1QZ1A

Crystal structure of the ig 1-2-3 fragment of ncam
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
290
structure length
288
Chain Sequence
VLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neural cell adhesion molecule 1, 140 kDa isoform
publication title Structure and interactions of NCAM Ig1-2-3 suggest a novel zipper mechanism for homophilic adhesion
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 66
structure length 288
sequence length 290
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qz1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qz1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qz1A03
3NCYS 1R5WB 1X6NA 3GRWA 2AXJA 3SQOL 3T1FA 1FG9C 2YBRA 3CSPA 3FHQA 4OM1L 3QT2A 5HYSG 3EHBD 3ARGB 4QY8A 1XGTB 3IB4A 4YWGH 5EU6D 1G7QB 4FQLH 2DN7A 5CEZH 3VCLB 1F02I 3ILPA 2CMRH 5BW7A 1KCRH 2BNRD 4H20L 5DJ8A 1WSST 1D9KC 2JCCA 1EEYA 1F4XH 3MNVA 2CDFA 2EDFA 3NFPB 4GRMB 3BVNB 4XCCH 4DN3L 1NGZA 2HFFB 5FM4A 5GQBA 3FFCB 1C5DA 2HVKB 3VXRE 3O45A 1G0XA 1UGNA 1PG7H 5DEGA 3ARUA 3LIZL 5DHVH 5TE7H 1EFXB 2XI9A 5EPMA 4LLYA 1DE4B 5I6XB 5F9JB 5J9PB 1S7WA 1CDUA 3MV7B 3QUYA 4TSAL 4XMPH 5E8EA 4JFPA 1G9NC 1SJEA 3T3PE 1F8TL 4YHZH 1D9KD 4HIHB 3U2SB 3RWJA 3ARFD 3Q2CA 1MCHA 3HG1A 5SV4A 2ED7A 2I9TA 4JM2A 5EOCH 3PE9A 4Z77A 4JFZL 2VABB 5DJ6A 4S11A 2H32H 4G8GD 4ZUWA 4C59B 1QSVA 4JFFE 3ARDB 4RAVB 1FRGL 5BS0E 3AS0A 3PIQB 1I1AA 4NRYA 4FTVE 4QRSB 3DVGB 1BJ8A 1L6XA 2G75A 1HIMH 5C09D 1C7SA 1BFOA 4WHDA 2K1MA 5I66A 4K3JL 3MLPA 2HN7B 3EDDA 1UM6L 4MJID 5GJSL 1TFHA 5LGJB 4DUVA 1I8IA 1WZ1H 1NH6A 2F15A 4JB9H 4IRJC 5IROC 1J10A 5IKCB 5DJ2A 4P4KA 3VXNA 1F58L 5FCSH 4ZMAT 1BZ7A 3WUWB 1AGEB 3TPKA 5JPMA 5I1IH 2ATPB 5FOBA 4JO1H 4OCRL 3MJ8A 4DCQA 4WCYL 5ILTH 4LNRB 3SJVB 2ID5A 2HVJB 2M8XA 5T3XH 2DMCA 5EU4B 4HFWA 1RZJC 1KJ3H 4HPOH 2KQNA 1Q9OB 4ZS6C 5EUKB 4QXGH 2ICEA 1ZS8B 5E8OB 1KPVA 2ICWA 2PYEB 2NNAB 1CICC 3IDIB 1A9BA 4LCUB 5FECB 2EYTB 5ADOH 1X5GA 4ALAL 5IV2A 5T5FH 4UNVA 4AM0B 3PJSB 3UBXI 1P7KA 5D7IE 4WDIB 1IGYA 1FGVH 3PP4H 4P2RA 2OM5A 1JK8A 4GH7B 4FOMA 4KJPC 1DBBL 4P57B 1SEQL 1OD9A 3VFRB 2EYRB 1NAKL 5EUOB 4ZS6D 3KPRD 3PNWA 4I8DA 1CTOA 2WUCH 5ALCH 1CICD 1IC4L 3RPKA 3HMWH 1BD2A 4UV4H 4YLQT 4KKAC 3HZMB 3NCJH 4WUUA 3TIDB 4WFHD 4PB9H 3GJFH 1FJ1B 2HTLD 1F2XK 4KJPD 1P7QD 1JZ7A 1JHKL 1ZXQA 5CJOL 1D5IL 4H26B 2AK4B 2Z91B 2W59A 1S9YA 3UJIL 3S8WA 3BW9B 2V7HA 4WU7B 1F4AA 4IS6A 5GRZA 5KS9B 2AEWA 1OP3H 1RULH 1QNZL 1QQDB 5I2IA 3QEQD 1UYWH 5IB1A 4P5KA 1ZLWH 5ESVB 4X5XB 4HAGA 2F54D 5C0RH 4R4BA 1IEAA 4ZFOL 2YC1B 1N5AB 2C3HA 4FQHB 4HS8L 5IG7B 5IIEB 4KJWD 4S0SD 4U1JA 2VR5A 4K7PH 4PYGA 3LZFL 1XGPA 5F44A 2E6PA 5IVXE 1W72H 1HEZB 3QPQC 4O4YL 2IPKA 3GIZH 4L8SB 1IGCL 3ARVA 5I9QB 1FN4A 3REVA 3GUTB 2R56L 3RWEA 2X1QA 1PZ5B 1Q72L 1NUDA 1TZIA 4LSPH 4MNQB 5I74C 1T5XA 3WJLC 2P5WA 4Y16C 1P1ZA 1SVCP 2JK5B 5GGRB 4PJ5D 4TRPH 4PJFB 1MRFH 4C56D 1P7HL 5IHZA 5E9DA 1IL1A 1NFDA 1H0DB 4X7TB 5C2BH 3QPQD 4K9EH 4UMGA 3EBAA 4UI2A 3IJSA 4DOHE 4JREB 1TJHL 1YEKH 2WINB 3QXDB 2DAVA 3MRQA 3QUZB 3KNBB 3BXNB 1U41A 1FDLH 3DI2B 2H41A 4Y16D 3LKRB 1VDGA 2NY6C 3FT2B 4M6NL 3FQNA 2X1WL 1AY1H 2MWCA 4ZUVB 4P46A 1J87A 1OAYL 4R96B 5E7BA 3BE1H 1KTKE 3V52L 2WLYA 1INQB 3QNYB 1NC2B 1T4KB 3HC0A 4WEMB 1S9KC 5T1DL 1HHIA 1TTGA 1KCSL 1T7XA 4P2CG 5EA0L 5FKPA 1LHZA 3SGKC 4MA3A 3UEZA 1T2QL 5F8RC 1JUFB 4JHAH 3ZKMC 4PJXB 2HJKA 3ELAT 5I17A 3TO4A 5IJVB 1MCQA 2JB5H 3GI8H 4WUKH 2AXFB 4UTAH 3ZZ1A 3LSOB 3UCRA 3BKCL 1NCAH 3R1GL 3C8DA 4HK3J 1N5YH 3DV6A 1JRHL 3ZSTA 3AMLA 2X4UB 1KB9K 1W8OA 3GB7B 4LSDA 3VFPB 4BZ1L 2GFBA 4UAOB 4HWUA 2HT3C 1BVKA 4NUJB 2C7UA 5ITFA 1QFWM 4YIQA 1YN7A 1TDQA 3DHJA 4OF6A 4FFZL 5F6HI 3MRMB 3CD4A 4JPKL 1IQDB 1NGWA 4M61B 1MFBH 2ESVA 5F9WC 2P8LB 1AQKL 2WLZA 5HBBA 1JE6A 2FIRT 1CL7L 1FYTD 4GUPB 3GMOA 2YD7A 2NLJB 1UKQA 2VLRD 4KGJA 2CUIA 4I2XA 2NY5H 3TN0C 4U1HB 3UC0H 1AJ7L 3OKKA 3BDBA 3RZWA 5C71A 3VWJA 4JFOB 5CJ5A 3IFNH 5HDLA 1HQ4B 1ZLWK 2HT3D 5F1SA 2PW1B 2AI0H 5IM7A 3IU3B 4DVBA 3ECBA 1TQBC 3THML 4OBSA 3IU4L 2HFGH 3C09C 5KVEL 3FQRB 3RNKB 4ACPA 4JY6B 4GJTB 3MLRH 3ARBC 1PQZA 3VH8B 3TN0D 1A4KA 3RWGB 1JN6A 3VI4F 4C54A 1SY6H 1P53A 2W9DL 5MP6L 4MYWB 3STLB 3LAFA 5JHLL 4P2YA 3VXRA 3A6BH 5DD5L 3IFPB 4G6AC 2Y06L 5CCKH 1RZ7L 4FQXB 1XF1A 2YA0A 3HMXA 5IW3A 5I75B 3ARBD 2YPKB 4I9WE 2JELL 5DJAB 1CT8A 4NQCB 5AG8A 4R9HA 3RPIB 3UTSE 1EGJA 4PLOB 1LK2A 4D0BB 1P4LB 4JFEB 1NLDH 3MBEB 3P9WB 1JPSL 4JFFA 3I75B 1H5BA 2FSEA 3K1KC 1EK3A 4FTVA 2DLEA 4OJFL 4WY7L 5IK3A 2YD5A 1YQ2A 4WO4C 2H6PB 4F37K 2XIDA 2DKUA 1AR1C 1G9NL 1EPFA 5EU7E 4PR5A 2VH5L 1WV7T 3SBWC 1QSFD 3BKYH 2NXYB 4HG4K 1CU4L 1NL0L 4NO0B 4NT6B 3T3MF 4RWYL 3HE6B 4Y1AE 3UJTL 5I0DA 5TDNA 3LS4L 4NHUB 4RIRA 4F7CB 1YQVH 2C4FU 3MRBB 4C55A 1RHFA 4PJBF 5E94B 3NBNA 2IFGA 3X3FL 3PQYE 2IQAA 4HULB 1VHPA 1MRCH 1TLKA 4LCWD 3DJ9A 4PG9B 1JHLL 4PD4J 3SE3A 3D2UD 4XCYB 3ORJA 2A6JB 2P46B 3IDJA 5D7IA 5E8NB 1UJ3A 2Y07L 1YUHA 1D6VH 3DYPA 1X5HA 1RVFH 4ZAKA 1KPUB 1OAKL 3HE7B 4M5YH 1WZKA 4UT9L 3WDJA 4KTDH 1A14H 1RZJL 2QQKH 1XGYH 1UVQA 3QI9B 4OCSL 1BECA 4WI3A 4YFLF 5T3ZH 3T0EA 4Z5RA 4WW2C 3OHXB 5HHMB 2F5AH 4WI2A 1MHCA 2F5BL 3LEXA 1K3ZA 1I1YA 4QWWC 5HDQL 3SO3C 1H3PH 2DL2A 3ALWA 4RGND 1HXMA 4WEBH 1MI5E 3F7RA 3OR7B 2IQ9H 4YQXH 1PW3A 4HXAL 3AC0A 1MLBA 4XCNA 3T0WA 3WNOA 2Z8RA 1D5MB 5C0IB 3EZ8A 4ZQKB 4GXVH 3ROOB 4L4VD 1IM3B 1I7RB 1YNKH 5IB3A 3S88L 4HUMB 4W70A 1T1YB 4Z0BH 3ZKXC 3LKQB 4QWWD 3ARXA 5D7SH 5JTWA 3QG7L 2BCKA 1OW0A 3KVQA 5ABDE 2Z92B 5TQ0L 3RWHA 4Z0XA 4AEIH 2ICES 3U0WH 2B1AH 5F96L 3P4MA 1FFNB 5AZ2L 1FSKC 3V9FA 4NKMA 4U3XA 4M7ZB 5JW4M 4PJCF 4GAJH 3HC4H 2XKSA 5HYQA 1UG9A 3TZVB 2GSGB 4X6DE 2X4RA 1MQKH 5IVXA 1QLRA 1U8OA 5L8JB 1HZHL 1I3VA 4NNXB 3TFKC 2VXVH 3QPXH 2GJZA 4RFEB 3CLEL 4DK3A 3QQ9C 3DGCR 5CEZD 3DVIA 1A7NH 1D6EA 1QTYT 1CGXA 4HDIA 2EE6A 4P5TC 3QISA 2YBRB 3T1FB 3QJHB 4WFGD 4MZ3A 3N1PC 4HCRH 2DQEH 4WFED 3VXUD 3K80A 5E2UH 1AKJD 3WKML 2IAND 5E00A 4QY8B 1T6VN 2AABL 1KENL 4E41A 5HDBF 4YDLB 1ORQB 3TFKD 4UIMA 3RHWK 4K2UH 3ILPB 1TCMA 4NGHL 3TBVB 4Y5XA 4PP2A 3H9SE 4R7DA 2JCCB 1EEYB 3MNVB 3QQ9D 2FH6A 1NGZB 4YHLL 3VI4E 1C5DB 1A1MB 5E5UB 5HD8C 3FO0H 3O45B 2OJEA 3V4VL 4U1IA 5DEGB 3PWVA 2JJVA 1NAMB 1KJMA 2R2BB 4UB0H 4AK1A 2R9HC 4KUZH 5EPMB 3BGFC 4LLYB 4ONGH 1S7WB 2ZUXA 3AREA 3QUYB 3U7YL 5E8EB 3MJ9L 1SJEB 1QO3A 4G6KH 4OD1H 3RWJB 5A16A 1RZFH 1XCTA 3HG1B 3NN8A 1YYMH 2VN4A 4JM2B 4NQDE 2I9TB 4PV9B 5C6TL 1OGAB 3C5ZC 1NMBL 4Z77B 5KZCB 5HD8D 3UTQA 1CLOL 4RFOH 3SDAA 3CMGA 2QSVA 3CIQA 1RAMA 1I1AB 2R9HD 4NRYB 4AQOA 1RZGA 2CLVA 1KSRA 2W60A 2DQCH 4HBQA 2IJ0C 5I66B 4OGXL 1I8IB 1LO4H 5F7DB 1JZ4A 5DJ2B 3OAYH 4P4KB 4IRSC 3T2OA 4W6YB 1MJ8H 2IG2H 1BZ7B 2YPVH 5T3XD 3G9AB 7CGTA 4P9HH 5JPMB 3T3ME 4YXHH 2R4RL 4YDKH 5FOBB 2VDRH 3GMRA 3KXFE 3PWNA 3S34H 1NGQH 3DOSA 3WO3B 3MJ8B 4DCQB 4K8RC 3HI6H 3LKNA 5K9JH 3KYMA 1FNLA 1MVUA 1AIFB 4IRSD 1XGQA 1MCPH 3MNWA 3QHFH 4TSCH 4PJBE 4D0DA 1QOKA 5IT2L 2ICEB 2DM2A 3ZE1F 3HCVA 4Q9QL 1KPVB 2ICWB 1JNNL 1MJJB 2CKBL 4JRXE 4WVRA 2B2XL 1A9BB 1HH6A 3FN0L 4FRWA 5IV2B 4LK4A 3FOMA 3NAAH 4R8WL 4X7SL 4Q0XH 4R0LB 5L2KD 3OB0H 4KHXH 4IDJL 1P7KB 4K8RD 2Z31A 3MGOA 1A7QH 4W6XB 1A7BA 4X9HA 4P2RB 5C0BD 1JK8B 4XPGH 2OI9B 2X1XR 1G6RL 3MO1A 4G43B 1MCSA 1GIGH 5B39G 1RPQA 3KHQA 3PNWB 3WFHA 1X5AA 2R0ZL 1I85A 1MJ7L 1BD2B 2VLME 1YECH 2RAMA 5EBMA 4IRZL 3V6ZA 3E3QE 3F58L 2PKDA 3NH7L 1I1RA 3VRJA 1MEXH 3ZKQD 3MODL 3D18A 1S9YB 1WFNA 1VGKA 2DTMH 3CFDB 5ICZA 1DANU 4YC2B 3X3GH 1K8DA 3CFKA 2OTPA 5BV7H 4IS6B 3QBTB 4L29B 3UTSA 2X4QA 4OD2A 5I2IB 2L0DA 4P5KB 1LO3L 5JO5A 4R4BB 4JQVC 1NCWH 4OF8A 2HJLA 5I19L 5M7QA 3B83A 2NY1D 1B0WA 2VXTL 4PJCE 4U1JB 4YGVA 1XGPB 2P7TA 4OQ1A 3MV9E 2VDQH 2OR9H 5GGTH 5HJ3A 3RFZC 2WWKO 2IPKB 3OXRA 4FQPA 1FN4B 1IARB 1D3CA 3L3GA 1FNAA 3REVB 5JW4Q 5FYLD 5IEKB 3RWEB 3W0WD 4Y1AA 1BFSA 3WBDA 2LTQB 3CFCH 1TZIB 1T5XB 1T1XA 3EO9H 3PWLA 2P5WB 4NQXA 1P1ZB 2X41A 2FD6H 5F7LB 2VN7A 4G9DA 4P2QA 1RHHB 5E9DB 1IL1B 1QHPA 3MA7B 1NFDB 4EJ1C 3OAYK 4QRRD 5HDBE 1ZA6A 2AQ2A 4EVNB 3IJSB 1F3RB 3GNML 1RIVH 3PQYA 5BXFA 4YDVA 3L7FA 1J8HE 4GXUN 3VWKA 3MRQB 4JR9L 1NCTA 5D6CA 3QQNA 4RDQF 5D96B 2VR4A 3UMTA 4U7MA 3IF1A 2KQMA 1R5VA 1FFQA 2VSCA 3FQNB 4QHMA 2EDJA 5SV3A 3F65A 4P46B 3HB3C 4WI4A 3RRQA 4JPWH 4YDJA 4D9RD 5E08L 2FBOJ 4QTHA 1NMCB 4D9QD 5DT1H 4GRWB 1H3UA 1HHIB 4DKEL 4ZNCD 3JV0A 3MZGB 2FJGA 1CF8L 1NDMA 4MA3B 3NZHH 1MI5A 3QNZA 1QLEH 3OB0K 4N0UE 4O02L 2Y1VA 2BRRH 1C8PA 1T0NA 4Y4HD 2AW2A 3MOAH 5I17B 3TO4B 3SGEH 1L0QA 5EU6E 3TPUA 1RQ5A 3ZHKA 4XAWL 3OKOA 3S36L 1BEYH 3MLWH 4OQTL 5KVDH 3W39A 2MSPA 3DV6B 2ZKHL 3LH2L 3SE9H 1I8LA 3VFVA 5ISZD 5IJKC 3JZ7A 3DNKA 4WIQA 5I8CA 3QIBA 3UYRH 2GFBB 5GGSA 1BVKB 2C7UB 5ITFB 4YIQB 1YN7B 4D9LL 1NGWB 4OZGF 5DR5L 2D7NA 1GPOL 3D6GA 3GMOB 4X6DA 5DZLA 1QHOA 5T1LD 4S1QL 2M26A 4NM8H 3VXTA 4Q9CA 3GM0A 3MCKA 4I2XB 3RKDC 4DWHA 3WKNA 2XPGA 1J5OH 3OKKB 2VWEC 4Q97A 3K4ZA 4NZDA 3QRFM 1UKTA 3SDCC 3VWJB 4APQC 3Q3GA 5FCUH 1A7RL 3GBNL 3VFGL 5IM7B 2CMRL 4DVBB 4BYHA 3ECBB 3ULUH 5LJYH 1A5FL 3VD4A 4MQ7A 1CDBA 1QBMH 5C09E 1TPXB 1OOAA 5E1AA 2NY4B 1S5HA 4PRPA 2W92A 3BPNB 4MJIE 1PQZB 3RKDD 5GRYA 2AJYH 3CCHB 2OBGA 3LDBC 4N90D 4Z7NF 1LNUB 2VZ3A 1A4KB 4OUUA 3D39D 5TE7L 1JN6B 3IFLH 3SDCD 4APQD 1IE5A 1RUMH 1AXIB 3OKMA 5I1GH 1P2CA 1MY5A 4IOSD 1KLFA 5ACZA 3BQUB 2VLLA 4FQ1H 1V3LA 2E9WA 3OZ9H 5EOCL 5KSAA 4RMUA 2PXYC 3B5GA 2FATH 3KG5A 4PIRF 3L6FA 1FH5H 3QO1A 4PRHB 1CT8B 3NCBB 5GSRA 4LPUA 5AZEL 4XP4H 4XCFH 2X1PA 4LGSB 2XICA 1RZKH 4WGWB 3C6LC 2DM7A 5LGKA 1FNSL 4JFFB 1H5BB 2FSEB 5D71H 4OLWL 2VUYA 4XP6H 4JB9L 1EAPA 4WHCA 4Y5YC 1QSZA 1WWBX 4U4BA 3SDYL 2NX5D 3F12A 4FTVB 1KB9J 4RBPH 1R3HA 5IK3B 3QFJD 2Y5EA 1OY3B 3C60C 3CX5J 4D8PA 3WSQL 4PR5B 1LO0H 4V1DE 1WEJL 4NO5A 3WJJC 3C6LD 1JPGA 1F13A 5F7YC 2XYCA 2K7QA 1MCOL 1KACB 5BZWB 4HUUA 1T0MB 4R7NB 4DQOL 1JZ3A 2CH8A 3MLUH 3F7QA 1NGPH 5TDNB 2J6EA 4WFHE 5SWZD 3KXFA 4RIRB 3C60D 3O2WH 4PJIF 1N3NA 2GT9A 3C8KA 1Q1JH 4AL8L 5GS1A 4UTBH 1ZSDA 4J3TA 4O00A 4ZOAA 4M62H 2IQAB 1MCWW 4PJBA 3FO9A 3WE6B 2VERN 1GVIA 3L3HA 4G7YH 4XWOD 3QEQE 3P73B 1Q38A 3OJDA 5K93A 3B8SA 3B9DA 5DGQA 2F54E 4ZFOA 4F2MA 1U2CA 1UJ3B 1SBBA 3O0RH 4K8RL 3ZTNH 2CRIA 1JGVL 4ZAKB 3L3OA 3R4DA 1KNOA 3ARGC 3UJJL 1A6VH 3O6LH 3VU2A 1UVQB 3SCMA 3T0EB 1P4IL 3BHBA 4LOUC 2PTVA 4XNYH 1MHCB 3LEXB 1I1YB 4PLJC 1NBQA 1QEWA 3T65A 1HXMB 3MA9H 2VL4A 4XVUC 3P11H 5I1JH 1MLBB 4OB5L 4FQCH 4XCNB 5K9QI 1BBDH 1RULL 4PJ5E 4QO1A 3ARGD 4QGTA 1UYWL 4C56E 1UFUA 2HMID 5I6XC 5IB3B 4KQ3H 4ZPVA 3UDWC 4LOUD 4W68A 4MHHI 3GRWH 4PLJD 2YMXH 2BCKB 3RWHB 4Z0XB 3BP6A 3FFCD 4YHIA 3BI9X 5GZNC 3P4MB 4XVUD 5C9JA 1CDGA 4I5BA 2AEQH 4JO3H 4YR6A 5CJXC 4ODXA 4JDTH 5EZOH 4NKMB 2XZCL 2YR3A 3FONA 4NC0B 5DJXA 1UXWA 4MNGB 1EFXD 3OJVC 4M48L 5T1MA 4PJCA 4OZGE 4YO0B 3DYMA 1FVCB 4NN5B 3MV9A 1KIUA 1QLRB 3MV7D 1U8OB 1OTSC 1XF3A 1KTRL 2GJZB 4GQPH 4KTEL 1E6JH 3U7WL 5DVLA 1G9MH 3EJZC 5GZND 3DWTA 4KV5E 5J3HC 4M7LL 1ZLUH 4F58H 1D6EB 1XF5A 4I0KA 3TT1H 1JI2A 5FYLL 1GGIL 2J8HA 2JLLA 3ARDD 3QWQB 4OI7A 1UB5A 4MA8H 1NCBH 4RBPK 1GGCH 5E00B 2I60H 3WMSA 3U4EA 1UZ8A 2ZCHL 4E41B 1OTSD 3Q1SL 4HKZA 3LN5A 4UIMB 1CVSC 4Y5XB 4R7DB 1FC1A 5CJ8A 4Z7NE 5J3HD 4OV6F 2BVUA 4TUJA 4DOHB 1K5NB 2DQGH 3DTXA 5EOQH 1JF1A 1ZLSH 4KRLB 2ZSVA 1CLCA 2B7DT 3R0MA 3DUHA 4G7VH 1TMCB 4NBZB 5IMLA 3BE1L 4PBWD 1KJMB 1YPZF 2A77H 2R15A 2QADB 3AREB 2JJWA 1N64L 1FYTE 3EAKA 1AO7D 3SJVD 1DLHA 1QO3B 3FZUC 2BSTA 3VFNA 1BQSA 2QQLL 5A16B 1XCTB 2HKHH 2JIXA 4H0HB 3MXWH 5T33H 4EXPX 3NCCB 1U92A 3UTQB 4NZUH 3FRUA 1MPAL 3SDAB 2JB5L 3GI8L 3H3BC 3VG0H 4OZHB 3RUGF 1RZGB 4F7TA 2CLVB 4N0UA 1CG9A 2AJVL 1HSBA 1BFVH 2CIIA 2DOCA 2W60B 3AXLA 1OP5H 4UUJA 4MD5A 1YEEL 3DRQA 5J6HA 1PKQE 2G60L 3FZUD 4LASH 5EORH 5C0GA 3MBXH 2V9RA 1MFCH 2DKMA 5DRZA 1A3LL 4NKDA 2YA1A 1RV6X 2ILLA 3DUSA 4CNIA 5I15H 3GSVA 5EZLA 4PGEA 3EOYG 4OGYH 4H5SA 4GOSA 4FZEH 4FQ2L 2YSSA 1AD9A 3QWRD 3GMRB 1S78C 3PWNB 3EYUH 2ZNXA 5DMGC 4EBQH 1PYWB 3BIAX 1PLGL 4HMCA 1OF2A 3KYMB 1MVUB 3IFNL 4PJIE 1XGQB 3L95A 2AK4D 4N5EC 1D9KA 3MNWB 2AI0L 4D0DB 1FC2D 3CXHJ 5F3HA 3HCVB 3CJJA 2HFGL 4Q9BA 3WDHA 1A21A 1Y6KR 4L8SC 1BQHG 1HH6B 3QB7C 1S78D 1MCRA 1JJUA 5EBLA 5DMGD 2O5YL 1LK3L 1S7UA 1NFIA 3NIDE 5F7HA 1F3DJ 4P48A 2Z31B 3MGOB 5CGTA 1PKOA 3PDDA 4EN3A 3FRPG 3VGAC 3BGAA 2HJFA 2H2PC 2FO4A 1A2YA 4GS7C 4TOYL 3MO1B 4N5ED 3WV0A 4MJIA 3WLBA 1GGTA 2DQDH 3A6CL 1C5CL 3WFHB 2GAZA 4HWZB 3GEWB 1A1OB 3RI5K 1WGOA 3QCVL 1ZLUK 3RAJL 5EBMB 3T4YB 3V6ZB 4CMHB 1KIQA 5IHBA 5IOPA 3F5WA 4K3DH 5IR1A 2MKLC 2VDML 3VD9A 1TTFA 1PVHA 1HKLL 4MNQD 3QUZC 1IEBA 1MLCA 2Q8BH 5DEFB 1J0IA 4OCWH 3VRJB 2XOTA 1IGIH 5F6IB 1NLDL 5IROA 4IRJA 5LQBL 5ICZB 4BSWA 3CFKB 3ZE0F 5JNYA 4M7KL 3UTSB 3T2NH 2X4QB 4OD2B 2VLJD 4LCWE 5D4QA 4QT5A 3MRHB 5ELIA 5JO5B 2CGRH 5J13B 3RIFF 5L6YL 3QUZD 35C8L 1RJYA 5GGSY 1VFBA 1ED3A 1ZTXL 2B4CH 2HJLB 1A0QL 3BFOA 5CKAA 1ORSA 3SGJA 4YGVB 2P7TB 1QVOA 1YNTA 3EDEA 5HJ3B 1U95B 4LQFH 1LGVA 4V1DA 3LV3A 2BJMH 1SEBA 3QO0A 3OXRB 4CJ0A 5CJBA 2JKXA 3RDTB 3L3GB 4LAQH 4WFFE 1NC2D 4JZNA 4ZUSA 1NCDH 4LPTA 1VKXA 4KI1A 4L9DA 2F8XC 1T1XB 2QSQA 4J3VA 4PBVC 1MAMH 3M45A 3PWLB 4NQXB 1BQLL 5D1XC 1MRDL 3IAQA 4YHPB 4P2QB 4F9LC 3IS0X 1I7UB 3IDYB 3R8QA 5AYQA 1KXVC 4GRWH 5CINH 5GRWA 4L4VE 1GGBL 1N4XL 1ZA6B 4ODVL 4PTTA 3I85A 1KCUH 2YUXA 5BXFB 3B9VA 4YDVB 3L7FB 3GSNB 5SX4H 1D6VL 5D6CB 3QEQA 1XEDA 3O3AA 1A6UH 1INEH 1U3YA 1E6OL 3I2CH 4KTDL 4UIKL 1M7DA 4MJ5A 4ZOEA 5J11B 2P5EA 1BPVA 2CDGA 1VADB 3KPMA 3RVUC 3UTOA 4YDJB 4WEBL 3UBXA 3AY4C 6CGTA 3PHOB 1K85A 4QHKI 4J3OC 4QTHB 5TE6L 2XTJC 3WFDL 3ZYZA 5F7KC 4L8BA 1NDMB 2L4OA 1MI5B 3QNZB 2E7BA 1QBLL 1YNKL 3C08L 4Y4FC 1X4ZA 3ME0A 4WFGE 1R0AH 4TTDD 4WFEE 1T0NB 2XWJA 3BN3B 3HNVL 1LEIA 5D7SL 4LEOA 2IANE 3RVUD 3WFCL 3TPUB 5KG9A 2BFVL 3GBML 4FQXC 1JBJA 4C56A 3OKOB 4X4ME 1W0VA 5DJ0A 3TCLA 2B1AL 1FAIH 4M3JA 4FP8H 2I27N 1VCAA 3ULUC 1YMME 3W39B 3HAEA 4ODBD 2D0FA 2Z8VC 4S1RH 3WD5H 3VFVB 3BESR 4M3KB 3BP4A 5I8CB 3QIBB 3WFEH 5GGSB 3WJLA 4Y16A 3G6DL 3MBEC 2UWEF 1JV5A 1P84K 1V5JA 5KOVC 4HJJH 4FQXD 2FLRT 2DS4A 3MJ9A 4PGZA 5EH1A 4OZGA 1A7NL 3VXTB 3ULUD 4I77H 3MCKB 4DZBA 5CUSL 1MCCA 4HMDA 3D0LB 2CKNA 2DQEL 2XPGB 4HCRL 5E2UL 1J8KA 2JJTC 4XP5H 1FNGA 1H9VA 1TZGH 3QEUB 4LLAA 4JFED 3RTQB 3MBED 1T7VA 3B5TA 3ULSA 3HE6C 2GTWA 4H1LG 5MEQA 4MQ7B 5E1AB 2Q8AH 1JYVA 1S5HB 3KGRA 4PRPB 1RK1A 4U3CA 2DWEA 3O81A 3NACH 3P9LA 1GAFH 4N1EA 4G6MH 5KTEL 4OUUB 3HZYA 5HGBA 2APTA 4CVWA 3JTSB 5I1AA 4ONGL 5IFAH 3OKMB 4C83A 2NXYD 4J2XA 4NCC1 1BZQK 2I07A 1P2CB 3HE6D 4YAQA 5ACZB 1JFQH 3VGGA 1IMHC 1JNLL 2VLLB 4WRLA 5DZNA 1KFAH 5BMFL 5KSAB 3F7YA 4OI9A 2WWKT 1FYTA 4NO3A 1WLHA 3G9VA 1T2XA 3GHBH 5E6IC 1QRNE 2OTWA 5GSRB 1IAOB 1I1FA 4AEHL 4QLRA 2CK2A 3HE7C 1T89A 2KL6A 2OQJA 1KGCD 3ZE0E 2E8ZA 1DBKH 5BJTA 4ODSH 5BO1H 2DQFA 1EAPB 3EFDL 2D7OA 3RL2A 1IAIL 3LN9A 2NMSA 3Q6GH 5L2KE 5MHSD 4CW1A 4ELMF 2I5YH 4FABH 1MJ8L 4LFHG 4OZ4A 1G6RA 5C0BE 2YD2A 3CK0H 3U1SL 2NY7L 4IMLA 4D8PB 3HE7D 4YDKL 2VDRL 1DZBA 1JPGB 2VDOH 3GKWH 2EKSA 3S34L 1NGQL 3UO1H 1JYWA 5HHMD 4HUUB 5LCVH 3BPOB 2J3SA 5DHXB 4PJAF 3ZO0A 2BVTA 5AUMA 3KXFB 3ARSA 3QHFL 4TSCL 3VMNA 5F88A 3NA4A 4JM4H 3S35X 1N3NB 5J7CC 2GT9B 3C8KB 3SY0A 4M7ZC 5C70A 5GS1B 4PJIA 1ZSDB 2CRYA 2ORBH 3NAAL 4KHXL 4PJBB 3FO9B 5D7LE 1A7QL 4XBPA 3L3HB 2X89A 3BGMA 1MF2L 3PABA 5D7KD 1I8KA 1DUYA 1HH9A 4P23C 3OJDB 2DM3A 4ZTOH 3W5NA 4ZFOB 4F2MB 2DICA 4XVJL 3N1GC 3L9RA 3O2VL 5FF6A 2WUBL 2CUHA 1KCLA 3HNSH 4DKFH 1U3HA 1ZT7A 3L3OB 1BP3B 1KNOB 3G6AA 5DURB 4KY1H 3TZVD 2Q76B 5IB2A 4XMKL 3SCMB 1OM3L 3BHBB 3O9WB 5F1OB 5FYLE 1QEWB 5IESH 3T65B 3W0WE 4EI5C 1YY8A 3V5HA 1P6AB 5DF0A 2VB5A 3QDJD 4QHNA 2OMNA 3HUJF 4WO4A 1A64A 1SMOA 4ETQB 4J6RL 1WCQA 4G3YL 4YDIH 4U2YA 4ZPVB 3SBWA 4M9PA 4QRRE 1NCWL 1FBIL 4JKPH 4N1CA 1JZ6A 4Q9RL 3DX8A 1WT5A 1F97A 5CEXA 2E6JA 4EI5D 2H2SC 4JM2C 1CFTB 5C9JB 2EZ0C 3G6JF 4ODXB 4DGYH 5EOTA 2BSRA 3CU1A 4HLZH 1B4JH 1FZOA 5C0AA 4KDWA 5DJXB 5FV1L 1UXWB 5FGBC 3OSKA 4JQIL 3S7GA 1HWGB 1I1AC 1KB5A 2C3XA 3MV9B 2ZJSH 3QUYD 4L5FH 1MAJA 1PEWA 4JGMA 1PSKH 3F7VA 3HG1D 4D9QE 2H2SD 4JM2D 4D2NA 1OGAD 4KXZH 1XF5B 1AFVH 5FYKD 1K9TA 4K7PX 5KZCD 1KEGH 4U1KA 3BKJH 4NDMA 4Z76A 2XN9E 2UZYB 3BKMH 5C86A 2P47B 1UB5B 1I1AD 3BEVA 4AJ0A 1RIVL 5J1SC 4NHCH 2Y23A 3U4EB 1UZ8B 1IM9B 5IQ7L 2JTDA 4HFUL 4HKZB 3LN5B 5MENE 5GPRA 4NFBA 4L4VA 1KBGL 3PHQA 3WEXA 2Y4SA 1PGRB 1CGUA 4RWHA 4TUJB 5C6WH 1CVRA 4U3HA 2MQ0A 1JF1B 3KPPA 2H8PA 1BJ1H 1C16B 5IMLB 1OPGH 4UDTA 5DJZA 3IVKA 2AP2A 3INUL 3OPZH 5DJDA 4MX7A 2ZUWA 2ZOLA 1FORH 5I71B 4LRIC 1VEMA 2X4PA 4GQ9H 1YPZA 1N26A 4KTYA 4R0LC 4Z7OE 3VXMB 1DLHB 1HK6A 1L9NA 2BSTB 3PL6C 5D5ME 4G8FA 4Y19E 2VYRE 5I30H 1NKOA 2ADIA 1WJ3A 5FYKU 3NZ8A 1U92B 3MOAL 4XI5C 3D85D 3IDGA 1XFPA 5FIEA 1IGMH 5D8JH 1BEYL 3MGTA 4JHWH 4F7TB 1QPXA 4N0UB 5I1EH 2YKLH 1CG9B 1Q9KA 2CIIB 4O5LL 4AG4H 3AXLB 1CQKA 4F8QA 4UUJB 3RUGA 4MD5B 1AKJA 3DRQB 3BSZL 3SE9L 5J6HB 4QYOA 5C0GB 4MXWH 4P2RD 4PY7A 5FUZH 4X4MA 1Q0YL 4XHQA 5DRZB 4N90E 4NKDB 1A4JA 4MZ2A 1DDHB 1YMMA 1ZV5A 2VWEE 4TSBH 3D39E 3QEHA 4XI5D 4CNIB 3GSVB 5EZLB 1IC7L 4PGEB 4YC2C 1CXLA 5I76A 1BD2D 2RQ8A 2R4SH 4P5TA 3RL1A 3QIUC 3BMVA 4LSVH 1X5YA 4NM8L 1AD9B 4UBDC 1KN4H 4M7JH 3T09A 2OLDA 4PJAE 3BDXA 2VAAB 1EJOL 1OF2B 2FRGP 2AJXH 4CJ1A 5DMKA 3L95B 1D9KB 5GS3A 1LP9F 4KHTH 3ULUL 3IT8D 5F7FA 5F3HB 2IPTL 2FX8H 3QIUD 3N85L 3GSWA 4UBDD 1JI1A 1BM3L 5EBLB 4Z8FH 1NFIB 4EN3B 2NX5E 1OLLA 2LTQC 1MREH 3IFLL 1A2YB 1RUML 3QFJE 2EIBA 3L5XL 1LE9A 3WLBB 2EICA 4GAFB 4MD0B 3C5ZA 3PWPB 1S9XA 1RUAL 3V6OC 4LPYA 3BDYH 2LFGA 3VGHA 1AGDA 3F5WB 5IOPB 1MH5A 4JFDE 4LPCA 1K6QL 5DRXA 5SWZE 1IEBB 2P5WD 4XP4L 3ZSSA 2XG5A 4IRJB 1UQSA 1GGYA 5E9DD 4PJHF 1QRNA 4QTIH 3HC3L 4BSWB 5D72L 3MSPA 1QFWI 4MLIA 1WWCA 1JWMA 1N7ML 4LF3B 2LV4A 3Q6FA 1MVFA 2GYSA 1INDH 2AJSH 4ELKA 4QT5B 4QNPF 4TULL 3WXVH 2AV7A 1RJYB 1ED3B 1AC6A 1P4BL 1ORSB 1A6AA 1QVOB 2R29H 1JTPA 4HWNA 1T5WA 4G8EA 5EO0A 1IKFH 3CVHA 1J1XL 4V1DB 5LGHH 3LV3B 2Q7YA 1SEBB 3QO0B 4LVOB 4W6WB 2EDHA 1BWWA 5GSVB 4PJ9B 4JZNB 1X4YA 2EC8A 3N1MC 3K2MC 2K3TA 4RAHA 5C3TA 4JJHA 5FA4A 2EO1A 3NMEA 4ETYA 1BZ9A 1NDGA 5DMYA 2W0LA 4GMSL 2R8SL 4IHOA 2MQ3A 2A1WL 2R2HA 2WBJA 3MLZL 3I6GA 1I3RB 2YK1L 3TO4D 1B0GA 3M17A 4LRNL 1IC1A 4PTTB 1EHNA 2BY3A 3BZFA 3ZT7A 2I26N 1U8LA 5D7LA 5E2JA 3O0RL 1KULA 5E1HB 3U0TB 2VQTA 3QEQB 3O3AB 2YRZA 3FFCE 3K81A 2KH2B 1M7DB 3O6LL 1DLFH 2P5EB 4H20H 3GJEA 4XNYL 3VA2C 1LWRA 4DN3H 4O58L 3KPMB 3MOBL 3MV7E 3UBXB 2IWGA 4HJGA 1TPXC 2HLFC 2NY4C 5DD6A 2YD1A 3H3PH 3BPNC 3P11L 1V7NH 3LQZA 3LN4A 1EBAA 1UWXH 2XRAL 5CWSA 3U4BL 3BPLC 2DF3A 4JQVA 4TSAH 3C8HA 5E2WH 5ENWA 1CDCA 1F8TH 2NR6C 2D03L 2WP3T 1CD0A 2VDPL 3PWJA 2XWJB 1CN4A 1YEIH 3MOQA 1LEIB 5ID0A 4LEOB 2YMXL 5CKGA 3STZA 3BQUC 2A6KB 5KG9B 1NANI 5IB5B 2Q3ZA 4C56B 1KF9B 1W0VB 5DJ0B 2HLFD 1FG2A 2NY4D 3TCLB 2BVEA 2I24N 2M2DA 3P0GB 4I18C 2AEQL 4QRRA 3HAEB 4F15B 3TWCL 3K8MA 3BP4B 3I6KA 5I8OL 1UB6A 5I74B 5A2IH 4K3JH 4BFBD 1FAKT 1UM6H 1GOGA 4AMKH 3QDHA 1CD1B 1JV5B 1E6JL 1H5BC 3BQUD 3T1WA 4BQ6A 5J6GA 4HQQL 1SYVA 1F58H 5JW4N 2UWEA 2FGZA 1NBYA 4OZGB 1NAML 3BT2L 1PZUB 1SJHB 2A9ML 4YNYA 3TT1L 1AO7E 3SJVE 4FFVC 4PRHD 4DZBB 4N8VA 4NOFA 4KMLB 3D1MC 1NCBL 4Z7VF 1LP9E 1FNGB 4OCRH 3LY6A 5JOFA 3NA9L 4QHLA 4UQ2A 4WCYH 4JAMB 2H26A 1EH9A 2NY6B 2ENYA 5FYKL 4JFFD 2XN9A 4A2MA 1I9RH 2GTWB 5MEQB 2YUZA 2VZTA 4FTVD 2YEZA 3CNKA 3SKNA 1VGEL 1KCVL 2K9UA 5JQ6L 4FFVD 1UENA 1CE6A 5MENA 5F1NA 3P9LB 1DQMH 4F80A 3HZYB 3QZWA 5FUCC 5HGBB 4NKIL 4LCYA 5I1AB 4KUCD 5F7EL 4C83B 2I07B 2AVGA 2XACC 4YAQB 4YE4L 4UNUA 5GS2H 3SE3C 3WIHA 2HKHL 1CK0H 3MLVL 3X14A 2HFEA 3F7YB 3KYKH 1ZVHA 4NZUL 1FYTB 4NO3B 4LP4A 4FXKA 2OTWB 2R0WH 2AK4E 1I1FB 3ABZA 4Y19A 4WJ5A 3LEVL 2OQJB 2J6EH 1A7PL 2PTTA 3MLYH 3V0WL 3S35L 4JCLA 5IJKA 4NCC2 3T0EC 5BJTB 3RWCA 4LASL 5KS9E 1EVUA 1ZMYA 2DQFB 3EYOA 3MBXL 4NP4L 1MFCL 2YPLB 5CJOH 4QNPE 1OSZA 3RL2B 1GRWA 5F9WB 1JMXA 4YFEA 3FCTA 5ITBL 1G6RB 4OKVA 3RY4A 4JY5L 4ELMA 4IMLB 1QNZH 4ZAKD 1P84J 3CSGA 4U1MA 1WICA 5I18H 3GK8L 2EKSB 3D39A 1X5LA 2QQNH 3SDCA 3T0ED 4OFIA 3I02A 4HS8H 2AAVA 1UWXK 5E99L 3U30C 4XBGA 3OB8A 2IPUK 3ISWA 3LZFH 1X5ZA 4ZODA 4MNQE 1LEGA 4PJAA 1EO8L 4O4YH 4Z95H 5D1ZC 4ZFGH 3SY0B 1KV3A 5C07B 1Z9OA 1GHFH 4PJIB 1ZGLM 3UYOD 2R56H 1IC5L 1Q72H 4JG0H 3BOVA 4UV7L 4XBPB 2IALA 1LEKA 2VLJE 3BGMB 3PABB 1I8KB 3OKYA 1HH9B 1DQLL 1BAFH 3LPGA 5ESQA 2EKJA 1CLZH 4U0RB 1EFQA 5FF6B 3RVWC 1U3HB 1ZT7B 2PXYA 1TZHA 4NZJA 3MRDA 5JDSA 3QFJA 3WIFA 3EZJB 3G6AB 1TJHH 1DJSA 3JWDC 4TNVF 5IB2B 4K3DL 1KCKA 1T03H 3OBAA 4IOFC 3C6LA 1C1EL 4YPGA 4M6NH 5JR1H 2APVA 1KC5L 3M1BA 1BLNB 1YY8B 4JFDA 3V5HB 2E5EA 1OAYH 1MIMH 5BZDA 5SWZA 3L3KA 1ROWA 4WO4B 3ZL4L 2B0SL 3VJ6A 3ILQC 1AGBA 2DLGA 4EQ2A 3HUJA 5T1DH 1KCSH 1KLGA 3JUZA 3QXUA 5L0QC 1SJXA 3MLXH 4E41D 4ODHH 2QADC 3AREC 5EA0H 5A2LH 1QA9A 2IGFH 2XWBA 4TNWK 3WJJA 3DX8B 4IOFD 3QXTA 4KU1A 2B4CL 1T2QH 4F7MA 5CEXB 2DJSA 4L8CA 2GY5A 1MCJA 1KYOJ 3BJLA 1EEZA 5C2UB 4NKQB 1EERB 1IAMA 5EOTB 2BSRB 4LQFL 4OIIH 4LHUA 4HUXA 1FZOB 3ARPA 5HY9A 5C0AB 2CDEA 3EW3B 3ZT6A 3BKCH 3G6JA 3R1GH 3D25A 3ILQD 1KB5B 4XRCA 1K4CA 1AD0A 4LSTL 2QADD 3ARED 2ADGB 3HPJA 1ZHBA 5IW6A 4HWEL 1MAML 5ICXA 3EJJX 4BZ1H 2Q6WB 4F9PC 5KOMC 4FFZH 1RMFL 4JPKH 1PX4A 1ACYH 5B22A 1AQKH 1CL7H 4NZRH 4U1KB 1TVBA 3SDAD 4NDMB 3H0TA 3IDMA 1H3WM 4PRAB 1KCUL 2DLHA 3BEVB 1FNHA 1ACZA 3O6FA 4RMQA 4ZTPH 3JV6B 4DGVL 3ARGA 3MACL 1UM5L 2FYYB 3PHQB 4NBYB 3B43A 1IJ9A 3VCLA 2XTJE 4EDWH 1IAKB 4LSRL 3SO3B 2XZQH 4UQ3B 3IU4H 3KPPB 2H8PB 1ITBB 3DX9A 5KVEH 2HFFA 1G1CA 5DJZB 2FECL 3NCFB 3IVKB 1YC8A 2HVKA 4PREA 4GRLC 4MX7B 2ZOLB 2X4PB 1YPZB 4ZFZA 2Z31C 2W9DH 5MP6H 3UDWA 3MV7A 4KDTC 4G8FB 1JVKA 3RVXC 3ULUE 5JHLH 4GG6F 3IJHA 2ADIB 5DD5H 1AH1A 4HBCL 1ZK9A 2BSSA 2VC2L 3NZ8B 2Y6SC 1CZ8H 3KR3L 5D2LF 1RZ7H 2R2CA 4F3FA 1YNLL 2Z93A 2A0LC 3VDAA 5CJXA 3MGTB 2B8OT 1FSKB 2NY2C 2JELH 4FP8L 1UCTA 1Q9KB 3RUGB 3NABL 2Z31D 1AKJB 4QYOB 4PY7B 4QRSA 1TTUA 3RVXD 1CIUA 5DRWA 2EDEA 5A2JH 2C3VA 1JPSH 2Y6SD 1YMMB 3U6RA 3QEHB 1PDKA 2A0LD 1DR9A 3DSFL 5C0NC 4OJFH 4WY7H 5I76B 4P5TB 3RL1B 4OBRA 2NY2D 1PFCA 4KKCC 2DQHL 3WUWA 3ZYOA 2APWA 2OXHA 5DZOA 4PY8I 2WIIA 1G9NH 5HSFA 4I77L 3MFFA 3ARQA 4AEEA 2NXZB 5CLWA 5FHBL 1NL0H 5DMKB 1AO7A 3HMXL 3SJVA 2P49B 3DX6A 1CFBA 2HVJA 5CD3A 4WI8A 1HHGA 1PEZA 1I75A 4RA0C 4ZNEE 3B9KC 5F1KC 1LP9A 1KGCE 3KPQA 4KKCD 3UTSD 3GSWB 5EUKA 3RDTC 1EGJL 1VERA 2VMFA 2DTSA 4G6ML 2A6IB 2HAZA 4LCUA 5CZKA 5MHSE 3X3FH 4N0CD 3NPSC 4OGZA 4WDIA 2YHGA 1LE9B 1U8HA 1JHLH 1KTDB 4Z7UF 5F9OH 3QXAB 2R1YA 2Y7QA 3IDYC 2X6MA 1YEDA 4NQEB 3C5ZB 1S9XB 2X4OA 5FB8A 5J1AA 2H3NB 3D9AL 4AY0A 3RDTD 2Y07H 5HHME 1UH2A 1MH5B 2PO6C 4MAYA 4U7KA 5DJYA 1OAKH 1F4HA 5DRXB 1U58A 2Z9TA 2MOVA 3QWRA 3SKOA 1RZJH 4OCSH 5L8LB 4LPVA 2V2WB 3RKPA 1FJ1A 1HINL 3MUJA 3T08A 4P2QD 1DBKL 5J11C 1QRNB 3AB0B 4H26A 4PJHA 5ICYA 4XPTL 3IXTA 2IPUG 3Q6FB 2PO6D 4KK8D 5HGGS 3U83A 2D0HA 1NCCL 3CK0L 5D7KE 3SGEI 2VZUA 2AV7B 1JWUA 4XBEL 2VE6A 5ESVA 3S88H 2AV1A 1A6AB 4RZCA 1IVLA 1IEHA 4QEGA 4RGOH 1N5AA 3QG7H 5DFWH 4FFWC 3VXQA 5IIEA 1T5WB 4G8EB 3QA3A 4LQ1A 2VDNL 3CVHB 3TBYA 2NY3C 5F96H 4FQQA 4WW1A 1F3JA 5AZ2H 1F6AA 3OGCA 2CRZA 4L8SA 4Z78A 4BZ2L 5C1MB 5F1IA 3F6IA 1I8LC 5FA4B 4L1DA 2FEDC 3QDJE 1MI5D 3VFUA 4RISL 1HZHH 4FQIL 4MNQA 1EUUA 4M6OL 4IHOB 3CLEH 3MRNA 2R2HB 3CSBA 2WBJB 4JQXC 5HHOB 2JK5A 2FL5B 5F3BA 1B0GB 5GGRA 1BBJA 3X11B 3WNPA 1L0YA 1U8LB 5D7LB 4CU6A 2JCCE 2VLJA 2VXQL 3RIAK 3UTZA 5L7XL 2AABH 2FEDD 2WINA 1KENH 3TA3C 3QIBD 5FYJD 3QUZA 3MQIA 4B0MM 4NGHH 1VEOA 1YJDC 3GJEB 3RTQC 3S3PA 3HAEH 5FO9B 4WV1A 4HJGB 4GW5B 3V5DA 5DD6B 1T83C 2R23B 4GG6E 1T7ZA 1UZ6F 2APFA 3JSSA 3LN4B 4WHYH 1OGAE 1NC2A 3TA3D 3O6KH 5FYKE 3QUML 3U7YH 3MJ9H 5ENWB 2VL5A 3PWJB 3RTQD 4X4XA 4JKPL 4LSSL 3V6BR 3OF6D 3STZB 4MQXC 2NZ9C 5C6TH 4HEME 1NMBH 2CQVA 3RJDA 1FG2B 1CLOH 3JWDL 3SOBH 4PRPD 1DQTA 4QRRB 2AXFA 1CXHA 4P0DA 1NCNA 2HKFL 2X44D 1MCIA 3I9GL 3FB6B 3I6KB 5FYJU 3Q5TA 4OGXH 3I3BA 4P9ML 3RBGA 5TE4L 2X4UA 5JUEL 4OGAC 2F53E 5D1XA 4MQXD 3WN5C 1TITA 2NZ9D 1SYVB 3HTLX 4F9LA 2Q87A 1KLUA 2Q86A 2UWEB 1NBYB 5KVGH 4MQTB 4YNYB 4DAGL 2J5LB 1KEGL 2CXGA 1KXTB 2FCBA 3AS1A 5IVOA 4OCLC 3V6FA 3RNQA 1ZLVH 5JOFB 4QHLB 4UQ2B 4XMLL 2H26B 3MJGX 4JGJA 4JE4B 2SEBA 1NGYA 3K74B 2XN9B 1LQSR 2EDTA 1Z2KA 2PW1A 1FL6A 2YEZB 4ORGA 3SKNB 5HXMA 4P2RE 3T0BA 1CE6B 5MENB 3RZCC 1JNNH 3AY4A 5KANG 1OPGL 2B2XH 1QFOA 3FN0H 4Z7UE 3QZWB 4R8WH 4YX2L 3ZTJH 3V7AG 3ZDZE 3IAGC 4OUOA 4UILL 1BD2E 3O3DA 4Y4FA 4YHOL 4ZPTB 1G6RH 1F4YL 5HVHB 4U05A 4WEUD 3X14B 3TV3H 43C9A 2HFEB 2UVEA 3KXFD 4FQJL 5FO7A 4FQXA 2XWTA 1NLBH 2GK0A 3VDBA 2FZ3A 4FXKB 4IRZH 5D8JL 2A9NL 4JHWL 4Y19B 4WJ5B 5I1EL 1XIWC 2OMBA 4AG4L 4IDLA 1MELA 2FWOA 2PTTB 2NYYC 4Q7DA 3ZE2E 5D1QC 4YK4C 3RWCB 1F11A 1GJIA 2GQHA 3DBXA 1OSZB 3S5LA 3MODH 3O9WC 5HHXL 3FCTB 5SX5H 3LD8B 4MCZA 2W9EL 1IGFL 1ZHLA 3LQAC 4OKVB 4ELMB 4OCXH 4RMWA 2R4SL 5DURD 1GYAA 2H6PA 4U1MB 1OTTC 2ED8A 5EC1B 4HS3B 1KN4L 2NYYD 1JL8A 2JJTA 3QCUH 5D1QD 3SDCB 4KROC 5I19H 3I02B 3NFNA 3TLRA 3BN9C 4XBGB 4MB4A 5JOPD 3O9WD 3EOAB 4NT6A 2OK0L 4X9BA 4ZDHB 3GSUA 3BD4A 5E03A 1XGRB 1LEGB 4PJAB 3TH3T 2F58L 3QSKB 4XXDA 1IRAY 4R90H 4JDZB 1OTTD 3LDBB 5E9DE 4HZAA 5GGQH 3V6OE 3F8UB 3FTGA 4KZDL 4ZNEA 1MREL 2IALB 3MRCA 1LEKB 3D87B 4J3XA 1XF2A 5EBGA 4HH8A 5DQ9A 5I1LA 3RA7H 4PGDA 3HI1A 4DN4H 1ZAGA 1TIUA 3L3JA 5ESQB 5F93C 2A6JA 2PXYB 1TZHB 1ADQA 3MRDB 3WIFB 5JDSB 3P77A 5E6IA 2CK0L 3TH4T 4JR9H 3MV9D 5HDOA 5GJTL 4LDOB 4BKLA 4YPGB 1ZLVK 3IKCA 4HX1A 5KSVB 1HSAA 4XPBH 3T2PA 5E95B 5MERA 3UYPA 4JDVA 5ECJE 4JFDB 5DGRA 4RX4A 5IWLC 1KB5H 4QTIL 5BZDB 5SWZB 2VITB 4OLUH 3L3KB 1MFEL 5E08H 3OR7A 1E27A 4ERSH 3HUJB 1JZ8A 1KLGB 4F33A 4NQSB 1IM9D 3C2AL 1QA9B 2XWBB 5C0IA 5IUSA 1CF8H 1JP5A 2YXMA 4F7MB 4M93B 4L8CB 2C5DC 2KPNA 3HFML 1EEZB 4UOW1 4Z7QF 5A2FA 3WHXA 1FVDB 4J3SA 2Z8SA 3GSNL 4XAWH 4LHUB 4HUXB 2CDEB 2ICWI 4ZD3L 4Y88A 3G6JB 3D25B 4MJ6A 2B1HL 4XRCB 1K4CB 1AD0B 2ZKHH 3LH2H 4DUXA 3OAZK 2E7HA 1ZHBB 1R3JB 3VXMD 2GSGA 5IW6B 1U8JA 5ICXB 2XTLA 4X5WA 4LVHB 2CR3A 1R6VA 4CN1A 4K3GA 5HPOA 4D9LH 5C9KA 4UOW0 5IGXH 4P23A 5DR5H 4ZYKA 3WXWL 4MJ4A 3S37X 1F00I 3H0TB 3IDMB 1GPOH 1NKRA 4PJ7F 4Q6IC 3QHZL 3W9EA 4S1QH 4AH2A 3GO1H 3TO2A 3QDJA 5SX5K 2KZWA 3TT3L 3QJHA 2V9QA 1FPTH 3O6FB 3WYRA 3KYAA 3S3SA 2KZ1B 1A7RH 3GBNH 4GAGL 4EUPG 1DLFL 1ORQA 3VFGH 4KDVA 3UROR 3MCLL 3TBVA 3S3JA 4M1CC 4G6JH 1A5FH 2CSPA 3QIWA 4OLEA 2XNAB 3DX9B 2XA3A 4EI5A 5EO9A 1U8IA 3NGBB 1ZHKA 1A1MA 4WTZG 1IZJA 1HQRA 4XVTL 4PREB 3BPCB 4CL7A 1DBMH 1RFDL 3H3PL 2Z4QA 4QHUA 5FYJL 1V7NL 1NAMA 4ZFZB 2R2BA 1MHPH 1A6WH 1GOHA 4EN3C 4ODWA 5GISL 1EMTH 5E2WL 3IJHB 4PRHE 1OAQL 2BSSB 4GG6A 3O8XC 1YEIL 4QRQA 4F3FB 1XCQA 2Z93B 4LU5H 4PV9A 2CO6B 1OGAA 2X10A 3H8NA 2HWZL 4LCIL 5DHVA 4OZHF 1I9EA 4HUWA 1E4WL 3AM8C 3L5WA 5FGBA 1IGTB 3JWOC 1YJDL 2CIKA 4RGMC 4EN3D 5AZEH 1NCUA 1O7VA 3JTTA 4C57C 3VXOA 5DRWB 3RBSA 2P1YA 2C3VB 2HFTA 1FNSH 4HGKC 4AMKL 1EO5A 4OLWH 4HIIA 3U6RB 5F7DA 4J1UA 1Z3GL 3SDYH 2AEPL 2BXYA 2F19L 3PWPD 5FAAA 4OCMC 3ULVC 1X7QA 5IF0A 2ENSA 2WIIB 3VGDA 3MFFB 1G0YR 3WSQH 2F53A 3F62A 1WEJH 3K4AA 4TUOB 1F6LL 1MCOH 4I3RL 3W2DL 4YHMH 1AO7B 4DQOH 1CFNA 4M1DL 5GGRY 3SGJC 4IRJD 4BK4A 3DX6B 5FUCE 5CD3B 1HHGB 1AIFA 1I9RL 4X9GA 4HUNB 1HDMA 1LP9B 5ERWA 3KPQB 4PRIA 3IXAA 3RGHA 4LVOC 3D85A 1MJJA 2Q3AA 3KPLA 4PJ9C 4AL8H 1DQML 1TXKA 1QP1A 1MCWM 4XX1E 2R0KL 4LRIA 4R0LA 4JZJB 2ITDB 4CVXA 5HYSB 5SX4I 1U8HB 1OB1A 3H9ZA 3PL6A 2R1YB 2Y7QB 3U7AA 3HZKB 4G43A 4J4PC 4K3EH 4Z7UA 1YEDB 3D48R 4RMSA 4YHYB 2X4OB 4V1DD 1CK0L 1V05A 5FB8B 5J1AB 3FKUS 3T0EE 3KYKL 5JHDD 1T7YA 4FFYH 4K8RH 4PJ9D 5ALBH 4MAYB 1JGVH 3A6OA 5ACMA 1UC6A 1EV2E 4I1NB 5DJYB 1QR1A 1U58B 1I7ZB 2R0WL 2O26U 2X9XA 3GMLA 3UJJH 3QG6B 4FXLA 3SKOB 1FLRL 1A6ZA 1YEHL 3VD7A 3CVHH 2J6EL 4ZUUA 1P4IH 3D0VB 3MLYL 1KELL 5CEYB 3SPVB 1TQCB 3FAWA 1H3VA 4OCNC 2ZUYA 3O41A 1GZPA 4WHYG 4PJHB 4OKDA 5ICYB 3HR6A 3CFDA 3IXTB 3WO4C 3DROA 3TYGH 3FJTA 3K0WA 4OB5H 4KKAD 3FO1A 3QIUA 1BOYA 4L29A 4Z7QE 1JWUB 1GGUA 4KRMB 2VE6B 1A7OL 5IP4A 4PB0L 3LRSA 3EGSB 4A6YB 5I18L 2AV1B 4IBLT 4HKXA 4RZCB 2QQNL 2P5ED 3VXQB 4MNGE 1V7ML 3QA3B 2GJ6A 3TBYB 4NQTA 4I0PA 4FQQB 4FMFA 2UZIL 4WW1B 4CAGA 1F3JB 1F6AB 2XZCH 4Z95L 3OGCB 4PS4L 3EYSL 4Z78B 5JW4R 3ESUF 1II4E 4ZFGL 3C87A 5F1IB 2HT4C 4F15C 4M48H 1GHFL 4PRBB 5IEKA 3VGAB 3VFUB 2IMMA 4PJ7E 5IHUL 4JG0L 3S6CA 3MRNB 1CYGA 4GS7B 4KTEH 3LQAL 3U7WH 5ESAA 3QDGE 2DIAA 5F3BB 5E2VL 2QKIA 4M7LH 1BBJB 1BAFL 1RHHA 4OLYL 4E41E 2BY0A 2R69L 3MA7A 5FYLH 1GGIH 3JV4A 1AI1L 1SM3H 3KPNA 3V6OA 1CLZL 2XQBH 4LMQE 4XP1L 3W9DB 4EVNA 2HT4D 2VLJB 3CMOL 3GBLA 4OAWA 3UTZB 1S3KH 2ZCHH 3KLSA 3Q1SH 3T4AA 1T03L 3L5HA 3Q0HA 5JR1L 3QDMD 4LEXL 4WV1B 3ZTJG 1CXIA 3PG2A 3V5DB 4MS8C 5DK0A 1MIML 5T5NG 1M4KA 4ZO8A 2QSCH 1WZLA 5B39A 2A6DA 1VFOA 2OCFD 3B8YA 2P8PA 4KKNA 1N64H 1RUQL 2OJZH 3MLXL 4ODHL 5DA4A 2VL5B 2NY6D 4X4XB 2IGFL 2QQLH 4OZHE 4B7LA 5FFLA 4L1HA 1EEUA 5CZXC 1NUFA 2VKXA 2VKWA 2Y36H 5LXGL 3P9MA 4NWUH 1MPAH 2X2YA 1MFDL 4OIIL 4EIZC 2AJVH 5BVJA 1JGUL 4WWKC 3MCG1 3RIFK 1M71B 1T89C 2ARJB 1YEEH 2BDNL 5I16A 5FDYA 2G60H 5D93C 4U6TA 5CJQH 5KN5A 1UWGL 2A83B 3ETBF 4GAYA 5D1XB 3MX0A 1G1YA 4Y4KC 3ZKMD 5A40E 3FB8A 5CZXD 3FQXA 1A3LH 2BVQA 3GJFK 4OZFG 1KLUB 2Q86B 5D7JC 2GCYA 1ACYL 2LE9A 5J0BA 4F7EA 3RWFA 1HYSC 4NZRL 2F74A 5DS8A 4UDUA 1CBVL 3NIFF 4JFHE 3V6FB 3RNQB 4FQ2H 1QUNA 2E7LC 1ONQA 1F90H 3WIHH 4GMTH 4Z7VB 3ZKNC 1OP3K 4ZTPL 1PLGH 2SEBB 1NGYB 1DQJA 1L6ZA 1IILE 2IEPA 4X9FA 4N9GA 2YPLD 1FL6B 4Q74A 2ZNWA 5D7JD 4EDWL 4ORGB 1HYSD 2E9BA 2XZQL 3OG4B 3DO7A 1QPPA 1D5XA 4NNPL 3EJYC 2XY1A 1CXFA 2XXCB 2XTJB 2O5YH 1LK3H 3BD3A 3CCHA 4OM0H 3ZKND 1LNUA 4R6UA 1RD6A 3LMJH 1IFHH 4N8PA 1HHHB 3O3DB 1U8MB 1Y6NR 1XZ0B 4Y4FB 4TOYH 4MMXC 5JPNA 5CLTA 4WU5A 4YUEH 3QHTC 3BH8A 3A6CH 43C9B 1SJVA 3BQUA 1C5CH 3O4LA 1CZ8L 4IJ3B 5FO7B 2XWTB 2GK0B 2FZ3B 2R2EA 1MFAL 4U0RC 3V95A 3QCVH 2BC4A 3RAJH 4I18A 1U3HC 3BJ91 5C07D 3B2VH 4PRHA 3SDDB 2VDMH 2FWOB 1HKLH 3DI3B 1F11B 4G42A 1FE8H 4W81A 2FEEL 2X89D 1T80A 5CHNB 3H7BA 5HHQA 3DBXB 4M8QB 5DFTA 3S5LB 5J1TC 3V79C 5LQBH 4G6AD 1PY9A 1R3LB 2EE2A 4MCZB 5F8QC 3DSNA 1DN2A 1ZHLB 4LSQL 1P6FA 1J12A 4JO4H 1U3HD 1Z0NA 4M7KH 4YXKL 4PG2C 5DO2C 4KPHL 1Q0XL 2BERA 4QXUL 2X05A 4KWUA 5L6YH 3CFEA 3T0DA 35C8H 1AXTH 1ZTXH 1A0QH 5L88H 3NFNB 1WT5C 3TCXA 3TNMA 4QKXB 5BZWA 3GSUB 1T0MA 3A0OA 4R7NA 5F7NC 3P40A 3DURA 3DO3A 4ORZC 4LBEB 3JWOL 5DO2D 4KI5F 4WO4D 4XXDB 2OL3B 4KXZI 4JY4A 4P2QE 1AR1D 4Z7WF 1J88A 3I3DA 2J12B 4DKAA 3FTGB 2PTUA 1AGFA 3MRCB 2OSLA 2ED9A 2X7LA 4JRYE 1XF2B 1BQLH 1FZMA 1MRDH 4MA7H 3WE6A 3ULVL 3B6SA 3MREA 3CC5A 1A8JH 5DQ9B 5F9OL 5I1LB 4PGDB 1M6OA 3HI1B 4HZLA 4NBXB 4DGIL 3P73A 5DMIL 3L3JB 1A6TA 1GGBH 1N4XH 5B3JF 4ODVH 5C0AD 3KS0J 4TVSa 3BP5A 3D69A 4BH7B 3P77B 4M6AA 5E6IB 3LCYA 5E4EC 3O11A 1N6VA 1E6OH 1ZA3A 4BKLB 3BH9B 4UIKH 4BSVA 2Q1EA 3LKOA 3IKCB 4HX1B 4NCDA 1HSAB 2YRPA 5MERB 2MJWA 3V7MA 4JDVB 4WFFD 2AJ3A 3SDXF 3ZKSD 5B4MC 1CLYL 3CDCA 1E27B 3QFDA 1OP9A 5TE6H 4FHBD 3RX5A 2IH1B 4F33B 3WFDH 3OXSA 3S37L 43CAA 1WC7B 1QBLH 3C08H 2W91A 1B90A 2XZAL 5E0QA 3HNVH 1VPOL 1NEZG 3GDBA 3P0YH 4RGOL 5DA0B 1VB9A 5HYEA 2VXUL 3IDNB 4MCYA 1LD9A 1R3KA 2EC9T 4N9OB 5DUPL 3MJ6A 2BFVH 3GBMH 3WFCH 3WHXB 4G9FA 5FYJE 4H25A 1A3QA 5ADPL 5D1ZA 4OZIF 4MJ6B 1T21A 1SQ2N 1AGCA 4NIKB 4NJ9H 5IFHL 4MNGA 3QWOA 5CP7A 4YO0A 1U8JB 2FH8A 1FVCA 4X5WB 2J1KA 5CILL 3G6DH 3NIFE 3FT4A 2GEEA 4P23B 3QUMA 4ZYKB 5FXCH 3W9EB 4AH2B 3TO2B 3QDJB 3ZDXF 4KC3B 4PJ7A 1X9QA 1S7VA 5CUSH 2C4XA 4JVWA 5JXEC 4DTGL 3QDGA 4P3CL 5TF1L 1SBSL 1WISA 2NXZC 4PRPE 3RI5F 2QEJA 2FHBA 1YMMD 1NMAL 2COQA 1EJ6A 4P4RB 3WNNA 3QIWB 3MRLA 1X5IA 4EI5B 4S2SA 5EO9B 1U8IB 1K5NA 1ZHKB 2X40A 2PETA 4P5TD 4PFEA 1HQRB 3CSYA 4PBXA 3FO2A 4N0FA 1T6WA 4X6CF 1I3UA 3FAXA 4I4WA 2Z4QB 4QHUB 5KTEH 2R39A 5MEPA 1BIHA 2NXZD 2PCPA 2ZG1A 4X7CC 4ODWB 3O6KL 1OAUL 1Z9LA 2BNQA 3AFLA 4GG6B 4QRQB 2AKRA 1G0DA 1JNLH 1XCQB 4K7FB 3DIFB 3OV6A 5HYIA 5BMFH 4KRPC 4LSUH 5D2LB 2VO5A 4K94H 5DHVB 3SOBL 1RI8A 4ZOCA 4PRDB 4HUWB 2QR0B 5D6DA 1FYHB 3L5WB 1Q9LA 2P44B 2L7JA 2CIKB 2YN3A 4OZHA 4AEHH 5EWIH 3JTTB 3ARWA 3LKSA 3VXOB 3QP3A 3RWIA 4QHKJ 4AT6A 3D3VB 1A1NA 3EOTL 1B0RA 4F9PA 4HIIB 5C0DA 3EFDH 4J1UB 1IAIH 2X9YA 4N1HB 4LKXA 4KRPD 4NQED 3C5ZD 2EYSA 3AB0C 2H32B 1P5UA 1X7QB 5KVGL 5IF0B 1YA5A 3LEYL 5JA9A 1ZOXA 3U1SH 2NY7H 1H3TA 2HA1A 2F53B 1UKSA 3PGFH 3HI5L 2C1OA 5DSCA 4CUCA 3B9AA 1CFNB 1PYWA 4TVPD 1QFPA 4YBQC 4XWGH 4PYHA 4Z7WE 1QRND 3W11C 5I1DA 1HDMB 3BEWA 5ERWB 5A3IC 1IAIM 4PRIB 4UT6L 3IXAB 2ATKB 3D85B 3KPSE 1EZVX 3PV7A 5EIQA 3KPLB 5F71A 3GSRA 4GRLA 3J7HA 1NC4D 5LVEA 1OL0A 1JF6A 2MPAL 5SWQA 4CVXB 5B3JE 3BZDA 1OB1B 3PGCB 1XR9B 4NYLB 3PL6B 4YBQD 5I1HL 4KDTA 1MF2H 3W11D 3MC0A 2WBJC 4TUKL 4Z7UB 5K59F 4X7DC 3TV3L 4XVJH 4OLXL 1U3JA 3O2VH 2WUBH 3UPRA 5HHVH 4HWZA 1NLBL 1A1OA 1QR1B 5JOPE 3SKMA 1X6LA 3T4YA 3GMLB 3MMEB 5IMOB 3SDXE 2VDLL 4XMKH 1A6ZB 4ZUUB 3FOLA 1OM3H 3GHEL 2EIEA 3V0AC 2WBJD 5DEFA 5HHOD 3O41B 1GZPB 1A47A 2VLKD 3ULVF 3VFTB 4PPTA 5CMAB 3DROB 4XHJC 5D7LD 4S0TD 3HZVA 3FO1B 3QIUB 1PAMA 4OCXL 4J6RH 3DHMA 1AE6L 2D9QB 4N8VG 4G3YH 3LRSB 3MRHA 2V5SA 3LKPA 1FBIH 3QCUL 4HKXB 4Q9RH 4U1GB 4PLKC 2GJ6B 2QHRH 1EX0A 2ZG3A 2LVEA 4I0PB 4LLVA 1IBGH 4XHJD 3B9KA 3ZHDA 2OZ4L 5JXAL 1U95A 3RDTA 4JQIH 1T3FA 2OX5A 4R90L 3MLTA 1ZT1A 5D9SA 5GGQL 5D2NC 1S9WA 1YEJH 2PUQT 3ZDXE 4PLKD 1MHHA 5AAWA 2X70A 5ESAB 5DC9B 4OFYD 2RBLA 2P8MA 4Q2ZA 2QKIB 3PWUA 1OCWL 1W72B 4YHPA 3FQUA 1I7UA 3RA7L 3JV4B 4DN4L 2O5ZH 3KPNB 2J5LC 3PF2A 1OQOA 3LRGA 3MJ7A 2DIJA 2EDXA 4JRYA 2PO6A 1HHJA 3R06A 4OAWB 4OF3A 1JPST 3GSNA 5IQ7H 4HFUH 4E0RA 5FA3A 4YBHA 3T4AB 3C5JA 1YEFH 1EHLL 5AWNL 1KBGH 3AS2A 1BMGA 4X6CE 4PV8A 4NC1C 1A9EA 5B3NA 4XPBL 3FRPA 3FB7A 5DD1L 3ZYJA 4PJDF 1Q8MA 4Z18A 1QD0A 1KB5L 2NW2A 1VADA 3VXME 5DK0B 4N0YH 1KN2L 3V5KA 2IBGA 4OLUL 5C0FA 3INUH 3PHOA 1Y18A 2A6DB 5B39B 4L8DB 2W0PA 4M03A 4ERSL 3WLWC 5AD0A 2P8PB 1E0OB 1DFBH 3DVNB 4QOKE 4ZXBC 5J8OA 2XN9D 4M1GH 2WAHA 4U0QB 5LAXA 3VI3F 2EDDA 5FDWA 5HVHC 1S7XA 3HB3D 2P43B 2QQQA 2J4WL 3P9MB 4P2OC 5MEND 4D94A 1G7HA 2X1OA 3P4OA 3WLWD 4O5LH 5BVJB 5FUOL 5K33A 4XZUA 1MHEA 4ZXBD 5I16B 3BSZH 4X5LA 3UTTA 4FZ8L 5KN5B 1Q0YH 4GAYB 3FB8B 5EOCJ 3FQXB 5GGUA 2BVQB 4JQXA 5GHWH 2H1PL 2GCYB 4P59H 4WI9A 4G5ZL 1TJGL 5IGXL 4F7EB 1IC7H 3KHOA 3RWFB 2F74B 3LD8C 5DS8B 5IBUG 5I1KL 4UDUB 5EO1A 5GRUH 1U36A 4OF0A 3GO1L 4BFGA 2VIRB 5HI3C 3G5XA 4Y19D 3CDGA 1ONQB 4N0RA 4NFDA 3WFZA 1FPTL 2JJSC 3RVVC 3D0LA 3WUZA 1EJOH 1D5ZB 3TA3A 1DQJB 4W4OC 3QEUA 5E2TL 3ZE1E 4N9GB 2WM0A 4YFLI 5LBSL 4HIEA 4WTWA 3BIKA 3RTQA 3WDIA 2FDBP 4LIQL 4UT7L 3OF6A 4BSJA 2NY0C 5C08E 4HV8B 3MRJA 4HXBL 4G6JL 5KANI 5DTFA 3DO7B 2IPTH 4X8XA 3N85H 1D5XB 8FABB 1T83A 1ZE3C 3CZJA 5HI3D 1PY4A 1BM3H 3WS6C 2D7PA 1DBML 5E8DL 3N9GL 5K59E 4UINH 3S4SG 4JEGB 3O6ML 3PWPE 1MHPL 1A6WL 3BPLB 2V17L 3JTSA 12E8L 3T3PF 5GZOC 3L5XH 1EMTL 5JPNB 4WU5B 4R97C 1DL7L 2E27L 3BH8B 3JV5A 1MFNA 2NY0D 4U1NA 1YC7A 3O4LB 3QXWA 4DVRH 1CXKA 3E0GA 1KTLB 1RUAH 2R2EB 4LU5L 3TBTA 2BC4B 4OLZH 4I18B 5CIPA 2N7BA 3DGGA 1K6QH 5KSBF 3Q5OA 4NZTH 1IAOA 3K8LA 4GG8A 3ULVE 1GC1C 4HF5L 2B5IC 3GI9L 5GZOD 4G42B 1N59A 4NUGL 3H7BB 3QUXB 5HHQB 2V5YA 4P49A 3T0VA 3WN5A 5BOPA 3HC3H 5D72H 5KJRH 5DK2A 2PXYD 1N7MH 1CR9L 1JPFB 4TULH 5DUML 3GKZA 2DQUL 4XPHL 3NFSL 4DZ8A 3CFEB 4PRNA 2WMPA 4POUB 1OAZL 2HT2C 3V8CA 5DJCA 6FABL 5E56A 1P4BH 4O51A 4NM4L 4BM7A 1DQQA 5JHDE 4JG1L 3TNMB 4M93C 1JRHI 4YHML 2PR4L 3DURB 4JFDD 2EXYC 1J1XH 5K9KA 1CFVL 1FFPA 4J8RA 3RZCA 4U6HA 4JY4B 4P5MB 3SGDH 3IDXL 4EOWH 1CL7I 2HT2D 4Z7WA 4TVPL 1KG0B 1AGFB 5D7IF 1B3JA 4K55A 2OSLB 2X7LB 4GMSH 1FZMB 2R8SH 1CD8A 3B6SB 3MREB 4LVHC 3IRPX 2A1WH 1DVFB 1U8KA 3IETA 2EXYD 3CC5B 3KPSA 3MLZH 4DUWA 1M6OB 4HZLB 1J0YA 4PGCA 2YK1H 4HSQA 3PDGA 1JHTA 4K3EL 4LRNH 1A6TB 2D0GA 3S96A 4LHUD 3ARZA 3BP5B 4B5EA 3D69B 3B9EA 2E9JA 2D7TL 1DP0A 2P5EE 4H1LA 4FFYL 3KJ6L 5ALBL 2V5TA 3O11B 3EYFA 3O6FC 1L4IA 4JPVL 1XIWA 5EU5A 1Z0MA 1RIUH 1ZA3B 2Q76A 4PJDE 2A2QT 3FN3A 3LKOB 4BSVB 1E28A 5D1QA 3CVHL 4QCIA 2D31A 3VDCA 1T1ZA 2AJ3B 3VXSA 3O9WA 1HILB 4O58H 5GGVH 3MOBH 1XF4A 3SDXA 1W2KT 3QFDB 4R2GB 5E70A 1ZHNA 3NGBC 2IAMC 3AROA 3TYGL 3VD3A 1KT2A 3O6FD 3WUWG 4Y89A 2Z35A 3OXSB 43CAB 2FGWH 3SO5A 2XRAH 3U4BH 4ETQA 2FJHA 2D03H 3KLHC 2VDPH 3VD5A 2KDGA 3U30B 3DXAE 4MCYB 1LD9B 1R3KB 5IVXF 3G04A 3EHBC 1HXYA 4G9FB 1CFTA 4ZO6A 2OTUA 4H25B 4HG4J 5D1ZB 4X98B 5EB9A 1T21B 2QHLA 1AGCB 2D7MA 3QDME 3TWCH 3E1F1 5IBTH 4PJGF 5J12C 3QWOB 5CP7B 3BRFA 1H8OA 5I8OH 4JLRA 5TH2B 3KLHD 1S5IL 3FT4B 3B5HA 4L4TE 4XNXL 3QUMB 1BF2A 3RX7A 3E8UL 4HQQH 1B2WL 1FLTX 2GW5A 4JKKA 2BX5A 1Z9MA 4NPYB 1NAMH 1T04B 3BT2H 5I73C 2A9MH 3VGFA 3F7PC 4PJ7B 5CAYB 1FL5A 1SM3L 1S7VB 2XQBL 2XKNB 2ZUTA 1T66C 3ARFC 3QDGB 2GTZB 3TYFB 4PJ8C 1KJVA 1S3KL 3NA9H 4K94C 1IM9A 2FR4A 2W07A 5FYKH 2IC2A 5IQ9A 1ZT4A 2GY7B 2C4FT 3C6SA 3H9HA 1UT9A 3MRLB 4PUBL 4TQEH 3EJZD 5GRJH 4S2SB 3ET9F 5IWLA 1VGEH 5KVFL 1KCVH 1N2RA 5JQ6H 3ZLQC 3CSYB 3TBWB 3FO2B 4N0FB 4HAFA 1C16A 3UPCA 4I4WB 4DFHA 1T66D 2QSCL 4X6CA 4PJ8D 4TNVK 5MEPB 2DLTA 2PCPB 4LLQA 4NKIH 2GK2A 4RCAA 3RGVB 5F7EH 5L0QB 2OJZL 2BNQB 3MNZA 5C3LD 4JZJC 3S98A 4XC3L 3VXMA 4YE4H 1JYNA 3DV4A 4ODTL 2RJMA 4NJAL 2AKRB 2ITCA 3MLVH 5KSBE 4K23L 4YHYC 1ETZA 3DRTA 4QGYA 2Y36L 2EDOA 4QOKA 4NWUL 2ZPKL 1DUZA 4LAJH 2DD8H 1Q9LB 2YPLE 4MAYC 3LEVH 1T22A 3LKSB 2LU4A 2WW8A 4U6XB 1A7PH 3RWIB 3V0WH 1QRKA 4XP9L 3S35H 2VQ1A 4AT6B 4JFXB 1A1NB 5CJQL 3MPCA 2WSKA 4NP4H 1B0RB 5JQHC 1IKNC 3QXVA 1RZIA 5C0DB 1MNUL 1TQCC 2UY7A 4LKXB 2EYSB 1YDPA 1DDHA 3LS5L 1MWAA 5ITBH 4BH8A 4JY5H 1QSEB 3M8OL 4Q6IA 4YEEA 4MAYD 2RFXA 4KFZC 3WS3A 4MAUL 3OWEA 1KPRA 3GK8H 1XT5A 1F90L 2C1OB 3WIHL 2E7MA 4GMTL 3DECA 1BGXL 5JIIA 5DSCB 2WP3O 2VAAA 4AENA 5E99H 5CZVL 5C07E 5I1DB 4MB3A 4GKSA 3BEWB 4DK6A 1EO8H 5KSUA 2KKQA 5TDPA 2HTLC 4Y2OA 3GSRB 4GRLB 1X5KA 5CSBA 3V2AR 1IC5H 5SWQB 4OM0L 4D3CL 2JJUA 5C08A 3LMJL 1CGTA 1IFHL 4UV7H 2DJ4A 2VUOA 4RRPA 2LQRA 1RUKL 1DQLH 2LAAA 2YD6A 4YUEL 3RY6C 3O8XA 1H8SA 3MV8A 5DQDL 3TM6A 4MD0A 3UPRB 3PWPA 3SKMB 2NY2B 2D4FA 1GZQA 1IT9H 1OAXL 1RJZA 3AM8A 4KJWC 1BVLB 3B2VL 4URTB 5HGHA 3FOLB 4LVNC 2H2PD 5IB4A 2ARWA 1C1EH 2IBZX 1FE8L 3VFWA 5EZIL 1KC5H 3HS0A 5DWUL 2LU3A 3IGAA 1NBVH 1VSCA 3QEGH 2ADFL 4WV1C 1ZEAL 4IMKC 1TJIL 3HZVB 4JO4L 3ZL4H 1FFRA 4R4FL 3GZKA 2B0SH 4LF3A 5F89A 3TH2T 3LKPB 1LDPL 1AXTL 5C0AE 5L88L 4KAQL 5DLML 5HTSA 4OIAA 5BV7B 4PJGE 2VSDA 4LLVB 5DYOB 1HOCA 3B9KB 2J8UF 3DUUB 1UH4A 4CN4A 4GW1A 1GC1L 5CBEA 1WBXA 1T3FB 5JHDA 3BZ4A 5GSVA 1B9ZA 3MLTB 4PJ9A 4LSTH 1MY7A 1ZT1B 5D9SB 3IRZA 3MRFA 3VH8G 1S9WB 5J06A 4HWEH 3NPSB 1OARL 1MHHB 3UTPD 2ZOKA 1OP5K 3MFGB 2X70B 3MZTA 3CUPA 4GSDH 2P8MB 4MA7L 1RMFH 4Q2ZB 3PWUB 4FXGA 3FQUB 4EDXB 3DPBA 1EBPA 4J4PA 5DK3A 2CLZA 1I3RA 1ODAA 1MOEA 3MJ7B 3PGDA 2XXMB 4JRYB 2PO6B 1HHJB 3R06B 3BISA 5CBAA 2EH7L 4L3CA 3U0TA 3DX7A 4E0RB 5FA3B 4DGVH 1ZANL 1ZVYA 3C5JB 1J1PL 3MACH 1BQHB 1UM5H 5DD3L 1K8IA 5D1XD 4PV8B 1DTUA 1A9EB 3FB7B 4LSRH 1YPZE 3S5LG 3ZMRA 1L9MA 2NW2B 5I1CL 4IOIA 4WI6A 2QSTA 3V5KB 4PJDA 3OJMB 5C0FB 1QFWH 1Y18B 3UAJC 1EHAA 1J0JA 2FX7L 1TETH 5AD0B 2QL1A 4HT1H 5JDJA 2KUTA 2E7CA 2VOTA 1MIEL 5FK9B 2R0LH 4LIQE 1AXSB 5JOEA 5HVGB 4L3EA 4X80L 1BIIA 5E5MA 5I8KL 4HBCH 5FDWB 2VC2H 5LAXB 3RUGE 3KR3H 1S7XB 4E9LA 3MRKA 3P0YL 1YNLH 2NY3B 2ZSWA 1NSNL 4IJ3C 2A6KA 2DMBA 1TVDA 5IB5A 1G7JB 1G7HB 3UAJD 5ID1A 3P4OB 3CX5K 3QAZB 2XTJD 1U91A 3NABH 4XZUB 1MHEB 1S8DA 4OTXL 4X6DF 4NJ9L 3D5OF 1DANT 3SDDC 3DXAA 5D70L 1ERNA 3UTTB 4U33A 4Y4FD 5IMMA 3MRPA 4X7EC 3HPLA 4S10A 3WFBL 5GGUB 3U82B 4A2LA 4G6FD 1CD1A 3QDMA 3DSFH 1JWSA 2BOCA 4G80A 5MI0B 3V8OA 5EO1B 1SJHA 2DQHH 3S36X 5C0JA 4HPYL 4X7FC 3NTCL 3G5XB 1DBJH 3CDGB 4QXWA 3O3BA 1Y0LA 3RU8H 3SDDD 4BUHA 4L4TA 5DVNA 4X83A 3TA3B 5FHBH 5EZJA 1XGUA 3K3QA 1G7MA 2AJZA 4JAMA 4O2FA 4O2EA 4HIEB 3HMXH 3BIKB 4S1SH 3MRJB 3E2HB 1Z6JT 5DTFB 3QUKA 2WBWB 2YUVA 1A3RL 1EGJH 3L5IA 2FX9H 2VAJA 4CVZA 4NQEE 1U6AL 5C0CD 4XGZA 3BUTA 2ERJB 2WQRA 1M7IA 1MCDA 4QRPD 3W82A 3GGWB 1PX3A 3IFOA 4U1NB 2J2ZA 3QR2A 1RU9L 3NVQA 3TBTB 4NFCA 4TNWF 1FGNH 3D9AH 4LSUL 1NANH 2AK1H 5CIPB 3DGGB 3FB5A 4K94L 5TPWL 4TVPE 4E5XA 3FHAA 4AIZA 4JVPA 5BS0A 5HHNA 1PG7X 2RCSL 4GG8B 4WWKA 1OWRM 5EWIL 5KSBA 4M7LT 4HC1A 1N59B 1CIDA 1V3JA 1HINH 2V2XA 2ZCLH 1E4XH 1KIRA 3CH1A 3WN5B 2N56A 4Y4KA 4AYFA 4H8WC 2YPLA 5DK2B 5D7JA 4MXQC 4XPTH 2H45A 1UM4L 5CD5C 5EG6C 5DVOA 2DLFL 1F3DH 5E6ID 1NCCH 1Z9SA 5B8CC 3QQ3A 1BQUA 5E6ZA 4DZ8B 3L1OL 4PRNB 3CLFL 5IVNA 1DEDA 2E7LA 4XBEH 5DJCB 3PGFL 2J8UE 3TJEL 4ZO7A 4O51B 1DQQB 3MXVL 4U6VL 8CGTA 2VR9A 4KMTH 4OV5A 2V6HA 1QFUL 2MCPL 4EIGB 3O2DA 4RX4D 3GSOA 4XWGL 2VDNH 4MXQD 2CXKA 1YMHA 4W4NA 5K9KB 2FHCA 1FFPB 3KDMA 4J8RB 5CD5D 2GIYA 5TJWK 2H9GA 3QDAA 3QULA 3RZCB 4U6HB 4KJYA 2UVFA 5DD0L 5M94B 2EE9A 5HHOE 4BZ2H 2EEAA 5C07A 4Z7WB 3CXDL 2VLKE 4RGNC 4OT1L 5IEHA 4RISH 4NWTH 4FQIH 3TIEB 4M6OH 4PY8J 4NQUA 3PDOA 2EDBA 1U8KB 3IETB 3KPSB 3CFBA 4PGCB 1UJTA 1S7QB 2BVPA 1JHTB 3S96B 5C7XL 4M43H 4C4KT 3MRIA 1CFSA 5GXBB 3CVIH 4H1LB 3OL2A 4K07A 5HHVL 4A6YL 1NEUA 3FN9A 3EYFB 2VXQH 1XIWB 4H88L 5L7XH 2OZ4A 5EU5B 3WIIL 3AS3A 1E28B 2NQCA 5D1QB 2CPCA 4YK4B 3JVGC 1L7IH 4QCIB 2YN5A 1N0XL 2D31B 3T77A 4PGBA 1T1ZB 4IIQC 1G7PB 4LARL 3VXSB 4P23D 4LCCC 3G08B 3QIWC 5F9AC 4RMVA 1XF4B 1BLNA 1Z5LA 4JVUA 3SDXB 1ZHNB 1UCBL 3OAUL 1UWEH 2FBJH 4PG2A 1KT2B 2Z35B 4B7IA 5J4MA 5IHLB 3QUMH 1X3DA 1XH3A 3DMMA 2FJHB 1CS6A 3KJ4C 4KROB 3N1FC 2FB4L