1Z6JT

Crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
207
Chain Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Structure-based design and synthesis of pyrazinones containing novel P1 'side pocket' moieties as inhibitors of TF/VIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 207
sequence length 211
ec nomenclature
pdb deposition date 2005-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT02
2DQFB 3OJDB 2LE9A 4E42A 4WRLA 4PS4H 3M17B 3K3QA 4HDIA 4MZ2A 1N59B 1KGCD 3AREB 3DSFL 3T4AA 2R0KL 5FCUH 4Z78B 1NJ9A 3OAUH 4GOSA 2A1WL 3SBWA 1UM6L 3P9MA 2G5RA 1QO3B 2X41A 3BXNA 3W9DB 1NGWB 4U1MB 3H8NA 4CBPA 3CH8A 2RGSA 1NMCB 3PWLA 4R96B 3V6OA 5B39A 1YC7A 3OR7B 3H3BC 2CR3A 5EOCJ 1KJ2A 3VXUA 4PV8A 4MJIA 4KRMB 4PJCF 3RL2B 3CLEL 5CS7A 2OBGA 1U3HC 3X12A 5TDOB 4MA8H 1JYNA 2DIAA 2FO4A 3SDXA 4CU8A 4YE4L 2PW2B 1MF2L 4JFYA 5IIEB 3RWDB 1AGEA 1Q94B 4Z8FL 1KEGH 3BKYL 4M3JA 4LCWB 1WT5C 3ZKSD 1T66D 4Y4FA 3SQBA 3MCKA 3QHZH 5FOBB 1UM4H 5JIKA 1MHPH 4BFBD 4XP1L 4CW1A 2I60L 1RK1B 3AU1A 4MWFB 1SJEB 4MXVF 4N1EA 2P5WA 5D70H 4JM2F 1NLBL 4F9LA 1Q9LA 1GGCH 3HZYA 3BDYL 2GTWB 1BZQK 4X7EC 5C6WH 4HWBH 5ESVB 5HHNB 3TNMB 5HPMB 3GSRA 2BSSA 1YEHH 1XZ0A 4HWUA 2MJWA 5FYJH 3L5WA 4C83B 3KG5A 4GG6B 3AXLB 3RWIB 2A6KA 3QI9D 1YEKH 3H0TB 2YD7A 3OF6A 4HUMB 4UNUA 5JDJA 3BJ91 3T4YA 4FQJH 1ED3A 2HA1A 1J18A 2BRRH 1J1XL 2EICA 1BVKB 5I66A 3MACH 4XNXH 1DP0A 3BW9A 4TQEL 5DYOA 3T2OA 3RWJB 3QEQB 3FB7B 1UXSB 1NC4D 2H9GA 3R4DA 4ZS7L 2R4RH 1BZ9A 4ZFFB 1RJZB 2B5IB 3VFSB 3VGHA 4FQIH 4PGEA 4M6NH 1KLFA 1PSKL 4WDIA 4LSDA 5I1KL 2NY7L 1A9BA 1I7ZA 1DSFL 3CUPB 1AIFB 4LGRB 5CJXC 3GFUA 5D2LA 3ZDXF 3BGMB 1PQZA 3RVXC 3C5ZA 5C9JA 2DKMA 5L6YL 2O5YH 2BVOB 3K81A 4RIRB 5J1TC 3WMSA 2DRUA 4PGJA 4Y1AE 1CGYA 2BC4B 1EMTL 1AGFB 1RI8A 4YXHL 3QFJD 1FVDB 3NIFF 3UJIL 3VXTB 3E6FA 2IQAA 1NC2D 2G9HA 2IADB 2DM4A 1GPOH 2Q7YA 2YXFA 3L5XL 3QUZC 5ANME 3UYPA 4FQLH 5D9SB 2BSRB 5FHAL 2R29H 4JQXC 3IU3B 1KPVA 3RAJL 4LSQH 4WJ5A 1ADQA 5HHQA 2Z31D 3RA7L 2CUIA 3TA3B 4EBQL 2P7TA 5ITFB 3K2MC 4X99A 1OD7A 1JGEA 1KYOK 1WZ1H 5DMGC 2FZ3B 3EIFA 5HHMD 4QRRA 3TYFB 1X5FA 4Q2ZA 4G9DA 1KN4L 3B9EA 3WJLA 4GKZA 4GH7B 1DQMH 1S3KL 1FV1A 3VXUD 5HYJB 4MJID 1CDGA 4NM8H 2X44D 2HN7B 4YHYB 2EDWA 2V7NB 1TQCB 1CGTA 1NSNL 2ZOKB 3K1KC 4NPYA 4Y8AA 4LHJB 4JZNB 3ARBB 2OSLB 3GSQB 3FO1B 3SEPA 4KKBD 3UDWC 5I8OH 4Y4FD 3MBXH 5CZXD 1YY8A 1A6WH 2JELH 5T1DH 1MCKA 2J5LB 5DJCB 4XNYL 1AH1A 5EZOH 1BFOA 2Z35B 4LHQB 4NGHH 4IRZL 1A2YA 5F21B 2EZ0C 2P5WD 2ESVB 1URLA 2NXZB 4LAJH 4W6XB 3SO3B 5AEAA 5AAWA 2DJ4A 3MLVL 4KVNL 4M03A 2BSED 3K4DA 2YPLE 3BIBX 4S2SB 1SEBA 5D7IE 5I17B 3ULVC 3TCLB 3VFPA 1EHLL 4OZIF 2PYEE 2YUVA 1CFQA 2QQNL 3T08A 1TZGH 1I1YA 1TJIL 1KJMA 4JDZB 4KK8D 3UTZB 1A3LL 1FL3B 1KEMH 1P7KB 5A2JH 1U8QA 4G7YH 4N0RA 4XC3L 1E6OH 3D3VB 1X5IA 1N26A 3MJ7B 5C0RL 4M93B 1A3QA 2EECA 1KCLA 3HZKB 5MERA 4K7FB 5EUOE 2CDFB 4R26H 2NTSP 3FN0L 2F54B 1W0YT 1YNTB 4XCCH 3U0PB 1WCBA 3P0VL 5ID0B 3UTPE 2E6PA 5AUMA 5SWZE 1G6RH 1TPXC 2VO5A 3O3EA 4JHBA 4OSUH 4RRPA 5T5NG 5IOPB 5FKPB 1V05A 1XGPB 1U8OA 2XICA 1BFTA 3ILQC 3WL9A 5CSZA 4ZUUA 2AJSH 4KH2A 4PJDF 5AAMA 4XNUL 4YGAB 3TN0B 4IDJL 2G5BA 3VFVA 4JB9L 3PIQB 1IEAB 3QIUA 3TM6A 1P2CA 4UUJB 3NMEA 3MLPA 2BOCA 3IS0X 3OG4B 4I4WB 4IMKA 1BAFH 1M7IA 3QNZA 3ZTNH 1HZHH 1SYSB 3WUWB 1AHWA 1KPUA 1XEDA 1FC1A 4HBCH 2FL5A 5EFIB 1QBAA 4ZFGH 3NIGF 2IANA 3HAEA 3HR5A 3ULVL 2BERA 5F3HB 5F44A 2CKBA 5D7SH 4KJQD 2MTPA 3MGTA 4CMHB 3GSNA 5HDOA 4MCZB 4ODVL 2HJKB 3EHBC 4I18C 3ULSB 1A8JH 3AVEA 1HYSD 1WC7A 1PVHA 1QVOB 1RU9H 4FQQB 1W0VB 3BUYA 2UY7A 1R5VB 3FO0H 5IV2A 3QWOB 1T2QH 5FYKL 2FJHA 5E7FA 4RA3A 4ODHL 3UX9B 2DMCA 1IGMH 3CVHL 3T2NL 2VQ1B 4NQED 2BVPB 5MHSD 1AY1L 3DVGB 3BP6B 2PETA 2XFXA 1IAKB 2WQ8A 3WJJC 3TZVA 1NFDA 4XPFL 3TBYB 3IETA 4YHPB 1A9EB 3EOBA 4Y89A 4GQ9H 5JORA 3QNYA 3PHSA 3HZVA 1J1PH 3BGFC 4U2ZA 5EU5B 4IRJA 4HQQH 4Y5VB 2EIBA 1K6QH 3SE8L 4OLZH 5CSGA 4PS4L 4NRZB 2EO9A 1QRNA 5KS9B 5IG7B 2X4RA 4GKNB 4P23A 4B41A 4F7TB 3OAUL 4HMDA 4J23A 1XGTB 1KLGA 5EC1B 4UBDC 4MA1C 3UBXA 2Q8BH 2GTZA 5E5UB 2ICWJ 1FP5A 1XR9B 4P2QA 3O45A 3VG0H 3GGWB 1WZMA 3V52H 3OKOB 4Z7WF 3GJFA 4B50A 4Y5YB 1BREA 1T80A 4NQVB 1TQBB 2FX7H 3V0VA 1G7MB 5SX5K 3WFCH 3O4LE 5GGTH 3KDMA 4O02H 4WGVB 2NY3C 3EW3B 5DT1H 2F5BH 1RUMH 2NY6D 2AK4E 4JE4B 4MJ4A 5IQ9B 1X6LA 5I6XC 1K8IB 2XA3A 3QHZL 4NHCH 5EOTB 1UM4L 1FNAA 4KK9D 1MHPL 3MLZH 4F2MA 3QDGD 5E2JA 5DUBB 3REWA 3INUL 4Z18A 5D70L 2YR3A 3QJHA 1CI5A 1OGTA 1EH9A 4HWBL 4PRIA 5JDSA 3QIBB 1YEHL 3DV6B 5CILH 2HG5B 3QIUD 1CLOL 1K4DB 4KI1A 3P73A 1YEKL 1FLTX 1A7RL 3DYMA 1S7UB 1Q8MA 3VXRB 3S4SG 3IKCA 3LS5H 2X1XR 4OFDA 3N1MC 2BRRL 1UWGH 3DUUB 4NJ9H 3BISA 1Q9KB 3L3KB 4GRLC 4XNXL 3D39B 1FC2D 5TPWH 5D2NE 2DMKA 2FD6H 1GL4B 4LKXB 5ERWB 1NEZB 1R5IA 4HBQA 5GRXG 1PFCA 1X5YA 4MCYA 2BVQB 3NIDE 4O2CA 4FQIL 3VA2C 2V5TA 1F2XK 5D93B 1IGFL 2P4AB 2PTUA 4U05A 1LDSA 5C0AA 4ZSOE 5LGHH 3RDTB 3CK0H 2VXSL 2EDXA 4OZFG 4ZG1A 3LQZB 4XAKD 5KN5A 3CC5B 1PKQE 1RUPH 4GG8A 1T4KA 2O5YL 5DC0A 1AR1C 2HH0L 3FQXA 4HIEB 4LGSB 5F7NC 2CQVA 4JM4H 3TZVD 1X7QA 2IFGA 4I5BA 3U4EA 4KAQH 1DQDH 1OW0A 1ZA6A 2AJUH 3MRPA 2FEEL 3OKDA 4P4KB 1A3RL 4IRJD 4S1RH 4JLRB 2Q8AH 2GSGA 5BOZG 1FAIH 3KYOB 3KLAA 4YDKH 4M8QB 1GPOL 4Q58C 1KIPA 4RMUA 1QRND 2B1HH 4FQLL 2UYLA 3BYTA 1D5MB 4XVSH 4NZRL 1AQDB 2C7UA 1R24A 2DBJA 4PBXA 2YKLH 1WZ1L 3O2DH 5C07E 1HQ4A 2EEAA 3FCTA 1JBJA 4P2QD 4U1JB 1H15B 3C5JB 4HUWA 2DLTA 5TE6H 2P8PA 5C0EA 3G5ZB 1IC7H 2BSTB 2DYPA 3HCVA 1DQML 1CXLA 4L5FH 2Q76A 4ZOAA 4YXKL 4HWZB 2J6EH 4NM8L 4WUUA 5GGRY 5FB8B 3ZHLA 4BELD 5L2JB 5J8OA 5A40E 5B4MD 1AD0A 2ICEA 4NHUA 2NX5B 3U9UA 3DO3A 3MBXL 3MV8A 1A6WL 2JELL 3O4OC 5T1DL 4OJFH 5EZOL 4LPYA 3WNMA 4J2XA 3GJEB 1J0ZA 4NGHL 3MRBB 1QHPA 2A9MH 4EDWH 5HY9B 4DZBA 3F12A 2BCKB 4OFPA 1UXWA 3C8DA 1VHPA 5E99L 4ELMB 1NCDH 3T0DA 1HSAB 5TGBB 4D8PB 5IR1B 1N2RB 3WS3B 1KBGH 1KJ2H 4G8GE 3EZJB 2CGRH 2YWZA 1ZHBA 4ZYKB 1NUGA 2FYYB 1TZGL 2P1YA 3HE6B 4PGCB 1N8ZB 3C5SA 3E1F1 3ET9F 1PY4A 2BP3A 4G7YL 4WW2C 4JKLA 1E6OL 1DUYA 1J0HA 1XGUB 3QUKB 4UZGA 5IB4A 1DLFH 2RHEA 1DFBH 4FQCH 1V3LA 3ZL4H 2FJGA 3IJYB 4D9RE 3V7AG 1BQUA 4R26L 1T1YA 3MRHA 3DI3B 3IDIA 4GXVH 2VDML 1WAAF 1GXEA 4XCCL 2V7HA 2X4NB 4X6CE 3JV0A 4XXCA 3HHRB 4NQDB 4NSKA 2IBZY 5HGBA 4JY4B 1IEBB 3BQUC 4OSUL 2EDNA 1U95B 1PZUB 4KJYB 4D0DA 2BY0A 2WBKA 4MB3A 5D7JC 3VMNA 5L0QB 4GSDH 5GQBA 5C0AD 1T04B 4O51A 1IAMA 5MI0C 3MV9D 5FYLD 2IPTH 3NPSC 2AJSL 4QT5A 1QEWA 4EZMA 3KPOA 3SDAC 3AGVA 1JWSB 4DZ8B 2HT2D 4OAWA 4CUCA 2JIXA 3HA0A 3WNLA 2AEPH 2WIIA 5CLTA 4FTVB 3ZTNL 1HZHL 2F53A 3WNPA 5IEHA 4JO3H 1CDYA 4N0UA 4UIMA 4HBCL 5DQJA 4HIJB 4BH7A 4ZFGL 3SKNA 4PJ5A 2ICWA 3QBTB 1F6FB 5D7SL 5E2TH 4YAQB 2VOTA 4EJ1C 3S36H 4CU6A 5IROC 4K3JH 2BX5A 1M7XA 4JEGB 5CEXA 2EH8H 3S9DB 5IP4A 4LVEA 5FDWB 3UBXG 2VR4A 4NUJA 2FO1A 1NDGB 4NO2A 5C09E 4ZFOL 4BSVA 2AV7A 1I3UA 3FO0L 4L4TA 1T2QL 3QP3A 5K9OA 1UYWL 4GAYB 1WGOA 4PJEB 2B2XH 1MJUH 3K8KA 1IGML 4HJGA 3UAJC 3JV6A 2J8OA 1MLBB 3EO1B 5E7BA 1IARB 2X4SA 2FIRT 5EIVA 5ESAB 2Q86B 1IE5A 3L3HB 4P46D 3BP7A 1OSZA 3HMWH 1DLHB 5J3HD 2VZTA 4OT1H 4GQ9L 2AV1B 1J7VR 4RMTA 4EI5C 5B3JF 1Q0XL 1J1PL 1WBYA 1JZ5A 1J9CT 1S7WA 4L1DA 4UT9H 1C08B 1K6QL 4OLZL 4HJ0D 3MV8D 3MYZA 1ADQH 3TESA 2YRLA 2NY4B 2F15A 4R2GC 3L7FA 1A4JB 2VMFA 3QJFB 4JQVC 4Y4HB 2Y72A 4RISL 5IFJB 4MNHA 1D5IH 1QLRB 4HKJA 4A2MA 2DWEA 4MA3A 4FG6D 2ZZUT 5F3BA 2R1WB 2Q8BL 3NFPA 3OKKB 4HIHA 1CDHA 3WD5H 1C12A 5TDNA 5DJAB 3V52L 1K2DB 3CSYA 3H3PL 3H42H 3C60C 3WIFB 1Z5LA 3DIFB 3TH4T 2OX5A 4BQ6A 2CDGA 3SKMA 1D5BA 3WN5B 4M7ZC 2MQ3A 3L6FA 2DM3A 1NGQL 2BNQA 2FX7L 5D7IF 4NCC1 1JF1B 1JZ2A 4IOSD 3WFCL 5BV7H 4O02L 5DT1L 4YBQD 4PJCB 1INEL 2F5BL 3MYJB 1EAPA 5D7LA 2GJ6B 5FM8A 3UTSA 3TO4C 5JLZA 3F5WA 2DAVA 4RMVA 3MLZL 1J12A 5I2IB 1B3JA 1CD1A 4U6XA 4JGJA 2VDRL 1UB5B 4HUKB 1I8LA 3GMMB 3E6HA 3MZTA 4JPIB 5CGYD 3QXUA 3KJ6H 1M05A 1O7VA 4J4PA 2F74A 5C0BA 3U4BH 5JUEH 5IEKA 5CILL 2X1QA 4J3WA 1FZKB 3PWVA 1MH5B 4JM2B 2BNRE 4ELKB 4FFWD 2JIXD 2WINA 2MWCA 4JFFE 1HCVA 2J4WH 2F53D 4J6RL 3EOYG 3V5HB 3TYGH 4PRDB 3RWHA 3SCMA 1JE6A 5L8KB 2QSVA 4M7LT 1FFOB 3LS5L 1VEMA 5CUSH 4X6DA 3EYSH 1K5NB 1UWGL 4NJ9L 2YPKB 3FHQA 3H9SE 4PJ5D 3CCHB 2ATKB 4OF8A 3ZKXC 4QYOA 5TPWL 5DD3H 5DVNA 5IW1A 2DM7A 2YEZA 3FQNA 5F9AC 4U1LA 1JI2A 4BYHA 1PG7X 1TVHB 5DO2D 4G42A 4EUPB 2E8ZA 1FVEB 3DV4A 4HMCA 4L4TD 3S34L 5CIPB 3VRJB 3IXAA 4K7PY 1R3KB 3SDCA 3CK0L 1YPZA 1U93A 1EVUA 1X5LA 5EU4A 3ARRA 2BOBB 5DMKB 1RUPL 4KDTA 4IMLA 5EIQA 2EE9A 4JM4L 4AEEA 4ZO9A 1X5JA 4FQ2H 1X4XA 3SBWC 3A67L 4R4NC 4KAQL 1DQDL 4U1KA 3D85B 1ETZB 1BGXL 1P7QB 3HAEH 1DDHB 2AJUL 3S98A 3A6BH 5ELIA 3TIEB 1HEZB 1IKFH 4S1RL 1ZLUK 2Q8AL 1FAIL 4FFYH 3V6OC 1HXYB 4YDKL 1TZIB 1CZ8H 2EYSA 1L0XA 3LEYH 1I7RB 2ITCB 1OF2B 2B1HL 3NCCB 4NNXB 3UTTE 1QSFB 4R0LA 3GEWB 1CLCA 4YHZL 4Z7UA 4XVSL 4IHOB 2HVJB 3B6SA 2VDOL 4JZJB 5BW7A 2WBWB 3W82A 2EDHA 1RZKH 2YKLL 5F7DB 2GT9A 3O2DL 3LN5A 1ZGLA 4F33B 4C4KO 3UJJH 5IBUB 5TE6L 3EOTL 2AQ3A 2OR9H 4ZS6C 1IC7L 3FQWB 3DETC 2Z4QA 1JHLH 1UC6A 2J6EL 1FRGH 4GQPH 2H6PB 5D1QA 4LCUA 4GW1A 3Q1SH 3QCTH 4F7PB 2BNQD 4QXTA 4F9LC 4L8BB 3O2WH 4Z7VB 2NZIA 3WBDA 2XNAB 3CIQA 4XNQA 3BO8A 3G04A 5D7LD 2A83B 1RZGB 3VH8B 1YMMB 3THML 2VWEE 1C1EH 1LE9A 2RR3A 3NZ8A 5ICXA 4OJFL 3SJVB 4KK8C 4APQA 1Z3GL 2ED8A 1MFCH 3QPXH 1XH3A 3F8UB 1U8MA 2A9ML 2D03H 3T09A 2GK0B 4EDWL 3C8KB 4HK3N 4MNQB 1WFUA 4E41E 5JR1H 1NFIA 3ARQA 5GISH 1NCDL 4LGPB 2CKNA 4OUUB 3OKMA 4F7EB 4ZFZB 4DCQA 1D5XB 1DEEB 4J4PD 5C0BD 5FO7B 1KBGL 5A1AA 3GJFH 2Y6SD 1G7PA 2CGRL 4TSCL 3JSSA 4L8DA 4ZUSA 3FOLB 2YMXH 3BI9X 2XV6B 2OL3L 3FMGH 4GW4B 5GGRB 3QXAA 1OAZH 4MHHI 3HLAA 1YNKH 3SCMD 3JTTA 4P2OA 1I1AB 4KI5C 4PJXE 4OZIB 5EWIL 4YIQB 5HHOB 1DLFL 4M8VA 2EXWC 3LEXA 3EO0B 4FQCL 3QIWD 4H26B 5I76B 3ZL4L 3EYQC 1WCQA 3PUCA 3GSWB 3REVA 3GMRB 3VWJA 3C5ZC 4GXVL 2Y5TB 3EFDL 2WSKA 3IFPA 4Y4KB 2DQJH 4Y8DC 4JY6A 2KL6A 4OZGE 1CTNA 1UM5L 2COQA 2BDNL 2EDYA 4LLYA 4LQ1A 5JW3L 1U58B 3TO2A 1UZ6F 3VRIB 3ARVA 4IS6B 2GUOB 4GSDL 1YN7B 4IRSA 4NO3A 3RJDA 2E6JA 4XWOC 4IOIA 3KPSE 4CADA 5FO9B 2OI9B 2IALA 2IPTL 3IJSA 1GGIH 1KXTB 1N4XL 5E8PA 4R3SB 3FQUA 1X5XA 1FG2B 5BCAA 5E8EA 2E9WA 5EA0H 1ULVA 5JO5A 5ICZB 1TCMA 2AEPL 1OM3L 4PJDB 2W91A 4X6FB 5CWSA 2IH3B 2YD3A 1MJJB 4JO3L 4ZO7A 4BFIB 3OXRB 5B38B 1IGCH 3P3YA 4XHJD 3RZCC 2NW3A 2FNBA 4QXWA 1U8IA 1U6AL 4QTHA 5DHVA 3WJLC 3GMNA 5E2TL 1FN4B 3CGTA 3U48A 3GM8A 1LQSR 1G0YR 4Q9BA 4HFWB 1NCUA 4QRPA 1QRKA 3MGOA 1A6VH 5IFAL 4JN1H 5MENB 3WO4C 1I7TA 1N0XH 4HF5H 1HKLH 1RFDH 2B5IC 5HHVL 4G6KH 3CFBA 4DQOH 3U79A 3V6FA 1JZ6A 3TV3H 1MCWW 4XH2B 3EYVB 2EH7H 4UV4L 2DLHA 3HI6H 2X4PB 3F7YB 3RBSA 5BV7C 2B2XL 5IB2B 5J11B 3D69A 2GSIA 3CSBA 3QXDB 5L2KB 1TVBA 1S5HA 1BIIA 2FATH 2VN7A 4YDLB 5JXAH 1T5XB 5DD6A 3HMWL 5D1QD 4OT1L 1FZJA 3DX8B 4NKDB 5E5MA 5HYFA 4NWUL 4HS8H 1SYVA 1FO0A 2DQIH 2Y07H 2XQBL 2FH6A 3IB4A 1T7ZA 2DWDA 1XF4A 3GSVA 4IJ3B 1JYXA 4UT9L 1W2KT 3MLYL 1S9WA 4JRXB 1I3RB 5CJBA 1JVKA 3G6AA 4OZHA 4PRHE 2HKHL 3FHAA 4BSWA 4YHOH 4P5MA 4XI5C 3QZWB 4I2XE 3RY5A 3TA3C 1J8HA 5K33A 2X05A 4BQCA 3KLHC 3MV7A 3NCYS 3CXHJ 3WD5L 3U2SB 1YMHB 3KPMA 3LKOB 3OX8A 3T0EB 3BH9A 4HGMA 3V6ZB 4NO5A 1UJ3C 3QH3A 2C4XA 4ZNEA 5BVJB 2NPLX 2XWBB 4P2OD 2R23B 1A4KB 3S37X 2VKXA 1MCOL 4G6FB 3P4MB 1W8OA 4LMQI 5BV7L 3EFFA 3L3OA 5INCA 3BOVA 1YEEH 1R3HB 3BKCH 3VWJD 4UAOC 2HWZH 1BFSA 2C1PA 3QIUC 3ZT7A 3TCXA 3VXPB 5DK0B 1IAIH 3PWJA 5EBGA 2KH2B 1AHWC 2J5LC 4PJBE 5MEQB 4JCMA 4IRSD 3VW3H 4HX1A 5F7LB 5GS0D 2IH1A 2J8UA 5I0DA 3BRGC 2D7TL 4WO4D 3ILPA 3RWEA 2I9LA 4X6CF 3KJ6L 3ROOB 3SO3C 5DHYA 3ULUF 4ZPTB 5GGUB 5CMAA 3U4BL 2XN9B 1XGRB 5JUEL 5JW4Q 5D1ZA 2B1AL 3PQYA 2H32A 3M17A 1T6VN 1N59A 4EXPX 2J4WL 2VITA 3KXFD 3AREA 3IAPA 4OLXH 5CUSL 2XI9A 4R7DB 3EYSL 4M9PA 5DK2B 2EKJA 1RZKC 5L7XH 2WBJB 4QLRA 5JPNB 4S0TD 5DD3L 3W9DA 4CVXB 4PJAF 3S96A 3D2UD 4LPTA 5IVZB 1REIA 3VFGH 2IAMB 3V95A 3L7EA 3MOQA 3RL2A 1CD9B 1S7SA 3ECBA 2VLKA 4QRUA 5TF0A 5C70A 2VXTH 3TT1H 3MXWH 3BHBA 1AO7E 3VI3E 2JB5L 2XKUA 2HJLB 3QA3B 5IIEA 1YECH 3TN0C 4JVUA 4LCWA 4EIGB 1TETH 4P23C 5IMKB 4FQ2L 5DD1H 4NKMB 2P46B 5E8NA 4P57A 5I1AB 4LHUD 4NT6A 3D5OF 1JF5A 3O3AB 3T8XA 3U6RA 1QPPA 1XCTA 2JB6B 2AABL 3BN3B 3MV01 4FXKB 3RGVB 4FFYL 2IPKA 1R5WB 5EOCL 3VXQB 2GTWA 2E7LC 4EOWH 4MQXD 1HILA 3MRMA 4MQ7B 2XIDA 3TLRA 5HI5C 5HPMA 3LEYL 4DVRL 3P4NB 7FABH 5F89B 3CSGA 3G9VA 1VSCA 3BEVA 1JP5A 4GG6A 4LOUD 3MLRL 5CZVH 1NDMB 3A6CH 2WLZA 1RZKL 2B20A 1J8HD 2UZXB 3MV7D 1EBPA 3B43A 4KFZC 2MKWA 3UJJL 5E2VH 3N0PB 3VJ6B 2M26A 3BP4B 3W9EA 3SOBH 2OR9L 3C9NA 5HD8C 1F3JB 4AK1A 1JHLL 3DBXB 1KCUH 4LSVH 2AKRB 3QUYB 2OS7A 4F15B 5CD5D 4O2FB 3QCTL 1VFMA 5C0IA 3O2WL 3RRQA 2NXYD 1L4IA 1A14H 4GXUM 4QY8A 2QTEA 3CUPA 3IDGA 1G7HB 4JFEA 1IC1A 4JRYB 4PJIE 4PPTA 1LO5A 1F3DJ 5FGCB 1C1EL 2NYYC 5H35A 1QUNA 4B53A 4YX2H 1A22B 2YD6A 2D03L 5E00A 1AGCB 2NR6D 5JR1L 5GISL 4JHZA 1VGEL 1RIUL 1QOKA 4ZXBA 1S7VB 4KV5F 5D1ZD 1MOEA 3HPJA 3JWDC 3LQAH 3MCG1 5D6DC 2IADA 1M1SA 2VXUH 4RBPH 3FMGL 2EYTB 3OQ3B 5HYSG 2FLBT 3MFFB 5D9SA 1OAZL 3ARED 5D4QA 3IDYC 5LAXB 4JFZL 3IU3A 1ES0A 4Y19B 3LV3A 1I9RL 1B9ZA 2WUCH 4DWHA 2VZVA 4OLEA 2VLJB 4DVBA 1UH2A 3QUXB 1D3CA 4UU9A 5C0CA 2CRYA 2DQJL 3CFJA 1OW0C 5HYJA 1L9NA 5INDA 4KJWD 5J1AB 4ZQKB 5DEGB 5BS0B 1IBGL 2CO6B 4N9OB 5CKGA 5EUKB 1ZLWK 5J4MA 1M7DB 1JWMA 2GAZA 2ICWI 1GGIL 3D87B 3QIBC 4NQSB 4R4BB 4LCWD 3MUZ1 4CVWA 4JREB 4OF5A 4LHUG 3HE7B 4PBWD 5EA0L 3QFJE 1XF5A 3WFBH 2OQJB 5GGSA 4GRWE 1SVZA 2GHWB 4TVPD 4JFHD 3HUJE 1IGCL 3EYUH 1CDBA 3DUSB 5JHDE 2Z92B 3Q3GA 3JWDL 2DQCH 2DBLH 2ZSWA 3ALPA 3MRRB 1CGUA 4OCRL 4LLVA 3HRPA 1A6VL 4JN1L 1N0XL 4HF5L 2BVYA 1HKLL 1RFDL 4PY7B 1T21B 1Y6MR 2XQYK 5DJYB 4G6KL 4S1SH 4DQOL 1OAUH 5FKAB 4HKZA 1U3YA 5D93C 1XF3A 2CMRH 3RDTC 3MBEA 3L3IB 2XTJB 4RGNB 4MYWB 2CXGA 1XIWA 2FJFB 1CDCA 5JXAL 1ZHKB 2DF3A 3B2UD 1JK8A 5GGQL 2FLRT 4OF0A 1ZLSH 4XVUC 5ANMB 5CEZH 4QF1A 3O6FB 3ZLQC 4M61A 3STLB 4HS8L 2DQIL 5FKPA 1N3NA 4LSUH 4YC2C 4G80B 4HKBB 3FB6A 2B8OT 4WU7B 3SY0B 2VUYA 3OKLA 4Q9QH 1EUUA 5IQ7H 2ICES 1MWAH 2R0WH 3EO9L 3M45A 1CFSB 2XKNB 4S1QL 2JCCF 4OZ4B 3O11A 4PRPE 1SYSA 4ZXBD 2HFEB 1P4BH 3KR3H 1EERB 1FYTB 1I85A 3DRTB 2DQTH 2QR0A 3VDCA 4H5SA 43C9A 4XTRD 3T77A 5D1XA 1CGSH 3RPIA 3L9RB 1O5DT 1TZHB 1F02I 2E3VA 4NN5C 5BQ7B 4GFTB 1LP9B 4IOFC 4MCZA 4XBEL 1GGYA 3IDNB 5IB3A 5C6TH 4ZAKB 3KPRB 4LLUA 4OD3H 2W1NA 1QVOA 1NCAL 1YEGH 4P5TB 1NGXA 1LD9B 1YEEL 1FZMA 2OM5A 4Y1AA 3BKCL 2R9HD 4R97B 2HWZL 5C0CD 1FFNB 2D0HA 2YD2A 2YS4A 2ZUSA 4V2CB 5D96C 1IAIL 3GO1H 5FK9A 1YYMH 4CMMA 1WIOA 3VFRB 5HYJD 5D8JH 4N0FA 4W4OA 5DJ0B 4G5ZH 5M94B 3VW3L 3TBYA 2P5EB 2FB4H 1A9EA 4NQCB 1E4KA 3X14A 5KSAB 3ARXA 2QADC 3ARBD 4P2YA 4W70A 2HT4C 2JJVA 1KV3A 3QXWA 3D9AH 1Y18B 4PJHE 4Y5VA 5H2BA 4HEPG 5JHLH 2XWJB 1NQBA 2Z91A 4XPGH 3VDBA 1AXIB 1KULA 3WXWH 1WZKA 5DO2C 1ZSDB 4JFQB 3TH3T 2E9JA 5IG7A 5ALBH 4OLXL 4GKNA 4JO2L 1SBSL 3WUZA 5T3XH 5TH2B 3KPPB 2NXZD 4ACPA 1CGWA 3OGCB 5L7XL 1HSBA 3GRWA 1CS6A 5EC1A 4RFNB 4BSJA 3BEWA 1S7XB 1LEIB 2V6HA 3GGWA 4AH2B 5IVXE 2N7BA 4DGVH 2V5YA 4UQ3A 3ISWA 4PG9A 4XNZB 1LO2L 1RULL 3B9AA 5HI3C 1ND0B 1ITCA 3DI2B 5IMOB 2VXTL 3TT1L 3MXWL 1G7MA 4NQEE 3MRDB 5LCVH 3T65B 1DE4B 3MBED 4XBPA 5IMMB 5IBTH 5C08B 2F54D 4CVZB 4S1DD 5IQ9A 3FO9B 4H20H 4M7KH 4Z5RB 4WU5A 2YPLA 1JMXA 4XCYA 5EO1B 5D7IA 3K2UH 4PRBB 5I1DB 3O3DB 1EEQA 1N64L 4FS0A 5JOPD 1P7HL 1CK0L 1K4CB 2PYEA 5DHVH 3OAZH 4WEMB 5DD0H 4F9PA 3QDJE 3FQTA 1SEQL 1G7IA 4KRPB 4EOWL 1PJ9A 3RL1A 2E7MA 4PYGA 5DC9B 5BO1H 1KB5B 3LQAC 1LHZA 5KVEH 1JGDB 2DQUH 2PF6A 1CT8A 2UY6A 5EUOA 5L9DL 1TTUA 5CZVL 3MRQA 4F7CA 5HVHB 3A6CL 5IWLC 5EU6B 4LNVA 1ORSB 4KHXH 3VCLB 4P9ML 5SWZA 3ESVF 4C56B 4NDMA 3L3KA 1P6AB 1MHHA 4E5XB 3GI9L 3ZYOA 5H37H 3T0BA 3PJSB 1PX3A 1S78D 2VR5A 5ERWA 1BECA 1KCUL 2P24A 4LSVL 4RGMB 1F97A 1S9KC 2EDFA 1FO0H 5IF0B 4I3RH 2VAJA 2D31B 1I8LC 2EXYC 4KUCD 2O5ZH 4Y5XB 1Q0YL 4YK4B 2P8MB 1BBJA 1A14L 1WIPA 5EDXA 1CGVA 1TCRB 3MZGB 4MHHG 4Y1AD 4NN6C 3OPZH 3TFKD 4P3DB 4D9QE 4CNIA 3QDGE 1P4LB 3D0LB 4X83A 25C8H 3HI1B 3QFDA 3BVNB 5I1JH 5KSUB 4I3GA 3X13B 1W72H 3F7QA 4LDLB 4U6YB 3QNXB 4YX2L 5F71A 5HVFB 5MP6L 1CL7I 1HN1A 4PJ7F 2LFGA 1MAMH 1X3DA 1NAMA 2R2HB 2BMKA 3FB5A 4P4KA 1EO7A 4X9BA 3PABB 3MXVH 4FRWA 5L8JB 4YLQT 1A1OB 5I71C 1KPRB 3LQAL 3MRLB 4MDJB 3ZDYF 1DL7L 5LBSH 4PJBF 2CRIA 5JIHA 2CIIA 3VA6A 5DUMH 2EC8A 5HDLA 3GSXB 3RHWF 4YDJA 4DAGH 2JJSA 4EKXA 2PKDA 3QAZB 4L3AA 3RIFF 3SDCC 5C71A 3WN5C 3RBGA 3CAFA 1OY3B 1KENL 1NANH 1E4JA 4U1IA 1J8KA 5C3LD 1CBVH 1CDUA 1CFTB 4M6MH 1UH4A 4GBXC 3V7AE 4U1JA 3KWWA 4I0CC 3GMLA 4P2RB 4PRAA 4PD4J 3GSOA 5DF0A 3NABL 4PREB 4HWZA 4LPUA 3Q5OA 4UQ2A 1N6QL 5CBEB 1U8LB 1NGPH 2D9CA 4L8SB 3QDHA 4XAKE 4X5LA 5D6CA 1KTDB 2H32H 3ARGB 5BJTA 1EXUB 5SX4H 1F6LL 4OLYH 1BBDL 4U7MA 2PO6A 2ZCKH 1PG7H 4R0LC 1B0GA 4HFUH 4ERSL 4I0PB 5EZJB 4UDUB 2YPLD 5DJXA 3WFBL 3W5NA 1KSRA 5BW7C 3CX5J 3FKUS 3CMOH 4PTTA 4OLUH 4MAYA 4K55A 3EYUL 1BJ8A 2BCKA 1OTSC 4MB4A 4RWYL 3WLWC 3IDMB 4NNPL 1JGUH 1J88A 1QRNE 2EDLA 2DBLL 3TJEH 4NOBA 4X4YA 2AXGB 2X1WL 2ZOLB 4JFOA 3O4LA 4M6OH 2L4OA 2X9WA 4HH9A 4KK5C 3RUGB 3WUWG 4PGBB 2Z8WC 1S9YB 4OBRA 3HE6A 2AK4A 4PJGE 3W81A 3QQ4B 2VDQL 5I1IH 4P2QE 4S1SL 4HS3B 1OAUL 2HLFD 1NCTA 3DURB 3NVQA 3DLQR 2KKQA 2CMRL 3BN9D 1I8IB 3D39D 3CFDB 3TEUA 1UADC 5AD0B 2X1PA 3IAQA 4LSPH 4APQC 4MX7A 3UPRA 5BZDA 4TVPH 3CFEB 1ZE3C 1ZLSL 5KSVA 4F37F 4LBEB 2I25N 3RX7A 4JY4A 5CEZL 1U95A 4FFVC 4N8VB 5T3ZH 4LSUL 3R0NA 3VFTB 1T6WA 1RZ8A 3L3DB 3SKUD 1QSEB 1UACH 3W2DH 4Q9QL 4AQOA 5IQ7L 2GITB 5DZOA 1FJ1B 1WWWX 4WW1B 2HTLD 1MWAL 2R0WL 3HNVH 3SPVB 5D2NA 3Q6FB 1GZPB 4OTXL 3JVGA 2WM0A 5DURB 1MJ7H 1B2WH 4D3CH 1P4BL 3KR3L 1G7JB 4P4KD 2HMID 4WTWA 2DQTL 1BLNB 4R7NA 3H9ZA 3SN6N 1CGSL 4CKVX 2H26A 3OXSA 35C8L 4V1DB 1NANI 3UC0H 1RJYA 4ONGH 3BIKB 4NZDA 5C6TL 1S9XB 1U3HB 3JZ7A 4OD3L 3JV4B 4DKDC 2XZAH 5ETUB 2ARJQ 4QNPE 2MSPA 3ULVE 3FAWA 3WHXA 1GHFH 1CLYH 4NQXB 3IXTB 3AM8C 4HUUA 1Z0MA 2C3GA 2A6IA 4GAYA 1UEMA 5T33H 2ATPB 2WIMA 1IC5H 1G84A 3G6JF 4EVNA 1ZHLA 3GO1L 5JNYA 3DJ9A 1EHXA 1YYML 2D4FA 4OLWL 5I8EB 4BK4A 5I16B 5D8JL 1LE5A 3O8XC 5C0JB 3MRIB 5FYKU 4G5ZL 3MV9E 5FYLE 5GS1C 3UJTH 1ODAA 5FYKE 1NCWL 2FB4L 3VD5A 3OR6B 1P84J 3QEUB 4WHYH 2ZUUA 3G08B 1HH6B 3OHXB 5EU7C 3D9AL 3MRGA 2VH5H 2PO6D 4X80H 1UB6A 1CL7L 1UQSB 2NX5D 2WZPD 3B83A 5T5NF 4NBXB 1WFTA 3SQOH 1IRAY 3I6KB 3WXWL 3PP3K 4LVHC 3ZHDA 5ALBL 5DRWB 4Y4HA 5ITBL 1E6JH 5T3XL 5IFJA 2JJTA 4PJFE 4JFXB 4LCYB 4TYUA 5F9JB 3RY6C 4Z7NF 4H25B 5F96L 4OCXH 2H3NA 4KRNA 3HC4L 4X9HA 2B7DT 1VGKA 3O4LD 4DGVL 3U0TB 4TUOB 4Y4KC 3WIFA 3IDJA 4XC1H 1K3IA 3HE6D 4RMRA 5FOJA 3TBSA 2APVA 1OLZA 4PJAB 2YRPA 4G9FB 1Z2KA 4MSWA 1I1FA 1XF2A 1R3LA 5LCVL 2OI9C 1AXSB 2BNUB 3QRFM 5T1KB 5IBTL 1U91B 3V5DB 1AKJB 1EEYA 2LU4A 4H20L 1VADB 4K3EH 4QEGA 4PUBH 3NN8B 4NCC2 1I1RA 4G8GA 1OGAB 4KRLB 2GJZB 1I3GH 2NY0B 5KAQF 5CFHA 2D7NA 1T7XA 1I8KB 5FF6A 2ZNWA 4U31A 1H5BA 1C16A 3BKMH 3MV8E 3NCFB 2OJZL 1N5AB 1A7OH 1AI1H 2X1OA 4KU1A 1SM3L 4X4XB 3SDXF 1D6VH 1HE7A 5BO1L 1I8MA 3DTXA 2NTFB 3QUZB 1I7UB 4ZPVA 1FZKA 4CGTA 1CGXA 5KVEL 2DQUL 2VISB 2ITDA 5DRXA 2ERJB 1DANT 1KN2H 3V5HA 3WEXA 4PRDA 5DJ2B 3TVMB 4KHXL 1FFOA 1OCWH 1SY6A 1HYRC 1K5NA 1LO4L 2YK1H 2XG4A 2YPKA 4ZDHB 1RIVL 1U8KB 2X5PA 5FAAA 2ICCA 1MCLA 3EJZD 3KLDA 1ZT4B 2E5EA 4I48B 5DJZB 3F7VB 3X17A 3PWPE 4JHWH 4PJ9A 1FO0L 1G7QB 4I3RL 1U92A 1MRFL 2O5ZL 1D5ZA 4AEHH 4MD0B 3MGAA 3PHOB 5E6IC 1QYGH 4EUPA 2I24N 5IW6B 4DGYH 2GK2A 3VRJA 3BZFB 5D1ZC 1U8PA 3OPZL 1RZ7L 4FHBD 3MV11 1UWXK 5FDYA 3BPNC 4QHMA 1MLCB 2FEDC 3H3KA 5ACMA 3EYFB 1YQVH 5GRVK 1BD2B 25C8L 3S37H 1EZVX 5I1LB 1KT2A 1RVFH 1W72L 1DZBA 4J1UA 5DXWA 3SKOA 1OTUC 1PEWA 4PJ8A 3PWUB 4YHIB 2LU7A 3GIVA 1HEZA 1BVLB 1J0IA 4OF6A 3U46A 1EAJA 3CDCA 5LBSL 1OAXH 1P9MA 5C09A 2ZG1A 5DUML 3MJ6A 4XRCA 5D2LF 1VFBB 2NY4D 3AUVA 3FFDA 3N1GC 5ESQA 1L9MA 4Y4HD 3RWFB 1QFWI 3FZUD 3JBG7 8FABB 2FSEB 3E0GA 2HVJA 3LKSA 3QG7H 4FN0A 4N68A 3V0WL 1CBVL 1ZHNB 4P3WA 4M6ML 3PDOA 4L3EE 1HNFA 5FUCE 2VZOA 3CVHB 3I75B 3FRPA 1A1MB 1T5WB 5KBNC 5FA3B 2AXFA 5JW5B 2YA0A 1JPFA 3FONA 1NGPL 4YUEH 4Z7VA 1RIHH 3B4NA 4X6EA 5GPRA 3FT3A 4D9LH 2XNAA 4HWEH 3S7GA 1U42A 3NFNA 4OLYL 1M4KA 1PG7L 1UA6L 3CDGA 4JO1L 1YMMA 2DICA 4HFUL 1OT2A 3I3DA 4HPOH 4HLZH 4P99A 4WI2A 4ETQB 3S88L 3PGDB 3GRWH 4OLUL 2Z9TA 4EI6B 3C8KA 1NMBH 2K1MA 2GCYB 2VDLH 4NYLA 1JGUL 4ZFZA 2CRZA 1D5XA 2WBJC 2BJML 3TJEL 4C54A 3ME0A 3IFNL 3ARYA 5SWSE 1T1ZB 2I07A 3DVNA 1BVZA 4DEPC 4JM2D 1UKQA 4I18B 3D25B 3MCLL 1MHCB 3HB3C 1CQYA 5GGRA 5GGVH 1QLFA 2CXKA 1HHJA 4DOHE 5I1IL 3S5LB 4L9LC 1F3DH 3QUMH 3ZE1F 1HOCA 4NBYB 1FNSH 4PV9A 4PLJD 5LGJB 3EO0A 2NNAA 4LSPL 4PP1D 1BWMA 4K23H 3MREB 4X9IA 5CJOH 3HC3L 4F3FA 1BHGA 4PP2B 2LVCA 5MEOA 1LILA 4IIQA 2SEBA 5KSBE 1YN7A 5T3ZL 2BNRA 3P4OB 4WWKA 3KNBA 4JFFA 1A6AA 1XGQA 1BQLH 4TTDC 1UACL 3W2DL 4PGDA 5EBWA 3LHPH 5E4EB 3W11C 2C26A 3H9SA 1QFWM 2F9BT 15C8H 2EKSA 3LDBB 1HQRB 3HNVL 2PCPA 4PJ8D 1G9NH 4HZLA 3T0WA 4XPHH 3PDGA 4X6FA 4G6MH 3EDDA 1B2WL 2AJ3B 4BFIA 5IB5B 1P5UA 5B38A 4MA1B 1RJLB 2MHAB 3GIZL 1QFUL 2APWA 4TSBH 4LQFH 2QL1A 2JCCB 5EN2B 3MRFB 5C09D 3GMPB 5EPMA 5K9KB 3L5HA 3RNKA 2HTKC 1D6EA 5HGDB 3UC0L 3QEHA 1F4YH 4ONGL 1QSFD 3OB0K 3FN3A 1YA5A 3QUYC 2VSDA 3PHQB 1YEFH 5D5MB 5HJ3B 2XZAL 4M7JH 1I9JH 1EJOH 4UI2A 4L3CB 1GHFL 3RTQB 1CLYL 2FGWH 1QTYT 2OTUB 4HK0A 3DX6B 3EYVA 5IHZB 3F7YA 4JFDB 5T33L 4P0DA 5IB2A 1IC5L 2W60A 5KVDH 4JGUA 4PLKC 1NAMH 1T5XA 5E1HB 5DJ6A 4G8EB 4OM1H 2J7LA 3UJTL 2DI9A 4JPWH 2XQYG 1A7BA 5TDPA 3AY4C 5AWNH 3MLWH 1D9KB 1MI5B 4ISVA 2Q6WB 2HT3D 2QSQA 2VH5L 4YFLF 1EX0A 1WEJL 3BPLB 1YMMD 4UTAH 1UGNA 4AT6B 1M71B 5GRZA 4K94H 3SQOL 5DSCB 3SJVD 4H0GA 1ERNA 4FQPA 2MCPH 2HFFA 1OTTD 2V9QA 1IM3A 5I9QC 1UH3A 1E6JL 4HZAA 2B4CH 1RV6X 1T89A 1MCFA 2CH8A 1DANU 4BUGA 1NFDF 4WGWB 4GRLB 1BOYA 4YBLC 1IKNA 1XIWC 4QOKB 4K9EH 4OCXL 1YMHA 3WDHA 1RK0A 3DGGA 1U3JA 4Z7UE 1F4XH 3I02B 2YA1A 3T0EA 1T0NA 3C6LA 4M5ZH 3V6ZA 3B9KA 3QXVA 4XC1L 1KG0A 5GZND 4E9LA 4NIKB 1HH9A 3QHTC 4RQQB 1DQLH 1MHEA 3U7AA 3BWAA 4CN1A 5IB1B 5HHOD 3UEZA 5AG8A 4J3XA 1JUFB 1NBZA 5DI8B 3MRKB 1MJ8H 5E94B 4E41A 4Z77B 5CCKH 3AAZA 4FQXA 2DB8A 4K3EL 1EHNA 5DK0A 2CIKB 4EUPG 1T2XA 4JREC 4JANA 1XF1A 3S3PA 4PUBL 4YNYB 5C2UB 3RNQA 1CICA 2CJUH 4I9WE 3V0AC 2HVKB 1I85C 3ZDZF 4JFFD 4RDQF 5D1XC 3BKML 2M8XA 2AI0H 4LCIH 4G7VH 2BZDA 2Y4SA 1A7OL 1AI1L 1HK6A 1D6VL 5F6IB 3I9GH 4PJXA 4OKVB 5C86A 3QDME 2A74B 3HG1B 2DS4A 1WV7T 2MFNA 5FGSA 3DXAE 1KN2L 1O0VA 5GRYA 4A6YH 1OCWL 4X7DC 2IPUG 1JZ3A 4Y2DA 4OZGA 2YK1L 2CK0H 4MA7H 4LLAA 3TGXA 2XTJC 1H3WM 2VIRB 3KPSA 4JHWL 1JN6A 4W4OC 2WW8A 4S11A 1KJVA 2DMBA 3BPCB 1N5YH 1G6RB 3R8QA 3G5XB 1QYGL 4OGXH 3HI5H 4UT6H 4M9OA 3C6SA 5IBUG 4XP4H 3MNWB 5M95B 2MMXA 1PBYA 4I0KA 2VDNL 3C08H 5ISZB 1AP2B 1OP9A 1Y0LA 2FBJL 1TMCB 4Q9CA 4M1GH 2YBRA 3QA3A 2DJUA 2NZ9C 5DFWH 5E2UH 3S37L 5ID1A 4XZUA 1RVFL 3O4OB 3X11A 5C7XH 3CX2A 3ZKNC 4LIQE 2W0FA 4I3SH 5I18H 1NFKA 3G5YB 1G7LB 3NFSH 5KVFH 5T1LA 1JWUA 5D7KD 4LEOA 4HIXH 3PL6A 4LPWA 4WI5A 4XPBL 5IJVA 1CXKA 5DK3A 1ZT7A 5GIRB 2O61B 3ARFC 4FXKA 3GB7B 4PJ7B 5EO0A 3B9VA 5TE4H 1OAXL 3KXFE 4OQ1A 3VXOA 3VD4A 5FEBA 4JRXD 5F89A 4JKPH 3IU4H 3VXSB 3DX7B 1XMWA 4ZAKC 5F1IB 1INDH 3QG7L 4Q0XH 3RVUC 3LPGA 1ZVSB 4N8PA 4ZFOB 3WHE1 2P8LB 5CEYB 2X70B 1F11A 4MDIB 1RHHB 4OI9A 4HSQA 4P5KB 3BP4A 4G43A 3T0ED 4ZODA 3C6LD 3M07A 1AGBA 2E6QA 4FQHB 3I3BA 3VG9C 2D3VA 3BQUB 1EGJL 1JJUA 2NY1C 4F9PC 5D7JB 3FRUA 2IF7A 1EJ6A 1B90A 2UWEE 1RIHL 1MY7A 5EC2B 4D9LL 3NPSB 5DTFB 2G60H 4HWEL 2VR9A 1WBXA 3Q6GH 2QEJA 4PRHA 4E41D 1UENA 3STZA 4U6HB 1IM9B 4OQTA 4RFOH 1UVQB 4CRPA 1LK2A 3SDAB 3GM0A 2NY5H 4I2XA 3T0VA 4M43H 4UB0L 4GRMA 4HPOL 1W8NA 1CICD 2H2SD 1PAMA 1TFHA 4G8FA 1EHAA 3GRWL 4ODWA 3TNNB 2WWMC 3L3GA 2ZSVB 1NMBL 3GMOB 1F13A 1AGCA 4ORZC 1JHKH 2ADGA 2VDLL 1H8SA 3ARDA 3DOSA 1DQJB 2XN9D 1S7QB 5DVOA 4W4NA 2CK2A 4TNVF 4XXDA 3VXNB 2VLLA 2X7LA 4NO0B 5GJSH 3L3JB 5GHWH 3N85H 2JF1A 4KY1L 1KIQB 3SDDB 5B38G 2R56H 3NGBC 5EBLA 3ZT5A 4Z76B 3GUTB 5GGVL 1S5IL 1SJHA 1T1WB 2W65A 4KMQA 4NRYB 5IM7B 1K9TA 4Y2DD 4Y19A 3QUML 2ZNXA 1Q9WA 1FNSL 1WLHA 4YPGA 1S8DA 1NH6A 1I4FB 3W5MA 3MROB 4JKMA 4K23L 4JAMA 4LLQA 3KPSD 3QUXA 4RZCA 2HTLC 3UYOD 2RAMA 2J88L 5CJOL 4JHAH 3IVKB 4XGZB 2IAMD 3CFKB 1AJ7L 1HI6B 5HYEA 4X9GA 4PLOB 1FIGH 4YHNA 4YXLH 4Q6IA 4EI5B 1E28A 4XBGB 5DDHA 1BQLL 4HWNA 3VFOB 5CD3A 1PLGH 1B0RA 1B6DA 1MUJA 4MJ2A 4F7MA 3WE6A 3TT3H 3NCMA 5BZWB 4QRTB 3L95B 4LPVA 3WIIH 5HGAB 2GI7A 4GS7C 4R2GB 4FNLH 1SY6H 4QTIH 5T1LD 4M4RA 1TJHL 2HRPH 5JIIA 5BXFA 3R1GL 4G6ML 2FWOA 2D0FA 4R90H 3PL6D 4GKSB 3FFCB 2YD4A 5JMRA 2VE6B 4TSBL 3WKNA 4LQFL 2ZP0T 2O5XH 2Y1VA 3ZT6A 5F7WC 3MRRA 1JGLH 1F4YL 3O41A 1QR1B 2X4TB 1AO7A 3QG6A 3K7UA 5C0GB 3K8MA 4RSVA 3C8HA 4RGMC 4G8IB 1YEFL 1PZ5A 4OD2B 2R2EA 1U8NA 4KTDH 4M7JL 4PY7A 1T21A 4N90D 1SMAA 4OCYH 4Y5XC 1JFQH 5DJYA 5DRZB 2FGWL 2XOTA 4HIIB 1CXFA 3DROA 4YWGH 2PO6C 3P77B 1HXMA 3B5HA 4LCCB 4DGIH 3KHQA 4YO0B 2Q7NA 2FX8H 3GMQA 5KVDL 2H45A 2VL4A 4XVJH 1IMHC 1NAML 5KG9B 4POUB 2VRAA 4MAYC 4OM1L 3BYYA 1U8JA 1AD9B 4ONFH 3O6FA 5AWNL 3G6JB 3MLWL 2DKSA 4RX4A 1C7TA 4OFKA 4LCWE 4HGWB 4PRHD 3NCBB 4NC1E 1JRHH 4OCMC 1KB5L 1NC4B 1IQDA 3SY0A 5DD5H 3QO0B 1FG9C 4TVPE 4FOMA 5I74C 1OHQA 1F8TH 2MCPL 4JFHE 5EBMB 4X8JA 2WANA 2B4CL 1BEYH 4EEEA 2I27N 3QAZC 4YEEA 3BDBA 3ARDD 3ZKXB 2HFEA 2RQ8A 3QQ3B 2YWYA 3DRTA 4GG6E 3MMEB 1BOGB 1F4XL 2CUHA 1TZHA 2NY2C 1QBBA 3PNWB 1FZOB 4M5ZL 1NGZA 3HPLB 4ODXB 1WBZA 1ZWIA 1LP9A 3IRPX 4PJIA 4FABH 3H7BB 1DQLL 4Y19D 1IZJA 3MNZA 1KB9J 3EOAA 5TQ2H 3OKEB 3EGSA 4L8SC 1KNOB 3CFCH 1FNEB 4P5TA 3QEQE 4E42B 1MJ8L 3JXAA 4KKLC 4HDIB 3QUXD 3ARGC 5LWYL 5J0BA 1DQTA 2ADJA 2AJXH 3DRQA 2EIEA 5HDBE 1TLKA 5D2NC 3T4AB 3NACH 1IVLA 3D0VA 4I0PC 1CN4A 3JVGC 3TP4A 5JXEA 2CJUL 1T22A 2A0LC 3QWRD 2AJZB 4KKAC 1K8DA 3BXNB 1OB1A 4ZUWA 3VFUA 4ENEC 4LCIL 2AI0L 4G7VL 1EIBA 5HHMB 3PWLB 4N0CC 4ZOBA 5B39B 5J6HA 3GDBA 4FXLA 3NCYP 1QPXA 3I9GL 1KJ2B 3QCUH 4HHAA 4NKOB 4WNQA 3VXUB 4J3VA 2V2XA 4PV8B 4MJIB 1FH5H 5TFSH 4Q6YA 4WV1C 3SDXB 1ZSDA 2R0LH 1MVUB 1T03H 1GIGH 4A6YL 2YD1A 4JFYB 3VD7A 2WMPA 4Y88A 1RPQA 2K7QA 4MA7L 1FFPA 3H9YA 5HVWA 4Y4FB 3MCKB 1S7XA 3MR9A 1BIHA 5F88A 3ROLA 2DD8H 4NWTH 3HFMH 4H1LH 4CW1B 3PGCA 1RZIA 2P5WB 5ICYA 4C57C 1GGBH 3HZYB 4UT6L 5GRWA 2YSSA 4XP4L 1SHMA 3GSRB 4NM4H 2BSSB 3KPLA 3QFJA 1XZ0B 4PR5A 4X6DF 4XMPL 5HYJE 4M1GL 4RGND 1H3VA 5E2UL 1NC2A 3HUJA 5A2KH 5C7XL 5JHDA 1V7MH 2GY7B 1ZLVH 3T4YB 4I3SL 1ED3B 2DKUA 5KVFL 1GGUA 3O6FD 4PRBA 5HPOA 1W0WA 2VXQL 4HIXL 3ZTJG 4D94A 2Z31A 4RX4D 5DYOB 1YYLH 5ALCH 5TE4L 3U1SH 2H9GB 1JGVH 1YPZF 4TPRH 1E27A 4JKPL 3IU4L 4PGEB 1VPOL 2DL2A 2ESVE 4LARL 4WDIB 4G6AD 1A9BB 1I7ZB 4JZOB 1SMOA 1INDL 1YY9D 4Q0XL 2XACC 3AB0C 5J1SC 5D2LB 3MLXL 2V5MA 5IBLC 4LEXL 1A7QH 3GSUA 4C56A 5LXGH 4LSSH 1PQZB 3C5ZB 5C9JB 4AJ0A 3VRLE 3WNOA 2BVEA 1B4JH 2DLGA 5J6GA 2VTFA 5DRNA 3D3VE 3FQRA 3V7MA 1J05A 3DMMA 2EDRA 3JTSA 2R8SH 3KPRD 2BY1A 1H5BC 2H2PD 4JDVA 4KJPD 4Z7UF 3E6FB 3V4PL 4P5TD 2G9HB 3TBTB 1JPST 2F54E 5IJKC 2ORBH 4YHKH 1TCRA 2Q7YB 3MUHL 4RFOL 4X6BB 4PRPA 1P5VA 2AXJA 4B7IA 4M43L 4MQSB 3VI4E 3D0LA 4QCIB 4WJ5B 3HI1A 5JOPE 4U1SA 5HHQB 4DUXA 5JXED 1G1CA 4U4BA 2P7TB 3ULUC 2DQEH 4X99B 2X4OB 1JHKL 1H3XA 1OSPH 5KSAD 3RZCB 4QRRB 4PP1C 3FB8A 4Q2ZB 4G9DB 3WKMH 3DSNA 1GSMA 3N1QC 3FL7A 4XNMB 3LOWA 4JPKH 1C5CL 4PJ9C 2K7PA 4L4VB 4OGAD 3N85L 3MJ9A 1AGDA 3WO4B 2R56L 4Q97A 2R2CA 5B21A 4NPYB 1KACB 1MCHA 2OXGA 2LABA 1QLEL 2FIKB 3GBMH 1QHOA 2GYSA 2XZQH 3QO1A 3KPQA 3QQ9C 4KK6D 4MS8C 1BZ7A 1IJ9A 5BV7B 1J5OL 1VKXA 1YY8B 4MXQD 1BFOB 4K8RH 4UDTB 3MRJB 4JHAL 2VDKL 1YEJH 4H0IA 5EZLA 3CXDL 1A2YB 4L9DA 4PJHA 4DKFH 4UTBL 4CDGC 1FIGL 1CU4L 2CUMA 3LIZH 4YXLL 1QKZH 2NY0C 1U8LA 1SEBB 2C9AA 5T1MA 1T7YA 1V7NL 1PLGL 5GZOC 3VFPB 3EJJX 3S4SA 1CFQB 3ZE0E 4EN3C 2X10A 4LMQE 3TJHC 3TT3L 1KJMB 5HI4D 5JHDD 3WIIL 5CGTA 3ULUL 1F6AA 1U8QB 4FNLL 3SDYL 4QTIL 1J87A 2ERJC 4R90L 5IVXA 2CLVA 1DVFA 5MERB 3TVMC 4RNRA 1CR9H 5F7EL 3V4UH 4KRPD 2NY6B 1KTRL 2O5XL 3IDMA 4XMKH 3MPCA 1WCBB 3ARWA 5IESH 3T3MF 5KS9E 4URTB 3RVWD 1JGLL 5AUMB 1JCKA 1CXHA 4NRXA 1UJ3B 5C1MB 3O3EB 2ZOLA 4NQEA 4MVBC 3RUGA 1U8OB 4OZFA 2QQQA 4KTDL 2Y7QA 4OCYL 3WL9B 1JFQL 5HDQL 5IKCA 5CSZB 4ZUUB 1IC4H 4X7SH 2XZCL 4YWGL 3LQMA 3LKPA 4C56D 4DGIL 2G5BB 3VFVB 4QHKI 1U8HA 4ZUVA 4UAOB 2PN5A 1CD8A 3QIUB 1P2CB 2FX8L 3ES6A 5FHBH 1DTUA 1M7IB 1MCCA 3QDJA 1VCAA 4XVJL 2EE2A 4Z7QE 3DMMD 1AHWB 3VGAC 1E4XH 1KPUB 1F42A 2K3TA 3EDFA 4ONFL 2FL5B 1ZS8A 3I6GA 1H3UA 4PBVC 2IANB 5CJQH 3HAEB 3HR5B 5F93C 1L6ZA 2VL5A 3VFTA 3MGTB 4I13B 5DFVC 4PRPD 2EO1A 1MFBH 3RWGA 5AYUH 1WC7B 4LASH 2GITA 2JLLA 4FZEL 4QRQA 3OWEA 4ORGA 1F8TL 2VQUA 4MXWH 3SPVA 1HHKA 1BEYL 1GZPA 5IV2B 5F9OH 2BFVH 3IS1X 2P48B 4OV6F 1ZT1B 1U0QA 3LKRA 1JYWA 3DO7A 5I30L 2QV2A 2XFXB 1NBQA 3RZWA 3VXRE 3V8CA 1NFDB 2W9DH 3IETB 5FA4A 2MCG1 3EOBB 5JORB 5TF1L 1MY5A 2V2WA 3EJYD 2ADIB 3TWCL 4E0RB 2E27H 2ZJSL 4WWKC 4Z7OF 2D9QB 3HZVB 3QDGA 3QPQC 3D39E 1CG9A 4GT7A 5ETUA 5TQ2L 3DPBA 3ZE2E 5JZ7D 4OZHF 3CFCL 4NQXA 4BQBA 1MCQA 5I1GH 1RURH 3RVTD 5MEPA 1FFRA 4M7LH 2AJXL 1IILE 1WT5A 2FEEI 1RUAH 3NACL 4P23B 5I8EA 1UZ8A 1QSZA 3CU7A 1NBVL 4P4RB 1YQ2A 4FMFA 1KLGB 5KZCB 1U2CA 4N9GA 3UBXB 2VC2L 1DBBH 2ZUYA 1MEXH 2C3VA 4MLIA 2N56A 3O45B 5D71H 4CN6A 3QEUA 2APXA 3ABZA 1IGJA 1WTGT 4LNRA 1ORQA 3GJFB 4XB7A 4HS6A 1L0YA 1FH5L 5TFSL 1QNZH 4NFDA 4WIQA 2AEIT 3I6KA 2W0KA 4LLWA 3V0VB 2R0LL 3RHWK 1MSPA 3FO2B 1T03L 1GIGL 1DVFD 3KDMB 1ZVHA 2PW1A 3RIFK 3NA9H 4H25A 2J8UF 4KKCC 4B7LA 5CLWA 3ZYIA 2DD8L 4F2MB 4DFHA 3H7LA 4RAUA 3HFML 3O3BB 3REWB 3NCJH 3EDJA 4RMSA 3IDXL 4YH6A 1GGBL 3QJHB 5HGHA 1OGTB 1T0MA 4PRIB 2WWKO 4NM4L 5B8CA 5JDSB 2VQTA 2GKIA 3RKDC 1XGYH 2X6MA 2YRZA 43CAA 4Z9KB 5I8CA 2OYPA 4C4KT 4WTZG 1T7WA 3P73B 1RY7B 3QDJD 4MZ3A 5E4EC 1V7ML 2IQ9H 2OJEA 1VADA 3IKCB 3WLBB 3LDBC 4M1CD 3MC0A 3NN8A 4GLRH 2QKIA 4UV7H 5FCUL 3MNVA 1C5DA 2NW2A 1INQA 4YHLH 2CO7B 3MO1A 2JTDA 2NX5E 1I8KA 5JQHC 1R5IB 1YYLL 1MFAH 1N5AA 3PF2A 4PJGA 4QWWC 3A0OA 1QSED 1JGVL 2ZKHH 2ADFH 3B9KC 5C92A 4TPRL 4MCYB 3QUZA 4O2CB 5HYQA 2JK5A 2PR4H 2XG5A 2VWEC 4JQXA 4ELME 3IDYB 5C0AB 5E8OA 4BQ9A 5DURD 4MA8L 4TSAH 1PGRB 4RFEA 3RTQC 1OD9A 3GHBH 2BHUA 5KN5B 4KMLB 4K2UH 1A7QL 5LXGL 4ZDHA 4LSSL 4FQXC 1SJXA 4GG8B 1T4KB 1LNUA 2IFFH 1T1XB 3FQXB 1C8PA 3SGJA 5A3IC 1KEGL 1X7QB 4I48A 4MD5A 1B4JL 3G9AB 2QQKH 4K8RC 4J3SA 1HHGA 1FGVH 1ZA6B 4HUVA 4X7FC 1KYOJ 4YGVA 4D9QD 3MRPB 5GS2D 1U3HD 3OKDB 1S7RA 4LRNH 4F37K 2A73B 3SHSA 4GG6F 1GYAA 3PHOA 1KUMA 2GSGB 2XRAH 3KLAB 3B2VH 2ORBL 4YHKL 1D9KC 1GGCL 4NQDE 3BE1H 1KIPB 2ED7A 1PYWA 1LWRA 3BPLC 2UYLB 3UDWA 3QWQB 3EYFA 3T1FA 5FYJL 2C7UB 5FECA 1R24B 3IFOA 3IT8D 4DJMA 2DQEL 3HC0A 3DYOA 1WFNA 4FQJL 3KYNB 1OSPL 4F8QA 2AERT 4HUWB 4O00A 4M5YH 1T7VA 3HS0A 2P8PB 3C09B 5C0EB 3RPKA 3WKML 1DN0A 2DYPB 3MACL 4JPKL 2Q76B 3BZEA 4YDIH 3W0WB 1ZA3A 2YZ1A 3B3IA 2MNUA 4FTVE 3VWKA 4WUUB 1KCRH 2FECL 2V5RA 2R4RL 3SE3A 5AYQA 4L29A 4FXGA 3RWFA 5ENWA 2Q1EA 4M6NL 1FBIH 3G5VA 3GBML 1NUDA 2RBLA 5J56B 2WNGA 2XZQL 1AD0B 1FL5A 2ICEB 2QSTA 2FHFA 5BVPH 2H8PA 3OJVC 2HJFB 3LRSA 3MV9A 3K80A 3L1OH 3IJHA 1T20A 3BJLA 4POZD 1Q9OA 1CE6A 4K8RL 2W9EH 2ED9A 1DQQA 3I75A 4YFEA 3FT2A 3I2CH 3F12B 3LVEA 4HD9A 4DKFL 1UXWB 3MJ8A 4F8TA 1EEZA 3LIZL 1X5AA 1QKZL 1J86A 5FIEA 4PJEE 3LN4A 5KANI 4YC2B 4X5WB 1LEKA 1OP5K 4Y7MA 32C2B 1ZHBB 4M6AA 1FDLH 1DR9A 5F6IC 1AKJD 4PJFA 3RVXD 3C5SB 4PTUA 1OP5H 5EU3A 3VFWA 2ZPKH 2R29L 4N8VG 2NLJA 4GW5A 5GSRA 1OGAD 2RCSH 1EFQA 3OJMB 4LSQL 5IB4B 3PGDA 2HAZA 3V5KA 1CR9L 4YZFF 3E3QE 1T1YB 3MRHB 3EYOB 1M6OA 2V7HB 2VNCA 4K71C 2AGJH 4F57H 4NSKB 1CF8H 5HHPB 5IESL 5FO8A 4RAVA 1S9VB 1T83C 3QUZD 2HRLA 4NN5B 1JZ8A 3O0RH 1QA9A 4D0BB 4I18A 4X0KA 3D25A 4P46A 5LG1A 3LKQA 1WISA 4O51B 1YEIH 4AENA 2IC2A 3NPZB 1IC4L 4GRWH 4QT5B 4X7SL 1QEWB 2HKFH 4LKCA 3KPOB 4O4YH 4X7TB 5DMGD 4OAWB 3ZKMC 5D96B 1GAFH 2JIXB 3EKCA 2PTTA 5I8OL 2WIIB 3N9GH 2F53B 5IEHB 1E4XL 4N0UB 4UIMB 5DQJB 4BH7B 3CFIC 3W39A 5DMIH 1QBLH 2ICWB 4PJ5B 4PJCE 5CJQL 3ARDC 2GJ6E 2QADB 2V2TB 3ALWA 3LB6C 3SE4A 5EO9A 2VABA 4ZUTA 4HWBA 3PV7A 1MFBL 5CEXB 1BD2D 3R06A 4LASL 1N7MH 3O9WA 1G1YA 1HWHB 4LLMA 4NO2B 4BSVB 2AV7B 1KEML 5F9OL 4L4TB 2EZ0D 5K9OB 2KDGA 3PWPA 5C0DA 4HJGB 3JV6B 2GFBA 2X4QA 4MXVE 2X4SB 1RJLA 2UZIH 2MHAA 3NTCH 2R1XA 5C0NC 4HKXA 3WFHA 4I1NB 3ULVD 2D7QA 1UT9A 1ZGLP 3BP7B 3VWKD 2W9DL 4LVOC 2A6JB 5JTWA 5E2WH 2NCMA 4Q6IC 2E27L 1G6RL 4LDOB 4WFED 1WBYB 1XFPA 4MGXA 1FNLA 4L3CA 1ZEAH 1S7WB 5DS8A 4J3UA 1RURL 2OTUA 1HDMA 2YOCA 5FYKD 4M7LL 3L7FB 1RUAL 4MNHB 1A5FH 2AJVH 3LEVH 1BAFL 4KXZH 2DWEB 5J12C 2XWTA 4MA3B 5F3BB 1DBBL 3F58H 1MEXL 1N6UA 4HIHB 2YD5A 3ILQD 5D71L 5TDNB 3KPNA 4NZUH 3CSYB 3HR6A 5DUPH 4JG1H 3MJ9H 4CVUA 1Z5LB 5ACZA 5FUZH 1QNZL 2CDGB 3ZDXE 4ZTPH 3SKMB 5DSCA 3LS4H 2BNQB 3LKNB 4L3EA 3SDDC 5L8LB 1Q38A 3LY6A 1FL6A 5C3TA 4J12A 1RU9L 1EAPB 5D7LB 3FOMA 3PV6A 3UTSB 2L7UA 2FHCA 3KS0J 3NIFE 1Q1JH 1QSFE 3F5WB 4QO1A 4RMWA 1G9EA 3EHBD 5EOQH 1CD1B 4U6XB 1I75A 2VZ1A 4RWHA 1YDPA 3NCJL 2LTQC 3BMVA 2DN7A 1DBKH 3E6HB 2ZUQB 3VFMA 5IGXH 1SJVA 2F74B 5C0BB 3BH8A 4ODUA 3RX8A 1XGYL 1LK3H 5AZEH 4NN6B 1CDJA 5IEKB 5LWYH 1LGVA 4HQQL 1NBYA 2WINB 4Y16A 5E94A 4NFBA 2IQ9L 4Z7VE 5SV3A 4X6DB 1KTKE 2DQHH 5LQBH 5SWSA 4YHLL 1C7SA 5BRZB 2VAAA 4QYOB 2XY2A 4X98A 1YMME 3RQ3A 4AIZA 1X5GA 5IW1B 1MFAL 2F8VA 5E9DB 5I71B 3SJVE 4Z7QF 2CLRA 2WP3O 2ZKHL 3VG0L 2ADFL 4BH8A 5A16A 1T66C 4OZFH 2GY5A 3O9WD 4MNQE 4G42B 2PR4L 3DV4B 3IXAB 2PXYA 4B5EA 3SDCB 3PWPD 4TSAL 1YPZB 1U93B 4MJ5B 4YEFA 4UBDD 5EU4B 4XX1E 3LPFA 4K2UL 5GGTL 4GBXB 4LCCC 4IMLB 2IFFL 5KSBA 5LJYH 1RUML 2QQKL 4U1KB 1KXVC 4NHCL 1FGVL 5I75B 3HKFA 3QI9C 5F7HA 4OZIE 4XP1H 5HHOE 5GJTH 1JZ4A 2I60H 4ODSH 4LRNL 2XRAL 5EUOF 3B2VL 3BDYH 4J8RA 4PY8I 1XR8A 2EYSB 3OG6B 3BE1L 2NY3D 1F4HA 1BPVA 1WF5A 5EB9A 1KELH 2R2BA 4R0LB 2YC1A 4WHDA 3UTQA 5M7QA 5CP7A 2DDQH 3B6SB 1MWAB 4XP5H 3WV0A 2WK2A 2GT9B 5CBAA 1J1OH 1ZGLB 2GJJA 3DX9A 4TUJB 4ZMAT 1LEGA 2P45B 4M5YL 5BMFH 1FLRH 1VACA 5SWQA 3IGAA 3ZO0A 3DWTA 2M2DA 3QIWA 3WS6A 1RSFA 2FD6L 4YDIL 3QXTA 4PJDE 4QHLA 1Z9SA 3MA7A 3Q0HA 2VLRB 5D1QB 4LCUB 1KCRL 4GW1B 3IF1A 4L3ED 5I1KH 1FBIL 4KQ3H 1DSFH 1L6XA 1R6VA 2X9YA 4WW2A 1WSST 3FTGA 1YUHA 5BVPL 5LGHL 4ZFOA 3ZSSA 2P8LA 5EIIA 3RI5F 4QOKD 4DTGH 1LE9B 3NZ8B 5IMLA 4JN2A 5DQ9A 3NIGE 4APQB 5MENE 4JFPA 3TBVA 4XCNB 2W9EL 3MTRA 4AZ8A 1XH3B 2Z93A 1U8MB 3I2CL 5DLMH 3S5LG 1NFIB 3BQUA 2Z31C 2YUWA 4Y2OA 3OKMB 3G6DH 2EDOA 4DCQB 5L2KE 2RFXA 1NPUA 2CKBH 3CD4A 3IFLH 4L8DB 4ZUSB 3GSNH 1FDLL 3WSQH 4Y16D 5J06A 1IL1A 5JA8B 2E9BA 1UEYA 3HLAB 5D7KE 5FHAH 5DEFA 1AR1D 3B5GA 3JTTB 5GGSY 2ZPKL 2RCSL 5SWSD 1YEDA 1CE1H 1E0OB 1EBAA 3RA7H 3TNNA 5I8KH 2ZSVA 3REVB 1WITA 3V4VH 5DMYA 1JV5A 1P6FA 3VWJB 2ZG3A 4HJJH 4JRXE 2AGJL 3DECA 3IFPB 4F57L 1CF8L 4JY6B 4Q7DA 4D0CA 4KKBC 2OZ4A 5DJ8A 3BT2H 4UT7H 4AIOA 4Y4FC 5CZXC 3QYCA 2UUDH 5FV2A 2CLZB 3TO2B 4L5FL 4IOIB 2PXYD 4AY0A 4CADB 4U1HA 2IALB 4NC2B 3SGEH 1A6TA 2L0DA 4NRYA 3IJSB 3MRNA 4OCSH 2VSCA 3T0EE 2HKFL 5E8PB 3QR2A 3FQUB 5C8JA 1JNLH 4OKDA 4ELMF 1EFXA 2VKWA 1GAFL 5LVEA 5JO5B 4CDHA 3KLSA 3FT4A 3N9GL 5CWSB 4KROD 3O8XB 4NNYA 4X7CC 3O3UN 5GS1B 2DTMH 5ADOH 2D7PA 2NW3B 2ARJA 3JWOH 3QDMA 1U8IB 4QTHB 3GJFK 5DHVB 4EI5A 3D18A 1R0AH 2DOCA 3GHEH 3GMNB 1LO3H 4WHTA 4HXBH 3VXMB 3DXAA 4QRPB 3OL2A 1KJ2L 3MGOB 4U1NA 1C5BH 4AM0A 1I7TB 1N7ML 2VZ3A 4CU7A 2IWGA 4LVHB 3CFBB 4JQVA 1HHHA 4MMZC 1IGIH 5DZLA 4YR6B 2XN9E 5FFLA 2GSIB 3U36A 2FRGP 1KTLA 3AC0A 1TVBB 4MD4A 2UZIL 1DFBL 2MOVA 2LAAA 2VE6A 3NTCL 1BIIB 4BFGA 3C87A 1G0DA 5DD6B 5LKNA 1A6ZA 4KMTH 5E2WL 1FZJB 3C60A 2GW5A 5E5MB 3WIHA 4HXAH 2KUTA 1SYVB 1FO0B 1YJDH 4WI7A 1GZQA 2DWDB 1ZEAL 3GSVB 2ILLA 4QHNA 2V9TA 3I3EA 1RUQH 4WTXA 3LRHA 4J3OC 4WO4A 4IDJH 3OZ9H 2I5YH 4KJQC 5BOPA 1X44A 3G6AB 3NIDF 3TO4A 4HUXB 2A2QT 4OZHB 4MNGB 4YDVA 5HHXH 1A5FL 2AJVL 1HYSC 1W72B 5KG9A 2DM2A 3LEVL 3BQUD 1KLUA 2MPAH 4BSWB 4P5MB 3BAEH 1ONQB 2X4UA 3KXFA 1J8HB 1N6VA 3F58L 4Q74A 3MV7B 2IEPA 3DHJA 2EE3A 3KPMB 5HYSA 2X09A 4NZUL 3MLUH 3ULVH 2OXHA 3NH7H 4YFLI 3OX8B 5DUPL 4HPYH 1BX2A 3BH9B 3JUZA 3MJ9L 4AL8H 1S7TA 4NO5B 3VFNB 1IM9D 1CIDA 2OTWA 2W0LA 5FUZL 3QH3B 2YPVH 3S36L 3D2UA 4K3JL 3QULA 5SV4A 2CDEB 2ENSA 4GXUN 2EH8L 2NXYB 3EFFB 3CU1A 2WUBH 3N1FC 3M1BA 5FYLH 5FYKH 2XXMB 2C1PB 3F6LA 3HZMA 4R9HA 4N1CA 1Q1JL 3PWJB 1MJUL 1JL8A 3MMEA 5F97E 2AS5M 1AY1H 2UWEA 5DGRA 2Y06H 4N90E 1MRCH 4HX1B 2EDBA 2IH1B 5IUSA 1DBKL 2J8UB 2G2RB 3RWEB 3ILPB 5E6IB 2I9LB 1BJ1J 4XCEA 1FSKC 5DHYB 5IGXL 3B8SA 5CMAB 4LHUA 5GGVY 2VDPH 1LK3L 5D1ZB 5AZEL 3PQYB 3RWCA 5GXBB 4I9WD 4ONHA 1FNEA 3TPUA 4ZNCD 4X5XA 2H32B 1PEZA 3BPNB 2AXHA 3SE8H 3UAJD 3UBXI 1EFXD 2H1PH 4X8XA 3TIDA 1CFBA 2VITB 4KGLA 1ADQL 1NGYA 4PRNB 2DQHL 3LCYA 5LQBL 4OV5B 1KC5H 2AJZA 3QDMD 1D5IL 4QHUA 4EI5D 2F19H 4JRYE 3S96B 3DVFA 5FGCE 3MLTA 3DXAD 1EPFA 5DFTA 2A9NH 2NY6C 4QRSA 1F4WH 5ECJE 4XCFH 5GSVA 4DK3A 4NKOA 3L7EB 3H42L 3FJTA 3KYMB 4TNVK 3WFDH 2QLVB 5K9QI 1S7SB 3ECBB 4KK9C 1CCZA 3AS0A 3OKNA 4R2GD 4U3CA 2OL3A 2VLKB 4QRUB 4HCRA 5JPMA 3BHBB 1MVUA 2XPGA 2UV3A 1DUZA 3E8UH 5CP3A 3FFCD 4Z7WB 3HRZA 5HYIA 4Z0XA 1CQKA 3VE0A 4BZ1H 4HV8A 4IMKC 3C60D 5E8NB 4P57B 4Y19E 5FM4A 4NT6B 4BKLA 2EYRB 5GJTL 1NLDH 4ODSL 2VLJE 3INUH 3U6RB 3T8XB 1XCTB 2IPKB 4HC1A 1HILB 3MRMB 3BEVB 1KELL 4XP9H 1CLOH 3TO4D 4HK3J 2DQFA 2DDQL 1A7RH 3OJDA 3D1MC 1WAAE 5BS0E 4XP5L 3H9HB 4PIRF 3FN9A 1J1OL 3TYGL 4Z78A 5H94B 5BMFL 1FLRL 2FBOJ 4LK4A 3W9EB 3C9NB 1QO3A 4POZC 1MIMH 1NGWA 5KANG 4U1MA 4DEPB 1WJ3A 4XAWH 3K46A 4R96A 3TZVC 3OR7A 5C0IB 3QQNA 4JPVH 5B8CC 1VEOA 1IGFH 4JZOA 4KQ3L 1K3ZA 4QY8B 3IDGB 4L9LB 1EUTA 5TJWK 4IRJC 1A6PA 5TDOA 4JFEB 1TTGA 1LO5B 1CYGA 2VXSH 1OARH 4K3HA 4DTGL 2HFGH 3MSPA 5H35B 2PW2A 1AQKH 3VGBA 2HH0H 3RWDA 4UNVA 1Q94A 5E00B 2QSCH 1F90H 5DLML 5FOBA 4Y0GA 5DVMA 3G6DL 1MRDH 4ZXBB 1A3RH 3A6BL 5JMOC 2XTJE 3JWOC 4RGNE 3HPJB 2CKBL 1RK1A 1IKFL 2AK1H 1SJEA 4MWFA 3TBTA 3IFLL 3GSNL 3WSQL 5ESVA 5HHNA 3TNMA 1CZ8L 4X6BA 1A02N 2EDDA 1P69B 2AVGA 5KW9H 4QCIA 1ES0B 3LV3B 4NZRH 4R4ND 4C83A 1CE1L 3AXLA 3RWIA 5F8RC 5FUOH 4OFVA 5I8KL 1A1NB 3H0TA 1NMAH 4DVBB 1JPTH 4XPAH 2X4OA 3V4VL 4G3YH 2UZYB 4UU9B 5C0CB 4HJJL 3RZCA 5B4MC 1UCTA 3SGJC 1RMFH 5B3JE 1J10A 3CFJB 1BVKA 4Z7VF 3BT2L 4UT7L 4XNMA 4OF7A 1HCFX 4L4VA 4IBLT 4YXKH 5INDB 3R0MA 4QXUH 3RWJA 1QG3A 3QEQA 1FRGL 3FB7A 1UXSA 4ESKA 1FYTE 1YJDC 1JWMB 1WTLA 3Q1SL 4ZFFA 1RJZA 3HNSH 3VFSA 3V79C 2GAZB 1IAII 2FIKA 3U82B 4OCSL 5F7MC 1JNLL 1ZVYA 1AIFA 1LP9E 1ZXQA 4AMKH 4ZS6D 1XF5B 3DETD 2X89A 5GGSB 3KPRE 3MOBH 3BGMA 2Y36H 3MRJA 4UDTA 2WV3A 3RY4A 4RIRA 2BVOA 1MFCL 1Y6KR 3QPXL 1QBMH 4GKOA 2DTML 3S97C 5ADOL 2BC4A 3JWOL 5E99H 1AGFA 3KHOA 3Q3GB 3ZYJA 1P53A 1R0AL 3GHEL 1LO3L 2PNDA 2ZSWB 4HXBL 4LLVB 1FVDA 4RBPK 1FE8H 2ZUXA 3VWKC 3VXTA 1C5BL 2EDKA 3SE3C 3MLSH 5DVLA 2YMXL 3OF6D 1KCVH 2P5EE 4NQCE 3NBNA 5I9QB 2BSRA 4HKZB 1YNKL 1IGIL 3HN3A 4J3TA 1XF3B 4V2BA 1KJ3H 4OIBA 3MBEB 3TA3A 4YBLB 1XIWB 1YNLH 5ITFA 2VDMH 3DYPA 4AYFA 1JK8B 2FZ3A 4KMTL 2OR8A 2HT2C 5DQDH 1FQ9C 3TYFA 4QF1B 1UJ3A 4JDTH 4M61B 4HXAL 1YJDL 5A2LH 3MODH 1N3NB 4KI5D 2HN7A 3LMJH 3FAXA 2V7NA 4JQIH 3FB6B 2EXWD 3SE9H 2ZOKA 1QFPA 4F58H 4POYA 1RUQL 4OBSA 3X3GH 3EYQD 3OKLB 4JZNA 3ARBA 2ZWLT 4QXGH 2OSLA 3CNKA 3C5ZD 3OZ9L 3GSQA 2I5YL 3FO1A 3P9LB 3PE9A 4HT1H 2QQLH 5HHXL 5EG6C 1HHIB 3PGFH 3O11B 3QRGH 2MPAL 3BAEL 1GVIA 5DJCA 3BD5A 1JIBA 2Z35A 2QR0B 4XWOD 43C9B 4H5SB 4GAJH 3T77B 5D1XB 3MLUL 3RPIB 2ESVA 3NH7L 5C08E 4HPYL 1QZ1A 4AL8L 3C09C 2W07A 1WICA 4S2SA 2YPVL 5IB3B 2BHZA 5I17A 5JIPA 4P46C 3TCLA 4UINH 4LLUB 1IAIM 5J3HC 4J7RA 2WUBL 2FX9H 4W6WB 1NGXB 4JDZA 3UTZA 1FZMB 2V9RA 1FL3A 5FYLL 3OBAA 4Y1AB 5B39G 1P7KA 1UYWH 3TV3L 3RZCD 4QRRD 1ZT1A 3D3VA 2EH7L 4GJTB 5KAQG 3HI6L 3MJ7A 2APTA 3LD8C 5FK9B 4CMMB 5D72H 5K9JH 3HZKA 4HJ0C 4K7FA 2AJYH 2CDFA 4L4VD 2Y06L 4N0FB 2FATL 1MRCL 3ELAT 5DJDB 2F54A 1G6VK 3QEQD 1YNTA 5EU6E 3U0PA 1MCIA 1FVCB 5ID0A 8CGTA 3X14B 2ADIA 4E0RA 4C56E 1BJMA 3LSOB 3OTTA 5IOPA 1Q0XH 3SE4C 2VDPL 1XGPA 2Y07L 4FG6C 5H2BB 3WFZA 2ZG2A 2W0PA 4ZD3H 2H1PL 3BD3A 5I19H 2Z91B 2X89D 3O9WC 3TN0A 2LVEA 3D48R 2I26N 2D4DA 4RISH 3PIQA 4OLVH 1IEAA 4UUJA 1N0LA 4I4WA 4P4RA 4QKXB 1KC5L 1HSBB 1QQDB 2DLEA 2F19L 4YHOL 3BEWB 2OZ4H 2BVTA 3WUWA 4YBQC 3ARFB 2A9NL 2W9LA 5EFIA 2E7LA 1F4WL 3H3PH 1MCNA 4XXCC 4XCFL 4UQ3B 4PG9B 5F3HA 2VYRE 3WFDL 4ZO8A 2HJKA 3ULSA 3V2AR 1NGQH 3FO2A 4LVNC 4WI6A 5CGYC 4XI5D 3E8UL 4XBPB 3TA3D 4FQQA 1W0VA 3QUMB 1INEH 3EDEA 3KLHD 5SX5H 1R5VA 3QWOA 4BZ1L 4WU5B 2YPLB 4LSRH 4XCYB 5D7IB 4FFWC 3T04D 2VQ1A 2BVPA 3VG9B 4PJXF 1MAJA 3O3BA 3P30H 1NLDL 3S35X 2PYEB 2M1KA 3BP6A 3DVGA 3Q2CA 1IAKA 1X5HA 2NY1B 2VDRH 4U3HA 1T2JA 3FQTB 1G7IB 4MQTB 3T3PE 4UOJA 4EDXB 3QSKB 4YHPA 3RL1B 5A2FA 1IGTB 2CD0A 4KTYA 4P2RE 1BWWA 5TE7H 5EU5A 4OZGF 4XP9L 2C3HA 2R69H 1UJTA 4XP6H 1CT8B 5EUOB 1JI1A 3MRQB 4F7CB 3U9PH 3K8LA 5FUCC 4J6RH 4NRZA 3WLBA 1EV2E 4DN3H 2XTLA 5KS9A 5EORH 5SWZB 3KS0H 2YHGA 4NDMB 2IAND 1MHHB 4F7TA 5T5FH 1UZ6E 2ESVD 3MRCB 1XGTA 3OMZA 1MIML 2P24B 5F7FA 3WIHH 1XR9A 4XAWL 5D6DA 3RFZC 1V8HA 3VFGL 1H3PH 1DEDA 3OKOA 3NGBB 4JPVL 1KXQE 2L7JA 4Y5YA 1BBJB 5GS0H 4LIQH 3BWUC 3UZVB 1MVFA 3S34H 5L88H 2VZSA 1KCKA 1BF2A 3D3VD 4NQVA 5IVOA 4CNIB 1OARL 2HFGL 4Y16C 3RUGE 3QFDB 1AQKL 2P49B 1T1XA 1YECL 2Q3ZA 2QSCL 5CKAA 1F90L 1TETL