The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
223
|
structure length |
223
|
Chain Sequence |
QSLEESGGGPVKPGGTLTLTCKASGIDFSSFYYMCWVRQAPGKGLEWIACIVTDITGESYYATWAKGRFAISKTSSTTVTLQMTSLTAADTATYFCARGDTYGYGDTVYALNLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAPST
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural analysis of a novel rabbit monoclonal antibody R53 targeting an epitope in HIV-1 gp120 C4 region critical for receptor and co-receptor binding.
pubmed doi rcsb |
molecule tags |
Immune system
|
source organism |
Oryctolagus cuniculus
|
molecule keywords |
Light chain of Fab fragment of rabbit monoclonal antibody R5
|
total genus |
37
|
structure length |
223
|
sequence length |
223
|
ec nomenclature | |
pdb deposition date | 2015-05-14 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |