 1U92B 1NBVL 4CW1B 4G9FA 4G8GA 3TNNB 4QXUH 4ODSH 1F6FB 5MEPB 1DJSA 1IGYB 5GGRB 1CI5A 1AHWC 3B9KB 1VEMA 4LLVA 2ICWJ 2VDPL 1QUNA 2V5YA 1R3JB 2C9AA 1U3HD 1XH3A 2VDRH 2AXGB 5FYKL 2P7TA 4BH7B 3IS1X 2ESVD 2JK5B 3LOWA 1W8OA 4L9LB 3P77B 2OL3A 1OWRM 4NO3B 2H3NA 5JLZB 4WEBH 5DFWH 3HE6D 4XMLL 3RY4A 2AKRB 1A9BB 2C4XA 3MLYH 2WLZA 5IQ7L 3TN0C 4U1LB 1VFAB 3VXNB 1LO4H 1MCSA 1N0XH 2NX5E 1TZGL 3ZTJG 4NKDB 4P2QE 3HUJB 4Y16B 5JXEA 4UU9A 1IAIH 2Y07L 1E28B 4HIEB 2GAZB 4LEXL 3DIFB 5DFVC 5JHDB 3RI5K 3TPUB 3QCTL 3FFCB 3MRIB 3OMZA 5T3XL 2NY0B 4R0LA 1UADC 1OSPL 4HXAL 1MF2H 3RUGA 4LSTL 1RURL 3R1GH 3SQOH 3MSPA 3GJFB 3HR6A 5B8CB 4YDJB 2Y5TA 1CR9H 5JW3H 3GSNA 3O6ML 4Y4HB 4KMQA 3IS0X 4MJID 5J1AA 4PG2A 3DX8A 3JV4B 5T33H 2DI9A 4AT6A 2ITDB 4IDLA 1MUJB 3M8OH 2VLJA 4M5YL 3U6RB 5KVDL 3WHXB 2QSTA 4ODHH 3O6LL 3QCVH 3O11B 4U7SA 1I3GH 1G7MA 2IH1B 2MTPA 4GLRI 1UM4L 4QHNA 3F5WA 1LWRA 3QG6A 4BUGA 3RTQA 1IEHA 3MRKB 4R4BB 2BRRH 4Y5VA 4MSWA 1AIFB 1MLCB 2J3SA 1DBML 3TJHC 3LPGA 3BHBA 2FZ3A 2R0WH 5INCA 4JE4B 1S7TB 4WO4C 5IMKA 3IU4L 5C0CB 5F96H 4WTZG 1U8IB 4AMKL 3OKMB 4TNVK 2IPUK 4Z5RA 1FO0B 1DP0A 4E42B 3AGVA 2QQNH 2QADD 4OZFG 3RWGA 5AAWA 5CZXD 1D5MA 1MIEH 4PJ5A 2V2XB 3UJTH 5J8OA 1A7PH 1WIUA 2X9XA 3SDAD 2EE9A 4QGTA 4TN9A 3SDCD 4JRXE 3T4AA 1FFPA 5GGTL 2IANB 2CH8A 1AY1L 1HSBB 4N8PA 2JB5L 2AS5M 4OI9A 3TF7C 3HMXL 4FP8H 1VA9A 5IF0B 3CAFA 1BZ9B 2OBGA 1S8DA 2XZCL 2HRPH 4QHMA 4P2RD 1JN6B 3PL6D 3QWQB 5IFAH 1ADQH 5AUMA 2PKDA 5IESL 2BVYA 2NY3C 4C58B 4LSRL 4QRSA 1DQLH 5ESAA 4PJFE 3WJJC 1QFWH 3OB0K 1JI2A 1YEJL 3ALPA 3CH1A 4JJHA 4LKCB 2NY4C 4RA0C 1FFRA 5IMMB 1MRCL 3QDMD 4CVUA 1S5HA 1NCAH 4HHAA 1A5FH 4TYUA 1MCLA 3AM8C 2EYTB 3N85L 4XB7A 1NMBL 3GRWL 4OZIB 3HTLX 2EEBA 3CCHA 1QACA 5DRNA 4NSKB 5D6DC 3EYOB 1HI6B 2CO7B 5FCUL 4HV8B 4OLEA 3FO1A 1E6JL 1DLHA 1HOCB 2ED9A 2H45A 5ESVB 2OR8A 2A6JA 4S1DC 4E0RB 1EEUA 4U1IB 4PJEB 3T65B 5I1KH 1T66D 2AI0L 1H8OA 5LWYH 4DVBB 1RIVL 4GSDH 4S0SD 5CSZA 4R8WL 2A1WH 2HP4A 3T3PE 4X5XA 2OJZH 1LVEA 1ETZB 5SWZB 2APBA 3BSZH 1PVHA 2DQEH 4YHYB 4XMPH 5DD6A 4P46B 2R1YB 4XBEL 4WDIB 3F6IA 3CXDL 3OKNA 3W2DH 3DTXB 1FQ9C 3TN0A 1L6ZA 1XGUB 4ZUWB 4WFFE 3QULB 4JFED 4HWNA 5KSUA 1FVCA 4OV5A 2X1QA 5DJ8A 3PDOA 4R3SA 3MREA 3PWLB 3KPMA 3MRLB 2W1NA 3QUYB 5E00A 1A6ZB 5BVPH 5C2UB 4HUMB 2GK2A 5E94A 4I9WD 3ARGB 4FFYL 3NPSC 1IGFH 3GM0A 5GS0H 4HUWB 3VWKD 3JUZA 2Q87A 2I07B 2GSIA 5C0AE 4MNQB 2FLRT 1UWEH 2PW2B 4ZSOB 2EICA 4QXGL 5DZLA 2LTQB 1E4XH 5AD0A 3OKLB 2LE9A 4NPYB 3WFEH 2CK0L 4AIZA 1AJ7L 1A1OA 2XKUA 3HR5B 3MCLL 4KK5D 4C83B 2OQJB 4WW2A 5IHLB 1FZOA 4FQXD 4GKNB 1F58L 4HIXH 4U1GC 2W0FB 2JJWA 4PJHB 3NABL 2DLFL 4XVTH 3OR7B 1KJMB 5CHNA 3VFMB 1NC2A 2VZ3A 1ZGLP 4Q7DA 2AAVA 2B8OT 5DJ6A 1N6UA 1ERNA 1WK0A 4R2GB 1T1WB 2DJ4A 4PR5A 1QFUH 1U3YA 5HI3C 3U2SB 1F3JB 4WO4A 3B5HA 3IF1A 3NFNA 2VLRA 5BRZB 5EO0A 5GRUH 1Q0YL 2YS4A 4NT6A 1ZOXA 1OSZA 1KJ3L 2B1AL 3T2NL 3UTTE 4EDWH 3IFLH 4CU8A 2OJEB 3CU1A 4E5XA 3MODL 3WLBA 3RIAK 3G6JB 4X9FA 1Z9OA 5J6GA 1QBMH 1MHCB 2IGFH 3VXSD 1CFTA 1LEKB 5E4EC 4OCYL 2VDKH 2F19L 1HDMA 2C3WA 5I1JL 5DT1H 1VFBB 4NN7B 5E7FA 5EUKA 2VDOH 3O6FC 3WD5L 2IPTH 4X8JA 1LDPH 5D8JH 4POYA 4XP1H 2UZYB 1LK3L 1IAKB 2QEJA 4XVSL 1FPTH 1FL3A 1N5YL 5AG8A 3D18B 1IRAY 2ADJA 2GEEA 2EDLA 1FRGL 4XC1L 3FQWA 3C6LC 1B88A 3G5ZB 3WBDA 4Y5YC 5FECA 3E1F1 1J7VR 3LS4H 4DK6A 1KB9K 4XXDB 2RCSL 2OK0L 5DMIH 4LVOC 4N8VG 1NCDL 3AM8A 1HQRB 3MV7E 1LP9B 3VCLA 1QNZH 5KSBF 4NQEE 4NM8H 4R9HA 3SE4A 5AZ2L 2PCPB 5IEHA 4OT1H 1JWUB 4ZFZA 3U0WH 1XF1A 4BSWA 5F1SA 5C6WH 4NM4L 3SGJC 4I2XA 3ARWA 2E8YA 3OGCA 4I0PD 1PKOA 5ICZB 1U3HC 5K59E 3GMQB 1EMTH 4HH8A 4PJ9A 4FTVB 5IKCB 5CWSB 4HUVA 1YYML 3MRQB 2ADGA 2Z91B 3U48A 1CBVH 3HE6C 1JZ7A 3ZL4H 4JY6B 1JZ2A 2DQHH 3IKCA 2NY7H 5ITBL 5IR1A 1WEJL 1F4AA 3C5ZA 1OGAA 2IMNA 3PG2A 4YPJA 1MRDH 3G6AB 3QXTA 5F7FA 4QHLA 2VL4A 4JPIA 2X09A 3CFJA 4FFWC 1FHGA 3TESA 3TBWA 4Z7WF 1ZLUH 4Z6AT 4K3EH 3RVTC 4QRRE 1WV7T 2Q1EA 2I5YL 3QEGH 4MDIB 3KJ6L 4UQ3B 4FG6D 4W4OC 5MEOB 1UKQA 1D9KB 2W60B 4QNPE 1VB9A 4NZUH 4Z7QF 5ELIA 4Z7VB 5I0ZA 5GSVA 3TBTA 4BH8B 5EUOF 4NBZB 3KS0H 5BO1L 3EOTH 4RIRB 1A6UH 2VERN 5I1LA 5JDJA 1JWMB 4PRPD 1NLBH 4MX7A 4Y16D 3VGAB 1OQOA 2OLDA 3H3PH 3FRUB 3KPNB 4X9BA 4NNYB 3U1SL 4P3DB 3AFLA 4XGZB 4PJ7E 3FFCD 4HLZH 3BVNB 4PJAB 5F88A 2NY0D 3ZSTA 5HDLA 3P30H 3QUZA 2Q3AA 4KHTH 1NFIB 4WU5A 4NKMA 3VRLE 2W38A 2K7PA 2XG5A 1S78D 4HBCH 1FZJA 3HI5L 5IQ9B 4PV9A 5F7LB 4ZFFA 2J8UE 1E4KA 5HHPA 2BOBB 3O8XB 4P59H 4RISH 4F8QA 4HX1A 2AGJL 1KPUA 4PTTB 1R24B 4R4NC 4UTAL 3U0PA 1JGUH 4OD2A 1URLA 4YHMH 1OTTD 2H9GA 4U1KB 1GIGH 4HZLB 4J7RA 2R0LL 3HUJF 3T77B 3F65A 3QFDA 1UZ8B 3GGWA 2B2XH 2FHFA 1K4DA 5CZXC 2P5WA 4GG8A 4HEPG 4JDZB 4HUUB 3SDAC 1K5NA 4TVSa 2I60H 1Z5LB 5ANME 5D2LA 4KPHH 4IS6B 2YEZB 1OAXH 1I8IB 4YAQB 4JFFA 2QQKL 4QRQA 3D48R 4HKJA 1KJ2L 3ZT7A 3L5IA 3WNNA 3LEVH 4Y2OA 5HHOB 5L8JB 2IWGA 4IBLT 5DURB 4F57H 3VI3F 1A21A 5FM5M 2VWEC 3V6FB 5JPNB 4WI4A 2AJVH 3BOVA 4NQSA 4YDVA 1S5IL 4LARL 5DYOB 2I26N 2Z4QB 4LK4A 4MHHG 4LBEA 4ZQKB 5F7UA 2IAND 5INDB 1P6FA 2J4WH 4JY5L 4XBGB 2DJUA 2YXFA 3X13A 5C2BH 3D39B 3IVKB 3BDYH 4OD3H 3O4LE 4QOKA 4Y5YA 5I66B 4JREB 4GAJH 1M7IB 3WFCL 1GC1H 2V2WB 4XNYH 2J8OA 2K1MA 3V7AE 2HN7A 2FGZA 2HG5B 3I2CL 4HWBL 3BP5B 4BZ2L 4LHUB 4NRZA 4TUKH 2G2RB 2ZUVA 5HVWA 4EBQH 4UOJA 1G9MH 4PP2A 4MNHB 1KN4H 3U4EA 3QJFA 1AGEB 1RI8A 2NW3A 5IHZA 4V1DE 5EZOH 3N0PB 1BIHA 3DVGA 1FO0H 3RZWA 2XXMB 1T21B 1SMAA 3SGJA 5GS0C 1FZKB 1T66C 1VFOA 1H3UA 1N3NA 4OFIA 1U3HA 3PWJA 1WBZB 4TUJA 4B7IA 3QAZC 5DA0B 4TSCH 4HC1H 2IH3B 4OQ1A 3OF6D 2ID5A 3HE6A 1K6QH 5D7JC 4DUVA 2YSSB 4JPWH 2ZPKL 5D7LE 4L8SB 4LSQL 3TZVD 1WICA 3L3DA 5D4QA 4P23D 5JTWA 5CMAA 1U36A 1T80A 3NOIA 4HT1L 1ZXQA 4EIZC 2P43B 3O3EA 3GO1L 4PRDA 2XRAH 2Z93A 3U83A 1BFTA 4CVZB 2F74B 3KWWA 3MUGB 1N6QL 3HMWH 5C08E 3SN6N 2BNRB 2MCPL 5JR1L 3MLXH 4FZEH 4MXVF 1I4FB 2VZUA 2FJGB 4P46D 5KOVC 4RSVA 4JFDE 1S9WA 1ZAGA 2MSPA 4UINL 4W4OA 4KH2A 1JNHA 2WWKT 4OZIF 3IXTA 2N7AA 2VC2L 1T7ZA 4HUKB 4LLMB 4X9HA 3QHZH 3L5JA 3BKYL 3MZGB 4MJIA 1JF6A 1KN2L 4NJ9H 2V7HB 4JHAH 5F7KC 4HCRH 1YMME 1U8LB 4S1RL 5AAMA 4R7DB 5D93B 1AKJD 5JDSA 4CBPA 7FABH 3SEPA 3X3FL 4OJFL 1T4KA 3ULVE 2BY3A 2GI7A 4FQXC 2L7UA 3W39B 3QUYD 3O3DB 1B90A 1SM3L 5DR5H 2GITB 4KVCL 1CL7L 3GSOB 5I1AA 4G7YL 2DQTH 1NCBH 3ARGD 1XF2B 2A73A 4LSSH 4O51B 3DVNB 1GGCH 3MBXL 5A2KH 2RFXA 4RGMC 5CEXA 3V5KA 3FQNA 3QNZB 2LABA 4AEFA 1FGVL 4PGCB 4MVBD 3RL1B 4HS6A 1QEWB 1I9JH 4XPFH 3QO1A 1T20A 2XZZA 5FO7A 4Q9RL 4JRYB 3SE3C 1GCFA 3OXSB 4LAQL 1DBKL 1WC7A 2VOTA 5JPMA 4RMQA 1JZ4A 4K8RH 4XAKD 3KLSA 1F4WH 3UZVB 3BZ4A 4F58H 4AIOA 5I76A 4ONHA 3ZDZE 3VGFA 1ZGLM 4C4KT 2FEEI 4ZDHA 3QA3B 4ODVL 1A7NH 4X6CE 5K9KB 3SDAA 1JRHH 3SDCA 1KCVL 4KI5F 2NZ9D 4R2GD 2UWEE 5TPWL 3GI8H 5DQDL 2DBLL 4NRYB 4G6MH 2NYYC 4KMTL 3NCCB 1DBBL 5KSAC 2DYPB 5F7MC 1ND0B 5F97E 2EE6A 3V6OA 1MWAA 3O4OC 1A6VL 4P2RA 3PL6A 4YWGL 4OZHB 1DDHA 2EDYA 1BM3L 1A6TA 3MV8B 1YEDB 1NH6A 3MBEC 1XR8A 3SDYH 3RU8L 1U3JA 2A9ML 4OSUL 5DUML 3DURB 3H7LA 2XFXB 1NBYA 3AS1A 2R15A 3QDMA 5EOCL 4PRNB 1KCLA 3RWHA 3RL2A 2EDOA 3MCG1 1MFCH 4Y4FB 2XTJE 1MHHA 5I16B 2BVQB 3D0VB 3L3IA 5HYSA 4I4WB 3ROLA 1KCKA 5D70H 1BAFH 3NIDE 3P40A 5HJ3B 4O02L 1XGQA 1RHFA 5B39A 1OF2A 2XIDA 3MRJA 1G9NL 4OD1L 4PJ8B 3MROA 3UAJD 5FA4A 1NAKL 3WIHH 1GGBH 2BSRB 3T2PA 2DL9A 4XP9H 5LXGL 4X5WA 3G6JF 4EUPA 5DO2D 3G04A 3GMRB 3K80A 1V3MA 3UPAA 3TBYA 2AEPH 1PG7X 5HSFA 1Y18A 4XI5C 1CG9A 3WFZA 1BVKB 3UTQA 1S9VA 3HB3C 2J88H 5GS2D 2PUQT 5A2JH 3MRRB 4LPWA 1SJHA 3FO2A 4XPBL 4ZPVA 3ZKSD 3SY0A 4KTDL 3B9KC 3UBXB 3DI3B 2WMPA 2YA0A 3ZMRA 2ZUXA 4WI2A 2W92A 5JQ6L 3S9DB 2Q6WA 4ZD3L 1U95A 1WBXA 3HCVA 3G5XA 4NZDA 3THML 4JFEA 2VLLA 3CK0L 1JWSB 2G75B 4FTVD 4L9LC 3T4YB 2D7OA 4GW1A 4UTBH 4K07A 3QXAB 5BOZG 3REVB 2X4UA 4YXLL 2WNGA 5HGBA 4FG6C 5FYJD 1EFXB 4GBXC 1LD9A 2ICWI 1KXQE 3QIWB 2EXYC 2FYYA 1QVOB 1S7RA 4OGYH 1JF5A 1QSEB 1WBYB 4ORGB 1EHAA 3VWKA 2OSLA 2XI9A 5F9JA 5GS2H 1FVDA 1L0YA 1XGYL 3I9GL 3I84A 5T1DH 3LKOA 2GUOA 2DIAA 1JNLL 1H0DB 4QT5B 3I6LE 4GMTH 1YPZE 1TQCB 2NY0C 1JHKL 4PRBA 3N1GC 5EO1B 4OUOA 1J8HB 5TDOB 4FQXA 3MLTA 5DEFB 1PYWA 1YN7B 5IK3A 3EOAA 4G6KH 1S78C 4G42A 4AK1A 3W9DA 5B8CC 4NQVA 3G6DL 4FQQA 4JHWH 1MREH 2YBRA 5HGHB 1B0RB 4J3VA 4Y4HC 5FYLD 5FOJA 3BEWA 2EDFA 4Y5XB 5I0DA 3PP3H 5DHXB 3F7VA 5AWNH 3VFSA 4AM0A 5D7KE 2VDML 5CP7B 3OX8B 3MQIA 3KHQA 1XZ0B 1YECH 1PAMA 4Q6IB 1XR9A 2EDQA 2VR4A 4H1LH 4GKZA 3ZSSA 2L0DA 1CFNB 1N6VA 1I7RB 4XMKH 3W81A 4GRWE 1TZHA 3TCXA 3TNMB 2ADIA 4I3RL 1TTGA 4M62L 1KTLB 1GC1C 3L7FB 4HS8L 3O8XD 1QG3A 4DQOL 2JELH 4Z7VF 3VXSA 4HAFA 1JMXA 4HUNB 2B39A 3CLEL 2RGSA 4EI5B 4TVPD 5C0IA 5KSBA 2PXYB 2OTUA 3BWUC 5KSAA 1FNGA 5F93C 4LMQI 1QFOA 1T0NB 2YPLB 3PGDB 1XT5A 2UZIL 4Z7NF 5ETUA 5FYLH 4L5FH 3MRBA 4NN6B 4PJAF 3O45B 3MZTA 2DAVA 5D9SB 2NNAA 1HH6B 2BP3A 3QEQB 4QRTB 3U4BH 5C0EA 5EIIA 2C1PA 4NFCA 3SCMC 4GFTB 3V9FA 1RUPL 4OGAC 2WUBH 4DKDC 3UPRA 5CGYD 5FEBA 1X4ZA 1GPOL 4LDLB 3FN0H 4GW4B 2HMID 5HHOD 3EYQD 2XA8H 4HKZB 3LQAC 2CD0A 5F3HA 4DKAA 4FQJH 2XY2A 2Z8RA 1IL1A 3PWPB 2VAAA 5CJ8A 3RFZC 4TPRH 4PGDB 5ICYB 5T1MA 3MR9B 4TVPH 5GZOC 3C08L 5F1KC 3KYMA 1MCNA 1DBAL 5H35A 3D39D 2HAZA 1NUNB 3VW3H 4HF5H 4UBDD 4I0PA 1JUFB 3E8UL 5FM8A 1EVTC 3S4SB 2R2EB 1NBZA 4M4RA 2Z92B 5EUOA 3TWCH 1DQDL 3C8HA 2BMKA 3LZFH 5FFLA 3RVWD 4MJ6B 4U3XA 1CYGA 5JW5B 4U2YA 3EJZC 4ZFOA 1U92A 4CW1A 1QR1B 5D1ZB 1SBSL 3TNNA 1IGYA 2D31B 5GGRA 3ZDYE 3WUWB 3B9KA 3P3YA 2FEEL 5IMOB 1DFBH 1R3JA 4O2EA 1J1PL 1F6LL 1A3LL 4ZXBB 2AXGA 4BH7A 1KGCD 4P3CH 1LO0L 1T89C 4MD5A 4UIKL 5D5MB 4DKEL 4L9LA 3P77A 3B5GA 1NGXB 3ARDC 3IYLW 4NO3A 4Y8AA 5JLZA 1NAML 4APQB 5KZCD 5TE7H 3UTSB 5IW1A 2APFA 1A9BA 3CXHJ 1ITBB 4K8RC 5D71L 5EOQL 3VFTB 3UO1L 5FYKD 3MOAL 1T7WA 5DZNA 1VFAA 4NZTH 3VXNA 3MJ8A 1Q9LB 3T08A 1U6AH 4X6DB 1FFNB 3CXHK 4NKDA 1QKZH 3AB0B 3HUJA 3T1FB 1WGOA 4Y16A 2F58L 3S35H 1ZVSB 2GK0B 3SGEH 1E28A 1A3RH 2GAZA 3DIFA 1VKXA 3CX5K 4G3YH 1OTSC 3FFCA 3MRIA 4M93C 2NY2D 3HAEB 3VA2C 1CDYA 3FL7A 3QUYC 4OKVB 5GHWL 1WFNA 1XGTB 4KI5C 3FT4B 3LEYH 1TCRB 3ARGC 3GBMH 3UC0H 4NFBA 3QQ3B 2AXFA 2BXYA 3GJFA 2OXHA 3GSUB 4YDJA 1Y6NR 5HGAB 1IEBB 5J13B 5T3XD 1KEGL 5JW4M 1YZZA 4CJ1A 1CVSC 3JV4A 2K7QA 2FWOA 3PQYD 2LTQC 4R26H 1MUJA 5E4IA 3U6RA 4Z9KB 2D4DA 3O2VL 1WISA 1NSNH 1YYLL 1I9RL 3V95A 3O11A 1TENA 4LIQE 2FO4B 5DK0B 2IH1A 2WLYA 1EUTA 5FKAB 4FFVD 3RWCA 2CKNA 4MA3B 3QI9C 4HPOL 1FJ1B 4DGVL 2F5BL 1SEBB 3L3KA 3C9NB 3MRKA 4MD0B 4R4BA 5DSCA 1MLCA 4ZOAA 1ZLUK 4AENB 2NZ9C 1HHGB 2HKHH 1S7TA 3S37H 5C0CA 4JRYD 4DUXA 3PXHA 4U4BA 2ARWA 3KYAA 1U8IA 5JO5A 3SKNB 1DN2A 1YEHL 1MQ8A 1UACH 1KCUL 4MCZA 1AQKH 3O3BB 1FO0A 5HHNB 4KDVA 4E42A 4XCNB 1Z2KA 2E6PA 1J5OL 5JOFB 4GG6E 2V2XA 2X41A 4KXZH 1PFCA 2IANA 4KRMB 1RURH 4D9RE 1HSBA 1B4JH 3CNKA 5I9QB 1BZ9A 2ENYA 1UA6H 1NGWB 4TRPL 5F7EL 2CMRL 4NN7C 4ZUVB 1JN6A 2FRGP 4P2QB 1WWAX 1H3TA 2Y9RT 2RR3A 5FGBC 2XZQL 4ZO7A 3MV8D 7CGTA 2J8HA 4PD4J 1OAZH 5L0QB 4GS7C 2R8SH 2DLEA 2M2DA 4YDLB 3WXWH 5MEND 3QUXC 4PJXA 2GYSA 4G5ZL 4PD4K 4LKCA 3ULVL 1Z0NA 4HWEH 5F70A 5IMMA 1WT5A 2ZG3A 4XNMB 5GS3A 3VFWA 5GPRA 5GSRB 4PGEB 1OGAE 5JZ7D 1XGPB 4LDEB 4EVNB 2EYTA 4I77H 4HH9A 6FABH 4OZIA 3OF6A 4YO0A 4HCRA 2E7HA 4NSKA 2DWEB 1RJZB 3EYOA 4HV8A 4ZYKB 4OZHF 5KN5B 3BKJH 3FOLB 4FN0A 3QRGH 5ESVA 4KV5E 1HIML 2VXQL 3R4DA 4E0RA 4U1IA 4PJEA 2P5EB 1OAYH 4FQCL 5GGTH 1MFBL 5HDBE 2ATKB 1AY1H 3S3PA 2X6MA 1K8IA 3MJ9H 1ETZA 5SWZA 1T89A 4JN1H 4QXWA 3QCUL 4H26B 1UXSB 4P46A 1U3ZA 4UT6L 1SVZA 2B1HL 3ZHKA 2R1YA 2VL5B 3C87A 4WDIA 4GRLB 3RJDA 2VITB 3SO5A 1HXYB 1G6RH 3PWNB 4RMVA 1XGUA 3F7YB 4ZUWA 1MCEA 1YEGH 2VSDA 2DDQH 3AROA 3RHWK 3CFCH 4JRXB 1NCCH 2DLIA 3Q3GB 2DIBA 2A6DB 3MRCB 1EEQA 2B0SL 2E9WA 5GISH 1HKLH 5IJVB 1AKJA 4UUJB 2X4OB 4YC2B 1I1YB 4WV1B 4JKPL 1TMCB 2MHAB 3GI9H 4TULH 3DBXB 1KLUB 1JFQH 1CDJA 1D9KC 1U8KB 3MRLA 4H1LG 1A4KA 3NZHH 3QUYA 3QIWD 1A6ZA 3OR6B 3U7YL 2XQBL 3MFFA 1QSED 3ARGA 3CMOL 4NUGH 4LGRB 4HUWA 1RIUH 2P5WE 3C8KB 4JB9L 4PJFB 3VGAC 4N1HB 4MNQA 2ZSWB 1IAOA 5GGSB 2WV3A 5DTFB 2IQAB 2O5YL 1FCCA 3OKLA 4NPYA 3VG0L 3HR5A 3FTGB 4C83A 3C2SA 2OQJA 1J8HD 4JFFE 2XACC 3N9GL 2FATL 2W91A 4GKNA 3JTTB 3E2HC 3I6GB 1DVFB 4PJHA 3ZHLA 1Q0XH 5KBNC 1IGIH 1X3DA 3OR7A 4G7VL 1GYAA 5DVNA 4PJCA 2AJXH 5TH2B 1T1WA 4M5ZL 1BHGA 1F3JA 1LO3H 3U2SA 1G1CA 1EBPA 1U93A 3RNKB 1T7XA 3RGVB 4IRZH 4WTWA 5DQJB 4JR9H 1BFOB 3K3QA 3QDHA 2OJEA 1H5BC 1IGCH 4OI8A 2NTSP 2DJSA 4JG1H 4M1CD 4HJGB 3G6JA 4TSAL 4NKQB 4QHUB 3WFBH 1MHCA 2Q8BL 1LEKA 1C16B 1RUKL 1GOFA 3NA9H 5BW7C 3BN9D 2PXYD 4M9PA 5IHUL 1WJ3A 4KC3B 1T5WA 3TO2B 2YPLD 3EYQC 3G08B 4O5LH 4QXGH 4KZEH 4MXWL 5FGBA 3U0TB 1AJ7H 3NCJL 5MHSE 4K94C 3QO0B 1N0LA 1MCWW 4OF6A 1IAKA 3MNVB 2BVOB 4ZPTB 2COQA 3QEQD 2R1WB 1PG7W 3D18A 2EDRA 2JJVA 4CNIB 2KQNA 3G5ZA 5C0AB 4JREC 3QWRD 5GRJL 4XVJL 4X83A 2VH5L 4YHLL 1XEDA 2X7LB 4WUUB 1LP9A 4B50A 4YNYB 4AYFA 4MB4A 4EN3B 2YD6A 4G9DB 4O2FB 2CR6A 5T1LB 1KJ3H 2B1AH 3KPSE 1DUZB 1U2HA 5J1TC 1JWUA 2ZCHL 1M71A 3IAQA 2D7TL 5E9DE 3EOYG 1SJEA 5KJRH 2Z0BA 3A6BH 1GH7A 1RUQL 3EJJX 1KXVC 5IKCA 4FTVA 5DA4A 5CWSA 4YXKL 3MRQA 4LHUG 5BCAA 3EJYD 1X6LA 3QDGD 5MEQB 4DN4H 3X3GL 5FUOH 4KKBC 1LMKA 5D1ZD 3UTTB 4L8SC 2VB5A 3MA7B 3D9AH 3RWIB 2B7DT 4EI6B 4P2OB 3CVIH 4HIHB 5TJWK 4BFEA 4XXCC 4IMLB 1MSPA 1LK3H 4A2MA 3CDGA 3MLUL 4ZXBD 2LFGA 1INQB 3SE8L 2X4SB 4DKFL 4OLYH 5C3TA 5EORL 3T0XA 4APQD 1S9YB 1DE4B 4MDIA 4UQ3A 3UTSD 5MEOA 2YD8A 4NKIH 1D9KA 4D9QD 2O5XL 2W60A 2VZOA 4Z7VA 2EH8L 5I18L 4BH8A 1VFMA 4ELKB 4YQXH 4GXVH 3X17A 4M61B 1NLDH 1BQLL 1FNSH 4RIRA 1GGUA 1JWMA 1PD6A 1BVLB 5FHBL 1BOGB 3N06B 3S36H 3LAFA 4QTIL 1MVUB 3MCKA 4LRNH 3FRUA 5IVXE 3BD4A 3KPNA 4OLWH 1Q9OB 4NNYA 4P3DA 5D93C 3QH3B 4MAUH 1HHHB 5DC4B 3DHJA 4PJAA 3V2AR 1FGNL 3ARUA 2Y7QA 1PX3A 3ZTNL 3ZZ1A 3W11D 4R7NB 1NFIA 3DRQA 5D5MF 4L8DB 5LCVH 4WI7A 3MV7B 3OXRB 5IQ9A 3IDMA 4NQEB 3M17B 1P4LB 2BOBA 3O8XA 3GBNH 5HHME 3HKFA 2VWEE 2HT3C 4RMUA 4PTTA 1R24A 4JFQB 5JNYB 5JA8B 1FL6B 3WIFB 2IFGA 5E6IC 4U1KA 1ZHBB 2R9HC 3FZUD 1S7UB 4X6DF 4HZLA 3NFSL 3T77A 2FEDC 3CZFB 4NRXB 3QYCA 2YUZA 5DJCB 3UJIL 1FDLL 3BX7C 1W0VB 4JDZA 4HUUA 5IWLA 1FYTE 5IGXH 4XPGL 4WY7H 1Z5LA 2ZCLH 5H94B 4M1DL 1IQDB 5HI4D 2YEZA 3HAEH 1DQML 4JPKL 1I8IA 1DTUA 2VRAA 2QL1A 1GZQA 1I3RB 1AD0B 5BW7A 5KVEL 4U31A 1CT8B 2EDHA 4TNWF 1G9EA 2VQ1B 5HHOA 4CAGA 1NGZA 2HFGH 1F8TH 5F9OL 3V6FA 5JPNA 1PQZA 3RVUD 3PP3K 5D1QB 1OT1A 5DYOA 5J6HB 1H3PL 2Z4QA 3ARBD 4ZQKA 5INDA 3BISA 3P4NB 2BFVH 2AEQL 2D7QA 3AY4C 3NCFB 4XBGA 1KSRA 3D39A 3IVKA 2NX5D 1NKOA 3TM6A 5HY9B 4Y4FC 1KENH 4KJWD 4P5TC 3O9WD 4P2QD 4QRPB 4UTAH 3G5YB 4HIIB 5I71B 1M7IA 5I8KL 3SOBH 5CJ5A 1B0WA 1C5CH 3K2MC 4MNGE 2MKWA 3BP5A 4Z0XB 2E27L 2G2RA 4J8RB 3SDDB 4PJ8C 3DX9B 4L8CB 4MNHA 2C3VB 1AGEA 1IQWH 5HHVH 4KROB 3H0TB 4LQFL 2E6QA 3G9VA 1WLHA 4LIQL 3HZMB 5CZVH 1T21A 3BEVB 1FZKA 2OZ4H 3LQZB 4F7PB 1JNNL 1T2JA 4M48H 1VADA 2OR7A 1CF8H 5C70A 1NC4D 1ZK9A 1FAKT 5E2VL 1ORSA 5DMKB 1KBGH 1Y0LB 3KVQA 2UUDH 4F7TB 5GS1A 5KW9H 2YSSA 5E5RB 2XN9E 3CFEB 3MXWL 3RWEB 1GL4B 5IFHH 1XCTB 3VXOB 4BK4A 2P8PB 3GEWB 1AGDA 1Q8MA 2BC4B 3ZKQD 1TJHL 1NAMB 2VLKE 3MUGA 1AXIB 2BNRA 3IFNH 1GGYA 1KB5L 3LIZL 4NWUH 1I4FA 1X4XA 2FJGA 1PJ9A 3MRDB 5CBEB 4DEPB 2BZDA 1PKQA 1TIUA 5EN2A 5SWSB 3O41B 4LLMA 4NJAH 2R0KH 4JRXD 2H41A 5HD8D 2BNUA 2V7HA 1I3UA 1Q1JL 1U8LA 5SX5H 1HXMB 3PQYA 4R7DA 4UDTA 1TQCC 4BK5A 1RUAL 3EO0B 3WEXB 2DWDB 4LVHC 1JHTB 4L3EE 2H1PL 3W39A 1V8HA 1W72L 3O3DA 3V4VH 2YK1L 1J9CT 5C9JB 5KSBE 3GSOA 1XF2A 5E5MB 4O51A 5C0JB 4Y5XC 4YGVA 4X4YB 3RL1A 2VIRA 1MCPH 1QEWA 4X6FB 1U42A 1U8QA 2JKXA 3QQ9D 4D0DA 4EJ1C 1MNUH 2BJML 4AL8H 4Q6IC 4JRYA 3OXSA 3WN5B 3KXFE 4ONGH 4LSDA 2IJ0C 4ZFGH 4U0RB 1NCWL 3QQNA 4S1SH 1DVFD 5CS7A 3Q6GL 1L0QA 5K9KA 3FQTA 3RPKA 1MFDL 1RZ8B 4HW6A 2HFFB 2GJ6E 3BE1L 4P3WA 2EH7H 3LH2H 2Q7NA 1IEAB 4NRYA 3LN4A 4EI5C 1P7HL 1P9MC 3RGVD 2PXYC 1QZ1A 4GH7B 4PJFF 4Z7WE 1ND0A 4IDJH 1KN2H 2LU3A 3CLFL 4OZHA 3L7EA 4NN6C 4BUHA 2VO5A 1A0QL 1CZ8H 1CGVA 3MV8A 5GGTA 1YEDA 3FRPG 1A7QH 1JHLL 4OLUL 5ALCH 3HMXA 1HWHB 4WI6A 4JFDB 3DURA 4KAQH 4KVCH 1JPST 4RQQB 4W68A 3R0MA 4PRNA 4WFFD 4I1NB 2DQIH 4Y4FA 5I16A 2BVQA 2X4TB 3D0VA 1YMMB 5I74B 4JLRA 2BXZA 4U1HB 4WI9A 3SO3B 2VZSA 5GGQH 4LAQH 5HJ3A 5K93A 3KHOA 2KZ1B 3F7QA 3MGTB 2JJTC 3FT3B 4PJ8A 2X5PA 3RX8A 5GGVH 2DMBA 1FG9C 3FQRB 1RVFH 3IAGC 4YJZL 3NACH 1YEEL 2AJUL 1I3VA 2QSCH 4QXUL 4ODSL 3GMRA 5C0AD 5CCKH 1WF5A 3LKNB 3MRNB 4Z18A 1BVKA 4KKAC 4UV4H 4WFHE 5HHXH 5ILTH 3MYZA 1QHOA 1DBBH 2VDRL 3MRRA 4X7SL 1Q9KB 3EJYC 1KCSH 4EN3D 1CXLA 4L29B 5JHDE 1YA5A 4NNPH 1O0VA 3LN5B 5L7XH 1S3KL 3FFCE 3TO4B 1K85A 4KDWA 2G9HB 4WEBL 2L4OA 3GSRA 3UBXA 5I6XB 1Z0MA 3MLYL 5FUCC 4X6CB 1PSKH 2W59A 2UYLB 4P5MA 4ZXBC 1MCWM 1CXKA 4K2UL 2UWEB 1JWSA 4I13B 4FFZH 1LO4L 3T4YA 1N0XL 3QXAA 3REVA 4APQC 1IAIL 1CXFA 3MGOA 3FQXB 3UTTD 3VI3E 1EFXA 4OZ4B 3QIWA 4KGJA 1QVOA 2IG2H 4P2OD 3S5LB 1QSEA 1WBYA 4ORGA 5A2IH 5ESQA 2Z31B 1MF2L 5EO9B 3R1GL 1QPPA 3AB0C 1NAKH 3KYKH 4I3SH 1CR9L 1H0DA 5JW3L 1X5KA 2CLZB 3N1FC 3NH7H 3KDMB 5T33L 4M6MH 5C0CE 1IKFH 1EX0A 1J8HA 3M8OL 2H32B 5TDOA 1BQHG 2XTJB 1YN7A 3DV6B 2FD6H 5ADPH 4XVUD 1EZVY 3GB7B 3IFPB 4F15B 3QCVL 1B3JA 1KELL 5J13C 1I3GL 5FO8B 5HGHA 1B0RA 5HVHB 3B2UD 2QQQA 3ZE0F 3OPZH 1KJVA 1ED3B 2BRRL 5CP7A 3OX8A 1XZ0A 3FZUC 1Z3GH 2R0WL 3AAZB 4Q6IA 1UXWB 3MYJB 1FIGH 5DI8A 5F96L 1G7PB 1CFNA 3PJSB 1EJ6A 3VMPA 1I7RA 1LE5B 1KIQB 2YD9A 3LV3B 3MV7D 5C6TH 5GGUB 5F7WC 5DJAB 4NQED 1KTLA 3GZKA 2FB4L 4Z7UF 2QQNL 3WJLC 1MIEL 2X1XR 4KJYB 3MACH 3DI2B 3FB8B 3VD3A 2PXYA 1J8KA 1XGYH 4ZODA 4FP8L 3FONB 3UROR 2YPLA 3PGDA 3PGFH 4GXUN 1S7VB 4BSJA 4Y7MA 4MXVE 2HRPL 2MPAL 4DCQB 1GOGA 3O45A 5IFAL 1ADQL 3VD4A 5D9SA 2ZJSH 1HH6A 4OZIE 2VDQH 3VFVA 4HFWA 5LQBL 1XF3B 3WE6B 4H25B 1GAFL 3QEQA 1DQLL 2R4RH 5TFSH 5FGSA 4N8CH 4LVNB 5I9QC 1QFWL 2XOTA 4UDUB 3KG5A 3FB6B 4F3FB 2V5TA 4RMTA 4LLAA 3DYPA 3QWRA 2Z35B 4KDTA 4HKZA 1NCAL 3VXUB 5L0QC 2JLLA 1FNEB 1YPZB 4QRRD 1A5FL 3RKPA 4ZUSB 5J9PB 5EBWA 4YDLC 3QDJB 5SWZE 4LDOB 1GZPA 2JCCE 4A6YH 5ICYA 2JJTA 4YGAB 5T1KB 4HFUH 4BQ6A 1YNTB 2X10A 1UWGH 4XH2B 3D2UB 3DLQR 4XRCB 1FBIH 5C0RH 1A47A 3QG7H 1G1YA 4F8TA 4YHZL 4RBPH 4QRPD 1JUFA 1NGYB 3KGRA 2E6JA 4QGYA 3S4SA 2R2EA 1I1RA 2N56A 5DJYB 4P9MH 5I1KL 2FX7H 5C0FB 5LWYL 3A6OA 4GSDL 4Q58C 3RIFF 2A1WL 4NCC1 1F11B 2FNBA 2OJZL 4MJ6A 3SDDD 1TXKA 2DTMH 1RZIA 4KVNH 3BSZL 1QR1A 4L8BB 5D1ZA 2DQEL 3JWNC 3GMNB 2D31A 2X44D 2GCYA 3WUWA 4XMPL 4KROD 3ORJA 2WBJD 4LOUD 4KI5E 5IMOA 2P45B 3V52H 3W2DL 2ERJB 4ZXBA 3LKPB 5D5MA 4MNQE 4U6HB 4ZSOE 2FR4B 5DD3L 5BJTB 3EZJB 4APQA 4RFEA 1XIWB 1ITCA 1V3JA 3UTSA 3BKCH 4GRLC 1RUMH 3EZ8A 2EKSA 3VFTA 5F3BB 5I73B 1RU9H 4U1MB 5BVPL 5I19H 3QR2A 4X6DA 1FFNA 1JPFB 2X40A 4J23A 1K9TA 1IGFL 3D5OF 3IU3A 4OV6F 5CJBA 3T1FA 5GS0L 1P4IH 3BQUD 1OM3H 1ZVSA 4XNQB 5DJ0B 4YC2C 4WV1C 4MAYD 3HAEA 1M6OB 3E8UH 4RAHA 4OKVA 5GZND 1XGTA 4K3JH 1E4XL 3FT4A 5F6HJ 3QIUD 3WFEL 2VN4A 1TCRA 3E3QC 5BRZE 3GSUA 4O4YH 3ULSB 4HIXL 3HLAB 5HGAA 1IEBA 4RMWA 5B3NA 1I1AD 4XVTL 2WSKA 4OB5H 2E7LC 1DZBA 3G6JE 5FUZH 3V6ZB 1R3LB 3QNYB 2PYEE 2AJZA 3EGSB 1QFUL 2EEAA 4LSUH 4X4ZA 3O4LD 1JK8B 1UT9A 5DK0A 2FO4A 5C09E 4K7PH 5IB1B 4I8DA 4JO1H 2ATPB 5FKAA 4MA3A 1NMAH 5GRUL 5FDWB 1II4E 1FJ1A 3WS3B 5JW4R 4EDWL 4L4VE 3IFLL 3C9NA 3L95B 2P48B 4IEFB 4WWKB 2EDDA 3TVMC 4XP4L 1G7JB 4KK8D 1SYVB 3ARTA 3GUTB 2IGFL 4X0KB 2HFTA 3PGCB 2VDKL 3SKNA 4QKXB 5HHQB 2NW2B 1J0KA 3O3BA 1ZLWH 5HHNA 5K9OB 4XCNA 5DT1L 2OZ4A 2P8LB 1V5JA 2VDOL 2IEPA 1P53A 5BS0B 1NGQH 2IPTL 1KJ2A 4X7CC 3ARBA 5D8JL 5JIKA 5C8JA 1AGBB 3VG9C 4XP1L 1FPTL 1OW0C 1C1EH 4M02A 2BHZA 1KPVB 1JTTA 1NGWA 2B5IC 3JUYA 1MRFH 4XPTH 1CGTA 4ZUVA 1CDBA 2EDNA 3W0WB 4OZFB 4P2QA 1GJIA 3IDJB 5C08D 3Q0HA 4XTRC 4F7CB 3PWVB 4Z78B 3LS4L 3NCEB 3STLB 3QNXB 5DMIL 4XCFH 4JFDD 1DSFH 1QNZL 3B9EA 1CFQB 4MS8D 4LSVH 4NM8L 1NGPL 2F5BH 3W82A 2R2CA 5FA3B 5GSRA 1B4RA 4OT1L 2YUWA 1OAQH 3NTCH 3DXAB 3U0WL 4HWBA 4YUEH 1XGPA 4EVNA 1YMMD 5CAYB 5DEGB 1NC4A 4W70A 3ULVD 3HE7B 2EC9U 1EMTL 1RJZA 3GKWH 4X6BB 32C2B 1YY9D 4ZYKA 1FZMB 4PUBH 4ZNCD 5KN5A 3FOLA 4M6NL 1CBVL 4POZD 3ZL4L 2DQHL 3KPTA 4Z7VE 2P5EA 3BGFC 1KNOB 1MRDL 3WDHA 4HS3B 2UZXB 2ATKA 2VZTA 5FYLE 3CDYA 1D5IH 4TNWK 3QZWB 3S36X 1J0JA 3ILPB 4KJQD 5GIRB 1IZJA 5F7EH 4Z7NE 4H26A 1UXSA 3TO4D 4HK0B 4MLSA 1S7WB 4K3EL 4PJAE 2ORBH 2VL5A 1MH5B 2XYCA 4P2OC 2VITA 2YD2A 1HXYA 3RI5F 3C09B 4PY8J 3ULVF 2FSEB 3PWNA 4GG6B 3F7YA 1AFVL 1I75A 1MJJB 4NZUL 4KUCF 4JRXA 4GRMB 3Q3GA 2NLJB 2DQFB 3EOTL 1A6UL 2A6DA 3L3OB 3MRCA 3B5TA 4K9EH 1NLBL 2DI8A 5IJVA 4G43B 3H3PL 4UUJA 5K9QI 2X4OA 4WV1A 2MHAA 3DBXA 2FBJH 5AZEH 1KLUA 5HPOA 3O3UN 4TVPE 1EA9C 3NCYS 3OR6A 3VDAA 1UQSA 1UCBH 3TEUA 5HDOA 1OAKH 2WQ8A 4KHTL 3OSKA 2Z31D 4KK6D 3TA3D 1EIBA 3C8KA 4HBCL 4PJFA 3T09A 2ZSWA 4KI1A 1MAMH 5T5FH 5GGSA 5D7IB 2E7LA 5DTFA 2UUDK 4P59L 1W72B 4RISL 4HBQA 4X6CF 1JGUL 3FTGA 5A2LH 2UWEF 4YHML 2QHRH 2XTJD 1TETH 3I50H 3JTTA 4Y19B 2E7MA 3LB6D 3I6GA 1DVFA 1QBAA 4QYOB 4WHDA 3WHE0 2X1WL 4R97C 5C0NC 2B2XL 4BFIB 4YBHA 2B1HH 5TH2A 3LKQA 1CU4H 2I60L 4D0BB 5F7HA 1K2DA 4YEFA 1W0YT 1U58B 1A7OH 3BKMH 3D69B 4KPHL 4DUWA 3RGVA 1OAXL 3S88H 5DQJA 1LO5A 3VRIB 2PN5A 1BFOA 3H8NA 3LEVL 1FFQA 1SMOA 1YEKH 4XPHH 4HJGA 5D7SH 4F57L 4QHUA 5SX5K 3T0WA 3FO9B 3MUHL 1EGJH 2AJVL 2CDGB 4XHJD 3SGKC 1C16A 1L7IH 2J7LA 3L3GB 3DETD 5AG9A 8CGTA 4HWUA 4U1GB 3WFDH 1QYGH 2ZP0T 1YDPB 2J4WL 1OTUD 4NQDE 5C2BL 3CMGA 3D0LB 2CDFB 3BDYL 4OD3L 1CD0A 5D1QC 3U0TA 4GAJL 2BY0A 3K4AA 1KGCE 1HH9B 5F7DB 1GC1L 3OB0H 2RAMA 3QO0A 4XNYL 3N9GH 3MJ7B 2BVOA 1DLFH 2R1WA 4GUPB 4TUKL 4FQ1H 4EBQL 4LCWE 2R0ZH 4ZS6D 1G9ML 4CNIA 4LLYB 1KN4L 5C0AA 4IRSB 1P84K 5EZOL 3RTQD 5I71C 5BOPA 4M5ZH 1FO0L 3I6LD 3VXUD 3REWB 4KMLB 4EN3A 1HHKB 3SDDC 2BNRE 2DLTA 5E4EB 9CGTA 4HC1L 4ONFH 5T1LA 1DUZA 3R8QA 3U4AA 4DK3A 4R6UA 2HYMA 4LCYA 1K6QL 1RZFH 4UNUA 1UJ3C 3O0RH 1X5LA 4JPWL 4N8VB 4XHQA 3L5XH 1BJ1J 3QWOB 5D7KD 1RUKH 3GK8H 5JA9A 2XRAL 1HZHH 3HNSH 5MEQA 3HMWL 2X70B 4ENEC 2X89A 3AREB 3HG1B 3UTTA 3MLXL 3C6LB 4FZEL 2CKBH 4EI6A 1I9IH 1YPZF 4P2OA 4HIHA 1SY6L 1HYSD 2UVFA 4IMLA 1ZGLB 1W0WB 4LVOB 1T3FB 4OGZA 1INQA 4JKMA 1ZLVK 2X4SA 1JYWA 3QHZL 5KAQG 1RZKH 1J10A 1G84A 3BD5A 4NJ9L 4JHAL 1T2QL 2CIKB 3RNQB 4J1UB 5I8CB 1MCQA 1XIWD 1S9YA 7FABL 1DUYB 4OBSA 4QRUA 3VU2A 3PE9A 4ELKA 2MMXA 2EEDA 2V2TB 1GHFH 3RWJB 5DR5L 1KUMA 1MHEB 2DQTL 5E2TH 1NCBL 1BVLA 3DROB 3OKEB 3U9UB 3QRFM 1BOGA 4LSSL 1GGCL 1F00I 1MVUA 1NANI 4PLJD 1Q9OA 4XPAH 1SBBA 3QH3A 4KWUA 5DC9B 1J0HA 2HT4C 2UVEA 1I9JL 4XPFL 2EKJA 5EZJA 3E6FB 2N4IA 4R7NA 4LHQB 25C8H 4L8DA 4P57B 3CSYB 3MV7A 2Q20A 4K8RL 3OXRA 3C5SB 1F4WL 4JG0H 4NQEA 1ZT1B 4F58L 1QRNE 3M17A 4HEME 3ARFC 4GKSB 1P4LA 4OLVH 2NQCA 3KPSB 1A7NL 3H9SB 4YHNB 5DUPH 5JNYA 4U1SB 5KSVB 1JRHL 4D0CB 2VDNH 1FL6A 3WIFA 5E9DB 3WN5C 3GI8L 5BMFH 3BMWA 1ZHBA 1S7UA 4MXQC 4G6ML 3TN0D 1TJGL 4U0RC 4CVWA 3CZFA 2ZWLT 3QEUB 2K3TA 5DJCA 1JIBA 1W0VA 4Y89A 1MCHA 1DR9A 1LK2B 4JO3H 2D7NA 1ZLSH 1K4CA 1M05B 5H94A 4WWKD 1M7DB 1X5XA 3SDYL 1OP3K 3OB8A 5DHVB 3ROOB 3QUKB 3C60B 3SGKA 1BZ7B 1I3RA 1P7QD 1AD0A 3SGEI 4RNRA 5FHBH 2X05A 1AXSA 1ZTXH 4LNRB 2CPCA 4QTIH 1IBGL 4OUUB 1CT8A 2VQ1A 3HHRB 1AGCA 2YHGA 1MFCL 3GSQB 3TT3H 4QRRA 1BFSA 1CGXA 5D1QA 4KTYA 2AABH 1L4IA 5DGQA 5D70L 5TDNA 5JOPE 2N1KA 1BAFL 4K23H 3RGHA 3TCLB 3WIHL 3DVFA 1GGBL 5HY9A 5IMLB 4XP9L 5M95B 4QRPA 4JDVA 4Y1AB 1CGUA 4M6AA 3ZDYF 4HIIA 5IVXB 5I74C 3MRHB 2XNAB 5J3HC 4M7LH 3SO3C 2AEPL 4CVXB 1C8PA 3ULVC 3TJHD 2J88L 4Z0XA 3OKDB 1YY9C 1FLTX 3SDDA 1OVZA 1KFAH 3DX9A 5IOPA 3VFUA 2C3VA 3WNPA 3T2OA 4JDTH 3MO1B 1ACZA 4GLRH 3QHFH 3SQBA 3H0TA 3U9PH 2FHBA 2LV4A 2QJDA 1NJ9B 5BVJB 5SX4I 1QSEE 3GSWB 3LQZA 2EIBA 5HHMB 4BQCA 1U2CA 1PEWA 2Q8AH 1DQMH 5ADOH 5DVKA 2DLGA 5DMKA 4KJQC 1D6VH 3K0WA 2V17H 5K9JH 1Y0LA 3GHEL 3CFBB 3DO3A 4YFDB 5I75C 4F7TA 4UTBL 4OQTH