1Z6JT

Crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
207
Chain Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design and synthesis of pyrazinones containing novel P1 'side pocket' moieties as inhibitors of TF/VIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Coagulation factor VII
total genus 46
structure length 207
sequence length 211
ec nomenclature
pdb deposition date 2005-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT02
1A21A 2B20A 4APQB 4MJ5A 2O5XL 4JJ5B 4KJQC 2ZPKH 1J5OH 5GGUA 3MRJB 2JIXA 5JO5A 1T21B 2VLKB 5KSUB 1WBZB 5GZND 4NN5B 4RMTA 5TE6L 4P99A 2AEWA 1MWAB 1KLUB 3NMEA 4YZFE 1NBYA 3MCLH 3P73B 4PGEB 1WAAF 5D6DC 3RIAK 5IB2B 2BSSB 2KZWA 2W1NA 5BMFH 3HE7B 3BRDA 3DBXA 5IKCB 1NSNH 5JUEH 3BE1H 3DROB 3OKLB 4P23A 3MXVL 1U8IA 4PJHE 5HGHA 1GOFA 2AW2A 5FB8B 3WEXA 4Z5RB 3DVGA 5GGUB 4YXLH 1MRDL 5DT1H 5JMOC 4E5XB 5LJYH 3RWDB 4GKZA 3CVHL 1HI6B 3MZGB 4Z7UF 4HS6B 4G8IB 3LKRB 3TN0C 1J88A 3RZWA 1QSFD 2HT3C 1FORL 2ZUUA 3LD8B 5CHNA 3NCFB 1KIRB 1ZT4A 3MOBL 4HUVA 1I1AA 1N7MH 1IGCL 1B90A 5TE7L 2BCKB 2BSSA 2VTFA 4J4PD 4JO2H 2VZTA 5DS8A 4BQBA 1REIA 4XP6L 4X4MA 5BZDB 1OTTD 3NPSB 3TNNB 2JIXB 4Q9BA 1PFCA 4PB0H 2CR3A 3QHFH 4I3RH 3W0WE 3RVUC 3UTZB 2F53E 3TPUA 3QEUB 4FXKA 5AZEH 2Z8SA 4MXWL 4ZO6A 2EDTA 4PJDB 4W68A 3UTTE 1EEUA 3KYOA 1HHKB 3QDJB 5E4EC 2HLFD 1W0WA 5I17B 4AMKH 1KIRA 1GH7A 1NDGA 4P4KA 1Q9WB 5HTSA 5TQ2L 3KPSB 4XVJL 2GSIB 4LVOB 3HKFA 4N9OB 2ADGA 3NCYS 4QRRA 4LCYB 1Q9KB 4EUPH 1A1MA 4HXBL 5T3ZD 3DARA 4PJIB 3T0EE 5FYLL 3HFMH 4HBCH 1ZTXL 2P7TB 3R06A 4C59B 3TYGH 1YUHA 3ET9F 5HXMA 2IMNA 1R3IH 1E4WH 4MSWB 5IBTL 4KROD 4WEUD 4OZIF 1CG9A 3F62A 5IHUL 1NGWA 1YEFL 3GIZH 2DBJA 4P3DA 1ACYL 5I6XB 4PJAA 2BVPA 3QQ3A 4DJMA 1R3JB 4KHXH 1DBJL 3UYRH 4X6EA 3FT4A 1SJXA 2VDKH 4X7EC 4AT6B 1SYVB 4LSTL 4YUEL 4QRPD 4U6HA 5DVKA 3D18B 2NNAB 2FIRT 5FHAL 4OGZA 5IVNA 4JO4L 4RGOL 1NGWB 4K3GA 2EDRA 4NZRH 3CFDB 5ERWA 3BEVA 1FO0A 5HSFA 3L3JA 4JFQA 3MLTB 2DWEA 2YPVL 1ZA6B 4G5ZH 1CR9L 4LLVA 3NN8B 1KC5H 4X8JB 3EYVA 4TVPH 3QHTC 2X6MA 1DEEA 3SGJC 1ZLSH 1IT9H 3BGAA 2XZAH 2J7LA 1TPXB 1YN6A 4Z7QE 3X3GL 1JNLL 4NBZB 5IMLB 3KYMB 4EDWH 2BVOA 1HEZA 3OAUH 2WBJC 2VLRD 1OCWH 1OHQA 3FOMB 4BQ9A 4M6ML 1BHGA 3CFCL 3P4NA 1T20B 3MLTA 4I3SL 5MEOA 1CDJA 3IFOB 1QZ1A 3L5IA 3IRPX 4ELMA 5JXAL 4YBQC 1HILA 4GG8A 3FOMA 3OF6A 1QSZA 5SWQA 1NAMH 1CYGA 3RZCC 43CAA 2QQLH 4JGJA 3RGVA 2IFGA 3NCJL 5GGTH 4M6AA 1OF2A 4JFDE 4MXQD 1J0YA 4X6CF 1AD0A 4NUJB 5IB5B 1U0QA 2B5IB 3C60D 4GW5A 5ICYB 4QO1A 3WMSA 4Y89A 1IBGL 2X7LA 4FZ8L 4J3UA 1D5MB 1KNOB 3FO2A 4JM2B 5GGSY 4LIQL 4IBLT 1A2YA 2BHYA 3UZEA 3AFLA 3RHWK 3KGRA 1MAMH 5EOTB 2ZCHH 3WE6B 3L5XH 1N5YH 4PP1D 1UQSB 5D2NB 1HXMB 3LHPL 3UXFA 5C8JB 4WUKH 2ZUVA 2B4CC 4PLKC 3UTSD 1TJHL 3HMWL 5DJ8B 4E42B 3QBTB 3MMEB 2ZG3A 4RAUA 1CU4L 4NNXB 3HNTL 2J6EA 3HS0A 3F12B 5GHWH 2VQTA 3FB8A 3FQNA 2R0WH 5I6XC 1I8LA 3HUJB 3ES6A 2OK0L 2B5IC 1TCRB 1R3KB 3ARGB 2XWJA 1J5OL 5HDOA 4RGMB 4L3EA 2ARJB 1FP5A 4TOYH 4WI8A 2HRPH 5FM4A 3RZCB 3DXAB 4M62L 3D2UB 4RGNB 4P9MH 4AEIL 2XZZA 4D0DA 2EH8H 4NM4H 4BSWA 1AE6H 4XI5D 1ZVSB 3BWUC 3EHBC 3RDTC 1I8KA 5FGBC 4P2QA 1CFQA 3JVGC 1U8NB 5T1KB 2DDQH 5BMFL 1UFUA 4NHUB 2Z4QB 3HZVA 1XR8B 4PRBB 2ENYA 1H0DA 3JWDH 3CSPA 3MODH 5DVOA 3GSUA 2Y06L 3KPSD 1AP2B 3FT3A 5HYFA 5IW1B 1F4WL 3HHRB 5EC2B 3DOSA 4KRLB 4G9FD 1X4ZA 3WJJC 2XWJB 3BDBA 5CJQL 3GNML 3PDOB 4XNXH 1MFDL 2RIKA 2PW1A 3OJMB 3ULUL 5MEND 4M62H 7FABH 2A1WL 5E6IA 5D1QA 3CJJA 1I8KB 3PJSA 1I9IL 1D5BA 2IAMC 4NM8L 1YEGH 3MXWL 2AV7A 3REWA 1DR9A 4N9GA 1MFEH 2Y1VA 3BN3B 5EZIH 2AXGB 1A5FL 2NLJA 3V8OA 4W6WB 3SDDC 3LCYA 3GRWH 1KCSH 4Z0XA 3HPLA 4LU5L 5EA0H 5C0RH 3RKPA 2BNRB 2Z92A 3L1OH 2PXYA 4S1DC 1X5AA 1RFDH 2XZCL 4ZTPL 3PP4L 2DQTH 2H32A 4DUXA 4CU7A 4Y5YC 4OZIE 2DOCA 2V5RA 1ACYH 3RY5A 4DQOL 2BY3A 2EDOA 2O5ZH 4XH2A 5F88B 1ZS8A 1RZKL 4UUJA 2XNAA 5EUKB 2FHCA 2CDFA 4ELKA 4OLWL 3VXMD 2MQ0A 4K3DH 5C0BE 3ZDZE 1UZ8B 3NIGF 3QJHB 3QUMB 4OQTH 1FCGA 2I07A 3OKDB 4Q2ZA 4TTGA 3T0XA 2C3GA 1CFTA 4WEBH 2FGWH 4P5TD 4KPHH 5HHOD 4K94H 4TRPH 1AC0A 3DYOA 1FV1B 1QBMH 1MLBA 3KDMA 3HAEB 3VXNB 5GS1B 2NY5H 5IQ9A 4F57L 3TZVB 4ZXBA 1BGXH 5I1IL 1KTLB 4OD2B 1C5CL 4GXVH 1NKRA 1GZPA 2PYEB 1SQ2N 3QUMA 4RMWA 2HT2D 5D2LA 1GGYA 1FAIH 4LDLB 2A9ML 4WRLA 3CCHA 3IF1A 1QR4A 5CEYA 2NXZB 1MVUB 4HGMA 2VAAA 1JCKA 4CNIA 5DTFA 2EDFA 4DW2H 3B9VA 1Q94B 4M00A 1CD0A 3GI8H 1OAYH 1VDGA 4M93B 3ZKMD 1DZBA 1B6DA 2CMRH 4K9EL 4GKZB 4MVBC 5TPWH 2CLVB 4Z7WF 1EO7A 2IBGA 3SEPA 2IALA 2JJTC 3U46A 4JZNA 4JM2D 2QKIA 2G5BB 2RFXB 4Z7NF 5LXGL 2X40A 1MJ7L 3S37H 4TVPE 5BVJB 3Q2CA 5HHNA 3SKNA 3VXSA 4NZJA 4AL8H 1YN7B 3QH3A 2C1OB 3LRHA 4Y2OA 4J3SA 1ETZA 4PY8J 3MJ8A 5DRWA 2VDLH 4K3EL 4PR5B 3SJVE 4LSSH 5HD8C 3JV6A 3JTSB 5IFHL 1WGOA 3L95A 1N8ZB 3RQ3A 1A6VL 1CICB 2CXKA 1WC7A 1G1YA 3VG0L 1S7SB 5GGRB 1LO2H 1YY8A 5D1XD 1JTOA 2VXUH 3FN0H 5HPMA 5B8CB 1AFVL 4ZD3H 3OMZA 3IF1B 3DBXB 5FHBL 5IKCA 5DJAA 5DJZB 5D9SB 3VW3L 2Y07H 3O45B 1XGTA 3MLPA 1XGUB 1TZHB 2KQNA 1TJIL 5FDWB 1EZVY 1GC1L 2OL3A 1RURH 1AHWC 4TSAH 3GMMB 1DTUA 5T1MB 1JZ5A 4GKSA 3CVHA 4HJJH 2YUVA 3GMPB 1J1OL 4EXKA 3L3GA 4UT9H 6CGTA 4PRHE 4H88L 1KEGH 1QUNA 4HKBA 2J88L 1VFBB 2X4UB 3ZDYF 5JW4N 1UWXH 1YJDH 4ERSH 1KOAA 3G08A 4IRJB 5EB9A 2E6JA 5C0BB 4P49A 2DQDL 3S88L 5C9JB 2VDNH 5IM7A 1LE9A 4OV6F 1IEBA 1NGXA 2GFBA 3MRIB 1Y6NR 1DP0A 1AR1D 3MLYH 1RIVH 4MAYB 4POUB 4TYUA 1JHLL 1N64L 1AHWB 4PJFE 4PV9A 1AJ7L 1G6VK 4Y5YB 4UT7L 2B1AH 4WI4A 1Q8MA 3IS1X 3LDBC 3S3PA 3LKNA 5J0BA 2AJ3A 4WHTB 4CU8A 1CFSA 3H3KA 4QF1A 5GRXG 1A1OA 4YHKH 43C9B 4MD4B 1DQTA 5AAMA 2EKJA 5BOZG 2R39A 1HYSC 2HFEB 1FYTB 3HE6C 2VAJA 2BOCB 4WFFE 2J6EH 3G6AB 3KG5A 1QKZL 4J6RL 1SYVA 2BHZA 4O00A 3HI6H 2XACC 2Z31B 4OLZH 1QBLH 3BE1L 2J6EL 4JM4L 3PWPB 1YY9C 1CD1B 5MERA 4PR5A 3O2VH 3PWJB 5AEAA 3W82A 3E8UL 3P11L 1DQQB 1UZ6F 3SQBA 3WV0A 2GAZB 1RZFH 3K46A 2NY2D 3UTTD 1EAJA 3EOYG 4YDLC 3G6JB 3WFEH 2Y5TA 3RDTA 4ZPTA 5C2UB 1BVZA 2J3SA 4F3FA 5E8OB 1FYTA 2YWZA 4PJ5D 2PO6B 1BM3H 1JMXA 4UINH 2E7BA 1TVBA 4P2OD 1MCOL 2H26A 5ICZB 1EK3A 1HEZB 3M45A 3TNNA 4QHKI 1OP3K 5EZJA 3AGVA 1IKFL 1C08B 3BGMA 5EU6D 3ULUE 3WIFA 2XQBH 2Y36L 1HSBA 2F15A 1OSPH 4RDQG 5CJOH 3V6ZA 5LGKA 4NN6B 4HUXB 1A6ZB 4DWHA 1E4KC 1L0YA 4F2MA 2YD4A 4QTHB 3BPNB 3EJYD 3MUY1 3PE9A 5L2KA 1O7SA 2Z93B 3JTTB 2PCPB 1NGZA 3VWJA 1N5AB 5K9OA 5FCUH 2ADFL 1G9ML 1J1PL 1MREL 4OD3L 3G9VA 5JIPA 2E9BA 3PG2A 1FAIL 5L9DL 2XZQL 1RZ7L 3SKJL 5K9JH 1EEYA 3UJIH 4OZGE 1IAII 2X4NB 5KANI 4HLZG 5T5FH 4EI5A 4U05A 4L1DA 4KVNL 3HI5H 5HHOB 3WS3B 2I9LB 2QHRH 2LTQC 4MQSB 4Z0BH 3TO4A 3V52L 1CL7I 1R5VB 4LPTA 4KTDL 1A5FH 1NDMA 5SWSD 3LKOB 1CG9B 5JTWA 5CGYD 4TSCL 2HLAA 4N0FA 1FLRH 1S9XA 3A6OA 3QPXH 1WCQA 4R7NA 3IFPA 3DETC 1KJ2L 4P4RA 4Y2DA 3FOLB 3O3DB 3FONB 4MVBD 1NAML 5AZEL 4MDIB 1JRHL 2F54D 3WFHA 2EC8A 5J9PB 3X13A 4HULB 3FZUC 3R0NA 2X9WA 2JCCE 1BBDH 1JTPA 3O9WA 2MNUA 4HIXH 4BZ2L 1UCTA 1OARL 5EOQH 1H3PL 4HIXL 1WBYA 2ITDA 2BNUB 4H8WC 3M1BA 1CE6A 1RIUH 3G04B 1DDHB 5HYSG 1SEQH 3WS6C 5J6GB 1ZA3B 3BPLC 3SDYH 1NQBA 4UB0L 4E41A 4OI7A 3VCLA 4PJEF 2B1HH 2YBRB 3TBVB 2YA2A 4B50A 3VFPA 4LSQH 4Q9QL 3M17A 1L4IA 1V8HA 1GZQA 4XCCH 2VXQH 4Z78B 3EO1B 4PGBB 5KSBE 4OGXH 5CILL 3HZMB 4HV8B 4YHOH 4PV8A 1CE6B 3GSOA 4OLYH 2W91A 4L3EB 2A9MH 2J4WL 1P7KB 2BVEA 1R3KA 4XHQA 2A9NH 3WHXB 1DVFD 5B38A 4H88H 1KEGL 1U8KA 3D85A 4QRQB 2ADIA 5DQJA 3OZ9L 4BM7A 1XR8A 1YQ2A 2EXWD 4JY4A 4LF3B 5L2JB 4PTTA 2GTZA 3DURA 5HDBE 1CXKA 4GBXA 4CN6A 4U1SA 3TT1H 2ZCKH 3V6OC 3LY6A 2J8UA 1KTDB 1AO7B 4ZFZA 1LO2L 2Q7YA 4OJFL 3MRNA 5CAYB 3BW9A 5E9DD 4GOSA 4HCRA 3C9NA 3ARRA 1T1XB 1RIVL 3VFSA 1A0QL 2X1QA 3Q3GB 1FYTD 5D7LE 1G7MA 1QNZL 4KJYA 2D0GA 4XCYB 3FKUS 4P4KD 4BQ8A 1P4BL 2EE6A 4Q9RL 4G42B 3BKJL 3SO3C 3KNBB 4I8DA 4FFVC 3IXAB 4R96A 3TC9A 4E0RA 4MJ6A 3F7VA 5C08B 3FN3A 4XNZC 1DUYB 3O6FA 1T3FA 3F7QA 4B7IA 1KB5H 3QEQA 2H2PD 3PL6B 3BT2L 1J18A 1MHEB 3NTCH 3CFBA 4S1SL 3JBG7 5FYLD 1OVZA 1YMMD 2X9XA 2EDHA 2VE6A 2OYPA 5DUPL 4UV4L 4ZFOL 4L1HA 4XCYA 2W0PA 3K8LA 2YKLH 1RPQA 3KPRA 4U3HA 3RPIB 5DHYA 3D39A 1E4KA 3RGVB 3ARED 2BC4A 3DRQA 5IROC 2W92A 4LGRB 5D2LF 4P2RB 4YWGH 4GG6F 2RHEA 2ILLA 1HH9A 3Q5YA 3HC0B 4QRPA 4HXAH 4M6NH 3CC5B 4B5EA 2NX5D 3RP1A 4JZJB 4Q74A 2DRUA 3WBDA 1VFAB 2FJFB 5CLTA 5HGBA 1KB5L 4Q2ZB 5IMMA 3NFPA 3BKCH 1EVTC 4JVWA 3JWDL 4HQQH 5T1LA 4CNIB 1KCRH 2AJUH 2J1KA 3V5KB 5BS0D 5B38B 2EXYC 5ANMA 5F93C 3PWLB 2PYFB 3DX9B 4G9DB 1VGEL 1PYWB 3NFSH 4CN1A 5IQ7L 4NZUL 3QCTL 5AWNL 1CLZL 2NR6C 3MRKA 1G9MH 3IVKB 4M1DH 1TJGL 5HYJB 3IFLH 3U4BL 1FL5A 5CKAA 1ZSDA 1T03L 5HI4C 5DJCB 4FQXC 3VG9B 4C83A 3LVEA 3EJJX 4NRZB 2V5SA 2W9DL 5CFHA 3TIEA 3TN0A 5H35A 4ORZC 2YUZA 3QUZA 3GSNH 4N8VA 4LQFH 5DVMA 4PBXA 4DW2L 4Z0XB 4MJ2A 1WBXA 5F3HA 4PJ5B 1JWMA 3GDBA 4N8VG 3MRQA 4WWKC 3PXJA 3BHBA 4G8EB 1E4XI 3UPRB 2D4FA 2NPLX 4DGIH 3WSQH 5EC1B 4G6JL 2BHUA 1YYLH 3GZKA 4N8PA 3F7VB 2OL3L 3L6FA 4LU5H 3UAJD 5IQ7H 2G2RA 4WHDA 4QRTB 2R4SH 5KG9A 3CDGB 3EYSL 5L7XL 1N4XH 1PKQA 1RZ8B 1I7ZA 3LPFA 1A7OL 2E8YA 3I02B 1GGBL 5TDPA 1GGIH 1JF1A 3MGOA 2BNRA 2Z92B 4WWID 4HJGA 4NQSB 4NRZA 3UROR 4UTBL 5D7LB 1CF8L 3BI9X 3MV8A 3CDCA 3MACL 1LK3H 4HW6A 3MXWH 2XN9D 4OQTL 1OWRM 2YK1L 1T2QH 4OLUL 4XB7A 3HE6A 3QXUA 1X5ZA 4BSVA 5EUOB 1KTKE 1HHJA 1JPGA 5F1OB 2EE3A 4LVOC 1ORQA 4HC1L 1DN0A 4DAGH 4KHTL 4QOKE 5FAAA 4WHCA 3LRGA 1G6RB 4DAGL 4R4BA 2FHBA 3QUXC 3QWRD 4FQQA 4Y4FA 4R4ND 2B39A 2ESVE 3KPLB 4FQLL 1JF1B 3QEQE 3UC0H 5ID1A 2BSED 5I9QC 4G9FA 1FVCA 5IIEB 1U92B 5DK3A 4NDMA 3RWEB 1F6LL 1YEFH 2FLBT 3GIZL 3NIFE 4V2BA 1FQ9C 1MCCA 4YZFF 5FYJH 4WI5A 5IBUG 2EIBA 1WWAX 1QLFA 2JCCB 4DKEL 1AY1L 1IAOB 1NMCC 5TDOA 4K7FA 4ISVB 5E08L 3CK0L 3GSNB 4XX1G 3ULVH 1FVDA 3P0YL 4OBSA 4P59L 4JB9H 5FK9B 5CP7A 3QFJB 4HGKC 1Y0LB 4NQXB 2DLHA 3C6LD 4D3CL 2FBOJ 4HJGB 4NQSA 1NLDH 4X6FB 4G8IA 2C3VA 3SDCB 4TNVK 4OB5L 1HNFA 4ZS7L 2A83B 4OIBA 5CZXC 2APTA 4POZD 3PP3K 2Q20A 1JYWA 4AEHL 3MLZH 1ZLUH 4OFYD 3CMOH 4OLYL 4XP4H 4FQCH 2PO6D 3ARDC 4JKKA 4ZUSB 2VR9A 3HRZA 4D9RD 4QT5A 3JXAA 2BOCA 5ALCH 1I9RH 4J12A 4WFEE 3HPJA 4Y16D 1BFSA 2FR4A 5CINH 4KRPB 3SDAC 1WICA 4JANB 3SDYL 1GJIA 1MWAA 3FL7A 1NANI 4F9PA 4GW1A 3LPGA 1AIFA 5DO2D 3L3GB 4I2XA 4XXCA 3VE0B 5HHOA 1LHZA 1A6ZA 1T5WB 2BRRH 4NZTH 1JPTH 4JO1L 3BX7C 1MJ7H 4BH8B 3BGFB 2YPLB 3QA3B 3VW3H 3T0DA 4OT1L 3QRFM 2R0WL 3FB7B 4Y2DD 1NC4B 4KKBD 1DQJB 4L4TE 5DD0H 1YDPB 2O5XH 5T1KD 4LEOB 1Q0YH 2XWBA 3IYLW 4RSVA 4XMPL 3O8XD 2YRPA 2H26B 2Q76A 5ICZA 1I8MB 4I18C 2ICEA 2QQQA 1I85A 5E03A 5C1MB 1VHPA 3TBSA 2QQKH 3G08B 2R2EA 4IRJA 1M1SA 1EX0A 4LPYA 1DANU 5EBLB 3SDAB 1MFEL 5FO7B 3FB7A 3VGEA 5I18L 4PRIE 4ONFL 3D3VB 3VFTB 1RZGB 5EZJB 2HFGL 5CEZL 4XWGL 1RHHB 2X70A 4ODHL 4EN3B 3NOIA 4WWKA 1A22B 2RGSA 1M05A 2EXYD 1E4JA 4TPRH 3GRWA 1Z3GH 4NYLA 2LU7A 3EYFA 3TVMD 1BFVH 4PRDA 5E8DH 1IILE 1J8HB 4KVNH 2AEQL 1VKXB 4XTRC 1CQKA 5J9PA 1MCPH 1UADC 4KY1L 4WV1C 2HJKB 4JREB 2Y7QA 2PYEE 5CZKA 1H3GA 1R24B 5JW4Q 2AJZB 5ESQA 5F97E 4FXGA 5TQ0L 3C5ZD 2CLRB 3QDMB 1BLNB 2DS4A 3DUHA 5TQ0H 1ORSA 2NX5B 3V6BR 4F9LA 1A1OB 2Q8BH 5FB8A 5L2KE 3TNMA 4PJGF 4OV5B 3N1FC 3KHOA 5IJVA 2JB6A 1S9XB 4CUCA 2KQMA 2IEPA 1RUQL 4NZDA 1CGWA 3VFRA 3CH8A 1XGQA 1BFVL 4ODVL 1TIUA 4ZOCA 5C71A 3S3JA 2ZKHH 1FFOA 1JWUA 1F4XH 4HXAL 4M6NL 3GSNL 5F9DC 1PEZA 5IBLD 1AGFB 1TQBB 1VACA 1DVFB 5J13B 4QHUA 2FX7H 3MNWB 4K3DL 4E41B 5E8OA 2DLTA 1CDCA 2B8OT 1QBLL 2JJTA 3CPLB 3CXDL 1L6ZA 5JHDA 1FGNH 3B3IA 3RWHB 1VGKA 3IDNB 1P6FA 1OQXA 1Y18A 2DICA 3PWJA 2X4SB 4G80A 5DO2C 3QUZC 1QFWM 4ONGH 3PQYA 1AXTL 3HZMA 4ZAKC 1GAFL 4WUUD 3DMMC 1IL1B 1BJ1H 5HVGB 1GZQB 4OZGA 1FZKB 2IPKB 3K2MC 3D39D 1KG0B 5DC9B 5K9KB 2DYPB 3NN8A 5E1HB 1MRFH 3C08L 1OLLA 2H2SC 2EYSB 4XVJH 4QY8A 1BAFH 1EHNA 2OTUA 1UACH 2EE2A 4XAWL 4R0LA 2KL6A 1NGQL 2FNBA 2Q8AL 5MEQA 4U4BA 1JPST 1HOCB 3ARDA 3MRNB 1T3FB 3K8KA 1INQA 5K59F 1BFTA 3HUJA 2OJZH 3RHWF 3WKMH 2HJKA 1KC5L 2DM4A 1WBZA 4QOKB 2YPVH 3VXME 1VSCA 2YZ8A 4ZO9A 5L7XH 1RK1B 2XY1A 1K4DB 3KAAA 3KPMB 4DN3H 2R4RL 2E27H 1QRNA 3A6BH 4UNTA 3ZMRA 1CBVH 4OCSH 3Q3GA 1T7YA 4G6KL 4UNVA 4UBDD 5DD6A 3BO8A 3WNNA 3WL9A 4POZC 2UUDK 2EDWA 4Z0BL 4PJIA 1NFDE 1XGQB 5C3TA 3QNYB 4HFUH 1T0PB 4WO4B 2UV3A 3B9AA 5GGQH 4PP2B 1CLOL 3ILPA 1OF2B 4PJGA 1AGEB 1MQ8A 4Z7VE 5FECA 2OJZL 4KDTC 3WD5L 3KS0J 1AQKH 4MA1B 1XF3B 3TA3D 5I1DB 4OJFH 3KYAA 5DD0L 1G9NH 3HUJE 3PDOA 1E4XH 2YA1A 3G04A 3HNVL 1YMHB 3VI3F 5BV7H 3U4AA 5FGBA 3QDGE 3L5HA 4NQEE 1NANH 2DKMA 3TBYB 5LGHL 1X4XA 4NGHL 1ONQB 1JK8B 2QQNH 5C07E 5I1GL 4EEEA 4OSUL 3PUCA 1X6LA 5CJBA 2VABB 3ZL4L 1W72H 2FATH 4RAHA 4PP1C 3BP5B 4I0PA 5DC4B 3BD5A 3B9KC 2VLRE 1MAML 2IH1A 4GKNB 3WDHA 4N8VB 1ZEAH 4GUPB 3NZHH 1FFNB 5F44A 4P2YA 4Q0XH 1DEEB 4NKIH 3AMKA 4XC1H 4NQDD 2CDGB 5A16A 1UT9A 2D03H 2P24A 5MENE 1MIEL 1M7DB 5HDBF 2CRZA 3FN9A 1G9EA 4NO2A 1GC1H 4U1SB 4HUWB 2ADGB 1DUYA 3O6FB 5E70A 2K7PA 5TF1H 4MJ6B 4NP4H 4LRNL 1N2RA 3BP5A 2Y23A 4L4VA 4EUPA 4YNYA 4XNMA 1M6OB 5A43C 4WV1A 2PW1B 4GG8B 1II4E 1FNGB 1C7TA 5CIPA 3Q6GH 5F1IA 4WO4C 2CQVA 3MOAL 3G5YA 4KZDL 1QSED 4PJ8D 4Y19A 4K9EC 4G6JH 2AGJH 3B9DA 4S1QH 4B53A 5I1CH 2BRRL 2VZOA 5SX4H 2J8UB 1EFXD 5BCAA 4U6TA 3MXVH 2WP3T 4WUUE 4KKCD 5KANG 3NGBB 1HZHH 2XA8L 3K4DA 4G8GE 2UY7A 5KN5A 3ARPA 3FT2B 3T3PE 1TPXC 2AEPH 2QBWA 4O58L 4QRQA 4PJXE 2EDYA 2FEDC 2I26N 2ICWI 3HMXL 5CIPB 3MV7B 2EDEA 1IMHC 1HWGB 2WMPA 1ZA6A 3TFKC 1UYWH 4X0KA 5SWZE 3DVFA 4ZSOB 2GW5A 4TSBL 4UUJB 5J7CC 3HR5B 4OZFG 5ISZB 5C08A 5J1TC 2XKUA 2XPGB 2YMXH 4OM0H 1RUPL 2MMXA 2Q8BL 3HC0A 4QRPB 5FA3B 3NCMA 1A9BB 2A38A 4WI9A 1UXSA 5FF6B 3V6FA 3VJ6B 3H6JA 5D7JA 5LQBH 3KDMB 3CFIC 3UPRA 4JKLA 4ZAKA 5DHVH 4G7YL 4M7LH 3T2NL 4NNYB 4YEFA 4NOFA 1LO4H 4ORGA 1Z9SA 3QUZB 3X3FH 5E8DL 2WINB 4GLRI 2HVKA 4AJ0A 5I8OL 2OXHA 1MCOH 1S7SA 1KELH 1EV2E 3WS6A 3MLRH 4IRJD 3PWUA 3RTQB 3CAFA 4M9PA 2ZUTA 3T1WA 1QA9A 3VU2A 1TZGH 1LP9B 3O4LD 3OF6D 2R15A 5EU5A 5H8DA 1KXQE 2ZJSL 3CDYA 1TZGL 2C3XA 2YZ1A 3GB7B 4NQXA 5DI8B 5ABDE 1JHKH 2CO7B 1NUFA 4O4YL 4QKXB 5ANMB 1FVDB 4Z76B 2JCCF 4RISH 3TIDB 4WWKD 1PQZB 2R0LH 4G8GD 4YQXL 1MCRA 1MCFA 5E9DB 1MJUH 2DKUA 3DPBA 4OD2A 4DN4L 4P46B 2ENSA 2OZ4L 5DHVB 3MGTA 4XP4L 2G60H 1CQYA 4KJWD 5EIIA 5IVZA 3W2DL 3GI8L 1UACL 4HHAA 4KTDH 2FR4B 2CKBB 3KPQB 4XNQB 3PWLA 4XCFL 4YGVB 4HUKB 3KPLA 3IETA 5MI0B 1HQRA 4K3JH 3KPTA 5KSAA 2EH7L 4IJ3C 4MD0B 2DTMH 4JFEE 1CFNB 4PJXA 1AFVH 4FG6D 3ESVF 5GGRA 3LOWA 3DHMA 1R0AL 1DUZA 4JFPB 1CICA 3P4MA 4PPTA 4P2QB 4JHBA 4CAGA 2XWBB 2KZ1B 3CX5K 1KPVB 3TJEH 2X1OA 3BOVA 4NHUA 1KJMB 4Z7UB 4I9WD 1PG7X 3MUGB 1RI8A 2FECL 2FSEB 4K3EH 5CP7B 3ETBF 3N50A 4JZOB 1C5DB 5DC0A 1J1OH 4XPFL 4LSRL 5AUMB 4APQD 4XXDA 4Z7OE 2SEBA 4OF8A 3P73A 4FFWC 2QLVB 5FXCH 4FQIH 4P23D 2HG5B 4Y5XA 5KG9B 2B1HL 1DLFL 1KYOJ 5DHXB 2FH8A 4G6AD 4P2RE 1ZANH 1V05A 1F5WA 5FM5O 4P46C 5FGSA 3MV9E 5BS0B 2IQ9H 3CX2A 4YHIA 3BSZH 4R26H 1D5XA 1QO3B 2W65A 5GS2D 1U6AH 4XXDB 2WUBH 3LKPA 3VXOB 3L7FA 1RZKC 3OJDB 3VXRE 4RZCA 5HGHB 4DGYH 4KK6C 3U7YL 1QSVA 4X6FA 5HHMD 3CFCH 3TJHC 5AAWA 4TTDD 3MCKA 2IPTL 1S7XB 1F45A 1HHJB 3GIVA 5ECJE 3AM8C 3HC3L 1ULVA 3WCYA 1WZMA 1ZOXA 1T6VN 4BH8A 1T89A 1CT8B 4WI7A 5DJYB 4GAGH 4Q0XL 1JGDA 1JNHB 1EHLH 2HT3D 1J8KA 1G9NC 1NLDL 2BSTB 2XI9A 3GJFK 2Y6SD 1JHLH 5F1SA 5HHME 4F7EA 3ECBB 1RAMA 1K8IA 1U36A 4G3YL 3M8OH 5DEFB 3U79A 2R1YB 1BWMA 1N8ZA 3WO4C 3QEGL 1XGYH 5J11C 4ODSL 1L0XA 1ZHLB 2EO9A 3MUZ1 1CD1A 4AQ1B 4RX4A 5ITBL 4TUOB 4PJAE 4MD5B 1CTOA 1B0GB 3RNKA 4CVXB 4NM4L 5ELIA 1P84J 1MFAH 2A0LD 3MLWL 2X4RB 4XVUC 4LMQE 5JNYB 2AKRA 1AH1A 5A2IH 4MB4A 1A6UH 1HXYA 3LN5A 5JZ7C 1MY7A 1MFCL 5DUBB 4DOHE 3C09C 4LNRA 2JTDA 4OT1H 3V5HB 1T0NB 3ULVF 4G8GA 1KLUA 2PW2B 5FYJE 1WQVT 4ZDHB 3GSVA 1Q72H 4AMKL 2IPUK 2HMIC 1B6UA 4G80B 3BZDA 3BDYH 3IU3B 2M26A 3ZKXC 3RVTC 4MA3A 4OCWL 1EVUA 4NM8H 4X7DC 2CRIA 3FT4B 2J5LB 5I1EL 1G6RL 2QJDA 5GS3A 3V79C 1KJVA 1V7NH 2V2WA 2X1XR 3MLUH 2W0FA 5E2VL 1BZ9B 1JI1A 1IAIH 3CH1A 2FBJH 1LMKA 3LH2L 1JHKL 5BXFA 4WNQA 1LO0H 1RUPH 4HEPG 2BERA 4ZTPH 3VXQB 2AJ3B 2X7LB 4WHTA 2CRYA 1IGML 3SY0B 1T1YB 4XWOC 2GHWB 4N1HB 5EORL 1JUFB 2NY3D 2VDMH 1B9ZA 2VKXA 3BPCB 4CVXA 3EGSB 4LCIL 3L3OA 4PRNA 3KPRD 2VDQL 3HI1A 4U1NB 3SE9L 5CMAA 4DK6A 1JFQH 1S5IH 2R56H 1MRFL 2YUWA 3TNMB 8FABA 5BRZD 1A4JB 1TVBB 3LIZL 1Y18B 4HG4K 1D6EB 4MB3A 4OAWB 3AU1A 1ZGLP 4NBYB 2EECA 3MACH 4AIZB 2BJMH 4PJDA 1NCWL 3UTZA 3WFHB 4GXUM 3MA9H 3G6JA 3ES6B 3LH2H 3FO0L 1S9VA 1SMAA 4J3WA 1XF3A 3G5ZB 3P4NB 2C7UA 1SBBA 1LWRA 5C0BD 3VXQA 1S9WB 2NY2C 1FVEB 3VXUA 3WFDL 4N0FB 3QQ3B 2VC2H 4ENEC 5GRJH 1IC5L 4JG1L 1MNUH 2X1PA 2WIIA 5EBWB 4OIAA 2NCMA 1A8JH 3MLZL 3EDKA 4JHWH 5BO1H 1G7LB 1KGCD 3MRGB 2VNCA 4KHXL 5CJ8A 4XGZB 5KVEL 3Q1SH 2VL5B 3DNKA 5IESH 4HGWB 4BYHA 3FQWA 1MUJA 1QR1A 4YUEH 4EUPB 1MCNA 4IIQA 4GSDH 2CLRA 3F7PC 3PL6A 5K9QI 3L3IA 1BQUA 3MA9L 5A2FA 5HGGS 3S6CA 1DBMH 4KI5F 2ADIB 3U9UA 2OR9L 3V0VB 3VD9A 1NGPL 4FRWA 4LLDA 1LO5A 3VFWB 5EOTA 3ZTNH 4HBCL 3DYPA 2NY3B 2P24B 5KTEL 4KK8D 4OZHB 3SOBL 1WCBB 4F7TA 5EO9B 2QADC 1BIHA 4NZTL 5HPOA 1D9KD 5JHDB 2IADA 5I16B 4FQLH 3STZB 4FABL 3IJYA 4AENA 3O6FC 5E8PB 1R5VA 1E27B 4GRLD 4PLKD 4G6KH 1QYGL 3SQOL 3D9AL 1T1YA 1QRNE 4JQIH 2OTWB 1KEMH 1EO5A 4ZFZB 3BKML 4P5TB 5IWLC 1NMAL 2LFGA 3SKUD 7CGTA 1V3KA 1IQWH 2ADJB 4LCCA 4XPHH 3UMTA 2NW2A 4KV5F 1NGPH 2J12B 1UWXK 5E8PA 3IDNA 2E9JA 3KPSA 4JFXB 2VWEE 4YDVB 5EUKA 3MLSL 2VH5H 4GG6E 3F5WB 4X6BB 4XCNB 5GSRB 5F88A 2OK0H 3D6GA 3ULVD 2Y07L 3B5HA 2OQJA 4UDUA 4Z7WA 4YX2L 1XF5B 25C8L 1JIBA 4IOIB 5I73B 3OPZL 4O51A 1SYSA 4HIJA 2AXHA 3DI3B 3EDJA 2AS5M 1U95B 2EYRA 1K3IA 1W72L 5LGJB 2IAND 5IB4B 4K94C 5ENWA 4DCQB 5KSBF 5GZOD 5E24E 4QWWD 4HDIB 4N9GB 4NKOB 3RWCB 1F4YH 3MLWH 2ZUXA 4X7SL 1IARB 2CIIA 3ZE1F 4GG6A 4MJIE 5D7KD 3MO1B 1A3LL 2Q7YB 4EI5B 1U95A 2EYRB 5E2UH 4GRLB 2A0LC 1A9BA 3QWOA 5IVXB 4OF6A 1QA9B 2VDNL 3IDMB 4KRMB 4M02A 3MRCB 4ZUUA 4HLJA 4YPGB 2LU4A 4WUUA 4NSKB 4L4VB 1PX3A 4IOIA 4M1GH 3B9KD 2N1KA 4NRXB 3K0WA 3V5KA 3IS0X 4JN1L 2OJEA 2VLRB 5JIIA 1G7IA 3BN9D 2X4QB 3C6SA 3V5DA 2H32B 1SJVA 2HVKB 3UTPE 5C0ND 4PRPE 1NBQA 5F7UA 4OFYA 4U6XA 1JPFA 4KZEL 5DFVC 4JFXA 4L8DB 1HNGA 1OAXH 5KVGH 1CLYH 5F9OH 3BPLB 4O9HH 5LKNA 1DBAH 5J3HD 2BVOB 3AS3A 4J6RH 3TBTA 3LD8C 1H3UA 2A73A 5HYJD 3O3EB 1VFUA 4ZXBD 1FPTL 5JW4R 3OJ2C 3D0VA 2BNRE 5I19H 2VLRA 4UT7H 1D9KC 5ACZA 1J0JA 3T65A 2R0LL 2ZSWB 1S7VB 5FA4A 4PJBA 4HZLB 4QRTA 4HHAB 2IGFL 2XNAB 3O3EA 2EEBA 4ZPVA 4EZMA 1TQCC 5F6IB 5KVGL 5DRXB 3KVQA 3MRBB 4K7PY 4XNMB 3MV9A 3SGEH 5FYJD 2CUMA 2J8UE 3NA9L 4RFOL 3QNXA 1VA9A 1P4LA 4OF7A 2ED8A 3L3KA 3EZJB 4I0PD 4JVPA 1RMFH 5C0FB 2F54E 4ZO7A 3RX5A 3T3ME 1EO8L 1YEEH 3DRTA 3UTSA 1S9YB 2VUOA 1CLZH 2VXTL 3MA7A 3VRIA 2NY0D 1HQ4A 5IB3B 1KJ3H 1HZHL 1U3HA 1W2KT 2XA8H 4MA7L 3ARFA 4MQXC 3G5XA 1WF5A 5D93C 1HINL 3V95A 1A64A 2D4DA 2GT9B 4CVUA 1CF8H 4R97B 1F4XL 3FQUA 1ETZB 1IJ9A 2X41A 2PF6A 1IM3B 3I3EA 4FNLH 4CJ1A 1D5ZA 1I7TB 4FP8H 4NQEB 1G7MB 2R1WB 2H6PA 3MROB 4I4WB 4KPHL 4ZTOL 4LCWA 3SE4C 2OL3H 1LO0L 2J5LC 2IMMA 4R2GB 4XP1L 3UTSB 3DV6A 1MI5B 4HMDA 3IJHA 4X4XB 4V1DA 5FCUL 2FO4A 3MGTB 3WO3B 4C83B 5DWUH 2X4RA 1XGTB 4LP4A 2OP4H 4KK8C 4RQQB 5CD3A 4UOJA 5GRUL 3O0RL 4MNQD 5DMIH 1IAKA 4PJAF 2D0FA 1OT2A 1DUZB 1TVDA 4UOW1 4X83A 4CU6A 3FO1B 3O6FD 5ESAA 1JE6A 1KEML 3NFNA 4YDIH 5C0NC 4NT6B 5JPMB 5C0DB 4JKMA 1NGQH 1AR2A 4MCZA 3EO9L 5D1ZC 1ZKAA 4AY0A 1A14L 2FH6A 3C6LC 1ZK9A 3LN9A 1SEQL 1UA6L 3QQ4A 5C08D 5HJ3A 5BV7B 3LKSA 4UMGA 3ZDYE 5E99L 5C7XL 1S8DB 1QP1A 5A40E 3DIFB 3EYFB 3O2DL 4MNQE 4JQVA 3QAZB 5C0EB 4YBHA 1KIPA 3BZ4B 2VISB 1G9NL 1A4KA 1DL7L 2LQRA 5I15H 1FFQA 1FO0H 5SWSE 1M4KA 4NQEA 3MA7B 4KGLA 2E7CA 2P7TA 4UDTA 1YMME 3PGFH 1INEH 5DDHB 4UT9L 1CFSB 2IALB 3U46B 2XICA 4H20L 5J8OA 5F7DB 3OKMA 4KRPC 2GT9A 1KJ2A 2ORBL 2JB5L 1KJMA 2RB8A 3DV4A 4Z7UA 5FHAH 4D2NA 5HYJA 1A02N 1BVKB 4K3JL 1DLFH 3RX8A 4Q6IB 3Q5OA 1EHLL 2DIBA 3LEYH 3DLQR 4KROC 1NL0L 3O8XB 4KKBC 4Y2DC 4KI1A 2ESVB 2WWMD 1IEHA 1LNUB 4U1IA 5LAXA 1C1EL 4B0MM 4HFWA 1EAPA 3FFCE 3SE8L 4PJ5A 4JQXC 3OR6A 2XXMB 5E2WH 4L8CB 4APQC 2KBGA 1KV3A 4CMHB 1YY9D 2YPLA 3QA3A 4FFWD 4J3XA 1HDMB 1M05B 4NGHH 4RMSA 5E2TH 3SDCC 3KPQA 1QRND 4TULH 3IDIB 1I7RB 1XIWD 1NJ9B 1BQHG 1CT8A 2BMKA 4NQCB 4ODBD 5EU3B 3V7MA 4D0CB 1ODAA 5HVWA 4HWEH 1EBPA 4MJ5B 4H26A 2V7HB 4QYOA 4AEFA 1P53A 3O45A 1LNUA 4U1IB 4HQQL 1B2WH 3ECBA 3S5LG 2RAMA 2B4CL 2WIMA 4HT1L 5GHWL 5L2KB 4KKNA 1N3NB 4TTDC 2YA0A 1CE1L 3L3OB 4PRNB 4BZYA 5KS9B 4LMQI 5ISZD 5ESQB 1MI5E 5JHLH 5F7DA 1BM3L 4QHMB 4OBRA 4BSVB 4POYA 3U9UB 4L4VE 1R24A 2HJLB 4EI5D 2EZ0D 5IEHA 3IKKA 5D96C 1GC1C 5DSCA 3SGKC 2QQKL 3T2OA 5JLZB 3CFJB 3UEZA 4R3SA 4NO0D 5SWSA 3PWNA 2V6HA 3ALWA 1FZOA 1EERB 1NDMB 5IB5A 5E7FA 3HI6L 3QIUB 4QHLA 2YMXL 3BT2H 1BF8A 5IJKC 5DVNA 3MRDA 1FE8H 1YUHB 2AJUL 3RZCD 4XP6H 4HT1H 4OCMC 4I48A 4LLMA 4NKDB 3VXUB 4TUOA 3WFCH 4EN3A 4PUBL 5KBNC 4PJCE 4I0PC 4NCC2 4X6DF 4NQDA 1QEWA 2DI9A 4JPWL 4LGPB 5JO5B 4WCYL 3WE6A 3MYZA 4PJAB 1KIUA 2B1AL 2X4SA 3IDYB 3QHZH 3DO3A 3U0PB 1I1CA 4F15B 5J6HB 1LO4L 4NJ9L 2LAAA 2XG5A 3AXLA 4DN4H 5F6HJ 1JGVL 3RBSA 4X6CB 1JTTA 1WZ1L 1E28A 3HE7A 1YECH 1HHKA 2L0DA 4JLRB 3OAZK 4M8QA 1FHGA 5CMAB 4WWKB 1A7RL 5GRWA 2HKHL 3PQYB 1P5VA 1R3HA 1FE8L 2ZUWA 1QQDB 1FNLA 4KRPD 4AYFA 2K7QA 5EO1B 3ZKND 5KSVB 4MWFB 3O81A 4Y19D 5I1IH 5JR1H 1RZFL 4GQ9L 5IG7B 1CDYA 1DBKL 3L1OL 5I1JL 5HDQH 2DM7A 5DK0B 1H8NA 1FRGL 2NNAA 5I16A 3SKOA 2J4WH 3FFCB 5DRZA 1T1WA 4X5XA 1IGJA 1PAMA 3V0AC 3QWOB 3LIZH 3T0ED 2BXZA 1M7XA 5AG9A 3P2TA 1OAYL 2APBA 2PR4L 3KWWA 4EKXA 1NCWH 1RIUL 1DJSA 1NFDB 3NVQA 3LEXA 3P9MB 1DQJA 3D39B 2AJXL 4CW1B 1QSEB 4RIRB 3VFUB 3KPRB 4CJ0A 2OTUB 5C70A 3U9PL 1NH6A 5C7XH 2HT2C 3HLAB 1JPFB 4JDVB 4ETQB 4U1KB 4KMTL 4XGZA 3B5GA 1NAMA 3S37L 3O2WH 3R8QA 1FBIH 4HIJB 1P7HL 3O3UN 4AL8L 5IHZB 3L5WB 2OP4L 4C4KO 2QQNL 3S96A 2VIRB 4P2OB 2GIYA 3QPQC 4TQEL 1MCKA 4P2CG 2VYRE 4EI5C 3EIFA 1OAZL 3GI9H 2PYFA 4N0UE 3N06B 4KU1A 3JWNC 4E41E 4G43A 1NDGB 1H15B 1QD0A 2BVQB 1ACZA 1Z9OA 1ADQL 4NQVB 3D0VB 2JK5B 2A6DA 3LS5L 2O61A 4EI6B 4NKOA 3RWCA 4M3JA 4RWHA 1Z9LA 3UDWC 3LEYL 5FYKE 2A77L 4XB8A 4D3CH 4P5TA 4YLQT 4YE4H 2WV3A 3CVIL 1JN6B 1S78C 3HI1B 3FT2A 2BSRA 4JDTL 3WJLC 1KG0A 4W4OC 1U6AL 4JFZL 2X44D 3AREA 2CDEA 5I1HL 1FIGL 1PG7H 4JFZH 5GRVK 5I75B 2VLME 3P9MA 1KF9B 2EIZB 3MRMB 5JXED 4F37K 3U30B 3TF7C 3S3SA 3X11B 3BH9B 5JPNA 3W9DB 3WYRA 5DURD 5GRYA 3C6SB 3V5DB 1U8HB 1F4HA 3T04D 3H0TA 4KI5C 2NY7H 5F3BA 3SKOB 5C0GB 4HMEA 4PRHA 2QSCH 3GBMH 4S1RL 4JN2A 3VWKD 5IMMB 1FNGA 4S1RH 1LILA 2A6JB 1F11B 1M6OA 3TYFB 1WZKA 2AGJL 4S1QL 4TVSa 2XKSA 4NZUH 1U3YA 5AWNH 2A73B 2EEDA 1G7LA 3MRGA 1HXMA 5C8JA 1UH4A 2I5YL 1FJ1A 3GFUA 5DEZA 4N0YL 1MEXL 4MZ3A 5F1IB 1U3HB 1BREA 3NGBC 4CBPA 4C57C 3TN0D 1NFDF 5I74B 1WIUA 3REWB 1RJYB 3MBEB 5IV2A 1P9MC 3QI9C 3U7YH 4PJ8B 1T04B 3GMRA 1XEDA 4WU5B 4YNYB 4IHOB 4XWOD 3RIFF 3C8DA 2D0HA 3BUTA 3RA7L 3TPKA 4FTVB 1KUMA 2IH3A 4JM4H 4LCUB 4DK3A 4RFNC 1P5UA 2J2ZA 3S37X 2FL5A 1DBBL 3T09A 2A6KA 3D39E 3MFGB 5DGQA 1GGTA 3KPRE 1ONQA 1YPZA 2DQHH 1CE1H 1M7IB 1Q72L 4PS4L 2E7MA 4PJGE 2OTPA 4K7FB 4JG0L 5I66B 4YJZL 3M17B 5C09D 2W9DH 5HHPB 2OMBA 2CKBA 4XNQA 4OUOA 2AI0L 2FD6L 5D72H 3O6LL 1L7TH 4OLWH 4JFFB 3E3QE 5JQHC 4C4KT 1WFTA 3GMLB 3W81A 3CZFB 3HE6B 1MHPL 2OL3B 1IAIL 3RUGE 4BQ6A 5GS2H 1Y6KR 2H45A 5JPMA 3T4AB 1MF2L 3P40A 4GBXD 1I7TA 3GMOA 4OLZL 4JVUA 3UO1L 1ZAGA 1QSFE 1B4JL 4ZUSA 2WQRA 3PP4H 3BEWB 3RWFA 5IHBA 2FHFA 2DQIH 5E5MA 4ZUVA 5JW5B 4AK1A 2CH8A 4RQQA 1FZJA 3ZKNC 1NMBL 1S5IL 4PP2A 1Z3GL 4OKVA 4Y4HC 4L3ED 3KLHC 2ICES 5ETUA 3U6RB 2DQJH 3DX7B 1UZ6E 4ZNCD 2ZZUT 5F7KC 1XIWA 2CIIB 5T3XL 3QDAA 4XNUL 1A6WH 4NC1E 1J1XL 1FSKB 1KCUL 1U8PA 3DO7B 4I77H 5DYOA 4MXVF 3DIFA 12E8L 3P11H 5FA3A 1AGCB 5BQ7B 1B4JH 1EO8H 3PQYE 4NO5A 1OP9A 3MRBA 5EUOE 3ARBC 3RWGB 2ZJSH 3FQUB 3W11D 3VFOB 3VH8B 1RUML 1WAAA 2V17H 5D96B 5EPMB 5HYIA 4QRSB 1OWWA 3RVUD 3O2WL 5F7NC 2UYLB 5L6YL 1J10A 3MRQB 4X0KB 1CIDA 2GI7A 5ISZA 5EBLA 3SDAA 2ZKHL 2VDQH 4Y19E 3ARXA 3C08H 2FB4H 2V7NB 3MJGX 2BOBB 5BQ7A 4ZOAA 4JRXA 4OLUH 5A2KH 5I8CA 5EOQL 3LSOB 2BK8A 1A9EA 1LK3L 1ORQB 4FMFA 3MUGA 4KC3B 4ZMAT 2DI8A 3QPQD 3U9PH 3ISWA 5E6ZA 5DA0B 5TPWL 3VJ6A 3T0EB 4X99A 5F89B 3WXVH 3G6DL 1RUMH 2CLVA 2AJYL 4G9FB 1W72B 5BS0E 1EFXB 3WO4B 2R1YA 1F2QA 5MP6L 4LLUB 4TN9A 4WTZG 3PHSA 2D3VA 4MXQC 3TJEL 3P4OA 2ZG1A 1UKTA 5GRVL 1TCMA 1X9QA 3LZFH 4R0LC 1JNLH 1IQDB 2R69H 1FLTX 1FZMB 4NJAH 1DN0B 1SMOA 1N5AA 1IGYB 1PKQE 3QDMA 5K9OB 5DLML 3SO5A 3ZE0F 2ID5A 5C0AB 3OL2A 4IRJC 2AK4E 3MRFB 4XVTL 3EJYC 1XGUA 3FTGB 3QO1B 4J3TA 4P59H 5IW6B 3MTRA 2NY4D 4NWUL 1WIOA 4K71B 2DQDH 3S88H 1HHHB 1XGRB 2VQUA 2XA3A 3LQAC 1IZKA 5IF0B 2DMBA 4TUJB 5J06A 1VPOL 1U8PB 4OCXH 5HHMB 3ZKXB 4W6YB 2K9UA 5IB2A 4Z77B 3I9GH 5DFWH 5IHLB 5IGXL 2LABA 3FAXA 4QRRB 1UVQA 2WUBL 2F53A 3I75B 2XN9E 4Z7NE 4DZ8A 1IGYA 4BK5A 1BVLB 3SGKA 4LKXB 1VKXA 3I2CL 4OZ4B 1BVKA 5ALBL 3MRJA 4Z8FL 2R0KL 4OFKA 4YDJB 4EDXB 1CD8A 1DQML 3IXTA 4MDIA 1WAAE 4PBVC 4MHHG 2ORBH 1A7NH 2AXJA 3AY4C 1BOGB 3PWNB 5C09B 1CU4H 3T0WA 2APVA 5EU6B 4YHNA 5CJXC 2HFGH 4PRIB 4XC1L 35C8H 4FA8A 1TENA 1X5LA 2VQ1B 1EGJA 3S98A 4F2MB 1YEDA 1GSMA 5HHOE 1D9KA 3OX8B 2LVCA 4V2CB 4WI2A 5TGBA 1MFDH 5C0AD 3WS3A 5SV3A 1GYAA 5GS0L 3ZHLA 4H0GA 5I1AB 4R2GC 3EOTH 1QFUH 2H9GB 2EC9T 5J12C 3LKRA 3SDXE 3QXTA 5F9OL 2PUQT 3EYOA 3HE7C 3NA9H 3OJVC 2JJSA 1QLEL 1RV6X 3UZVB 3JTSA 4M93C 5BVPH 4JPVL 2PCPA 1ZWIB 1KCSL 3VWJB 5E8NA 5T5NG 2Z8WC 2HFFB 4OUUA 3SDCD 1T66D 5DGRA 4HF5H 3HC4L 3QIWA 1XIWC 3MLVL 3UX9B 4DZ8B 1BD2B 3QXDB 1MRDH 2VL5A 5MERB 3U4EA 2VL4A 2Z8RA 1GOGA 3FONA 3T2NH 4TOYL 3RVWC 1T0NA 5E2TL 4EIZC 1P84K 1LP9F 4R3SB 4TPRL 4M5ZL 3SCMA 4CDHA 4HPOL 4Z18A 1LO3H 1CGVA 4KY1H 1BEYH 2PO6A 1FFRA 5K9KA 1ZGLM 4FFZH 4HCRH 3LN4A 3UTQA 3WIIH 4G43B 2QSQA 3MODL 4Y16A 2EYTB 5SV4A 3SJVD 3BKCL 5FKPB 2HFFA 4OUUB 2W38A 4M7KH 1QACA 4RGNC 4AIZA 5I0DA 3MJ8B 5DRWB 3UPAA 1VGKB 1YMMA 2AK1H 1K3ZA 3ARDB 5IHZA 4RGMC 5C0GA 1RUQH 5M7QA 4ZODA 2C5DC 2AEPL 2E5EA 3ARBD 3IFOA 4KAQL 6FABL 2CLZA 3ULUD 3UJIL 3CSGA 4AEEA 1JFQL 3MNWA 5I76B 4JPKL 2BP3A 4NJ9H 2JIXD 1ROWA 2H2PC 4QRRE 2MQCA 4Y1AD 4PJCB 1C16B 3QNYA 3VFRB 5DMGD 4XNYH 3IU4L 5EULV 2P5WA 3SDDD 2DQEL 1UA6H 2XWTA 3WFCL 4OZHE 2V17L 1Q9WA 1TZIB 4LLDB 5JHDE 3CVIH 5ERWB 4L8BB 1KXTB 1S7UB 1QFHA 2IF7A 3EO0A 3X3GH 1ZT7A 4EVNA 3U2SB 2EIZA 2ZG2A 2J8UF 1CI5A 2HA1A 3RY6A 4O2EA 4LCCC 4ODWB 1ED3B 3TVMB 3WN5C 1S5HB 2BSRB 1I3UA 3TO2A 3RIAF 4DKDC 3SE3C 4P0DA 4OKDA 3VCLB 3BH8A 4KK5D 2PR4H 4NKMB 4WNQB 4Y19B 1A6AB 2QHRL 5GISH 3THMH 1HIML 4MQ7B 4P9HL 1J86A 4FNLL 4JKWA 4UV7H 1G7QB 3PV6A 4HFUL 2X89D 5GJTL 3K4ZA 3VGHA 2BNUA 4XCFH 3FB6B 2KKQA 3GGWA 2YD9A 4JR9L 3MOQA 3T8XB 4JO4H 3WDJA 4X9BA 3SDXB 3FFCD 4PLJC 2WK2A 1NLBH 1CLCA 3MJ6A 1VEOA 3WDIA 4L3AA 2OJEB 3O3BB 4Y4KC 3U0PA 4EN3D 2WAHA 1JGEA 2A6KB 4ZG1A 3I9GL 1T66C 1HE7A 3QIBB 4DN3L 5CS7A 5MP6H 4NO2B 1XF4A 3HR5A 3TVMA 3FMGL 4PTTB 4QRPE 4UDUB 4Z7WB 2BX5A 1AXSA 1P4BH 4Q9RH 3H9SD 4EDWL 3SKMA 2MPAH 1Z9MA 2ZOLA 4D8PB 2EEAA 5D7SL 4WU5A 3MZTA 5GISL 1C8PA 1IM9A 1IKNA 2X1WL 3ZKSD 1PG7W 5GS0D 2HLAB 5CINL 1G7QA 1WWWX 4OZIA 1GL4B 3NZHL 2VERN 3ULVC 4FQIL 1LE5A 3DSNA 4ZQKA 1ZLWK 2NY0B 4JM2C 4WW1B 4PG2A 4HZLA 1Q9KA 4UIKH 3CD4A 3H9HB 4JN2B 1FH5L 3ME0A 2E27L 2CD0A 3OG4B 3G6JE 4Z7QF 2GJZA 2DAVA 1FO0L 1HWHB 3OKYA 3CFKA 2QADB 1TZIA 1T7XA 4LIQH 4R4BB 2F58L 1OTTC 4N5UA 4FZ8H 5BRZB 2GCYB 1NGZB 2BY1A 3O9WD 5F7WC 1H8OA 1LDPL 1CGXA 2NXYC 2UYLA 3OWEA 2VZ1A 2IBZY 3DUSB 4JFFA 4R2GD 4EJ1C 2EDNA 5F3HB 1MFBH 1CFQB 5B3JF 4QY8B 2O93L 1F4WH 2MSPA 4OZGF 4OTXH 4S0TD 4LAQL 4PY7A 5KZCB 1RJYA 3PQYD 1RJCA 3I02A 1KPRA 4ISVA 5CJQH 2VWEC 1CL7L 1UWGL 1U8MA 3D0LA 1N64H 5DJ0B 3HMXA 3RPKA 5C6TL 4WUUB 3N85H 4QOKA 3UZQA 3QJFA 1UXSB 4NQVA 1IM3A 4HUUB 4JRYD 2FL5B 4OKVB 4PJXB 4Y8AA 1MHPH 5CJ5A 2DDQL 5ACZB 1V7NL 5DYOB 4ERSL 1A6WL 4X9IA 3MOAH 4HUNB 3N9GL 3DO7A 3QG6B 3S4SG 1F90H 2HTLC 3U0TB 1NCDH 4IMKC 3VFSB 1GCFA 3DWTA 3GSRA 5C0RL 1LD9A 4ZS6D 3KLSA 3SO3B 4PS4H 2RQ8A 2P8MA 2Z35B 1I8LC 3UBXA 1ITCA 4XTRD 1DQLL 1F4AA 5T1KA 1XGPB 3MX0A 3PXHA 3A6CL 5KW9H 4PRAA 4X98A 5FKAA 3VXNA 4PD4J 3VGBA 3CVHH 2P44B 3NACH 3FQTB 4FXLA 4MDJB 5ILTH 4IRZL 5HYQA 1FNFA 1UWEH 3VRJB 4YHLL 3PL6D 3KPOA 4XP5H 1ERNA 3QXWA 4L9LB 4NQUA 4PJBB 3CFBB 1MFAL 4PJEB 3QIUC 1D5XB 5E2VH 3CDGA 3VXRB 5EU4B 4MJIB 4K94L 4YHIB 5KSAD 3UYOD 4UI2A 3MRCA 4ZUUB 2EE9A 5SX4I 3TYGL 1YEEL 5E6YA 1EH9A 2DQUL 2OTWA 4LGSB 2LVEA 3BQUA 2PO6C 3BHBB 4D94A 3KXFD 1MVFA 1KT2B 1D6VH 3X3FL 1I4FA 3ULSA 1XIWB 4NQCD 2UZIH 4I0CC 4J8RA 1BBDL 1VERA 4UTBH 3HRPA 1BWWA 5ADOH 3JSSA 3N1QC 3H7LA 1EHXA 1A7BA 1T2QL 4ZYKB 2FJHA 2XYCA 5FYKU 5D1XA 2AJXH 4LVHC 3VFOA 1KCUH 1AHWA 2OR9H 3C60C 1JPSH 1QTYT 2ATKA 2G75A 1BQLH 1OAUL 3LDBB 4MNQB 3L3DB 1N4XL 1TDQA 4GQ9H 2ZSWA 5AYUH 2X4PA 2Q76B 4JFEB 5B4MC 1B0WA 3AM8A 3TVMC 3WFDH 3A6BL 1IT9L 4PGEA 4L4VD 2VXVL 1CGTA 2G5BA 3SKNB 5GQBA 4P3CL 3EFDH 2DQCH 4URTB 1OGTB 3HI5L 4EN3C 1NC4D 5CD3B 4M48H 3UYRL 3I2CH 3ZYZA 3B8SA 2LE9A 3TIDA 5F89A 1HKFA 4OLVH 2GUOA 5IB1B 3QXAA 2W0KA 1V5JA 4GAJH 1I9JH 4MGXA 5CSGA 1S7TB 5B3NA 2NY1D 2V7NA 4L8SC 2UZXB 2MKWA 4CRPA 4P3WA 2NXZD 1I7UA 3H9SB 3PV7A 1MVUA 4LSQL 1IQDA 3KLDA 1PG7L 2PYEA 3VA6A 2CIKA 1IVLA 5F9WB 4JDTH 4HLZH 1V7ML 4LPWA 3WIFB 3LMJH 2A83A 5ID0A 3S5LA 3TV3L 4PGZA 3RL1B 3P30L 2X4OB 3GMQB 4FQJH 5BXFB 5T1MA 1ND0B 1PDKA 4JY5H 4Y4FC 5DLMH 3IDIA 1OGAD 4U3CA 1I4FB 4WVRA 1T4KA 3BPOB 1DBML 4DVRH 3BXNA 4OFIA 2OZ4A 3TH3T 3ZTJG 4WUKL 4EQ3A 4OCNC 5IVOA 2YHGA 1BD2A 3D48R 2GTWB 3QDGB 3S5LB 3UTTA 2EYTA 4KTEL 3RWJA 1EXUB 3FFDB 5F6HI 1TTUA 2E7HA 3V7AG 4XT1C 1UB6A 5JHLL 4MCZB 4MAYA 5HI5C 1NCNA 4OCSL 4WFED 3BDYL 2FX9L 1WWBX 4GQPH 4CVWA 3I50L 4TUJA 3PGDA 3SCMC 5B8CC 4IJ3B 2GQHA 3DRTB 3E6HA 4QF1B 2GTWA 3MQIA 4S1DD 4WTXA 1D3CA 3LKNB 3QFJD 4LARL 5D7KE 4K2UH 2VISA 3O4LA 2WIIB 5EBWA 1CXHA 1TVHA 4M4RA 2JELH 5IG7A 3MRFA 5J1AA 4Y8DC 2ICWJ 2QSVA 2VKWA 4N5EC 1NEZB 3LS4L 3N1PC 5DSCB 2X4NA 5HHQA 4U0RB 2PTTA 1TZHA 5I9QB 3D3VA 5FO9B 2X4TB 5DJ6A 4YXLL 4AG4H 4FFYH 1FN4B 2VLMD 3AAZA 3IDGB 1YMMB 3BUYB 2YPKB 1ZT7B 2C9AA 4LAJH 1U8LB 5CBAA 3TCXA 1SEBB 3MRHB 1G6RA 1G7JB 4M8VA 1WCBA 4F7TB 5EUOF 1ORSB 4OAWA 4JDZA 1YYMH 5DJXB 5TE6H 4J4PC 1QFUL 5DEGA 1XZ0B 4L29A 1C08A 4U1NA 5FCSH 5MHSE 5ITFA 2DIAA 4X4ZA 1DQDH 3VWKA 1DE4A 3H2WA 3GSQA 3MRPA 2YR3A 4NO3B 1AIFB 3CMGA 3EDFA 1TMCB 5KOMC 1I1YB 4UBDC 2DQIL 1FO0B 4EOWH 5JA9A 1S7RA 2GSGA 1KFAL 3QHFL 2V5TA 2AKRB 2IH1B 4I3RL 5E00B 1ZGLA 2YEZA 4JPWH 5DR5L 3ULUH 3AS2A 3M1BB 4ODVH 4TNWF 4OZ4A 4NOBA 3WFBL 3NIGE 3KYKH 4AT6A 4JFDA 1YNKL 1QFWL 4YHKL 3PDGA 1S8DA 1KPUA 5T3XD 2YRZA 1S5HA 1DBAL 4Y16B 2HRLA 1OSPL 4HWBA 5KS9A 2FBJL 3RUGF 2PW2A 3QXVA 4YGAB 5EA0L 1OP5K 5CSZB 4UQ3B 1I1YA 1MWAL 4B41A 5FM8A 1F3DH 1NGYB 4PRPD 3GJEA 4G7VH 2AJVH 1P9MA 1RULL 2DYPA 2G9HB 1Q38A 3QDJA 1C5BH 1I3GH 5IB4A 5FFLA 5F9AC 5C2BH 3X11A 2AV1B 3MR9B 2Q3AA 3U48A 2DB8A 2B2XH 3T4YB 3MRMA 1J8HD 1ADQA 15C8L 2DQFA 4U6VH 5DR5H 2Z4QA 3HZVB 5F7EH 7FABL 3Q6FA 1GGBH 2UY6A 5BO1L 4FQXD 2QADD 4TQEH 2DQJL 2BFVH 3C5ZB 1K4CB 3BUYA 3DSFH 1BLNA 5T3XH 5F71A 2YWYA 4KJPD 1E6JH 3V4VH 1YYLL 3DUUB 1TXKA 5EZLB 1CD9B 2JK5A 1EEZA 4RDQF 2VIRA 3NABL 4ZQKB 2IWGA 1KULA 1XF2A 3UAJC 1R3IL 4GFTB 5CGTA 4PFEA 4HKJA 1OM3H 5D71L 3QIWD 2BVTA 4PY8I 5T3ZH 4XCEB 1SY6L 3MLXH 5IHUH 2JB6B 5D70H 1MUJB 3B6SB 5DQDL 4NKQB 2DWEB 4NO3A 1IC4H 4MQ7A 1CXLA 1XF1A 3EJZC 5D7SH 1T0MA 1A2YB 5AZ2L 4RBPK 4P2RD 3S4SB 3WUWA 5K9QG 3EO9H 2L4OA 1EUTA 3BEVB 4O51B 1QRNB 1IZJA 1NUGA 4JJHA 1RVFL 4GBXB 4XCEA 1ZT1A 2GSIA 5C0IB 1H15A 2BVQA 5JIKA 3F12A 5IOPA 1MFBL 3QCVH 1QVOA 4TNVF 3MO1A 1U42A 1IGTB 1PY4A 2H41A 5FUZH 1F97A 1XF2B 3GBLA 5DRXA 4OLEA 4FABH 4KTEH 2Q6WA 3FQRA 4HAGA 1RURL 5LGHH 4YX2H 1AD9A 1JRHH 2APFA 3CLEL 3VXRA 3U0WH 3BKJH 3ILQC 4ACPA 1MELA 4DGVL 4U3XA 3QULB 3U0WL 2XKNB 3B9EA 3LV3A 3B2VH 4TUKL 1I9EA 2E7LC 4GW4A 3BD4A 4QEGA 3TO2B 1CTNA 1OAXL 3EGSA 4FZEL 4GKOA 4IRSC 4RFNB 4NCDA 1AD0B 1E27A 3VG0H 2I27N 1UC6A 4Y1AA 4BA8A 4K3HA 3SE4A 3OGOE 2GK0B 4KQ3L 5JXAH 1A6UL 2N4IA 5CEYB 3HR6A 5EC2A 2NZ9C 3GSRB 4JO1H 1ES0A 3GO1H 1AP2A 1ZV5A 4UIKL 4P2OC 2HKFH 1ZLVH 4JFQB 5CGYC 2ADJA 2QSTA 3CFKB 2GEEA 4LCCB 4M9OA 5D4QA 5T1LB 3RGHA 1R5IA 3VXUD 1JGEB 2OI9C 1UEYA 3SPVA 4O58H 3X17A 3FQTA 4OF3A 5DJDA 4MWFA 4RA3A 5ADPH 2WWKT 2ZNXA 2C4FU 2P5EE 5BVJA 2P5WD 3VI3E 4RFOH 4LBEB 2UWEA 3TA3B 1MCSA 2FLRT 2Y6SC 3HUJF 3IFNH 3VXSB 2OS7A 4Y16C 1NCBH 1KXVC 1AD9B 2H1PL 4KI5E 4HF5L 3HNTH 2D31A 2H3NB 4OTXL 1XCTB 1KB5A 4S2SB 3RTQD 1RFDL 3U30C 3GKZA 4KJWC 1MCWM 2P43B 1A7PL 4PJFA 1F42A 4ZOEA 3OPZH 43CAB 2HWZH 3ARGC 2RJMA 4DGYL 5F8QC 4GRLA 1BEYL 4CDGC 5IW1A 3QRGL 3VRIB 4E0RB 4OF0A 4P5KA 2NY0C 4KI5D 4YDKH 1I9IH 4U1JA 3FRPA 1D5MA 3WLBA 3GSOB 4X9HA 1G6RH 2CSPA 3QO0A 1R5WB 4MQXD 4O9HL 4QGTA 3BZ4A 4XMLL 4TSCH 1VEMA 5IQ9B 2ERJB 4MQTB 4HKXB 3WSQL 5F96L 3PJSB 4V1DD 2YOCA 3GMPA 4Z7UE 3HC4H 4G8FB 2AJVL 5H94B 2CR6A 4CGTA 4F15C 2Y06H 4YR6B 4M1GL 5F7LB 3NA4A 5I19L 3VXMB 5E9DA 3VMOA 1BOYA 3WUWG 2GTZB 3DURB 3TJHD 5M95B 4LLWA 2GCYA 2IPUG 4HJ0C 3C09B 1RZIB 3OBAA 1I7ZB 2VAAB 2A2QT 3OKNA 1YNKH 1IAKB 5B8CA 2AAVA 2BSTA 2YK1H 4Q6IA 5LAXB 3MV01 4ZUTA 2R0ZH 1WLHA 2X10A 1RY7B 2ZSVA 2VJXA 4I3GA 3BRGC 1F58H 3TT3H 3UTOA 4PJ9B 4ELMF 3SDXF 1CFBA 5DD1H 1JNJA 4F7CB 2XTJB 3QXAB 3HAEH 3C6LA 4D0DB 5HVFB 4I77L 3I6KA 5E95B 4FQ1H 5FYLH 1NJ9A 1OPGL 2YSSB 4X80L 2HH0L 1QLRA 5J11B 1C5CH 4GXVL 3TCLA 4LLQB 1PSKL 3C87A 3UDWA 5JNYA 4YHPB 2JLLA 1ZSDB 5GRJL 3VD3A 4Z76A 2OZ4H 5KSAC 1XR9A 4F9LC 3LMJL 1ND0A 2JF1A 2IAMD 4K23L 3I6KB 5C0EA 2GFBB 5B38G 1WFNA 3UJTH 5C0JA 1KN4L 5BW7C 2Z31C 3AREC 3O4OC 1IFHH 4L3EE 2D7OA 1JWSB 1KJ2B 5IJKA 5H37G 1KB9K 1U2HA 3BZEB 4HIEA 1YQVL 4YFDB 3G6DH 3TCLB 4NN5C 2CGRH 1MPAH 5A1AA 3MBEA 4KQ4H 3CFJA 4WGWB 3BIKA 3VFGL 1C1EH 4JGUA 5TGBB 2PTVA 4PJHB 1UJTA 1WFUA 1TJIH 4ZAKD 1YEHH 3HN3A 4IOSD 1UKSA 2E7LA 4F7MA 1U3ZA 1S7XA 4P3CH 1DEDA 5B21A 5CGMA 1B0GA 4K71C 3I6LD 3ARGD 4YDIL 3VFTA 3LRSA 1ADQH 3O4LB 4K8RC 5E08H 2DTSA 5T1LD 2F5BH 1SM3H 1QRKA 2W07A 4GSDL 1AI1L 1VFBA 5C6PB 3WHE1 2F5BL 1HHGA 3HPJB 4IMLA 5IFAH 1HCVA 3RNQA 2D7MA 1IEAB 4OFDA 2YD3A 3TT1L 1BVLA 4QRSA 1CWVA 2XOTA 4F7MB 4LHQB 3I75A 2VDRH 4C55A 4TVPL 2X9YA 4O2FB 5EBMB 2Z31A 4HWBH 3EUUA 3OR7A 2X5PA 2VLJE 3RWDA 1Q0XL 4MYWB 1B3JA 4OCRL 2GUOB 3O11A 5LWYH 3IU3A 3FRPG 1HSBB 1H8SA 2ZUSA 3NCJH 5GGTL 3IJSA 2W60B 2K3TA 1I85C 3QDGA 3V2AR 1P4IH 4U0RC 2OSLB 5FGCE 1QSFA 3NIDF 3DI2B 4AM0A 3CDFA 1Y0LA 5EU6A 2V2TB 2E6QA 1MCIA 3VI4E 4WTZA 1T7WA 4PRID 4X5LA 4OCYH 1OW0A 1W8NA 5IEHB 2VLJD 3D87B 1GHFL 4O2FA 1T5XA 5E2UL 1AQKL 2DJUA 4Z7OF 3EBAA 1WTLA 1QR1B 1FZMA 3FFCA 5DRZB 1HSAB 2FEEI 4L9DA 1N3NA 4IDJL 5KSAB 3KXFA 3DVNB 4JQVC 1W0WB 1FIGH 5I17A 1ZGLB 2PETA 4DFIA 4PREA 2BNRD 1CICD 3WNLA 1JZ2A 4QHUB 2FEDD 3MV8D 3AU1B 3L9RB 5E00A 3VXSD 1AGDB 4YAQA 1R3LB 4HD9A 1PZ5B 3GSWB 2VLKE 5HD8D 4GMSH 3T2PA 1A1MB 2ZCHL 1IM9D 5MI0C 1QKZH 2Y5EA 4MNHA 2P5EB 4PJ9C 3OR6B 3BVNA 1RZJL 3BAEH 3OHXA 4E9LA 1G7JA 4QXGH 1HCFX 4F33B 5TH2A 5L88H 3GJFH 1SBSL 4NT6A 3MLVH 1DBBH 5I71C 3IDGA 5I1LA 3E6FB 1TJGH 2HJFA 3RNQB 3OJDA 5ANME 2AK4A 3GNMH 4XHJC 1CCZA 3PWPD 4CMHC 4WHYG 5EORH 4N90E 1FL6B 1EJOL 3WLWC 4JHZA 4MNHB 1PD6A 5IFJA 3ZKQD 1NEZA 2P48B 4M6OL 2R8SL 3I84A 5CD5C 4C54A 4OGAC 3SDXA 5D8JL 4Q58C 4KROB 4Z6AT 3FB6A 3GGWB 4X7TB 2FWOB 2GITA 3RFZC 3C8KA 5ICXA 3GIVB 3S4SA 4WO4D 4WEBL 3HA0A 4X8JA 1G0XA 1UG9A 3PF2A 4U0QB 1MY5A 2HAZA 4JDVA 4PGCA 5HHVH 1BIIA 5DQ9B 3V0VA 5JIHA 1KJ2H 1UB6B 5FKPA 5A2JH 5IFJB 3IAGC 5LQBL 4EOWL 4R6UA 2V2XA 4M1DL 1SY6H 1UXWB 4PG9A 1MNUL 4LP5A 4EVNB 3QQ9D 4PRHB 4MZ2A 3FQWB 5I1KH 2DQCL 3QAZC 3ARYA 4M5YH 4IRZH 4XPTL 4I48B 4LLMB 4NKDA 5D7IB 5JA8B 1CLYL 3TFKD 1MHHB 4FP8L 1P1ZA 1CGYA 1HXYB 4LCWE 4LSTH 3ROOA 2QV2A 2XTJC 1S9KC 1T83A 2IBZX 1JPSL 5EU3A 4D0CA 3ULVL 3QXDA 3NH7L 2FGWL 2PTTB 5I2IB 5KSUA 3TBVA 4FG6C 1F3RB 1CDHA 2ADFH 1FFOB 1JWUB 3PIQA 3BH8B 4A6YL 3TWCL 4LSVL 2MOVA 1X4YA 3QSKB 2YD2A 2WLZA 3TBWB 1WTGT 3L3HB 4U1MA 5DFVD 15C8H 1RZKH 1O7VA 1X5IA 2UZIL 3VRLE 3IAQA 1D6VL 5DD6B 5J1SC 3VFWA 3BH9A 5JPNB 3WHXA 2AJSH 4KFZC 3NBNA 1MRCH 1YC8A 5IVXE 4YXHL 4U33A 4KKLD 4R4FL 5E1AA 1S3KH 4ZOBA 4MXVE 1T6WA 2NXYB 2OCFD 2BVUA 2A74A 2AEIT 4XNZB 3SY0A 4HGWA 5TFSL 4EUPG 3L3IB 4KRNA 2AJYH 3H3BC 4XX1E 1JYNA 5DURB 5CBEA 3RZCA 3GJEB 4HWBL 4A6YA 2NTFA 2D31B 4GUPA 3RIFK 2VXQL 5JW4M 4Y4KB 4UOW0 4CW1A 1GGIL 3B2UC 2EDBA 3A67H 3W39A 5DZLA 2NX5A 3WNKA 1JHTB 2F58H 3P0VH 5BRZE 2E9WA 3P30H 4P2QD 4WHYH 2JJVA 2ERJC 2MTPA 3ZE2F 3W5NA 5CD5D 4K8RL 3EHBD 1I1RA 3KJ4C 4LK4A 3PHOA 4D9LH 1TJHH 3HMWH 3FT3B 4O02H 1S7UA 3EO0B 5L8LB 1U8KB 3D85B 4L8SA 4KMTH 4P4KB 1YNTA 2WLYA 2WUCL 1FFNA 2M2DA 4MDJA 2IBBA 4DCQA 1P7KA 5BV7L 1UJ3B 2O5YL 1XGPA 5EUOA 1L0QA 2VLLA 1CIUA 5E2JA 1MH5A 1QNZH 3M8OL 1YN6B 3IVKA 3DV6B 3QUZD 3FCTA 2NXYD 4FQCL 3RWHA 3RVXD 4H8WL 4C58B 4MJIA 5I66A 3CFDA 5D7JC 2XTLA 1R5WA 1PW3A 4QHKJ 4G6ML 1FVCB 5IIEA 5D7IE 3T0AA 2A6IB 4LL9A 1NKOA 1NCBL 4H1LB 2VXUL 5EIVA 2XTJD 5BVPL 5KJRH 1NCDL 4YR6A 4KDTA 3FO1A 1AXSB 1UCBH 3QI9B 4G6AC 5C86A 1LO5B 4IM8A 3KYMA 3WXWH 3GK8L 4IRSD 1SJEA 3ARWA 2VLLB 1C16A 1DCLA 2XV6B 5C6WH 4DGVH 4KWUA 1KACB 4FFYL 3QUYD 1IBGH 1OAKH 1KPRB 4ZYKA 4AENB 1XCTA 1KNOA 3FO2B 3BYYA 5HHPA 1KYOK 2EDDA 1I1FA 2NZ9D 1OL0A 4P57A 1FDLH 4JO3L 4NNYA 3D85D 1KGCE 1MJJA 2F8OA 4KQ3H 4S1SH 5SWQB 4MLIA 4OGAD 5CEZE 2OQJB 4OD1H 5EG6C 5F96H 3HS0B 5FA4B 1JPTL 3JV4A 3IDYC 5EIQA 5EOCJ 3NFPB 3VGDA 3ALXA 4HUWA 5IK3B 4GMTL 4X4YB 1KFAH 1OAKL 4ZFGH 3KYKL 5I71B 2O5ZL 2ZUQB 4MLSA 5F8RC 1I1FB 4X9GA 2Z91B 5JXEA 2IG2H 4PJ5E 5GGTA 3E2HB 5GGVH 3VGAB 3DGCR 1MH5B 2D7PA 1NCAH 1OAQL 3MGAA 5CJOL 1PQZA 3KR3L 1BMGA 2DMCA 4NRYA 3VXPB 3JZ7A 2GJ6A 1E6JL 3V4VL 1A9EB 2WWMC 4HXBH 2I07B 2VLJA 3GRWL 4GRWH 5CLWA 3MRKB 5B22A 2HH0H 2VABA 4YFEA 3MV7D 2DN7A 3QUYB 1G7IB 1VFOA 3VXRD 1DBKH 4HMCA 4JY6A 1T03H 5L9DH 1A1NA 1VADA 5D70L 4AIOA 3F6IA 1HINH 4BQCA 2J8HA 1RQ5A 2HG5A 1MLBB 2ED9A 1BAFL 3EZ8A 1JGUH 3S34H 2VDOH 3MSPA 1WZ1H 1OGTA 4UDTB 4HPYH 3DRQB 5HI3D 3TT3L 1IFHL 1XCQB 2P8MB 1YEDB 2Z35A 2Q8AH 1EJ6A 4ZNEA 3ALPA 2XRAL 2FSEA 1BJ1J 4MAUH 5EWIL 1RU9L 1FG2A 4HC1H 4ZS6C 5LGJA 3V6FB 5FF6A 2MHAB 1HHHA 3U6RA 4RZCB 1KCVL 4M7JL 2ED7A 3LQAH 5LXGH 5IW6A 3BP6B 5E4IA 5I8KL 3RNKB 3O6KH 1KPVA 1AXTH 3BGFC 1MFNA 2D9QB 1LEGB 3P4MB 4LSDA 1MHCA 3VH8A 3O0RH 5MENA 1GPOL 5GSVA 4JRYB 1V3MA 4RAVA 4AH2A 4DKEH 2MCG1 3B2UD 3NZ8B 2COQA 4F58H 4AQOA 5IFHH 2J8OA 1W0VA 5EU7E 4YIQA 2P47B 5KN5B 1NFKA 4FQQB 4Y4FB 3GBNL 1HHIA 2JKXA 3WXVL 4C56E 5JOPD 1U58A 1EFXA 2AP2A 5INDA 3HAEA 1NLBL 1JNNH 4I2XB 4UILH 4MNGA 1R0AH 1P6AB 4JPIA 1BBJB 3QQ4B 2F74A 1ZHLA 4OZFH 3VFGH 3H7BA 1IAMA 3BP4A 1C12B 1RUKH 4ALAL 5F9JA 3E6FA 2NZIA 3ESUF 3TV3H 4JRYA 4PGDB 5MENB 4F8TA 5F7MC 4MD0A 1YPZE 1XH3A 3NPSC 5JDJA 3P9LB 1X5XA 4W6XB 1OOAA 4XAWH 5GGQL 1J0IA 3IXTB 5ALCL 4YBLC 5FV1L 3RWJB 4QHNA 2ZCKL 4H5SB 3HE6D 1C12A 5E9DE 3ZT7A 1RK0A 4U1GB 2E8ZA 4J1UA 4LQ1A 2PN5A 3CVHB 4HSQA 4QXTA 4LVEA 3MRDB 4RNRA 4IDLA 4K8RD 2OSLA 4R0LB 4N68A 1J11A 1A7PH 4TSAL 4NP4L 5AUMA 5I1HH 1W0VB 1OCWL 4X6CA 3N1MC 1CK0L 4JG0H 3SBWC 3VWKC 1HSAA 3O6ML 4IOFC 3T2QA 1CN4A 2OR7A 4H20H 5B39G 4OI8A 5K33A 2IAMA 4KDVA 2UWEF 1IQWL 1AI1H 3D25B 3EKCA 1EEQA 2H8PA 3ARFB 1RZJH 4O2EB 4ODWA 5I18H 2CJUH 4WFGD 1URLA 1PKOA 5I8EA 4WGVB 4KK9C 3NTCL 3CUPB 2NXZC 4J8RB 1WZLA 3LN5B 2AXFB 4NCC1 5DUMH 3HCVA 3UBXG 2XQYK 5FK9A 4Y88A 1ZHKB 4ZNEE 5LCVL 4WENB 4XP9L 4RWYL 5BJTA 5ITFB 4ODXA 5DK2B 3KWWB 4GAYB 2I9LA 3AUVA 2V9RA 1SJHB 4JFPA 5HVHC 1LK2A 4TSBH 3TO4D 4FTVE 3CFEB 5JDSA 1GRWA 1OTUC 3HZYB 1NCTA 5EZIL 2NYYD 3G5VB 3OKKA 2J88H 5I1EH 4PREB 5E8NB 3CPLA 2V2WB 2NQCA 3KPMA 2CKBL 2Y5TB 3TP4A 1BFOA 4HWZA 4YEEA 4HFWB 1S78D 3CUPA 1YEJL 5D5MF 2ITCB 2H9GA 5L0QC 4N1CA 1SJHA 3UTSE 4XPGL 2HVJB 1N6UA 3BISA 4ETYA 1PJ9A 2Z31D 4Y5XB 5DMGC 5HI5D 4CMMA 1FRGH 3PIQB 5F9WC 4EBQL 2XZQH 2AABH 2IQAA 1FNSL 3A6CH 1BIIB 5DQ9A 4XZUB 3NCEB 3RUGB 3VGGA 5T5FL 2CK2A 1NGYA 2WQ8A 1OP3H 4HPOH 1NCAL 3GHEL 4RIRA 3VFUA 5DD1L 5J3HC 2D2OA 3K2UL 2YPLE 4YXKL 2IAMB 3H9YA 3BKYH 2C4FT 2GJJA 4MA3B 1KJ3L 3DUUA 1H3XA 3IDJB 1DQQA 4RISL 3TWCH 2MWCA 1U8LA 4Y4KA 3B43A 2F53D 3QHZL 2I9TA 1FNEA 4ESKA 3BXNB 2H2SD 4A6YB 3C5JB 5SWSB 1DVFA 4PLJD 3SE9H 2R8SH 1EHAA 5DJYA 1PY9A 2AI0H 2ZCLL 3W9EA 3GSQB 4BSJA 1OGAA 1JBJA 5CCKL 2P5WB 4GRWF 1AO7A 1JF5A 4P48A 4DKFL 3C60B 3KPNB 1OAQH 4NPYB 4Q97A 3OHXB 3MLRL 4R8WH 1FGVH 2VZ3A 1U8QB 4LCYA 4K8RH 2ICWA 3DSFL 1QFOA 4OZIB 1SHMA 3PGCB 2YD6A 3BGMB 4GRMA 3QPXL 4K7PL 3FO9A 4LLYB 1JGLL 3QUKB 3LQZB 4M03A 1YA5A 3WKML 4LVNC 3PGDB 4XVUD 2XZAL 1BQHA 3ABZA 3C5JA 2NW2B 3DETD 5I8KH 1KCKA 2F5AL 4ELMB 1LEIA 5D2LE 4JAMA 3RL2B 3RDTD 1KPUB 5DJ2A 3WIHH 2APWA 1P7QB 2WP3O 3AC0A 5K93A 5KVEH 3QUKA 1QVOB 4O5LH 1F02I 1HOCA 3TZVD 4HUXA 4P2OA 4Q9CA 3CK0H 4XPFH 1Q1JL 1B4RA 3ROLB 2ICWB 5IMOA 1A6VH 1WVZA 1UM6L 2Z0BA 3WUWB 4HH9A 5DHYB 1DFBH 5L8JB 4LLVB 5KTEH 1GOHA 3TESA 2O5YH 3CXHJ 3D3VD 4IDJH 3BP7B 4BUGA 1TCRA 5KS9E 5B3JE 3S35L 1F13A 1RUKL 2FDBP 3KLAA 5GGRY 1P4IL 1F11A 2XFXA 4O5LL 1BZ7A 2NY3C 5SX5H 4PGJA 1CDGA 3I50H 4QCIA 5BRZA 4XPAL 4G9DA 1MJJB 3TBYA 2DLFH 3OZ9H 4J23A 3H3PL 1NC2D 3SDDB 5IB3A 2YEZB 5HGAA 2A77H 5IMOB 1N5YL 2JB5H 4IOFD 4U1LA 1F90L 1MAJA 3MLSH 3OAZH 4I0KA 1O5DT 4MNGE 3M07A 4WTWA 3GUTA 1JNNL 5CEZH 1Z6JT 1S7QB 1KBGH 1WK0A 2E3VA 3A0OA 3RI5K 1NUDA 2YBRA 4NUJA 1ZLWH 2GKIA 4YHML 4OGXL 3CLEH 3TBTB 2OI9B 3RBGA 3RGVC 3GK8H 4GMTH 3N85L 3DECA 3QJHA 4JFDD