1Z6JT

Crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
207
Chain Sequence
b'SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Structure-based design and synthesis of pyrazinones containing novel P1 'side pocket' moieties as inhibitors of TF/VIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 207
sequence length 211
ec nomenclature
pdb deposition date 2005-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z6jT02
4DN4L 2J5LB 3GK8H 3S4SG 3FOLA 3KDMB 4ZFGH 4ODSL 3O2DL 3TYGL 3QG7H 5F8QC 1HHIB 4EUPH 5HTSA 1JZ8A 4JFZL 4WI6A 1ZSDA 3SKMB 6FABL 5A43C 5IMKB 3LDBB 2VITB 1SEBA 4YFDB 3DX7B 1KLUA 3TO2B 3CX5J 4U1JB 5E8PB 3C2AL 1KC5L 1BZ7B 4Z7QE 4HLZG 4PJXB 3WFZA 4JZJC 4XC1L 4H88L 5HVFB 1TTFA 4YHOL 3O3UN 4S2SB 1DQMH 1L9NA 5D96C 5CGTA 1IAKB 1UKSA 2WV3A 5DA0B 5AZEL 4U2ZA 3IU3B 5C0JA 1S9WA 2C9AA 1Q38A 3GSNL 2BK8A 3QWOA 2X4PA 3NN8A 2AJYH 2P8LA 4Y5VA 5TE6H 3DUHA 3L3DB 1PG7H 3RP1A 1MI5E 1MRDH 4DOHB 3MLWH 1A3RL 3M17B 2XZCH 3C8KB 5EWIH 5JXEC 5J1TC 4NFDA 4U1GB 4N0UE 1EZVX 3X13B 3IS0X 4XNXH 1OTUD 3CIQA 3TT1L 5HDBE 2EDBA 2VLRE 3DVNB 1I1AA 3GK8L 5EIIA 3ZKNC 1IC1A 2ICCA 3L3HA 4ZFGL 4L4TD 1RMFH 2MHAB 4HKXA 1T80A 4XPTL 5AUMB 4RDQF 5FYJE 1E4XL 4Y16C 2VISB 1MCCA 5C09E 4X6EA 3EJZD 2VXVH 1NSNL 3AM8A 3DIFB 3QJFB 3X11A 1FHGA 4XWOC 1Z9LA 4UU9A 2AXFB 3KPMB 3QUYB 1A6WL 4JO2H 3GBNL 4G9FA 5B3JE 4K2UH 1QLRB 2A77H 4TRPH 5E6IB 3VXUD 2IFFH 3WMSA 4CU8A 1SQ2N 5D5ME 1AGFA 5FYJU 1MWAA 4WHYG 3O2VH 2AI0H 2AJYL 8CGTA 1FVCB 5CEXB 5TE6L 2AK4B 3O3EB 5E8OA 1MRDL 3MLWL 5CKGA 3T3MF 3IU4L 3GJFA 2XZCL 1UA6H 4Q7DA 2JF1A 3QSKB 1U91A 2ADGB 4LLUA 2FIKB 3TGXA 3K8MA 3JWOC 5FHBL 5A16A 4OSUH 1NEZB 4XHJD 5M7QA 4HKZA 4LSDA 4U1MA 2UY6A 4LLAA 5EBGA 5CD5D 4RGNC 3O6FA 4WDIA 3W9DB 5FAAA 3RPKA 1S7SB 3BEVB 3X12A 3OB0H 1ZOXA 3RVTD 3L5HA 3FFDA 4LRNL 4OZFA 2WZPD 2AXGB 3RKDD 3TBWA 4WEMB 2VZOA 5IQ7H 5T1LD 1CG9B 5JNYA 3IVKA 2E6JA 4XMPH 5C0FA 4JO2L 1G1CA 3ZTNL 4K2UL 3KXFE 1KV3A 2VTFA 4JANB 2Y07L 5EZLA 2UUDH 1UZ8B 4J4PC 3NCBB 2OX5A 3UTQB 3O2VL 1HKLL 1IQDA 3V4VL 4C56A 2VXQH 1IAIH 3G5ZB 5EO9B 2VWEC 5ABDE 2WANA 3RNQB 3WHXB 2BDNL 3BZ4A 2IPKB 5GS1B 4OSUL 4MDIA 4NBZB 1MY7A 4Z8FH 1IGFL 2W9LA 5EBMA 3VFOB 1G7HB 3HRPA 1B2WL 1S7RB 5IF0B 4HAFA 4DKEH 4NP4H 3MNWB 1BIHA 3QUZB 3RTQB 3U30C 4OCSH 4HFWA 1KBGL 4JM2F 5IQ7L 3OJMB 1MCWW 3KHQA 3MJGX 1UWXK 4JRYE 4ZAKA 3I9GH 2NNAA 4LLMB 4NRZA 3REWA 5GHWH 2ZCKH 5TE4L 1HK6A 1BREA 4MJ2A 1I1AD 2YC1B 5FECA 3D85A 3EZJB 4YHYB 3B8SA 1IGJB 1S9YA 3QEQB 4LPTA 5IW6A 3PGFH 2A83A 3C6SA 1MCPH 2RCSH 1P53A 1YEFH 2BMKA 1OSZB 4NPYB 3D5OF 3QCTL 2VXQL 3A6CH 5LJYH 1RZFH 2Z93B 1IC4L 4N0CC 5T1KA 3TVMB 1NBZA 1GZQB 3CFIC 4JPVH 5D72H 1E4WH 3M1BB 3TBYB 5DUMH 2Q7YA 4JRXA 4Z8FL 3HAEA 4M02A 1KELH 1YPZE 2R0LH 5HY9A 4HUVA 1BVKB 4KK6C 4JFHD 2NYYC 3PQYD 4NP4L 5HVHC 2K9UA 4XB8A 4HS3A 4P49A 4OCSL 5F1IB 2FIRT 1F3JA 1FYTA 2E7CA 3G5XB 2FATH 1HHKA 3DV6A 3UBXG 3WNKA 4JM2B 5GHWL 2ZCKL 1YNTB 5IHZB 4PJAA 4TNWK 3EFDH 4OV6F 1DUZB 4NBYB 3H8NA 5EN2B 4P99A 4N0FB 5DT1L 3D0LB 1MCPL 3BXNB 2RCSL 1UEYA 4MA7H 3BP6B 1YEFL 4MQSB 4N8VG 5CEZL 2E3VA 1MHHB 1L9MA 3SJVE 4HIJA 1R0AH 4L8CA 4I48A 2CUHA 3A6CL 1RZFL 4NIKB 1TCRB 4LAQH 3ZDYE 3MRMA 2OMBA 5F71A 3MCLH 4MSWA 4JPVL 1J12A 1GPOH 2F5BL 5MI0B 2R0LL 3J8F7 2NY6C 3QA3B 1JPSL 2VLMD 4E42B 3D3VA 5KZCB 3QI9D 4BK4A 1HXMB 1DVFC 2YPVH 1I3VA 3JUZA 3ME0A 1MAJA 3QNZA 4Z7VA 1H0DA 4KJYA 4UV7L 5JQHC 1NLDH 2FATL 3QDHA 1I7RB 1XF3B 2WBWB 1QSEB 3T0BA 4OCXH 2NTFA 1WFUA 2W0FB 5D7LD 1MPAH 4KDTC 5H35A 5GS0D 1U3HC 3MLTB 4X4YA 1Y6KR 5ITFB 1WZMA 3RUGE 5I76A 5D7JA 1CXFA 2BSSB 4OZ4A 1F5WA 3WL9A 4QXUL 4DK3A 1NEUA 2EDKA 4IS6B 1W8NA 4D9QE 4LKCB 2EXYD 3VFTA 1INDH 1CD1B 3QUXB 3QDMB 5F9DC 3LHPH 1BP3B 1R0AL 5BMFL 4MXQD 3T0EA 3KWWB 4S0SD 4L29B 3OKNA 4LAQL 1IT9H 1A6UL 1N0XL 2HG5A 3EOBA 3K80A 3LPFA 4QOKB 4QYOB 4ZAKD 3ULUC 1GPOL 3TBVB 3GGWA 2P8PA 3INUH 2EIZA 2EKSB 3D85D 3DUSB 3RJQB 1GAFL 4XXDB 5D7KD 3D39B 2YPVL 4AIOA 5IGXH 4G8GE 4HDIA 4HQQH 4PJIE 5E1HB 3HPLA 4DKFH 4XXCC 1S7TB 2R1XA 2VC2L 4X7FC 4JFYA 5FFLA 4F9LC 3CDYA 1JWUB 1GC1C 5KW9H 2H3NB 4OCXL 3FN9A 5I75B 4BFBD 3Q3GA 5CSGA 5DRXB 5T1KD 3QQNA 4XNMB 1F90H 1FNFA 1PBYA 4I18A 3FQXB 2BERA 4JHWH 1TITA 3QAZC 5TDPB 4G7VH 5HXMA 5HD8D 3BOVA 2IMMA 3LHPL 3TZVA 1FZOB 4ZXBC 4ISVA 2IBGA 4WCYL 1Z0NA 3TO4C 4UBDD 4XB7A 1T3FB 1JWSA 5C08D 1PKOA 3OX8B 1EFXA 4DUXA 1PY9A 1YMMD 3INUL 3E3QC 4DGIH 3AMKA 1ZVHA 3DGCR 5F21B 4F33B 2ADFH 4PP1D 4UNTA 3FHAA 5IGXL 4HQQL 1VGKB 1FDLH 1XIWB 3SE3C 4QRQB 3VFWA 4JREC 4JDTH 1SYSB 5KW9L 2OQJB 3H9YA 3DI3B 2HJKB 1CICD 1HI6B 4LGPB 2Y6SD 3OKKA 4NQVB 3WFHA 4KJPC 4LPUA 5DJZA 4KTYA 4ZNCD 1SJHB 5I16B 4OGYH 4XI5C 4ODVH 4BFGA 5EU6E 2L4OA 5KAQG 4CMHC 3IRPX 4OZHA 1JWMB 4G7VL 5F3BB 3D3VD 3PDDA 4HFUH 4LF3B 5E4EC 3DVFA 4CRPA 1HH9B 3QCUH 5AYUL 5IBTH 3IKKA 5L2KE 4J3XA 4Y19B 2J5LC 3B6SB 3GB7B 1FFNA 1H9VA 2FJHB 3GIVA 5I8CB 1ZANL 1A2YA 1ZE3C 5C0CB 1MI5B 1U95A 4JFFA 4DGIL 2VQ1A 2LVEA 4IOFD 5KSUA 3GFUA 1AGCA 1CGSH 3VFGH 3LDBC 2VLRB 2AJZB 1V7NL 2DMCA 2ED9A 3ESUF 5LGJB 3QUKB 4LCUB 5IVXE 3ARPA 2IJ0C 2ZOKB 3BT2H 1KF9B 4I3SH 5EPMB 3ARGD 4IRJB 2H6PB 2XTJE 5ICZA 5FUCC 5ID1B 3CFCH 3MGTB 4LRIC 5IIEB 4AJ0A 1MCEA 1J0ZA 4FHBD 1WT5A 4J2XA 4OGYL 3TBTB 1ZMYA 1Q0YL 4UQ2A 3OZ9L 5ICYA 3LAFA 4X6BA 4EDWL 3VXTA 1AD9B 4HFUL 3PWNB 5CGYD 4JKPL 1ZTXL 4U1GC 4HH8A 4Y5YB 3QCUL 3QQ9D 1BZ9B 1MCKA 5IBTL 3ALWA 4ZUUB 5I1DB 3VFNB 3G6JA 2V7HB 4M7LT 4KUCF 1NBYB 2AXJA 2X4QB 4FFVC 4G43B 1TJIH 3LKRB 3NBNA 3NCYP 2HVJB 1EDQA 4FXKB 4R2GB 3WKNA 1OLZA 2YUXA 2BOBB 2LU3A 4OD3H 4UZGA 4M43L 4P4KB 5DK0B 3FB6A 2DJUA 4Z7WF 1BIIB 1N3NA 4OFKA 3JBG7 5C0AD 3UX9B 5EC2A 5JO5B 4L5FH 4P5MB 4EEEA 4QF1A 5ISZA 4F58H 3TZVD 4I3SL 3QUYC 2V7NA 3TNMB 4OGXL 3TH3T 3FKUS 4IMKA 3LD8C 1T2XA 5E6IC 5E24E 1P4LA 4GKSB 4QRSA 1F58L 2D7MA 5T5FL 4L3EE 4PJ9B 2ZNWA 2B0SH 3OB0K 4K8RC 4XP6H 4NOFA 1F4YL 2ZPKH 1M4KA 3T2OA 4YR6B 1QLEL 2VLKE 5HPMB 4P2OB 2VE6B 3KYOB 5EBWA 5TDOB 5LQBL 4Z18A 3BYYA 4I3RH 1FN4A 4EN3B 2UZIH 4Y4HD 1TJIL 1TZIA 1TZHB 2COQA 3GUTB 4NJAH 1QSFD 3QJHB 4GG8A 5BQ7A 1HKFA 2UUDK 4OD3L 3FB5B 2GEEA 4X4ME 3T77B 3B9KB 5F1NA 3SY0A 2N7BA 2IH3B 3K81A 1NMBL 3RU8H 4MNQA 4KRMB 3H3PL 3TYFA 2VLLA 3VDBA 5CIPH 2X89D 5IEHB 3NPZB 4RZCA 1N0LA 4L5FL 2HKFH 4Z7WB 3PGCA 2Z31D 5JXAH 3HC0A 4H1LH 1JCKA 3BIKA 3KXFA 4C58B 5E7FA 3QULA 4G8EA 1EBAA 3ZE2F 2XZQH 3VFVA 3JV4A 5I1CH 3MJ8B 5K9QG 2B0SL 4JFOB 3IFLH 4XP6L 4JRYB 5BRZE 2ZPKL 1UH3A 2NY2B 2IG2H 5TE7H 4L1DA 5HGDA 1IEAB 3RY6A 5DVMA 4ZFOL 3QXAB 1RU9H 3FONA 4ONGH 4MS8D 2VZ1A 1E28B 1YDPB 4R90H 1MUJB 4G8IA 4I3RL 1UXWA 5DVLA 1D5XA 1MLBB 3OXSA 5GS1C 1JFQH 1ZHBA 1H8SA 4DN3L 1LNUB 1UZ6F 4U6XB 1CDIA 3MACL 1KFAH 1ZLWH 4H5SB 4F9PC 3VXSA 1VKXA 5HYJA 3RU8L 2OR7A 2E6QA 1EAPB 1B3JA 5EZOH 1YN6B 3QUZC 4MJIB 4YC2B 3RTQC 1K4CB 3L7EA 4M9PA 4RGMB 1NC4B 1A4JA 3UAJC 1FL3B 4Z0XA 3WKML 4S0TD 5C07A 4GAFB 2HKFL 3EFFB 5JXAL 2KQMA 1WWAX 2M1KA 4PLKD 3BDXA 3SO3B 3BQUA 1BBJA 2AXHA 3EJYC 4YHYC 2E7LC 4KY1H 2Q86B 3CZJA 3KPSE 5AYQA 5FYJD 4U1SA 1QVOA 1S9VB 2VXUL 5C09D 1BPVA 4JFXB 5TE7L 3L5JA 3OKOB 4KMLB 4I77H 2QL1A 4TSAH 4P5KB 1W72L 4MCYA 2IPTH 4QXTA 4R90L 2J4WL 4ONGL 3TVMC 2WBJA 3AREA 4YHML 4Z7NF 1CFTB 4RAHA 5IWLC 3DOSA 1HCVA 2H8PA 5ISZD 1MFEL 4H8WL 5DC4B 5TGBA 3MRNA 1JGUL 5DJCB 2QHRL 4KJWD 4EJ1C 1A3QA 5ACZA 1U8JA 4PGCA 4ORGB 5FDYA 3UCRA 3IFPB 3CCHB 3RWJA 3FN0H 4WTZG 1C1EH 3R1GH 2HLAA 3ULVL 1P4BH 2VN4A 1FC2D 5DD3H 2JJTA 2DQDH 3S4SA 3WXVH 2CKNA 1KB9J 4EQ3A 1VFUA 4JM2C 2X4NB 4PJIF 4YBQC 5GGUA 5FYKH 2X70B 5DHVB 2A6JA 3OJ2C 1YA5A 1HHHB 2HYMA 1HDMA 2CDGA 1R24A 5E9DE 5DRZB 1IJ9A 3L9RB 2LU7A 3NGBB 1CTOA 1ZHNB 5E8DH 5CUSH 1XR8A 3SJVA 3VE0A 2R0KH 5F7DA 2K7QA 2LVCA 3TN0A 4ZUSA 5DK3A 4TSAL 3NABL 3O2DA 4LSQH 4JJ5B 2IPTL 4KMQA 4ZSOB 2R1WB 3GJEA 1UC6A 3GBMH 2DQJH 1PW3A 2YXFA 4F7EB 3CH8A 3VJ6A 3UJTH 4XCYB 3F6IA 5L2JB 2NZIA 3HLAA 3KXFD 4LLVA 3DROB 4F7PB 1BFTA 3E0GA 4GRMA 5JW5B 1YEDA 2UZYB 1RV6X 5K9JL 4LNRA 1M05B 4YDJA 4ZOAA 1CFNB 1OCWL 5J12B 2QR0A 2ATPA 4FTVA 5M94B 3U0PA 3OF6A 2YD6A 1AXTH 1JHLH 5DFVD 4PS4H 5IW3A 1I3GH 3GSNA 1CGVA 1E4JA 2ADIA 5FYKL 1CFVH 1Q8MA 3RWFB 4XVJH 2V17H 1K5NA 5CD3A 1IC5L 4PJIB 3UROR 1S8DA 1WK0A 3HR5B 1DLHB 1LEKA 1KPVB 1X5LA 4OF6A 3HZKB 5CUSL 1QO3B 2R0KL 5HYJD 3QUXC 4DCQA 3E6HA 5D1QB 5SV4A 1T2QH 3CH1B 3OKEB 1MF2L 4ZUVB 3C5JB 2DF3A 4F7TB 2M8XA 3W39A 1CF8L 1AI1H 2VDMH 3ZYIA 5IKCB 3GBML 2E8YA 4O4YL 5IHBA 1NGXA 2DBJA 1X4ZA 4U7SA 1RULH 3WUWA 5ICXB 4N9GB 4MB5A 3GSOA 4FRWA 3H9SE 2QSTA 4XCEB 1TTUA 5A2FA 4FQHA 1N59A 4Y4KB 2B8OT 2FX8H 1CVRA 1WBXB 1D9KD 3DRTA 5FKAB 2JCCF 1K8DA 5JHDA 3L5WB 1AXTL 2X4OB 1JHLL 5DRNA 5FM5M 4RWYL 2HAZA 1CD8A 1TDQA 4IDJL 4S1DC 3VXME 1Q9WB 5I75C 4NUJB 4XVJL 4EI5B 1INQA 3HTLX 4H0IA 3QQ3A 1T04B 3HG1A 1RZIA 2YPLE 4NNXB 3NZ8A 4ZNEA 3UTTE 3WLWC 3ECBB 4NQDA 5CCKH 2V2XA 4QRTB 5JORA 3QIUA 5EOTA 4OFVA 2DI7A 5KJRH 2B4CH 3AU1A 3TPUA 1T6WA 5GZNC 2GJ6E 1AI1L 2VDML 1FQ9C 1M7DB 3NPSB 5DC0A 3IDJA 3RHWF 5MP6H 2I9LA 3DTXB 1RULL 3WS6C 4UUJA 1KJ3H 1X4XA 5L2KB 2FH8A 4JDVA 1JGVH 5CS7A 4LHUB 3HFML 3NA4A 1M7XA 4YEEA 1F4XH 3SJVD 5I1IH 1XIWC 5C8JA 2Z4QB 1TFHA 3JTSA 5F7WC 5K9KB 4YDVA 4NO0B 5F3HA 5BVPH 2DS4A 2JCCB 4P2QB 3FZUD 2O5YH 3C9NB 5JOFB 1E4KA 2HP4A 3VXQA 3OXRB 3QO0B 3B5TA 3DV4B 1A7PH 4M4PA 1AD0A 1RIVL 3FFCE 2UYLB 4JGMA 1YN7A 1OSPL 4X7SH 4PUBH 1JRHL 8FABA 5I18H 1KCUL 4PREA 3C60B 2HMID 4HPOH 1MCOH 1A7NH 4FTVD 43C9B 4PY7B 2Z91B 3OF6D 4ZS7L 4ZQKA 5FKPB 4P2CG 4XH2A 2H41A 3SDYL 2GHWB 2QBWA 3CDCA 4GSDL 4OIIL 2BSED 5HYSB 4Z5RB 2DQTH 4FA8A 1B88A 4TTDD 2NXYD 3UYRH 4HC1H 3VXNA 1I7ZB 4X5WA 3Q1SH 1BHGA 1G7PB 3QXDA 5C9KA 1F4XL 1MFAH 3CPLB 1KIQB 5I1IL 4U1NA 2QQQA 1YQVL 2VDLL 1RHHB 2JIXB 4NJ9H 1KJVA 1ZA3A 5BVPL 2HFTA 1FG2B 1DP0A 3K46A 2V5RA 4IRJC 1Q94A 5I1AA 4KVCH 3P9MB 2O5YL 3AXLB 1X4YA 3SGKA 1KPUB 1A7PL 5DVNA 2Q6WB 3SKOA 1XR9B 1QPPA 2UWEA 2AW2A 3U4EB 2VABA 4HKJB 3K2MC 3TA3A 1JV5A 1Q9KA 3LKQB 4X7TB 1G7LA 2BFVH 4X7SL 4PUBL 2W65B 4NZUH 5I18L 4FQPA 3RA7H 4Y5YC 1XGYH 2E7BA 3LQAH 4PG9A 1XGRB 4MLIA 3C5SA 3UBXA 3T1WA 1FSKC 5JUEH 2VOTA 1MIMH 1T22B 2DQEH 4P57A 4X4XA 1KJ2H 3HMWH 2NLJA 4Z7OE 4R2GC 5IB4A 4M93B 2PNDA 2DQTL 5IV2A 1K6QH 1I9RH 4LIQL 2FX9L 4P4KC 4N8VA 1CGUA 3HG1D 5KG9B 5DURD 1ZT4A 3FOLB 2V9TA 1MFAL 4NO2B 4XX1E 1KB9K 4UDUB 2A9MH 4GKZA 3QIUD 2PTTA 1YNLH 5F1KC 2OR9H 5I30H 1NCWH 3OQ3B 3GKWL 4KVCL 3PNWB 5JW4Q 3W0WA 1SEBB 1MJ7H 1MNUH 3MOBL 5C6TH 1KLUB 3VH8A 1TNMA 2R0ZH 3DX9A 2R23A 2Y23A 2YD9A 4PJ9C 3E8UL 3IJSB 4ODWB 1QR1B 2FLBT 1LO3H 3CVHH 4HGWA 1MRFH 2BFVL 1G9EA 1CFQA 4P2OC 3LQAL 3TWCH 4ZUWA 5C0JB 4NZJA 1S9WB 1SVZA 5BO1L 1MIML 4EN3C 2DQEL 1PEWA 3G5VA 2BCKA 5BJTB 1KJ2L 1BJMA 2X4PB 2GQHA 4U6VH 3NN8B 4URTB 4X4MA 2P8LB 1JJUA 4Y5VB 5BRZB 5ID0A 1SEQL 4XVSH 4L8SB 5A2IH 3QDJE 3B9KC 1AQDA 1K6QL 2K7PA 1FG9C 5EU6D 3QNYA 5DQJA 1R5VB 5HHVH 1OT2A 3A67H 3GRWH 4MQ7A 1ZVYA 4ODXA 1NAMH 5EIIB 4M1CC 4MAYD 5KSAA 5FYKE 2ATKB 2HT2C 5DMGC 3CFEA 4KUZH 2BC4A 4XRCB 3ZT7A 1FZJA 2QKIA 3VRLF 1QP1A 4ZPVA 1NUDA 4GW4B 1YNLL 3S88H 4KKLC 2XN9A 1SJVA 3BEWA 4PB0H 1MJ7L 1MNUL 5C6TL 5HYQB 2BNRA 1WCQA 2F8OA 2AQ1A 2WINA 1KIUA 2XXMB 3O45B 1CVSC 1LO3L 3CVHL 1JHTA 2NY2C 4G42A 1GGYA 4G9FB 1LK2B 4ODTH 1YY9C 3CFBA 1X5GA 4MJ5B 2DIJA 3NIDE 4HT1H 3TWCL 3HI5H 3NTCH 3SDDA 2AEQL 2EDRA 3FT3B 4LBEA 3TC9A 4X6DE 2MNUA 1UM6H 2ID5A 2ZSVA 3LQZB 5FA3B 2ZJSH 2WUCL 1F6AB 1MWAB 2Q87A 2EIBA 2XTJD 3H0TA 4ERSL 1YYML 4LSVH 3LRSA 4NUGH 4MXVF 2DYPA 1FRGH 1U91B 1KPRA 2X7LA 4YC2C 3A67L 3RBGA 4U1KA 4RGMC 3VMPA 1IE5A 1J88A 2DLEA 1L0QA 5C2BH 1H8NA 2Z9TA 2BZDA 4HKZB 4R96B 5TFSL 3WFBL 4P4RB 3O6FB 4WDIB 3S88L 1X5FA 3NCCB 3Q0HA 4LCIH 3X12B 3BGFB 1FNSH 4XCNA 3SO3C 3V8OA 4OZFB 4RNRA 4OM0H 3KNBA 3TBWB 5EUOE 1LEGB 3UJJH 4PJ5A 4XP9L 2IBZY 5HGBB 4XVUC 2DAVA 5JNYB 5B3NA 4JB9H 4M6NH 4BSWA 1MHPH 4O02H 1OAYL 4G5ZL 4MQXC 4OCMC 3ZDZE 5E9DB 3BVNA 3HI5L 3NTCL 3HI1A 3AGVA 4ALAH 3HMXH 1G0YR 1UM6L 5CEYA 2ZJSL 4DJMA 3LQMA 3WJJA 2C3HA 3LEXA 4P23A 1IQDB 4NUGL 2BVOA 4C56B 5CEZD 1FRGL 2MOVA 1KIRA 2P49B 3D48R 1AGEA 4PV9A 4GBXA 4R26L 5EUKB 3T2QA 4OLUH 1OGAA 4TOYH 4F15B 3BZ4B 3EAKA 3IDYC 2VLKD 5DHYA 4Q9RL 2EDDA 3MV8A 4JM4H 4RA3A 3GSUB 4PGEA 4LQ1A 3WE6B 2NTSP 4IJ3B 1FNSL 5EA0H 2CRMA 4NNPH 1OT1A 1WC7A 1TNNA 4E5XB 3NFPA 1IL1B 1A1OA 2PYEE 3GIZH 4TUJA 2RFXA 5FOJA 4HFWB 4NC0B 1P1ZA 3ZE1E 2Y36H 4PJAF 3NGBC 3LVEA 1I3RA 3ARXA 3FQWA 3GMMA 5FO9A 4WIQA 4MNHA 3REWB 4OFIA 1C8PA 1MHPL 4O02L 2BSTA 3BX7C 4MD5A 2Y7QB 4G6FB 4XPFH 3OJVC 1ACYH 5KSAD 2IH1A 3HMXL 4UTBH 4ALAL 3UTZB 5IW6B 4HUWB 2X05A 4BELD 1HNGA 3NIGF 5HDLA 2A83B 4I0PA 4PV8A 2GSGB 5GSVA 1T5XB 3HN3A 1T0PB 5CHNA 2BMKB 3DETC 1UWEH 4R7NA 3H42H 5IEKA 1N26A 3D9AH 2YUZA 4PJHE 5AEAA 2DLFL 4JPKL 4GUPB 4HMDA 3MBXH 5HHOA 1CDJA 1YYLH 5J12C 4Y7MA 2EDXA 1A6ZA 1NBZB 2FECI 3MODL 2J8UA 3PUCA 4JRXB 5CWSA 1TVHA 3HAEB 2E8ZA 4JM4L 1P5UA 2PTVA 3ZE0F 4HUVB 3DX8A 2PXYA 3B83A 2AJUL 4A2LA 5EA0L 4NNPL 3V7AG 4Z7VF 3EHBC 1ZGLA 1IBGL 3K0WA 3GIZL 1EH9A 3NH7L 2VYRE 5C6PB 3DX6A 2OTPA 1F3JB 1FYTB 2HFGH 2Y36L 1S7QA 5E7BA 4OM1L 2DYPD 2IQ9H 3UJIL 1HHKB 2MWCA 3DV6B 4HIEA 2EDTA 4NYLA 1QLFA 3OR6A 4MA1B 4PJAB 5D1QC 5DO2D 5KSBE 2QQNL 4HX1A 4XPFL 1ACYL 5H37H 1CDGA 1DE4A 3KPRE 3MRBA 1T5WA 3RZCA 4NCC2 3SDCA 2QADD 4O58L 3QG6A 5JA8B 3ARUA 4XNUL 4PGJA 3H9SA 3D9AL 2A73B 1JNNL 4HIJB 1CT8A 5EO1B 4I48B 4DQOH 4F37K 4GO6B 3MBXL 3O9WA 3U48A 3B2VH 3KPSD 2AJ3B 5K33A 2GK2A 3OV6A 4Y4KC 2I60H 4U6YA 3PP4H 5EORH 3C5ZA 4AENB 4WFHE 4M4RA 3VXMA 2X4TA 5H2BA 4IMLA 1OB1B 1BECA 2C3VA 3AB0B 3SGJC 4EI6A 2EO9A 5E2JA 1XCTA 2AGJL 1Q9OB 2EYSA 4EI5C 1CS6A 2YPLA 5TQ2H 1FE8H 3UTTA 2HFGL 4Z7VB 1S5HA 1AXSB 3PV6A 3QPQC 5AAWA 4OAWB 4BA8A 4GBXD 4L4VE 3RBSA 5H35B 4G7YH 5I76B 5D7JB 2A6KA 4OZ4B 1A7QL 3NPSC 1DJSA 4NN7B 4CW1A 2WP3T 4YJZL 2GTWA 5EG6C 5I2IB 3VFTB 3W5MA 1H15A 3EUUA 3GZKA 4NC1E 3I6KA 2HTKD 4DQOL 3T0EB 3BZEB 2YMXH 3OKNB 2HG5B 3EOBB 1SMOA 4WHTA 2I60L 1CD9B 5K9QI 4LSUL 3PP4L 1FL6B 3BMVA 3RVUD 3GGWB 2P8PB 3DYOA 4JR9H 1F6FB 1OWWA 4TQEH 5LXGL 3GM0A 1LDPH 2ZG2A 3DNKA 1EGJH 3VXOA 2VDKH 2PTUA 5IVZA 3ELAT 2C4XA 5JLZA 4UI2A 1UB6A 4LCWE 2EYRA 3EOYG 4HDIB 4ZODA 1R5IA 3QDGA 3HPLB 5IFHL 5JIIA 1OTUC 1FE8L 5DMIH 4ZFOA 5DS8A 4KK8C 1SYVA 1F6LL 3Q3GB 2DLIA 1N7MH 4GAYA 3L5IA 4G7YL 3OHXB 4I18B 4JFDE 4OZHF 5D9SB 3S5LG 2VSCA 2P48B 4QTHA 3BE1H 4Z0BH 1XGPB 3DYPA 4NRXA 1A5FH 3BP7B 2F19L 4Z7UE 2PXYD 3QP3A 1MCQA 2R2BA 4HJ0D 5IROA 4KI5E 1GRWA 1PSKL 4W6XB 4H1LA 1Z5LA 2FJFB 4P2RE 2NW3A 1XCQB 4XBEH 1XF4A 3OJDA 1L6ZA 1P7QD 1JWSB 2JKXA 3F58L 1EFXB 1XEDA 1A6VH 4JR9L 4NT6A 3PXHA 5J6GA 3IGAB 1JPFA 4JLRA 5DJ0B 2I5YH 3FQTB 3RZCD 5ENWA 1W72A 1OW0C 4NSKB 5DMIL 1FNEA 3REVA 3KYNA 3RVXC 3H9SD 3ROOA 4WTZA 2B2XL 4BQ9A 2F8XC 15C8H 3OKKB 3WFHB 1D5MA 4NO3B 5J3HC 1F97A 3ETBF 5DJZB 5EZIL 1RFDL 3RVTC 2EEBA 1QBLH 3C5ZD 3EYFB 1HNFA 4PJCE 4Z0BL 4OD2B 3VXMD 1S9XB 5F1OB 4E9LA 2UV3A 1M71B 4OZHB 5TDNA 2VRAA 3KS0J 1IKFH 4M93C 4ZO9A 4FFWC 5I9QC 3G6JF 2XFXA 3K3QA 3RGVA 1EO7A 4X6DF 3T8XA 2YPLD 4HWZA 2CPCA 2DQCH 1UGNA 2O61A 3UTTD 1HILA 2RJMA 3QH3A 3FRUB 1KULA 2NMSA 5DWUH 2BVPA 2JJSA 4XBEL 1FFNB 4BH8A 3IDGA 5E94A 1F4HA 1CDBA 1A2YB 1A6VL 2HWZH 3QDJB 4JFFB 5IVOA 1PGRB 4QLRA 2GJ6D 2VQ1B 2KBGA 2I5YL 2G60L 1FVDA 3NA9H 1V8HA 3L1OH 1QUNA 4CMMA 4W6YB 4YXKH 5SX5K 3HCVA 2FYYA 3PWVA 1CFBA 2VR9A 3JVGA 4U1HA 1NMAL 4TN9A 4O2EA 15C8L 1U6AH 1VACA 3SKNA 1JPST 2ICWI 4Z78B 1MOEA 5ACMA 4UQ2B 4WU7A 4APQA 4FN0A 4Y5VC 5J11C 4CN6A 4L8SC 3SDAA 1A0QH 2C26A 2OJEA 3U7YH 3PP3H 4XWGH 2VJXA 1ERNA 3QDGD 1JI1A 3THML 1FH5L 2DQCL 1CU4H 3B3IA 3G6JB 3L3GB 4S1SL 3FFCD 4RA0C 4XPHH 4X6DB 4WJ5B 1GIGH 4WWKB 4TNVF 4Q9CA 4Z77B 3LSOA 3VWKA 4LGSB 2HWZL 3JWOH 2DICA 1LP9A 2JB6B 5DSCB 4OFYA 5E99L 3FB6B 3ARVA 5KSVA 4GG6A 3GHBL 5E5MA 1AHWA 2XWBA 2QEJA 3VD7A 3ZKXB 3GSQA 1W0VB 4HJGA 4YXKL 3S96A 3QRGL 3VU2A 4M5YH 4QF1B 5DJYA 1NH6A 3LS5L 4MNGB 2V7NB 3S36L 3ES6B 4RRPG 3VD3A 2DRUA 3UTSA 1U6AL 3BH8A 3MBED 3ZE1F 1YJDH 2P43B 4JHBA 4QRSB 1A9BA 3DO7A 1AKJA 1PVHA 2XZZA 3BUYA 3O6LH 4EXPX 3MRDA 3ZKMD 1BGXH 2RBLA 4GJTB 4XWGL 1I85C 3MRCA 2DJ4A 5DGQA 3WYRA 4O51B 4FQXB 1T1WA 2APXA 1RUAH 2Q8AH 4XPHL 1FN4B 1TZIB 5MERA 4RFNB 5I1LA 4GMSL 1TJGH 4GG8B 5BQ7B 4HCRH 5GSRA 3D0VA 3O6FC 5B8CA 2AK1H 2V5YA 4X99A 5HYIA 1X5HA 4FZEH 3BGFC 2G5BA 2WWMC 5FYLH 3WDJA 2GTZA 4MNQB 4E41A 1TMCB 1GSMA 2VAJA 5K93A 4D9LL 3TYFB 1WAAA 3F7RA 5GJTH 1PDKA 1CE6A 1UENA 2G75B 3L5XH 4D0BA 4M61A 2BHYA 2EH8H 3RGVD 4M5YL 4AK1A 1LO0H 2X42A 1ED3A 1F8TH 1IQWL 1JNHA 1B90A 2WUBH 1IGIH 4YFEA 1OTTD 3BZFB 3QULB 4G8EB 4IRSB 3VFVB 3JV4B 5CZXD 1OTSD 2F9BT 4PTUB 3O6LL 4PB9H 3P4LA 4KKCD 4ACPA 3STZB 2HH0H 2HN7A 5DFTA 5E5RB 3LKOA 4FNLL 3NFNA 4CBPA 1GGTA 3FONB 4LP5A 1RUAL 2Q8AL 1SM3H 4ENEC 1UXWB 2ESVA 4K3EL 4JHZA 3TESA 3OXSB 4F15C 1X9QA 3EDDA 2CKBH 1TJGL 2JLLA 1FFOA 2YD1A 1S3KH 5C0BE 3GHEL 5LGHH 2J2ZA 5BS0A 3VXSB 2YD5A 4IJ3C 5K9OB 1WICA 4PRIA 1DLFH 3LY6A 4HUMB 4Y1AE 3L7EB 2P5EA 1A4JB 5GJTL 1KTDB 4PGBA 1U8IB 3L5XL 1B0RA 3IDIA 5C07B 3SDAD 2EH8L 3U4BH 2BRQA 3QRFM 4WUUE 5IW1B 3MRIB 1ZEAL 2WUBL 3WIFA 3MV7A 3ZTJG 1IGIL 3OKDA 3IS1X 5T3ZH 5J56B 3BQUB 5FYKD 1MFDH 2QSQA 1ZLSH 4PB9L 4JQIL 3Q48A 2YBRA 3HUJF 2A6DA 1YEHH 1C16A 4ZS6C 5KVFH 3G04A 3QFJE 3IB4A 4NNYA 4Q6IA 4LLDB 3X3FH 4BFIA 1ZHLB 5CBEA 4D9RE 4MMZC 5I19H 2HVKA 9CGTA 5C9JA 5CJQL 4XGZA 2WBJB 3AREB 3LKSA 1LDSA 1HSBA 4X83A 1G6VK 3SGEI 2H8PB 2H2PC 4FQLH 2CKBL 3UC0L 5TGBB 3VFSA 4LARH 3BN9D 5L8JB 2XG5A 3MREA 3GMLB 4HZLA 2WBKA 4QRRE 2NXZB 6CGTA 4LEOA 1U8JB 3RWJB 4OV5B 2HLFD 2G5RA 1U8LB 5E56A 4UBDC 4I5BA 4PG2A 5B22A 3S4SB 3T65B 5F89A 4X6CA 3TV3H 5GGUB 5HHQA 5I1KH 4MA1C 2A6JB 1G6RH 5DVOA 1HDMB 1WBYA 1IAIM 1MFDL 3ARDA 2ZG3A 1AFVL 4UT6H 4UNVA 4J3SA 2EZ0D 5ALBH 4DZ8A 4OZIA 3B9VA 4HSQA 3KJ6L 5IJVA 2W92A 1MJ8H 3VE0B 5KVFL 3HUJB 3TN0B 3IFNL 3X14A 1QRNA 4YNYA 3CDGB 4ZUSB 1XAUA 4E41D 1NFDE 5IMLB 5CJXA 2R69L 1OY3B 3MRLA 1BWMA 4Q97A 4D94A 3PWPA 1V7MH 5D2NA 2QSCL 4ESKA 2IANE 5CILH 5FGCE 2NCMA 4FQLL 3VJ6B 1OVZA 5E8NA 2N1KA 2MCPH 3WUZA 1OL0A 3HLAB 5AWNH 1SHMA 4LARL 3CLEH 4GRMB 3BMWA 4HULB 4HEME 1YEDB 1MJJA 3JWNC 3ULUH 2XQBL 3AB0C 2YA1A 3I75A 4P3CL 4LNRB 4YDJB 3D2UD 4LVNB 4XBGB 4F2MB 3Q2CA 4KZEH 2NY7H 2AV7A 2P45B 3U0PB 1IILE 3EYQC 4FZ8L 1XF2A 3GSNB 1P9MA 4OT1H 1KJ2A 3MLYL 3MMEA 4L4VA 3SDXA 2ADIB 3RIAK 4NKOA 4R4NC 4YK4B 3ARZA 2CDEA 1GC1H 1OOAA 1QTYT 1K5NB 4HK3J 5D7JC 4UT6L 4JG0H 1WLHA 1DFBH 4KJQD 3CJJA 3MX0A 5ALBL 4NN7C 1DQDH 3PJSA 5DEFA 4YZFF 1TVBA 2X4UA 3EYVB 3IXTB 5BS0D 1YNKH 4HWNA 4DCQB 2PYED 1JF5A 3E6HB 4XNQB 3HZMB 1IFHH 2ENYA 2P5ED 3GMNB 3T0EC 1HSAA 4PJBA 43CAA 3I3EA 3W39B 4KZDH 2VDRH 1IGTB 2BNQA 3B5GA 2OK0L 1C12A 3AS1A 1NGXB 3FL7A 3NCJH 1J8HE 2MCPL 1SBSH 1OP9A 4ZO8A 5AWNL 5KVGL 1NAMB 2NY3B 3CLEL 3GSOB 3KPPB 4KVNL 5H94A 3WS3B 2QJDA 3B9AA 3P0GB 4FQHB 3UTOA 4FFZH 1N59B 4P46A 4BZ2H 2FJGA 1IARB 3O3AB 3BPCA 5D2LF 4NQUA 1BD2E 2YPKA 5GRXG 3CK0L 4KTEH 5JHDB 3QHZH 1ES0A 3HNTH 5DRNB 3TH2T 2HT3D 4YHKL 2XQYG 4QHUA 4XCFH 4OT1L 1ND0A 2IMNA 4H26A 1CXLA 1NFKA 1INQB 4I18C 1FV1A 4JG0L 3U0TA 2ICEB 5A2KH 3CXDL 4Z7UA 5SX4I 4M3KB 4HF5H 1QSZA 4NQDB 1YNKL 2VO5A 2V2XB 4WI7A 4KK5D 5JORB 2AJXH 5CFHA 3DXAE 5EOTB 4FQ2H 5HPOA 4XAWH 5DUPL 4AEIL 4U31A 1NUNB 2R56L 3RL2A 3AU1B 2P1YA 4LLWA 4KZDL 4JAMB 2DN7A 3B9DA 2P7TB 2XWJB 2W9EH 2I9LB 1XH3A 1Z2KA 1SBSL 4RGNE 5BZWA 2ICWJ 4UUJB 3KPRD 4MDJA 4EOWH 2Y72A 3KPTA 1GGBH 1QBMH 4J6RH 5GZOD 4JDVB 3WNNA 2KQNA 2DI9A 2EH7H 2IQAA 3CD4A 4FFZL 4BZ2L 3HS0A 4LKXA 2G2RA 5C8JB 4Q9BA 5MEPA 2IFGA 3VG0L 2JTDA 4KTEL 2XOTA 3JTSB 3HNTL 3GSRA 4YDVB 2Q3AA 4IIQA 2HKHH 4XP5L 5HI4D 4XCFL 5D2LB 1T0MB 1CE1H 2UWEF 4DFIA 5EU3B 4CNIA 2B39A 4GS7B 3HB3C 4WFHD 3P9LB 4EDXA 2EDLA 4WI2A 1AIFA 1YN7B 8FABB 4WFGE 4PREB 4FQ2L 4OLWH 2VWEE 4XAWL 1JGLH 1CIDA 4F7CA 1ADQH 1MHCA 2NY1D 2PW1B 3NVQA 4OQTL 3SGEH 4M5ZL 2MTPA 5FYLE 1YEKH 2W9EL 1BF2A 4L4VD 3DURA 2GYSA 4V1DE 1RUQH 1F13A 3T2NH 5ESVA 1GGBL 1QBML 2P5WA 4JY5L 1NGWA 3VXNB 3QXDB 2EH7L 4X80H 2ENSA 3PP3K 2ADJA 1Y0LA 4O5LH 4UIMA 1HQRA 4U1NB 4EKXA 1RAMA 3I02A 1JTTA 2ZUXA 3JUYA 3HMXA 3VMOA 1MCFA 1RZGA 1KJVB 2GAZA 3QIWA 3QEHA 5KS9E 4L8BB 4PP2A 1CE1L 1Q94B 3MC0A 1AH1A 5GRZA 4LGRB 3H3BC 1AJ7H 1WT5C 3U7WH 3FOMB 1KCLA 4LCYA 2UWEB 3RGHA 2VABB 3TA3B 1JV5B 1Q9KB 1Y18A 1QRKA 5JW3H 1NCDH 3DSFH 3P0VH 4LCWD 4OFPA 1UKQA 2ZSWA 4K8RH 3GMPA 1MLCA 1JGLL 1HYRC 4YO0B 1OAQH 3UBXB 1ADQL 4NZTL 5DK2B 4PLKC 1J0YA 5L0QB 1NGZB 3DHJA 3I85A 4P57B 1YMHA 4X4XB 1Z9SA 3GI8H 2DQHH 4WWKC 2YN5A 4WV1A 5BZDA 4JFDD 3MLPA 2WIIA 2MQ3A 3O81A 4N8VB 4O2CB 5ETUB 3WNLA 3NAAL 1OAZL 5C86A 4X80L 3O3DB 3ZKXC 1UVQB 1W8OA 1DQQA 1ZT7A 1OQXA 5T3ZE 4K3JH 5CJ8A 4CADA 4GKZB 5HI5C 3GBLA 4KI5D 1H3PH 2O26U 4K3DH 5DJ6B 5DJAB 2CK0H 2WM0A 3VGGA 3W0WB 1ZVSA 1MFBH 1AJ7L 3U7WL 4JFEE 3DX9B 2GSIA 4HGWB 5JW3L 1NCDL 3DSFL 3KG5A 3P0VL 4WO4A 4HK0A 3QO1A 4K8RL 2IWGA 1CFQB 4FQXC 1J11A 4ZUWB 5C1MB 1SVCP 1FIGL 2OI9B 3MFFA 2D4FA 2FX7H 3GI8L 3EO9L 2BCKB 3G5VB 4M8QA 4RFNC 5JQ6H 2DQHL 3SKUD 2XKNA 4P5TA 1ZS8A 3RWGA 5CZVH 5GGVY 3KYMA 1D5ZA 2VKXA 1OP3H 3BWAB 3HZVA 1A9EB 4FQ1H 5ANME 1FZJB 5C0BB 3BPOB 5F1SA 1H3PL 1NLBH 4K3DL 5GS0L 2W0LA 4FG6C 2XN9B 4H25A 1MRCL 3BEWB 4BQBA 3UXFA 1RK0A 4DGVH 4IRSC 2VAAA 2YD8A 4QHKJ 1WBZB 2BNRB 3VXRB 2F54A 1U2CA 1HEZB 2WINB 5SWZA 1NCUA 1QPXA 1JHTB 1Z6JT 4G42B 1HIML 3CFBB 1S9KC 3B8YA 5EB9A 2Q76B 3HR6A 1ZK9A 3OGCB 3SDDB 5IB3A 5I8OH 3O4LB 4PRHE 4DAGH 5IG7A 4QRPA 4PJEE 2FX7L 5KAQF 3ULUE 2V9QA 2ZSVB 3QIWD 3S5LA 3MYZA 4PBWD 3L6FB 1A1NB 1IC7H 2W38A 4R4FH 1EV2E 2OBGA 5CZVL 1IRAY 2FGZA 4U1KB 2Y06H 2DLGA 1YECL 4PIRF 4CAGA 2EDYA 3CUPA 3OMZA 5SWSA 1I9JH 4FQ1L 4RMWA 2GK0A 1KTKE 2FR4A 1NLBL 3VFPA 2HT4C 4J8RA 1U36A 1Z0MA 5IHUH 3EZ8A 4XCNB 3BQUC 4DGVL 2DJSA 4HS8H 3QUMB 3PG2A 4RNRB 3GMRA 3ARBD 4ZUTA 3V5HB 3JWDC 4RMVA 5E1AA 4PJ5B 3RVVD 4F3FA 3MOQA 4X9BA 4OZGF 4WFED 2R0WL 4D8PA 4BSWB 2V2TA 4M62H 1NUFA 1OARH 1UM4L 2ZUVA 2NY0B 2NW2A 3NFSL 1KLFA 1Z3GL 3BVNB 3P73B 3HI1B 3WXWH 2CO6B 25C8H 4LPVA 2WBJC 2J6EH 3AREC 3V2AR 4WW1B 4OUUA 3L3JA 5CEYB 3WFEH 3LEXB 5E2VL 2VLJA 3DVGA 5DD1H 2BXYA 3BKJH 3MV9A 4P23B 3RKPA 3CDFA 4NQCE 4C55A 1IC7L 3E3QE 1PD6A 1VEMA 5JZ7D 4M7ZB 2OS7A 2J8UF 3ZDXF 1E6OH 1HXYB 2NXZC 2GI7A 4O9HL 1QEWA 2Y06L 1EBPA 1OGAB 5LVEA 5L6YH 4NKQB 3U0WL 2CLVA 5DHYB 1J5OH 1I9JL 1GZPB 4WO4D 4YQXH 1EJOH 3MV8B 2JJTC 4UT7H 1DR9A 5D8JH 4PGEB 4RMSA 1SBBA 2MFNA 2IAMB 1WC7B 2CIKA 4HS8L 3RPIB 3NFPB 1A1OB 5F7NC 2R2HA 4TUJB 5IHLB 5C0EA 3MRPB 1YEJL 2DKMA 5DJ8B 1K8IA 2YZ1A 3BH9A 4MHHG 5FO8B 2EYTA 5LGKA 1A47A 1I3RB 3FQWB 3GMMB 1NQBA 3TN0C 1OWRM 4M62L 1OARL 5JTWA 1N2RB 2BSTB 4MD5B 4OZGB 4YDIL 4RWHA 1EERB 3OBAA 3MA9L 1U3JA 1ZA6B 1LO2H 4WFFE 2B1HH 2IH1B 3PIQA 2J6EL 3Q5TA 5K59E 3LN4A 4I0PB 5IMOA 1NC2D 3Q5YA 5CHNB 5DD1L 2I07B 3V4UL 4R7NB 5DJ2A 4HBQA 5IEKB 2AEWA 4Y88A 1Q72H 4HWBA 2GCYA 2W07A 2IEPA 3HE7A 4XPGH 5HHOB 1EHNA 1CL7L 3T0AA 3BN3B 3ARQA 4LVNC 2NQCA 1U8QA 5SWZD 1A6ZB 1K2DB 1QQDB 2J8UB 1WISA 4U6TA 1MFCH 5CWSB 1J5OL 3DMMA 1J8HB 4YQXL 4CGTA 4PJXE 3RQ3A 4UT7L 1MCJA 1VFMA 3JV0A 4YLQT 4S1QL 3DX8B 3QDAA 4MQTB 5FUCE 3QFDA 4TTDC 4YK4C 3EYUH 5FF6B 1ZGLB 5DZNA 2O93L 4C57C 4MZ3A 3DX6B 4M1DH 4MYWB 5MHSE 1S7QB 3FT4B 4YE4H 5HHME 4DOHE 4HIEB 3OKYA 4NKIL 4Y1AD 2ZP0T 3NCFB 4HX1B 5IBLD 1L0XA 1A4KB 5J9PB 1LO2L 2CJUH 1DANT 3MRBB 5ILTL 1T5WB 3M45A 5GRUL 5SWSD 1HYSD 3RZCB 4UINL 5GIRB 1RIUH 2CGRL 1IGYA 3SDCB 4RFEB 4WUUD 1JI2A 3QG6B 3BKCL 1X44A 3UPRA 5AD0A 3QPXH 4M1GL 4Y16A 2NY3C 3TCLA 3L7FA 1Q72L 3G6DL 1J86A 3U79A 1UWGL 3O9WB 3U9UA 3DJ9A 2BVQA 3PL6D 3P40A 2OTWB 4P9HL 3QFJD 5I1JL 2E9JA 1R3IL 1MFCL 1NAKL 4D9RD 1V5JA 4WY7L 2X4TB 5H2BB 3F5WB 1ORSA 4IMLB 3KLHC 2C3VB 3QEGH 4ZYKA 1XCTB 2EYSB 4ONHA 3EGSB 2VLJD 4M1DL 5D6CA 3MV9D 1XGUA 2A9NL 4YXHL 3V4PL 4S10A 4LOUD 4LVOB 2AK4E 4Y2DD 4QRRD 4HAGA 3MNVA 2HFFB 3GSVA 3T3PE 3VI3F 2CJUL 2Z92A 3EJJX 3P2TA 1RIUL 1AO7A 1S7VB 5FGBA 4CW1B 1OM3H 3ZT6A 2IC2A 2GW5A 5L8LB 3RY5A 5ELIA 3PWUA 2EC9U 3QPXL 3FO1A 2BX5A 2AERT 5AG8A 3BSZH 4K7FB 4M6MH 4MAUL 3IDMA 4MX7A 5AAMA 4BZYA 1FCGA 4WHTB 3VRJA 2ZCHH 5EU7C 4LSRL 3FTGA 2WWKO 3N1QC 3TFKC 5T3XH 1PLGL 3LN9A 1NGYA 1AGBA 5JLZB 4U3XA 2IAND 2OL3B 1E4KC 1UB6B 2EYRB 4JDZB 1NJ9A 4MVBC 3WIIH 2FEDC 3FQNB 4GW1A 1P7HL 2DTMH 5DS8B 4R4BA 1SYVB 3LV3A 2DDQL 5F9WB 2C4FU 1WEJL 1T7ZA 3T3ME 4GAYB 3OAUH 5JW4M 1AE6H 3A6BH 3DMMD 3DGGA 2CH8A 4NRXB 3ULVF 1MREH 1OM3L 5EU4A 4BKLA 4V1DA 4ZOBA 3IFOA 4YGVA 3WCYA 4PJGF 4YDLB 3M07A 1MCHA 4J1UA 4TULH 2GJZA 5FV1L 1BF8A 2FD6L 4GOSA 1HOCA 4M6ML 1AP2A 4CJ1A 4PLJC 1BQSA 1XF4B 2YKLH 2ZCHL 5JXED 1CQYA 1PKQA 3UDWC 4NT6B 3BIBX 4M7KH 4PRNA 3ZKND 5HVHB 2FWOB 3I50H 3SGKC 3QEQE 4PYHA 1WV7T 2SEBA 4JY6A 5DMKB 12E8H 2P46B 1OAKH 3REVB 3KYNB 3TA3C 4Y16D 2DTML 3G08A 1KN4H 2W0KA 4RAVA 1VEOA 1G7MA 2DQFA 2CKBA 4Y5XB 4D0DA 4XWOD 5J8OA 5I1HH 2JE8A 1BD2D 2FZ3B 3OAUL 4B50A 1AE6L 5L0QC 3A6BL 4JFEB 4IBLT 3H9HB 3U36A 1U92A 1DUYA 1MREL 5TDNB 4HHAA 4LK4A 1T83C 1LMKA 2OJZH 2XFXB 1A7RL 4TULL 3T8XB 3ULUF 1Q1JH 3D69A 4HWZB 4NFCA 4OCWL 5GGTH 2A74B 4PJGB 2O61B 1G7QA 3GEWB 1D6EA 1I1FA 4PTTA 3AVEA 4BH8B 3IDGB 5C71A 5E94B 1LP9F 3DXAD 4D3CL 1JF1A 1UKTA 2GITA 1KN2H 4I9WD 5T5NG 4GG6F 3TIDB 4N0RA 4HV8A 4M7KL 4AEHH 1KTRL 5CJOH 4JFQA 4PGDA 4OFDA 1FVDB 1AO7D 2FBOJ 3K8KA 3C09B 4RGND 2CD0A 2FYYB 3JV5A 5IB2B 2CMRH 3AAZA 3MRGA 3TJEL 1I7TA 3HPJA 3SKNB 3BGMA 2VKWA 2ZKHL 2OI9C 1OPGH 1JNLL 4ZOCA 3BDYH 3WSQH 4APQB 1VGEH 4CDGC 4MCZA 3LB6D 5DQ9A 3WEXA 1IM9B 1C08B 4CVXA 1NFIA 2OJZL 2VZVA 1FZKA 2OJEB 3M8OH 2RIKA 4J4PD 3EDEA 3NZHH 2CDFB 3B3IB 4MD0A 1U8HA 5MENB 2YA0A 4BUHA 4QTIH 5DJXA 4WFGD 1HH6A 3BW9B 2FH6A 2R8SH 3LSOB 5HHNA 3HE6B 5H8DA 2C3GA 1ZLVH 3VWKB 3BPOC 2XYCA 1QSEE 2DQGL 4ZD3H 1LP9B 1RY7B 1F11B 4PJDE 4AEHL 1AC0A 5CJOL 4HBCH 3ORJA 4EVNA 5KSVB 4GG6B 2XWTA 3CSYA 1UT9A 3SOBL 3DARA 4V1DD 3ROLB 4HJGB 4XP4L 1G7IB 3S96B 2MPAH 3R06B 4CU6A 5EC1B 2CMRL 4GKNA 5DJYB 5ECJE 1MIEL 1RJZA 1H3TA 4L4TA 3BYTA 1Z9OA 1X5XA 3UTSB 3ILQC 4ELMA 4YBLB 3SDDC 1A7OH 2R2EA 1AKJB 3DO7B 4PJEA 4QOKE 4U1IA 1OPGL 3BUYB 1LEIA 2LABA 3MRDB 5FCUH 1CDHA 5JOPE 3L3OA 4PJ8A 1OD9A 3WIHL 4WI9A 2VL5A 3M8OL 2VQUA 1EMTH 4LDLB 2VDQH 5BCAA 3NZHL 1CDCA 3D25B 3HHRB 2HFEA 5LCVL 4F9LA 1F3DH 4OLXH 1MQKH 4F37F 1BAFH 3EOAA 1FO0L 1PX4A 1VFAA 5ERWB 4IHOA 4OF3A 4ZD3L 1UCTA 1O7VA 2V2WB 4HIHB 1LVEA 3X3GH 4C4KO 4HBCL 1RJLB 4GXUN 4K94L 2WMPA 1RUKL 5DHVH 4FXLA 2AJVL 4KC3B 2MPAL 4M61B 4KK6D 1JZ7A 2NYYD 2DM4A 2YEZA 2Y25A 3MCKB 1JNHB 2Q7NA 4ZXBA 5IQ9B 1JPGB 4JJHA 4XTRC 3F12A 4LQFH 2NY0C 1F4WH 2BHUA 3TO4A 2HRPL 5T3ZD 1A7OL 1CXEA 2WQRA 3FB8A 4MZ2A 3MSPA 3MUGA 2OYPA 2VQTA 1RVFH 3WJJC 4ODHH 4P23C 3ARYA 4OF7A 4ONOA 3MPCA 2HN7B 4JFPA 1EEQA 2VL4A 4P9MH 3LKOB 1DN0B 3I84A 4XHQA 1EMTL 4M7ZC 3ESVF 4NO5A 3OKLA 2ESVB 4NN6C 5AG9A 3RJDA 3KPLA 4OLXL 1MQKL 2X4RA 1BAFL 1RPQA 5IJKC 3EO0A 1ZT1A 4OB5L 4W81A 2IAMC 5KVEH 2DWDB 4AH2A 4PRIB 2EICA 4DVBA 2HTKC 1HHJA 3R4DA 3QZWB 2NY6D 4X6CF 1K3ZA 4PGBB 5DD6A 5C7XL 1JGDA 2CLZA 1OP5H 4QY8A 3BP5A 1VFBA 1WZ1H 3DRQA 4OQTA 1DVFD 1FC1A 3LPWA 4XNZB 3WIFB 3HI6H 3MV7B 3OKDB 3MXWH 3BFOA 1F4WL 1WZLA 5D7SH 4Y19E 1II4E 3KDMA 4FS0A 4Z95H 4Y2OA 4CUCA 2YBRB 2FB4H 2HTLC 4I0PC 1RVFL 2A6DB 4TYUA 5HHMB 1J1XH 1D6VL 5C0CE 5IFAL 1U3HD 1AGDA 1MAMH 4L9LA 3SKMA 3T3PF 1OGTB 4Q6IB 3PABA 3VWJB 1GOHA 3IETA 3TO2A 3MRJB 5C9JB 3MLXH 1AY1H 5D70H 4K9EC 4XGZB 3LKSB 3QIBB 5T3XE 1JYWA 1BZ7A 1LWRA 3MLZH 3QG7L 5FM4A 1IAKA 2X41A 5CJ5A 4LRIA 2PXYC 1X7QB 2PN5A 4KKAC 4LEOB 3O6MH 1X6NA 4POUB 4I2XA 4HUXA 4PJ8D 4OUOA 2XRAH 3L3DA 3SDXF 1G9MC 2VMFA 4G9DA 4I5BB 1KYOJ 1WZ1L 2VIRA 3VDAA 4EUPG 5F89B 4X6CB 2QTEA 5HHQB 4KKBD 1DQML 3I3BA 3HI6L 3LD8B 3SE4A 1WBYB 3DVNA 3CGTA 1OF2A 2DBLH 1F3DJ 2VZ3A 3ARDB 3PQYA 4Z95L 5KANG 3RZCC 4ZPTB 3WUWG 4DZ8B 2FB4L 1O0VA 3SDCC 2Z35B 2MHAA 2HJFB 1PG7L 3TLRA 5IJVB 2J88H 3GNMH 1MAML 1YEGH 5EWIL 4PJBF 4CKVX 5DTFA 3X14B 1QRNB 3IT8D 2VISA 4NBXB 4XNXL 3O9WC 3MLXL 3DIFA 4EXKA 5D70L 3PWPB 1P2CB 3LZFH 2AXFA 4OCNC 4X0KB 3C5ZC 5E8NB 4YDKH 3T0DA 1RMFL 3MLZL 4ZXBD 4CJ0A 1VPOH 1U41A 3LRHA 3TO4D 2AQ3A 5E6IA 4POZD 4PRPE 1A02N 5B39G 4AIZA 1T66C 2VXVL 5F7UA 2Z8SA 3F6LA 4NQCD 4NGHH 3HC4H 1B4JH 1NPUA 1YJDC 3P4OB 4LVOC 1BJ8A 1XF2B 4R0LB 1R3LB 3SDXB 3OPZH 2A77L 1KLGB 4NQEA 4TRPL 2AABH 4BYHA 2ARJA 3QI9A 1B0WA 2DBLL 2IFFL 2NX5B 1RIHH 4UT9H 2MKWA 1NEZA 5FM5O 3K1DA 2ED8A 3MLSH 1RJCA 5E5UB 5DEFB 1JK8A 2FCBA 4NHUB 5JMOC 2AI0L 3F62A 1JUFB 3SKJH 5BV7B 4UQ3A 3O8XB 1TVBB 4PJFA 4KJPD 2J88L 2X4UB 3BHBA 3W9DA 1KIPA 3GNML 3BEVA 1YEGL 5CP7A 1UA6L 4XI5D 4KHXH 4RMUA 1HSAB 1S7XA 5D7LA 2AXGA 2XG4A 1BMGA 4PJBB 5LAXA 4WWID 3QWQB 3LZFL 3DUUA 3T1FB 2APBA 2BNQB 3S37H 4X9FA 4N0YH 1NKOA 3MRFB 4AEFA 4Z7WE 1NDMA 4YDKL 5FO7A 1VPOL 1UCBH 5J06A 5IM7A 2D7OA 2YR3A 2CR3A 4JANA 1CD0A 2VXTH 5H94B 2D31B 4M8VA 5I71B 3MCG1 4P46B 3UTQA 3BPCB 1CDYA 4NGHL 3HC4L 2YPKB 4HLJA 5TH2A 1ES0B 4LHUG 4UB0H 4XMPL 1KEMH 1I8LC 5EO9A 5F9WC 1ND0B 1RZJH 3RNQA 3MNZB 4RISH 1RIHL 2IPKA 4UT9L 5CSZB 1FV1B 3EDKA 2CSPA 5GS1A 1QFWI 5T1MA 5B21A 5HYEA 3IYLW 3S97C 2VXSH 3BPNB 4F9PA 1GJIA 4YDLC 1IAIL 4UILH 4W4NA 1NANI 3MNWA 5BW7A 5BXFB 1LE5B 3VI4F 1FNGB 4MJIE 2PW2A 5ADOH 3RL2B 1XZ0B 4LLWB 5DHXB 3TEUA 2X9WA 2OTUA 4E0RB 3BKYH 3S37L 4LLMA 3VXPA 3E6FB 1XH3B 3CMGA 5BZWB 4X5XB 4JKKA 4FFVD 4DKEL 2VXTL 3UEZA 1IGJA 2E7LA 3CFJA 2IQAB 3EDFA 4N90E 2ZNXA 3F7YB 3HS0B 3N1PC 2G2RB 3GSXA 2PETA 3ZE2E 1OSZA 1U8KA 4PJDF 1RZ8A 4YHLH 3I9GL 3GSRB 5C08A 2R9HC 4UB0L 4IIQB 4KDVA 4OGZA 1YMMA 2Z93A 4Y5XC 4H8WC 3TVMA 1PZ5A 4RISL 4R3SB 1GZQA 5IWLA 3PGFL 3TBYA 4XZUA 1DQJA 3QUYD 4EDXB 1ITBB 1AIFB 3WO4B 4X5LA 5DZLA 5E6ID 3RWHB 1BVKA 1CXIA 3TIEB 3U2SA 3ULVC 3V6OE 1ZXQA 1CICA 2CRZA 1CQKA 1UZ6E 4C83A 4F7CB 2IPUG 1MHCB 4K8RD 1KEGH 5F1IA 4WVRA 5ADOL 2AK4D 2YSSA 5D72L 1E4WL 2JJSC 5DUML 4S1RH 1A6TA 3BKYL 1KELL 4Y89A 3DURB 3I3DA 4HIIB 2ZUTA 4NQED 3QWRA 4M7LH 3VH8G 4G8FA 5D1XA 5ESVB 2DI8A 4GW5A 2P5WB 5GPRA 1NGWB 1H3GA 4N0FA 1EEYA 3CU7A 4FABH 3C09C 5EZJA 2ADJB 4RGOH 3BD5A 3MLRH 4PBVC 4UIMB 2DWEA 3BP6A 4JG1H 3RNKB 4PJ7A 3I02B 1CLZH 2J6EA 1RZGB 3UPCA 2D7PA 1AC6A 3U4AA 2R2CA 4PJDB 3EFDL 4PP2B 1J1PH 1ZLVK 2W9DH 4ZSOE 1X5AA 2PCPA 2AKRB 4LCYB 4J7RA 2CLRA 5JPMA 2O5ZH 4APQC 4MA7L 2L7JA 1Y18B 4E42A 4Z7NE 2X1XR 1PX3A 1XF5B 1HXMA 3ARGA 4KWUA 1MWAH 2JK5B 5HGAB 3GMPB 1MLCB 4Q2ZA 5F7FA 4YAQA 1G0XA 1TJHH 1KEGL 3IXAA 3SCMB 4QHLB 3MLUH 4I3GA 4JKWA 3MCLL 3GJFH 4S1RL 2FEEI 5I1GH 4RMRA 1I7RA 3MJ9H 3HE6C 4G3YH 3VWKC 4WV1B 3OGOE 2W0FA 5BZDB 3CSPA 3LN5B 5ITFA 3PGDA 1A14H 1MSPA 1RQ5A 4JY4B 4FABL 4IS6A 1KYOK 4RGOL 1DQQB 4JG1L 1ZT7B 4LKCA 1BLNA 1NLDL 1CLZL 3QUXA 4OZFH 4YFLF 5F9AC 3QDMA 3QUZD 3RTQD 5GRWA 1BQUA 1CZ8H 3UAJD 1MPAL 3BD3A 4LMQI 2X9YA 3W82A 4EQ2A 1EAJA 2X1PA 4LFHD 1ZVSB 4YBLC 5I74B 3T2PA 4QYOA 1CCZA 5GQBA 1ZAGA 4KK9C 2O5ZL 2R4RH 5C0AA 2GSIB 1INDL 1N5YH 2EKSA 3DUSA 2BVEA 3EJYD 5DJDB 3SGDI 5CKAA 4HUUA 3QEQD 2MQ0A 4HK0B 3QO1B 4XXDA 3D39A 3ET9F 1T21A 1TJHL 3CC5A 3MLUL 1IT9L 1T0NA 3C08H 3Q6FB 1KXTB 3R0MA 5GJSH 1JWUA 1L0YA 1WFTA 1G7JA 1DSFH 4JE4B 5I1GL 3MJ9L 1D5BB 1EEUA 4P5TB 1ZGLM 3TVMD 4S11A 3RWGB 1LHZA 3VG9B 1A14L 4XNYH 3QXUA 1D5ZB 1NGPH 4YWGH 4DKFL 1N6VA 5TDPA 4IDLA 1IEBB 4Y4HA 2G9HB 3RWEB 2F53B 1QSFA 2P4AB 1QZ1A 3RWDA 1FZOA 1CZ8L 5CSBA 1EZVY 1F90L 3L95B 1RK0B 4UDTB 3DBXB 2A6IB 1KB5B 1QFWH 1T3FA 4JHWL 3OX8A 4JM2D 4QT5A 2F54B 4YBQD 5FOBB 1UJ3A 3QWRD 2NPLX 3WS6A 5D1XD 2X89A 3N85H 3ARWA 3S6CA 1NANH 1DBKH 2Z31A 1I7UA 2PYFA 1OP5K 4GMTH 4P3DA 2FNBA 5DVKA 2BY3A 4Q74A 2OR8A 4KROB 4QRPB 5GJSL 3K2UH 2V5SA 3B2UC 4LAJH 3S5LB 4GAGH 4QGYA 2JCCE 2NY4B 2AP2A 4P2QE 4RQQB 3HAEH 1SJHA 2ADFL 4XNYL 5EOCH 1NKRA 1FDLL 5L88H 2VZSA 4JO1H 1JWMA 5GRYA 5KZCD 4JDTL 4LF3A 2GK0B 2ZZUT 1U0QA 2AEIT 4KV5E 2P24B 3MQIA 4XNZC 3ALPA 4O00A 1N6QH 3GMRB 4ODVL 1I4FB 4HK3N 1QSED 5E1AB 4OD1H 1MI5A 3SN6N 4F3FB 2EKJA 4OGAC 3N85L 1MAKA 1VDGA 4X7EC 1RURH 2V2TB 4N0UA 4Q6IC 3VWJC 2VLRA 1VENA 1FSKB 5I15H 2CUIA 1U8NA 3QUKA 1T1YB 2W60B 3QIBC 3VXUE 4PLNC 3QUXD 4QHMA 3QDMD 4NM4H 3L3KB 4GRLB 4U3HA 4KGLA 4XMLH 4B0MM 1FFPA 3DVGB 3C8DA 1ETZB 1U58B 4IRJA 4GAGL 2I9TA 1C7TA 5C09A 5ID1A 1I75A 3MGTA 3GMQA 4NFBA 4QOKD 5IIEA 4YX2H 1CGSL 3VFGL 4WNQA 4KK5C 3OTTA 3UO1H 3VRIB 1SY6A 1QEWB 32C2A 5L88L 1EHLH 3O3BA 4JO1L 2EE3A 5J57B 4LHQB 2CLVB 3BT2L 4PG2C 1GVIA 1GYAA 3G9AB 4FMFA 3D39D 4Y5YA 4A6YB 1BZ9A 2M26A 4OIAA 4ZUUA 3CX2A 4N68A 4PRPB 4LCCA 3CFCL 1NBYA 1T1ZA 3MV11 4G43A 3CFDB 5D5MA 3ARDC 2R2HB 3AROA 3KPNA 3LKRA 4KGJA 4S1DD 5IOPA 4GRWH 1YUHA 2DTSA 5EBLA 3R0NA 4CDHA 1PQZB 1FFRA 2ZG1A 1CXHA 4YBHA 3ZSSA 3RZWA 1TPXB 2FSEB 4HKBA 1FPTH 5E00A 5I15L 1KACB 2BHZA 1BEYH 4QHNB 4WTWA 5D2NC 5M95B 3C6LB 3LN4B 4NM4L 1M7IA 3DLQR 4JO3H 4XMLL 4DEPB 1EK3A 3QYCA 1IGCH 2KUTA 4L1HA 2APWA 2V5TA 5GZND 4GKSA 4G6JH 4YX2L 3HE7B 1IGMH 2GT9B 2O5XH 5HHPA 1U8QB 2GY7B 1EHLL 3AC0A 5FIEA 3DMMB 5FXCH 4F58L 2E6PA 4PR5B 4YR6A 5HPMA 4U7MA 4R0LC 4G6AC 1P9MC 3MRHB 2VE6A 3RHWK 4FQJH 5TDOA 1XIWD 3QFDB 4RIRA 1UJTA 4YHPB 4EN3A 3GUTA 2H45A 1EXUB 2GJJA 2RQ8A 5IT2H 3VGEA 3FB5A 3RWCB 5BV7C 5KN5B 3O8XC 3SGDH 5L9DH 4LPCA 1PJ9A 2BNUB 5HI3C 1FPTL 2UZIL 4OCRH 1BEYL 4N8CH 4HH9B 4NJAL 2ZOLB 1H3UA 4KRPB 1IGYB 2FEEL 2IPUK 2VH5H 5CJBA 4JO3L 4DZBB 2I25N 3UMTA 3LKNB 3TCLB 4Y19D 3OAYH 1JN6A 4X7CC 4G6JL 4GQ9H 1JZ3A 1IGML 1QFUH 3O2WH 5I71C 2O5XL 5C0CD 1MI5D 4OCYH 4P46C 3F7VB 3RVWD 4JRYA 2H26A 3JV6B 1J05A 1BFOA 1T6VN 2VLRD 4G9FE 3KHOA 1ORSB 4NC2B 5T3XD 4FQJL 2FO4B 3O41A 1E28A 1YDPA 2XZQL 3BJ91 3WIHA 5I1CL 4JFHE 5EH1A 5DEGB 2EDEA 3VFUB 5D6CB 1U8OB 4AQOA 5FDWA 1XGUB 3IFLL 4IRJD 5D7IF 3WN5A 1D9KA 1ONQA 4U6XA 2IG2L 3BPNC 4H1LG 4H5SA 2CQVA 3NCYS 5L9DL 1JZ5A 1LO4H 1FO0A 1RU9L 1NC4A 3GSVB 4NZRH 5F7MC 1FL3A 2C3WA 2Z92B 3P4MB 4OCRL 4R97B 3TH4T 4N8CL 5DR5H 1JFQL 4O2FB 3P77B 3EFFA 4B41A 1YPZA 2VH5L 3QB7C 5C70A 7FABH 3RAJH 1KFAL 3K4AA 1M6OA 3E1F1 2DIBA 3VRLE 5EZOL 2P47B 1F4AA 3RL1B 1QFUL 4R2GD 3IDMB 4OCYL 4M9OA 3IDYB 2LU4A 3VRJB 1S9VA 3VFMA 1J1OH 1IAOB 4JFXA 4P4KD 4DTGH 1QFHA 4CVWA 4IIQC 4P5KA 1BQHG 3JTTA 5D6DA 4MB4A 3SEPA 1CFTA 1ZGLP 4KY1L 5KTEH 5EU5A 5F9OH 1KXQE 4FXGA 1J0KA 3RDTB 1E27A 4R4BB 3WO4C 4C56E 4I77L 2LFGA 3S3JA 4XX1G 5D7IB 4XBPA 1UYWH 5F7EH 4ORGA 4PJ9D 1P5VA 3CCHA 4MXVE 5FB8B 2F5AH 5C0DA 1J0HA 1CR9H 5DR5L 3DGGB 4BKLB 5ACLA 4P2OD 1I8IA 1NGQH 3BD4A 3PDOB 1RZKC 3RAJL 3IFOB 2FGWH 3WDHA 5HVGB 1HHHA 4X6FB 1DBAH 2E27H 4EN3D 4J1UB 2GJZB 5DRZA 1U3ZA 2R1YA 2B20A 1HOCB 2ZCLH 1P69B 4KUCD 2WLYA 3FN0L 1XGTB 4M3JA 3QQ4A 1C1EL 3R1GL 3B9KD 1P4BL 3U1SH 5DD3L 1J1OL 3CZFA 2D9CA 4Y4FB 2DQDL 5I66A 3WXVL 4Z76A 1PKQB 3BAEH 4L8DB 4M1CD 1UADC 4JJ5A 4PRNB 3RUGA 5DMGD 2R1WA 1MHEA 2X10A 2IADA 4JY6B 4F7EA 5FEBA 5KTEL 4XCYA 4U1LA 4KKLD 4NQXA 5E8DL 5L2JA 1JGEB 3WJLA 4BFEA 2YWZA 4Y8DC 4RAVB 3SBWC 2YD2A 1G7MB 1FBIH 2DQFB 1M05A 5C92A 4D0DB 4LSQL 5F7EL 1MCLA 5I1EH 4EUPA 2PO6A 4JPWH 3SCMC 2UZXB 3HNVH 2F5AL 4JRYD 3U6RA 1RJYB 2NY2D 2DQJL 4P2YA 1CR9L 2OZ4H 4OKVB 3UJTL 4JRXE 4XPAH 1YY9D 3CMOH 3DECA 3EYOA 4AL8H 4WV1C 1K4DA 3N1GC 1E4XI 4JZNB 1U93A 3RWFA 2E27L 2BJMH 3D69B 4G8GA 3H7BA 4PJIA 3RI5F 4AMKH 1BVLA 1I8KA 5J1AB 3I6GB 1YEIH 5TF1H 1HQ4A 1D6EB 1FYTE 1I1FB 2YWYA 4PTTB 3TCXA 3U1SL 3I6LE 4PS4L 1I3GL 4MJID 4RCAA 3BAEL 1CFVL 3MGOB 4PJAE 1NC4D 2DM3A 4HV8B 4U0RB 3P0YH 4JFQB 2V17L 4PGDB 2VDPH 3FT2A 5I74C 3S34H 4KV5F 4LNVA 5DC9B 1MCWM 1E6JH 5B39A 3LH2H 1LE9B 5ICXA 3PV7A 3NIGE 2ITCA 3ULSA 1GXEA 5A40E 4XCEA 1T2QL 1QNZH 2H2SC 1I7TB 4JCLA 4XMKH 1H3WM 3BGMB 3EDJA 4NHCH 5I1EL 4Y4KA 1LK3H 3HNVL 1I8MA 5E95B 4AG4H 5FKAA 1TQCB 3L5WA 2OZ4L 5C3LD 4XPAL 1CN4A 3CVIH 4MCZB 5DQ9B 4MQXD 3WEXB 3NACH 4CVXB 1NFIB 4P5TC 4WEBH 5F6HI 5MEOB 3WFDH 4EI5A 3VG9C 5DD0H 2WAHA 3ZE0E 4G6KH 1U8HB 4KH2A 4NNXA 2FX8L 3BUTA 2JJWA 5DJXB 4RMQA 1HH6B 4Z7VE 3MRQA 3V8CA 1UB5A 1ULVA 4MWFA 4HMEA 3ZL4H 5C0NC 3MRRA 3P0YL 4GRWE 4D0CA 4J3TA 2VB5A 4GAJH 2XWTB 5EU6A 3S34L 3CSYB 5E70A 3EOTH 3LH2L 3MO1B 4MAYA 5CCKL 4GKNB 2AEPH 1RJZB 3JWDH 4I4WB 5L2KA 4L4TB 1QNZL 4LHUA 3T0EE 5KJRL 2B4CL 2R2EB 1UACH 4AG4L 1F3RB 2I24N 1LEIB 3MXVH 4X8JA 1FL5A 1YQ2A 2FBJH 4KROC 5D1ZA 3CVIL 5MP6L 4IRZH 3L3OB 5HDOA 2JCCA 3W11C 1KJ3L 2NY4C 3C9NA 3FO9B 2BP3A 3A6OA 3OXRA 3QO0A 1JGVL 1KCKA 1CLCA 5DD0L 4D9QD 4G6KL 3DETD 3U82B 2EEAA 3WNOA 2DKSA 2HFEB 3VXUB 5IVXA 4LMQE 2UYLA 2H32B 4BQ6A 3GDBA 2XA8H 3EOAB 1KT2B 1XT5A 5T1DH 4BQ8A 1VFAB 1UM5H 3C60A 5B38G 3ZL4L 2PO6D 1MH5A 4ZOEA 3B5HA 4JPIB 4GT7A 4PRBA 43C9A 4PY7A 3V0WH 1MEXH 5FKPA 3FB7A 3V0AC 1T4KB 2CR6A 3KAAA 3EOTL 1MVUA 1C5DB 5DF0A 2YEZB 1E0OB 3EHBD 2AEPL 3JWDL 4G8GD 3HC3H 2GKIA 4HPOL 4PPTA 1MCOL 2DL9A 1A7NL 1I7ZA 3F12B 1G7PA 5F7YC 4MA8H 4DN4H 4KPHH 3JZ7A 3MLVH 2GFBB 3CPLA 5I17A 3AUVA 3MXVL 4ODSH 1IZJA 2FBJL 3MUGB 4GRLC 5D1QD 2JIXA 4HLZH 1PEZA 4IRZL 4YHIA 5I9QB 4FQQA 5T1LB 3UBXI 2GIYA 4JFZH 5JDSA 2KH2B 3UZVB 4JGJA 1BJ1H 3AXLA 3UYRL 1T1XB 2BVUA 1KPUA 4HC1L 3CLFH 1A7BA 2MSPA 3DWTA 3Q1SL 4EBQH 2Q6WA 3E2HB 1OW0A 3U4EA 4K55A 2NR6C 3C2AH 1KC5H 3BJLA 3KPLB 2YUWA 1PG7X 3LKQA 4JQVC 4DW2H 2X4RB 4XC1H 4NJ9L 2XA8L 3EO0B 1ZT1B 4YHOH 1GH7A 3IRZA 1ZSDB 4Y4KD 1XGRA 2JJUA 2DQIH 4M48H 3V0WL 3GSNH 4J3OC 1MEXL 2MCG1 4DVBB 3QBTB 1HHJB 4L3EA 1FAIH 1J8KA 1L7TH 5DD6B 1JIBA 2CLZB 1JE6A 4OZHE 1S7WA 1VFBB 2VLKA 2EXWC 4EI5D 4NZUL 3RA7L 1XGYL 5KG9A 1TPXC 1EJ6A 4MA8L 4KPHL 3VA2C 5JUEL 3MLVL 4NO2A 3QWOB 3QPQD 2VERN 4UDUA 1S7UA 3HMWL 3C6LC 5E2WH 4RBPH 5J11B 1BBDH 4XPTH 4DEPC 1AGDB 4L9LB 4JFFE 1E4XH 1I9RL 2Z0BA 3PNWA 3ZHKA 3PABB 4C54A 3IETB 3S3SA 3CLFL 1NSNH 3HE7C 4WW2A 4EBQL 1I1AB 1T89A 4BSVA 1G0DA 3N1MC 4WHYH 2V9RA 3D18A 4GXUM 3IJSA 4ODWA 1QR1A 3L3HB 2A9ML 3V0VA 4DW2L 5L2KD 1A6WH 3DMMC 4HKXB 4OI8A 3GBNH 4DVRH 4LHUD 1RK1A 2OR9L 4OI7A 5I30L 1NCWL 4XVTH 4X6EB 2DQIL 2VSDA 4M48L 1TIUA 5D1ZD 1ZLWK 4I2XB 5BJTA 4HUXB 4NO0D 1FAIL 2R0ZL 3OAYK 4WENB 3X11B 1L7TL 3FAXA 5BRZA 4UU9B 1BX2A 4P2QD 4G9DB 4L8SA 4RSVA 3IU4H 4PY8I 1MRFL 2VIRB 4HW6A 1R5VA 5C2UB 1OF2B 3G6JE 4PJFF 3PQYB 2UVEA 4U49A 4KK8D 5FHBH 2ATKA 3VD4A 4XRCA 1AGFB 4U6VL 4KRPC 5E2WL 4GW4A 3C60D 5E8OB 1BBDL 4XVSL 2X1OA 3GJFB 5DTFB 4LLUB 5SWQA 1EVUA 4LRNH 5HHVL 5HYQA 2OSLA 3GRWL 3K74B 1NCTA 1NAML 5A16B 1VFOA 3O45A 4KUZL 5CLWA 1MFNA 4U1MB 1CGTA 4NZDA 2RGSA 5ISZE 3ZTNH 1LK2A 4DVRL 4MNGE 4MJ5A 4XVTL 2Y07H 4PB0L 1NCAH 2X44D 4TUOA 3FT3A 4AIZB 3FFDB 1G9NC 2JIXD 3LQZA 5FA3A 3KPSA 1F6AA 3S37X 1HKLH 3V4VH 3IVKB 1BJ1J 4OF0A 5C0FB 1I85A 2GY5A 4UV4H 4ODTL 3TNNA 4ODBD 4NQEB 3MJ9A 3NMEA 4HT1L 2ARJB 3QI9B 5EZLB 2EDNA 3RVXD 2BDNH 4R97C 1IGFH 2YRLA 4R96A 1JK8B 5FGBC 4UQ3B 4PJFB 1B2WH 4P4RA 3JSSA 4LSVL 3BHBB 5J3HD 1KIPB 4G6MH 3V7MA 1X5JA 5CP7B 5HGHA 3V6OC 2ORBH 4L3ED 4MNQE 1S7XB 5D7LB 1UEMA 5LAXB 1KBGH 1LEGA 4FFWD 5C2BL 5J13B 4MDIB 1NL0H 3DUUB 2VZTA 5HGBA 1NDMB 5EBMB 5FO7B 5TE4H 3LB6C 4LCIL 5IM7B 4R7DA 5E9DA 1LD9A 5C0RH 4ZO6A 3T08A 4WHCA 1AR1C 1NCAL 4OM0L 2Z8RA 3PF2A 3UJJL 1BFVH 4FFYH 1JZ4A 5TH2B 3QCTH 4NWUH 3RDTC 4ZAKB 5F6IB 2NNAB 3FQRA 4JB9L 4M6NL 4NRZB 1NBVH 4UV4L 1IC4H 5FECB 3D85B 1NUGA 5EUKA 3VD5A 5ADPH 2OXHA 1S9YB 1WCBA 4UAOB 2E9WA 5T1MB 3C6SB 4LDEB 3IF1A 3LS4H 4LL9A 3GSUA 3U46A 3RIFF 3KPOA 5A3IC 1EO5A 3DPBA 4G6ML 3WE6A 3VXSE 1ITCA 4E5XA 5HYJE 2ORBL 4MD4A 1IL1A 3FO2A 3PHOA 5T1KB 4TOYL 2PW2B 4OLUL 5BRZD 1D7FA 1L6XA 4Y0GA 4R8WH 1NL0L 2Q7YB 2OTUB 5C07E 1BVZA 3VXPB 4Y4FC 2RHEA 5HY9B 4B5EA 2Y7QA 3D1MC 3K4ZA 4KRLB 2VN7A 3LIZH 5C0RL 2L0DA 3OG6B 3UTZA 4HUWA 3T4YA 4PJ7F 5ESAA 3CFJB 5DT1H 1T03H 4HS3B 2GSGA 2PUQT 1T5XA 1UH2A 1BFVL 3GSXB 4FFYL 5CEZH 1U8KB 5F6HJ 3V52H 5FHAH 1RZ8B 4GRWF 4NWUL 1P7QA 4UTAH 5C08B 5F7HA 3MR9A 1NBVL 1WITA 1JNJA 4TNVK 4GUPA 1YMMB 1LO5A 1PZ5B 5ADPL 4UTBL 4P59H 4XZUB 1DQJB 3CAFA 3TJHD 4G9FD 4JN2A 2F5BH 3LS4L 3MJ6A 3P11H 1UWEL 1JPSH 3H42L 2CIIA 1MCSA 4L8CB 3U2SB 3LCYA 4CU7A 1ORQA 5DLMH 1CICB 4C83B 1YYLL 3MRMB 4MSWB 2YSSB 3BIAX 4UV7H 4R8WL 1ACZA 1A6TB 1EUTA 3V5KA 3ZYZA 4NQSA 2ILLA 3D3VB 3TPKA 4G8FB 5D1XB 3IJHA 1OQOA 3LIZL 4U0RC 4GW5B 4X9HA 3UYOD 5B4MC 2UY7A 1T03L 5DMYA 3B4NA 1EEYB 4QXUH 3S35H 3UP1A 1VEPA 5DEZA 5EZJB 3O6FD 3QNZB 3CNKA 2DWEB 3SPVA 1H0DB 2VZUA 4KJYB 4TTGA 4PJ7B 1KOAA 5FHAL 2IQ9L 3V52L 2WWMD 4UTAL 2A73A 3HUJE 5BMFH 5EO1A 5IMMA 2NTFB 5CGMA 4GRWB 3HNSH 2AJ3A 2F58H 4X4YB 1T7VA 2GJ6A 1A6UH 1N0XH 4LEXH 3H6JA 2PCPB 3WL9B 3IDNA 4P59L 1TQCC 1EUUA 4AENA 2CLRB 5JPMB 1U2HA 3ILPA 3P11L 2VNCA 5E9DD 1OB1A 3CSBA 3ZKSD 4LHJB 3CX5K 1GAFH 3ARGB 1Q9OA 5DLML 1N8ZA 4Q2ZB 4YAQB 5H37G 3B2VL 3IXAB 2VC2H 1VADA 4FTVE 4C56D 5EORL 1JL8A 1AXSA 2EIZB 1REIA 3MJ7A 4OAWA 5IR1A 5INDA 4ENED 1HWHB 1EA9C 3PGDB 5D4QA 3RY4A 2DM2A 3UYPA 5TQ2L 3S35L 2R1XB 3FFCA 5BVJA 4JFYB 1WGOA 4KAQH 5I2IA 1BLNB 3QUMH 5EO0A 4UIKH 2WLZA 2A1WH 3BZEA 4WCYH 4LVEA 3HNSL 2BXZA 2F58L 2CRYA 1HWGB 4LEXL 3W2DH 5DA4A 1FL6A 1WWWX 3EJZC 5C0AB 4PJ8C 4G6FD 5CIPA 1HZHH 4HUUB 1JF6A 3TZVB 4PRAA 2AS5M 1N64H 2YMXL 4ISVB 3P4NA 1T21B 3MUHL 2W1NA 3CC5B 3MBEA 4KKBC 2H9GA 1T0NB 1K9TA 4ZS6D 1P7KA 5JHDE 1XGQA 1G7JB 4TQEL 1LDPL 1EGJL 3DHMA 1F45A 2VDKL 4AT6A 5IBUG 1CFSA 3OHXA 5FM8A 5D9SA 2H2PD 4Z7QF 4JRXD 1FNAA 1EHXA 1XGPA 3HG1E 3BP7A 3VFWB 1DDHA 4ZNEE 4Y4HB 4KAQL 1RZJC 3QUML 1CLOH 4J3WA 4UIKL 1QSFB 4NQDE 4XHJC 5AYUH 3RWDB 4YZFE 2A1WL 5CD5C 5J6HA 1N7ML 1FYTD 5EFIA 2FJFA 4EIZC 1XCQA 4N5ED 3W2DL 3PDGA 4POZC 1BQHA 3I6LD 3BE1L 1GOFA 3DSNA 1ZANH 4QT5B 1A5FL 3RKDC 1UJ3B 2N7AA 5HDBF 2DM7A 3IGAA 1HZHL 2Z31B 2W59A 3SHSA 1HCFX 5DJ0A 1I7UB 3FQTA 2PYFB 3BP4A 3EO1A 1N64L 1V7NH 4P3DB 2R29H