1QZ1A

Crystal structure of the ig 1-2-3 fragment of ncam
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
290
structure length
288
Chain Sequence
VLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Neural cell adhesion molecule 1, 140 kDa isoform
publication title Structure and interactions of NCAM Ig1-2-3 suggest a novel zipper mechanism for homophilic adhesion
pubmed doi rcsb
source organism Rattus norvegicus
total genus 66
structure length 288
sequence length 290
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qz1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qz1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qz1A03
3FO0H 2VSDA 1N0LA 5EWIL 3STLA 3TO4B 3JV5A 3U1SL 4Z7NE 1YJDH 4P5KA 1QEWB 1GRWA 5DC0A 3EFFB 4PJ5D 4Q0XH 1GOHA 4PIRF 3VFRB 2PXYB 2VB5A 4R4BA 1ORSB 4X5XA 2NY3D 4NKOA 1ZT1B 1X4YA 3CVHH 1D5IL 3RVTC 1UWEH 4KI1A 5C0IA 1C5BL 3ROLB 4HEPG 3AS2A 4JO1L 3T0ED 1FV1A 3O3EB 4PJIE 4PB0L 5IV2A 4S0TD 1NGQH 3GMNB 2X1XR 2VXSH 4OUUA 3VD4A 3QIBD 1CDUA 3LQAH 3D0VA 2R29H 2N1KA 3UTZB 2GI7A 5K9QI 4DAGL 3W0WD 2X9WA 4M6OH 4YAQB 2XN9E 3LN5A 5FA4B 3PXJA 4M7LH 3MA9L 1FGVH 4PS4H 3PGDB 5D5ME 2COQA 1CDGA 5J8OA 2OS7A 1IGJB 4KKCC 5IESH 3N9GL 3PWLA 3RVXC 3CZFA 3BZEB 1KTKE 2BVPA 2DM7A 2NY1B 4UV4L 3WXVL 3KYNB 4LSVL 4FHBD 5FGRA 1WAAF 1TVDA 4U2YA 4AJ0A 5JOEA 1YC7A 5H2BA 4NO3A 5ALCL 3SOBL 1PW3A 1UXWB 3UZEA 1RK1A 5EUOF 1QNZH 4FQXB 4RMQA 4HIHA 5IHUH 5B8CA 3D5OF 5K9JH 1CDHA 1FL5B 4HCRH 5CJQL 5C0AB 1KENL 3RBGA 1RV6X 4AQ1B 2A6IB 3DXAD 5IHBA 4RIRB 4R90L 4G9DA 4LAQL 1A3LL 3T1FB 4QYOA 3T2QA 3U4BH 2EKJA 4GBXB 3O3DB 2D7NA 2OK0L 1B4RA 1AGBA 1A1MA 4HC1H 4YBQD 3IDIB 3INUH 1K6QH 5I30L 4QXWA 3SJVA 3P4OB 3L5HA 4MVBC 1OTUC 5E5UB 3V5DA 5FO7B 3VXTB 4XC3H 5J9PB 3QNXB 4NO2A 5LAXB 2CKNA 2OBGA 5I8KH 3VW3H 3TT1L 3HPLA 2X05A 2D7MA 1A7RH 2CUHA 5GS3A 4LCUA 1RVFH 5I1GH 1FL6B 5C9JA 5HYFA 3WKMH 1QBLL 1FRGL 3LN4A 3S37H 3VDAA 3KXFB 1EFXA 2IAMC 2VDNL 1FQ9C 4P59L 3VJ6B 1GL4B 4LKCA 4DZ8B 1KYOK 1ZHKA 3CX5J 4KH2A 4HUMB 2OZ4L 3MRMA 4J12A 3FFCD 2N56A 3QCVL 1A9BA 3MRJA 2F53D 1K8DA 1OLZA 4LMQE 4WV1B 3ZKXB 1DBAH 4NQEB 3VI4F 1Q0XL 2HTKD 4TTGA 4M1CD 3JVGC 5B3NA 4PLJD 1QRNB 1ZAGA 3HKFA 1A6AA 2FB4L 5IFHL 3SJVE 4GQ9L 1II4E 5JW4M 1I1YA 1U8HB 2GJ6D 4MWFA 4HW6A 5D70L 2F5AH 4MMXC 1R3LA 3MGOB 2X4PA 4TSBH 1MIMH 3M17A 3RGVA 3Q3GA 4FFWC 1YEIL 5EU3A 4LEXH 1FFRA 3VFGL 5A1AA 2ATKB 3S9DB 2JTDA 3RDTA 5C3TA 4X80H 3QQ4A 1TVBB 4Y19D 4RQQA 3VD3A 1DVFC 4BFIA 1MWAH 4P9HL 4ZUUB 1J0ZA 5DVMA 4ZS6C 1N64H 2ID5A 4LARH 2C3XA 4RMWA 3OL2A 5DSCB 2C4FT 3QP3A 1FNLA 5IBLD 4MAYD 2BHZA 3TZVB 2J4WL 4K3EL 3KG5A 1SJEB 4HPYL 3V79C 1EHLH 4X0KA 1KN2L 5I8CA 3RNQB 2PYED 3ILPB 3WD5L 5IG7A 4UB0L 3TNNB 1Q9OA 4HWEL 3U6RB 5E8DL 4ZD3H 2GSGB 4IIQA 3DX8A 4Q6IA 1CT8A 4XCYB 5TH2B 1VGEH 2O61B 3L3OB 1WICA 3BUTA 1PJ9A 3QUXC 4NWUL 4WDIB 5F3BA 1MH5B 5C0RL 3HC0A 3GDBA 5IJVA 2ZUUA 4PRDB 1L7IH 1WCBB 3CXHK 2Q76A 1QA9B 1YQVL 5DURB 2IH3A 1TVHB 2IBZY 3U7YH 1IGTB 5F96H 5KJRH 4U0QB 1ZVSB 5CINH 5JO5A 3QCUH 3WFBL 1RURL 5FUCC 3AU1B 3RQ3A 1WJ3A 4PG2A 5AWNL 1CXKA 1T3FB 3VGAB 1Q1JH 1CDCA 5CGTA 3U30B 2B5IB 3CCHA 4POZC 4G8GA 2R4SH 1FZOA 3AY4C 1PX3A 2FBJH 2PN5A 3MNZB 6FABH 3PV7A 1DUYA 1DQLL 1W0VA 1DBBH 4WFFE 1FVDB 1C12A 4M00A 3GSNH 4NM4L 4YGVB 3IT8D 1D7FA 5ALBH 2B1AL 1G7QA 4GKSB 4ZUWA 1DLHB 2Q7YB 2NY4C 4PJCB 4LHUG 4S1RH 4I0PD 3JV6A 4WTZG 3H9ZA 3ROOA 3WFEL 4UBDD 2MKWA 2XQBH 5AD0A 1IGYB 1SVCP 3WIFB 4K8RC 5JOFA 2AI0L 4U1HB 3WNPA 1RI8A 3KNBB 5EU6B 2CUMA 3VXMB 5F7LB 1RAMA 4ODTL 1PG7X 5DJAB 4R97C 3RVWD 4OT1H 1J9CT 1NFDB 2EE2A 5DT1L 3QUZD 3HMXH 4G8GE 1ZEAH 4NC1C 3HNTH 1DN2A 4HQQL 5F6IC 4M4RA 3UTOA 4RFOH 5DUMH 4ZOCA 5B38A 1W0WA 1GVIA 2QSCH 1HKLL 1RZFH 1D5MB 1T4KA 5FIEA 4NM8H 3GUTA 5CBAB 1FE8L 4WVRA 2P42B 2BSTA 1YUHA 3IXTB 4MB3A 3MRRA 3MMEB 3MUGB 1CGSL 3NABL 4J4PD 5D7JD 3HB3C 5L8LB 1ED3B 1FGNH 2K1MA 4JFOB 5JOPE 4FQLL 4WFED 5LWYH 5D7LA 2BVQA 2XWTB 4P2RA 4I3SL 5JDJA 3IDXL 2DQEH 1JP5A 2LU4A 3SDCD 4PV8B 4IJ3C 2MQ0A 2V2XB 3HZVB 3QH3A 4G8IB 4LSRL 3WE6A 5CLTA 3VD7A 1WVZA 4K8RL 3TVMC 2R23B 1EUTA 5HVHC 2IC2A 4NQTA 3ZYJA 8FABA 2DBLL 3FN9A 4NT6B 5DQ9A 5CILH 4QHMA 4K3DL 4A6YB 4I2XB 5C0EA 4RGNE 1F5WA 1QG3A 4NZUH 1EVTC 1JGUH 4YPJA 3VG9C 5J06A 1X5IA 4L8SC 2YHGA 3GI8H 4JDTH 5EIQA 2AK4B 4ZXBC 4BKLB 5DQDL 2EH7L 1MRCL 4Z5RB 3BP7A 2Z31D 4GRLC 2X4QA 3HHRB 3DJ9A 5F9DC 4L9LC 1MCPH 3V4UL 2WIMA 3SKMB 1PEWA 3EYVB 2RHEA 3DMMB 3V6BR 4XNYL 1QRKA 4KHXL 4PJEB 1UKQA 5K93A 1WAAA 5FYKD 5D7LE 4UTAH 3MV7D 5CD3B 4P2RE 3VMNA 3RA7L 2F9BT 3TGXA 2XZQL 2CO7B 1NUNB 5SX5H 3L3IB 2DJUA 2BJML 4HIXH 1N6QH 5IB1A 5EUOA 5ITBH 2KDGA 3HZYB 4PJ9B 1EZVY 5B22A 4XGZB 3F7QA 3RWFA 4IOFD 1UB6A 2HT2C 1N2RB 5BW7A 3TWCH 1XEDA 3I75A 1RZGB 3DPBA 5T1LB 3DIFB 1A4KB 4CMMA 1LDPL 3DURB 1YPZB 5FGCE 4IDLA 3LIZH 4GKNB 1KB5B 2CIIB 2R1YA 1LNUA 5GS0C 3U2SA 1INEL 4M6AA 3IVKA 5BJTB 5BS0D 3EAKA 3IRPX 5F97E 4CVXA 4XNZB 2ADFH 3O8XD 3BT2H 2VDRH 4HV8A 1OSZA 5TF1L 2DKUA 4NPYA 2FX9H 3TIEA 3QO0B 3EO9H 1BIHA 4XMKL 4HUXB 1WAAE 1OGTB 5KSVA 4JO4H 4M5YL 2XTLA 5IFAH 2YRPA 3EYSL 4K2UL 5B8CC 4WFGD 5EUOE 5D1QA 2EXWD 4LPYA 3PGCB 3S37X 1CLZH 4ENEC 5KVDH 1WBZB 2Z8VC 2C3GA 4DK6A 4JPVH 3O3AB 4RGOL 3MLYL 5C07B 1R5WA 1D9KB 2W0PA 4G9FB 4OKVB 2VN4A 1AFVL 1CVSC 1QFWL 5JR1L 5K9QG 5MERB 4QXUH 5FK9B 1LDSA 3FOLB 2VAAB 4H1LH 2BMKA 1HK6A 2ADJB 2AJVH 1FPTL 2Z35B 5T33H 5ECJE 5CGMA 1W0YT 3ZLQC 1EEUA 4D9QD 5GS0L 3OTTA 3MTRA 5KSUA 1ACYL 2KZWA 5TDPB 5IFJA 1LEGA 5FYLE 3HI6H 1KPRA 3JWNC 1U91A 5C92A 4BSVA 2EDWA 5CP7B 5C8JA 4QRQA 3BRGC 4JJ5B 4NJAL 3LOWA 1BJ8A 4HS6A 1A7PH 1A1NA 4YLQT 3B9KB 3FT4A 3GBMH 3HFML 1BQUA 4OFPA 1IEBA 3CDFA 1YEKH 4XPBL 5JPNA 5D1XD 1AQDB 3MJ7A 1M05A 4LLVA 4JG1H 4PP2A 5GGRB 2W1NA 1H3PL 2Q8AH 1I1AC 1BJ1J 4L1DA 3F7VA 1YC8A 4KUCF 1FFPA 4OZHB 5LXGH 2WBJA 3ECBA 2R0KH 3HUJA 5DD5L 3M8OL 3ME0A 1KJMB 2RAMA 1N3NB 1J10A 1KCVH 3UX9B 3OB8A 3QJFB 4HS8L 2MPAH 1YNKL 2DTML 4KKAC 1OWWA 3GRWA 5J6HB 1EHXA 3AFLA 3VI4E 1N7MH 1P4IH 1MRDL 1WC7A 4OM0L 4WO4A 2CLVB 2X4UA 2IG2H 1A7NH 4PRID 3SDYH 5TE6L 2H1PH 1RZKC 4QRRA 3QO1B 4YDIL 1IFHL 1W8NA 1BREA 3RKDD 5I74B 4LVEA 1HHGA 1BBDH 4RAHA 1MVUA 2W0FB 4YHNA 5CEZD 1HKFA 5D2NA 1P6FA 2CD0A 3PABA 2W0KA 2IMMA 1U9KA 2GYSA 4CW1A 3UMTA 2XRAH 3QDJA 1K2DB 5H8DA 4X6BA 3QDGD 1QQDA 1MY7A 1IZJA 1NL0H 5LJYH 1B2WH 5IUSA 4DZBB 2OMBA 1KCUH 2XTJD 3WN5C 2X4RA 3MRKB 2HN7A 4MJ5A 3HUJE 2FGWL 3O6LL 3ARWA 2F54B 3QQNA 1E4WH 3JXAA 3P4NB 3HPJA 4F7CA 2X10A 4ODVH 1Q94A 3DUSA 3E0GA 4Z7VB 4ZDHB 4IIQC 2X9YA 5HHOB 3ARRA 4Q6IC 4P4RA 2BVUA 4X4YB 5FCSH 2JB6B 3HG1B 1NBZB 2A74A 1BZ9B 5T1MA 4QRRE 3BPOB 1MJ8H 3QHFL 9CGTA 2AEIT 2CGRH 3O41B 5DHVB 2EO9A 3SDDB 1QFWM 1TQBC 4N0FA 2BNQD 4LMQI 5A2LH 1RZKL 3THMH 4KY1L 5GSRB 4XP5H 5IQ9B 2VZVA 5D2NE 4XH2A 2OTPA 1CD1A 1G6RB 1MNUL 3OAZH 1CFQB 3G6JB 2BOBB 4M5ZH 4UDUB 1IILE 3QDJE 3RJDA 1QUNA 4GKOA 1MFDL 4QO1A 3NTCH 3X3FH 1UJ3B 1BECA 4LF3A 3O6ML 4UT9L 3I85A 3TH2T 4R7DA 1JMXA 1OP3K 1S3KL 5E2UH 5SX4H 4D0BB 3UTSB 2K7PA 3OG4B 2EC9T 3OG6B 3BJLA 3P4LA 5CLWA 2CDEA 2UY6A 3O2VL 2A6DB 4GXVH 4IMLA 1BEYL 5JNYB 4Q9QH 5CKAA 3OX8B 3L3JA 3OSKA 3O4LA 4N8PA 1K4DB 3GSUA 3MNVA 2DWEB 3VRJA 1P7KB 2F58L 5CJ5A 1T0NB 3TYGH 2D31B 5IQ7H 4XRCA 3MV01 2RB8A 1AGFB 4I4WA 4YHZL 4UNVA 4QCIA 3VD5A 1FO0H 2OJEB 1EV2E 2A9NL 15C8H 3P4MA 4PJFF 1S5IL 2Q7NA 3N1PC 3VXOB 1A6TB 4U1NB 2IGFH 5HGHB 4NQXA 3KPMB 1ITCA 1UVQB 5CHNB 2CLZA 4LDEB 5BXFB 3L5XH 5DUPL 1LMKA 4AM0A 1MJUL 4TUJA 1AD0A 3MROB 5E6IB 1YYLH 1ODAA 2R8SH 4RGNC 4L1HA 3Q6FB 2VQUA 3HAEB 43CAA 4OGAC 1HDMA 3MREA 4EDWH 3VXUA 2AGJL 1S7UA 4HJGA 4E41A 4Y5XB 1KIQA 3MV9B 3O4LE 2VDPL 2FHFA 2MJWA 4JQVA 1CF8L 2VLJB 4YDKH 3FB6B 4XVTH 1A0QL 4JG0H 1AI1L 3QWRA 2Z92B 3KPNB 2B2XL 1CBVH 3MLPA 3W11C 4Z78A 5C2BL 2MCG1 1KJ2H 2EDLA 4M3JA 4WI5A 2NY0C 5EBWA 2CQVA 5HI4C 3X11B 1PSKL 2EICA 4OSUL 1YEDA 3I50L 2DLTA 4ELMB 3TM6A 4NZTL 3CSBA 3W9DB 1CE6B 3DETC 1L6XA 3QZWG 1UENA 5EUKA 2W91A 1RJYA 4KKCD 4ZFFA 3TJEH 3KS0J 1NFIA 4O4YL 3MJ9H 4C56D 8CGTA 4I48A 5H35A 4X7TB 4P48A 3TYFB 3V8OA 2EIEA 3C2SA 1OAYL 4JFZH 3IU3B 2NNAB 5FO9A 3DO7A 3VXUE 4PRBB 2W60B 4B53A 4E41E 3QCTL 1ETZB 4Q9BA 1X6NA 4PJBF 1MI5A 2V7HB 2ZKHH 4XPTH 1WITA 3U9UB 1G7JA 4HBQA 4D9LL 3LPGA 3D69B 3LS4L 4I0CC 5DJCB 4BSWB 3GMOB 4GAFB 2VTFA 3RWGB 1X44A 2P45B 4N8CL 4PJHA 1WZ1L 3I9GH 1HXMB 3PWNA 1A5FH 1KJ3L 1NPUA 2PR4L 4EI6B 3CC5A 4PJCF 4MVBD 1OTUD 5GHWL 3NCYP 2M26A 5E56A 4Y89A 5LQBL 1JGDA 3KJ6H 3S34H 2NY2B 1YY8B 4NUGL 4PLNC 1F6AB 1UWGL 1J11A 3IAGC 5DJ0B 4WCYL 4JHWH 4DQOH 3RZCB 3EO1B 4L3EB 5L2JA 4XP4H 4LQFL 5SWZD 4GS7C 4MX7A 4YXHH 1NFDF 2IAMD 2WUBH 4OCXH 2HG5A 1TPXC 1MI5E 2Z8SA 2EIBA 4HH8A 1S5HA 2I60H 2X4NA 4MZ3A 2FO1A 3CFCL 4U0RB 5DC9B 1RUMH 4CN1A 2JB5H 3RWEA 4F2MA 3MLZL 4Z0BH 2A83B 1QFHA 4G43B 3GBNH 3BP4A 3D39A 5C1MB 2JK5B 5J11B 1H3WM 4Y4KB 4FG6D 1JRHL 4PJHE 3DUUB 3BRFA 4Y16B 5D1QC 3TO4A 3VMPA 3L1OH 1QEWA 2X5PA 3ARBC 4XP9H 3EFFA 3W5MA 1RZJC 3W2DH 12E8H 4LGSB 2NY3B 3VFRA 2PXYA 1A7QL 1ORSA 4J6RH 4C4KT 4FFWD 5TPWH 1JYWA 1YEHH 2R0WL 4ODBD 1ZT1A 5E4IA 3AS1A 3NPSC 2ED8A 1F2QA 4LKXB 1ZS8B 1OGAD 4NNYB 4Z7WB 3IETB 1JWUB 3MRHB 1DVFD 3ROLA 1C7TA 3T0XA 1BMGA 4FZ8L 2WP3T 2FR4B 3C2AH 3EGSB 4ZS6D 3RVUD 4Y2DD 3H2WA 5HVGB 1KLGB 3O3EA 2VXVH 1FDLH 5JTWA 1LVEA 3GMNA 1CLCA 5DZOA 1T6VN 3W0WB 4JR9H 3MLRL 4OF6A 2HRLA 5FYLL 3UTZA 1MFCH 1NCDL 1RY7B 4LVOB 3D39E 4YAQA 5FA4A 4ODSL 3ARQA 2BX5A 1W2KT 2XA8H 1TJIL 4KAQL 5DJ2B 3PGDA 3AM8A 1WIPA 1IGJA 32C2B 1SYVB 3BFOA 3BZEA 4MAUH 3FB8B 3KYNA 4PJEF 4OIAA 5DK3A 4OB5H 4GAGL 3QUXD 2EH8L 3GO1H 4X4XB 3K1DA 4M6ML 1RZJL 1UXWA 5DFVC 4FQXA 3QYCA 1BJ1H 4O02L 2ERJC 1FL5A 1SEBB 5C0AA 1S7XB 3SKUD 5HYJD 4AEEA 4LIQH 4NQCD 4XBEL 1XF5B 4AEHH 3H0TB 2A6IA 1JZ8A 3KWWB 4IRZH 4YO0B 5GGSB 4RIRA 2AJZB 2CRYA 4V2BA 3T1FA 4MMZC 1YPZF 2DLGA 4GBXA 3O3DA 4ZQKB 1IAKB 5EOCL 2DTSA 2OMNA 4ONHB 4POZD 3IDIA 3V4VH 3MODH 3DROB 4JKLA 3P4OA 4UV7L 5E9DD 5FO7A 5IT2L 5J9PA 3QNXA 5LAXA 2H2PD 4F15C 5C09D 4YDLB 4MS8C 1I3GL 4ZNEA 4WGVB 1T7XA 1OP5K 4Y4FC 4DTGH 2IPKA 3RWCB 2P5EB 1FL6A 3CH8A 4HAFA 5I76B 4P5TC 1T0PB 2NY4D 3LQMA 4HMEA 1GZPB 2BSED 2H45A 3KXFA 3QPXL 1ZTXH 3VJ6A 2EECA 5HYSG 4DZ8A 3FFCB 5C0AE 4ETQB 5J56B 4XPGH 3MACH 5I1HH 2F53B 4GRMB 3GRWL 4K8RD 5DRWB 1BVKB 1KUMA 3V6ZB 4LSDA 4JKPH 4JO2L 4LSPH 2EDXA 1OAUL 4NKIH 3WDHA 3QUKB 2MQCA 4WV1A 4NQEA 4HJJL 1KV3A 3UO1H 2D0FA 5JW3H 1FZKB 3H8NA 1MHPH 3HLAB 1QRNA 2J88H 4OIIH 2VDOL 5GRJL 1IZKA 1U8MB 2ICWB 1XMWA 1B3JA 1U8HA 3SY0B 3MGOA 4HD9A 5JXEA 5TE4L 3VXNB 3IDYB 4Y19B 3UJJH 2ATKA 4ZNEE 3ARED 1TVBA 4F9LC 3HB3D 2DD8H 4UT7H 4ZUUA 1T03L 4XVJH 1JF1B 4R6UA 3KXFE 4MAYB 1IKFH 1IT9L 3CMOL 1NCCH 2UZYB 2VC2L 1MPAL 4OZHF 3TZVA 4EOWH 1SJEA 3IDUA 2ZCKH 4XCNB 5GJTL 5MI0B 3RNQA 3ILPA 3K8MA 3IYLW 4P99A 2YN3A 3TNNA 3P73B 3DVGB 1MF2L 2D0HA 4NQEE 4OF5A 5E1HB 3U6RA 4HULB 2GJJA 4BH8B 4D0DB 4P9ML 1QRNE 1A6VL 5F8RC 2GSGA 1WEJL 4F9PA 2OP4L 4XCYA 1YY9C 5TH2A 4GOSA 2XN9D 2O61A 1A4JB 3L3OA 2J6EH 3EOTH 1IMHC 3QAZC 3C08H 4WDIA 1CDYA 4ZTOH 4ZXBD 1MH5A 5ELIA 4PRDA 4FQPA 4GRLD 5ESVB 1WCBA 1RUQL 1QA9A 1TVHA 1IGTA 2GITB 1JTPA 4YEEA 5DF0A 3ZSSA 3HC3H 1ZVSA 4OLUH 1LP9B 5HHVL 5T5FL 2IQ9H 5IB4B 4TULH 2QHLA 2ADIB 4PGDB 3AU1A 4PTUB 1E4KC 1L9NA 1T3FA 2GY5A 2NY6B 4AEIL 5GZOC 2X1PA 4JQVC 4D0CB 1J12A 2C1PB 3QT2A 2HJLB 3MNZA 5DD1H 4CN6A 3LCYA 4Z7VF 1YEJH 1NSNH 2HFTA 1MHCB 1JYXA 3EDJA 3OJDB 4LCIH 5C3LD 4KRPC 3MLVH 3QWOB 3OF6D 1FVDA 1PY9A 1N8ZB 1PFCA 3JTTB 4GRWH 1P1ZB 5GS0D 4YGVA 1NC4B 2HFGL 2E9IA 3EZ8A 5KVFL 3W9EB 1HNGA 4TVPE 4U05A 4I0PB 1DLHA 2Q7YA 4PJCA 1NBVH 4MA8H 3DV6B 2XT1B 5JUEH 3FKUS 1JL8A 1IGYA 1IGMH 3X12B 5J4MA 3WIFA 5ID0B 5D71H 3L7EB 4CVZB 3V6OA 4PP1C 1I9EA 3G5YB 4RFNC 4U1HA 3NH7H 3KNBA 5EU6A 3VXMA 2FO4B 1RZIB 3KS0H 3NCYS 5TGBB 5DJAA 3QUZB 2YK1H 5EU4B 3I2CH 1NFDA 2WQ8A 3NCJH 1OARH 3OAYK 1PBYA 4ENED 4WI3A 2R9HC 2AABL 1JVKA 4RMUA 3VXSD 1FVEB 3GNML 2X7LB 4UOW1 1C5DB 1TCMA 2AERT 1D5MA 3IKCB 4H0IA 2C3VB 1CFNB 2BRQA 5CBAA 2YPVH 2VR9A 5GGQH 5D7JB 1DSFH 3SJVD 3IXTA 3MMEA 3A67L 3NCCB 2AJUL 3MUGA 1ZANH 5F7EH 1I9IL 1ED3A 4PJCE 4JFOA 1I3VA 4YX2H 1ZXQA 3FONB 1GYAA 2XWTA 1ZLVH 3VWKB 3SDCB 2LTQB 4HH9B 4WW1B 2GSIB 3EJYC 4PV8A 4NYLB 2H6PB 3Q1SL 2AEPH 2V2XA 3HZVA 4G8IA 3V6OE 2R4RL 3QDMB 1INDH 2D7TH 5EU6E 3OGCB 3VXME 4C4KO 4FNLH 2R23A 4NZRH 5FHBH 2P46B 1LK2B 1I1AD 1NFDE 4ERSH 4NT6A 1KIPB 5ESAB 2E3VA 4XHQA 4FZEH 4A6YA 4I2XA 3DRTB 3T0WA 2WP3O 4LCCB 1JFQH 2AK4A 4XBPB 2NYYC 3QG7H 4YJZL 4BKLA 2Z31B 4KKAD 2MOVA 1PD6A 1FCCA 1SJXA 1E6OH 1F6LL 1ZLUK 4UILL 2DI8A 4M1GL 1EPFA 3SKMA 4XI5D 3EYVA 1AR2A 4GKZB 3DMMA 3K8KA 3BKYH 4PJEA 1WZLA 3RGVD 3TBWB 3ETBF 5EB9A 1C16A 1I3UA 1RMFL 2O5YH 5CD3A 1OCWL 1E4XL 2VLKD 3GZKA 4J3WA 3RDTD 3L3IA 1XR8B 3RHWK 5CJOH 3RWIB 2VXUL 3HZYA 4PJ9A 4ELMF 1HOCB 1DQDH 3B6SB 3DYPA 4XGZA 2OXGA 2YUVA 5AG8A 5HI5D 1OP9A 3WHE0 4O5LH 1N2RA 4ZYKB 1T20B 4PYHA 1RZGA 3DECA 1CFSB 3OKOB 2C7UB 4QNPF 5T1LA 3LY6A 5CEZH 3DIFA 1A4KA 5I1IH 5ERWB 3T1WA 2HTLC 3DURA 4I2XE 1VADB 1YPZA 4GKNA 1KB5A 2CIIA 5BJTA 4CUCA 2AK4E 3ALPA 3AAZB 4DKAA 1IRAY 3AM8C 3UJTH 1S7QB 3LS5L 4NQDD 4WFFD 2FDBP 1OSPL 3QO0A 4IMKA 4JFPB 5A2KH 2W92A 5CJXC 3IFPB 5F71A 4HUXA 3MSPA 4PJEE 1OGTA 3KHQA 4TPRL 2R0LH 4FQXC 4UMGA 2MCPL 4U1GB 5CZVL 5HVWA 3X17A 3PGCA 2D03H 4Q9RH 1S7VA 1RU9H 1WBZA 5INDB 3O3AA 3BP5B 5C07A 4AL8L 2QQNH 1D9KA 4G9FA 4OKVA 3IGAB 3IFLH 4K7PH 5L7XL 5MERA 4NNPL 4X7CC 1NMCC 2FYYB 5IEHB 4HS3B 4J3TA 3FO1B 3B43A 2VLME 1YPZE 3DVNB 2VAAA 3FOLA 5FK9A 3WHXB 4G6AC 2ADJA 4UQ3B 3NVQA 2Z35A 3U1SH 4Q2ZB 1J18A 1UZ6F 5EZLB 3EFDL 1KG0B 3DO3A 3Q6GH 2AQ3A 1I1RA 1YN7B 3D2UD 4LFHG 5TDPA 2H32B 3I3DA 4MJ2A 5CP7A 2W0LA 1MCBA 1WTLA 4JJ5A 2HMIC 1D5IH 4YWGL 2IADB 4PGEB 3B9KA 2YRZA 4GJTB 4FXGB 4RA0C 1C5BH 5FA3B 1AQDA 4JO1H 4ZAKB 4N1EA 1CFVH 4ZFGL 5GGRA 3H42L 2G5RA 4L4VD 2FD6L 3KLDA 4HIJB 1MLCB 4OZHA 5C07E 2ZG3A 2DN7A 4O58H 4G9FE 1YZZA 3K4ZA 4DAGH 1KJMA 1N3NA 4WWKC 5AYUL 3QJFA 4XCEB 1RK0B 1U8OB 5J6HA 1TJGL 3N9GH 1NAMB 2SEBB 1JTOA 4RGND 3OWEA 4UV4H 3WXVH 5KVEL 4OGAD 3B9VA 3QO1A 4TNWK 5ALCH 3SOBH 1QLEL 4U49A 4O2CB 5DJXB 2W0FA 3FFDB 5D7SH 1I75A 1CXEA 5DRZB 5CJQH 1NGYB 4ZSOB 1KENH 3WO4B 5D7LD 1K2DA 5T5NF 1U8NB 3QDGB 1MHEB 4JY6B 4P2RD 3ARYA 1UZ8B 2XTJB 1WF5A 3W11D 3CFIC 4R90H 4LAQH 5GGUB 1A3LH 2PETA 2NY0D 1VPOL 5HI4D 4DZBA 4WY7L 4OZHE 3MRKA 5SV4A 4Z7OF 4B7IA 2OK0H 2F54A 1L4IA 1JPTL 5I30H 3DETD 4X5LA 3WFDH 5EN2B 2VL4A 4Z7VA 4ZDHA 4AG4L 5HHOA 4JLRB 3WUWB 3TT1H 1CDBA 1V3KA 2ZNXA 2E6QA 4X4YA 5DJ6B 2JB6A 3HG1A 1NBZA 4KK6C 3EDFA 2DLFL 4XZUB 5BZWB 3O41A 5DHVA 3SDDA 2X1OA 4LFHD 3FHQA 5GSRA 2Y72A 4XX1E 1G6RA 4U6TA 1CFQA 1FAIL 3G6JA 2BOBA 2OZ4H 4UDUA 1IGCL 3QCVH 2FECL 3LHPL 3GSVB 3QIWB 1UJ3A 4K9EC 2F5BH 2FEEL 4JGUA 4KRNA 3H9HB 2E8YA 1DANU 4D0BA 3ULVC 2A6KB 1Q0XH 4JFFD 3UTSA 1KULA 2F54E 1AGDB 1YDPB 1AJ7H 2FB4H 1KB9J 4GQ9H 4HUKB 1QSFD 5F7HA 5D70H 1MCOH 2VDQL 2A6DA 2DKSA 5JNYA 2Y36L 4Z7VE 5IW3A 5DGQA 1A14L 3OX8A 5HHOE 2VMFA 2YD5A 1LO0H 3NBNA 1K4DA 3VFGH 4UIKH 2DWEA 3WYRA 1J86A 3HG1E 1P7KA 3BD4A 3L95B 1T0NA 5J1SC 3KPRB 4W4OA 4P9HH 3OMZA 5GQBA 5IK3B 4TVPL 4GW4B 4LOUC 4YEFA 1AGFA 1MUJB 4FFYL 4HXBL 2OJEA 1B90A 5IBUG 3PUCA 5I1DB 1Z9LA 1XH3B 2J4WH 3V6OC 5JHLH 3VXOA 1L0XA 3BE1L 3DV4B 1A6TA 4U1NA 4HPYH 5HGHA 1KN2H 2BHYA 3KPMA 1UVQA 5TDNB 5CHNA 1CQYA 3AS0A 3WD5H 5D1QD 4HXAL 5BXFA 1V7ML 2GCYB 1QD0A 4LSUL 2VQTA 3ARBD 4K9EL 3UTSE 2JIXD 5E8DH 3IFOB 1S8DB 1K4CB 2CIKB 3MROA 5E6IA 4H8WC 2FECI 3Q6FA 4WJ5B 3HAEA 2FEEI 4LCYB 1P5VA 4NWUH 3BKML 3EOYG 4N0UB 4Y5XA 3CFKB 5GRYA 3MV9A 1Z0NA 3TO2B 5C0RH 4Z9KB 2AJXL 1C1EL 2ZOKB 4P2QB 4XP6H 5BVPH 25C8L 2VR4A 3FB6A 4MA7H 1YQVH 2OTUB 3BPNC 3BXNB 3NN8B 3VD9A 2ED7A 1W72L 2ZJSL 5DA0B 1AR1C 3WFBH 1EUUA 2Z92A 3KPNA 1RURH 3NAAL 4PLOB 5CIPB 1WK0A 5AWNH 3X11A 1T2JA 5J13C 1SM3H 3S98A 1P4BL 1I9RH 4Q6YA 4ELMA 3W9DA 1CE6A 4OM1H 3RAJH 1RZ7L 4C56B 1VEOA 1LK3H 1ADQA 1DFBL 1XF1A 4X7TA 1DQLH 3QEQD 3TYFA 1DBMH 4X6EB 3BRDA 2EDJA 3WJJC 3HN3A 3IU3A 2NNAA 3F12B 4OGXH 4PRBA 2B1AH 2W60A 1ETZA 4C55A 3MV9E 2V7HA 1NGZB 2QJDA 5KBNC 1DP0A 3U9UA 1A3QA 1XT5A 4L8CB 4U3HA 3MOAL 3WFEH 3A6CL 4OCLC 3D69A 3SGEH 4BSWA 4QRRD 5DJCA 5E8PB 5FM8A 4M7KL 1B6UA 3GMOA 4JRWA 4LLQB 2VSCA 4ZO6A 5ANMB 3RWGA 1G9ML 4GO6B 3RHWF 1T5XB 1HXMA 1DZBA 4ODTH 1Z2KA 4HKXB 4PBWD 5I9QB 2XZAL 4EI6A 3QDJD 5F7DB 4UUJB 2P8LB 4NOBA 4ELME 3KJ4B 2EE3A 4HQQH 1G0YR 5A2JH 3W39B 1CIUA 1HKLH 3BN3B 2CSPA 5CBEB 1YY8A 3CDCA 4QNPE 1N5AB 4K7PX 1F6AA 4WUKL 4Y4FD 3RIFF 1FE8H 1OLLA 5DJ0A 4HX1B 4A6YL 4P5TD 3RZCA 3EO1A 4L3EA 2IAMB 1CGSH 1VKXB 2JELL 4FQLH 5DXWA 1A6WL 3ULUF 1KIUA 4I3SH 3IDXH 4AH2B 4XAWH 2A83A 4NGHL 4X7SL 4JDZB 4G43A 1ZWIB 2JK5A 5IBTL 2MQ3A 4OCMC 4Y4KA 4LSRH 1JJUA 3DUUA 4Y16A 4K8RH 3ARSA 3BVNB 2PO6C 2DBLH 2IBBA 5T3XE 4K3DH 4X9GA 1NMAL 4OBRA 5LGHH 3C9NB 3IAQA 4KTDL 3QZWB 4S1QL 3QUMH 1OGAB 4WI2A 1S9XB 2WM0A 5E6YA 4PY8J 1NKRA 4LKXA 1ZS8A 1O7SA 1DVFB 4BQ6A 4Z7WA 1RUKL 5DQDH 2EH7H 2BVEA 3IETA 3MRHA 3IDMB 4YHMH 1LWRA 2AXJA 4L3EE 4ZPTB 1Y0LB 2FR4A 4KZEL 4LGPB 3EGSA 3OQ3B 3GIVB 1MQKL 2AVGA 5I16B 1KLGA 1TNNA 3AB0B 1UZ6E 3RRQA 4XNYH 4KHXH 3R0NA 4HGMA 3VXQB 1UCBL 2NX5B 3IRZA 4F8TA 2V17L 3W0WA 1CZ8H 3RA7H 3FB5B 3VCLB 4JEGB 2Y1VA 5F89B 5DJ2A 5IM7B 1HH9B 1VSCA 32C2A 4TNVK 1SYVA 3MBXL 3FB8A 1SYSB 1QSZA 3MLSL 4J1UB 1YY9D 2EIZB 2J3SA 3QUXB 1I7TB 4I5BB 1LDPH 5SX5K 1LEKB 4X4XA 3H7BB 3C6LB 5ITFB 1QFUL 3V52L 1INEH 2EDRA 4FQIL 4OGYL 3RVVC 5HYJB 4NQCB 2PTUA 5ISZD 4GQPH 4XCFL 5TE7L 3T0BA 1SEBA 1S7XA 5TF1H 2CK2A 3WS3B 3QDAA 5CD5C 1XF5A 2EDDA 3MJGX 3H0TA 1JHLL 4MJIB 4XMKH 3KWWA 4TNWF 4YO0A 5GGSA 1HSAB 4HHAB 5HJ3B 3VXUD 4E41D 2AJZA 5JIHA 3BIBX 4G8FB 4I18C 4CADB 4BQBA 4QHLB 4ZQKA 3HR6A 1IAKA 3EYSH 3W0WE 1GH7A 4ONHA 5K9OB 1SY6A 3DROA 4JRYD 5E9DB 1EGJA 5FB8B 3QWRD 4RGOH 5EC1B 3MLYH 3BQUC 1X5LA 1ZA3B 2MSPA 1RFDH 4KRPD 1AFVH 2EYRB 4F33B 1QFWH 5JR1H 1BFOB 5DK2B 2IAND 3Q5TA 3GJFB 2NY4B 3VI3F 1UYWL 2P5EA 4RX4A 5I76A 1OB1B 4Z7OE 3K3QA 1FPTH 1GZPA 5FGBA 2C5DC 1MCWM 1HHHB 2F8XC 4KK9C 5GS0H 3A6OA 3FFCA 2C3HA 1ACYH 4ETQA 2APXA 2MWCA 2F53A 4HWNA 4R4NC 1BOGB 2I5YL 4GRMA 4LVHC 1NBQA 1PAMA 4OFIA 5DRWA 1BVKA 1GGBL 2QSQA 4PP1D 1EEYB 3V6ZA 3V0WL 4NJAH 4R97B 3CK0L 4D3CL 4R96B 3QUKA 1MI5D 1B4JH 2B0SH 2F15A 3HFMH 3TESA 1FZKA 3S3JA 3PWUB 1FIEA 3HLAA 5F6IB 1U8MA 2R9HD 2ICWA 2J8HA 3RUGB 3SEPA 3DVIA 3SY0A 2A6JB 3SGDI 3I02B 2CKBB 4XPHH 5DD5H 3VXNA 1F11B 3M8OH 3RIAK 4KUZL 4Y19A 3QQ3B 5JLZB 4HS8H 4KGJA 1YNKH 2P5EE 1Y6NR 4Z0XB 4Z95L 5EOCJ 1AC0A 3NCFB 1MRDH 1JF1A 3LKOB 2R2BB 4OM0H 4CKVX 1OAQL 4EVNB 4GAJL 4MAYA 3GKWL 3ZHDA 4IJ3B 3FFCE 4JE4B 2GW5A 4YDIH 3EJYD 1IFHH 2F53E 1AC6A 2JJTA 3DGGB 3V8CA 2X89D 5BMFL 3CX5K 4XCNA 3TVMB 3DYMA 1KXTB 3D9AL 3GSQB 3DUHA 2XI9A 4PJAB 5HVHB 5I1CL 4U7SA 5ETUB 3P73A 3DVGA 4BH8A 4D0DA 3PP3K 3MRQB 5F1SA 2F19H 4YH6A 5BV7B 1ZK9A 2DQUH 3AGVA 5F9OL 1I3RB 2DQIH 3VG9B 4LLYB 5INCB 1A4JA 4ZXBB 1G6RL 4MXVF 4K3GA 2NYYD 2YEZB 3HMWL 2FGWH 3O6LH 1V05A 4GRLB 2BNRB 1MCJA 2OTWB 4L9LB 3SE3C 3WNKA 4Y19E 3DX7B 1FNGB 3TO4D 4FRWA 2YSSB 5ESVA 2WLZA 5FUOL 4OZFB 2GITA 1Y18B 3MA7B 2PXYD 1IBGL 5IB4A 5CS7A 4FQQB 3NA9H 2ADIA 2QHRH 3C60C 4PGDA 4PTUA 3X3GL 1OM3L 3KR3L 4Z8FL 4Y5XC 2RBLA 5HYSB 5AZ2L 1A3RL 3BMVA 4PRAB 1NANI 3QHFH 1IGFH 5HGDB 1G0XA 4D0CA 4LCWD 5C08D 2OCFD 2C1PA 1RZKH 2HJLA 3EYOB 3BGAA 2E8ZA 4OUUB 5GGTA 2X1WL 1MNUH 5F9WC 2X44D 5HHNB 5IMLB 3MYZA 1M7IB 4ODUB 1MHCA 4M7JL 3OJDA 2WLYA 2A9ML 1SEQL 5FM5M 2NR6C 1MFDH 3SO3C 1PG7W 3DYOA 3QWOA 2HTLD 3O6MH 4UT9H 1N8ZA 3JTTA 2HT4C 1P1ZA 4G3YL 1NC4A 2EO1A 3W9EA 4ZMAT 3GIZH 4I0PA 3DV6A 7CGTA 4YGAB 1NGXB 1IC5L 2NY1D 1CD9B 3W5NA 1GZQB 1PDKA 4PJ7F 3X12A 1HXYB 4XT1C 5ID0A 5IGXL 4E5XB 1J0HA 1QR4A 3L7EA 4XNUH 1QHPA 4CVZA 5MENE 3G5YA 4UINL 1IE5A 4FQXD 2FO4A 1RZIA 3I6LE 5TGBA 3QEUB 1T21B 3TFKD 4M6NL 4OZIB 2F58H 3QUZA 1DDHB 1TITA 1XF3A 3NCMA 5EU4A 3VXSB 1IGIL 1UH4A 4RGMB 1MY5A 4YHZH 1FVEA 5DVLA 2X7LA 3ALWA 2A9NH 1C5DA 2R56L 1HNFA 3WNNA 1PGRB 1S5IH 2GQHA 3UDWC 1I8IB 3IKCA 1HHJB 1CFNA 2C3VA 4IOIB 5IP4A 5C0NC 2VWEE 3TT3L 2BVYA 5D7JA 1HCFX 4G6AD 3WIHA 4HDIB 1MJUH 2ADGB 2R2EB 4QXGH 1EAPB 1HEZB 1X5JA 3CLFL 1OVZA 2YD6A 1R24B 3GI9L 3V4PL 3FONA 4LU5L 3LPWA 4JFYB 4LCUB 3VWKA 3SDCA 2WUCH 4HH9A 4WW1A 2AGJH 1AQKL 1VACB 2GSIA 4NYLA 2H6PA 2HMID 2X4SB 1ADQL 2R0ZL 3GKZA 3RZCC 1KOAA 3QDMA 2VDPH 3PJSB 1H3XA 5MEQB 1CF8H 4NHCL 1GGIH 3OGCA 4YBLB 4RZCB 1I1AB 1IQWL 1A0QH 2RJMA 1DBKL 1AI1H 2HP4A 1KIPA 4G6KL 5ESAA 4M48H 4OF3A 2YD4A 3DRTA 3ZZ1A 3ULUE 3HNVH 2Y25A 3VU2A 4LCCA 1UGNA 4I3RH 4Y4KC 4OSUH 2EYSB 4WWKD 4XBPA 1G9EA 3I50H 2Z31A 4Y16C 1QRND 4AMKL 4NZTH 3HI5L 1MRFL 4OQTL 4CU6A 1ND0B 2NW3B 1YEFH 4O4YH 1EAJA 4ZFZB 4GKZA 2XWBB 1DUZB 3CSYB 3TBWA 5JXED 1OAYH 2VLKB 5ADPL 3HZKB 1DQTA 4WTZA 4K94C 4YR6B 5E03A 1XR8A 3QCTH 3RWIA 4K55A 1HOCA 2EDYA 5I2IB 4IRJB 3B6SA 4QRPB 3QDME 1JBJA 3B2VL 1CGWA 1X3DA 5D1ZC 5F21B 4ZYKA 1T20A 3CUPB 4D9LH 1F02I 3BSZH 2BDNL 1DCLA 1CFSA 3OKOA 2C7UA 4LLUB 4RMVA 3SQBA 3WN5B 1ZE3C 4F7PB 5ERWA 5F7UA 1CN4A 4M9PA 4N8CH 2L0DA 1VADA 1WZ1H 2NZIA 1HWHB 4J3VA 5CJ8A 1IAII 4APQC 1KJ3H 5DJYB 3R0MA 3AAZA 4NQDB 3ARGB 3VWJB 1S7QA 5L8KB 2LAAA 4M1DL 3PL6B 3LKSB 5KOVC 2Y06H 1NBYA 2ZZUT 5DTFB 5LQBH 5DMJB 4JFPA 3S4SB 5FYKE 3IFPA 3BH8B 4NUGH 3WL9B 3S36L 2DQDL 1J1PL 1UWGH 4TVPD 4KK6D 3S7GA 2KPNA 2N4IA 1CICC 1NCNA 4LQFH 3MUHL 2VLRB 2V9TA 4ESKA 3KYOB 4K94L 2JJVA 5KOMC 4KDTA 4KROC 3DRQB 5F88B 5INDA 3BP5A 2E9WA 2WMPA 3LEXB 3MLZH 4XWOC 3IGAA 4Y4HC 3CFDB 4J2XA 1OTSC 4OLZL 3KPOB 4EUPG 2FYYA 5IEHA 5EFIB 3ULVD 4HS3A 3FO1A 1JRHH 3DVNA 5I18L 5CWSB 4UQ3A 1IAOB 4Q2ZA 1RIUH 4RBPH 1X5AA 5EZLA 4X4ZA 1KG0A 3D2UB 1LE9B 5FYJE 1KCRH 1OPGL 3U7WL 1YN7A 2H32A 1A7QH 2A77L 4OGZA 1HHIB 2AS5M 3MXVH 3QRGL 3N1MC 1OAKH 2E7HA 1LD9B 2R0WH 1VFAB 4F57L 1BZQK 3FRPA 2IADA 4PGEA 2CMRH 4FXGA 3CFBB 3VI3E 5FA3A 4WFGE 4HT1H 5E08L 4ZAKA 4F37F 2MKLC 1WZMA 4LOUD 2WSKA 4L4VB 3QDHA 1L0QA 1RHHB 4C54A 3W82A 1GGUA 4V2CB 5J6GB 1DEDA 3GHEL 4HIJA 1MLCA 5HHXL 2W65B 3MLRH 4ZO8A 5EU6D 2V5TA 3VXMD 5FYLH 1ZHBB 3Q5OA 1NCDH 4RWHA 5HGAB 1KYOJ 1XFPA 1P5UA 4ODSH 4XCEA 1JHKL 1RK0A 1U8OA 1TJIH 4KAQH 2JF1A 5L6YL 1DTUA 1ZT7B 4S1SL 4MDJB 5FDWA 2YD8A 1NAMA 4D9QE 2SEBA 1SY6L 4GAGH 4HFWB 3RIAF 1EGJL 4KQ4L 4DFHA 3IDYC 2YD9A 5CGYC 3UTTB 4O2CA 5A2IH 1RZJH 3WMSA 3QXUA 3OKYA 5DJXA 3FFDA 4HUWB 5JW4R 4ONOA 5CP3A 1H3TA 1RUAL 5DRZA 3SN6N 1NGYA 1BVZA 1OQXA 2ZPKL 1AR1D 1JWMB 1U8NA 1YNLL 4XNMB 3QDGA 1MHEA 4JY6A 4U31A 1FZMB 2NY0B 1UZ8A 3KPSE 3G08B 2N7BA 5GGUA 4BQCA 1YMHB 3FQXB 1GOFA 4PJXB 4NCC2 2D4FA 5MI0C 4YHOL 4XVSL 3BGMB 4KKBC 4O2EB 1YA5A 2J7LA 1V3JA 4HIEB 4B7LA 4UV7H 4Z18A 5BVJB 5EZJB 2HWZL 5IT2H 4JFED 4YXKL 5EN2A 5FKAB 1CK0H 4U4BA 4YIQB 4G5ZH 4JLRA 2I27N 3VE0B 3HR5B 3WUWA 4XP1L 4U1SB 1I3GH 1MCHA 1NEZG 3GMRB 4XNXL 5DJ6A 2AK4D 3BPCB 4GLRH 3O9WC 5J1TC 4XZUA 5BZWA 5I1KL 4MXVE 2A73B 3SKOB 3MCLL 3AVEA 3D18B 1FL3B 1XGUB 3DHJA 3GRWH 3QDGE 3GSVA 3QIWA 1FAKT 3P0YL 4GW1B 4MD0B 2XTJE 4JO2H 2NY6C 3CXHJ 4JFFB 5IEKB 1WFUA 5L0QC 3SE8L 3H9HA 4PJ9D 2A6KA 4HJJH 3NOIA 3CU7A 5IMOB 1QSFB 5GRJH 2DQJL 1AGDA 1YDPA 4R3SB 1GC1C 5I6XC 4BSJA 2GK0B 1T89A 2VLMD 5TE4H 4TYUA 3WS6A 2DOCA 4GS7B 4MD5B 1CVRA 1ZOXA 5DZLA 2BCKB 1MIEL 2M8XA 2YC1B 1TPXB 1UA6L 3CFEB 5LG1A 3L95A 2ENYA 1JTTA 2UZIL 1A9EB 3KPRA 4XCCH 3SCMC 4QHKI 2CLRB 5IK3A 1T03H 3RUGF 3ZDYF 4GW4A 1ZLSL 1BF2A 3WO3B 1IT9H 3CMOH 2VC2H 3QEHB 1MPAH 5I1DA 1R3HB 1XH3A 2A1WL 1JI1A 2EYTB 3DV4A 4JPKH 2D7PA 1SMAA 1KF9B 1U8QB 5TDNA 1UM5L 3ARBB 2JIXB 4MXWL 4ETYA 1MF2H 1T1YB 2GCYA 3VXPB 5A16B 2FJHB 3IFOA 4P9MH 1S8DA 1K4CA 1A6VH 2CIKA 4G9FD 4WJ5A 4JN1L 4X83A 3NPSB 4IHOB 2Z9TA 2Q8BL 4LCYA 1FYTB 5GGTL 4N0UA 3CFKA 1GC1L 1N4XL 3TO2A 1UG9A 4PJAF 2ZOKA 4P2QA 2B4CC 1OHQA 2OTUA 3BXNA 4KXZI 3NN8A 5IFJB 3KPRE 4XXCA 5HHVH 3ZTNL 3TCLB 5T5FH 4LPWA 2FCBA 3VWKC 4WHYG 1MREH 2LTQC 3V6FB 5LKNA 2XZCL 4ZO9A 5CIPA 3CJJA 3CLEL 4NP4L 3B9KD 4CL7A 4AEIH 1MOEA 3VG0H 3UXFA 5C0DB 2DL2A 2PF6A 1R3JB 1JPST 4C56A 1CFTB 2P8MB 1AP2B 3WFZA 4PLKC 3REVB 3QEQB 3KVQA 4R4FL 2VQ1B 4X6EA 4LCCC 2K3TA 2Q1EA 3RWDB 1KXQE 3F12A 5C0CB 1U8LB 1VCAA 3QXTA 3ULUL 1YJDC 4N0UE 5EZIH 3RVVD 4K7PY 5KVFH 1O5DT 1NGZA 4QOKD 2FSEB 2JJUA 4P2QE 2FHBA 4L8CA 4DGVH 5CD5D 4QRRB 3N0PB 1FC2D 1FIGL 5CZXC 3WIHL 5E8PA 1AO7B 4UIMB 1ZGLB 4LLQA 5ANMA 4YHNB 3L3DB 1T5XA 5I8OL 3G9VA 4HKXA 4WHCA 4P5MB 5K9KB 4PGCB 4U1JB 3VFMB 5FV2A 4XTRC 4KFZC 1TXKA 4F80A 5F7DA 4UUJA 2P8LA 4F15B 3LQAC 4C56E 3BQUD 4F58L 1JGVL 1C7SA 2O5XH 3W39A 1K9TA 1TTGA 1FLRL 3P30L 5DA4A 5HHQB 4Y4FB 5CBEA 4LPTA 1N5AA 2Z8WC 3HAEG 2CK0L 4P5TB 2R1XB 4HX1A 2HAZA 5BCAA 4OZIF 2IAMA 5IKCB 3BZ4B 2AJUH 3OKLB 3IAPA 4KK9D 1VKXA 4NZJA 4W6WB 5HHOD 1YJDL 1JNHB 2VOTA 4R4ND 3MLXL 3ARXA 3Q0HA 4AH2A 4X9FA 4JDZA 1ZWIA 3UYOD 4BYHA 5ANME 1JYNA 2R4RH 1KCLA 3MFGB 3ELAT 4TOYL 1MELA 4N0CC 5KTEL 4XBGB 3BVNA 1RJLB 4KDTC 1EBAA 3TN0C 2AQ1A 4NRXB 1X6LA 4UI2A 4KTEH 1J8KA 3QZWA 2ZP0T 4KMQA 4ISVB 1XF2B 1OGAA 3BAEL 1S9XA 1UB5B 4G6MH 1BD2D 3LQAL 2NXZB 3MRGB 2NW2B 5F7FA 1DVFA 1KTRL 3IDMA 5EIVA 4Z7QF 1HWGB 4ZPTA 1Y0LA 3K81A 1FGVL 2UUDH 2BERA 4M1GH 3N1GC 2M2DA 3GIVA 4PS4L 5I16A 1GJIA 5M94B 1U8PB 1N5YL 3HE6C 3TCXA 4HFUL 3VXQA 3FQNB 4EN3B 5FYJL 2NX5A 1RMFH 5GJSH 1E4XH 3FB5A 3ZT5A 3VCLA 4TTDC 3X13B 3MNWB 2ICCA 4XRCB 3MUJA 2VXUH 4ZAKC 5F89A 5IM7A 1HH9A 1F4XH 3PWVB 4NN7C 1ULVA 2RFXB 1QPXA 4JVUA 1GHFH 4J1UA 2EIZA 3I6GB 3QUXA 2DJSA 5E2JA 4EXKA 1I7TA 4I5BA 4DUVA 1LEKA 3H7BA 3SDAC 5I1LB 5DC4B 1I8LA 1OGAE 3C6LA 1S7SB 5ITFA 3CD4A 1XGPB 5ISZB 2XY2A 3S35L 3INUL 5HYJA 1K6QL 4OCRL 4NQCA 4OLVL 3LS5H 5E6ID 1F42A 3WS3A 3FO9B 1D3CA 3UYRL 1XCTB 5FYKU 1YEGL 4MJIA 5IWLA 3C60D 4URTB 1HSAA 4HHAA 5HJ3A 4OTXH 5I8KL 5SV3A 3PHOB 4G8FA 2FWOB 3MRDB 4TPRH 2NX5E 4QHLA 3AY4A 2MCPH 4JRYB 4AIXA 2CO6B 5K9OA 1NH6A 1DR9A 3WKML 5E9DA 5FB8A 4KRPB 1DANT 4LP4A 5EC1A 2IMNA 3QQ9C 1ZA3A 4AL8H 2NR6D 3BGFB 3PDOB 2IANB 4YHLL 2EYRA 4F33A 5L7XH 1BFOA 3MGTB 5DK2A 2HT4D 1U58B 3GJFA 3K2UH 4OLWH 3O81A 1OB1A 1DBAL 1HHHA 3JUYA 4BM7A 4KU1A 5HYJE 4NQCE 2ESVD 3DOSA 3HZMB 3FT3B 4HK3J 1BOGA 2FLBT 4RFNB 1DQQB 3UZVB 1J5OL 3HRPA 2V7NB 2VIRB 4MJIE 1EEYA 5I66B 2J1KA 1MIML 3UBXI 3L6FB 1GCFA 4YWGH 3RBSA 4R96A 5DGRA 5GRVL 3QI9C 3PWUA 1AD9B 1I85A 3H42H 3RUGA 1D5XB 3ZT7A 5J57B 5JDSB 2A6JA 4S1DD 1N64L 4LARL 4XHJC 2FD6H 5T5NG 2KZ1B 3I02A 2CKBA 5TFSL 5C0ND 3S96B 1F11A 3QQ3A 5JLZA 4NKQB 3V0AC 3G04B 4Z0XA 1TJGH 2VNCA 2BRRL 5HYIA 5IVNA 1MEXH 1YQ2A 1CLOL 2R2BA 3LKOA 4EVNA 5HY9B 3R4DA 3TV3L 5KVEH 3KLAB 5CCKL 1QLEH 3DGGA 3JWDH 1VGEL 4OCYL 3RZCD 4M7LT 3TVMA 3G5XB 1Q72L 5D72H 3GSQA 5LGKA 5DVOA 4PJAA 3QXVA 2D2OA 3P11L 5ETUA 2FL5B 3IKKA 4NBYB 2BFVL 1GSMA 4U7KA 3HTLX 1P84J 3MRQA 2HFEA 1VERA 3U7YL 3S88H 5KJRL 3RUGE 3ZDYE 4RMRA 5ICXB 1I3RA 4LLYA 5INCA 4ZXBA 3IDGB 4Y4KD 3GSOB 2YEZA 2H41A 4D2NA 1VFMA 2H3NB 4FTVB 2BNRA 4GRLA 4Y16D 2OTWA 1Q1JL 1AXIB 4L9LA 1MCIA 3B9DA 3CMGA 3DX7A 1FNGA 2YSSA 2I9TB 2VXTH 2LU7A 4OZFA 3BYTA 1Y18A 1PQZB 3MA7A 3ZHKA 4AG4H 3ABZA 4FQQA 2Y4SA 5E4EB 3C8DA 3FO2B 1I8MB 2ZUVA 4PJXF 1DBBL 3TJHD 5HYSA 5SWQB 4LCWB 5C08B 4PRAA 3VFNB 2N7AA 4K3JL 4JKWA 4FQ1H 5I1AB 5HGDA 5IW6B 5ALBL 3EYOA 4PJAE 3UTQB 3KDMB 5GIRB 4XXCC 1FAIH 2HKFH 5HHNA 5IMLA 3WKNA 4HWZB 1M7IA 4ODUA 2CRIA 2YZ1A 3WDJA 3OF6A 3LHPH 1GGCL 4MB4A 2YN5A 4ORZC 4RNRA 4KTYA 2J2ZA 4APQD 2OJZL 5KSAC 5DFTA 5HDQH 4ZG1A 3SKJL 1ZLWH 2BNRE 4OT1L 2HRPL 1NGXA 1NMBL 1ONQB 5F3HB 3NZHL 2VITB 5KW9L 2VDQH 3GSRB 1GZQA 4U6XB 1HXYA 1A14H 5DUML 4E5XA 2QSCL 1RZFL 4WU7B 5T1KB 3IXAB 3ARFB 1CICD 5E7BA 4NM8L 1B0WA 3QEUA 1E0OB 1MFEL 1T21A 4OZIA 1NC2D 4P0DA 1DDHA 3VXSA 4TVPH 3BZFB 4KROD 5DJZB 3T4YB 3ZE1F 2VO5A 4FFYH 4HXBH 4DEPC 5J12C 4GRWF 4XWOD 3NGBC 4POYA 1NMCB 4Y4HD 3L5JA 1I8IA 2DDQL 3QEGL 3O6KL 1T22B 1OTSD 3EIFA 1HHJA 4IOIA 4OV5B 5D7IB 1R5VB 5I9QC 2E7LC 3BIKB 1V7MH 5GZND 4LSUH 4U7MA 4HDIA 1BFTA 3C8HA 3KJ4C 4K9EH 2ADGA 2R2EA 1PX4A 1EAPA 1I1CA 1HEZA 2HT3C 4JQXC 1R24A 4I8DA 4JFYA 5CILL 2IPKB 4WFHE 1QKZL 3VFTB 3UPRB 3PG2A 1VACA 4PJ8C 3BKMH 2P5ED 2X4SA 4RX4D 2DBJA 3U0WL 3QUYC 2XICA 4NZUL 5HI3C 4KC3B 2AJXH 3BX7C 3BESR 1C1EH 3PJSA 4JDTL 5MEQA 1DQML 25C8H 4RZCA 2L4OA 1I1AA 4OZIE 4KVCH 1IM9B 2ZJSH 3MPCA 4N9OB 1G84A 1MCPL 3VXSE 4PR5B 4FXKB 4WWKB 4ODHL 4UTAL 4HWBA 2EYSA 1P4BH 3S6CA 1RZ7H 1ND0A 2NW3A 1DLFL 4PJFB 1ZA6B 4ZFZA 3FRUB 1DFBH 4KPHL 5KZCD 2XWBA 1GOGA 3EJJX 1DUZA 3CSYA 4CN4A 2VLKA 3HZKA 4X4MA 1FFNB 4YR6A 3DI2B 3NIGF 3ZKNC 2VKWA 4LLDB 4HUNB 3MRLB 2R39A 2YUWA 1TCRB 5I2IA 1T83A 4IRJA 4QRPA 2ADFL 5MP6H 3AB0C 4Z7QE 3T0DA 1J0IA 3MOAH 3A6CH 3CUPA 4J23A 3WLWC 1WWWX 5AYQA 4LLUA 1F4WL 4NRYB 3WN5A 1FNSH 4HLZG 4M7KH 2XFXB 3JBG7 4F7PA 1YNTB 3EO9L 4JB9H 5GRZA 1G9MH 1MCDA 4AY0A 5DUBB 1YMMD 5DJYA 1F00I 2XZAH 4U6HB 4KZDH 4NQDA 3ARGA 3VWJA 3BI9X 3H9SD 5A3IC 3PL6A 1D5ZB 3LKSA 1BF8A 4NO5B 5DTFA 5KVDL 2GTWB 3S4SA 4LEOB 4YUEH 2X1QA 3BH8A 3WL9A 4P2OC 4WUKH 3O9WD 7FABL 1I8LC 2VLKE 3C6LC 3HE7B 3TBYB 1RJZB 4A6YH 2DIAA 4QXUL 1U0QA 4X4ME 5CUSL 3O11B 4GAYB 3STBA 1U3JA 2VLRA 2FH6A 5D2LB 1KSRA 3MRFB 2KKQA 3KYOA 5DEFB 4QRPE 2AV7B 1A6WH 3DRQA 4FMKA 5F88A 5MEND 5IWLC 2EC8A 3LEXA 4NGHH 3I6LD 4X7SH 3CFDA 3MRCB 2NY6D 3TBVB 3QFDB 4PJBB 3VDBA 2OL3B 1FORH 3KPOA 5F1IB 5EFIA 2WW8A 1A7PL 4P3DB 1JK8B 3T8XB 3QIUC 5CWSA 3FT2B 1IAOA 4NQDE 3BDYH 3D2UA 4S11A 1LE9A 4EI5B 2G2RB 2Q8AL 1U95B 4WEMB 1HHIA 1HCVA 4KJPC 1W72B 3MV8A 4S1QH 2ZUYA 1NC4D 1LD9A 3LRGA 1VFAA 3QR2A 2LVCA 5LXGL 3S8WA 3LKQB 3RL1B 1RUKH 1X5KA 5DRXB 3CFBA 4BUHA 2VDML 1BGXL 2QKIB 2E7CA 4KZEH 4M02A 1KB5H 2VLRE 4L4VA 1MQKH 2BZDA 2DMBA 1A6UH 1RHHA 5J6GA 5F7YC 1UCBH 3C8KB 3MCKB 3FAWA 2W65A 3V95A 1ZHBA 4LLMB 2HKHL 5HGAA 4J3SA 1BBDL 3EDEA 4Y5VC 1IKNC 1WISA 1I85C 1ZT7A 2AJYL 2DF3A 2JLLA 4MDJA 1QYGL 3ULUD 3MBXH 1BFVH 3MLSH 2W07A 4NKDB 1PVHA 3W81A 1X5ZA 4HFWA 5DO2C 5DJDB 5DMGC 1REIA 3UTTA 3MV8E 1B2WL 1TETH 2EDEA 1QFUH 4FQIH 4OGYH 3BPNB 4QGTA 4QTIL 4HUWA 4ONFL 1G7IB 3TF7C 3TA3C 4XCFH 5TE7H 5T1DL 2VH5L 1JWMA 4AT6B 4XNMA 5DQJB 4DVBB 4ODVL 3VWKD 4L4VE 1JHLH 1FZMA 1PEZA 3G08A 4QXTA 5J13B 3UBXG 1YMHA 1OL0A 3FQXA 4PJXA 2KBGA 3QDMD 3BGMA 1NLBH 1MFBL 4O2EA 4HIEA 2CGRL 4JFEB 2AXFB 4NUJB 2YA0A 5BVJA 5EZJA 1S9WB 5DWUL 5FKAA 3PQYD 5BV7C 4EUPB 4YIQA 3VE0A 3HR5A 2DIBA 1GGTA 4U1SA 3GMRA 5CAYB 1CLYH 1PZ5B 3BPCA 1UYWH 2A73A 3SKOA 2XACC 3UTTE 3FRPG 2CKBL 2V2TB 3D18A 1WFTA 5E2UL 1NDMB 1FL3A 2VL5B 5F9AC 3F7PC 1XGUA 4WW2C 2DL9A 1C16B 1UXSB 2BY1A 4WHTB 5AZEH 4NCC1 5CZXD 1NCUA 5C2UB 1CDJA 2I5YH 3U82B 1BIIB 5DMYA 1GGBH 3ET9F 4LSTL 4GW1A 4MD0A 2ITDB 4JM2B 5DR5L 4JFFA 3CK0H 5DS8B 3IFNL 5IEKA 4PJXE 4HMDA 4U1LB 1HILB 2YKLH 4XMLH 1B6DA 4XTRD 2QEJA 5IMOA 3SGKC 4LVNC 2XNAB 1LHZA 1I9JL 5E8NB 1QSFA 4R3SA 3NIFF 3WIIH 1R5IB 4PG9B 4L8BB 4F8QA 4JCLA 2GK0A 1FO0L 2QQKL 4BZ2L 3D85D 2W9DL 3QIBC 5BV7L 4MD5A 1FFQA 1Y6KR 2BCKA 2YC1A 3CFEA 3GM0A 5FYJD 4NRZB 1M7DB 1A9EA 2HVKB 2CLRA 2R2HB 1OAQH 3GKWH 3LDBC 1LEIB 3OKEB 3VXRD 2R8SL 3QEHA 4KJQC 3MXWL 1R3HA 2EYTA 4EDWL 1U93B 3LKRB 5BMFH 5GS2H 5HYQB 3D9AH 3LV3B 1U8QA 1S7VB 5SX4I 2HH0H 5I1CH 4JFFE 3LMJL 3ARBA 3V7AE 2ICWJ 2PO6B 2JIXA 2DQHH 4N0CD 1T1YA 3L3HB 3VXPA 5A16A 4FQCL 4RGMC 5CSZB 2Q86B 2FJHA 2V5YA 3TN0D 1QSFE 4JG0L 5DHVH 3B83A 1VDGA 2YD3A 3OAUL 5F9OH 3ZE1E 4IHOA 1FYTA 5E8EB 3MRIB 1NCAH 3WUWG 1P2CB 3WFCL 1G6RH 1HSBB 5J1AB 5FGSA 1TTUA 1M6OB 4MJ4A 2NY7L 4HGKC 5FUOH 1NEZB 5KVGL 3F65A 2CPCA 3M1BB 1IBGH 2BNUB 3TJEL 3TCLA 3MJ9L 5F7MC 2NQCA 3X3GH 3V6FA 3BWAB 1JV5B 5ILTL 1OM3H 3KR3H 4Z8FH 3ZE2F 4TTDD 4JREC 1VFUA 5AZ2H 1JZ3A 1A3RH 5MEOB 1U2HA 3OPZL 2BY0A 4H20L 5IR1B 2G5BB 4YBLC 5C0DA 5M95B 4ZAKD 2IBZX 1R3JA 1MLBB 2ZCHH 1CFTA 2P8MA 2NMSA 1AP2A 5JA9A 2ZKHL 4UQ2B 3KPSD 3REVA 2VXQL 3QEQA 3PIQA 5FCUL 4M7JH 2A9MH 1SEQH 2DRUA 4YFLI 2VQ1A 3RWDA 5D6DA 3UP1A 5C0CA 1U8LA 3WUZA 4G3YH 1FYTE 4XXDB 5I73C 1CGXA 1R3IL 4QOKB 3RY6C 2GJZB 2FSEA 2HTKC 3ARDC 1IC5H 1X4XA 3EYUL 4YDVB 3T2NL 4KJWC 1PZUB 2W9EL 4I18B 3D6GA 1AO7A 4UIMA 1ZGLA 5IGXH 1Q9LB 1RIHH 3QBTB 3RZWA 3KJ6L 3S34L 1Q9KB 4UINH 3T3MF 3L3DA 3T3PF 3VDCA 4PJDB 4HK0B 4QWWD 3OZ9L 5C70A 4P5MA 4M6NH 3HAEH 5K9KA 2B1HH 4PGCA 3MQIA 2OR9L 3NIGE 4LGRB 4U1JA 1T83C 4IRJC 3VFMA 4DQOL 5GS1C 3BQUB 3LRSB 1IGIH 3P77B 4YXHL 2XQYG 4JRXD 1EVUA 4ELKB 2Y5TB 2YOCA 3QQ9D 2I60L 3KPLB 1HHKB 1RD6A 3GGWB 3JWOC 3QEQE 1G7PB 1J7VR 2P5WD 4Y4FA 5HHQA 1X5YA 4EKXA 2JB5L 4JN2B 4Z0BL 1BVLB 4P5TA 3TT3H 1KPUB 2AJ3B 2R1XA 3K74B 4Y5YC 5C0CE 4NNXB 2DMKA 5IKCA 3ARGC 3L3KB 3BZ4A 3VWJC 1GIGL 5I75C 2NXYB 3IS0X 1A64A 3CFJB 3OKLA 2VE6B 3PL6C 4HWBL 1RQ5A 4HF5H 3S3SA 3CLFH 4LVHB 4G7YH 4MA1B 3L1OL 1JNHA 3V4PH 4LU5H 3QXDB 3B5HA 1AO7E 1FNFA 5D7IF 1ADQH 3OXSA 1BQLL 4OJFL 1UADC 43C9B 4EXPX 4S2SB 3QI9D 4NHCH 3LSOB 1HZHH 5B3JF 5JMOC 1IQWH 4RRPA 4XBGA 5GRUL 1RJLA 2YBRA 4PJGB 4G6KH 4XHJD 4NRXA 5IF0B 4UZGA 2VXVL 3QIWD 1JNJA 2AV1B 1BD2B 1XF2A 3CU1A 4ISVA 1CXHA 5JIPA 1C5CL 1UB5A 3KHOA 3HRZB 3N85L 4F9LA 1KACB 3MRGA 3OGOE 4LL9A 4MQSB 1R3KB 2NW2A 3BKCL 3JWOL 2DQTH 3HI5H 1XIWB 2OQJB 1JGLL 2QSVA 5TQ2H 2F8VA 2XA8L 4QT5B 1U8PA 1I1FB 5IROA 3K1KC 3VFUB 1PKQB 4TSAL 3FQNA 4EN3A 2L7UA 5ADPH 5F7NC 5T3XH 5FM5O 1MQ8A 3X13A 3MNWA 2X2YA 1VFBB 3GO1L 3KPRD 4QEGA 1IAMA 1ACZA 1KTDB 1IC4L 4JPWL 3PWVA 4FQ2L 2RFXA 5DHXB 4HPOL 1V5JA 4LIQL 3ZTJG 3I6GA 4HLJA 4IRZL 1FYHB 5I1LA 1S7SA 3B8YA 1XGPA 5ISZA 1KCSL 1OP5H 2W59A 4OUOA 1CR9H 3VH8B 3C60B 3FO9A 1XCTA 3F8UB 1E4KA 4PGZA 3ULSB 3BISA 3RVTD 3FQTB 3EKCA 3IDNB 1H8NA 4GG8B 3S36H 3PHOA 2FWOA 5I1JL 3MRDA 2C1OB 2HVJB 5D93C 1XR9B 4KHTL 1F3JB 4JRYA 4P2QD 3BOVA 5F9WB 3BMWA 5MEPB 3SHSA 5TQ0L 4MSWB 5KN5B 3SO3B 4X7EC 1UKSA 4HGWB 3O2WH 1H3GA 2KQMA 4P46B 3PDOA 2IANA 3GMPB 1YEEH 3MACL 4BUGA 3D0LB 3MGTA 4OLZH 1U58A 2HJFB 3RWJB 1CWVA 1U6AL 4LSPL 1H9VA 5KSAD 1GAFL 5I18H 5I17B 1MAML 3RVXD 1HI6B 5JW5B 3MO1B 5D2LF 2ESVB 5ISZE 4GXUN 2NY5C 3HS0B 3NFNB 5F93C 1OPGH 3HZMA 4EQ2A 3FT3A 3QFJD 2A77H 3WNLA 2XPGB 2LABA 2GKIA 3QRGH 2VAJA 5L2KB 1DQQA 4DUWA 4OCWL 5I66A 2V7NA 2VIRA 4QHNB 3ULVF 2C3WA 4J8RB 3L6FA 4ONGH 5DD0L 2LE9A 3U9PL 4AYFA 4RBPK 1DBJH 1ZVYA 5E08H 4JRYE 1AD9A 4KDWA 4J7RA 1D5XA 5H94B 5JDSA 3BYYA 3GHEH 1JZ4A 5C0FB 5HHXH 4I13B 1NCCL 3S96A 5L9DL 2IANE 3FQRB 3SE9H 1QSVA 1NQBA 2DWDB 2ICES 4OLYH 1JHKH 5L6YH 3G04A 1FNHA 3AMLA 1NDGB 2FHCA 4MLSA 3O6FC 2ATPB 3KPTA 2HT3D 4NQSB 1NUDA 5HY9A 1XZ0B 1SY6H 1H0DB 3PHQB 1T1XB 3GSXB 2X89A 3KLAA 4OF0A 1EGJH 4S0SD 2ZUXA 1F58L 3D3VE 3C5ZC 3U0TB 2FLRT 2NY5L 5GSVB 3QUYD 5HI3D 5JORB 3G5XA 5E24E 5EO0B 2E27L 4DN4L 2UV3A 1RUAH 2FL5A 1HINH 2VISB 1OD7A 2ZPKH 3KGRA 1YNLH 3O8XC 1QP1A 2P44B 2BVOB 2GTZB 4OLUL 2I9LB 4PRPB 4Y8AA 5ICXA 4PRHB 4PRNB 3IDGA 3GMMB 3GSOA 2J8UB 3P3YA 3MR9B 2H3NA 4FTVA 2WANA 3PWJB 3O0RL 3F58L 1WQVT 4GMTH 2FATH 4UTBL 5DLML 2I9TA 3P9LB 4JHZA 2D9QB 2HWZH 4XMPL 1ZHNB 3MRPB 4G80B 1PQZA 4WI8A 4FFVC 4XP1H 1NSNL 1FCGA 1EBPA 3TNMB 4JJHA 4LCIL 3FO2A 1I8MA 4K23L 1BX2B 3OKKB 4H25B 3KPPB 5F1KC 4OIBA 1E27B 5SWQA 4LCWA 5C08A 5I1KH 3QULA 3VFNA 5KAQF 5I1AA 5D1ZB 5IW6A 1B9ZA 1U3HB 1KEML 1V3LA 1U8JB 3UTQA 4M43L 4K07A 1NBVL 2WZPD 5LBSL 3KDMA 5GIRA 3WLWD 4LNVA 5I19H 4HWZA 3CXDH 2YUZA 2NX5D 2OI9C 2FX7L 1IGML 4XC1L 4APQB 2VZSA 3DSFL 3WFHB 3SE8H 5DMKB 3RTQC 3ZE2E 2ZG2A 4BFEA 4KQ3L 2ED9A 4PD4J 2AW2A 4FTVE 5A3ID 4RMTA 2DQJH 1ONQA 1OW0C 3E6FB 5F3HA 1QBBA 1OARL 2Y23A 2NZ9C 2LQRA 5CJXA 2VITA 3GSRA 4U6XA 4P2OD 2BVTA 3ZMRA 1CICB 5D6DC 1N0XL 2P48B 4JM2F 4WU7A 5T1KA 5FHAH 3C6LD 1UEMA 3IXAA 3ARFA 1NC2B 3JTSB 1XCQB 3VRIB 4JO3L 4LCWE 5GGQL 5C08E 1CU4L 4KROB 1DSFL 1IL1B 5BO1L 3BUYB 3BZFA 5DJZA 3T4YA 4E42B 4MJID 5ABDE 4Y4HB 3LB6C 4JHBA 1FNEB 1F4AA 1SJHB 4NHUB 4Y7MA 3QB7C 4RISH 1T22A 1LO3L 4OV5A 5D7IA 2XG4A 5CZKA 5HDLA 4W4NA 3G6DL 3IS1X 1XGTB 1R5VA 2AEPL 3T3ME 3T3PE 3BIKA 1V8HA 3QIUD 4M7ZB 4MXWH 5AUMA 2D7TL 5DZNA 4N5UA 4XPFL 1BOYA 2YXMA 3PXHA 4LRIC 3WCYA 4OLXL 4OZFG 1ZLUH 4KJPD 3LQZB 3BO8B 4FZEL 3VFTA 4K3HA 2Q8BH 3UPRA 4FXLA 1JMZA 3WEXB 5GGTH 3HC4L 3LAFA 1LO2L 4JY5L 4CU8A 1JI2A 1U3YA 1GC1H 4HKZB 5HGGS 2AJSH 1FBIL 1BZ7B 3BDBA 3QG7L 3U4EB 1J1XH 1IM9A 1E6OL 4O9HL 4FQHB 4XPAL 2NTFB 3V5HB 3L9RB 4P4KB 2XZCH 3BKYL 1RUPH 2FNBA 4PR5A 4FXKA 3SKNB 4YHPB 4WWKA 5EORL 4TUOA 2O5YL 4NP4H 1S9YB 3QHZL 5D7IE 4TQEH 5DK0B 1AGCB 4N90E 5EZOH 4BK4A 2GUOB 1A21A 4KRLB 3OKDB 2VKXA 3RNKB 1DQDL 4NDMB 4PJFA 5KZCB 1ZA6A 5B3JE 4R0LC 1M1SA 3FRUA 1TJHL 5I71C 1W8OA 2FGZA 3ZDXF 1MCEA 1KT2B 5I1IL 4WUUB 2NXZC 3MFFB 1FFNA 3ULUH 1QBMH 4LLDA 3MRLA 1AY1H 4OBSA 1TCRA 4IBLT 2D7QA 4LBEB 2XA3A 2P7TB 5IROC 2HA1A 3PF2A 1J0KA 1FIGH 3GHBH 3WIHH 4NRYA 2GT9B 4EN3C 1ZT4B 1CXFA 2XFXA 4CAGA 3HCVB 1YNTA 2NLJB 3S36X 3TVMD 3STZB 1YMMB 4L4JA 1QSED 4DGIH 1MCRA 5D4QA 4KK5C 5DUBA 5I8OH 3K8LA 3H9SB 3B4NA 4U6HA 5C9KA 4X8JB 2R0LL 3ES6B 4YFDB 5M7QA 2AEWA 2YS4A 3BPLC 3FQUB 1AHWC 2APVA 3BW9B 1D5ZA 4Q9RL 4JAMB 3NIDF 4NO5A 1JGVH 3D48R 2H2SC 4F58H 2GTWA 4PJFE 3P30H 1FLRH 4DKEH 4LEOA 3O9WB 4U1IB 5E2TL 1JHTB 2CK0H 1UC6A 3HE7A 2BNRD 3QG6B 4PJDF 3TBYA 1RJZA 3QSKB 4H5SB 3WNMA 2YA2A 3O11A 4GAYA 2YWZA 3OR6B 2OR8A 5D2LA 4OZ4B 5JHDB 3MRFA 1F2XK 5MENB 5DEFA 2AV7A 4W68A 2HLAB 3MLXH 3Q6GL 5ESQB 3B3IB 3ZDZF 2EDHA 5L0QB 3TBVA 3MRCA 1SHMA 3QFDA 3BIAX 1AXTL 4PJBA 5JW4N 2OL3A 5E2WL 5F1IA 5FYKH 5K59F 5I15H 2HT2D 4P3DA 1JK8A 4TOYH 3T8XA 2D3VA 5KTEH 3T04D 3FT2A 4KJYB 2VRAA 1B0RB 5C6WH 3MRNB 4MQ7B 3TEUA 5I6XB 1CG9B 1GGYA 1IC7L 1CFVL 4EI5A 2G2RA 3ORJA 3BGFC 1U95A 4DKDC 4DOHB 3HA0A 1W72A 2YMXL 1CGTA 1UACL 3BAEH 5KG9B 2YR3A 5KSBB 4O58L 1LE5B 3LKQA 3RL1A 4HJ0C 3SCMB 5DRXA 1RIVL 5JQHC 4GG6B 1LO4L 2QKIA 4NJ9H 4H88L 1Z6JT 5JPMB 4WFHD 1ZGLM 5D2LE 4PJGF 3WSQL 4F7MB 1N5YH 4HFUH 4KJQD 4NBXB 5FYJH 3OBAA 4I9WE 4LRNL 3C8KA 3MCKA 1OAZH 3B9AA 2DQCH 1RZ8B 4L5FL 1XF3B 4LLMA 3CVIL 5IVZB 3ULVE 4PJBE 1G9NC 4O2FB 2UUDK 5B39B 3TH4T 5CSGA 2BOCB 4FMFA 4UT6L 5D7SL 3KYKL 4FN0A 4LASL 5K33A 4NKDA 3SGJA 1BM3L 5EBMB 1S9VB 5DJDA 4PV9B 3S4SG 4CDHA 4HUUB 3ESUF 1N6UA 3TBSB 1MFNA 1G7IA 3S35H 4O00A 5I8EB 1I7ZB 4OCRH 1F4YL 2APBA 4OLVH 3SE4A 1AXSB 3MX0A 4G42B 5GGVL 5C6TL 4AT6A 3UYRH 3WFDL 5DQJA 1SJVA 3S3PA 4DVBA 35C8L 1YEGH 3JUZA 3L7FB 1KLUB 4EDXB 4P9HC 1F90L 5HHMD 2H32H 4PB9L 1L0YA 4MQXC 1NEUA 2V2WB 3CSGA 4JFEA 4NUJA 1UH2A 2AXFA 3PQYB 1HH6B 1S9WA 4DVRH 4EUPA 3WJJA 1G9NL 3UPCA 1FFOB 1LO5B 4W70A 2Q20A 4Y88A 4YHLH 2V9QA 1MCSA 1PZ5A 1H8SA 4JFDD 1J88A 2F5BL 4DGYH 4HBCH 4CNIB 1NCTA 2V2TA 3ZSTA 4FG6C 1NDMA 2P43B 2GAZB 2VL5A 3ARDD 1URLA 1DN0B 3CVHB 1P7HL 2FRGP 3CIQA 1UXSA 4WHTA 1AJ7L 4KJWD 5DEGA 3ILQC 2IPTH 5E4EC 1MCOL 1BIIA 2Y6SC 3RI5K 1J5OH 4UNTA 1NAMH 2ITDA 4FP8L 2XOTA 4JM2A 2VDLL 5DS8A 2GY7B 1T0MB 4U1KB 4CMHC 1LO0L 4DWHA 3OJMB 4U1LA 3NACL 1KJVB 1HILA 1UWXH 4UIKL 4IRJD 4QRPD 3T77B 5F44A 2XNAA 2RIKA 5E8NA 3I3BA 4JFEE 1KNOB 1N6VA 1R5IA 1UKTA 3RVUC 4Y2DC 4PG9A 4L8BA 5CP3H 3D85B 4NCDA 4LP5A 5TFSH 4ZTPL 5JHLL 1U2CA 3HUJF 4MLIA 3VGDA 3CZJA 3ARGD 3VWJD 2NCMA 1JPGB 4NRZA 1M7DA 1NBYB 1ZKAA 2A0LC 2BRRH 2HVKA 3PL6D 1FN4B 1A7OL 1CLOH 4PTTA 1KC5L 2R2HA 5HBBA 3VXRB 3TV3H 4ZOAA 1T2XA 1LEIA 1RULL 3OKEA 3VA6A 5CCKH 1F3DJ 1FG2B 3ARFC 1E4JA 4FQJL 2IBGA 1U93A 3LKRA 1M71B 4OCYH 4DW2L 1Q72H 5HYQA 5KANI 3EZJB 3LV3A 4NWTL 2VLRD 2PO6A 3P11H 1EX0A 3CX2A 3P40A 4P57B 3L3HA 4J3UA 2MFNA 3TN0B 3UBXB 2BFVH 2RR3A 3KPQB 4XP6L 5BVPL 5CSZA 2Q86A 4QLRA 1KBGL 4MA7L 1E6JH 4BK5A 3P9WB 4JCMA 1H5BC 5E8EA 3MRIA 1P2CA 1HSBA 1FSKC 5J1AA 4YC2C 3VGBA 4EBQL 1KELL 5EWIH 5AAWA 2EDOA 1M6OA 2EXYC 3S5LG 1SM3L 1VHPA 2LFGA 1I9RL 1NEZA 3HE6B 4OM1L 3RAJL 3M1BA 5E95B 5F1NB 2BNUA 1LK3L 5FF6B 3MV8D 1TZIB 3BWAA 1JV5A 2H2PC 4KVNL 1DBML 4OD1L 1DQJB 2J8UF 5MEOA 4K3JH 1LQSR 5IR1A 2G5BA 4OGXL 4NN7B 3V7AG 4JFHE 4PB0H 5ACZB 3KPSB 2GFBB 1MLBA 3K80A 1J1OL 1OAXL 4UQ2A 1KN4L 2B7DT 2CDGB 1INQB 3MBEC 1QR1B 3LRHA 3DBXB 2UYLB 4LDOB 4HKJB 5E94B 1TTFA 3NFPB 1GGCH 3SDAB 1PKOA 3FMGL 4PY7B 3MA9H 4XB8A 2W38A 1BFSA 2OJZH 4XXDA 1WBYB 5IIEB 4QOKA 5FDWB 3BKJL 3SKJH 3CGTA 2GJZA 3VGFA 2HRPH 3WV0A 2Z4QB 1NMBH 4LSVH 3NZHH 5E0QA 4P49A 5KW9H 4YDVA 3BD3A 4WHDA 4I18A 2C26A 1Q9LA 5ACMA 5FV1L 1MWAB 3QA3B 3UTTD 4N1HB 1Q9KA 3D87B 4PJDA 4HK0A 3ZDXE 1MFEH 5DD6B 1ZLWK 2VDKL 3SBWA 4WEBL 3AREC 4RA3A 4HZAA 4JRXB 3BQUA 3LRSA 3P77A 1IVLA 1J0YA 1C08B 2L7JA 2EZ0C 4ELKA 2Q3ZA 2Y5TA 2D0GA 2P5WB 4UOW0 3KPLA 1HHKA 3GGWA 5MHSD 3TBTB 4JZOB 4PPTA 1G7PA 4PGJA 2DDQH 4AEFA 4P23C 3QEGH 1Z0MA 3O6KH 4Z76B 4JN2A 4XAWL 1BVLA 4L9DA 1KPUA 2AJ3A 2D4DA 4X7FC 4NNXA 2P1YA 3L3KA 5CIPH 3CFJA 3IB4A 1KTLB 2VE6A 4QOKE 2ICEB 2P8PB 1NAKL 1FJ1B 5EDXA 4AZ8A 2YPKB 3GSWB 4HMCA 1EEQA 3QXDA 3SGEI 3NIDE 1QKZH 5LGHL 1EIBA 1JNLL 1QBLH 4L4TB 3HE7C 2DICA 5E6ZA 1FRGH 2R69L 5TF0A 3QUML 1MFAL 3QI9B 5HVFB 3U0WH 3MLWL 3MUZ1 1X5XA 43C9A 2VDNH 4P59H 3C87A 3PP4L 4YXLL 4PJDE 1DQMH 4S2SA 3LSOA 4KI5F 4PJ7B 2BP3A 4YHML 1AKJD 4OCSL 1M4KA 4PJGA 1MJ7L 1X7QB 5IF0A 2AV1A 1BD2A 1MCQA 4ODHH 3ZDZE 3HRZA 2CR6A 4UNUA 1UM6L 1CZ8L 3BEVB 5T3ZE 1R3KA 2JKXA 5IFHH 3MLTB 4LHUD 1XAUA 1XIWA 2A38A 2OQJA 3QHTC 4O51B 5K59E 4LSQL 4Z77B 3O6FD 3GSNB 4PUBL 1DLFH 3VFPB 4QT5A 4X7DC 4EI5C 2G9HB 1I1FA 1YEIH 4JHAL 1Z9SA 4KPHH 5E00A 1BWMA 3VFUA 1PKQA 3NPZB 2Z8RA 3C5ZD 1Z5LB 3ZTJH 3U83A 1VFBA 5GGRY 3MRBB 1KTDA 3S35X 3QNYB 4HG4J 1IEHA 5HPOA 4WTWA 2DS4A 1IEAB 5EIIB 4K3EH 2VERN 1F4WH 4LK4A 1QLRB 2K7QA 4PJGE 3EUUA 2WINA 3L5IA 3G5ZB 3PE9A 3U0PB 3SE3A 4UB0H 1BD2E 3M45A 4HWEH 4PJHF 1YYML 3O4OC 4C83B 2E9BA 1X4ZA 3LPFA 1K85A 1JZ6A 3ULVL 2OL3L 5DD3L 3VH8A 3C60A 4JZNB 3ULSA 5ID1B 2WQRA 4FFVD 2FEDC 4NN5C 1FYTD 3SGJC 5ICZB 3FQTA 3SPVB 5FUZL 3IDNA 4GG8A 1RFDL 1PKQE 3T09A 7FABH 1BJMA 2C1OA 2HVJA 1XR9A 1F3JA 1P7QD 1KFAL 4YNYB 5CUSH 3SE4C 3TLRA 4J3OC