1Z6JT

Crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
207
Chain Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Coagulation factor VII
publication title Structure-based design and synthesis of pyrazinones containing novel P1 'side pocket' moieties as inhibitors of TF/VIIa.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 207
sequence length 211
ec nomenclature
pdb deposition date 2005-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT02
4EI6B 4N0UE 4LPTA 5BRZB 5C0DA 2W9EL 2H2SD 4IMLB 2FDBP 2XWTB 2VQ1B 5C0AA 4X6CB 1EUTA 3O3UN 5JR1H 1U93B 3QSKB 1RQ5A 2VNCA 5K9OB 1ACYL 1M71A 4YHPB 4Y2DA 4JM2B 4ODHL 1A4KB 4WUKL 3WXVH 2IPKB 4DGVH 3UTTA 4PJFA 1A22B 1F3DJ 1B0WA 1CQYA 2VWEE 3SN6N 2ZPKL 1BQSA 2EDFA 3HG1B 2HRPL 4ZFOB 2IH1A 2BNUB 3G9AB 4WFHE 5LAXB 3HAEH 4QTHA 2ZOLB 4Z7OF 4YXLL 4MNHA 3MRCB 4HMEA 2YD1A 5INCA 3ULUD 3BAEL 4X6FA 2NX5B 4D9QD 1PY4A 4P9HC 5FDYA 1JHKH 1EO7A 3BQUC 1RIVL 4JREC 5CINL 3GNML 3QEHB 4MQ7A 2VUYA 3F7VA 4XNQA 1GJIA 4K7PH 5DMYA 3HI1B 3UTQB 5T1KA 3O9WC 2RR3A 5KTEL 3LKPA 2R0WL 4UV7L 3L1OL 5I75C 2FO4B 2MPAL 1FQ9C 1G7QA 25C8L 3JSSA 3T4AA 3JTSB 5DHXB 3CVHL 2FX8L 3DYMA 3VWJD 2A83A 4OCRL 1C1EH 4KQ3L 5F97E 3LS5L 4HUKB 1EBAA 4OLWH 4G6FD 1E6OH 2VQTA 2GK0B 3CXHJ 5DMJB 3WO4C 5IEHB 1IC7H 5T33H 1K2DA 3PUCA 1QR4A 1EFQA 4Z0XB 3SY0B 1C8PA 1RMFH 3V5HA 1HIMH 1R6VA 5EU7E 5IFHL 3LV3B 1ZE3C 1I1AC 2W9DH 4J2XA 5C6TH 1F2QA 4P5KB 2I26N 4LVNC 1QSFE 1RK1B 3U4BH 4WY7L 4E41B 1FL6A 1CTNA 1E4XH 4HJ0C 1UWXK 4U6YA 5CAYB 2HG5A 5F1SA 3SDCD 1T21B 1I3UA 1S5HA 4L4JA 1LILA 4U1IB 5F89B 4D0BA 4TULH 5HYJA 1KG0A 5DURD 2MQ0A 4PJ9D 1CGSH 4RWYH 1OP3K 5GISH 4KJYB 5C2UB 2DBLH 1OARH 3GI9H 4LOUC 2Y36L 5JXEC 4JFED 5EO1A 4OD3L 4NJAL 5C0CE 5HPMA 4FXGA 1SMAA 4O9HL 2VZVA 4LCIH 2D9CA 5CSZA 3LQAL 3O3AA 4P3CH 1H5BB 1CG9A 1QSEA 5DS8B 1CFVH 1A7RL 4ZFZA 4HFWB 4EXPX 3PWLB 3OKEB 2OL3A 5HVHC 2EDQA 2VLKA 2PYFB 4NQXA 3TCLA 3TM6A 2HFGH 3WV0A 2NY0C 3S5LA 2GY5A 5MENE 1AR1D 3M1BB 5J6HA 1IAII 1P84J 2HKFH 3LB6D 3P4NA 3QEUB 5IB4A 1OT1A 2W1NA 4HWEL 4N8CH 3O0RH 1VPOH 2AJZB 4NQSB 4FZEH 1BD2B 3AY4A 1NL0H 1T6WA 1XIWA 3FOLA 4QRPA 1EEZB 5KSUB 3GSNH 4ORGA 5ISZA 1MREL 1IC5L 3UAJD 4PG9A 5CZXC 2HWZH 3P0GB 1HHHB 1FAIL 1MHPH 4BKLA 1FZOB 2JTDA 1J86A 1I9IH 3GDBA 3UCRA 4HFUH 4P9HH 3LVEA 1MIMH 2ADJB 5BRZE 1BFOA 1ZVSB 5EOCH 5DD5L 5HHOE 1TNMA 5GRWA 3RJDA 4OZIA 3QDAA 3PP4L 1WGOA 2M8XA 1IKFH 2XQBL 1QRNA 4KK5C 4X6CE 1UZ8B 1R3HA 3C09C 2X4SB 3DYOA 4W4OA 3D85A 4NN5C 2X9WA 2PYED 3KPPA 1BVLB 1SQ2N 1W72B 5ERWA 1YEHH 2BRRL 3WMSA 5CLWA 4HHAA 3S4SB 3JVGC 4Z7UE 2Q7YB 1YQ2A 5DDHA 3HG1E 3L3HA 1LNUB 1J8HE 3HC3H 4U1LA 3MLZH 4GKZA 3LKOB 2HT3D 4HUXB 1BEYL 4MMZC 5GZOC 5F7UA 1RJYB 2KQNA 2R29L 5TDOA 4MXQD 4WEBL 4HWBH 1RK0B 2D0GA 4X7SH 2Y9RT 3GBML 3GIZL 3RQ3A 2P8LA 4PJEF 5E6YA 1KN4H 4U1NB 3RTQA 4P2OB 3W2DL 4OFIA 2EIBA 3NGBB 1FCCA 3V95A 2YC1B 2VDKL 2YD9A 4LCYA 5E4EC 3HNVH 5I73B 1XF3A 3LN5A 1R3IL 4ISVA 4YHIA 2DQFB 3DUHA 3U4AA 4S1QL 4IOFC 1KTDA 1YNLH 3DUSB 4DCQB 2OSLA 3EYFB 4NRYB 4A6YH 1WT5A 1O5DT 3SKUD 3UEZA 3A67L 2PXYB 4P2RE 1U3HC 2WUCH 1RZ8A 3SGKA 3PV7A 5BZWB 5CILL 1GGIL 3OL2A 2HFFB 3MYZA 5CKAA 1HILA 1CWVA 4NQCE 4NZTH 2YSSA 2OR9L 4RMTA 1ZT7B 6FABH 5GS0D 4GO6B 1KJMB 2GFBA 3O6KH 4FQQA 3MLRL 4ZUTA 3ZT5A 3KR3L 2XICA 2NR6D 4ZSOE 4MXWH 4Z0BL 1MHHA 5D1QC 4OI7A 4ZO6A 1XCQA 1BZ7A 4NFDA 5LCVL 3VXUA 1XGPB 5IBTH 4JY4A 4JFYB 5E8NA 3CX5J 5SWQA 2IADB 1S8DA 4JFXA 2E27H 4WW2A 3WFZA 1ZHBB 2VL5A 5I8EA 4YHYB 1BVKA 4X8XA 2Q76A 1FVCB 1MCRA 4FG6C 4NDMB 4YGVB 5E08H 5ADPL 5CZKA 3FFDB 5F7KC 1XH3A 5JXAL 1C12A 3DHJA 5ID0A 3NN8A 3MJ7A 3RGVA 4GKNA 1WFUA 5DD6B 1RVFH 1IL1A 3RDTD 4G9FA 2R9HC 4TVPH 5DJ2A 1KYOK 1WSST 2DM3A 2CO6B 3ARFB 3GMPB 4N1EA 3G6AA 1KUMA 2ICEB 5T1LB 5JIIA 3T77A 5GXBB 4XPAH 4AH2A 4PRIB 4Y2DC 4R97C 4CW1B 4EQ3A 1J1XH 4DZ8B 4XHQA 1U8MA 1JZ8A 2WBJC 3ARZA 3KYOB 5K9JH 1MI5B 2YA0A 4F37F 4RGMC 3P4LA 3GMQA 4OQTA 4YDIH 5JQ6H 4DN3L 4JHZA 1TJIL 1HHJA 2CDEB 1ZSDA 4U3CA 5FKPA 4R90L 5GSVA 4XH2A 1XMWA 4NRZB 5FK9A 2NY2B 4PTTA 1HSBA 4G42A 5IOPB 1ZWIB 4R0LB 4DW2H 3MJ8A 3ROOB 2AI0H 2VXVL 5LXGH 1CYGA 1CXHA 4GW4B 3S96A 4QOKE 4FQIL 5F7DA 1NGXB 4JRYB 5HSFA 1CLOL 3ME0A 3O6FD 3G6JF 1DBAL 3QEQA 4GAFB 2LABA 4HK0B 4EKXA 2WIIB 3CFKB 4YBLC 3CLEL 5D70H 4MD0A 3CD4A 2LVEA 5I18H 4AEIH 4ONOA 2E7BA 4IRSD 5I8KH 2SEBA 4Q6YA 2XZAL 3EO9H 4ZNCD 4KMTH 1ZS8B 2C4FU 2UWEB 3G5VA 3THML 5E9DE 1EEYA 2NXZB 2JJSA 2ZKHL 3UZQA 5EPMA 3QCTL 3CDYA 5C2BH 3GEWB 3IJHA 4QHUA 5HYQA 4PJBB 5DJZA 1JWSB 5GIRB 1OHQA 4QRQB 1FV1B 2VDML 3OXSA 4RQQB 3HKFA 5IVZA 3ARDA 3BKML 3OAZH 3O9WD 2A9NH 4JANB 1S7VB 2VDQH 3LEVL 1Z9MA 1X5LA 1OSPL 4KZEL 1SY6H 2NY1C 3EDEA 4YHMH 4IOSD 1E27A 4HDIB 3MA9L 1F45A 5EBMB 1ZLWH 4YFDB 5D7JB 2CK0L 1TTGA 1D5IL 2VLLB 1J87A 3NIDF 4BYHA 5A43C 4Y5YB 5E8PA 3ARVA 4PBXA 2F53B 4GMSL 2NW2A 4O00A 1U8KA 3MBXH 4G8GB 1T04A 3IF1B 1Y6NR 4EI5A 3PJSA 5F9OH 3LMJH 3RIAF 5IR1A 5CIPB 4M6MH 4L4TA 3SGEH 4AEEA 2VXSH 1UCBH 1GC1L 4RFOH 1NEZG 4X6DF 2Z91B 3FMGL 4U7MA 2RCSH 1PY9A 4AMKH 1S9VA 1I9JH 4R26L 4LLMA 4G80A 1J7VR 2FX7L 3FT3A 1HH6A 4PJAA 2I9TB 5FO8A 5HHQB 1JPSL 5HGGS 2JIXB 3WE6A 1I7TB 4PJXE 2AK1L 1VGEH 5B3NA 4AK1A 1MPAL 1B2WH 4LOUD 5JXED 5F1IA 4MGXA 5L9DH 5A2IH 1JWUB 1XIWC 3SDAB 4OGXH 2A77H 3FFCD 3DRQB 3W0WA 3MLPA 3OJMB 3V4PH 3TV3H 1KJ2A 4HUVA 4L1DA 5KG9A 2JK5A 3MGOB 1IRAY 3MV9A 4X6EA 5I6XB 2XA3A 4WDIB 2FATL 2DMBA 4DN4L 3QQ3A 1WFNA 4OD1L 2JCCB 3C6SA 3CJJA 1MWAB 2NY0D 2P5WE 5C9JA 1NGYB 5EU3A 4MJ6A 3RL2B 1J1PL 4XGZB 4KC3B 3MCG1 3C5ZA 3I85A 2YEZB 4W4OC 1NC2B 2ZG2A 5J56B 2Q20A 2VAAB 3UZEA 2O61B 5D6DA 1K8IB 2DJ4A 2ADIB 5TDPA 3KXFB 5ICZA 5CUSH 4OT1H 4XRCA 2FCBA 3QG7L 4Y7MA 1RZKC 3EYUL 2MJWA 3FZUC 1ZHLA 4KJQC 1IGCH 1XGRA 3RNQA 3KPLB 4Q9BA 4L8CB 5CZXD 1NCCL 4XC1L 1A6UL 3SKOA 5JOFB 4ONHB 5CGTA 1OGAB 1IAKA 1TTFA 1RU9H 3RZCA 1T2XA 1OAUL 4GG6B 4GBXA 4GW1A 1T1ZA 4F7CB 4HGMA 4L9LB 5DTFA 1KJVB 1PD6A 2XTJD 3JV6B 4RFNB 1QUNA 1K4DB 1TQBC 4KK5D 5EWIL 5DJXB 4EBQH 1UWXH 4BH7B 3KJ6L 3BDBA 1FFNA 4BZ1H 3HPLB 4G7VL 1NLBH 3BZEA 4JRYE 1OP3H 1YEDB 5CEZH 2XYCA 1Q72H 1EHLH 5BV7B 1WT5C 4Y1AD 5ILTH 1OM3H 3MV7B 2BSSB 4HGWA 2F54A 4OLZH 1U6AH 1IEHA 5I1EL 2V7HB 2CPCA 4PJ7E 1YY8B 4Z77A 3SGKC 4PJFF 4RZCA 4JY5L 1TZHB 2IAMB 2NNAA 5HHXH 1W0VB 3U7YH 2OXGA 4F9PA 2UWEE 5GZOD 1ADQL 3C6LB 5DQJB 5CGMA 5LGKA 2Z93A 5J0BA 3DV4B 3IRPX 4NN7B 5EN2A 4PJBE 5M95B 5C3TA 3LS4L 4Q2ZB 3LHPH 1KT2B 2B1HH 3OKOB 4M5ZH 3PGCA 5E5UB 4XXDA 4PRAA 3BHBA 4ODWB 1RJLA 3FT2B 3TBTA 4Y4HB 2CO7B 1A6TB 3NABL 4IOFD 4Z7WA 3NFSH 2D2OA 1KCSL 1YN6A 3DO3A 4XNZB 4NBXB 5L2JB 2A1WH 2Q8BL 4M6OH 4DFHA 1T2QL 4EUPH 5CMAB 3IDIA 2YN3A 1NMCC 2CKBH 1KB5A 1KCRH 5IBLD 2AJ3A 1ZT4B 4AT6B 1GOHA 1VEPA 5E2TL 2W60B 2XFXB 3RGVC 1X5HA 4WU5B 1YEGH 4U1KB 3R06B 3SOBL 3KLAA 4QXTB 3REVB 2G9HB 1NCDL 4G3YH 1G6RA 1IGFH 4WTZA 3WUWG 4GFTB 3SKJH 3VGAB 3X13B 4NZRL 5DJ8A 4HIIB 5D1QD 5C6WH 5M94B 1YN7A 4MA7H 2IBZX 5F44A 3V6BR 2D4DA 3VFMA 4EI6A 3HI5L 4IMLA 4X6BB 2MMXA 2ZJSL 4R4FL 1EERB 1QYGH 1YY9C 1UKTA 5L88H 1U93A 3UJIH 1ZLSL 4QXUL 1A3RL 3PL6B 5I30L 4X4YB 2AGJH 4Y88A 1V3LA 1YEIH 4X7TB 5K9OA 4LASH 2I25N 4YHPA 4JM2A 3BISA 1A4KA 1OD9A 2IPKA 5E8OB 5CKGA 1OCWH 5JTWA 3BT2H 3V8CA 3RY6A 2MHAB 5FCUL 2QSCL 5I1CH 1FH5L 4FP8L 5T3ZL 1IARB 4ZFOA 4KHTH 1XGQB 4POZD 2DQCH 5FKAB 5C0AD 1EZVX 3GUTB 3MCLH 2WLYA 2R9HD 1BJMA 5LAXA 2QV2A 2ZOLA 3PDGA 1TJHH 4GQ9L 4P4KB 3VFSB 4JO3H 3MRCA 5T3ZE 3T3PF 4Y2DD 1H8NA 1VESA 4J3VA 3UTTD 3WCYA 2AV1B 2NX5A 2R2BB 3ZTJH 4Z8FH 1OAZH 5GSRB 2AEPL 3DJ9A 3RKPA 3QEHA 3GJEA 4GSDH 4KKCC 4V2CB 4OD2B 4P59H 3HNTL 4B53A 3HI1A 4DKAA 3UTQA 1DR9A 3TF7C 3GJFK 2YMXH 4LQFL 4PJ5A 1P4IL 2W38A 2JJSC 3IT8D 3FO2B 1K8DB 5TQ2L 3JTSA 4C56B 1MHEB 1CDUA 5EZIL 3QUXB 5F9JB 2GK2A 4GQPH 2APFA 4I0PB 4F15C 4JQVC 1B3JA 3I6LD 1XFPA 5T1KD 5E99L 3U9PL 2A74B 3EIFA 5MEPB 5I8OH 4U33A 4FQCL 3TP4A 1JPST 1CE6B 3S88L 4M02A 2GK0A 3NPZB 1AD0B 1OGAE 3GBNH 3S36L 1GCFA 5IEHA 5DD3H 1E4XI 4EN3B 4GG6E 1FORH 1CBVH 4Z0XA 1G6VK 3QUMB 3SY0A 2AJUH 5IBUG 3K8MA 5FECB 1HWHB 2AJYH 1BIHA 1P7QB 3DTXB 5MHSD 3A6BL 1WVZA 3P11L 1RULH 3CH8A 1TJGH 3BPLC 3FRUB 1YC7A 4P5KA 2FHFA 4OM0H 4E41A 4OZIF 1FGVH 4EI5C 5ICXB 4KY1H 1CDHA 4WI7A 1CT8B 5FO7B 3VXMA 4RX4A 7CGTA 4NJ9L 4U2YA 1FDLL 1T21A 4U1IA 3I9GH 4LHJB 5F89A 3VMOA 3WN5B 3HZKB 4YQXL 5IIEB 3VG9B 4LPYA 3FTGB 5AZEH 3RBGA 4MDJB 4KJYA 4HT1L 3BGFC 3V5KB 4ODSH 3BPCA 3D6GA 5GS2D 1KC5H 1EXUB 5D8JL 5D1XB 5B3JE 3QJHB 3Q5OA 4C57C 3QEGL 1E4WH 2X4RB 4S1DC 3QFJB 5LKNA 1TZIB 1RZJL 1YZZA 5HYJD 1KYOJ 3L5XH 4PJDB 4U4BA 1FZJB 1H5BA 5E2WH 4UILL 4UOJA 2F8XC 3DVFA 4HFWA 3E3QC 2A73B 4RFEB 3UBXG 1BQHB 3OKEA 2F58L 2PYFA 3E6HB 2NXYB 4YIQB 5C0RL 4FZ8H 5CS7A 1GAFL 9CGTA 3M1BA 4WO4A 1KEML 2XN9B 3VXRA 1QSED 3S7GA 4KI5C 3QEUA 4CDGC 4ZUUB 1JVKA 2APXA 1RUML 3MTRA 4NOBA 3CMGA 1JNJA 1IQDB 2AJZA 4NQSA 1BD2A 3B2VL 2C5DC 2HT4C 1EEZA 5KSUA 2CJUH 1A64A 2R0KH 5D7LB 5BVJA 3ZKXB 2H8PA 3CMOH 5D6DC 1BM3H 4M93B 3K8KA 1HHHA 1NMAH 2R56H 3IXAB 1Z5LB 4Z76A 4UT7H 4N90D 5TPWL 4NM4L 1XIWD 4L3EE 4QRPD 2ADJA 5H35B 1ZVSA 3NPSC 5ISZD 1HHIB 1TNNA 3BOVA 5GHWH 1A02N 4LIQH 1P2CB 2EICA 2NY5H 1TPXB 3DYPA 2X4SA 1Q9WB 3PHQA 3MLXL 4WW2F 1F4XL 1BVLA 5FUZL 4Q9RH 1VFAB 1W72A 3RZCC 2P8PB 4GBXC 1SJEB 1Q0XH 1MFDL 4FTVD 3S4SA 1BQLL 4U49A 4PBVC 2Q7YA 2VDNH 5FM5O 3H9SE 1LNUA 2AS5M 2NY7H 2W9LA 5DHYB 1XZ0B 4K94L 1TCRB 1QRND 2DL2A 1HKLL 4OI9A 1T7YA 3D85D 3LKOA 4HUXA 5BCAA 5D7KE 1RJYA 2YRLA 4MQXC 1TQCB 4WUUA 1RK0A 2X7LB 2QQKL 3UC0L 3HLAB 4XPGL 2AKRA 2H3NB 3LAFA 2BSRB 3I50H 5ESAB 4J6RH 5I1JH 4U1NA 3AGVA 4KJQD 4P2OA 1TMCB 4M6NH 3V52L 5DVOA 2NW3B 2YC1A 5A3IC 4J3XA 5IQ7H 4EDWH 2ZUYA 4F9PC 1N6QL 2DDQH 4NKMB 5JOEA 4X7FC 2DQFA 3DUSA 1Q0YL 3WKNA 3OPZH 3UPAA 4DCQA 3EYFA 4FNLL 4NRYA 1W8OA 4C56E 3RTQD 3FAWA 4O58L 3R0NA 1M7IB 3C60C 5BO1L 2PXYA 2BNRB 4DVRL 2R69H 5DFWH 4ALAL 5K59F 3FN3A 1DN2A 5IVXE 1ZGLB 5JW3H 1ZT7A 4XAWL 4XVTH 4HWZB 1AE6L 2RAMA 5E2UL 2QHLA 1EBPA 1KJMA 3HC4L 3B9DA 2X5PA 5AZ2H 3VFOB 1CFNB 4AEHH 1L9NA 1CR9H 3S36X 4JRXA 4KHXL 3NZHH 4L29B 3V79C 5FAAA 4OCNC 1NFIB 2EE2A 1XGPA 4JFYA 4LLVB 1PLGH 3BO8B 4XPHH 1U3JA 2IADA 3O6LL 2IANE 1ZHBA 3WJLA 4JHAH 5EBLB 1KJ2H 1FVCA 2XZZA 2FLRT 4NDMA 4YGVA 3RHWF 2ZUQC 4YK4C 4O5LH 2YPLB 3FFDA 3QNZB 4QNPE 1CK0H 3DMMB 4ZMAT 3BKYL 3U7AA 4LLWA 3VXUD 4GS7C 5DD6A 2HKHL 3SE8H 3TPUB 1SYVB 1BWMA 3QFJE 3OKDB 1BECA 3VFWB 5I1HH 2AEQL 2J4WH 3MRGB 4PJDE 3ARFA 4RGOL 4HKZB 2ICEA 3JUYA 5T1LA 6CGTA 3TT3L 4CJ1A 3S5LG 4PRIA 4H20H 4JM2C 4CW1A 1SEBB 2ORBH 3RY6C 1U8PB 4U1MB 4YDKL 2DIBA 3RGVD 3KYOA 1MI5A 3WBDA 4HWNA 5CWSB 4M62H 5F96H 2VZOA 4G9FD 1DSFL 1JI1A 3WXWH 4UBDD 2X10A 1N26A 2CDEA 2Y1VA 1VHPA 1VFBB 2XN9E 3QNXB 4NRZA 1GGCL 4E5XB 1RFDL 3VRLF 1IE5A 4P5MB 2OZ4L 3G5XB 2BVEA 5IOPA 3WIIH 1G7LB 5BQ7B 1ZWIA 4R0LA 1FRGH 4OLEA 2CDGA 3ROOA 4ZUWB 5D7LE 1YY9D 1MJ8L 2FJGB 4GW4A 2YD5A 1NGXA 1BBJB 1Q9LB 2ZOKB 4MSWB 4XVJH 4PJAF 3D0VB 4M5YL 4XTRD 5HGBA 4XNMB 1U8OB 1V8HA 3QXUA 3SKMB 4KTEL 4HK0A 1O0VA 3CSYB 2WIIA 1GRWA 5GGTA 3CFKA 4P49A 1TDQA 4W81A 4X4ZA 4YUEH 5L2KB 1MLBB 2WMPA 4RGNE 4NUGH 4YDVB 4RAVB 1U42A 3K2UL 1P6AB 1AGEB 1RJZB 4HIJB 5H94B 1JBJA 1NANH 1YEJL 3CAFA 2DIAA 3N06B 3QEQD 5K9QI 2ZUSA 2IG2H 1AH1A 3MA7B 3LKSB 4DOHB 2P8MB 5J11B 1P5UA 1T03H 4KI5F 5IB3B 2CLRB 2OJZL 5EA0H 3SE3A 1I85A 4K3GA 4PJBA 1M6OA 3BKCL 5GIRA 3IKCB 1J88A 4KKCD 1INQB 4QRQA 1FV1A 3DO7B 3F7QA 4RQQA 2PKDA 5IHZB 5EULV 5FYKL 4JANA 1S7VA 3ULVH 3C2SA 2AJXL 1JNLL 2DQEL 1I3GH 3W5NA 1Z0MA 4HDIA 3LRHA 5IHUH 5EBMA 5ALCH 4K2UH 3BDYH 5D7JA 1EAJA 3RA7L 2B2XL 4ONGH 4B41A 5FYKE 1K3ZA 2OP4L 2P43B 3QCUL 3G6DH 2VLLA 2YK1L 1F00I 3SGEI 4JDVB 4Y5YA 5CJXA 3ARDD 3MRIB 2F53A 5DMGD 2VIRA 4G8GA 3IF1A 4OFYA 4GJTB 3IVKB 5J13B 2YPVH 2FWOB 4OQ1A 1T7ZA 1G6RH 5CIPA 1H5BC 3O2VL 4PRPE 4P9MH 1CN4A 3NA9L 3BWAB 4PRBB 3D5OF 1FN4B 2YUXA 1F4AA 1N6VA 2BNRE 2Z91A 4X80H 2AERT 3BN3B 1W2KT 3AS1A 5I15L 1AHWB 4EI5D 3OSKA 3QDGE 4X8JB 3ZKMC 1HZHH 3C08H 4F33B 2VXUL 4WO4C 3O2WL 4XNXL 1VKXB 2I9TA 4G8IB 3OG4B 4L4TD 5HHQA 2Y07H 3GSVB 5C09A 4JPVH 1LWRA 2JIXA 1Z9OA 3LDBB 3GSQB 1KCVL 1I7TA 3MRQB 1LEGB 1S5IL 5FA4B 5FF6B 3JV5A 4HKJB 5MP6L 1YNKL 1JWUA 1A3LL 2F5BH 3SBWA 3SDAA 3EOAB 4OSUH 5J4MA 3DRQA 2IBZY 4XVSL 4S1DD 3F8UB 5IT2H 1QNZL 4M6AA 3MGOA 5E2JA 4WDIA 3FOMB 1L6ZA 1OQOA 3IDXL 4YXKL 1J10A 4UI2A 2Q8AH 5JA9A 1NH6A 2G2RB 3IDYC 1XF1A 1ZT1B 2JCCA 5EDXA 5F3BB 1DBMH 4H1LH 1MWAA 3WLBB 3S97C 3W0WD 5GRJH 3GJFH 3RU8H 4XGZA 3NAAL 1A5FH 2XA8H 2YEZA 3RWJB 1XF2B 3MV9D 1NC2A 2JE8A 3VRJB 2VAAA 4I3SH 2DQIH 2O61A 1EZVY 4KI5D 4Z7WF 4BQ8A 5FGCB 1K8IA 5JHDE 1CU4L 2ADIA 3KXFA 5EO9B 2WQRA 43C9B 2DI9A 1MJ7H 1YPZA 3HE7C 4IMKA 1OAKL 5DEFB 5GRVL 3BRGC 4OF6A 4PRHE 3WFBL 2R4SH 4OZFH 3MV8B 2BC4B 3C5ZD 3KPLA 4L8CA 4NM8H 5C08E 3UZVB 4ZD3H 2YD7A 5JOFA 1AC6A 4ONHA 4KK8D 1N5AB 1OGAA 2I60L 2QQNH 4I48B 5GRZA 4FFVC 1KGCE 5DUPL 3WL9B 4NHCH 4F7CA 5DUML 5D72L 4P2OC 3SEPA 3UTSB 4L9LA 4OLYH 2GUOB 3NGBC 1KJVA 3JV6A 1A6VH 1BFTA 2IJ0C 4TSAH 3QDHA 3BEVB 1K4DA 5DJXA 2FGWL 3L3IB 4ENEC 3WKMH 4BH7A 4UAOB 4XP9L 3DXAE 4TUKH 4C58B 1RUQL 1P53A 3HPLA 5I73C 3IAGC 4X5WB 4X6CF 4ZFGH 2BOBA 1YEDA 5GS1B 3RZCD 1HDMB 4GBXD 1IGJB 1UT9A 4OZGB 1L7IH 4RMUA 3MV7A 2BSSA 4NPYB 3MXWL 3QPXH 3GHEH 4QHKI 2V7HA 4XPFL 3AMKA 1YY8A 5KSBE 2IAMA 4HS8L 1DQML 3NVQA 3ARTA 1W0VA 4Z95H 1NCWL 4TRPL 4MQXD 4XMKL 3F7YB 3C6LA 4S1SL 1JZ2A 5DQJA 2Y72A 5BVPL 3DWTA 3DV4A 2F54D 3QIBB 4QGYA 4Q2ZA 3O4LE 2DQTL 1KT2A 4UT6L 3OKOA 4WGVB 3VD5A 3CPLB 3FO0L 1EEUA 4N5ED 3FT2A 4Q9CA 1PBYA 4Y4HA 1N64L 1A6TA 2ZG3A 3AROA 3D3VB 1QVOB 1ZVYA 3ILPB 4HF5H 3WJLC 5GGVY 2HFEB 4YHYC 5L2JA 4A2MA 2CXKA 1V3JA 5SV4A 5T3XD 4ELME 4IM8A 1MEXH 1ZT4A 4AT6A 1SJVA 4J4PD 2W60A 4ZAKA 3FB6B 2XFXA 3K4AA 4DKEH 3VFGL 4WU5A 2ARWA 1SEQH 3QFDB 4OZHE 5MEND 4U1KA 1J11A 3R06A 3REVA 2LAAA 5ID1A 3L3OB 4ZTPH 5GJSH 1BHGA 4Z7NE 2XY1A 3ARFC 5FYLD 3QP3A 3VD7A 5J12C 3NBNA 1CD9B 3X13A 4HQQL 4HIIA 3BP6A 2RIKA 2ICWJ 3LKNB 3WS3B 4U1HB 4X9HA 4LFHG 1UA6H 2DMKA 2DKMA 3O45B 4CVUA 3GKWH 1NAMB 3RI5K 3K7UA 4L5FL 4F2MA 4X6BA 3QIWB 5M7QA 1JHTB 3OZ9H 5CJQH 5LBSH 2DKUA 3EW3B 5CZVH 3TBVA 1JTPA 1U2HA 2DLIA 5DURB 3PL6A 4X4YA 4X7TA 2R2EB 1W72H 1K6QH 4MD5A 2NY2C 5E8OA 1J5OH 3GRWH 2MHAA 3PWUB 5BRZD 3ZDYE 1WISA 4R0LC 1XGQA 2G75B 4LP4A 1AGDB 5EOTA 5FKAA 3WS6A 3GUTA 2JLLA 2YRPA 1JF1B 5K33A 3PXHA 1I9RL 3O8XB 1A1MB 4P4KA 1B4RA 1LDSA 3VFSA 1A7QH 1LO5B 1C5CH 4JM2D 3R0MA 2HLFC 3PGDB 2Y06L 5BS0E 3QR2A 2ZUTA 2AV1A 2R4RH 1MIEH 2R2BA 1U8NB 5GSRA 3BKJL 3MNZB 3WFEL 1PDKA 2XACC 3RIFK 3PQYB 1FYTB 5F7LB 4OD2A 2FD6L 2DD8H 3V6OA 1FNEB 1G9MC 1NCBL 5DWUL 1LK2B 3MLTB 4JKPH 2NXZC 5CCKL 5FGCE 2ENSA 3FO2A 1Q94B 3RVVC 2NX5D 4C56A 1MHEA 1T5XB 5IGXH 1NFDE 2HVJB 3H42H 3SE3C 1N0XL 2X4NB 3MNVA 4YE4L 3I3BA 3QUXA 5F9JA 5J1AB 3AC0A 1LO4H 3MV8E 4I0PA 2Y6SC 1MFAH 1F90L 1U3ZA 2A74A 5MEPA 2EE3A 5F1KC 1WK0A 4G6JH 2E3VA 1CE6A 2EDLA 1A0QH 3TJEL 1AD0A 2EDTA 5D7JC 4UIKL 1VADB 4U1JB 2VZUA 5H8DA 3QUMA 4K8RC 3CFBB 2D7MA 5FECA 1P7QA 3DTXA 5DUBA 2F19H 1VA9A 4XPBH 2B4CL 4Y5YC 4XP1H 3GBLA 2V2TB 5JUEH 3FRUA 2WM0A 2ICCA 4XWGH 1FNSL 3QHZL 1AXTH 2PYEB 4K7FB 3DSNA 5ICXA 4F8QA 1CT8A 4EQ2A 3WN5A 3HZKA 5IIEA 1IT9H 4MDJA 2R0ZH 4J3TA 4PJCE 2ENYA 5ANMB 2X41A 1CGXA 1NKRA 3V5KA 3BD5A 2GT9B 1DP0A 3QI9B 4HC1H 5DGRA 1CGWA 1EXUA 5D1XA 4E41D 3QJHA 4BZ2L 3LIZL 1CLZH 1MUJB 1N5YH 1ETZB 2X4RA 4RX4D 3QFJA 5J8OA 1TZIA 5DI8B 3UDWC 5E6IB 3MO1B 3QXDB 4BFGA 3BEWB 4PJDA 4D9QE 1HNFA 2EDKA 1UWEH 4XPTH 3EO0B 2A73A 4RFEA 1MFBL 1BQHA 3HAEB 5JW5B 3QUYB 3E6HA 4JO2H 1RHHB 3SDAC 1ZA6B 2DN7A 4YIQA 1MAMH 4FFYH 3A0OA 4S1RH 5DEGB 1F4WL 2VLJB 4N0YH 2OM5A 3NZ8B 3QJFB 1AKJB 3VMPA 4G5ZH 1IC4L 5L6YL 3W81A 4FABL 3QWRA 1NBQA 2XN9A 5I6XC 2EYTB 3QA3B 4ZUUA 1JGEB 3FONB 1B6DA 3QHFL 3G9VA 1IQDA 4XI5D 5KOMC 3WFCH 3JV4B 2VMFA 2CXGA 2HH0H 3ZKMD 3EOTH 1AI1L 5D7LA 1I8IB 4GKOA 4PUBH 4Z7QE 3P77B 3WNKA 3SDXB 1CFQB 4KJPD 2QQLH 4PB9L 3U7WH 1KIUA 3IXAA 1Z5LA 4HMDA 1FPTL 3ZLQC 4FQHB 3CIQA 4YWGL 1LO3L 1BD2D 1J0IA 1N8ZB 2Z9TA 5H35A 5FUCC 4P48A 5SWSB 2VLMD 1HHIA 2APWA 1X9QA 3MLVH 1P2CA 4RMSA 1H15B 4OFVA 4NKDB 3X11B 2Z92A 3LEXB 1Q9WA 2DQGL 4NSKB 4ETYA 5TE6L 1VFAA 3D48R 1U92B 5AWNL 2P8PA 4QLRA 4NYLB 4S11A 1DCLA 1SJEA 2IFFH 4L9LC 1JUFB 4J3SA 4JFEE 2C3HA 5DHYA 1ULVA 1XZ0A 3QYCA 2B20A 4GRWH 1TCRA 2ITDB 1MCOH 3RDTB 5F88B 1I8MB 3ROLB 4U6VH 1G0YR 2ESVB 1Q1JL 3I3DA 4JG0H 2CRYA 4I18B 1UM4H 2X7LA 4LSQL 3HLAA 4MA8H 2H3NA 4IRZL 4GXUM 3UTOA 5BV7C 2CIIA 3HCVA 4ONFH 3TYGL 2BSRA 5ESAA 4K8RH 1Q38A 4LSTH 4Z78A 3B6SB 3TFKC 4Z7OE 5ACMA 2Z0BA 1NFKA 2IAMC 2NW3A 4XCCH 2YHGA 3MC0A 3VFUB 3RX7A 1QFWI 3O3BB 3K3QA 4NKMA 1CICB 4GMTL 3MRFB 5FYJH 3DNKA 4UV4H 1WZKA 1BQUA 1RUPL 1BGXH 4B7IA 3I75B 4P2OD 1GGBH 4NWUL 1M7IA 1YMMB 4RMVA 5CP3H 4LEOB 2BNRA 4MJ5B 1BBDL 4ENED 3H8NA 3RWCB 4H8WL 3VGHA 1ZGLA 3UJJH 4Y4HC 4TQEL 4NNYB 3UPRB 1BF2A 2XNAA 2CKNA 4HWZA 5A1AA 4GKSB 1KXQE 4XP4L 4XNZC 5F7FA 1UKQA 5I8CB 3T1FB 2PXYD 3GSNB 1U58B 4PYGA 1CFNA 3VFOA 4O4YH 3U0PA 2BMKB 4ZAKC 1JP5A 4L29A 1NFIA 2MNUA 2DKSA 2PYEE 1T83A 4LLVA 3BO8A 2CDFB 3S9DB 1BJ1J 2X1XR 2HYMA 1CD1B 3TLRA 2UWEF 1PJ9A 5JR1L 1D5XA 4K3HA 4MHHI 4PJHB 3VGAC 2M2DA 3MQIA 2FZ3A 3BQUB 1JMXA 2Y23A 4JREB 3M8OH 3TT1H 2YPLA 3QNZA 4DGVL 4JRXD 5MEQB 3DMMA 4PJBF 1KCUH 4D2NA 1MFCH 5I75B 1EO5A 5KVDH 3TPUA 2J3SA 1TCMA 2VN4A 4GRLB 4YHKH 3OKDA 4QRUB 1NBYB 3VFWA 4WCYL 5KBNC 3MRGA 3PL6C 2A0LC 4HKZA 4EZMA 1KIRB 1SEBA 1U8PA 4U1MA 1DVFC 3SDYH 4JFOA 1GSMA 2DQJL 15C8L 1KBGL 5F93C 3WS6C 4K7PL 2VLJE 4D9LH 3DLQR 4LAQH 1A9BA 3ARFD 4N8VB 5T1LD 1ZANH 4P4KC 1VFBA 2WQ8A 3QNXA 2ED9A 4PRID 3QCVH 4JO1H 1I1AB 5I0ZA 5GS0L 3EZJB 5I1KH 2ADFL 4E5XA 3QISA 4LVNB 4P5MA 4HKXA 1MI5D 3G5XA 1G7LA 3VFTB 3V8OA 1P1ZB 4OLUH 5DK2B 3V6OC 3T2NH 1Y6KR 2FJGA 4A6YB 1JMZA 2YBRB 4YPJA 4AY0A 1HXMB 2F5AH 4MSWA 1Q9LA 2ZOKA 3DGGA 4LLYB 5CBAB 3D0VA 5KVGL 4I2XB 4XNMA 1IC7L 1U8OA 2NY2D 4L8SB 3SKMA 1NANI 4AL8H 2FBOJ 3CSYA 1RMFL 1I3VA 5L2KA 3TC9A 3QUXC 4QTIH 3WHXB 2W9DL 4ZOAA 5SWSE 1MLBA 1CDBA 4YDVA 5C6TL 4RAVA 1UADC 4FMKA 4X5LA 4ZOBA 1DANT 1G0DA 1AGEA 3KPSA 1RJZA 4HIJA 5KSAB 5H94A 2GHWB 4JRYD 1F58H 3MJ9A 1HQRB 5EIQA 5ITBL 5D96B 3MA7A 3RPIB 3LKSA 1N4XL 3MOBL 2P8MA 2VDPH 4RWYL 5IB3A 2VXQH 2CLRA 5GISL 1JRHI 4YXHH 4JHWH 3IKCA 2JCCF 2BX5A 1INQA 5FHAH 3VGGA 3DO7A 1KCLA 5IHZA 3GI9L 5IVOA 1WBZB 2PTUA 1X5IA 2NXZD 4F7TB 1AXSB 2Y5TB 2OCFD 4X7EC 4LCIL 4OZ4B 3U6RA 4O51B 3RVVD 3DV6B 4B0MM 1IGIL 3RWGB 2IGFH 3VG9C 1CZ8L 1FFPB 4JDVA 4MJ4A 4NO5B 1A6WL 2Y6SD 1DDHB 4WJ5B 4Y5VB 3CK0L 5D1XC 1X5JA 4JR9L 3ZSSA 2KL6A 1ERNA 3AB0C 1KULA 3EOYG 2NLJB 2FWOA 2QADB 3WIHA 5D7JD 1QLEH 3P2TA 3U4EB 1F4YH 1NC4B 1U8QB 1P69B 3OKMB 3BWAA 5C92A 5FB8B 1FN4A 3IKKA 4GG6F 3E8UH 4KAQL 4YFLI 2Q7NA 2F53D 3C09B 4G8GD 1QOKA 4LPWA 1NGWB 5BW7A 4NN5B 1B4JL 4OFYD 2FNBA 2EDDA 1AHWA 5HYFA 5FYJD 3GSNL 4X8JA 4F33A 3D1MC 1UENA 1HKFA 1PG7H 4OCXH 1VKXA 4G8IA 4NZDA 1KELH 2HWZL 4LLUB 3GSVA 3FB7B 1FFOB 3QUZB 1MHPL 2O5YL 3GSQA 3MRQA 3F58H 3RBSA 4BSJA 4M1DH 1LEGA 1YECL 4I4WB 5FA4A 5FF6A 4HKJA 3PIQB 4HFUL 4P9HL 2HLAB 3V0AC 1MIML 2W0FB 3EOAA 1OPGH 2VKXA 2FBJL 4Z7VB 4H26B 5B3JF 1G1YA 1J05B 5GGSB 3CVIH 1SM3L 2WAHA 1WIPA 4PJHE 5HHPB 4L1HA 4HZLA 2JIXD 3FOMA 1YEHL 3QDJB 5FDWA 3L5JA 4JPKH 4EDXB 4ZOCA 2G2RA 3IYLW 1ZT1A 5F3BA 3SDAD 3Q6GL 4UB0L 3WLBA 2XG5A 3HC3L 5D1ZC 1TPXC 4JDTL 1YEEH 3L7FA 3DSFL 3RWJA 4HLJA 1XF2A 3VRJA 2VXTH 1GPOH 4YHNA 3QZWG 3IFNH 4HH8A 3ULSB 1KFAH 4HWBL 1UJ3B 1U3HB 4X7SL 5F8QC 5EO9A 43C9A 3MGTB 4LCUA 1AC0A 1FNGB 1KN4L 5DEFA 1OTTC 4XP6L 2IALB 3BXNB 3AFLA 5I19H 5JOPD 2B7DT 3MV8A 2BC4A 3VFVB 1P4LB 1NC2D 1PX4A 2CUMA 2OR8A 3MBEA 3NH7L 2WBKA 3BD3A 1F13A 4RBPK 1EGJH 3KDMB 4IRJB 1CVSC 3KXFD 1YNLL 4I48A 2YN5A 2DQHH 4K7PX 4A6YL 2EH8H 3L3DB 3VU2A 3WL9A 1YQVH 2FEEI 2J6EA 3UTSA 5I1IH 1IEBB 2GUOA 1NBVH 4YH6A 3FAXA 3M17A 3BEVA 1C5BL 3L3IA 2OTUB 1OB1B 1R3KB 4NZTL 4P3WA 4X5WA 1NGPH 1OGAD 2CD0A 1S7XB 1J1OH 3HE6B 4HAGA 4JN1H 4L8BB 3O6KL 1IGJA 4OZGA 4YLQT 3MUGB 1SJHA 4UTBH 5C0DB 3QWQB 3FFCE 3C5JB 4MXWL 1R3JB 5C0AB 5KJRL 1ITCA 3GSRB 3PE9A 3GMLB 1T1XA 3G6JE 3UYRL 1NSNH 3F7YA 3HFMH 2K3TA 1A7OH 3MV7D 2WBJB 3QIBA 4PB0H 3TFKD 1QBML 4UT9H 3BE1H 1MCPL 1SHMA 2IAMD 3BMWA 2X44D 4NWTL 4S10A 3CPLA 1JI2A 2VL4A 1YYLH 4QGTA 1RVFL 5HDOA 3C6LD 1T83C 4OCSL 3D3VA 1QVOA 4U7KA 1BZQK 4X6FB 3ILPA 2HFEA 3B9KB 3REWB 3BX7C 4JZJB 5LWYH 1HINH 4XNQB 4QRSB 3DMMC 2GJ6B 4DUXA 1RZGB 1ZA3B 2W9EH 3FB6A 3VD9A 3TVMB 3SE9H 3QFDA 4Y4HD 3L3OA 5JQ6L 1K85A 5IVXF 1R3LB 3HRPA 2Y7QB 3K8LA 2LQRA 3U0WL 1ACYH 3MRMB 3I2CL 5ENWB 1YEFL 2NMSA 4WUKH 4YR6B 1MVFA 4J8RB 3LKNA 3WS3A 4ZAKD 1P7KB 4U1HA 2HRPH 1S7TB 3O45A 3OWEA 4M3KB 2YD3A 1NAMA 5E6ZA 3QIWA 1DL7L 1JHTA 1YJDC 3O4OB 3VMNA 4YXLH 4Y1AE 1QBBA 3ZHDA 3Q0HA 1H3WM 2EDNA 3BAEH 1HHKB 2R2EA 4GAGH 1INDH 5IB2A 1RIVH 4RMRA 3IAPA 2EDXA 5CINH 3GNMH 3QIUB 3PWUA 1FL6B 2XZCL 5I18L 2NY1B 5GGQL 2G75A 4Z7VE 4KI1A 1AGDA 1JHLH 1OTUC 4HCRL 3SGDH 2R0WH 5KTEH 3T0EA 1JF1A 3L1OH 2FJHB 3IDJB 4KMTL 2H6PB 2J5LC 3PL6D 2A0LD 2MPAH 1A1MA 25C8H 1LO5A 3TNNB 4LF3B 1I8KB 3QDJE 4PJDF 1R5IB 1VDGA 3PGDA 2FX8H 4I3RH 4YC2B 1NGZB 4K9EC 1U8NA 4OCRH 3MLYL 4KQ3H 4H88L 3MNZA 1ZK9A 4NO2B 3PQYA 1FYTA 5ALBH 4WI3A 3CNKA 2A9NL 1FNEA 2D7QA 5E95B 2VDQL 4P4KD 3OHXA 2RJMA 5LJYH 1LK2A 3MLTA 2X70B 1NGQH 3JTTB 2EIDA 4ODUB 2VLKB 4JO4H 5IFHH 4HIHB 4OIIL 1T5XA 1HE7A 2HVJA 2X4NA 4ZUVA 4OBSA 2C3WA 2P4AB 5J1AA 1ONQB 1AQKL 1VACA 5DC4B 4WY7H 3MBXL 5HGDB 2B1AL 4EUPB 2LU3A 3QULB 3V2AR 1R0AL 3X3GL 4XCFL 4JKKA 2CKBB 4KGLA 3HMWL 4C56D 1NUGA 3T09A 1T0PB 4ETQB 3CFBA 3QUXD 2JELL 3T1WA 4RFOL 1IKNA 4I0PD 5JIKA 2RCSL 2V2TA 2Y36H 2QL1A 1J8KA 3D39B 1I9JL 3T65B 4O9HH 4K7FA 3LQAH 5J13C 2HJLA 5C0NC 1IFHH 3N9GH 4NP4H 1A7RH 3FO1B 1ZLVK 1P7QD 2NCMA 1I7RB 4J1UB 4NBZB 5ANMA 1VGEL 4Y19B 4NQDA 2BZDA 1B2WL 5C9KA 5C0AE 3QI9A 2GT9A 1CI5A 5L9DL 4ODVH 1HYSD 1CF8L 2A77L 1AHWC 1X4XA 3PHSA 1MUJA 2E9BA 3PABB 5ERWB 1ETZA 3V4PL 1DQQB 3TV3L 3Q3GB 3QO1B 4Q74A 5E6IA 3UTTE 1V7MH 4PJFE 3BEWA 4U05A 2VDOH 4HWEH 1JGDB 4U1LB 4OJFH 3EO0A 3HAEA 3FJTA 5D1XD 4OFKA 3WFDH 1RHHA 3AU1B 4JLRA 4YEEA 1MREH 3P4OB 5TDOB 5DEGA 3QFJD 2VLJA 2Z8VC 1FG2B 3QJFA 1AKJA 4XBEL 5B22A 3IU4L 1FAIH 4OKVB 2EYTA 5SX4I 3QA3A 5HHMB 1JGEA 3FONA 1UM5H 5CUSL 3I6LE 4U31A 2GJ6E 5DD5H 3JV4A 3SQBA 2XQBH 2DAVA 1KTDB 1I8IA 3N1PC 1B6UA 3QWRD 3P77A 4Z18A 5TQ0H 2XN9D 3SDXA 1CFQA 2BRRH 5KVFH 2X9YA 5EZJB 3B3IB 3L9RB 5MHSE 4JE4B 1RU9L 1X5FA 2X1QA 5DD1H 5DFTA 2CRZA 1NCUA 3VW3L 2YSSB 1N8ZA 5SWSA 3KYMB 4I0KA 3CXHK 5D7LD 1K5NB 3VXOB 3FKUS 2GFBB 1BEYH 1H15A 1NCAH 4PGDB 4NKDA 3MBEC 4KKBC 3X11A 5CJ5A 3LEXA 2R29H 3CUPB 2Q3AA 4NC1C 1RZIB 4BQ6A 3GBMH 3UTZB 5CEZL 1PZ5B 4HXAH 1U92A 4NYLA 1OM3L 3FQTB 3W2DH 1U6AL 4BSWB 3WDJA 2ZCLH 3Q5TA 5E8NB 5CEZE 3VXNB 1I8MA 2ITDA 5F88A 4JQXA 4UAOC 3ROLA 4L3CB 4WU7B 1U8IB 1RUAH 2ESVA 4MVBD 3MX0A 4S1QH 3INUL 4PJGB 4JB9H 3DIFB 1NMCB 4I18A 5D5MB 5LG1A 4NN6B 4LHQB 1TIUA 5LGHL 3A67H 3NN8B 4XCNB 3MJ7B 4YX2L 1ZEAH 4D9RD 4GKNB 4XP5L 4W68A 1JCKA 4F58L 1YNTB 2OL3L 4M5ZL 3T3PE 1PZUB 4G6KH 4HK3J 3VFUA 3V4VL 5CHNB 3O3BA 3T77B 1QSEE 1CICA 3MRFA 2BCKB 1RIUH 3NFSL 4ODTL 1DQJB 3K1KC 2VLKE 1J9CT 3KR3H 5AEAA 2A1WL 3RVTC 3QIBC 3I75A 4HLZH 1GH7A 1YMMA 1W0WA 5DRWB 2CKBL 3KVQA 4LEOA 4LSSL 5LCVH 4ZO8A 1HHJB 5DJ0B 1P84K 3HUJB 1RAMA 3RWCA 1PYWB 5IG7B 3BRDA 3TIDB 1YEGL 5SWZB 3UPRA 4G3YL 1GOGA 5DHVH 4PTTB 1HQ4B 5I8CA 3T1FA 2I24N 3GSNA 5KVEH 3RY5A 1U58A 2BNRD 5JXAH 5ISZE 3IFLH 4TNVK 4M8VA 2BMKA 3IDGA 1CIDA 3WUZA 5KN5B 2BHUA 2DLTA 4MAUH 1UWGH 2CDFA 5D4QA 2FLBT 3CDCA 5L88L 1CD1A 1QFWM 4X4ME 1LK3L 1YEIL 3JWOC 2AK4B 4OZIE 4Y19E 1QRNE 1KSRA 5MEQA 4MB3A 4AG4L 3RVWD 5I1CL 1RZKL 4KHTL 2H2PD 1G84A 3EJZD 4QRRB 4DN3H 3QIWC 1TJIH 3RWEB 3MCLL 2VDRH 4GRLA 1ND0A 4QRUA 1NBYA 1DUZB 1BQHG 4HKBB 5D93C 3BGAA 5HYQB 1KIRA 5B8CA 3MRJB 2YPLD 4Y5XB 1CDGA 4F15B 3DMMD 5KW9L 4Z8FL 1OAZL 4NQEA 1KOAA 2B0SL 2XKSA 2VXVH 3GO1L 5E2VH 3S34L 3B5GA 4GSDL 5A16B 4HWBA 8FABB 3T0EC 4RBPH 4FQIH 2M1KA 3NOIA 4JAMB 3EGSB 3QUKB 4N8VA 3WJJC 4JFZL 1CLOH 2W59A 4OAWB 4Z7NF 1I1AA 3DX8B 5HHME 1OW0C 1EHNA 4IDLA 3MOAH 4M7JL 2GY7B 3CLEH 5HI4C 1T7WA 2AXHA 1MVUB 2QR0B 12E8H 1MCHA 4FQLH 3CH1B 3VFTA 1S7WA 4DK6A 1P1ZA 3M07A 5DK2A 4U6HB 3W9EB 3THMH 4A6YA 2YBRA 4DUWA 2ZKHH 2BVUA 1E4JA 3C5SB 4LLYA 4GG8B 5CBAA 3C8HA 2OK0L 3OGCB 4I2XA 2GAZB 1DQDL 3MXVH 4L8SA 1FORL 2C1PB 5H2BB 2AJUL 2MOVA 3HS0B 4HG4J 2IWGA 1NAKL 2VDMH 3WHXA 2ZNWA 3BKMH 4K7PY 3GMRB 1NBZB 3N50A 5DD0H 3U48A 3BN9C 3MA9H 5KSAA 4KY1L 4MX7B 1HQRA 1UB6B 2FYYB 2APBA 4KTDL 3RPIA 2PR4L 3GSXA 4J7RA 1D5IH 1T6VN 1MCDA 4GOSA 5L2KD 3ZE0F 3VXUE 5AZEL 1NUDA 1S9WA 1IKNC 2FECI 2NQCA 3W0WB 3WNPA 1DLFH 1FZKB 4ODSL 1F8TH 1KC5L 2EDWA 2ZUVA 3X3FH 1KJ2B 2JF1A 5KG9B 3MV9B 1QBAA 4X6EB 1WBZA 1CDCA 1AXSA 3RUGB 2Y5TA 2ZSWB 3FB5B 1QZ1A 4M61B 4OZ4A 2NZIA 4O51A 3L5XL 3DV6A 1GC1H 3RWGA 3TO4B 4PGJA 2ZSVB 3MRLB 3VI3E 3FMGH 3DPBA 2HA1A 1FFPA 3F6IA 32C2B 3QI9C 4G9FE 4NO5A 2KKQA 1D7FA 1DDHA 4R26H 3IJYB 1FL3A 3TCXA 4Y5VA 2E7LA 1IAOB 3G5ZB 2FX7H 1G7MA 1WIOA 4FZ8L 2OR7A 3IDNB 4R96B 3VGEA 2NLJA 4OQTL 1JPSH 5E6IC 3U4EA 1MH5B 4KVNH 1NC4A 3OKMA 2AK1H 1ZHLB 1MPAH 1GVIA 3NPSB 4HJGB 5FB8A 4G8FA 1T2JA 4QT5B 2L7JA 4JM4L 4KRMB 5JMRA 1XF4B 3FT4B 1XF5B 1PAMA 3DX7B 1NGWA 5ESQB 3SCMB 2CJUL 2FEDD 1MY5A 5C0ND 2E7MA 3BSZL 4MNGB 4DN4H 4JFFB 2E7HA 3GMNB 5K59E 4LLUA 4LCCB 3FB7A 1FFOA 3QUZA 4I4WA 4ELKB 4UT7L 4H0GA 2LFGA 3PIQA 2HLAA 1J1PH 2BVYA 2W0FA 4XC3H 3F7PC 5GHWL 4RNRB 4LIQL 4H26A 4PJ8C 1UEMA 3QEQE 2J8HA 2UZXB 4E9LA 4OF7A 5EFIB 5HHPA 3MRDB 2QBWA 4Z77B 4RZCB 3QDJA 4LIQE 4CN6A 4EDXA 1G7IA 5DJAB 2VDNL 4WI8A 5ECJE 1CGTA 3VG0L 4AM0B 3BFOA 3ISWA 3IRZA 4OKDA 2JJVA 2G5RA 4XC1H 1A6UH 2BP3A 4KKAD 3BWUC 2CMRL 5SX5K 4HUMB 3ULSA 3C60B 2VQUA 3ARBC 1UJ3A 4NC2B 1U3HA 2BY0A 3MLUH 5CEXB 3MGTA 3I50L 4J6RL 5I1JL 1FNGA 2BY1A 5J3HC 1OLZA 5JW4M 1SY6A 2IALA 3BXNA 5EWIH 1OLLA 5EU5B 4LNRB 5JPNB 4JQXC 4G7VH 5F71A 3VFVA 1P4LA 4LSRL 4CAGA 1X5ZA 3RKDC 3U0TB 3KDMA 4HX1A 2CR6A 4Z7QF 4IRJA 4I18C 1CFTB 4TYUA 3OPZL 4B5EA 5I1EH 3L3DA 1F3JB 1ACZA 4JY5H 3MV8D 1QFWL 1G6RB 1H3UA 4XBPB 2OTUA 1OB1A 1ADQH 4L4TE 4KKBD 4F8TA 1R3KA 2C26A 5TDNB 3IJSB 1CICC 2BY3A 4W6WB 5JDSB 2ZUQB 4XVTL 4YK4B 5GGRB 4MXVE 1ZLVH 4P2QB 1S7XA 1YA5A 3HE6A 4L8BA 4MA3B 4K3EL 3T0WA 3MUGA 3VFMB 1TVBB 4GS7B 3UTSD 1SBSL 2XIDA 3C5JA 1R3JA 2X89A 3ZTNL 4PJAE 4QHNB 3GSRA 3GMLA 3NZHL 1RZFH 1F3DH 2VKWA 3KYNB 4XPHL 1KCSH 3RP1A 2Q8BH 3E3QE 1UYWL 1T2QH 4PTUA 1BP3B 2XOTA 8CGTA 1KJ2L 2WBJA 2ZUWA 4KKNA 3NCJH 1PFCA 3ZKQD 1IQWL 2LTQB 3W0WE 4LRIA 3UTPE 5E2TH 5E1AB 1QFOA 1LE9B 5I1LB 4WI2A 3MV9E 3QO0B 1NCDH 4H0IA 1KPRB 3O2DA 4M1GL 3CU7A 4KI5E 1MF2L 3C8KB 4TPRH 3V4UH 1BMGA 1JGLL 4H1LB 3T2QA 3QIBD 3B9KA 3KYAA 4D8PB 3REWA 1AJ7H 4JZJA 4TVSa 3QT2A 1JIBA 1FLRL 3GJFB 1RY7B 3GJEB 4H20L 1NCTA 4QRSA 2ORBL 4Y16C 2GJ6A 1JPFB 5EIIA 1RZGA 1ZA3A 2ZJSH 3TVMA 4R4FH 4M62L 3B9VA 4PJ5B 4R7NB 2VDLH 1A1NB 3D3VD 5IESL 3EZ8A 4GRLC 1ZLSH 4K07A 4QXUH 4UOW0 1A3RH 1R3LA 2Y7QA 4I5BB 5DQDL 4BSVB 3F12B 4WRLA 1PG7W 3B8SA 2FO1A 5F70A 3MRMA 4OZFB 5C0BB 5ENWA 5B8CC 4PYHA 5I9QB 4AIOA 4YR6A 4OB5H 5DEZA 2OQJB 4J8RA 5IMOA 2QSCH 4QWWC 1FH5H 4FP8H 1P7KA 4KKLC 5T3ZH 3ECBB 1S7TA 4C55A 1JYWA 2I27N 3GM0A 4CKVX 4GQ9H 1L7TL 3BIAX 3SGDI 5E5RB 2L0DA 4LCWB 1HHKA 4PS4H 5EBWB 2AEPH 3QIUA 1KTLB 2A6JB 4YUEL 3WLWC 2KZ1B 5FXCH 3HNTH 3QIWD 3VXMB 3TZVB 2I07B 2DRUA 2FJHA 3P0YH 3IDJA 1FGNL 2GJJA 1L0YA 2F54E 2H6PA 3L3JA 2W0LA 1ZHNA 4U0QB 3LOWA 5TQ2H 5C71A 3TNNA 4LF3A 1I8KA 1U2CA 4L8SC 2EDYA 1R5IA 2P48B 3BPCB 3EAKA 4IJ3B 5EZIH 1NGZA 1T03L 5E70A 3V6FB 1VB9A 5T3XL 4I8DA 5HDQL 5KZCB 5E99H 3U9PH 4NO2A 3T0ED 3S3JA 4FQCH 3O8XD 3S88H 3C9NB 4P46B 1RZ7H 1J12A 3S36H 5KSAC 1A9EB 2C7UB 1LO2L 5T3XE 2X70A 4YEFA 5IHUL 3JTTA 5ALCL 1JRHL 4K2UL 5D96C 4ODUA 1S9KC 5F6HI 5GGSY 5HI4D 4ONGL 4HIHA 4J12A 3NCMA 3MRBA 5FYLL 4LP5A 3G6DL 3PQYD 1FYTD 3ETBF 1ONQA 5TJWK 1KB5L 2YWYA 4YFEA 1Z9LA 1QFUL 4Z7WE 3KG5A 5I76B 1KENL 4WO4B 4NKQB 4CMHC 2HJKB 5HGDA 5FYLE 2O5XL 1S7QB 3D25B 5H37H 3VFNB 3VXRB 4EUPA 3QULA 3STLB 4NJ9H 1FDLH 2CKBA 1F97A 3HHRB 4YQXH 3G08B 5DR5L 1G6RL 3SDXF 4DZBB 4HT1H 4ETQA 1KN2L 2C1OB 1CDYA 1KF9B 3KPOA 5BZDB 1DZBA 5D8JH 5BVJB 4CVXB 3LY6A 4WGWB 4Y5VC 2E7LC 2H8PB 2ICWB 3D39A 3BN9D 2DLHA 3T65A 1GZPB 4WI5A 1NJ9A 4RA3A 1GYAA 1V7NH 1HZHL 2ARJB 3C08L 2QADC 4Z76B 4N8PA 3IDYB 4UILH 4CRPA 4X4MA 4L4VB 1WZMA 3FO1A 3ALXA 4IEFB 4JPVL 1EAPB 1I7RA 3TNMB 4J1UA 4X9BA 2EKJA 4Y19A 4OUOA 3PWVB 4WHTA 2XZQL 5C0RH 3A6CH 4I0CC 2VISB 3PHQB 4OSUL 4FN0A 2VSCA 1D5ZA 4KVCL 4ZFOL 4P2YA 3PABA 1KEMH 4XHJD 4YNYB 2ED7A 5IT2L 1DQQA 1KTRL 3Q3GA 3QO1A 1S3KH 4OM1H 5FCSH 1IGML 1TETL 3HE7B 2EC9T 2UVFA 1RUMH 4PPTA 3MSPA 3QUZC 2LU7A 1JGDA 1MFEH 4XNYL 3QI9D 2BXYA 3QHTC 3B2VH 1DBML 4XZUB 1UGNA 3AU1A 1D6VH 4WUUB 3P4OA 5DJYB 2AKRB 5E6ID 1FG2A 2R1WB 2NX5E 3DI3B 4I3SL 2DQIL 5T1DL 3CLFL 4KQ4H 2RGSA 4OKVA 3IXTB 4DFIA 2O93L 1OAXL 2CRMA 3LD8B 5TPWH 4NM4H 3QUYD 2NY6C 4HUNB 3Q5YA 4AQOA 2QHRH 4PJ5E 2VLJD 1AKJD 4NM8L 4K3DH 3MLXH 1TVDA 5FUZH 3H7LA 4C59B 1S7UB 3HI6L 2L4OA 2YD2A 5EZJA 2W91A 1UJ3C 2YXFA 3B3IA 3L9RA 4QXWA 4EEEA 5CD3B 2LU4A 1BQLH 3GMOB 3NCFB 4W4NA 4HEPG 2DF3A 3IU3B 4JFHD 3CFJB 4OLYL 1D5BB 1A6VL 3KYMA 1IZJA 1K5NA 3VXOA 3WKML 4MDIA 4PGDA 5E56A 1CXFA 3EOBB 3CUPA 3UC0H 1RZIA 3L95B 4XPGH 3LEYL 4IRJC 4ZXBB 3UTZA 5I16B 1PZ5A 2FEEL 3EYQC 5GRUL 4PJHF 4JRXB 1DBKL 2H1PH 3T8XB 3FQTA 3QPXL 1AO7A 2E6PA 1QBLL 1VFMA 4BSWA 4E41E 3V52H 5SWSD 2GKIA 1OWWA 4MJIB 1LQSR 1WQVT 3GHBL 3VXNA 3VXME 2PO6B 5F9DC 3CC5B 1DJSA 3O81A 4L3CA 4WU7A 3TWCL 1U8IA 4OUUB 4IOIB 2I5YL 4JQIL 4PJGA 4FNLH 3DIFA 3HE6C 4FS0A 1X5GA 4AYFA 5D5MA 3LH2L 4O58H 3N85L 3VJ6B 4H5SB 3BUYB 4LLWB 4XCNA 1GIGL 5J3HD 4DVRH 2VOTA 2CGRL 2BDNH 2WUBL 4M4PA 1YNTA 3KLHC 1T4KB 4R8WH 2EYSB 5IW6B 2ESVD 2IC2A 1FVEB 5J12B 5CHNA 5HYIA 1AE6H 5E2UH 4NUJB 3EDKA 2BCKA 1T66D 3VRIB 3HC4H 1DQJA 4HF5L 4GLRH 4JZOB 5E8DH 4R6UA 1ZOXA 4WWKB 4Q0XH 4U6TA 5IP4A 5I71C 4LRIC 2XXMB 5DRWA 4KHXH 2DIJA 3FQUA 1KPVB 3BP5B 3MGAA 3GK8H 4YBQC 2NPLX 3WEXB 5DJ0A 5JW4Q 3HUJA 5FOJA 1PYWA 4V1DB 5IG7A 3VXRE 3O6LH 3HZVB 3LN4A 3TIDA 1CICD 5SWZA 1MQ8A 2OX5A 4XWOC 4ZTPL 5GJSL 4TNWK 2D7TL 1QFPA 2KDGA 3B9KC 1BD2E 1HQ4A 4JZJC 1YMMD 2X4TB 2CDGB 4HJJL 2VLME 5E7BA 1OP5K 3ZT6A 4NFBA 4ZQKB 5DXWA 3U46B 3V0WH 5KN5A 1LGVA 4JFQB 4DKFH 3TVMC 3GKWL 3NIGE 1BF8A 3UO1L 5HGBB 1CL7H 1LDPH 2P5EB 5LBSL 3TT3H 1C7TA 1QRKA 2AK4A 2H9GB 4YDKH 1W72L 3QQ4B 3ZE2E 1IBGL 1WBYB 1TTUA 3EYVA 3G04A 5C86A 1DSFH 4GXVL 4QRRA 2A6IB 1NLDH 2O5ZL 5SX5H 3RWEA 3O4OC 4G7YL 2IPTH 1T0MB 4ZTOH 1DUZA 4HKBA 3BQUD 5ACZA 1A7QL 1M6OB 4LDOB 3HNSL 1MELA 3QRGL 3MRJA 1RFDH 4GRWB 4JPIB 4Y5XA 3QXWA 1C08B 5HDLA 1U0QA 2OZ4H 2XQYG 4JQVA 2C3XA 1MIEL 2RFXB 3QIUC 2DJUA 2IQAB 4MZ3A 1JF6A 1KLGB 4POUB 3V7MA 5A16A 4WUUE 4LLDB 8FABA 2FB4L 4GRLD 2DD8L 5HVFB 5F72S 4LU5L 4JAMA 1VCAA 1U91B 3EGSA 3QUKA 4M5YH 2N1KA 1RHFA 3TESA 4OAWA 3N0PB 3DX8A 2Q3ZA 2AJVL 4YC2C 2VIRB 4QWWD 1FP5A 1MVUA 5IGXL 4KKLD 1NUFA 2QR0A 4LPCA 1BFVH 1X5AA 3CH1A 4FXKB 3OTTA 4FQXB 3NMEA 4PBWD 4U6HA 3KLDA 3W9EA 2FX9H 1UC6A 4GW5B 5J06A 1YEJH 4AJ0A 3C5SA 2YD8A 1I1AD 4GG8A 3DGCR 3OGCA 2GAZA 5TE7L 2OJZH 4RISH 5BOZG 2C1PA 1IM3B 5H2BA 1DBBL 4KUCF 1LO0L 3HS0A 3RY4A 5KS9B 2F9BT 1OAQH 3NFNB 3EYSL 2F19L 1U95A 4HJ0D 4XP1L 2B8OT 1MCFA 3NCCB 5FYKH 3GMRA 5JUEL 1NBZA 1XGUB 4Z7VF 5C09B 1AXTL 1WZ1H 2WINB 2EKSB 1M05B 4MX7A 2B2XH 1GZQB 3P0VL 1DN0B 2MCG1 4QRTB 1UB6A 2FYYA 4JRXE 2CIKB 3TBSB 1X44A 2YK1H 3SJVB 4BUGA 2PUQT 5DRNB 2ZCKH 1FZKA 4HC1L 1LP9B 1CGUA 1WFTA 5KSAD 3KNBA 3O2DH 5EUKA 3RUGA 2ZSWA 3FB5A 4M61A 3NA9H 3H3BC 2WWKT 3TO4A 2ZSVA 3H9YA 3MRLA 4LARL 3ZDXE 2V5RA 1ORQA 2A9MH 2E9JA 2ZP0T 4XPTL 5HTSA 1Z3GH 32C2A 4LMQI 4PR5B 1I7ZB 3IJYA 5DRZB 2BFVL 5I15H 4MCZB 4P5TC 4JO2L 1IAOA 3G5ZA 4WHYG 2EDEA 1EJOH 2MQ3A 2VXUH 2XWBB 1T7XA 3O2WH 4XNXH 5FOBB 3IDNA 4N0YL 4PRIE 4R96A 3P4MB 1YPZB 2A2QT 1UXWA 4WTXA 1MH5A 1MI5E 1JE6A 3RVXC 4HJGA 3MRRB 4QT5A 5B21A 4TVPD 3CDFA 5MP6H 1XF4A 3FT4A 1XF5A 1A3LH 1PEZA 3GSWB 4UU9B 1DEEB 3DX7A 4XVSH 5ESQA 3SCMA 1PKQB 1QNZH 3EOTL 2DWEA 2QADD 4HK3N 5TE4L 4PUBL 5D71H 3O3EB 2VITA 4Y8DC 4MNGA 1NC4D 4JFFA 4NO3A 3GMNA 3IDXH 1HXYB 4YXKH 2QQLL 4LCCA 3RX5A 1JK8B 2AXFB 2EIZB 5AYUH 2ZWLT 4ELKA 4YZFE 3LCYA 5EO0B 5GGTL 2CLZB 4R3SB 4G43B 4LSPH 2CK2A 2COQA 2OMNA 2BOBB 4RNRA 2BSED 3MLVL 2P5EE 1WEJL 1FL5B 1G0XA 1G9ML 5GGVL 5EFIA 3MRDA 1CU4H 4KUCD 3QUZD 3E2HC 5IEKB 4M43H 5DJAA 5GRYA 1DTUA 4AM0A 4JFDB 4PY8I 4EIGB 3VXSB 4M1CC 4C54A 5EUOB 1DE4B 4KRPC 4I77H 2I60H 2V9QA 3J8F7 5EOQH 4JG0L 3C60A 2Z31B 3QDJD 1UM4L 3K1DA 3GMMB 4M7KL 2R0LL 5CEXA 2JJWA 4OCWL 4YDJB 3T2OA 4K8RL 5D2LB 5F7YC 5CEYA 5ESVB 2NY4B 2KBGA 2FGWH 5EU5A 5TF0A 4XP9H 4LNRA 1GL4B 5JPNA 1DUYB 5JNYB 3DURB 3ARUA 1ZLUK 4NO0B 1S9YB 1ZXQA 5A2LH 3U0TA 5E94B 4K23L 5FYJL 1U3HD 2DTMH 3Q48A 1CFTA 3UX9B 1OAYL 3OKKB 3MV11 4NN6C 4UV4L 3MXWH 2F53E 1BGXL 2IPUG 5MI0C 4ZAKB 3JV0A 1F3JA 4G8GE 4NIKB 5TH2B 2QSVA 1DQMH 5FYJE 5ID1B 4WFED 4G9DB 1NCWH 2DI8A 4XBPA 4TRPH 4FHBD 1FSKC 2H2SC 5TDNA 3IJSA 3UJJL 5B4MC 1P4BH 4IRJD 3BP6B 3CSBA 5JDSA 5GGRA 1NQBA 4P2QA 2X1OA 4MA3A 3W82A 4PGEB 2P42B 4ZYKB 5DT1L 4YAQB 2FHCA 4KDWA 4OCLC 3QAZB 1TVBA 2DQTH 4UOW1 3X14B 4F2MB 4O4YL 3KHOA 1IVLA 5E0QA 4QHNA 4YDLC 3TBVB 1YYMH 4FG6D 3ARGB 1URLA 5C09E 1QPPA 3KYNA 1YUHA 3HE6D 4MD5B 3K46A 2VZSA 4PJEA 4U1SB 3GM8A 2BK8A 2YD4A 1DVFB 1QEWB 4CUCA 3FO9B 3ULUC 4OLXL 2VLRB 3AMLA 1FNHA 3M8OL 2X89D 5EOTB 1MCKA 4WV1C 3KLHD 5E1AA 1LE9A 5I1LA 4PJIB 3CXDL 1MWAL 5JHLL 3VWKB 3QO0A 1KPRA 4DK3A 3C8KA 4HV8B 5CBEB 2VERN 1CQKA 2WBJD 2JCCE 2D9QB 5EZOH 4HQQH 4TUJB 4H1LA 4N1HB 4D8PA 2J8OA 2F74B 4CADA 4MNQB 5JIHA 3GJFA 4ZFFA 5JOPE 2UZIL 3S35H 2NY5C 4HZAA 1JPFA 5FUOL 4WHDA 3SDYL 1BZ9B 4L5FH 3CZFB 1EK3A 5KSVB 5D2NB 3OX8B 4R7NA 1WWBX 4LVOB 1A1NA 4NZUL 4XWOD 4G8EB 3KXFE 1FYHB 2AJSL 4LAQL 3RZWA 4I5BA 4BSVA 1YPZE 3F12A 1ZANL 3B9KD 4Q6IC 3MNVB 4OZFA 5C0BA 35C8L 4HGKC 5FUCE 4Y5XC 5KVMC 1H3GA 2OQJA 1G9NC 2GJ6D 1A2YB 4G6AC 2YOCA 3ECBA 3TVMD 3L3GB 2PTTB 1PKQE 1ZVHA 3FQNA 1BFSA 1I9RH 4M48L 2VR9A 3B9AA 5FHBH 5T5FL 3KPNB 2FIKA 4DWHA 5DUBB 2Y06H 4LCWA 2X6MA 4ZOEA 3EJYC 4PJ9C 5EBWA 4KUZH 5BV7L 1T89A 3BKJH 3U36B 3WFEH 2ERJC 1KTLA 2A6JA 4YBHA 2FD6H 2NY3C 3TZVA 2I07A 1NCBH 2HAZA 5DWUH 2DQUL 1P7HL 1FFQA 5BMFL 3MV7E 5B39G 3IFPB 1LE5B 1F58L 1X5KA 1CLCA 4X7DC 3LKQB 2YA2A 1N0XH 2O26U 3QIUD 2VDPL 1G9EA 1H3PH 3V6FA 1NCNA 3ORJA 3AB0B 5HDBF 2NY1D 4JFDE 2H32H 4JHWL 1F90H 4OF8A 3TYFA 5CEZD 3KPRB 5ICYB 5FHAL 1Y6MR 5TFSL 3D9AL 2OJEB 3VH8B 4F37K 5EUOE 3UJTH 4C83B 4JG1L 3C9NA 3TJEH 4D0CB 3T0VA 4P46A 4BELD 1A9EA 2C7UA 5K9QG 3F65A 4UIKH 2F8OA 2A6DB 4H25A 3LB6C 1QACA 2FECL 4TSCL 2B4CH 1UM6H 3OXRB 2DLFL 5D2LE 2ZZUT 5HVGB 3UMTA 4N0UB 5I76A 2R8SL 1MCQA 3QNYB 1INEL 1FNSH 3QHZH 4FRWA 2HJKA 5IHLB 3VFNA 1S7QA 3D25A 4HBCH 2WV3A 4APQB 3STLA 5DC0A 3NACH 2VLKD 3G08A 4IIQA 4DZBA 1OP5H 3TO4C 4HIEB 4BQBA 2C1OA 1AY1H 4YHZL 3ULUH 2H45A 5BZDA 3E8UL 4CVXA 3T3ME 3MRHA 3LIZH 2ICWA 1X6LA 2DTSA 1GZPA 4JRWA 1ROWA 2ARJA 4RSVA 1BLNB 4L4VA 3C87A 1MFBH 4WWID 1EAPA 4NRXB 3TNMA 1T0NB 1REIA 4EOWL 1A6AA 1ZGLM 4M1DL 5D1ZB 3PWVA 1WITA 4LEXL 2V17L 2DM7A 4LGSB 3D39D 2XRAL 3NCEB 2Z92B 2VISA 1A14L 3SCMC 1OPGL 4P3DB 3IS1X 1IAIM 2EDRA 1IC4H 4YNYA 5L6YH 3DETC 4FABH 3ABZA 3GRWA 3ZYJA 3HE7A 1KNOB 3E0GA 4LCCC 2C3VB 4LLQB 5D5MF 5GGRY 2WWKO 3QHFH 4Y19D 3S6CA 3WNLA 3VI3F 1G9NH 5DMIL 4JCMA 3ZDZF 2HMIC 3AS3A 4XZUA 1AI1H 4ZPVB 5DJYA 1HYRC 3ARXA 1MRCL 2YKLL 2CIIB 3HCVB 2R1WA 2VXTL 4PB9H 3DUUB 4YO0B 4Z78B 3IXTA 3FZUD 3RIAK 1FPTH 3STZA 5L7XL 3U83A 2JB5L 4X6DA 4YWGH 2WLZA 5TGBB 3V6OE 4EVNA 5HXMA 3H7BA 2AABH 1FFRA 2V7NB 2OS7A 3H3PH 4NBYB 4BK5A 1QSFB 3UYOD 2ZCHL 3HUJF 3S98A 1U9KA 1S7UA 5HHMD 2Z8WC 1ITBB 5CD3A 2LVCA 3GMOA 2DQHL 2EH8L 4EXKA 3NCBB 3ULVC 1YQVL 3QUML 5KAQF 2PETA 1EO8L 3IU3A 5I1IL 3CFJA 3LQZB 1D5BA 5DJ6B 1KLFA 2XNAB 3KPMB 3P9LB 1CDIA 5C0CB 1F2XK 3SO3B 3EOBA 3EFDH 3ZE1E 4LSQH 3L95A 5IHBA 1NMBH 2JB6B 3HMXA 4IRZH 3W11C 1T22B 3TYGH 4ZXBA 5I16A 3U0PB 4FQ2L 3T8XA 3EBAA 4KRNA 1GHFH 4JHBA 3GZKA 4U7SA 4MJIA 5LQBH 5CD5C 4M1CD 4CGTA 2PO6A 1D5XB 3CC5A 2FZ3B 1CD8A 5MEOB 4OUUA 4IOIA 1E6JL 1EUUA 1RUPH 2VSDA 1KJ3L 4HC1A 4XB7A 3E6FB 3VJ6A 4NWUH 5J89A 2EEDA 4H5SA 4TN9A 3BUYA 1JNNH 4BK4A 3BE1L 1BBDH 4DTGL 5DJCB 3HC0B 4LHUB 1LVEA 3ILQC 4H8WH 3EKCA 1T4KA 4KU1A 1E0OB 2EYSA 3EUUA 3GSOB 5IW6A 1MHCB 4TQEH 4KROB 2P24B 1FVEA 4PV9B 1CLYL 1YYLL 3RWDB 3PGFL 4NUJA 5IB1B 4XP4H 4ZPTB 2HN7B 4F3FB 3VRIA 4NKOA 4JZOA 5ADOH 4HXBH 1MCWM 2HJFB 3JWDC 2PNDA 2XKNA 4JFOB 4WWKA 2LTQC 4EUPG 1A7PH 1ZTXH 4O02L 1KPVA 3BP5A 4MMXC 3WEXA 4OF0A 2EZ0C 1A9BB 1NUNB 3WHE0 5HHOB 1WC7B 2Z35B 2G60L 4V1DA 3SE9L 5B4MD 3HZVA 4CU8A 5IM7B 3G5YB 3MUJA 4O2FB 2NYYC 3O6ML 1CL7I 1XGYH 4HKXB 4MD4B 2AXGA 4MXVF 4FQ1L 3O6FC 1WCBB 2X4TA 4LLAA 4Z7UB 1QKZH 4XMPL 3T08A 4ZQKA 3U46A 2UYLB 3U82B 1J8HB 4JFQA 4JJ5B 4IRSC 5JO5B 2J5LB 3PV6B 1JZ7A 5SWZD 2DQDL 3DGGB 3PDDA 4Y4KB 2P5EA 4WCYH 4ZNEA 3WNOA 2AQ3A 3L5IA 1OQXA 3SHSA 1CS6A 4ZDHB 1ZAGA 5I9QC 1S7SB 4GAGL 1INDL 4F7EA 3IFOB 2H9GA 3AXLB 3QQ4A 2WWMC 1WBYA 2DQJH 15C8H 1PG7X 1KBGH 3KPSB 3VDAA 5DK3A 3PG2A 2A6IA 1JHLL 3NFPB 2PW2A 2XPGB 3PWPB 1T0MA 4NZJA 2R1YB 1N6UA 3RUGF 3ELAT 5GS0H 5CLTA 4D9RE 2ADFH 2AK4D 4ZS7H 4ZS6C 4JPIA 2P7TB 2R2CA 1C08A 2H41A 4PG2A 4QEGA 5J1TC 1T89C 2V5MA 1CE1L 4I3RL 2RFXA 2UY6A 4P2RB 2IQAA 3ZTJG 1UEYA 3VFPB 1ZLUH 1KLGA 4QRRD 3BP7B 4LLDA 5ALBL 3TZVC 4DAGH 3U6RB 1SVCP 2MQCA 4NQCB 3SQOH 1U91A 3EO1B 4QXGH 3TJHC 1JPGB 5KVGH 1NGQL 5JIPA 1MCCA 1WUNT 3FN9A 4JO4L 4IJ3C 4MJ2A 4ZSOB 4L9DA 4DQOL 3MYJB 4G6AD 3VDCA 2BVOA 4FXKA 4FQXA 4NGHH 3AM8A 2EEBA 3O41B 3H3KA 1ZGLP 2DJSA 4HS3B 4GW5A 4P46C 4OCYH 1I3RB 2VR4A 5CP3A 3DHMA 4DGIH 5ITBH 3I02B 3MOBH 1N4XH 3B83A 5KANG 3EJYD 5GRXG 5E8EB 4TOYL 3ESVF 1IM3A 2BERA 2FH6A 5DC9B 5KS9A 1IAIL 3NFNA 4BZYA 2GCYB 4HWUA 2K7QA 2YUVA 2NY3D 5DHVB 3OMZA 2ZUXA 3UDWA 3JUZA 1XGUA 1B0RB 2JJUA 4KK6C 2WINA 2EKSA 1M05A 2MWCA 1L6XA 1GZQA 1O7VA 1IGIH 1DN0A 1IFHL 4IIQC 4QRTA 3MNWA 3BIKB 3N9GL 1CZ8H 1FO0H 1VEMA 2CIKA 4NP4L 3TBSA 3V5DA 3SJVA 5HI3C 4M9PA 3JWDH 1A6WH 1EMTL 5ITFB 4LKXB 1DQTA 2G5BA 3CK0H 5DRNA 4WHYH 4JR9H 4MQTB 1C16B 5DYOB 4PRNB 1LP9A 4ODVL 4XB8A 4HZLB 2EO9A 3JXAA 2WP3T 5C0GB 3RWHB 3RL1B 5FDWB 3MRKB 3HZMB 2YPLE 1YEKH 4NNPH 1V7ML 3BUTA 2VDOL 4KAQH 1D9KB 3UTPD 4OJFL 5J6GB 4PR5A 3ULVF 1I7ZA 4BFIB 1B4JH 3L7FB 5DRZA 4MCZA 3WFDL 3UXFA 2QKIB 2UZYB 3IGAB 4LGPB 4YHNB 2XWBA 3KGRA 5FOBA 1F42A 3QH3B 4QOKB 3P4MA 3S8WA 1YJDL 4LCUB 7FABL 5JZ7C 3TO4D 2O5YH 2IMNA 1EJ6A 2HT4D 4JVPA 1YECH 2X1PA 3MRRA 5IFAL 4FTVA 3QRFM 4OV5B 4HPYL 3GI8L 4RAUB 1UM5L 4DGYL 3R1GH 1JN6B 2XTJC 3GSWA 3MUZ1 4UU9A 3MBEB 1DEEA 2FBJH 4HIXL 1H3TA 1RV6X 1PKQA 1XR9B 1J0ZA 5KAQG 5EOCJ 1SM3H 3O3EA 5E9DB 3LPFA 4F9LA 5TQ0L 3Q2CA 4XAKD 4I3GA 3OAYK 1HXYA 5KVFL 3NA4A 1JK8A 2AXFA 2EIZA 4XCEB 3LPWA 3LD8C 1EFXB 5DD1L 3M17B 5ETUB 3Q6GH 4R2GB 4UB0H 5FV2A 1J0JA 5EO0A 4K9EL 2CLZA 3SCMD 4R3SA 4G43A 5DVNA 4UDUB 5F3HB 4JDTH 5AG8A 3DSFH 4F57L 2NZ9C 3DBXB 3DETD 4N0FB 2QEJA 4YFLF 1NCAL 1FL5A 1KEGH 2EE6A 1TENA 4JFFD 1SJHB 5L2KE 4LSVH 4JM2F 3MJ9L 4HXAL 1QPXA 5IEKA 4XP6H 2HMID 3BD4A 1T1XB 1HEZB 1JWMB 4R4NC 3KPSE 1JPTL 2ZCLL 4JFDA 5EU4B 1I1YB 3VXSA 2BXZA 2DL9A 1CDJA 3NH7H 5BOPA 3PWPE 3ZL4L 5F1OB 5EUOA 1DE4A 1SBBA 4DOHE 1OP9A 1RUAL 1KXVC 2AAVA 2R1XB 4ACPA 3HPJB 4ZXBC 4MLIA 4N1CA 3L3KA 4JB9L 2Z31A 5A3ID 3GMMA 1NPUA 4YDJA 1UCTA 1ZEAL 4N9GB 5IBLC 5D2LA 5GJTH 4HPOH 1C5BH 5ESVA 4G6ML 4OTXL 5I66B 1JF5A 2PO6C 1DUYA 5JNYA 5FYKU 4G6KL 3DURA 1MCNA 1DBJL 4J3OC 1ES0B 4NO0A 3ZHLA 1S9YA 1NDGB 1II4E 4KPHH 4QKXB 3C60D 1UZ6F 5E94A 1RIUL 3OKKA 3WIHL 4LSUH 4ZO7A 4PFEA 1X6NA 3ULVD 5IMKB 4PJXB 2K1MA 5IF0B 4RIRB 5TH2A 5KJRH 3D0LB 2D7OA 1BX2B 5ELIA 1U36A 2NTFB 1L0XA 4MA1B 4G9DA 4ZODA 2J88L 2DBJA 3MACL 3QG6B 3UYRH 2OLDA 3V9FA 3MMEB 1FNFA 1R24B 3W11D 3D18B 1PEWA 4MZ2A 1FCGA 4URTB 4PGEA 2PCPB 3CFEB 4ZYKA 1HN1A 1QBMH 4YAQA 4DJMA 1MCPH 4WWKC 2MTPA 5KVEL 3X14A 4NWTH 5CD5D 3I3EA 4KK9C 3IFLL 2J2ZA 2P5WB 5D93B 4MAUL 4POZC 4NFCA 4OCSH 3ARGA 1UWGL 3V7AG 2E6JA 4P2QD 4AQ1B 3QXVA 5JPMA 4Y2OA 5IB2B 3CSGA 2ATKB 4U1SA 4Z6AT 1DVFA 2JJTA 3VCLB 3PWNB 1QEWA 3ZMRA 5HYEA 3FO9A 3P30L 2VLRA 4R4BB 3ILQD 5C07B 3QZWB 3T0EB 2Q86B 1PSKL 4PJIA 4WI9A 3FRPA 1T20B 3VWKA 2DICA 3C2AL 4U0RC 4U6XB 2X40A 4AZ8A 2VDRL 3ZE0E 1M4KA 4HV8A 1JNHB 4MHHG 5CBEA 3U0WH 1FE8L 4KJWC 3I2CH 1YEFH 1MCLA 3IDMB 4TUJA 1U8JB 1XEDA 2F74A 5JORB 5IW3A 4MNQA 3BZ4B 4WVRA 2V2XB 2X2YA 2EZ0D 4CNIB 1S7RB 3OHXB 1BZ9A 4ZUSB 5E2VL 3CZFA 1DL7H 3NTCL 5KSVA 3P9MB 5D2NA 3OX8A 5J9PB 4G8EA 4OLVL 3VXQA 2C3GA 4KZDH 4JN2B 5KANI 3OAUL 5F7MC 2NYYD 1WAAA 1HSAB 4ZUVB 1QO3B 3MLSH 2ED8A 3KHQA 5I1GH 4LDLB 4PG2C 3MOAL 1VACB 3Q6FB 4KMLB 4PJ7B 1A2YA 2XZCH 3MJGX 5CJOL 4XXCA 5GGQH 12E8L 5D7SH 3L3GA 3T2PA 4HCRH 4FQLL 2J6EL 4PJ5D 1EGJA 5C0EA 2PTTA 4NC1E 1EEQA 5DA4A 1ED3B 4D3CL 5DLMH 3NIGF 2GSIA 3KPNA 3WNMA 5C0BD 3UTSE 1RUKL 1NDMB 3HMXH 3MXVL 3MLYH 2WWMD 3RHWK 4H88H 2VE6B 43CAB 3LZFL 3SDDB 3U36A 3K2MC 1F4HA 2UY7A 3ZE2F 4FQXC 3AM8C 1IM9B 2HJLB 4OBRA 1JFQH 2VH5L 1Q8MA 5DD0L 5EORL 4KRLB 4OZGE 1WWAX 2Z8SA 4IS6B 1MRFH 3IFPA 1LE5A 2VC2L 4LCWD 4ZS6D 3H9HB 5HHVL 4NQDB 5HGHB 5CGYC 4OIIH 1IAMA 3LKQA 4GAJL 5C3LD 3DARA 1AQKH 4OGYH 4RWHA 1DLFL 3KPRA 3VXMD 5ICYA 3TZVD 1T80A 1F8TL 3PHOB 2B1AH 3X3FL 2OJEA 3QPQC 3VH8A 1R0AH 3X3GH 4C83A 3TJHD 4XCFH<