4ZTPH

Fab structure of rabbit monoclonal antibody r53 targeting an epitope in hiv-1 gp120 c4 region
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
223
Chain Sequence
QSLEESGGGPVKPGGTLTLTCKASGIDFSSFYYMCWVRQAPGKGLEWIACIVTDITGESYYATWAKGRFAISKTSSTTVTLQMTSLTAADTATYFCARGDTYGYGDTVYALNLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAPST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of Fab fragment of rabbit monoclonal antibody R5
publication title Structural analysis of a novel rabbit monoclonal antibody R53 targeting an epitope in HIV-1 gp120 C4 region critical for receptor and co-receptor binding.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 37
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ztpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ztpH01
4LASH 1R6VA 1KUMA 1NCAH 2EE3A 2UZIH 1FLRH 4KVNL 4GKOA 3MBED 5ETUA 4C4KT 2HFTA 4WTZG 3SEPA 2WMPA 4TUOA 1CDYA 2Y7QB 1N3NA 4TULL 5FO8B 3TZVC 1IGIL 5L7XL 1KJMA 4YDLC 3O4LD 4ZNEA 1OGAB 4NRYA 3C5JA 1C7SA 5HD8C 2DAVA 5GZOC 4EXPX 1NMBH 3S35H 1TJHH 4YE4H 2DN7A 1MLCB 1X44A 5TF1H 5JZ7D 5BS0B 1H3UA 3D39E 4KKBC 4PRPA 2P8MA 4WENB 2D3VA 3TBVB 3H3BC 3ZHKA 1GZPB 5DVLA 3EFDL 2BOCA 5KZCB 2P7TA 3QEQA 3GRWL 2XI9A 2EKJA 3V4VH 4QHUB 3VRLE 3MRCB 4LPUA 2VLKE 5ILTL 2P8PA 2Z8RA 3QG7L 4LEXH 4XC1L 1MCNA 2B1HH 3VXOA 4CU7A 3BHBA 1OAKH 1OTTC 2EIBA 4Z7QE 3D85A 3QFJA 4NNYA 1JGUH 4UB0L 4MLIA 5E4EC 4HAGA 3WNLA 4KVCL 2LFGA 2X2YA 3WS3A 4ZFFB 3VFOB 4DQOH 2BSTA 4M6MH 5BO1H 3ZE2F 3KPPA 2MCPH 1EXUB 1K4DB 1T04B 3GMMA 4D2NA 3HE7D 3W11D 3DI2B 3D0LA 1K8IA 1W0VB 1KELH 1MFAH 3QEHB 1Y18B 4F80A 3I50L 1HOCA 4GAFB 3FOLB 3VGEA 4KDWA 1HKLH 1HDMA 1NEZB 4HWZA 3TH3T 2OL3B 1AGCA 4IRJC 1A4KB 5MI0B 3RWJB 2FD6H 2PW2B 3ZDYE 5FB8A 4Y4FD 1BJ8A 3QXWA 4MNQA 1IBGL 2V7NA 3MC0A 3MGTA 2PETA 5A3ID 4V1DB 1DQLL 3EGSB 4TSCH 3QUKB 1EZVX 4MJ2A 3GK8L 4NSKA 4WWKA 4WJ5B 4HK3N 2YSSB 3W9DA 1TCRA 3KPSE 1NSNL 1IEAA 3ZSTA 3VXQA 1FE8H 3BP5A 2F53A 3P9WB 5IV2A 1JHLL 1CLOH 3MRFB 3CPLA 4OZHB 3SJVB 4WY7H 3PWUA 1OAXL 3Q6FA 5LAXA 4E42A 4QNPE 2CRYA 3CDCA 2V5MA 2ZUUA 1C16A 1KJ2A 1WBYB 4Y2DC 1QSEA 4ZFGH 2DDQL 3RWGA 1KTDA 4I0CC 4S0TD 2FJGA 3PXJA 5EA0H 1VEPA 3FJTA 1CICA 4JFDD 2EH7H 3PWPE 1NDGA 5DTFB 5JXAL 1O7VA 4TQEH 3HC3H 3UYRH 2EXWD 1HYSC 1EO7A 3EDDA 4EUPA 1W0YT 5ALCL 4OJFH 3H3KA 4AIXA 2K3TA 5F7YC 3A6BH 3MLTB 4YHLH 4NO3A 1RK0B 4ZO6A 1ZGLA 5D1QA 1OTUC 1ZHBB 1OD7A 4FQJL 4TTDC 1U8MB 4GXVL 4KMTH 1SYVA 2X9YA 1EMTH 3O8XB 1HHIA 4LRIC 3TYGH 3ZT6A 3BW9B 4JG0H 1RZGA 3C5SB 5I19L 1IM9B 1UM6L 4M7ZC 4Y5YA 3TBYA 4BUGA 3R1GH 4IM8A 3E8UL 3TO4A 2R0KH 4GLRI 4XVJL 2G60H 2PO6A 1NGWA 1Q9OB 3GJFH 5INCB 3ZL4L 4O58H 3PHOA 3VG9C 3GSQB 1CGWA 4GKZB 1CGYA 3IJHA 1AXSB 3VGGA 3U4AA 2EDKA 4S1QH 5JQ6H 3VU2A 1N2RA 1NGPL 5ABDE 4WTXA 3ZDZE 1U58A 1TZGH 1VACB 3DUSA 5GS2H 1I3GL 3P4OB 4D0BA 4OLZH 2WIIA 4KK6C 4ONGH 3MV9B 1I9IH 4EQ2A 1T4KA 1OAQL 4KDVA 2HTLC 1UWXK 5E08H 1JP5A 4GW1B 5EIVA 5E2UL 3CUPA 3ARWA 1TETL 4PJBF 1TVHA 3QJHB 3TN0D 4JDVB 2MOVA 3MV7B 3BPLC 1L6XA 2YXFA 4K3DH 1CLYH 4ZG1A 1FFNB 3VXTB 4LGRB 3EOTH 1A7PL 2BRRL 2HLFD 4Y16B 3VXPA 5E99H 2LU7A 4RCAA 3SE8L 4ODUA 3TVMA 4YWGH 4UZGA 1JRHI 4G6JH 5T5NG 3ULVL 2L7UA 2RCSL 4JFFA 1WUNT 5E24E 3VXUE 3QUYD 3F7VB 3CSGA 1LE5B 4HWUA 4N8CH 3SGEH 3M07A 2GJZB 3OJVC 4UAOB 3VXSD 3KPOB 5EN2B 4RFNB 2FECL 2FYYA 1RU9L 5BVJB 4RGOH 5LQBL 2VR9A 4XWGL 2LTQC 1KIQB 3SKJH 4HS8H 3H42L 2GK2A 1HI6A 4APQC 3KYKL 4YDVB 2F5AL 1KCKA 1S78D 4FQQA 4O2FA 3I02B 3X11A 2DLFH 1ADQH 5JDSA 4U6VH 3WNOA 5J3HD 5J1AA 4YNYA 3G6DL 2GJJA 5E95B 1YNTA 3RHWF 2QV2A 2QQLH 5HHOD 3KPMA 5LXGL 4MYWB 2PXYA 5EBMA 5KANG 4OTXL 5J56B 5T3XE 3OAYK 3TJHD 1L7TH 1IGFH 3LS4H 4PYHA 3ZYIA 4D3CL 2BY3A 1M05A 4HLZH 4NUJA 4Q9CA 3VXRB 4PYGA 2WANA 3BIKB 1IGCL 3ME0A 3INUH 1JV5B 1Y6NR 2A77L 2D0FA 3O45A 1PKQE 5CJXA 1S3KL 1INQB 2BVQA 5CINH 1T0PB 4OZFH 4JREC 4N1CA 4G9DB 2CIIB 3O6KL 1AR1C 5I1CH 3MRLA 5DJ2B 3E6FA 1G0YR 1KB5H 4BSVB 5DMYA 3C87A 3EDJA 3DTXB 4FZEH 4WTZA 4IRSB 4NZRL 4ODWA 1OTSD 1F4XL 3G5ZA 5EU6A 3BT2H 3V7AG 2VTFA 3HS0A 3CVHB 4HWBL 1M7XA 1P1ZB 3I6GA 3WJLA 1AGFB 1NLBH 4WUKL 5GRJL 1AO7A 1LWRA 3T3PE 5H94B 5D1XD 1J8HA 4UILH 5F6IB 2ARJB 1NGXA 2PYFB 5J8OA 2XY2A 3NABH 4I0KA 3VRJA 1U3JA 1CDCA 3FB8A 2XWBA 2HWZL 5E8OA 2F19L 4NM8H 2Q6WB 3UPRA 2J6EL 4IRZL 3FO9B 4CW1B 1KBGH 1JGEA 5C0CB 2OR7A 1YEFL 1AHWA 3QUZA 4JHAL 3WKMH 2ICES 2NY6C 5FGSA 4A6YH 4RMSA 4H25A 4TNVK 4TN9A 3HTLX 5HXMA 3B4NA 1GGIL 4P99A 5EDXA 1AIFB 4S2SB 3RQ3A 4LQFH 4AK1A 2J8UB 1G9NC 1MJ7H 5HJ3A 3BQUD 5DYOA 4JG1L 1UM4H 1FPTL 3ZTJH 5KVFH 1H8OA 4QXGH 3SDCD 1RZJH 3G6JB 4R7NA 3KPRD 4OCNC 4X9HA 2R4SH 4OM0H 2P47B 4FQ1L 3Q2CA 4NNPH 5LCVL 1BJMA 3HR5A 2XRAH 1MCOH 5EOQL 3BPCA 4GMSL 2O5YH 2W65B 2V5RA 3D3VB 1NAML 1XH3B 3MNZB 1XGUB 2F74A 3LRGA 1XIWC 3LB6D 4NRZB 5ELIA 5CBAB 4OLUL 4LSVH 2EE2A 3QI9C 4M02A 5SV4A 4JFZH 4QO1A 4G8GB 2D7MA 2NCMA 4K94H 4Y19D 4RISH 1ZLWH 5IWLC 1INDH 4HUWA 2WZPD 2HTKC 2UZXB 1JGVH 4CVZB 5DD1L 3QIBB 5E6YA 1CFQB 5D96C 4PGZA 5J11C 4OLYL 1FBIL 4YHKL 1R0AL 4NQUA 1YJDH 2BVEA 4ZS6C 1E6OH 2YBRA 1T20A 5D2LF 2CUHA 3DGGB 1WZKA 43C9A 3QT2A 3D69B 2C9AA 3RX8A 1E4XH 4L8DB 4DOHE 2ZP0T 4JFYB 3U4BL 4QCIB 4PRIB 5GS1C 3DVGA 5EORL 4BH8B 1MI5B 4QYOB 4KK8C 1A8JH 1MOEA 1NBVL 1UVQB 4AL8L 5ICYB 1CD1A 6CGTA 3K8LA 1CE1H 3QZWB 3SGJC 5C0AD 1NMCC 5TDNB 5MHSD 5D93B 5IB3B 5C1MB 4OLXH 4KV5F 3O6MH 3RL2A 2QQNL 3MXVL 1F45A 3T0EC 5C07B 5D7JC 4NFDA 1AP2A 1NUDA 1RULL 1PSKL 3P0YH 5EBGA 1VGKA 3OXRB 3B2VL 1G7HA 4I3SL 1NCDL 3CXHK 3DRQA 3QUXD 5F97E 4XWOD 3ULVD 4Z78A 1X5AA 3MRMB 2JLLA 2R1XB 4XPBL 4EOWL 1F58H 1U3HB 4L9LB 4ZXBB 1XGPB 1ORSB 5D6CB 4GSDL 5BV7B 3GSOB 5IKCA 4GRMA 3WUZA 1FGNH 4YPGB 1IAKA 2AP2A 4HGWB 1MFEL 1J18A 1S7VA 4XRCB 5A2LH 5IESH 1F02I 4PJEA 3BRDA 1FG9C 1NCCH 5I1IL 2PKDA 1NL0H 5C0DA 3AU1B 1TJIL 4MDJB 1ZA6A 4X5LA 1H5BA 3L9RA 1D9KA 5F8RC 3RUGA 1P6FA 5TE6L 5FYKL 1JJUA 2EKSB 2R2BB 3OMZA 3PL6A 1NDMA 2HJLA 1DSFL 4GKSA 5E8NA 1AQKH 5C08E 2FBJH 4FRWA 4UTBL 4DFIA 3P4NA 4PJDA 4LARH 3EYQC 2V7HB 4L3CB 4F33B 5C0IA 3KJ6L 4ODTH 1QFHA 3OX8B 3S3JA 1JIBA 5AYUH 4OF7A 1JYWA 4P9HC 3ARSA 5HHVH 3EKCA 3EJZD 3QWRD 2MCG1 2R2EA 4MQ7B 1UACH 2RIKA 5E6IB 3SKOB 1NMAH 4MA3B 4GRWE 4KMLB 1DFBH 5ISZE 1ND0B 1OL0A 2VSDA 4PREB 5I6XB 4WW2A 4G8EA 2GFBB 2WSKA 1JGLL 5TE7L 3GI9L 3C2AH 1WWCA 1T0MB 1S9XA 5EO1A 4O9HL 4Y4KD 1WT5C 3I75B 3UTPD 5IT2L 1FYTA 4GW5B 1I7RA 3HZKA 1FC2D 4QHNA 2C1OA 4X6EB 5E2VH 3TNMA 3BZEB 4ODSH 2DJUA 4JN1L 4C4KO 3RL1B 4F7CA 2DQDL 4P4KD 4OCMC 2VUOA 2FDBP 1RSFA 4EI5D 4QHKI 2IH1A 2DJ4A 4KKLD 2NZIA 5D1ZB 5HGHB 1MH5A 3CLFH 1HIML 5B38B 3NFNA 3LCYA 3GNML 4XI5D 3GSWA 1NC2B 1A5FH 4HUVA 4NO0B 3D48R 4ZAKA 4O00A 1VDGA 4ALAL 4E41E 3VGDA 2B2XH 3S37H 3V5HA 2IAMC 2R0WL 3VFSA 1QLEL 4WRLA 3WIFB 3WLWC 3ALWA 3AFLA 1T1XA 4GKNA 5GGTH 2QADD 3HRPA 4L5FH 1MAJA 3W0WB 5CGMA 1ZWIB 1I4FA 43CAA 3OKNA 3JV6A 5EU4A 3V0VA 2YKLL 1VFOA 4F7PB 5FYJU 1YEIL 5EZJB 1G0XA 3C60A 1S5IH 1ITBB 4G9FA 4LHUD 1MELA 1MAKA 3L95A 3V8OA 4HBCH 3CFEA 2V9QA 1IAMA 4JFQA 3HNSL 5ICZA 1OSPL 4R8WH 4LLAA 2YPLD 5HDQH 5CD5D 5I15H 1YECH 3OR7A 4P5TD 1KEML 3R8BB 1FZJA 5JR1H 3CCHB 1MHHA 1P7KA 1RZKC 3K7UA 2W0FA 2V9TA 4F58L 4YFEA 5E9DD 3SKNA 5F3BA 4JZOA 3DO7B 1X7QA 1MIMH 1T21B 2XZCH 5SX4I 3X14B 4YH6A 1GOHA 1QEWB 3PABB 3LKQB 1T7XA 1KN2L 1J86A 3F6LA 1U91B 2NW2A 5H37H 5A16B 2C3WA 4M62H 3SQBA 3H3PL 1WWAX 1JK8A 2E9JA 4ZFZA 1CR9H 3UJTL 3SDXB 4S1SL 3MACH 4LLDB 1QP1A 1UQSB 3AM8A 4LEOB 2I26N 2C4FT 5CMAA 3NIDF 1NANI 3OGCB 4IIQB 2GI7A 5F9JB 4PJCF 4X7SH 3IF1B 4Y7MA 5C09E 4LMQI 5MERB 2P8LA 3MJGX 4DN3H 5T1LA 3KPSA 3T8XB 3T0BA 3GSNA 4OLVH 2X4TB 1E28B 2Y4SA 3B83A 1JPFB 1GIGL 1H3GA 2NYYD 1IC1A 3F58L 4XBGB 4HUKB 1K6QL 4PP1D 1KLGB 2EIDA 3KYNA 2AXGA 3O9WC 1A3LL 2Z4QB 3HRZA 4IEFB 3JWDC 1LO4L 4KKAC 3SO3B 1BFVH 3OHXB 2DKMA 3HC4L 1DBMH 3SDYL 1KIUA 5J89A 1A21A 4MAUH 3T0XA 1RY7B 4G8IB 5TGBA 4XNYH 3BP4B 5I1GH 5DFVC 4PRPD 5EZOH 1CDUA 2R69H 1I7ZA 2OSLB 1YYMH 5T1KA 2RB8A 5EO0A 1QD0A 3C08H 3PWPA 3QEQD 2ZCHH 4MNHB 2FL5A 3AXLA 2QKIA 4G6AD 4MB4A 5EOCL 1DE4B 1J9CT 4DEPC 3ETBF 4GG8B 1U8QA 1U95A 2OXHA 3DPBA 5E8DL 3D85D 1EO5A 3HMWL 3QFJD 4U49A 1BGXL 3BO8A 4Z7NE 1T04A 5TF0A 1AGDB 4H5SB 3PQYE 1AXTL 2R1YA 5HGAA 1GC1L 3I9GL 5FYKD 3U30C 1I7TA 4AMKL 2XWJA 1A6UH 5EPMA 1YEJH 3LKRA 4R3SB 4FXKA 3BH8A 3E2HC 4XAWL 1N6QH 3PGFH 2C5DC 2W60A 2DQUL 3GMQA 2CRIA 4G43B 5LKNA 4KJPD 2X1QA 4CMMB 1BHGA 4P4RB 1UA6H 2DJSA 2AJZB 5FHAL 3VFGL 3CFDA 5I9QB 5I1AB 4X9BA 5SX5H 2B0SH 3OKEA 1CIUA 2AK4B 1IQWH 4J1UA 4RDQF 4POZC 4V1DA 3EGSA 3QUKA 4Z7UE 1Q1JL 2UY6A 1CLCA 2YSSA 4P46A 1PYWB 3PP3H 5I30H 4HX1B 5FCSH 3IDIB 5JIPA 5GRXG 4DKFH 4QRPE 4MNQD 2I5YL 4CMHB 1VEMA 1YY8B 1SYSB 5IF0A 3QCVH 3CLEL 4KUZH 3SQOL 1BLNA 1MY5A 1DLHA 2YD2A 4KVNH 4WWKD 3IDNB 3LDBB 2COQA 1MQKH 2KBGA 4LCCC 2VDPH 5I1KL 2WBKA 3ARFD 4TULH 5L2KE 4BYHA 3EYVA 1IGIH 1P4LA 1NCTA 5K59F 2F53D 4GG6F 1TZIA 4J3WA 1Z9OA 2Q7YB 1TVDA 1IAIM 5BRZB 3QXAA 3FB6A 1H3VA 4XHJC 1HILB 4NZTL 2AEPH 4HXAL 1ONQA 4R96A 1YC8A 2HT3C 3VXUA 4LP5A 1QSED 4ISVB 3U48A 4AG4L 4RMQA 4HH9A 2W1NA 1CICD 1FNSL 4Y1AB 4PY8I 4NC1E 5ILTH 4YEEA 3VA6A 1I7UA 3QG7H 5DJDA 1VFAA 2GQHA 4LMQE 3ARDA 4WFFE 1A1MA 5LWYH 5EULV 4IJ3C 4UB0H 1RUAL 1SJVA 3LKNB 2IF7A 4M00A 3T4YA 1W72B 5D1QD 3GO1H 4X4ME 2JIXB 3WKNA 2UWEE 1KF9B 1ZHNB 3QIWA 4YJZL 4EDXB 2J88H 4OQ1A 3TO4D 1G7MB 2AW2A 2PO6D 3I50H 1G9ML 2ADGA 2L0DA 1WSST 4UT7L 4X8XA 4B53A 3VWKC 5C0BE 3DIFA 3KR3L 4Q9QL 4NQXB 4NQDE 3MOQA 5ESQB 2A6JB 4LLMA 1KN4H 1P69B 3ILPB 5IMMB 4N5ED 3IDGB 2N1KA 1Z2KA 1X5KA 5GRVL 5FFLA 3HCVA 1IBGH 4ELKB 1WBZB 1PDKA 4RWYL 1FNLA 1DQLH 3MUZ1 3P9MB 1HZHL 1PZ5A 3U9UB 3GK8H 2NTSP 3VD4A 5CJBA 3DHJA 4FP8L 5T5FH 4GBXB 2PF6A 4XCNA 3LKPA 1FC1A 4YAQB 3ES6A 4NPYB 4YBLB 15C8L 1LQSR 1JGDB 2YPKB 4JM2D 5F7LB 3BVNB 8FABA 4G7YL 3CVIH 1WAAF 4JHWH 1OAXH 3FFCB 2H32B 4IOIB 2FJHB 3IXTA 4I9WD 2DQJL 3TVMD 4DN4H 5KVGH 1ZLUH 4PD4K 1XR8A 4R7DA 1AI1H 1MWAB 4TSBL 2A9ML 4JFFD 3RPIA 2BNQE 4HKJB 4ZNCD 1X5ZA 3T0AA 3LAFA 3P77A 3LH2L 4K7PL 1XCTB 4JGUA 1OWWA 3N9GL 4JPIA 1KIPB 3RVXD 4U1SB 3BJ91 1E4KA 3QDMB 3EOAB 4YGVA 3T2PA 5K9KB 3T77A 4Y5VB 5IIEB 3WIHH 2NY5L 3K3QA 3MTRA 3NH7H 4OGAD 2V2XB 1KACB 3U46B 3O3DB 2AJYH 3SGEI 4OCXH 3NMEA 3A6OA 4FQJH 4FZ8H 3QR2A 4GXVH 1ETZB 2I24N 2PXYD 4AYFA 3QWQB 5JNYA 5EC1A 5FUZH 1MVFA 3I3BA 4JE4B 3C5ZB 3E6HB 4Q97A 4XVJH 5CCKH 1N5YH 4NQCA 3ZL4H 3KGRA 1VHPA 1PGRB 2FX7L 4K8RC 2YD1A 3D39B 2VISA 1WVZA 5D6DC 4POUB 1UYWL 1XF1A 5C7XL 2XPGA 2WBJB 2DM4A 3Q5YA 4LKCB 1SJXA 1XF4A 2XA3A 1CU4L 2VLKB 3DURA 4PG2C 5EO9B 3V5DB 1M4KA 2LQRA 1YN7B 4RSVA 5GGVL 1VFMA 5D9SA 1OAQH 5EU6D 1A6VH 1OLZA 1OVZA 3SKMB 1QVOA 5E2UH 3C6LC 4Z6AT 3MRPB 4RFEA 3HZVA 3MGOB 1MAMH 2ICCA 3GIZH 3H9YA 4ZUVB 3HG1B 5JW3H 1J8HD 3MUGA 2Z92A 1FFQA 1E4WH 2IALB 5KSUB 1HHJA 1I1YA 3OJDA 4P23B 1JWMA 4K3JH 5JLZA 4XP4L 2P5WA 3U7YH 1A47A 5KS9A 1S9VA 5FO9B 3QUZD 4HHAB 5SWZD 4QRTB 2P46B 4XPFL 1YNKH 1T66D 1UZ8B 2WWMC 3CFCL 4ELMB 1T6WA 5T33L 5JHDE 4MQTB 4FQ2L 4D8PB 3H42H 2IPKB 3EJYC 4MQXC 4M7JH 1GVIA 5I1EL 2APXA 4I0PC 3VFUB 2HH0L 1S7XB 5HPMB 2G5BA 1AQDB 4OQTH 2GTZB 1CVRA 2D7TH 1KNOB 2K7QA 3UJIL 5MEOA 3PP4L 3G6DH 1FGVL 4FFYL 4X4YB 1WIOA 4OGYL 2YRPA 4JFHE 1IRAY 2W65A 3HKFA 3EHBC 5KSBE 4LAJH 4OTXH 1CLZL 1OP5H 3DYPA 3MRGB 5BXFA 3VFNB 4NRXA 2VLJD 5HVGB 5AYQA 2CO6B 5EOCJ 1DUYA 2A77H 1WICA 2Z31A 1FNGB 2EDEA 3FONB 1AD9A 1IAII 5C08A 1F11B 4Z0XA 1I1FA 3OGOE 1B9ZA 3O6KH 4ETYA 2J8OA 4FTVE 3WXWH 3CZFA 5DD5H 3KLAB 2Y6SD 1VSCA 3FO0L 1MRCH 3TT1H 2RHEA 3P2TA 3KS0J 5D5MF 1DEEB 2PTTB 4DFHA 1NBQA 4G6KL 3TZVB 3FQRB 4AM0B 3QHFH 5IMOB 1T03L 5I1HH 1FP5A 1JUFA 3FZUD 5E8EA 3HNVL 2YC1B 4Z5RB 3CSBA 4PJ8A 1Q72H 3VWJC 4FQXB 2I9LB 3O4OC 3GMOB 2E5EA 2XWTA 4L29A 5ISZA 1CI5A 2CQVA 4K23H 2A74A 4PJGF 1G7JB 5EB9A 1VGEL 4HUMB 5DVNA 3GSNL 1J5OH 3L5XH 1N64L 2VZVA 3ROLA 1OHQA 3H0TA 1FVDB 1I1AC 4PS4H 4IRZH 4PJBE 1J0ZA 1UM5L 3BIAX 5BZWA 1QKZL 2SEBB 3RRQA 3CAFA 4MJ5B 1J0HA 3KYAA 1YJDC 1E4XI 4YC2B 2WNGA 3TBWA 5K9OB 3LEVL 4HV8B 5DDHA 2VXQH 1GGIH 1QQDB 5FECB 1BWWA 4S1DC 3D0VB 4XVSL 1IGTA 1CGTA 4M1CD 1AD0A 1F2XK 2YD3A 5GS1A 4JG1H 4F9LC 3IKKA 5GSVB 4GAJH 4HWNA 4MDJA 5FA3B 2APVA 5IB5B 5DEFA 2VLRB 3NZ8B 5FGRA 3N85L 3CVHH 3PIQB 5JUEH 1I8IA 2Y06L 1HKFA 5KSVA 4PB0L 5IMKA 2EKSA 3I6KA 4PRNA 4R4FL 3STZA 4Z7OF 2A6IA 1NFKA 5EOQH 3F7YB 1F6LL 3EFFB 4P59H 1S7QA 4BJLA 3BDBA 4NHUB 5IR1A 4DW2H 3P9LB 2DYPB 2XTJD 1D9KD 2Z0BA 4KJWC 5ESVB 4D9LH 3K8KA 4NM4H 3UTSE 5BZDB 2D9QB 3PL6D 4IRJB 2KZWA 3WNNA 4PY7B 2IQ9H 2YD6A 2ITCB 3OZ9L 2JB5L 3O11A 2ZCKH 5MEQA 1F3JB 5AUMB 5D4QA 5I76B 4LCWE 4PJIA 1FG2A 2OL3L 4I5BB 3CXHJ 3FMGH 3FTGA 5DJCA 3KLHD 1OAYL 3FHAA 5DD1H 1UWEH 2JTDA 3SKOA 4MA3A 4U1GC 5C71A 5KVDL 5HGDB 5EU5B 2D0GA 4JFXA 4NQTA 4RNRB 5GGSY 4KKCC 4JKLA 4KXZI 7FABH 1RZ7L 5HI4D 4NDMA 4M43L 3OR6B 3ARUA 3F6IA 3SE3C 1AFVH 4YQXL 3V79C 1GHFL 4TSAH 1KTRL 3BZDA 1AXIB 3TPKA 3LQAL 2YD7A 1UXWB 4Y2DB 2Y25A 1KPUA 3JV0A 4P2OB 4GW5A 3BKYL 2KQMA 3UROR 3M1BB 3A6CH 5MP6H 2DIJA 1N6UA 2H2SC 3UPCA 1DN0A 4LIQL 2H9GA 5C09A 2X4QB 1FCGA 1PKQB 1LEGB 1FYTD 1XGRB 3F5WA 3MXVH 4JY6B 3ARBC 3FB7B 1FVEB 4H1LG 4L8BB 5MEND 4P2RB 3SHSA 3VFVB 3FQUB 1A7NL 1PSKH 2OMNA 4M8QA 1BD2E 4NBXB 1QSFB 4Y4HC 3AY4A 4YBQD 5HHQB 1NCDH 3KYOB 1BBJB 3WUWG 4YK4C 5KG9B 4DAGL 4PJ5B 2X4RA 3B9KA 5EZLA 3X12B 3MBEC 4EOWH 2VN4A 4ZAKD 1VB9A 1KIRA 3PDOB 3CDGB 5FYLE 3VGFA 4R0LC 2CD0A 4NNXA 5DK0A 2ADJB 2IEPA 3GSVA 2BSRB 3MOAH 3U83A 3NIFF 1MFEH 4P48A 1ED3A 3HI5H 3RY4A 3WD5H 5I1IH 4N9OB 1IC4L 4J12A 1TJIH 1CGXA 1SJHA 3VG9B 3OKKA 4HIHB 3FAWA 4QOKD 5JZ7C 1YMMD 4PJHE 2IFFL 5TE6H 1U93B 2ARWA 1SJEA 5L0QC 2JF1A 5HI5D 3DXAB 3QG6A 1OW0A 1FFPA 3C60D 1T3FA 5D2NB 3T1FB 4G9FD 4G3YH 1ZT4B 5IK3A 2HN7B 1G9EA 1EJ6A 4Q58C 2XKNB 3IDMA 4OGZA 5CILL 1W8OA 3PQYA 1F5WA 3DO7A 4ETQA 3GMRA 1NCUA 1NGYA 3PDGA 4KHTL 2BNRB 1HQ4B 2N7AA 1D5ZA 5D7LE 4K9EC 4NBYB 1DANU 3MRRA 4HK3J 1Q8MA 4TPRH 4WUUE 2FNBA 4ZSOE 4QF1B 4X5WA 3SOBL 2CLVA 3HE7C 3W11C 5TE7H 5EBLA 1RIHL 2R56H 1TDQA 1QBBA 2L7JA 4AIOA 1T5XA 3HE6B 1EEZA 4XXCA 1JPFA 4NCC2 4NKOB 5IT2H 4OF5A 3QUMA 2LTQB 1MSPA 4APQB 4JN1H 5DJAB 1IGML 5ITBL 2M8XA 3KPSD 1B0RA 2DQDH 3UBXI 5I73C 3ARXA 1KJ2H 4Y4FC 5L2KA 2X4PB 1CDBA 5A3IC 1HIMH 1UWXH 4TRPL 3GNMH 1FL3A 1KCUL 2BVOB 4YHNB 1RUPL 1XF3B 2BVPA 4HIJA 1IGJA 4OKDA 1Y6KR 2ITDB 4UV4L 3IFLH 4E0RB 2ORBL 3DBXA 4JY4B 1KJ3L 4LLVA 4EUPH 2R0WH 1HH6A 4U1LB 4JZJA 1LDPL 4GAGL 2AJSL 3BKML 5FOJA 3MRKA 4YPJA 1YY9D 2MSPA 5KJRH 1MREH 1OAUH 1UZ6F 4JREB 5T1KD 1I1CA 4L8SC 3V6BR 2ZUQC 1MF2L 5DVOA 2RR3A 3GI8H 1U8JB 4ZPTA 2EDBA 4Y8AA 4CL7A 5DF0A 1UB5B 4JQVA 3VMOA 2AQ2A 4YX2L 3QEUB 4M5ZL 3RWHB 5IOPB 1ZLSH 3HNSH 3TEUA 1IGYB 1BVZA 2EXWC 4PJ9A 1UJ3B 4HXBH 2BCKB 1KEMH 2PYEB 4JRYE 1LEKA 2LU3A 4OM1L 1BIHA 3DX6A 3THML 2UWEA 2CIKB 4F58H 4JDZB 5AZEL 1U8LB 4Y5XC 3IXAA 3WSQH 5FDWB 5ENWA 4K3EL 4PR5B 1PX3A 4KHXL 3BYYA 3NZHL 1VERA 5J13C 3IKCB 1R3KA 3OAYH 3WLBA 4AEHL 1JWUA 1PX4A 2EDJA 3H7BB 1BOGB 1CIDA 3P40A 4PRHB 2XNAA 2P43B 4U1NA 5C0BA 4NQDA 4QTIH 3DRTB 5F88A 2B39A 5I74C 3UJTH 4XPAL 1SM3L 3NCBB 3ARGA 4V1DD 2NY6B 5DJXB 3UDWC 2H26A 4P46D 4M03A 4X7DC 5CGTA 1TZHA 3VFPB 4XTRD 5H2BB 2AAVA 1FDLL 4O4YL 3WFHA 4TNVF 4PRBB 1ZK9A 5J9PA 1FHGA 3ULSB 2CKBB 3QCTL 32C2A 4JKPL 1A3RH 3EYFB 1JCKA 1MPAL 2X9XA 1K6QH 4ONOA 4UBDD 1SEBA 5TH2A 5HHPB 3ZYOA 3D87B 3P4MA 3VH8B 1ULVA 1N0LA 1JPTH 5F6HJ 1WFOA 4JPVL 4OFDA 4AEIL 4PJ7A 5I66A 1NCWL 4QT5B 3TN0C 3SDYH 1NGZB 5AEAA 4OZIB 4GQPH 3RTQA 3BN9D 2XZZA 1CCZA 5CZXD 4XCYA 4G6ML 2BNQA 4NOBA 2GJ6A 3NCYP 4KTEH 1MRDH 4GRWB 2HLFC 5EWIL 4D0DB 2BFVH 1XIWB 1FZOB 3GKWL 4WGVB 3QI9B 1B4RA 4HK0B 2DLEA 3WCYA 3O2VH 1KG0B 1EBPA 2MQCA 5EOCH 2O61B 3PWNA 3VGHA 3T2OA 2B5IC 3QUYC 4HGMA 4PTTB 5DC4B 3NGBB 1JF1B 4XNMB 2Z8SA 3ARDD 1RUMH 3CH8A 3GSXA 3T65B 5J11B 3UXFA 2R4RL 5IB4B 5FM5O 1BGXH 5MEPA 3K1DA 4NQVB 2FB4H 5KVEL 1IM9D 3ZE1F 3I9GH 4M6OL 4U1HB 2BERA 4Q74A 3TBTB 1S78C 4FQHA 5JW5B 4W6WB 4M4RA 4XMKL 3T4AB 3KS0H 5J3HC 4L4VE 3QISA 1FORH 3GB7A 3I3DA 3WDHA 1GYAA 4XAWH 3QIWD 3C8DA 5GXBB 4UNUA 4NQXA 4WW1B 3S4SG 4OIBA 4UQ3B 3DV6A 2EIZA 3RZCA 2EDDA 2X09A 4KROB 1GZQB 1LHZA 1BBDH 3MJ9A 1G7IA 4FMFA 1YNLH 4JJHA 4F15C 4E41B 3TJHC 4HCRA 1YQ2A 4X9IA 2ESVB 1R3JA 4U3HA 4JFDE 4MCZA 1P84K 5AZ2L 3UZQA 2G2RB 5DRXA 4L4TB 3OV6A 2GK0A 3T0EB 4NWTH 4H1LA 5D7JB 3HLAB 4J3TA 2NLJB 1J0YA 2W9LA 1D6VL 3MLWH 4QKXB 3CH1B 2JJWA 2HVJA 4YXKL 1HHKB 3WUWA 1VFBA 4XP5L 4QY8A 1G7PB 3L3KB 3BVNA 3O3BA 4JFPA 4ZFOB 2XFXA 3G5XB 4B0MM 3RA7H 5GIRA 4Y16D 1B2WH 1U41A 2HJKB 2E9WA 5I1KH 1LK2B 3L3GB 1IFHL 1FN4B 2HLAA 1OTSC 2AEQL 2CDGA 2FEDD 1ES0B 1M71A 5F1OB 4I3RL 3R4DA 2V2TA 5M7QA 1DBAL 4NKDB 2Q8AH 1K8DB 2E9IA 5D1XC 1P5UA 3LQZA 4DZBB 4NZTH 3PG2A 3GHBL 3HUJB 4P57B 1K2DA 3LIZL 3UZVB 4CAGA 1YN6B 5IVZA 1MY7A 4GO6B 2FR4B 3MRDA 1OGTA 1EERB 3BEVB 5FV2A 4PGEB 3WFEH 4MJ4A 2Q3AA 3OKOA 1FNSH 4LSTH 5JHDA 4LAQL 3QAZB 3OKDB 5L2JA 5FM4A 5E5MB 1PG7X 5GJTH 3X3FL 1YA5A 2NX5B 4E5XB 1ORQA 4PGCA 4OD1H 2DTSA 2C1PA 3OKMA 1RUAH 4JRXA 4GQ9L 1AGEB 4DCQA 3CX5K 4Q2ZB 3JSSA 3B8YA 5T1DH 5KSBA 2BC4A 5FF6B 3DWTA 2AABH 4W6XB 3BQUC 4YZFE 1C7TA 1MNUL 3R0NA 1O0VA 2GITA 3SDCC 3SDDA 3OAZH 1TXKA 3NACL 4NOFA 4NQCD 1DBKL 3D6GA 4HF5L 4U1IB 3C8KB 1G0DA 2IBZY 3U0PB 4JFOA 3KR3H 1G6RB 3IJYA 4NIKB 4FTVA 2OJZL 3GSUA 2XKSA 5HYSB 1AJ7L 4X80H 3LB6C 4JHZA 4NT6A 4JN2B 4PJEF 1ZKAA 3IDJA 5EUOB 5HI3D 5HGBA 1RURH 4RWYH 4J8RA 3KNBB 2ZPKL 4MVBD 5FO7A 3RUGF 5INDB 3VXNA 1BQSA 2Z91A 4H8WL 5HHOE 3RY5A 5FOBA 5I8EA 1PAMA 1SY6A 1FZMB 4MJ6B 3MCLL 2R1WA 2IAMB 5E03A 3GUTB 3DX7A 5C0CD 1UB6A 3ZE0F 4PJDF 4PJBA 4JVUA 3KWWB 4X4XB 5DVMA 4TSBH 3PGCB 2FZ3A 2A9MH 2P5WD 4EBQH 5CEZL 5K59E 1S8DA 2ATKB 5C0JB 4X6CB 2DLIA 1QYGL 3N9GH 1DVFA 4LF3A 3R06B 4X6DE 3TA3B 3S3SA 4BZ1L 3L3JB 5B8CC 1OSZB 3BUYB 4H20L 4Z7UB 3MODL 3KG5A 5T5NF 2J5LC 1HSBB 1G1YA 4MA1B 5D70L 4WW2F 3EDFA 1NC4A 4QRPB 3ZSSA 5F96H 4U7KA 1CT8A 2FIKA 4R90H 3DI3B 3CD4A 4PLOB 2F54E 3ECBB 3TT3L 2BSSA 5EZIH 5J57B 5DGQA 3S35X 1PY9A 3DROA 2FECI 4JPKL 3FO2B 3MA7B 4S0SD 3QUXC 3PWLA 4XWOC 3NN8B 3QQ4B 5FDYA 1IKNA 3D25B 4YHOH 4EKXA 5D71H 1Y0LA 2EYTA 5DMKA 4F37F 1RHHB 4BFIA 1ZANL 1B0GB 1K9TA 4G8GD 5F72S 4F9PA 4C83B 2NY0D 3VFMA 4Z77A 5I1DB 2Z31D 2R29H 5DA4A 1MCBA 3VI4E 3HA0A 1FFOB 1ZHLB 2FX7H 1XR9B 4X6BB 2YUWA 4I0PA 3QO1B 2R0LH 2YMXL 3QIBD 4LCWA 5C08D 4P3DA 4IS6B 5F1SA 1Z0NA 2DQTH 4BKLB 4AJ0A 3PV6B 5BQ7B 2AK1H 4M1GH 1OF2B 1CFNB 3DMMB 1FV1B 4OCWL 2EC9T 1T1WB 5ESAA 2GUOA 4W4OA 1FQ9C 4KQ3L 1BECA 4MHHI 4P5KB 4U1JB 1CXEA 3UBXG 1JNNL 2OQJB 4AIZA 2BXYA 3IFPB 2VZUA 3JV4B 3O9WB 3VRLF 3OPZL 3KPRE 2A1WL 4PRID 4KZEL 5JW4Q 4X7FC 5E8PA 3IVKA 5I2IA 1MI5D 4PJ8D 4K7PY 3QRFM 4DZ8A 3EO9H 5ISZD 1QRKA 2Z93B 3EJZC 4PJFA 5E2JA 4WO4B 2AV7A 3MNVB 1A2YA 3HPLA 1FH5L 1UENA 4OCSL 4U6YB 4MJ5A 4R9HA 4HIXL 3W39A 3BD5A 4HT1H 1P2CA 3L5WA 5K9OA 3HPJA 4FA8A 3LMJH 1A6WH 2BY1A 4HV8A 5CJOH 1CK0L 3OB8A 1ZS8B 1FVCA 1XF5B 4BQ8A 3HMXH 1ZGLM 5DQJB 4Y19E 1EHLH 1LE9A 2YUXA 2WP3T 4F57L 4LCIL 1F90H 4OGXL 5I75C 3BWAB 1BD2A 5E00B 5ALBH 4QRQA 4FQ2H 4Y4KC 4Z7WA 2VXTL 5EFIA 1X3DA 3QQ3B 2YN5A 2VYRE 4LVOB 1I85C 4PB9H 4OV5B 3C6SB 1EFXA 2HH0H 1X5JA 3FN3A 2YZ8A 3U30B 2Z8VC 1C12A 1F6AB 3LPWA 4TUJA 4EI5C 5JPMB 1J05B 3M8OL 3UJIH 3TF7C 1FGVH 3GHEH 4FFYH 2HAZA 3E2HB 4KKLC 3S4SA 4HC1A 1FNFA 2YUVA 1D6EA 3IRZA 4XI5C 4X99B 3GSRB 3A67H 4PY7A 2H6PA 5GGRY 4BK5A 2YPVH 4PJHA 4ZUTB 5I76A 2AXJA 1TMCB 3GIVB 3PJSB 5GGVY 3WHXA 3CZJA 5CEYB 2VKXA 1S7WB 2PW1B 5MHSE 2B4CL 1DDHA 4ZS7L 5B21A 2QADC 1K3IA 4Z0BH 2WLYA 1J1OL 4RGMB 1FO0A 1A0QL 2AGJL 3MRHB 4XPHL 3MR9A 4KJQD 1V3JA 5IQ9B 1CBVL 2VKWA 2HKFH 5HGDA 2OYPA 1M7IA 4QNPF 4UNTA 3HI1B 4I18C 1QPXA 3C9NA 5DUBB 3VFWB 1TVBB 3OR6A 5IW1B 3ULVE 3H9ZA 3VXMB 1PKOA 4G6KH 3BEWB 4AENA 2IC2A 5CD5C 1ZT1A 5HYQA 5D7LA 4C56E 1JZ4A 3KPLA 3HNVH 4P5TC 3QH3A 3H9SB 3CC5B 4LLUB 1VGEH 3GSNH 5FKPA 1YEGL 2AV1A 2A9NL 1MCJA 1A6TB 4X5XA 2F58L 4F2MB 1MUJB 4CADA 3Q1SL 1UM5H 3BPNC 3P30L 1AKJB 4KWUA 4MD4A 5BW7C 1K4CA 3MLYL 5C09D 4DGIL 5E7FA 1RFDL 2A6DB 5EC2A 4QHLA 4YHPB 4XCEA 2G5RA 3I3EA 3TCLB 3ISWA 5IMLB 1NC2D 1RZFH 3V8CA 1IEBB 4MAYA 2W9DH 1HINL 4XVSH 5IM7A 5IFJA 3B9KD 4CU8A 5I1LB 4JFEB 3FRUA 5I0DA 3OXSA 5DJ0A 4J3VA 3RWFA 2NYYC 5CEZD 3EZ8A 2ZKHL 4BQ6A 3L3OA 4QTHB 3VE0A 4X4ZA 4PP1C 2Y06H 5ITFB 1XZ0A 5IVOA 3UPAA 2AXFB 5C0EA 1IMHC 5B39G 2OTWA 4ODXA 1A1NB 3VWKB 5D2NA 1N7ML 4AQOA 2ARJQ 1Z9SA 3CSYB 1Q0XL 3WFDH 4RAUA 1S9WB 5TDPB 1EH9A 3V9FA 3PWJB 4M1DL 1AGBA 3UTPE 2V17H 4ACPA 3GMNB 3MRQB 1JYVA 3VG0H 3UJJL 1RIVL 3FT2B 5F7NC 1JFQL 4MA8H 4G6AC 3ARYA 5CJQL 1YUHB 3MJ9L 3KXFB 2BNRA 2XZAL 1HQ4A 1OLLA 4XPGL 4JRYA 2F15A 3PQYD 4WHDA 1R5IB 1FL6B 3HZYA 4BA8A 3O6LL 2X4OB 2A6KB 4NO2B 2P4AB 4ZTPH 1RJZA 3TESA 1RVFL 1RUKL 4LCYA 2EDXA 4M61B 4XP6L 3H2WA 3KHOA 3OKLA 1RZ7H 2DLGA 1TIUA 2I07A 4DVRL 1F4WH 1CDJA 4ODHL 1GHFH 3E0GA 4N0UB 3Q3GB 3X3GH 2Q76B 1WBXA 4OD2A 4YHIB 5DMJB 4KJPC 2HKHL 3IU3A 5IQ7H 3AAZB 4LIQH 4MWFA 5C2UB 1XF2B 1D5BB 4FFWD 4PJGE 3QXVA 4MA7H 2X4NB 1K3ZA 2R0ZL 1ZHKB 2YOCA 1JPGB 5CEXA 4GS7C 2K9UA 3SO5A 5C0GA 4WI4A 2HYMA 4OAWA 5L2KD 5CZVL 2FO4A 3V6ZB 4ZUSA 1OWRM 4PRAA 4UDUB 4P9ML 1T1ZA 4F8QA 3FQWB 5E9DE 4HPYH 1U92A 4WWKC 2HT4D 2WQRA 3T2NL 3ARFC 1D5MB 2EIEA 4TYUA 1EAPB 5CLWA 4UUJB 3TIDA 2X40A 4UT9L 5E94B 4ZQKA 5C6PB 3DV4A 1YQVL 2WLZA 5FKAA 3RWHA 5DURB 1MEXH 5T3XH 2C3VB 1BM3H 1DQQB 3LEXB 2H8PA 4HZLA 1UJ3A 4YBHA 2HRPL 4JQXC 1V3MA 2PYEA 1BEYL 4N8PA 4OZGA 4Z7OE 1CICC 2QHRH 4NFCA 4CUCA 3PWVB 3U4EB 2EC9U 4R97B 2YD8A 1DCLA 3VCLB 4HZAA 4PJ9D 1B6UA 3BP6A 3C6LB 1V3KA 3EUUA 4MB5A 2WK2A 1N0XH 4PV9A 1QLRB 1KCLA 3ZTNL 4L4VA 4ZNEE 4KHTH 2FWOA 4OZFB 3IFNL 5D1QC 4M3JA 1LGVA 2Y5TA 2AK4D 2NY4B 3OSKA 4LPCA 4JAMA 1TPXB 4PRPE 5C0BD 3DJ9A 1OB1A 3BGMB 4NQDD 2VDQH 3W81A 1KB5B 3QEQE 5GS3A 2CMRH 3VFPA 2WUBL 3TO4C 1S9YA 2IADA 5HHMD 1CGSL 1SY6L 2PO6C 4MMXC 1R5VB 2IMNA 3ARGD 2XA8L 4M3KB 1IC5L 4DVBA 4WV1C 2GCYA 2HP4A 4UIKL 3G08A 2A83A 2BDNH 5HHPA 4Y0GA 2NTFA 4KY1H 3QFJE 3O2WH 1FRGH 4N5EC 3IAQA 4P5MA 4HFWB 5F3HA 5J6GA 1EVUA 5DA0B 4MX7A 4FNLL 4WDIB 1RJYB 1GPOL 2ZUVA 3BKJH 3PHQB 5BRZD 5FYKE 1RUPH 1V05A 1HN1A 1TNMA 4JO1L 4UV4H 1KJVB 2HFEB 5J7CC 3BRFA 4PV8B 3LKSB 4WU7B 4N8VB 3MV01 2ICWI 2CLZA 1NFIA 2A2QT 3PHSA 3RTQD 4A6YB 4FQCH 1HSAB 1R3HA 4JM2C 4YDJB 3VJ6B 2F8XC 1I3RB 3T0WA 4GAGH 2BNQD 2GJ6D 3VW3H 35C8L 2YD5A 2ZCLL 2E9BA 1LEIA 3TVMC 1V3LA 2IWGA 2H3NB 1MF2H 1QBLH 5EIIA 4MNGE 4B5EA 3IRPX 1NGQL 1GOGA 3WEXB 1Z5LA 4MB3A 1YEHL 3TBTA 4M5ZH 1RK1B 5ICXA 1HNGA 3RVXC 2IPUG 2GAZB 1A1OA 3AB0C 3X13A 4RRPG 4HFUH 3Q6GH 2OM5A 1EJOH 2A0LD 3G04A 1MFCL 1MHPL 3VWJB 5KS9F 2F53E 3IAPA 4OGAC 4FQIL 4GMTL 2G75B 1F4HA 3LPFA 1EO8L 4KHXH 3RZCD 1MJ8L 4AEHH 3QA3B 2JK5B 1IM3A 2PXYC 5L6YL 3BJLA 2DWDB 3QUYA 2Q8BH 1KCRL 3PNWB 3TWCH 3PGDB 4ZUUB 1QSEE 4KZDL 1J1XL 3IGAA 3O3AA 4Q9RL 4HQQH 2HFGL 2V5SA 5CP7B 3K74B 4XPAH 2DBLL 3TCXA 1WFTA 1ZTXL 1YPZE 4GRLA 5SWSB 1T7WA 5CJXC 5JO5A 1C08B 2IH3B 4MJIA 2V2WB 5IEHA 1GC1C 3MRBA 4BQBA 4UU9A 5DO2D 3QIUA 4O4YH 4JCMA 3GRWA 3ESVF 1OCWL 1WJ3A 5IVXE 4UV7L 1CDHA 3QJFA 5F7DB 1X5LA 4UTAL 5JOFA 4DKDC 3V5KB 5LVEA 4JANA 3MFFB 4NQEE 5BVPH 3BRGC 2BRQA 3HUJA 3FO1A 2VDML 3F12B 4JPVH 3RWIA 4WFHD 4U6HA 2AI0L 3WJLC 3UTQB 5B39A 2XOTA 2GSIB 3STLB 5HDBE 1U6AH 2NMSA 2HJFA 3BIBX 1P84J 4G6MH 3BDYH 3EYOA 4AH2B 3PP3K 4HUUA 1DBJL 4C58B 2JCCE 4LSQH 3PUCA 1SVCP 4OIIL 2FHCA 4ZSOB 4X6DA 5JHDD 3EOBB 4HC1L 3FHQA 3MCG1 3S36L 3B8SA 3BDXA 5D2LB 5CJ8A 2QSQA 3TJEH 4OCYH 2N56A 1AHWC 3QUZC 4M5YL 4BZYA 3JZ7A 2JE8A 3D9AH 1T66C 1R5WA 3GBML 1ZLVK 5FUOL 1BFOB 1VA9A 4PP2A 5EUKA 4U1GB 3B2UD 1SBBA 3WO3B 5DS8A 5FGBC 4JRXD 1VKXA 2F54A 3TP4A 4KPHL 5KVEH 3FOMA 3HNTL 3ULUL 5C0FA 4JFHD 3AREA 1FO0L 1G9NH 2NXYD 4HUXA 2EEBA 2VN7A 4NKMB 5EOTB 2UZYB 5DMIH 2Q3ZA 3SDDD 1TQCC 3QP3A 5BMFH 1RMFL 2IANB 4JFFE 5DJYB 3UTTE 5GRUL 2WIMA 4PJXA 3H9HB 4UQ2B 3ARBB 3P73B 4RZCB 3BSZH 2VITA 1DQML 1S7UA 1D6VH 1BWMA 1A7QH 4PY8J 4UINH 3IETB 4K7FA 5I8KH 1PLGL 1B0WA 1V7ML 3CX5J 4Y4HB 4EEEA 1GRWA 3HG1D 2CLRB 4O51B 1XEDA 2DWEB 3SDCA 2VXSL 2EDTA 5DZNA 5DRWB 2Y6SC 3MBEB 5E0QA 4R2GD 3LHPL 4U0RC 3AROA 1C5CL 1HWGB 3A0OA 4R0LB 4RIRA 4LSRL 4LVHC 3JTTB 1G9MC 1OOAA 2ZJSH 3WO4B 3PGCA 3FZUC 3DSNA 3O4LB 4PJIF 2DICA 2O26U 1DBAH 2ICEB 2AJXL 2B7DT 2XZQL 2MHAB 4EVNA 5GQBA 1CGVA 3GHBH 1Q0YL 2E27L 3G6AB 3GM8A 3LIZH 5GPRA 5J12C 4JO2L 3TA3A 1VADA 5DJ8B 3U36A 3MCKA 3B5HA 5L0QB 1WK0A 2ZOKA 4D0CB 3U0TB 4OUUB 4LHJB 4MSWB 3I84A 2NZ9D 4YHYB 3FQTA 4LAQH 5D7IA 4PBXA 3MXWL 4NWUH 5C8JB 4MXWH 1DVFD 5IROA 4HD9A 3CU7A 3UC0L 3UMTA 4JZNB 2B1AL 3ECBA 4RAVB 3L3IA 3X3FH 2D31A 3BE1H 1A7OL 1D5XA 2DM7A 5IB2A 2EE6A 3QNYA 5EU6E 1BPVA 3QQNA 1CL7L 4LLWA 5TFSL 1CXIA 1A7RL 2VZ3A 5IB1A 1ZVSB 3QWOB 4HKXA 2XT1B 4YIQA 4N0FA 4R4BB 4M1CC 1OPGL 2UVFA 2CK2A 4GT7A 1TJGH 4Q6IA 4TNWF 2E7MA 4HJ0D 3DO3A 3G5YA 4ZPVB 3RJQB 1EHAA 3QDJA 3U0WL 5ACZA 3NACH 3MLUL 2VL5A 3HE7B 5B8CA 2P5EB 4EDWH 1DBKH 4LSPL 3RGVA 2VZOA 3O3UN 3TYFB 4XMPL 5I0ZA 3DX9B 1H5BC 1HXYB 1LP9E 1M6OA 2NY5C 5SWZE 1HH9A 1MHEB 5CZKA 2XTJC 1D9KC 2VB5A 4S11A 1Q9KB 4WFGD 3PL6C 2DM3A 1I1RA 3S5LG 1JRHL 1Z3GH 3REWB 4NC0B 1FZKA 4H0GA 4RMWA 5I73B 4YHML 5HD8D 2E6QA 1MQ8A 2NNAA 5AG9A 3T3MF 4FQXD 4KDTA 4ONFL 4C56A 4LBEB 5H35A 4GW4B 1CZ8L 4X98B 4C55A 3KLHC 4HLJA 3S98A 4H8WH 2KH2B 1UCBL 3MYZA 4LP4A 2C3HA 5ADOH 2X44D 3TFKD 1IL1A 1W0WB 1U8PA 5TDOB 5DJ6B 4JJ5A 3MA9L 2VLJE 4Z7NF 5HI4C 3VD7A 4CJ1A 5EBWA 1RZ8A 1A9EB 4FN0A 4MGXA 1XGTB 1FAKT 1S5HB 4L8SB 2ZUQB 2FEEI 2NR6D 4HJJL 3X17A 4WW2C 2NY7H 3RPKA 4EN3A 4UI2A 1G84A 1KCSL 1B4JL 5DJZB 4JFDB 2M26A 1EEYB 4BZ1H 2ADFL 4H20H 4RRPA 2OJEA 4NYLA 5DHVA 3UO1L 2XXCB 2Q86A 5D72H 2VLRD 4QEGA 2VDNH 2NY3D 5D70H 1EFXD 2E6PA 4NUGL 1I9RH 5F7EL 2N4IA 1LNUA 2YXMA 4LNVA 4Y5XB 3TT3H 3SY0B 4YBQC 3L7EA 5IJKA 3NFPB 4GOSA 1KLUB 2YRZA 1U8NA 1XGYL 4N9GB 2BOBA 4NQSA 1U8KB 4HS3A 4ORGB 5B4MD 3QFDA 3D2UA 4PJCB 4ZAKC 4Z7VE 4LU5L 2B8OT 5FV1L 2FX8H 2DL9A 4G42B 4J6RH 5I74B 4TVPL 1HHHB 5DWUH 3RNKA 1BQHG 5BJTA 1F00I 1G7QB 3K1KC 4OT1H 3ZKXB 2FHFA 4N0RA 5GSRA 3ULUD 1P5VA 5KSAA 1KPRA 4ONHA 4EJ1C 4P4KA 5IGXH 2DMCA 2VE6B 5HI5C 4X8JA 4PJAE 1I8KA 2J6EA 1U3YA 3C60C 4KQ3H 3SCMA 1TTUA 1JNNH 3QO0B 3BGFC 3GJEB 1NUGA 3R8QA 1OP9A 4URTB 1CFTA 3MROA 1ZXQA 4KJYB 4QRSA 1E4JA 3OPZH 5D7LD 4X83A 5FHBL 1QRNE 2QEJA 1SVZA 4AT6B 3QUMH 4P2OD 3TN0B 3MLXL 4N1EA 4P2YA 4OBRA 4PJEE 4Q7DA 4C59B 3MSPA 2C7UB 3TNNB 4KUCD 3WMSA 5IBLD 1FH5H 5DQ9B 1N5AA 2D7QA 4EQ3A 1JMZA 2XTJE 4I18A 3WE6B 3MGAA 3EO0A 3OB0K 4LLYA 1CK0H 3H6JA 1QR1B 1YEEH 4PJGA 5SX4H 2UWEF 2B5IB 5JPNB 1QSFD 2PCPB 3FQNA 5ANME 3VXSB 4XH2B 1DUZB 4K2UH 3ZE0E 4OGXH 4PJ5D 4P3CL 3HZMA 4LCUB 1FL5B 3AM8C 3D1MC 4WI8A 5F6HI 1IAOB 2RFXB 5DQDL 3FFDB 4IHOB 1FIGH 4FQLL 4MAYD 1NAMA 3CFKA 4QTHA 4WHTB 3RWCB 3G5VA 4GXUM 3QDGE 2AJ3B 2FJFB 4GAYB 3MJ8B 1MCSA 1T2JA 3ROOA 4F7EA 3TIEB 3M8OH 1HCVA 3W9EB 3OG4B 2HVKB 4XZUA 2VLLB 1MCRA 4XNQA 3JWDH 5BW7A 4H26B 1S9WA 3MJ7A 3QULB 3SPVA 4OD3L 4YDKH 3RVUD 4XP1L 2D03L 2XN9E 1C5DB 5F7KC 2OR9H 1J0JA 3U2SB 1YY9C 1J1OH 1FYTE 3ZO0A 4KRNA 2EDFA 3L6FB 4I8DA 3FB5B 2VH5H 4PJ7F 3QDHA 5MENE 1CBVH 4EI6A 3MMEB 4GG6B 3S7GA 3LS5H 3GJFA 2BNRD 2GIYA 4JRYD 2ZOLA 1R3LA 3JWNC 3RWEA 1EVTC 8CGTA 3O2DA 4KU1A 1MVUB 4G5ZL 4KTDL 4HULB 4DK3A 1XAUA 5IFAL 1U42A 5I16B 3RAJH 3DX8A 3HAEG 4TOYL 1LO5A 4S10A 5F9WC 1OQOA 1OY3B 3TM6A 4ZFOL 1FNEA 5C9JA 2CSPA 4O02H 3G9AB 2Q87A 4OBSA 3U9PH 3O3EA 5D1XB 4LKXA 2NQCA 3AAZA 3NIGE 1CN4A 3DVIA 3AS1A 3HE6D 5CIPB 5JTWA 2E7LA 2APBA 3JBG7 5CSGA 2HFFA 4QOKE 1YMME 3LKOA 5FYJL 1SHMA 1JPGA 3VRIB 2X1PA 2DD8H 1HQRB 3HFML 3P30H 1DTUA 1WQVT 1XGQA 5CD3B 3V6FB 3MLYH 4CVXA 3V4UH 1JNHA 1Q9LB 2VDLL 4G9FE 1RFDH 4YO0A 4Z95L 1WZ1H 1KYOK 4W6YB 4BK4A 1KT2B 1MLBB 4Z9KB 3HC0B 1AE6H 3V7AE 4LVNC 1G7LB 3MOBL 4P46C 3CDFA 3WNMA 2ERJC 1CG9B 3REVA 2ZNXA 4OZ4A 4IMLB 5I17B 4XTRC 1CVSC 1HINH 3L7FB 5DD6A 4IDJL 1P7QB 25C8L 5IHUL 2IMMA 1PQZB 4GUPA 1I8MB 3LQAC 3BQUB 5F9AC 5E7BA 2XIDA 4J4PA 5DR5H 4XGZB 3AGVA 4UBDC 1IQDA 1P9MA 3C8HA 2OTUA 4OFYA 2KL6A 4WI6A 3P3YA 2N7BA 3LN5A 2OXGA 5FAAA 1N7MH 3LN4A 5K9JH 3BN9C 1FJ1A 1Q0XH 2EH8L 4MNGA 5CZXC 1A6AB 3ZKSD 3U4EA 1M7DA 1B88A 1ZSDA 3S5LA 1DL7H 3UJJH 3LSOB 4UDTB 2PYED 4JGMA 3MNWB 1T0NB 5HHNA 3QNZA 4Y19B 3WDJA 3FQXB 2I60H 1OGAE 4XC3H 4HCRH 4CN6A 3ARFA 1XCQA 5JW4R 3ARDC 4NJAL 3MREB 1YEKL 3FT3B 4L4VD 4ZDHA 4X6FA 4PRHD 3LY6A 4MD5A 2EYSB 1DEDA 3BH9B 1BAFL 2WINA 1KB5A 2E6JA 1U8HB 5KAQG 2BMKB 1OARH 1S7RA 4OSUL 5KW9H 1YYLL 1A4JB 4M9OA 4ENED 1S7SA 4PTUA 3MO1B 1X5IA 4JQXA 4CGTA 4FG6D 4JQIL 1WTLA 4DTGL 1KB9K 4P2CG 3QIWC 5C3LD 4NHCL 1J87A 1QO3B 2IG2L 4QHMB 1YPZA 4J3UA 4NJ9L 3M17B 2UYLB 2KQNA 3JTSB 5KSBF 5HY9A 4UNVA 1P4BH 1YDPA 2BVYA 5CP3A 5C0AB 2OP4L 4EXKA 4ZOCA 1PG7L 2R0ZH 3ZZ1A 3EW3B 3TC9A 1YMHA 2J5LB 5FK9A 3TH2T 4CJ0A 5IVXA 2BZDA 5ERWA 2I9TA 4RA3A 4NQEA 3WFCL 5B22A 2G9HA 3F7RA 3VFRA 4G80B 3QNXB 4H88L 3UCRA 1R24A 1U8OA 2QR0B 1LILA 3QUXB 4L8CB 3QPXH 2X4UA 4Y16C 3T2NH 4PGBA 3T08A 4PRDA 1BVLA 5SWQA 3KDMA 3UTZA 5CHNA 2FEDC 2X4SA 4WV1A 1OM3L 4MCYB 4W68A 1P4IH 2EYRB 4HPOL 2A73B 3SDAA 2CGRH 1CXLA 1F4YL 5JMRA 4G8FB 2FSEB 2JCCA 1BQHA 3B6SB 2F9BT 5ID0A 1MCPL 5J6HA 4UT9H 5JIHA 1ACYH 5LGHH 4V1DE 3AVEA 2QSCL 5DUMH 1Q94B 4M48L 1ZA3A 5AD0B 1WEJH 1CFSA 5L9DH 1GGCH 1ZEAL 3O6FA 4OB5L 5DEGB 2FHBA 1H15B 5KN5A 5GGQH 2GW5A 5C6TL 4JPWH 2G75A 1E4KC 3BZ4B 4F7MA 1TLKA 4XCFH 4ZUWA 4OZHE 3SJVE 2R23A 4JM2A 5GGUB 1E27A 4KROD 3QA3A 4QRUB 4LIQE 3ZTNH 2DIAA 5F1IB 1QLFB 3MV8A 4LDLB 3IFOA 2ICWA 3AS0A 1KCVL 3K8MA 4HKBA 4JR9L 2ESVD 2UVEA 4M6NL 1HK6A 4OF3A 4HJGA 5L88H 3O41A 4ZYKB 3UTTA 3NTCL 2YK1H 4QRRA 1QUNA 1T5WA 4RQQA 4Z8FH 1BF2A 1H3TA 3VGBA 1IZJA 1K5NB 2MKWA 4U33A 2PR4L 3SGDI 2XA8H 4GRLD 6FABH 1F2QA 4K8RH 1IC5H 5I75B 4MJID 1NCAL 1FLRL 2BHUA 5DT1L 4Y4KB 1SBSH 2NW3B 1MHCA 3QIUD 2EE9A 4JLRA 3RI5F 4KAQH 3WN5B 1JHTA 3GM0A 1UKTA 3UTQA 3UYPA 4L3AA 4FFZL 1GPOH 5HI3C 5FYJD 4EI5B 5IW6A 3KPQA 4X7CC 5I1JH 1TJHL 4YE4L 4MVBC 5TF1L 3IJSB 5GGSB 4M7LH 2DB8A 4BELD 3KPTA 1MCWM 2F5BL 2FX9L 1X4ZA 3IS1X 4RMRA 2BX5A 1NJ9A 2R2HA 3S6CA 2X5PA 3MRJA 4HIEA 1BZ7B 5F7HA 3V4VL 2DQCL 4YLQT 1WC7A 5HYJB 2ZCLH 3VGAC 4O2EA 4QXTB 5D5MB 4LEXL 2B1HL 5IHLB 1Z0MA 1OAKL 4JO4H 4IBLT 1G1CA 3EO1B 1JGUL 4PJFF 4LRNH 3MV7E 4XXDB 4U3XA 4QXUH 3LEYH 4LHUB 4BSWB 2IPTH 4M6ML 3TPUB 3HAEA 5BO1L 3LN9A 2F54D 1T1YB 2YPLB 2MCPL 3BAEH 3CJJA 4P5TB 1HHGB 3ARED 4PG9B 1MHPH 1JWSA 1U8IB 3LRSB 2DQGH 2DQFB 1MCWW 1C5BH 5DJYA 1KELL 1MFAL 5E9DB 1NUFA 3RWDB 2VQ1B 2P24B 5IG7B 1RZIB 4Z7WF 3CFBA 5L6YH 2ADIB 1HKLL 4D9RE 5IP4A 1KCRH 1NKRA 1BIIA 3G9VA 2VXVH 4HKZB 4HH8A 4N0YL 4RZCA 5SWZA 1LP9A 3WS6C 4Q9RH 4UIMB 3LOWA 2IBGA 2HFGH 4DUWA 4FFVD 3K4AA 3FCTA 2FD6L 2GSGB 2WBWB 2DBLH 1JN6A 3B3IA 5FGBA 1H3XA 2NY0C 1CD9B 5DK2B 2Z31C 3L3HA 4FXGB 4WNQB 5FCUH 3UZEA 3KPNB 1WF5A 4LNRA 5IHZA 3QIBC 3GMLA 1FE8L 5C70A 4PJHF 4U1KB 1H0DA 1IAIH 4POYA 5ETUB 5J4MA 4P2QA 1JE6A 1MFDH 4G6FB 4KKNA 4XB7A 5F21B 1CLOL 5DRNA 3ULUF 1QFWM 4TUOB 2ZSWA 5T1MA 1N3NB 5IEKA 1X4XA 2VXUH 2Q7NA 2VLJA 2CDFA 1KJMB 1KV3A 4NRYB 4YFLF 5FA4A 3WIIH 3C5JB 1MCDA 4OUUA 4PJ8C 4S1RH 2GT9A 4NQCE 1MJJA 2EH7L 3TA3D 5D93C 4YXHH 5FYLH 4Y8DC 4NO5A 4PRPB 2P8MB 2DQIL 3BXNA 4TQEL 2BOCB 1T22A 2P7TB 4HC1H 1CS6A 4O2CA 5SV3A 3TH4T 3A6BL 1JI1A 4BFGA 1WIPA 1X5XA 5FGCE 2P8PB 3WYRA 3HB3D 1A9BA 4KUCF 3NCJL 4WU5A 3VXOB 1AC0A 3BHBB 1JNLL 4KMTL 1VFUA 3QFJB 4NNYB 1EMTL 4KPHH 1CXKA 3TYGL 4U6XA 1NH6A 4JG0L 1FO0H 3WS3B 1KOAA 3R1GL 4OF6A 5HDLA 4XPTH 2BSTB 5E5UB 2IQAA 2R0KL 2X7LA 4KI5E 4Z7VA 3FT4A 2G60L 5C0CE 1NEZG 3KPPB 1FFRA 1UH4A 4O58L 5DSCA 3QDJD 2DTML 3GMMB 4U2YA 4HG4K 5C2BL 3RDTA 3O2DL 2FGZA 5DXWA 3D0LB 1K8IB 2P5WE 2PNDA 3CFJA 4S1QL 3RGVD 5JQ6L 3JUZA 5HBBA 1KPVA 1WZLA 3DMMD 5KS9E 1HOCB 2P42B 3J8F7 2J8UE 1HDMB 4HWZB 4PJAA 1AGCB 2AQ3A 1I9IL 5GRWA 2JB6A 5E08L 2CDEA 4KJQC 4NKIH 1V7MH 3I2CL 5FB8B 2UUDK 4MNQB 1H3PH 3MGTB 2F8VA 1LO2H 3TO2A 1ODAA 1QRNA 4C56D 4NSKB 4L3EA 4WWKB 1CLYL 4WO4D 2ID5A 3W9DB 3OAZK 1TCRB 2JKXA 3EOTL 2VAAA 1IEAB 4OLWH 1Q9WA 3VXQB 5AAWA 3BP5B 5DEZA 3D3VE 2C3GA 2YHGA 3ZKMD 4YWGL 4YDIL 2HMID 1JPSH 2F53B 3GGWA 4G6JL 2FLRT 4FABL 5HYIA 5IV2B 1GGYA 2AJXH 4G8GE 5DRZA 2AJUH 3B9VA 2XZQH 3CPLB 1GGTA 2YEZA 2YZ1A 4N8CL 3PWUB 3Q6FB 5LAXB 4DGYH 2ZSVA 4E42B 4KXZH 3QXDA 5GRVK 3EAKA 1KJ2B 5ANMA 1QSEB 5D8JH 3SKJL 4HS8L 3RWGB 4EN3D 3HI6L 1KTDB 3S97C 2FJGB 3MXWH 4MDIA 5A2KH 1CICB 4I4WA 4I77H 4XVUD 1NDGB 4X0KA 1CE6A 2HT2D 4NGHH 4H8WC 3UC0H 2DLFL 2FIRT 4ZOAA 5DGRA 1UXSA 2MPAH 3QDGA 1A7OH 3NVQA 4RMUA 4EUPB 2QQLL 5H8DA 4KRPD 5TFSH 3JXAA 4PRIE 4NO3B 4GXUN 4FS0A 4DKAA 1L7TL 1IGFL 1MI5E 2ATPA 2DMBA 3LS4L 3AY4C 3CMOL 3KAAA 1ZGLB 2HG5A 5ID1A 5D1QB 5GGRA 3RX5A 3B9KC 2EEDA 4RGND 1LD9A 3WL9A 5IBUB 2KDGA 3INUL 5C92A 1SYVB 3D2UD 1HHIB 1NFDA 1JI2A 3D18B 1RZGB 4FOMA 1OQXA 1F13A 4PGDA 2XN9A 4Y5YB 3TBYB 3IDYB 5HVHC 1QA9A 3TO4B 4HS6A 5I1CL 3ZYZA 1BZ9A 2PO6B 1NGWB 4XMPH 3PHOB 5KSAD 5MENA 1KB5L 4HIIA 1ZT7A 2BVUA 1NLDH 3VXMD 1PVHA 1N2RB 1OW0C 1TFHA 3DVNA 2VIRA 1U58B 4YHMH 3SCMD 1SEQH 3DUSB 1NLBL 4Z76A 3H9SD 4D0BB 4CNIA 2WIIB 4ONFH 1W2KT 5TQ0H 1N26A 4UILL 1MCIA 1I3UA 1T4KB 1UKSA 3OF6D 1DQTA 1N8ZA 3U6RA 2GTWA 5I8CA 1TVHB 4LPTA 4W70A 5GHWH 2AXHA 1KTLB 3U79A 4NM8L 2VABA 4OZGF 4JO3H 5LGJA 4QOKA 1YMMA 1KBGL 2OK0L 4K9EH 3VXPB 4I48A 3MV11 3WFZA 2VDOL 4HGKC 1QBMH 2AKRA 4ODUB 5DHYA 3TVMB 3WKML 4A6YL 3DLQR 1ZGLP 5E1AA 4JFFB 4LOUD 5AAMA 4G7VL 4PJIE 4LQFL 4GAYA 5GS0L 2FYYB 4M4PA 1MJ7L 2ADFH 4XXCC 4FFWC 3UO1H 1UM4L 4LPWA 1NBZA 3VFTB 1T2QH 3TV3H 1RZJL 4LPVA 1HI6B 4F37K 1OAZH 2R4SL 1HXMA 4FQQB 3SO3C 3NPZB 4B7IA 4NNPL 3X11B 5A2JH 5JDSB 1L9NA 1HEZA 3DUUB 2XRAL 4YNYB 1MCOL 5J1AB 1YNTB 2JJSA 1EK3A 4I2XA 2O5YL 2HT4C 3KPMB 5TPWH 2PXYB 1J1PL 5EBMB 4ODVH 5CSZA 1AY1H 4KI1A 1M05B 4NUJB 4LSVL 5J1TC 4M8VA 1Y6MR 4JFZL 4K94L 1JHKH 4RISL 2ZUWA 3SE9H 4JZJC 1INDL 3O45B 2ZUSA 2Y7QA 1XFPA 2BVQB 5FO8A 3RKDD 5DK3A 1JGVL 3NA9H 4NC1C 1OGAA 4J2XA 2DS4A 3MRLB 1GAFH 2O5XH 1YJDL 4JQVC 1MLCA 1MIEL 1E6OL 3MLVH 2VC2H 3NCCB 5BS0A 3CX2A 2R8SH 3TBVA 4ODWB 1GZPA 5E2WH 3QRGH 3G5ZB 5CEZE 4ZO8A 5EU6B 2CJUL 5FHBH 3V52H 4PJ9C 3HS0B 3W0WE 2XQBL 3I6GB 4QHUA 3MRCA 5AWNL 1AO7B 2B4CC 1J8HB 1I9EA 2YA0A 1QNZH 4FXLA 1INEH 1CE1L 3T3ME 3WJJC 1NGXB 5I9QC 2F8OA 3VRJB 3FB8B 3O6ML 3IYLW 5E8OB 3QCUH 4ZFFA 3MLRH 3UPRB 12E8H 3VFOA 4YZFF 1T83A 3WHE0 1D3CA 1JGEB 2L4OA 3P0YL 5CKAA 1AHWB 3QUZB 1EXUA 3H8NA 3NAAH 4P3CH 3ARGC 1K4DA 2J2ZA 4I13B 4XMLH 5JOEA 4KRLB 4H25B 3LQMA 1W0VA 3QEHA 1Y18A 4MQSB 2Y07H 1FGNL 1QTYT 3S34H 3FOLA 3V4PH 1C1EL 5HJ3B 5DYOB 1IKFH 1NEZA 1NL0L 2OL3A 4J4PD 4XCCH 1QZ1A 3SDXE 4R7NB 1AH1A 3WIHA 1TQCB 1A4KA 5DURD 3RWJA 2PW2A 4OFYD 4ZD3L 3I6LE 4UDTA 3HR5B 2VQTA 3BPCB 3RTQC 4WJ5A 4XP1H 4K7PX 2A38A 4JVPA 5KOVC 1KYOJ 3L5HA 2FBJL 5F8QC 3HUJF 2F74B 4LARL 5J06A 5HPOA 4ODTL 1H3WM 3MRFA 5AYUL 3BP7B 2Q1EA 4HUWB 4OZHA 3SJVA 4NBZB 1H9VA 5HHVL 1VCAA 1ZLVH 5L7XH 5J0BA 4G5ZH 4U0RB 4KTDH 1UACL 5ECJE 1A4JA 1NMAL 1WBYA 5TJWK 2NY4D 2GHWB 4X6DF 1DFBL 2YBRB 1T20B 3BD4A 2A0LC 3QZWG 5DTFA 2EXYD 4M7LT 4MXQD 43C9B 3EFDH 2MTPA 1WIUA 3C2AL 3GRWH 2GEEA 2MWCA 1P7HL 3RZCC 3MLTA 3DVGB 2YR3A 1RK0A 5E2VL 1QHPA 3BN3B 3HFMH 4K3GA 4XC1H 1CD1B 4L1HA 1ZHBA 1LO0L 1U8MA 3O8XA 5E4IA 3RL2B 3QNXA 4LQ1A 3BW9A 2WAHA 5JXEA 4KVCH 2JJTC 3C5SA 3L5JA 1IM9A 3CLFL 1AP2B 4M7KL 1CDIA 3VI4F 5A43C 1A5FL 1VGKB 4NQED 5DO2C 1Q9OA 5INCA 1G7HB 4IDJH 4XHQA 2B2XL 3GSQA 4GKZA 3DRQB 4PJXF 5IHUH 3DARA 3S37L 4PLNC 1AXSA 4Z78B 4JVWA 5KBNC 2NXZD 2EO9A 4K71C 5GGTL 3KYMB 5BOZG 2AK4E 1KB9J 2ILLA 5IKCB 5HDOA 5GS0D 4H0IA 1IAKB 1VACA 1S7VB 1DBBL 3SDAD 4OQTA 4PJEB 3P4OA 3N1GC 5C0DB 3MV9A 1ZA6B 4XT1C 1RHFA 5HHME 1H5BB 1S5IL 5CIPH 3L9RB 4GW1A 5AG8A 1D9KB 3RUGB 2Y36L 3QJHA 4JDVA 3MV7A 3PL6B 1J12A 1NDMB 5CJ5A 2IFGA 2HJLB 5F70A 3O6FD 4GKSB 5E8NB 3SGKA 1FFNA 3VXTA 4BQCA 5JR1L 4Y16A 1NSNH 3P4NB 1SMAA 4PJDB 2DLTA 5BRZE 5C0IB 1CTOA 4NN5C 4YEFA 1JHLH 1MIML 1URLA 2XZCL 3B2UC 3F7VA 4HEPG 4PJ7E 1LE5A 5D7IF 2GJZA 3MV8D 1BAFH 5T3ZL 3KPOA 5EN2A 4WTWA 5BVJA 2NXYC 2R2EB 4OSUH 1PZUB 4Y1AE 2DL2A 2DDQH 4KFZC 1CR9L 1KIQA 2QSTA 2GJ6E 3V0WL 5SWSD 3UTTD 4QRRD 3MACL 3SDDC 4YDVA 4WW2B 4G8EB 3I02A 5JXAH 4X7SL 3ZDXE 3BMVA 1TENA 4DN3L 5ALCH 5M95B 1S9XB 5B38G 5F9DC 4OLVL 2OP4H 5EO1B 2FRGP 4PIRF 1FYTB 1V5JA 1I7RB 3HZKB 4QHNB 2C1OB 3TNMB 1NCBL 2J1KA 3VXRA 3BIKA 4F7CB 1I3VA 1BFVL 1JV5A 1WFUA 4TTGA 2IH1B 4H88H 1INQA 1MH5B 5I19H 1UM6H 3NFNB 1X6NA 3GSWB 1MFNA 4G9DA 2CIIA 4HUVB 3E8UH 4R2GC 3OJMB 3F62A 4ZAKB 5DJ2A 5EZOL 1ZAGA 2EZ0D 2R69L 4XB8A 1OM3H 2CXGA 3C08L 4FHBD 3ULVF 2ZCHL 4BSVA 3V5HB 3DTXA 4B41A 4IRSA 1MCPH 1T1XB 4GKNB 1PBYA 3N0PB 1NGPH 3W2DL 4QWWD 2X05A 3CVHA 2NY2D 1I4FB 1P1ZA 43CAB 1AGFA 2VL4A 4YFDB 3OKNB 3JV6B 1I3GH 5EU4B 4TUKL 5H94A 3UTOA 4RX4A 3V0VB 1ZEAH 5EU7E 2NZ9C 5DHXB 3C60B 2Z9TA 4CDGC 2ARJA 3VD9A 4G9FB 2PYFA 1DVFC 5I8OL 3LRSA 1TETH 3L95B 5DZLA 3CFEB 1TQBB 1A6UL 3ORJA 5ICZB 1YEJL 2Q6WA 4U2ZA 2ZUYA 3FFCE 2BHYA 5IG7A 1L0YA 3OR7B 1FZJB 3FO9A 1MHHB 4CW1A 1A7PH 1P7KB 2BRRH 1DANT 1J8KA 3PGFL 5C0CA 4WFHE 2NY1C 3MYJB 2W0FB 3SE8H 4LK4A 1FNAA 3SKNB 5F3BB 3S9DB 4JR9H 1UA6L 1II4E 3IU4L 4LLQB 3T09A 2ZG2A 4JKKA 1JPST 1X7QB 3ULVH 2RCSH 3BGAA 1IKNC 2VNCA 2YUZA 1NQBA 2B0SL 3QDME 1AIFA 2ICWJ 4HJ0C 4S2SA 4MMZC 3DETD 2EDRA 2NW2B 4TVSa 2J8UA 1RU9H 3QPQD 2ENSA 3QSKB 5I30L 3SBWA 5LQBH 5F7MC 1JK8B 4F9PC 4XWGH 3EBAA 4DKFL 4ZFZB 2VR5A 4U7MA 4PLJD 1M1SA 1RI8A 3B43A 3QCVL 3G6JA 4Q9BA 3KYKH 2F5AH 5DT1H 4PPTA 5CMAB 1CWVA 1MQKL 2VDPL 1BVKB 2P8LB 4JRXE 1PEZA 5T1LB 3KPSB 3GSNB 1EFQA 5K9QG 4P2QD 5LXGH 4FFZH 4W4OC 4CN1A 3F8UB 5E6ZA 3D3VA 5EU3B 1XH3A 3MNZA 4FQXC 1XGUA 4D3CH 3WS6A 5KOMC 5CBAA 4NRZA 3KYNB 5IUSA 2AXGB 5L8LB 2W9EL 3HRZB 2AEPL 4G8GA 1IGCH 1TTGA 2DI8A 2F5BH 2FX9H 5DHVH 1S3KH 3TFKC 4CVZA 3QIBA 4WEMB 1CFQA 2DQCH 5TGBB 4HMEA 1NPUA 1ZVHA 3WXVL 1I7ZB 5T1KB 3OB0H 5EO0B 2CKNA 4XNUL 3UAJD 3PWPB 2EECA 4YC2C 5LWYL 2FL5B 3AXLB 5JA8B 2QKIB 3DGGA 4XP9L 2NR6C 4NZRH 3D69A 3PE9A 1F4XH 3EOYG 4DKEL 4L8DA 3HG1E 5CKGA 4JFYA 4HWBH 1VEOA 3QHTC 4QCIA 4YDLB 4PRIA 5GRJH 4WUKH 1U8QB 1U95B 3GO1L 4BH8A 1MI5A 4QYOA 1UWGL 3BO8B 1UVQA 5F9WB 5ICYA 1VESA 2NY3C 1E6JL 2R1YB 3FAXA 3QZWA 5HGAB 2J88L 5TDNA 5IB3A 2P5ED 2OI9C 1HYRC 4JEGB 1I7TB 2YRLA 2HWZH 2XWJB 2F19H 5EPMB 3LKRB 5C07A 2J6EH 4FXKB 3BH8B 1CQYA 4ELME 3RDTD 1PW3A 2W60B 3GMQB 2R39A 5B4MC 1YEFH 3OXRA 4N0YH 1Q38A 1KN4L 3MQIA 1WV7T 4JHAH 3EYUL 1DJSA 5JIKA 3CFDB 3MRMA 2R1XA 1U3HA 4L9LA 2OZ4A 4YFLI 1XGPA 3OKEB 4J1UB 4ZXBA 1ORSA 5HYEA 5D6CA 5T3ZD 3GSOA 5E4EB 4ZMAT 1P6AB 3ULUC 4YPGA 3ARPA 4LVNB 5T5FL 4P46B 4HGWA 1SQ2N 2Q20A 1WCBB 4XRCA 2ERJB 2OMBA 1BJ1J 3AU1A 1A02N 1FPTH 5IF0B 1BLNB 1DLHB 1QRND 1FSKC 4L3ED 4J3SA 1KGCD 4FQ1H 2LABA 2FATL 2R2BA 3CVIL 5LCVH 2ZUTA 2VRAA 4OV6F 1AR2A 4JHWL 3EYVB 4DN4L 4HG4J 5KVGL 1P4LB 4GMSH 2GYSA 1AI1L 1L9MA 1TZIB 1IILE 4P2OC 4R4ND 1NAMH 3EIFA 4U3CA 3QXAB 3FB6B 2V7HA 4L3CA 4OLUH 4F33A 4R96B 3OX8A 1ONQB 4WEBL 5DD3L 5IBLC 3VXUB 5JMOC 5GZND 3WNKA 5CAYB 2DQIH 2MMXA 4HH9B 4WFGE 3IDXL 3WIHL 5ADPL 3BESR 4MQ7A 5E6IA 3NH7L 2WM0A 4OLYH 1FBIH 4YHKH 1R0AH 1I7UB 3ZMRA 3NCJH 5DJDB 3QDGD 1VFAB 2AJYL 3ARDB 1ND0A 3ELAT 4OCXL 1A1MB 4PREA 4B50A 1JNLH 4FZ8L 2GFBA 4YHZL 1JYNA 3FN0L 1IVLA 2APFA 4MAYC 3D18A 5FUZL 1T0MA 1WFNA 2BNUB 1XT5A 3T4YB 3U4BH 4PJFE 2EEAA 3I75A 1F3DJ 5EORH 5CCKL 1N5YL 1NBVH 4U31A 4X6EA 3C09C 2H2PD 4AL8H 3BZEA 2DTMH 3QIWB 5C2BH 3RVWD 2XN9D 4IMKA 3RL1A 3O2DH 1CL7I 1A7BA 1T7VA 3ET9F 3I85A 2QQNH 2ADGB 5D1ZA 5HGHA 5B38A 3RVUC 5D2NC 1I8LA 3DIFB 1RULH 1NC2A 4NO0A 4CRPA 3B2VH 4Z7WE 4LLMB 4I3SH 1IT9L 1A6VL 3QDAA 3RIFK 2VLRE 4BZ2L 3I2CH 3WIFA 3HCVB 4XPBH 1KTLA 1MAML 3GIZL 4GSDH 5JW3L 3S8WA 1PZ5B 3VI3E 1QACA 3W0WA 4ZODA 1ZWIA 4M7ZB 4QGTA 4XCNB 3LKPB 2WWKO 2IJ0C 3C2SA 1E4WL 3MFGB 1OD9A 3ES6B 4F7PA 3GMPB 5JOPD 1BQLL 5EZJA 4ESKA 3BZFB 4K3JL 4YDIH 3OBAA 3ZKND 1UEMA 4FABH 3U7YL 8FABB 5FYKH 1KENL 2MFNA 1DSFH 3IXTB 3BMWA 3N1FC 4R7DB 1XR8B 1YNKL 3HE6C 3SE4C 2W92A 3CCHA 1BQUA 3SKUD 3ULUE 4UTBH 4ZOBA 3RPIB 2E8ZA 2CRZA 1ZE3C 3HI6H 3VFTA 1DLFL 2YN3A 1UFUA 1ZV5A 2CUMA 3P77B 3KJ6H 4M7JL 4JPIB 3MPCA 3X14A 1T21A 1IEHA 4OQTL 1QEWA 2D7TL 2P49B 3PABA 3BPLB 3LKQA 1AC6A 2IGFL 4YGVB 3DUUA 3T77B 4TNWK 1U91A 3ZT5A 5I71C 5A16A 2VZTA 1YPZF 4GH7B 4YUEL 4BM7A 3SDXA 3CMOH 4LLDA 2W0LA 1UQSA 4LEOA 4K3HA 3OGCA 4IIQA 5F9JA 3IF1A 1JGLH 1KC5L 5JNYB 5MERA 5EC1B 3GI9H 5IVXF 1J10A 2MJWA 3T8XA 4L1DA 4P2RE 4LSSL 4O9HH 2X4TA 1E28A 3CK0L 4NQCB 1IJ9A 4XBGA 1QSFE 3K46A 3WXWL 1KLGA 5DD5L 1CF8L 2Z4QA 3U82B 4PJ5E 5HDBF 1OGAD 2VISB 3OHXA 1MRCL 3TT1L 2XPGB 1T89A 4MXVF 4KC3B 1UJ3C 3QHFL 1GSMA 1PY4A 1XF4B 1BZQK 4G8IA 5I1HL 2JCCF 5BS0D 5FGCB 3DURB 3BP4A 1Q72L 2W38A 4ALAH 2OSLA 5D9SB 1NAKL 5KZCD 4K23L 5CP3H 1QVOB 4MNHA 1QLEH 1J5OL 3L5XL 4RFEB 3HZVB 1DE4A 4DJMA 3DXAE 3KHQA 4MD0B 4DOHB 4PS4L 3MUGB 2Z92B 4GG8A 3NCMA 2OK0H 5D2NE 3VGAB 3RJDA 2VDOH 1HHJB 1I1YB 1QFPA 3OJDB 2YKLH 4ENEC 1Z6JT 1YEIH 1JWMB 4LSUL 1AGDA 4JM2F 4FG6C 4ZTOL 1EBAA 4H5SA 5JLZB 1V7NL 2P5WB 3CXDL 2VXQL 4G7VH 1N59B 5KS9B 1OSPH 4R3SA 1H8NA 1S9VB 5GS0H 1P7QD 2BNRE 1PG7W 4RFOL 4G43A 4GAJL 4OI8A 4CMMA 1JBJA 3DYOA 4P4RA 4A2LA 2AJZA 3CVHL 5JUEL 3WJJA 3FKUS 1UJTA 4LFHG 5I1AA 2G5BB 4HSQA 5A2IH 2AK4A 5MEOB 1KN2H 4RBPK 4P59L 1PYWA 1TITA 4DW2L 2EDNA 3H3PH 4HX1A 1J1PH 5HVFB 3IDIA 4D9LL 4NM4L 3RU8L 1U2CA 1YY8A 1SYSA 4S1SH 3IAGC 4WHCA 2BK8A 3LVEA 2IQ9L 5BXFB 4NRXB 4AEFA 3IDNA 4I3GA 2ZCKL 1DUYB 2NY0B 3BP7A 2Z31B 5HSFA 2WQ8A 1C8PA 3FMGL 3NGBC 2KKQA 2D2OA 1AD9B 5C08B 4Z0XB 3MLZL 1RIUL 1I1FB 4BQ9A 1UWEL 1A6PA 4PLKD 5GJSL 1GIGH 1NUNB 4QLRA 5C0ND 2Q7YA 3F58H 3RX7A 5BRZA 3SJVD 3KJ4C 1LO3L 1HILA 1MIEH 3CZFB 1A3LH 3NFSL 1L4IA 4X7TB 1LO4H 7FABL 2H1PL 4MLSA 4ISVA 3HC4H 1AFVL 2CJUH 2V6HA 1JUFB