4ZTPH

Fab structure of rabbit monoclonal antibody r53 targeting an epitope in hiv-1 gp120 c4 region
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
223
Chain Sequence
QSLEESGGGPVKPGGTLTLTCKASGIDFSSFYYMCWVRQAPGKGLEWIACIVTDITGESYYATWAKGRFAISKTSSTTVTLQMTSLTAADTATYFCARGDTYGYGDTVYALNLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAPST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain of Fab fragment of rabbit monoclonal antibody R5
publication title Structural analysis of a novel rabbit monoclonal antibody R53 targeting an epitope in HIV-1 gp120 C4 region critical for receptor and co-receptor binding.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 37
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ztpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ztpH01
5T1DH 1OAXL 5C0BD 4FXGB 2YMXL 4MAYD 1W72L 2VZ1A 2Q6WB 1MIML 4J6RL 3QPXH 1QBML 3T0EC 1A6WH 1QO3A 1JV5B 2XZCL 1X7QA 3VFMA 5MI0C 3TIEB 4JO3L 5LBSL 5IUSA 4XNUL 1UB6B 3QISA 4PV8A 4I48A 4JANB 4RA0C 3QIWC 1WZKA 4UV4L 4ZG1A 3WLBB 5IBTL 4PJXB 1S7QA 4Y19E 1UM6L 1EBAA 2PW2B 4LARH 2IANA 4FQ2H 2AEWA 1G7QB 1EEZB 5KSUA 4BSJA 3BEVB 2CDGA 3UJJH 3BMVA 4LSQL 3RWJB 2ITCB 4XWGL 3ZE2E 3MLWH 4LF3B 1MCJA 3T4AB 1AO7A 4U2YA 1NSNH 2DQTH 3U9PL 3S9DB 5LXGL 4XPBL 4EQ2A 5E1HB 1CQKA 1X6LA 1JNNH 3NZ8B 3SDAA 1G7MA 5D1ZD 4RX4D 3BGFB 3VFSB 3V5HA 3TH3T 1MQ8A 4HS6B 2MMXA 4DUWA 4FTVA 5GGTA 1NAKH 1AI1L 1U58A 2WLZA 3ARFB 1VFOA 3X14B 3CXHJ 4PY7A 4P2OA 4RFNC 1QR1A 4XP1L 1IC1A 3UROR 4FFZH 1V3KA 3D39A 3NVQA 3H9SD 3BWAA 3HG1B 5GRYA 4JRXE 3NH7L 1TVHB 4LP4A 2AJYH 2COQA 1BD2B 4NQDD 3SJVB 2QBWA 1A7OH 4URTB 4LRNL 3ZYOA 3FQNA 1MFEH 3QFJE 5DRXB 3TBYB 3TT1H 5H37G 3ARED 2J7LA 4XMKH 1JGEB 2OZ4H 1ZA6A 4Y2DD 4PREB 1D5MB 4MJIA 1JYWA 2H2PD 4PJXE 1I7TA 5DJXB 2AGJL 4C58B 1N64L 1EV2E 3B5HA 3MMEB 3LQAC 5EUOA 2VITB 2X4PA 4NO2B 4P2QB 5CP7B 3BW9B 1OSPH 2FJFB 5IBLC 5LAXB 1XF5A 3VWKA 3VXSB 5EUKA 5EZIH 5JIPA 3EOTL 3DBXA 1XGQB 2WBWB 3UPRA 3RL1B 2HMIC 4V1DD 3U7AA 3C2AH 5FYLE 4NN6C 1FNHA 3OJDB 5LKNA 2IFGA 1Z6JT 2JJWA 1NCNA 5F1NA 1G9MH 1Q1JH 4PGCB 3QXWA 1AGEB 3L7FB 2EDBA 3ARXA 1FNSL 5EOQH 4D9QE 3MJ9A 3HE6D 3HPLA 4JVPA 1NJ9A 2WV3A 1MJJB 2VZUA 2C3VB 4HWZA 3WMSA 3ZDXF 4R96B 3CZFA 2D7TL 3RX8A 1CE1H 1ZLUK 3OPZL 2XWJB 4ZUSB 5C08A 3QWOB 4K8RD 1ADQH 3JUZA 4JPKL 1T1YB 2C4FU 2WWKO 2A2QT 1DQJB 3C5ZD 1DDHA 2XRAL 3SDXF 2ESVB 4TRPL 1FLTX 3D3VA 5CGTA 4PGJA 1PKQA 1V8HA 4NIKB 4NQUA 5D7JC 2QQLH 3LQAH 3SJVE 1GIGL 4LSDA 3FT4A 5E00A 4LKCA 3C09B 1JPTH 2RCSH 1LEGA 1A6UL 3B9EA 2ZOKA 3ES6A 3QQNA 2XQBH 4PJHE 3WIIL 1F90H 2XYCA 3DX6A 1DQMH 5MEPB 4WCYH 5KVDH 3EBAA 1SHMA 3M1BA 3BKYL 4HC1H 2F53D 5C3TA 1FL5B 4P2QE 4K2UL 5FA4B 3MRBA 1C08A 4KAQL 3STLB 3QUZC 5FYKL 4ESKA 3VXSE 2GTWA 4ELKB 4M1GL 1NFDA 2YD8A 3EJYC 3IU4H 4WW1A 4XAKD 3HE7A 1ONQA 5F6IB 4KTDL 1TJGH 2YSSB 3AROA 5C0CE 2B5IC 2DI7A 3BP7B 3B2UD 2H9GB 3BEWA 4NKOB 3OKYA 1MCFA 2HAZA 4IRSD 3SHSA 5E6IA 5FCSH 3FOLB 4YWGH 3LMJL 1U6AL 4GAYA 4BQ9A 4HHAB 3DMMC 3H0TB 1H8SA 3BVNB 3QQ4B 5IBUB 1V7ML 5C0AA 5IIEB 1A3QA 1BVLA 2Y5TA 5F88B 4WFGD 3ZTJG 4LLWA 4NUGH 5E9DB 1CFSA 2NQCA 1GXEA 3SKJL 3KPPB 2VE6A 4ZXBC 4FFVD 4R7NA 4LHQB 3SO3B 5DJZA 1P5VA 2ESVE 4TTDC 5DS8B 2BCKB 1T7VA 1YJDH 3RIAK 4AK1A 3TA3C 4M93C 5JW4M 3BH8B 4OCSL 3RWEB 1HIMH 1CDIA 3NAAL 1S9YB 1RZ8B 1QSZA 1VFBB 1BBDH 2ED7A 3O3DA 2AK1L 4WUUD 2ZUSA 3IXAB 1G7JA 4JFEB 5DD5L 1YY8B 2Q7YA 5HGAA 5KTEL 1MHEA 3QIUC 4K3HA 5DRZB 4LLYA 1MFAH 4OBRA 3TV3L 5ENWA 5I15H 3L95B 4P57B 3MQIA 1OARH 4Z7VF 2Q8BL 5JQ6H 5DFVC 1PG7L 3ROOA 2ZG2A 5T1LD 5K59E 4JB9H 3LN9A 3UJIL 4G9DB 1IL1B 4NM4L 2YHGA 2YC1B 15C8L 4EI5B 2NY2C 1XIWA 4X5WB 3VDBA 2W9EH 5BJTA 1QSEA 2OTWB 3R1GH 4NWUH 4W81A 5K9OB 4OLWL 1X5ZA 4D94A 5HY9A 1AIFA 3HR5A 2X7LA 1KCVL 1OP3K 3U4EB 5IVNA 3AXLA 5T33L 5IVXA 4LCYB 2DM4A 1YNLL 5L9DL 2Q86A 1KNOA 4JDZB 1DQDL 2DM7A 5C0RH 5CEZE 5FUZL 4ONGL 2I07B 3NCJL 5I0DA 3ZKMC 1A1OB 5J12B 1YEDA 4EVNB 3RZWA 2C1OB 1CDHA 5E9DE 3MLVH 1HXMA 4OGXH 4NNXB 1F00I 1UZ6E 2PTVA 1CG9A 2EYRB 2CXKA 5CJOH 3BSZH 3JTTA 1XF4B 4M1CC 5CBEA 4GXUN 5FO8A 5TDOA 5B38B 2XTJB 5IEHA 1I7UA 3OWEA 3O3AA 3AAZB 4N5ED 3ZDZF 3S37X 1KPUB 2H8PB 4OAWA 4S1RH 2J4WL 2DS4A 3KPTA 3SKMB 3VDCA 3QH3A 4JFEE 1JGDB 4JN2B 5BZWB 5CMAB 4HIIA 1ND0B 4YFLF 3FQRB 3SDAC 1EFXB 4OGZA 4FQHB 1C1EL 1JPGA 1I3GL 2DJSA 4WFFE 2E6PA 3HKFA 3GMNA 4WI9A 3MOQA 2QHRH 3LAFA 3MGAA 4MJ5A 1ZWIA 2UZXB 4G43A 2DQGH 1BQSA 3OR7B 1NLBL 4LHUB 3MRRB 5HDOA 4K7FB 4FQCH 1CYGA 2CLVA 3FZUD 1WBYA 3M8OL 1FFOA 2RBLA 4TUKH 4YHOL 1AQKL 4MQ7B 1H3PL 3EUUA 5D96C 1SBSH 1LO4H 1I9RL 2AI0H 3BJ91 3JZ7A 4ONFL 3X3GH 4K8RL 4GO6B 5J11B 3VFRB 5HD8D 3I3BA 4A6YB 4ZSOE 1T5WB 1UXWB 1K3IA 1K4DB 2PXYD 3ISWA 3STZA 3G6JA 1XCTB 3WXVH 3OZ9H 4QEGA 4FABL 1KJVA 4OJFH 2VZTA 4OZFH 1MHHB 3GZKA 3BESR 2ARJB 3EGSB 1KJ2B 4GG8B 1MRCH 1FDLH 1N8ZB 1KJ3H 4D9LH 2AK4B 4RFOH 3WLWC 4LCUB 5F9DC 5HVHC 2NY3C 4XXCC 2CKBL 3VWKC 2XTJE 2FYYB 1GGTA 4UBDC 2KL6A 5EU6D 4HJ0C 4NJAL 2LVEA 2Z9TA 3L5IA 4Y4KC 2JB6B 2Z31B 4J3XA 1U8JB 3P2TA 2OXHA 1OTUC 3C6LC 4UI2A 4GXVH 2P8MA 2YXFA 3WDIA 2DD8L 4GQ9H 4JGMA 5HHXH 3V79C 4NRYB 3RWDA 5ITBH 3G5XA 3GMMB 1K8IA 3GSUA 2XWBB 4KRPC 2W60A 1GGCH 3PDOB 4RDQG 4RFEB 5JIHA 1TETL 4LGPB 3QBTB 4LASL 5HHOA 1NANI 1K8DA 3K3QA 5E94B 4WNQA 3SDXB 3BH9B 1MPAL 4ZTPH 2R2BB 3NOIA 4KRNA 4R97C 4YR6A 1SYSA 4N0YL 3CFDB 5CWSB 1R3HB 2I9LB 1OCWH 3O8XD 2JIXA 4YBQD 1F02I 5KAQG 3UZVB 1C5BL 1KXTB 5GZOC 3MC0A 3VJ6B 4LVNC 4DEPC 3MCLL 1IM9B 1KIQB 3BZFB 4DGIL 1WFTA 4JGUA 3EOYG 4PRBB 5E4EC 4XH2B 5D7LB 3E6HA 2BSTA 2EECA 1J1XL 3MRGA 3N06B 5CHNB 1QACA 4P46B 3BYYA 5F44A 3VD4A 3AY4A 3SOBL 4YHLL 2IAMA 3OAUL 5L6YL 3RZCA 1L9NA 2DL9A 3S96B 2YD9A 1YY9C 4WI4A 4Z7OF 1J0YA 3QUMA 5ADOL 1IKNA 1RJZB 3QEHB 1GOGA 3EFFB 1NMAL 2AK4E 4HMDA 2ENSA 2Z93A 1OAZL 3DV6A 4OLEA 1EO8L 3HC3H 3HPJA 4XP6H 4ODSH 3E8UL 1NCTA 4S1DD 4WRLA 4P4KD 5FA3A 1FV1A 3LDBC 5FDWA 1QFWH 3HE7C 4JFDA 2YRLA 1S9XA 3NTCL 4PG9A 1ZS8A 3ZDXE 4E41A 4H8WL 3MXVL 1IARB 5ALBL 1B6DA 2VDRH 1X5LA 3ARPA 1K4CA 1I8KA 2ZPKH 1JHKL 3DNKA 2BMKB 4IRJD 5FGBC 2I27N 4KMTH 1IBGH 5E6IC 4AIOA 5KW9L 3UJTH 1SJEA 1N7MH 2L7UA 5AZ2H 1BZ9A 2R2EB 1FZMB 3HTLX 5F1IA 4NQSB 1WTLA 4LIQE 1E28B 5GGRB 4JQIL 2K1MA 2VLLA 3Q5YA 5GRVK 4BQ8A 4Q97A 4FQIH 3WLBA 1HI6A 5HYSA 1A3LH 1JJUA 3E0GA 3VH8A 1ZLSL 2GHWB 5CJBA 1F6FB 3RUGF 5D1XD 5HGDB 3RJQB 1WWAX 1EEZA 5C6TH 4L4VB 1CVSC 5D7LE 4X4XB 4YDLC 3SDDC 3RTQD 1JNHB 3RWJA 3H3KA 3FQUB 4Z7VB 1AC0A 4F3FA 1WFOA 5CD5D 1BOGB 5EBMA 2W0PA 2WQ8A 4PRIA 4MDJA 4IS6B 4KUZH 4YGVB 3T2OA 3HR6A 5B4MD 1GOFA 3BKJH 3OKNA 4NP4H 1PG7W 2QSCL 3QULA 3QJHB 3VFSA 5HGBB 2JELH 4N1EA 4X99A 5LQBH 1NCUA 25C8H 3HC4L 2P24A 4O4YH 1XIWC 2XZAH 2HT3D 3F7RA 1MHPH 3X14A 4NQEB 3V4PL 3C60B 2FO4A 4FZ8H 1LD9A 4APQA 2BNRB 4Y4HA 1YN7B 3CK0H 3Q5OA 1NGXA 3X11B 1BD2A 2YD5A 5E5MB 5IF0B 5FKAA 4PJFA 3L5WA 3RIFK 5E70A 1ZHBB 4WVRA 2VUYA 4XC1L 3SE8L 5GHWL 1B4RA 5IFJB 4ONHA 3QIBD 3VFNB 1UCTA 3S37H 4ZUWB 3MPCA 3GJFB 3MUZ1 2X4SB 3DVNB 3QUKB 3TVMB 4KJQD 3OKKA 5L2KD 1ZLUH 2VL5A 4XCYB 3N50A 4JFYB 4J1UB 3TBVA 3T2NH 4LCCC 3L1OH 2G9HB 4QRQA 3SO5A 4XBPB 1W0YT 1HWHB 1F3DJ 2ATPA 5HDBF 5ANMB 5I6XB 2BVQA 2X41A 4E42B 1KCSL 5BQ7B 1WWCA 2BSSA 5GS1B 4Z7VE 4XVJH 4HPOH 3KPQA 5JW5B 3K7UA 4ZPTB 4OF3A 3AUVA 4KK6C 5GRJH 5C0JB 1EHNA 2EYTA 3SGEI 3OJDA 4ODVL 3C5SA 5KZCD 1NMBL 3TYFB 5FECA 5EBLB 5JPMA 4KK8D 4S11A 4G3YH 5I1GH 2BY1A 4X6BA 2DLHA 3UZEA 2Y36H 2RQ8A 1AGDB 4D0DB 1W72B 5JXEC 4CVZB 4P5KA 1HH9B 1H9VA 5IR1B 1U93B 2B39A 5JLZA 5HJ3A 4G8GD 4HH9B 5E2TL 2VISA 1UG9A 4M00A 1A21A 4NQEE 4JHAH 2DYPD 4M6OL 2EKSB 5I66B 1YECL 3TZVA 4ZUTB 3KPSB 4YBLB 3PJSA 1OAQH 4YK4B 2BJMH 2BXYA 4PFEA 1NCDL 5F7LB 2XY1A 3QUXA 4OBSA 3BJLA 3KYKH 5E2UH 4YHIB 3LB6D 4CL7A 4NO0D 2IMMA 4LPXA 4PR5B 3SQOL 4GLRI 3SGKC 1A9BB 4OF0A 3ZDZE 5E99H 4KROC 2B0SH 1J0JA 1FL5A 1T20A 3JV4B 3MLXH 1QRNA 3H7BB 1V5JA 3EYSH 5ANME 4RISL 4WV1B 4A2LA 2ZZUT 1CLZH 3FRUB 4JREB 5JW4Q 3WEXB 4GW1A 3D85B 4M6NL 4OZGF 4F7TA 4NDMA 1MNUH 2EC9T 4I3RH 3GMLA 3QDGD 5AEAA 4U1KB 1PX4A 3ARRA 3G5ZA 3ROLB 3KLSA 4N1HB 1NGPH 1J8HE 3U0WH 5C7XH 4HWUA 5BW7A 1T2QH 2VLJB 1KLGB 1T04A 4UT7L 5C09A 3ZSTA 4QF1A 4F8TA 5D70H 4HWBA 3O9WC 4ELMA 1IILE 4OM0L 5EC2B 3KLAA 5F88A 3P0GB 5HPMB 4NHCH 3RDTD 4F7PB 4GRLC 4K9EL 4NUJA 1TZGH 1UACL 4TVPD 2VDLL 4ZUUA 4KTEL 3WD5L 1UZ8B 2MJWA 3KPSE 3GHBL 1RULL 3U7WL 3TWCH 1CWVA 3W0WD 4F8QA 1GGBH 5JOPE 5MEQB 3ULUD 4U05A 3EW3B 1OGTB 2A9MH 3G08B 1NGQH 3MGOB 3OB8A 1S9YA 1YPZA 4AENA 1RZ8A 3ULSA 3OHXB 4KK5D 2P45B 3NPZB 5E8PB 5HHQB 1KSRA 1DN2A 2IAMC 2E7MA 3RZCC 1DVFC 3Q1SL 4WU5A 3TF7C 1IKNC 3VFPA 2Z8RA 2VUOA 1WQVT 4PGZA 3IDIB 4XMPL 2DIAA 5C0ND 4H5SA 2LQRA 5INDA 3QFDB 3WXWH 1NC4D 5E03A 3QNYA 1RZIB 5D6CA 5DK3A 1ACZA 1FO0L 4GMTL 3ZKNC 3SKOA 1KOAA 1Q0XL 1NAMA 3B5GA 3C8KB 3PV7A 4XBGB 1P2CA 4OQ1A 2ID5A 4Y88A 4JZNA 4OV6F 4LLMB 5FM4A 1F8TL 1FYHB 4L4TD 5CINL 4OV5A 2W9LA 2VDPL 2JKXA 2VLJE 2VYRE 3V2AR 2QQKH 4JDZA 1WCBB 4U1NA 5HYJD 5IFAL 1PYWA 4EUPH 1D5IH 1RV6X 1RZ7H 3RUGB 3TBSA 4CUCA 3DGGA 2ICEA 4ZS7L 4DKEH 3MNZB 3EHBD 2EDXA 3L3IB 2Z35A 5DLML 4YFDB 2X9WA 3BIBX 4UU9B 2R8SL 4XNMB 2GQHA 1FCGA 4IMKA 1KB5A 3LEYL 4JG0H 3E6FB 5HYSG 4M7KL 3VH8G 3LSOA 1U42A 1SEQH 2W0LA 5DT1L 2AEPH 3K0WA 3O11B 1CZ8L 4EBQL 1HK6A 4Z7OE 3ZSSA 5JORB 4L29B 2MHAB 3UX9B 5EIVA 5TF0A 3SGEH 4QRSA 3WUWA 1JWMA 3V5DA 1RFDH 1CTNA 1YEFL 5CJ5A 5FF6A 3L3OB 3I9GH 5D1QD 5GGVL 3TNMB 5HI4D 2H32B 4D0CA 1PBYA 5IB1A 1EFXA 2HLAA 2MQ3A 2P48B 3UBXA 4LSUH 3GHEL 3MODH 3BGFC 2CJUL 5F9OH 1IC5L 4HZLB 4YDIL 4MVBD 3MLUL 2E9IA 2HG5A 2O5XL 4UAOB 2ZSVA 4HUVB 3B9VA 1U8OA 3OB0K 4F15B 4FQJL 4HUWA 5C0BB 4YE4H 4U1SB 1E6OL 4QY8B 1P84K 4Y4HC 2YA2A 3QDJE 4PGEB 3BT2L 4PJBA 2A6KA 3O3BA 5TFSL 4C56D 3B43A 4QXWA 1G9NC 2GTZB 4GBXD 1TVDA 5D5MA 5DJ8B 4I2XA 2XT1B 4EOWL 2OTPA 3OF6D 3RUGE 2V2TA 3BP4A 4X9IA 1I85A 5JW4R 3RY6C 4QXGL 1P4IL 43CAA 4GLRH 1QG3A 5FYLH 3MRCB 4LSRL 1MJ7H 1IAIM 1QA9B 2ARJA 1KLFA 4PJ8A 1JWUA 1N8ZA 5D93B 3Q6FB 4MAUL 1CFBA 4GW5A 3F7VB 1NCWH 3ALXA 3SE9H 4HLZH 3PDGA 1WZ1H 2K7QA 2P42B 2XIDA 4AEHH 4S10A 3V0WH 2AEQL 4O2CA 5BOZG 3NIGF 1EX0A 2AJSL 2JF1A 3JTSA 1RURL 2ZOLA 4LSVL 2V17L 4DN3H 2F5BL 1TPXC 5I8EB 1CR9L 5D1ZB 4U1LA 3PHQA 4WDIB 3JV5A 1FLRH 1FVDB 5HDQH 4YEEA 2DLGA 5KJRH 3L7EB 3HI6L 2D7PA 3RA7H 1F5WA 2EDDA 2N7BA 5ESVA 4MA8H 1AGFA 1MUJB 3T4YB 3BDBA 3WJLC 4NZDA 3VG0H 1HILB 5GS2D 4DQOL 4HMCA 1JZ8A 2VR4A 3H9SB 4HMEA 1F4XH 4OT1L 4XRCA 1U8HA 5ACLA 1AHWA 4WW2A 2YPLD 3BD5A 4QHMA 5H94B 3CXDL 4AT6A 5BMFL 1BX2B 4XH2A 3L9RA 1C7SA 4HAFA 4J3VA 4QT5B 1DBKL 5AYUH 4J8RB 2DI8A 3CU7A 1IQWL 3QUXC 4JRYD 5DEGB 2ZNXA 2V5TA 2PUQT 1NBYB 2NYYC 3D2UD 2HT2D 3O4LA 2Q87A 2CLZA 3TJHD 1SYVB 4JZOB 1ZLWK 4GKSB 2PYEA 4UDTA 5F7EH 4OZGB 1H8NA 3LN5B 2J2ZA 3S97C 3FMGH 2ZCKL 2HVJB 3I6GB 3GJFK 1DZBA 3WFCL 3CFCL 2VQTA 4X7SH 5D7IA 3V6ZA 1VGEL 5I18H 5F6IC 1VHPA 3L6FB 3K1DA 1HKLH 5FKPB 2OS7A 4MNQD 3BE1L 3DARA 3CVHA 1LK3L 3HE6B 1J9CT 1CFTB 5BW7C 1YDPA 4PD4J 4JFXB 5FDYA 1NC2B 1AGCA 4ISVA 2H2SD 3PV6A 4NFCA 5KG9A 4NBYB 5DC4B 3WHXB 1FC1A 4MHHG 4Z7NF 1URLA 3OAYH 3LZFL 4X5LA 4LPCA 4HV8B 4KQ3H 3RVWC 3C5ZB 3CLFH 3ARBD 3GMOA 4Z8FH 5IHZA 4O02L 5FUOL 5DVOA 5HXMA 3KLHC 1QSFD 1MCPL 1XZ0A 3SGJA 1IAIL 4M1DL 4NJ9L 4XTRC 1B0WA 3PWPB 1PX3A 4DTGH 5CS7A 2LTQC 2A83B 3MRIA 3C6SB 4ZOAA 3P4OB 4R3SA 5HGGS 5C70A 2HFEB 2DQCL 1M7XA 2I24N 1DL7L 2X9XA 4OZFA 4F37K 1EVTC 2F53B 3LEXB 5GXBB 4IS6A 3W2DH 4DZ8B 1DQQB 1P4BL 1PQZA 2AJXH 2CPCA 1MCOL 4OZGE 1MOEA 5F9AC 5FYJD 5SX4I 3IDUA 1S7VA 3IDNA 1LILA 4KUCD 4DGVH 1ZANL 4OCXH 5A3IC 4EI5C 1OM3L 4M43H 4RAUB 3V4VH 1N6QH 1CICD 3MO1A 4UT6L 1CLYH 1FAIL 2AV7A 1TCMA 2HKHL 2PYFB 2WWMD 3ZHLA 5C3LD 2VXTH 4IRSB 1SQ2N 2Z8VC 5E5MA 3B2VH 2F19L 3OX8A 3VFGL 4U6XB 4L8SA 5T3XD 3PWUB 5D72H 3BQUA 1JMXA 4G9FD 3QEQA 4MXQD 1P4LA 3QXDA 2R56L 1RQ5A 1ZHLB 5IFJA 4XPTH 4WENB 3ILPB 3QO1B 2GKIA 5J12C 2A6JB 4FQQA 4OZHE 1R3IH 2EYSB 4JO4H 1FYTD 5L7XL 3KDMB 1SJXA 4DFHA 3Q2CA 3UPAA 2YKLH 1YEIL 3PWPE 4RMVA 4U6VL 1MI5A 3S35L 3N1GC 1RUPL 1F4HA 4WUUB 4PP2A 3DETC 5I0ZA 4ZTOL 3AGVA 1AXSA 1X5HA 2EXWD 5ILTH 4W4OC 3UTSA 2WIMA 3WUWG 4HKXA 4R0LB 1DCLA 2VDNH 4UILL 3BZ4B 2FATL 4QWWC 2LU7A 1EHLH 1TZHA 1DUYA 3SKNA 2FBJH 5T1LB 4WFHE 4L3CB 1Q9LB 3UBXG 2ILLA 1BLNA 1TTGA 1CIDA 1GC1C 4ZO7A 1MFCH 3GMPA 3T08A 1CD1B 1RK1B 3JVGC 1AKJD 1OTTC 2WUBL 3DX8B 1KFAL 2IG2H 5L8KB 1U8QA 4JAMB 2NNAB 1T1WB 3QEGL 1AQDA 1LGVA 2C7UA 2AABH 1OD9A 1G7IB 1HCFX 4K71C 4WO4D 4GRMA 2OTUB 2DQUH 1M71A 1JZ2A 2DBLH 5J11C 5J8OA 5CEXB 2R4SL 2PR4L 1YEEL 1T2XA 1FH5L 4NQCA 4F57H 5INCA 3MRNB 4ODWA 1BZ7A 4J3TA 1A9EB 1S8DB 4BH8A 2MCPL 1JZ7A 3FO1A 5GGSA 3FN0H 4PJ8C 1IGCH 5E2JA 1UWXH 5C07A 4X6DF 2VABB 3IDGA 3KPOA 5DA4A 1S7XA 2Y6SC 2RHEA 4Y1AA 1BGXL 2VC2H 2ZCHH 3AB0B 1LP9F 4H0HB 2V9TA 2DMKA 3DHJA 4WTWA 5ACZB 5IJVB 4HFUL 1PZUB 4FN0A 1XF1A 4BZ2L 1TJIL 3DRQB 2KH2B 3L3JA 3FB8A 4JGJA 4JDTH 1A1NB 5C2BH 1QBLH 6CGTA 4NYLB 5F7MC 3JSSA 1W8OA 4PUBH 3UTTB 5FIEA 1GAFL 4PIRF 1DBBH 4UQ3B 1TVBB 1A8JH 3X12B 1M7DB 1LE9B 2QSVA 3VWJA 4M7ZC 2CK0H 1A2YB 4LSSL 4Z77B 3ZE1F 3D6GA 4WW2C 1KJ2H 4Z5RA 2AJVL 1SY6L 1UYWH 4Z7UA 3VFVB 2HH0L 5EZOL 2PXYB 4OQTL 3GJEB 5DGRA 1IKFL 4ZUVB 1JTTA 4WUKL 2BSRA 2VXSH 1A22B 4BFIB 4FTVD 1T21B 4GRWE 5DK2A 2BY2A 4L5FH 4KVNL 1LMKA 4YFLI 4P46C 2QL1A 3AFLA 5E8PA 3S88L 2I9TA 2O61B 4PJ9A 1KENL 4FQXB 1X4XA 1T0MB 4P2OD 4KMLB 5DHYB 4NKMA 4ODHL 4PB0H 4GT7A 3D39D 2J8UE 5I1LB 1XT5A 3IXTA 3NIGE 1Y18A 1UEYA 5F3HA 3MJ7A 1T0NA 1U2HA 3IDIA 1ED3B 5I16A 1JNLL 3NIFF 1S7SB 5DEFB 1AD9B 5SV4A 1XGPA 3JV0A 3T2QA 2FIKA 3PP4L 3ULVE 5SWZD 4CAGA 3CDCA 5GQBA 1EAJA 4JO1H 1L7IH 1PW3A 3MR9B 4LCWD 4LIQH 3C8KA 4K3DL 5ADPH 1QUNA 4N5UA 4XP9H 4MJID 1P7KB 3BPLB 4IIQB 1I9IH 3C8HA 2KKQA 2NY7L 1QVOB 4LLMA 1DN0B 1NCAH 3L3GB 3U9UA 2ADFL 4R26L 3BAEL 4X80L 1F4YH 3FB6B 3VE0A 4PJEF 3WLWD 3FT2A 3QQ3B 4MS8D 4AH2B 3UTTE 3U7YH 1UM5H 3GSWB 1RZFL 3CVIH 1S7WA 4JR9H 2W9DH 4XB7A 3O2DL 3MV9D 4XBEH 1NL0H 1QZ1A 3O8XB 5IG7A 1EXUA 4OIIL 3OB0H 1D6VL 3HNTL 3EZJB 1U92A 3PL6A 4QO1A 5JDJA 3EKCA 5I8OL 1FGNL 1G6RL 5F21B 3MOAH 4DJMA 3GSRB 5F89B 3SGJC 4IRZL 3MLPA 4HCRA 2UYLB 4H1LB 2APVA 1DFBL 4HF5L 3R06B 3CX5J 4P4RB 2A0LD 3VXMA 1S9WB 4HEME 3S34H 1CL7H 1NGYB 4L29A 1I75A 4X98B 2MHAA 4ZFOA 3BIAX 3QXVA 3HZYB 1P6AB 4YJZL 4K7PX 4ZQKB 4FP8L 3T1FB 2GFBA 1HN1A 3N9GL 1A7NL 4MDIA 1IEHA 1MHCA 3RAJL 3D3VD 5IHUH 3GK8H 1JN6B 2D7QA 4P4KB 4BQ6A 1QNZH 2XKUA 3ILQC 1MRFL 1EO7A 5D2LA 1W0VB 3VW3L 4G7YH 3TPKA 5IGXH 4JY6B 3T0AA 1MCWM 3INUL 3EOBB 4MAYA 4NZUH 3PE9A 4ZFFA 2R23B 4IRJB 4PGEA 2XWTB 5CIPA 1MELA 1J5OL 5HHPA 3DX7A 4L8SC 1IVLA 1KTRL 2IH3B 5E7FA 4F33A 4JFZH 3BQUC 5HI5C 5DMGD 4ZAKD 3RVVC 5IVOA 4OCYH 4WEBH 3TPUA 4HKBB 1R5IA 2HYMA 3QHZH 4NNYB 3V6OC 3DO7B 1MH5B 3FO2A 3FFCB 1WFNA 3LQMA 4U0RC 4HKZA 1I9JH 3TVMC 1UWGL 3BPNB 2AXGA 1MIEH 1F11B 3D0LB 1C5CL 4HIXL 5IW6B 5BXFA 5KSAD 3HAEA 1T83A 2VDOL 3EZ8A 1IGTA 1U91B 3P30L 3DX9B 1JPSH 1CU4H 4LEOB 5I6XC 5IVZB 3PGCA 4HS8L 4GXUM 3LV3A 4YXHH 1C16B 2OJEA 3EYUL 5LCVH 5GS1C 4O2EA 3IU3A 4PJ5D 3EYQC 4KKAD 3MRKB 1QFWM 3X3FH 3AU1B 3MA9L 2RIKA 5I8EA 2X4QB 4POZC 5D1ZA 4WTXA 4RX4A 1PFCA 2DQDH 2VN7A 3TFKD 1YQVL 4U7MA 1U8LB 3DXAD 4IMLB 1ZLWH 1X44A 3VGDA 5F7DA 1RIUH 1OTSD 4W4NA 4NHUA 3RNQB 1QFPA 3MV8E 3BPOC 3DIFB 3T4YA 2IPUK 4M7JH 4NO3B 3GJFH 3DVFA 2KQMA 3QZWB 2IQ9H 1U8KB 4FFYL 5CKGA 5DJ0B 4NQDA 2FJGB 4JVUA 1GZPB 4KQ4L 5CGYC 2UZIL 3MRFA 5I30H 4TULH 4YBLC 1OF2A 3JV6B 3QXAB 4YK4C 1B4JH 4LLDA 4MD4A 1G1YA 1ZT4A 3IDXL 3QIBB 3AREA 3BPCB 3QQ9D 4Y2DA 4FQ1H 4ORGB 4PTUA 4HIJB 1KCRH 4X6DB 3FFCE 4ZFGH 2R0WH 5L2KB 4U1HA 1MCIA 1HXYA 4YHZL 1QSED 1QKZH 4DKFH 4OCMC 3T09A 1MF2H 4KJWC 3RBGA 1UCBL 1LP9B 5GJTH 1IE5A 1YEJL 4HJGB 5GGTL 3T3PF 2FECI 4KVCL 5EO9A 3LEVL 5DZOA 4W68A 3O4OB 2EDRA 3ZE0F 1PD6A 3BGMA 1KF9B 1OAXH 3QRGL 4WV1C 2ZUYA 4V1DA 3P4MA 5ERWB 2YMXH 2Q76A 4JKKA 1W72H 4JREC 2A6IA 1T1XA 5MHSE 1MIMH 4J6RH 5F7WC 2Z4QA 5KZCB 1LNUB 1QBMH 1MFBL 4PRDA 3L6FA 4QNPF 2XZCH 4L8DB 1OB1A 2HJLB 2P5EE 4JKLA 4JO3H 5LBSH 5HSFA 4QOKD 2BHUA 2WSKA 4XNUH 5DJDB 3U36A 4JRXA 5FOBB 4UV4H 5F71A 5C0DB 4IDJL 2XG4A 5K9JL 4G6FD 4Z0XB 5IBTH 3WFEL 4G8GB 1UM6H 3WKML 4MXWL 1QQDB 3QFJA 4TNVF 1DBJL 3EYOA 3FT3A 4AMKL 1HZHL 5IMLA 3C5ZA 4FNLL 4QRPB 2OMBA 1H15B 3RL2B 4E0RB 3MV01 4LSQH 1FCCA 4XWGH 3RBSA 4X4MA 3IF1A 3TGXA 3NABL 3U9PH 4XWOD 5LXGH 4XPBH 1T7ZA 3MZTA 2AS5M 1YMMB 1JWSB 3SBWA 5E2WL 1JFQL 4M4RA 1V7NL 2APXA 1BIIA 4HIHA 3MRPB 4X6DE 5DJCB 5L2KE 3Q3GA 3MJ9L 2E7HA 4U49A 4P5TD 1FFRA 4PJ9C 1KT2B 3P73B 4MLIA 4XVUC 1MCEA 2F53A 4JQXC 3W11C 5ESQA 1FG2A 1AI1H 2E5EA 4X6FA 4XP1H 4LAJH 1RHHA 4PBWD 2GT9A 3NH7H 3QG6B 1I3RB 3THML 3QDGB 1ZVSA 2X4TA 3BP6B 2Z92B 4R8WL 5IW3A 4PJEB 3BHBA 3F12A 2L4OA 4LRNH 1BBJA 1P9MA 2VAJA 1K5NB 2DMBA 2ORBL 2WINA 4O51B 3KYMA 5B8CB 5DHXB 1NH6A 1U8PA 3PWVA 4Q2ZB 1B2WL 3RWGB 3UYPA 3ZE1E 1CF8H 1EH9A 2DWDA 2AGJH 4G8GE 2H6PB 4A2MA 1N64H 2BY3A 2MPAL 3LKPB 2O5YL 3RDTB 3QUYB 4PJHA 4JJ5A 1MAML 3DSNA 4QRPE 4MMZC 3PL6C 5JIKA 4I9WE 3EOTH 1ZA3A 3W0WB 1BVKB 3WHE1 4M6ML 3U0TB 1DLHA 4KI5C 5KVMC 4DVRL 1UKSA 1YMME 2A1WL 1RIVL 4R4NC 3VXTB 5GS0D 1IAKA 4J3UA 5HHOD 4UTBL 4WUUA 1MY5A 4NN5B 1I1YA 4O00A 1FNSH 1NMCC 5FFLA 3V95A 4OF7A 1A14L 2X70B 4PJIF 3QO0A 2JIXD 5ICYB 2D7TH 5F7YC 5AUMA 2NY0D 3GIVB 3OPZH 3RU8L 1KLUB 3BUYB 2XPGB 3I2CL 4KJYA 1P84J 5TDPA 3CH1B 5FO9A 1WBZB 1CS6A 4JPKH 4AIXA 4KJPD 1HHIB 3V7MA 2XRAH 4FS0A 4UDUA 4UAOC 4TRPH 4H20L 1I1AB 1UEMA 1KACB 2AAVA 3QDGE 4F15C 1GIGH 3SE4A 3RNKA 1TIUA 3CFKA 5F1SA 5ID0B 2NNAA 3MGTB 4HGMA 5DJ2A 4L4TB 1ZGLM 4MAYC 4CNIA 1A6UH 1B9ZA 3K8LA 3K80A 4JVWA 3WIIH 4M03A 1DEEA 5AAMA 5HYJB 1ZT7B 5A2JH 3OKDA 2CKNA 4HH8A 3DURB 3OV6A 3QJFB 3BKYH 3WNMA 1W0WA 4MX7A 5F6HI 1H5BB 1ZT1A 1R3JB 2C4XA 3HHRB 4K23L 4K2UH 3UZQA 5J6GB 4HX1A 4KAQH 4GW4B 2UVEA 5FYKH 1GZQB 3E1F1 2IH1A 3DOSA 5FYJU 4M1GH 4OLXL 3I75A 5JXAL 4WU7A 3RGVD 2PCPB 2H32H 4JHBA 5D93C 3HAEG 2VL4A 4KTDH 2MOVA 3VXPA 2V2XB 2DDQL 5E5UB 2CDEA 1RU9L 1LO2L 4R2GD 4S1QL 5TGBA 1SEBB 5CD3A 2O93L 3ELAT 5F1KC 3UXFA 5BVPL 2L0DA 5D1QB 3LMJH 2ZUUA 4MNHA 4U33A 1U6AH 4FQLL 1KXVC 3KYNA 2GK0B 3HFML 5D1ZC 1Z5LA 2VLMD 1V7MH 4U1JA 1K2DA 4MCYB 4WHTA 5I8KH 3LIZL 1IJ9A 1N6VA 1XR8B 5JOEA 1U3ZA 3SKJH 4TOYL 2BZDA 3CFBB 5E6ZA 1R24B 4HULB 1MAKA 4JFOA 1G6VK 1VERA 3P11L 2UY7A 1UXSA 4OCSH 2XKNB 4GG6F 1P5UA 1IFHL 4L4TE 3WN5A 3NAAH 1JK8B 3K2MC 2DQEH 4RWHA 2X05A 5KS9A 2XY2A 3OTTA 3MRJA 2AK1H 1YUHA 5K93A 5BS0D 4GBXB 1TTUA 2VDKL 4RGOH 1KIUA 3IFNL 5DD5H 5KTEH 2ADJB 3VFVA 2WUCL 1FC2D 2X4RA 3AREC 1FVEA 4MNGB 1I9EA 3TV3H 1X5XA 2GUOA 4Y2DC 4JDVA 1HSAB 1N59B 5DI8A 1I8IA 1T21A 2Q8BH 3D9AL 4EN3D 5DD0L 1PG7H 4I18A 2Z8SA 1QLRA 4BZYA 1CIUA 2H2PC 2O61A 3GRWL 4U4BA 3LQZB 3KXFB 3UJIH 4NCDA 4APQD 4NM4H 4OUUB 2ZG1A 15C8H 5AZEL 2BVOA 3PGDB 3NN8B 3T0EB 1LO5A 5DUML 3W39A 3KPLB 1OT2A 1P1ZA 2DQFB 3IGAB 1XGRB 4LVOB 4OLWH 5EU6A 3RWIA 1LEKA 1IGJA 2X40A 1VADA 1KCVH 2CUIA 1J0IA 3QIWB 2EE2A 5T33H 2AV1A 1Q9OB 4HFWA 5JTWA 3BWUC 1YNLH 4G42B 4U1MA 2IF7A 5L9DH 1DQDH 4XPHL 3V6FA 4UNTA 4B7LA 5FUZH 2FJHA 4M8QB 4ONGH 5E8NB 3HE6C 3NCJH 5T1KA 4XC3L 1ZTXL 1MCWW 1MVUA 3GSNA 1RHFA 3PIQA 5FK9B 5EN2B 1I8LA 3EJZD 2EIZA 1EFQA 1T1ZA 4K8RC 4PJ7E 4QYOA 4XVTL 4ZSOA 3PWJB 1YMHA 3C5ZC 1NDMB 1G7LA 4P99A 4QCIB 4UIKL 1RUQL 3DYOA 3IJYB 5EPMA 1FBIL 2YPLB 4ZYKB 2J4WH 2VZ3A 4LL9A 5ESAB 5DHVA 2R1YB 4LNRA 1UB5A 4PP1D 2V7HA 1K6QL 3RHWF 2YD3A 4K3JL 3PWNA 4Q9QL 2DQHL 5LGHL 3SBWC 2FO1A 4D9RD 4OD3L 5C8JB 2E9BA 3FOMA 4HUUB 3T3PE 3IJHA 4NN7C 4DUXA 1C1EH 1I3GH 3V8OA 1A6VL 1L7TL 3WIHA 5DK0B 3ZE0E 5GS0L 4UZGA 4OFPA 4XHJD 4P48A 3VRIB 1NGZB 3KXFE 3S3SA 4MQSB 1U3YA 2BSED 5DMIL 3TZVD 1NLBH 4U1IA 1B88A 2HA1A 3T0EE 3BZEA 2OL3A 3MTRA 1DP0A 4B50A 3M8OH 4QNPE 4YHOH 1AQKH 4TUOA 1H3PH 4R4FL 3U6RB 3F5WB 1S9KC 5DFTA 4AQ1B 1I9RH 1X3DA 2CIIB 3IFPA 4ONFH 5I71C 2AJ3A 4ODUB 4OZIA 1W0VA 4K8RH 4MNQB 3S8WA 1HKFA 3B2UC 1BF8A 5I75B 2NYYD 2N4IA 3HZMA 1JTPA 3AS1A 3GI9L 2IWGA 1BQHA 4CDGC 2AKRA 4IRSC 5I1DA 4EIZC 1LVEA 1G9EA 4N8VA 4DVBB 3B8YA 4R6UA 4FABH 5ICZB 5TPWL 1OT1A 1OGAB 4KDTC 5H35B 4C83B 4G80B 3QI9A 2D7MA 2CLRB 4QRRD 1INEL 3QDMB 1UWEL 5EUOF 4HUKB 3VD3A 5ICXB 2HWZL 3ARBB 2J8HA 3V0AC 1PEWA 4NN6B 1CGYA 4PY8I 4QHNB 2VLRD 2BVPA 2HRLA 4CN6A 2P8PA 4FFVC 4OFDA 1CTOA 2CKBH 3HMWL 1V3MA 1QSFB 1DSFL 5D1XA 2YR3A 3KS0J 5HVFB 2YPLE 4MD0A 4X4ZA 5E2VL 3PDDA 3EO9L 5LGJA 3RTQA 4PJIB 5I17B 2DD8H 2G2RA 1DLFL 3CSGA 3DX9A 5C09D 1KG0A 3Q0HA 1AC6A 3SDCA 4L9LA 4PTTA 2YBRB 3FB7B 4RDQF 3BOVA 1BFOA 1CT8B 1DTUA 4MD5A 2IPKA 1TETH 4OIAA 2R1XB 1N6UA 4LASH 3IVKB 3I6KA 1MLCB 1MPAH 4R0LC 3EO1A 4AM0A 5BV7C 3VXNB 5IMOB 4N0YH 3KLHD 1D7FA 1IGIL 1HHGB 1TLKA 5KAQF 5F7KC 1GHFL 3IDMB 4MJ2A 1H8OA 5A2IH 1HINH 2VDQL 1WISA 4H8WC 3MYJB 1C5BH 4RGND 1BFVL 4KK9D 3MCLH 2VWEC 4DGIH 3SE4C 4PJCA 4L4JA 1RPQA 2FSEA 3LKNB 2YD6A 1UGNA 5EBWA 1T3FA 3QCTL 1NGWB 2AXHA 4MB4A 4RAVB 1J1XH 1T89C 4JFFE 3RVTD 4G9FB 4MZ2A 3U0PA 3QUZB 1L0QA 1SVZA 1OGAE 3SOBH 4YHLH 2Q8AL 1O7VA 3OAUH 5L6YH 3PNWA 4PGBA 2LU3A 1G6RB 3QDME 4XAWL 5IW1B 1EEYA 2HFFA 4N0UE 5ADOH 4HIJA 5CEYA 1IGYB 1NMAH 1OAZH 4JFQB 1EO8H 4GUPA 3CSPA 3PXJA 3DUSB 1JL8A 2KBGA 5HI3D 3E8UH 3O6KL 5I76A 1LWRA 1BP3B 4DN4L 1INDL 4KHTL 2D7NA 3G6DL 3NTCH 4P9HC 3WNOA 4N5EC 4UUJB 5SWQA 1DR9A 4H8WH 3MXVH 4NC1C 1PZ5B 3TIDA 5ALBH 5F3BB 3OJVC 1WBXA 5JDSA 3DGCR 1JHKH 3T2PA 3GDBA 2CIKA 4X8JA 2K7PA 1AXIB 4HUNB 5KW9H 4X0KA 1G9NL 4JHZA 5L0QC 5DDHA 4YIQA 1VKXB 4L8DA 1EUUA 3VDAA 4RMQA 3TA3B 4M93B 1MLBB 4JQIH 4MJ6A 4NZRL 1BQUA 1HWGB 5C0DA 4MXVF 5E24E 2YA0A 1I7ZB 1AKJB 2GEEA 2Z91A 2NZ9D 1P7HL 1QFHA 1ZLSH 2NR6D 4YHPA 2WIIA 2DYPA 5CP3A 4S1SL 3QIUB 3FZUC 3PG2A 4LCIL 3DUUA 4ETQA 4EDXA 1VA9A 3K2UL 4AL8L 4WO4B 3WN5C 3KNBB 2VZOA 5A2KH 4LPVA 1CVRA 4GJTB 1A6TA 2X89A 5HD8C 2DIJA 2FHBA 3QHFL 4QRUB 4XMLL 4NKIL 4L3ED 3P0YH 5BZDA 3WE6B 4OUOA 5CILL 5DR5L 4NO0A 3LRSB 4X4YB 5K9KB 4I18C 3VFOA 2QSCH 5LWYL 1UKTA 5IV2A 3CD4A 1NBVL 4PV9B 3HC4H 4OLUL 3VRJA 4EIGB 2D0FA 4XZUA 2R4RL 2R9HD 4L8BA 1QO3B 2NY5C 4YO0A 3V4PH 4RSVA 1X7QB 2CH8A 3VFMB 4JY4B 1A0QL 2VLKA 3K74B 4NSKA 4PV8B 4I48B 5IVXF 3UCRA 2ZUTA 4PGDA 1J0HA 1S7QB 3SE8H 4XC1H 4P2YA 1K5NA 5GHWH 5F1OB 2IANB 5TF1L 1MSPA 1WC7A 3CUPB 2EDFA 4O51A 3V7AG 1QLFA 4JFHE 1IGML 5KSUB 1NPUA 2M2DA 2VSCA 4Q2ZA 3FHQA 3TN0D 3WBDA 2CDGB 2W59A 5ETUA 4GG6E 2WP3O 3RKDD 4OLZH 5A1AA 2H6PA 1AO7B 1I8LC 3QDAA 5E08L 3GIZL 5DXWA 4YBQC 2GAZB 2HJKA 4WIQA 4Q6IA 5D6DA 3HZVB 3SDAB 4KXZI 3SCMD 2F54D 4LMQE 3CFJA 3IDYB 1KCSH 3GSVA 3IYLW 3WYRA 2P49B 3V5HB 1U3HA 1CDUA 5LVEA 4FTVB 4ODVH 3STBA 1KGCD 1P7QA 1NMBH 1AXTL 3QDHA 4YHKL 4RIRA 1U58B 4PY7B 4P2OB 2WQRA 3WKNA 5BCAA 3D39B 3BWAB 5D96B 2DKUA 2ATKB 3KPRD 3PGFH 2APWA 5ICYA 4HWBL 3GIVA 4HXBL 43C9A 3B9AA 1J8HA 3CNKA 5E2TH 3FQNB 1NC4A 4M61A 1KN2L 4M6OH 1WBZA 4NPYA 4P4KC 5I8CA 3QEUA 1YECH 4GOSA 1ZA6B 1JNJA 4MJIB 1NCDH 5GISL 1VFMA 1I7TB 1KPVA 3O4LD 4CN4A 4I13B 5EUOB 2IANE 3G6JF 4IRJC 2X4PB 1FHGA 1BQHG 2MCG1 5HVHB 3QCUL 4N8VG 1XF5B 3R8QA 1FP5A 3VWKB 3AS3A 1GPOL 4BFGA 4H1LH 3DBXB 3SQOH 1JTOA 4UOW0 3UPRB 1R5WA 2AXFA 3H42L 3W9EA 1AO7E 1VEOA 1Z0MA 2EEBA 3WS6A 2NY1D 1D9KA 5EU5A 3FQXA 3HRZA 2QQNL 5KBNC 2FR4B 4GW4A 3X17A 5AAWA 3BPNC 2OQJA 4TNVK 4RISH 4DWHA 1TENA 4KRPB 5F1NB 1BIHA 4PRNA 5D1XC 3V4UL 1FGVL 4RMWA 2PCPA 4G7VL 1NJ9B 2VR9A 4M6NH 1NAML 1Q94A 5L8LB 1NCBL 3RTQC 3CZFB 1FORL 4YDJA 4QTHB 3JWDC 1TQCB 4L9LC 2EDLA 4R97B 3T0WA 2JCCA 5C08B 5CD5C 5FGRA 4JLRA 5TQ0L 4UT7H 3D39E 1DDHB 4HBCL 4BSVA 2A6DA 2YK1L 3D3VB 5CSZA 5B4MC 4FXKB 4J12A 1PKQB 4OM0H 3OKLA 1JF6A 3FT4B 35C8L 3BX7C 4MCYA 5ALCL 5E00B 5T5FL 1WZLA 4LKCB 3K8KA 4AJ0A 4G8FA 1YC7A 1LEGB 4K9EH 1JGUL 3WDHA 5C9JA 2VDLH 1KB5L 4Z7WA 1R24A 2ZOKB 3ES6B 4KTEH 3WD5H 1YA5A 3GSOB 3MSPA 2HT3C 1I1FA 4BUHA 3GHBH 1RULH 3DX6B 4MJIE 3U7WH 3T0VA 2QQLL 1JUFB 2FZ3A 4S0SD 3M1BB 3QXTA 5GRUL 2W65A 1OOAA 3BIKA 4LQ1A 4C56A 5EUOE 2VO5A 7CGTA 2E27L 3MRBB 4ZAKB 5IP4A 2GTWB 4WI6A 3QIBC 5KVDL 3Q1SH 5KVEL 1NFDB 4MNGA 4Z0BL 2HKFL 3LDBB 4K3EL 1T03L 1IGFL 2OI9C 4WW1B 4WWKD 1ONQB 4KJQC 3KYAA 4XMPH 1A1MB 3B3IA 1E4XI 3BEWB 1GC1L 1FO0H 4GMTH 5E6IB 4AEIL 1Q0XH 2FLBT 1T66D 1KIPA 1WLHA 5FO7A 5JHDD 1V05A 4GAYB 4JKWA 2DQFA 4HT1L 3QEQD 2YD1A 1NUFA 5C0AB 1F8TH 1RZKL 4PJ5B 5CINH 4Y5XA 1BVLB 2Y5TB 2VDPH 4LLWB 5C08E 3RVXD 1CFSB 5L2JA 1BFSA 2FGWL 2VE6B 2XFXA 2VXUL 2GY5A 4R7NB 4A6YL 2P44B 5DJZB 4M8QA 4ZS7H 4KK8C 4V2CB 3QDJA 5J89A 1KUMA 5DLMH 4YDLB 1FJ1A 1J10A 2E6QA 2R8SH 4NUGL 3UTPD 4LRIA 5DO2D 3LEYH 1MI5D 4M7KH 5DT1H 3F65A 2Q7YB 1MHEB 2DI9A 1RIHL 1IAII 2ENYA 4LLYB 4WGVB 1CZ8H 4KXZH 4EBQH 4OGAD 5ENWB 3CPLA 3UTSD 5F96L 3IJYA 2XZQL 5TE7L 3SGDI 4KV5F 3HUJA 3ROOB 5D2NA 4BKLA 3MV7A 1YEFH 5KSBE 2P5WE 3DWTA 4JRYA 2JB5L 5GGVH 4KRMB 5BJTB 1PVHA 2X4NA 1QSEB 3LB6C 1KTLB 4HUUA 5ABDE 3D2UA 3OXRA 5CJXA 4X7CC 5BOPA 4PBXA 3VXOA 3GHEH 2CJUH 1IC5H 4YDIH 5F93C 5HY9B 1AIFB 2X7LB 3MLUH 2O5XH 2VH5L 1A7QL 2YD4A 3AXLB 5IVXB 3HZKB 2KPNA 3LKQA 2ZSWA 4FQJH 4N8CL 3CDGA 3DUHA 1CBVL 4LLQA 1KNOB 2Q86B 5I1AA 1E6OH 4G8EA 2J6EA 4M48L 4UT9L 4LFHD 3BT2H 5C0AE 1YEDB 4RAHA 4PJFF 2H26A 5TFSH 3ZMRA 3I6LD 4NQCD 1EBPA 3CDFA 2H1PL 4Y2OA 4NFDA 1HXMB 1C8PA 4JPIB 3QR2A 4QOKB 5DC0A 1E4JA 2EICA 1CG9B 5FUCC 1Q0YL 3R4DA 3JWOC 4XCCL 1CE6B 3JTTB 4YZFF 3V8CA 5B8CC 1H3WM 5CBEB 5FO8B 4QXGH 1P4IH 2GSIA 5TDOB 1S7RA 3VXRD 1I7UB 3O3AB 4LSRH 2I5YL 4Y1AD 4M3KB 1BREA 4MAUH 2Y25A 5J3HD 3RDTC 3QH3B 4ZD3L 4HIIB 1F6LL 2CUHA 5D6DC 1QSFA 2AEQH 4N9GB 2AJSH 2G60L 1JPGB 4NCC2 1F6AA 4P23A 3D0VA 1RURH 3GKWL 3ULUC 5A2LH 4AIZA 4LSVH 2GITA 2V17H 1DQTA 2F5BH 1ZWIB 4G43B 4MJ5B 3TYGL 4D3CL 5F7UA 1CR9H 3CVHL 4JZJA 1MWAB 5TH2A 1L6ZA 4KK5C 3HMXA 2NXYD 2ZG3A 2Y4SA 1KEML 4JCLA 5C0EB 3OSKA 2CLVB 1WBYB 3VWJD 1FFOB 2B7DT 3HI6H 5TQ2L 5IWLC 3IVKA 5C0NC 4I0KA 2FD6L 2WBJD 1CDJA 4TUJB 5IVXE 3PABA 4DQOH 2VXVL 3IDMA 3S4SA 4NT6A 2NX5D 1VEPA 3STZB 2IFFL 4HDIA 4NRXB 3G6JB 2B1AL 3PHOA 1KJVB 1CICA 3CXDH 5BMFH 1ZMYA 3KG5A 1ZEAL 2FLRT 5HHMD 1DBKH 1VDGA 4H88L 1IQWH 5E8OA 5BRZE 4G9FA 3RWHA 2CO6B 2I60L 5IW1A 4F2MB 3QYCA 1WITA 3EHBC 2BRQA 2D2OA 1IGYA 1ACYL 3D87B 1YYLL 3WS6C 2P8MB 5KVGL 2ZCKH 3RWDB 5M95B 1K8IB 4KKNA 1FYTA 4PRPA 2X1XR 3WFCH 3FJTA 2Y7QA 2W60B 5FXCH 2JJTA 3CFCH 2HP4A 1A64A 4U31A 1VGEH 4S2SA 4J4PA 5CZKA 2XN9D 3BN9D 2PNDA 3BD3A 5B3NA 5HHOB 1EHXA 1K8DB 2QKIA 1BZQK 5L88L 2R29L 4WNQB 3BE1H 4F7CA 1X6NA 1LK3H 1PZ5A 4YR6B 1SYSB 2IGFL 2BVUA 3V6BR 4PLKD 3W9DB 3RHWK 1G0DA 1XGTA 2JIXB 4JG1L 5D1QC 2NY0B 3I02A 5HI4C 4ELMF 1VKXA 2A38A 1I4FA 2VKXA 3MOBL 3LZFH 3QNXA 1F3RB 5DD1L 5EO1A 4RMSA 1CDBA 1IEAA 3N1QC 2BSTB 4MVBC 3RI5F 4O02H 5FUOH 5DTFA 1WICA 2BK8A 4FFWD 4BZ1L 4N1CA 4WWID 3G6JE 1F3JA 3VXMD 1QTYT 1MCPH 4QTIL 3VGGA 1IAIH 2IAMB 2AJZB 4M1DH 4NJ9H 5I73C 2YWZA 3S3JA 4WI5A 3QUMB 3SGDH 1I1CA 6FABL 1DQLL 1HEZA 2YUZA 4OZHA 1YPZF 3I85A 2Z93B 3DV6B 1RD6A 3IAPA 3HPJB 2VIRA 4GBXC 1S7UB 4GAJL 2DQCH 2E3VA 1DL7H 5C0GA 1J18A 5FA3B 1FV1B 1P4BH 5FDWB 1VENA 1MCOH 4JFDB 1LHZA 4X4YA 1S9XB 4PG9B 1ZS8B 1WVZA 4E41B 4PV9A 5T3ZL 2LE9A 2EE9A 4HXAL 1ZANH 1K4CB 2EIDA 2LVCA 1I8KB 5CSBA 2QADD 2JJSA 3T77A 1OM3H 4P2RA 4EQ3A 1SJEB 3HA0A 1NBZA 1BZ9B 4UT6H 1FAIH 5F1IB 4JY4A 5CSGA 4LVOC 2HKHH 3ARGA 3MLYL 2VLLB 2DQIL 5GIRA 5J6HA 2F19H 3MACL 3VFGH 1FPTL 5MP6L 1HI6B 5HYSB 3VH8B 2YZ8A 2R56H 4Y4FD 4GKZA 1JF1A 1WEJL 3CUPA 3F6IA 2A9NL 3DV4A 4KWUA 4AG4L 5I19L 5DVNA 4D8PA 4X7DC 4F7MA 2YRPA 4F3FB 4X9GA 2DM3A 5L7XH 1IQDA 5EBMB 2HVKA 4U3CA 2GAZA 1YEIH 4PRIB 4MDJB 4U6VH 5DMKA 4U6TA 4EEEA 4ERSL 1VB9A 3S35H 3HZVA 1RUPH 5EOTA 2A74A 5BS0B 3U46A 3OKNB 4ZTOH 3B9KD 3O6ML 2BC4A 1I3VA 3TO4D 1GGIL 3QULB 1VPOL 2GSGA 4X99B 3DJ9A 1YN6A 1AGBA 1RVFL 2P24B 4UILH 2FATH 4Z78A 4MA7L 4JFDE 2FO4B 2FGZA 2HT2C 1LD9B 1J87A 3OKOA 3TJHC 4APQB 4ZFZA 4E41E 4Y4HB 1MJUL 1LDPL 2ATKA 1NGXB 4RBPK 5IEKA 5JO5A 4S0TD 2WUBH 5FKAB 4DKDC 5CCKL 4PJFB 3L5WB 1KFAH 2DQJL 4OCLC 1CLOL 4Y19D 4F9PA 5SWZA 2D31A 3QEGH 2G5BA 3TCLA 4ONHB 4QRTA 5T5NG 1R3LA 4PJBF 4LCWA 5A2FA 4LSPL 3ARYA 3V9FA 1CD8A 1AY1L 3OKKB 2VL5B 5D5MF 3LKSA 3HI5L 3TBVB 5I75C 2VLME 3WIFA 2R4SH 2PR4H 1YEEH 4ETYA 1FH5H 4QRQB 1OAYL 4LMQI 4LHJB 2H2SC 2ATPB 2VN4A 5IOPA 4K7PL 5EU7C 5IM7A 2DLFL 2MCPH 2BVQB 4FQPA 2BSSB 3MV9A 2PW1A 3KPQB 2EE6A 4KV5E 5E8DL 4KDWA 3ARBC 4P3CL 3TJEL 1TPXB 3FAXA 4CU7A 2EYTB 2FR4A 3C5SB 3ARWA 1D3CA 4PRIE 2CSPA 1R5VA 5FECB 1BGXH 1EZVY 1KULA 2GY7B 5JPMB 4ODTL 2J8UA 3GSXA 1UVQA 4HFUH 4JRXD 1TQBB 1DBAL 4X6BB 1T4KA 5H37H 4P5KB 4QTHA 5DUPL 4BZ2H 1FAKT 1TJIH 5JLZB 3LCYA 1V3JA 5HJ3B 2BRRL 3ZL4H 2VISB 3QFJD 2BDNL 2VERN 3PQYA 3CLEL 3RP1A 1CFQA 2W0FA 1FFNB 1MCLA 1SMAA 2ZJSL 5GGVY 1SM3L 1GAFH 4ZDHA 4KKLC 3WS3A 3TZVB 3HG1E 5EWIL 4KKCC 4QHUA 3UAJD 3REVA 4FXKA 2Y36L 5E0QA 1BD2E 4POUB 1U9KA 3PJSB 4QHLA 1GSMA 4PJFE 3K81A 4LSSH 3CC5A 4X5XA 4O9HL 1KV3A 3S4SG 3QUXB 4WW2F 2NTSP 4UOJA 3GSOA 4H25A 4YZFE 2AJVH 1SY6H 1CICC 2Z0BA 4HCRL 1YNKL 4BELD 1JUFA 2HH0H 1TCRA 5EZOH 2WWMC 4OQTH 1IKFH 1BQLL 3ZHDA 4WUKH 5DQJA 5MENA 5FYLD 5TE4L 1T20B 4KVNH 4ZFOL 3KYOA 4JRWA 1QRNB 4ZAKA 3S88H 4MXQC 1O0VA 5DYOA 1D5XA 1MCBA 1CXIA 1KENH 3H9HA 4D9QD 3EIFA 4O2FA 4ODHH 4GW1B 4F7TB 4NDMB 5MERB 5FB8A 1JNLH 3MUGA 3GMLB 1A1MA 3O3UN 4R7DA 3G5ZB 3A67L 1MRDL 3PP4H 1E4WL 1ZAGA 4UB0L 2AEIT 2CUMA 1XAUA 5KSAA 3ARFD 5D7KE 5D7IF 2EIEA 5F72S 1T04B 2WM0A 4K3DH 1RMFL 5C09B 3FCTB 3ZYJA 4QF1B 4ZO6A 5GJSL 4ELMB 4FXLA 2NY7H 4MA1B 5IKCA 4DZBA 3KGRA 4PJ5A 3KLAB 2EXWC 3S36L 2ADFH 4R26H 5IB4A 3BAEH 4X80H 3VMOA 5ISZA 2RJMA 3A6BL 3MREA 4PD4K 1Y0LA 4NUJB 2CMRL 1RZJC 4F9LA 3PXHA 4ZUUB 4Y16A 1RZFH 3Q5TA 3DXAA 1QPXA 1FNFA 3O2DH 3M07A 3WO4B 2X09A 5B39A 1IRAY 5E6YA 2LTQB 3IDJA 4OIIH 4RGNB 1D6VH 5DZLA 1FL6A 2IQAA 4P2QD 1YPZB 4AENB 32C2A 5CUSL 1TMCB 1FGNH 1G6RH 3MUJA 4K3GA 5I8OH 3ULSB 2XA8L 3VXSD 2IALA 2MKWA 5GRWA 4IRZH 2F8XC 1DFBH 4HF5H 4WU5B 3V5KA 4WFEE 3VFPB 4WO4C 1WTGT 2IJ0C 3WNLA 3C8DA 5C0CD 4RNRA 2X1OA 4H5SB 5INDB 2WW8A 1QRNE 2AQ1A 3QNYB 3FTGA 5D6CB 5EFIA 4FP8H 1A7BA 3FL7A 1KELL 5I1HL 2FX9L 3SKOB 3N9GH 1A7NH 1NAMB 3RAJH 3ZTJH 3VGFA 1KTLA 1P2CB 1QFWI 1GOHA 1CFNA 2DF3A 2UY6A 4JZNB 1U3JA 3ZO0A 3U82B 4OV5B 2G75A 4PYHA 2X6MA 4LQFL 2IPUG 2JJSC 4NO5A 1DEDA 3HZKA 1MRFH 1F3DH 4NKDA 3VW3H 3WFDL 2ESVD 4U1NB 5C09E 1PYWB 1R3KA 2DIBA 5IQ9A 1WAAA 3INUH 4ELME 3TBSB 3DGGB 5EBGA 1LE5A 2ICEB 3RJDA 3ARTA 1T80A 2ZKHL 2SEBA 1J5OH 1ES0A 2Z35B 4U1GC 3P4NA 1JRHL 4H0GA 1N2RA 4JPIA 1K3ZA 1KB5B 4QOKA 4NNPL 3LSOB 4B41A 1CE6A 5DGQA 4P9ML 2EDEA 1UWGH 4RGNE 4JHWL 2IBGA 1JMZA 1C5CH 4HIXH 3WNKA 3BP5A 1BECA 1YPZE 5CZXD 2F58L 4QRSB 2VDOH 3WUWB 1JWMB 3P30H 5KANG 1UQSA 5FV2A 1Z9MA 5FF6B 3V5DB 3GFUA 4D0CB 3A6OA 4HS8H 4YPGA 2HLAB 3TEUA 4PLOB 5IB1B 4N9GA 3IDYC 3EYUH 3UBXB 3FQWA 2B1HL 5C71A 3FQTB 5TDNA 1S9VA 1PAMA 3MA9H 2HG5B 4C59B 2ZSVB 3O6LL 5DVMA 1U8OB 2R1WA 2EDYA 4NQVB 1MWAA 1YQVH 2C3HA 3TO2B 3NCYP 4P5TA 9CGTA 4HUWB 5CEZD 5C0EA 5E56A 4P2OC 3S6CA 2IPTL 1JZ4A 1ERNA 1J05A 4PJBB 3WSQL 5DD3L 2A6KB 4K71B 5E9DD 3O3BB 2BX5A 4LPTA 3BI9X 1NEZB 3P0VL 2P5EA 2UUDK 5KN5A 2BNQA 4TUJA 3U79A 4F58L 2XI9A 4F9PC 3MRDA 4DGYL 4U6HA 5D5MB 4I2XB 3F7QA 4FFYH 3VXUA 4MCZA 4KQ4H 5DQ9A 1QLEL 2UZIH 4NRXA 2V2TB 3BP4B 4G6ML 43CAB 2OX5A 5DUBA 3CMOL 3IDXH 5EU3A 2VMFA 4PJ8B 2YN5A 3WFHA 1JWUB 3DTXB 5D7SL 1XGYL 2CR6A 4JFED 5HVWA 2P7TA 2LU4A 4MS8C 4GW5B 5C1MB 1KCUL 4PG2A 4YHZH 3GMRA 2VQ1A 4O2CB 1S5HB 4WFFD 5DMJB 5F7FA 1UCBH 3VA2C 4F2MA 1YEJH 5GGTH 3JTSB 4NBXB 4KVCH 4YH6A 2ZOLB 4GFTB 3LEVH 5JMRA 4FRWA 4Z76A 4FMFA 4U1LB 1OSZA 3QRGH 4YHYC 3PHQB 4EI6A 1JBJA 4KGJA 4X8XA 1FZOA 5T1KD 1MFBH 2J88L 2A0LC 3NCCB 5ESVB 1H0DA 1AGFB 3TNNA 1OL0A 1TQCC 4M7ZB 3W9DA 4I0CC 5HDQL 4IDJH 5K9JH 4XRCB 2NTFA 1U8HB 3WFEH 3EYFA 4C57C 4UTAL 1AHWB 4WW2B 4PJBE 4CADA 3WKMH 4MXWH 2VZSA 4RQQA 1DBJH 4QHMB 4AT6B 2FH6A 1HZHH 4UQ2A 3L9RB 4KZDL 4FNLH 3TBTA 2OCFD 5D5ME 2BXZA 1BJ8A 1EHAA 3EDEA 5IQ7L 3SEPA 2XTJD 3NABH 2AJZA 3O4LB 4OKDA 2CLZB 2L7JA 5FEBA 3OJMB 4KZEL 2PYEB 4UDTB 5E2WH 1JFQH 1ZSDA 3VGHA 1V7NH 4Z95L 3GSQA 2DJ4A 3MJ9H 5DMGC 4ZAKC 1S7UA 4LNVA 3R8BB 4NRZA 1T22A 3B4NA 3MV11 3V6ZB 5D7IB 4JFPA 5BV7L 3LKRA 1A4KA 1IAOA 1EZVX 1TTFA 1BWMA 4HK3N 5IT2L 2EO1A 3CVHB 4LHUD 1ZVHA 5KSAC 3RGVA 3ALPA 3UMTA 3IKCA 3THMH 1YDPB 4N0FA 4R8WH 2R0KL 3F7YA 3MLRL 1JZ6A 4TNWK 1AGCB 4ISVB 3PV6B 5KG9B 1FN4B 1KGCE 1SJHA 1LK2A 1NDGB 4JM2A 2M26A 3QI9D 3LS5L 1RSFA 4MSWA 3SDXE 2ORBH 5D9SA 1JCKA 1FVCA 1KTKE 1WCQA 4KKAC 1B2WH 3GMOB 1S7TA 5IHZB 4F9LC 4HJJL 3BN3B 3TFKC 5C6WH 2XACC 1EERB 2MPAH 4HIEB 4D0BA 1XZ0B 4XCEA 2O5YH 3IFOA 2HN7A 4BSWB 1OTSC 4UV7L 4RBPH 5B39G 4XP4L 4N90D 1QEWA 1MAMH 2AK4D 4PJGA 4JEGB 2X9YA 3CLFL 5EU4A 1I1RA 1X5AA 1ZK9A 3MRIB 1B0RA 3SDCD 4KI5F 4M6MH 2FCBA 1EGJA 4R3SB 3QHTC 1F2XK 4OZFB 4DVRH 1YYML 4P9HL 1J1OL 2A1WH 1RIVH 1PQZB 2Z31D 3CX5K 4PS4L 4UTBH 2PYEE 3VA6A 4Y0GA 3MRLA 4WTZA 5BS0A 3OAYK 1S7VB 3IDNB 5AWNL 3QQ9C 3K4AA 1IM3A 4TQEL 3TCXA 4EN3A 1X5YA 5A16A 3RU8H 4O58L 3VGAB 5D7IE 3I2CH 3MO1B 3OAZH 2AV7B 5JZ7D 2CR3A 1M1SA 3QB7C 4YXKH 3ESVF 3MLZL 3OL2A 2X1QA 1FNGA 4H20H 3OX8B 4CVXA 4CJ0A 5D2LF 5CEZL 4L8SB 2FWOA 3BQUB 4YC2B 3QEQB 3UC0L 1P4LB 3QXDB 1A5FL 4MJ4A 2H45A 4WI3A 4LVEA 1GJIA 3LH2L 4R90L 1UT9A 2Y23A 3JWNC 4U0RB 2DOCA 5D7LD 1CQYA 1TNNA 4FQQB 3RWCB 5J9PB 1S78D 4LPWA 4M62L 4YGAB 5GSRA 3TT3L 3GKZA 3OKMA 4K23H 4L4VE 2J3SA 1MI5B 2Y07L 4X9FA 1UH3A 3BKCL 1F2QA 4PP2B 4M6AA 4OLXH 5JXAH 1CXHA 1AXSB 4KHXL 2H3NA 2DTML 3UTSB 2NY5L 2DDQH 1DBML 1IEBB 4HKXB 1KTDA 3VCLA 1IT9L 1UJTA 2YKLL 4JE4B 1RU9H 1LO2H 2HFGH 4S1QH 1TZHB 1DUYB 3SKNB 4XWOC 5BVPH 4YAQA 1DE4A 4CW1A 4OD1L 4HWNA 1A7PL 1BLNB 1HQ4A 1Z9LA 3BRFA 2MSPA 1FRGL 2GW5A 3BPOB 3GMPB 1MCDA 3LRGA 4FQLH 4NQXA 1D5ZA 1T7WA 2VJXA 3HFMH 3U83A 4QXTA 4P5TC 1U8QB 1EHLL 1M6OA 3GSNL 4PJAA 1AQDB 5J1TC 4RMUA 3LIZH 1FFNA 2C7UB 1F42A 2BNRE 4KY1L 4TOYH 3LRHA 4GRMB 1YNTA 1M71B 2RR3A 4G8IA 3P11H 3LHPH 4OFYD 2X89D 1IFHH 2XNAA 3V6OE 4Q58C 4M02A 1FIEA 1NKRA 3E3QC 1HSBA 4NQCB 3UYRL 5INCB 1OHQA 1CXLA 1RZGB 4ODWB 4GH7B 4J3OC 1BZ7B 2VDKH 1HHHA 3IFNH 1ZGLP 2W1NA 4BH8B 4PJ7A 4XI5D 2WUCH 3FO1B 5GGSB 3QG7L 1AD0A 3NZHH 4W6YB 5C07B 2E7BA 3IDGB 3KPOB 4HQQL 4XNZB 2NW2A 3D9AH 4F80A 5DD0H 3VMNA 1S7XB 1WUNT 3VXRB 4QRRA 2KZ1B 3UTPE 3WIHL 1MI5E 3GRWH 4Y1AB 1PEZA 5JQHC 2EDOA 2VLKD 5AZEH 2VLRA 5MERA 3CDYA 5JPNA 5DUMH 2OL3L 1BWWA 2UZYB 3L3JB 3FB8B 3MRHA 4DUVA 2NY4D 3HI1A 3C60D 2V7NA 3VFTA 4ORZC 1JPST 5F9WC 3LS4H 5GS0C 3FCTA 5T3ZE 4WHYG 5DD6B 4XPHH 4HGWA 2NXYB 1ULVA 4M7LT 5M94B 4P59L 2FL5A 4XC3H 1ZTXH 1WWWX 3VWJB 3T0DA 1UWXK 3VFWA 1HHKA 1KYOJ 2PETA 4W6WB 2YPKA 3TESA 1NCCL 2NY0C 5C0FA 3TBWA 4Z5RB 4XNYH 5KVFL 4Z7UB 4CGTA 1DUZA 3GB7A 4XVTH 3EO0B 4OSUL 3N1PC 4KJPC 3OGCA 4ZNCD 4MWFA 3BDYL 1MEXL 2CK0L 2BSRB 1U3HD 4UIKH 4YFEA 1RUQH 2AQ3A 5DK2B 1FBIH 1P7QD 1UM4L 1VGKA 4I4WA 2OZ4A 4XB8A 4RMTA 5T1MA 1E27A 4BUGA 4CMMA 3P9LB 2I9TB 4PJ9B 3AY4C 3D25A 3DROA 1FZJB 5HHMB 1MCCA 1K6QH 2ZNWA 4NKMB 1N3NA 2CGRL 3JWDL 4K3JH 4Q9QH 2DQHH 3IXTB 4CBPA 1Y18B 4Q9CA 5LGHH 5F3HB 5I2IA 1OWWA 3MJ7B 4OD3H 1T0NB 5EC1A 5C07E 5I16B 5FAAA 3C08L 1A6VH 1J8HD 1XGPB 2FIKB 1L7TH 2ICWA 5GS0H 1ZVYA 4Y1AE 1NEUA 5I1KL 2P8LA 5DMIH 3WFBL 4I1NB 4Q9RL 3HB3D 4R4FH 3RGVC 4TSBL 3U9UB 4PJDB 3VE0B 2XN9B 2AJUL 3FT2B 1M4KA 4FG6D 8FABA 4R2GC 1S7WB 1W8NA 3GI9H 5DVLA 1LDSA 5JOPD 4XPFL 2F8OA 5IG7B 1EXUB 5TPWH 4C55A 5FHBL 1D9KD 2OR7A 3KWWA 1U92B 3PL6B 1ADQA 4OB5L 1INEH 3CSYA 2V6HA 1UWEH 4L8CA 3MNWA 4OD2A 2HWZH 4L3AA 2J8OA 4PJHF 4JFFA 4LKXB 4FZEL 4XXDA 4EJ1C 2VAAA 2UUDH 5IK3A 2X42A 3VXMB 1JYVA 1DSFH 2GJZA 1NMCB 4ZFOB 2CK2A 5E2VH 4YHML 4N0UA 1OY3B 3RVUD 1BFTA 3G04B 3DI3B 2DMCA 5F9JA 3ZTNL 3DI2B 3EO9H 4BH7A 5HHME 1DLFH 2GFBB 3D85D 2BOBA 5F7NC 1WIUA 3MLTA 4MDIB 1MHCB 4HC1A 1I7RA 3J8F7 4WTZG 2XXMB 4HZAA 3FQTA 3QT2A 4L3EA 2OP4L 2VLJD 2KQNA 4EN3C 4MHHI 4NQVA 2BNUA 3TO2A 5D2LB 2CRMA 3GGWA 1IGIH 2FX8H 1GHFH 1MCHA 4MAYB 4APQC 4ZFFB 2VDQH 2QADB 3KPMA 1BFVH 4WY7L 5CIPB 3DVGA 1NEZA 1YZZA 1U95A 5HHPB 3DX7B 3D18B 5D7JA 1KIRA 4F33B 1XEDA 3MUY1 3TPUB 5EZJB 1R5IB 1HH6A 3H9ZA 5DJ6A 3FO2B 4NZUL 3V52L 3QCTH 3O3EB 2XA3A 4HKZB 3G9AB 2AXGB 3HNSL 2Q8AH 3GI8L 4E5XA 5HBBA 5BXFB 2DKMA 3HC0A 3DTXA 4XAWH 1MFDL 1XF3A 3HAEB 5DRWA 3FO9A 2C26A 4MQXD 4KI5E 3TN0A 1IGTB 5EIIA 1GCFA 5H8DA 2X44D 3PGCB 1S5HA 4OFVA 3LV3B 3IJSB 2RFXA 3EJZC 2OJEB 3L5XL 3O6KH 5I74B 4O2EB 3IU3B 4YQXL 4DN4H 1N4XL 1INDH 4KHTH 1NLDH 5FYKE 4EKXA 3G6DH 3SCMA 2F54A 4TSAL 2EDTA 3U2SA 2NW3B 5IHLB 1CU4L 3MNVA 4M3JA 3B6SA 5ELIA 4I77L 4PP1C 4K94C 5JUEL 2OXGA 5F7DB 3REWA 3QDJD 4M7LL 4NHUB 1G9NH 1TQBC 1WV7T 4KPHL 4JM4L 2ITDA 4JY5L 1YEGL 3JWOL 4EDWL 3DMMA 5I1IL 4PB9L 5D2LE 4JPVH 4LDEB 1R6VA 3MFFA 4NZRH 5C0BE 4XHJC 3KPRA 4AEEA 4NQDB 5HDLA 2HJFA 1G0YR 1OWRM 1J1PL 3MRFB 4KRLB 3TZVC 4ZXBA 2N1KA 4Y19B 4G6KL 1OF2B 3DRTA 3EOAA 4DW2L 2Y06L 4LLDB 4MD4B 4S1SH 5F8QC 5FOJA 5AG8A 1ZT4B 3AREB 3MV7D 4LCIH 4TVPL 3K2UH 4Y2DB 4AL8H 4PTUB 5KS9F 5LG1A 4GG6A 4U1HB 1NBQA 1HXYB 2J5LB 4CDHA 1JHLL 2OSLA 5H2BA 3ULUL 2R0LL 1ORSA 4QHKI 5HDBE 3QHFH 3G5VA 1UA6H 2AP2A 4XMLH 5E1AA 4NKIH 2QHLA 1FFPA 4HK3J 1ZHNA 4DAGL 5EO9B 4N0CD 5CILH 5DR5H 5HHVL 2HT4D 5LWYH 2VRAA 7FABL 2LV4A 5GGUA 4LP5A 3RPIA 3BGMB 3T8XA 1NBVH 5EORL 3UBXI 5HHNA 3P9MA 3FONA 4V1DB 3P4MB 2VKWA 2Q76B 3ZKSD 5IB3A 2MFNA 3BMWA 4OLUH 2A6IB 3UO1L 1T1XB 1FL3A 1A4JA 2OR8A 4MA3A 3CH8A 2Z4QB 2PKDA 4PRDB 1AJ7L 1OB1B 2GIYA 1A0QH 3L3HA 4I0PD 1XGUB 2R2HB 3U36B 4TTGA 4JRXB 3IAQA 5EA0L 5IMKA 1FN4A 4H0IA 3PWLA 2IC2A 1NDGA 3EDDA 1TITA 3QFJB 3QCVL 4MA1C 5TF1H 3EYOB 3FT3B 1IGMH 2C5DC 3GMQA 4PRAA 5IMLB 3H9SE 3LY6A 1JP5A 5J1AA 2ERJC 3MRMA 4NQDE 1NFIA 2YN3A 2YPVL 3IKKA 3IF1B 4HIEA 1WZMA 5E08H 3WO4C 3GIZH 2Y9RT 4BSWA 4OLYL 4P23D 5DJAA 2EEDA 4RGNC 3VG9C 1RK0A 4IHOA 4DK3A 2BOCA 4KK9C 1BIIB 3QNZA 4HIHB 4NN7B 5HYQA 3Q3GB 1EEQA 2X4OB 2ICCA 4NWTL 4ZS6D 4KKLD 1WFUA 5I1CL 1AXTH 3BKML 1FG2B 3MJGX 3QPQD 4YHKH 4KKCD 5ESQB 3RVTC 2QTEA 5JOFA 4X6FB 3BXNA 1RHHB 1FE8L 1FSKC 4NGHL 2GT9B 3NFSL 1G7HA 4V1DE 4WWKA 4OF8A 4HWBH 1ZVSB 2X4TB 5I71B 3G5YA 4HXBH 1RJYA 3BHBB 3F12B 2FB4L 1BBJB 1KN2H 3ORJA 4W70A 5HI3C 1UADC 5I1EL 3MROA 5C0IA 2WINB 5BVJA 1C12A 1T7XA 3KYMB 1HDMA 1U8PB 1G9MC 3PWVB 4OZIF 4YHNA 5JHDA 3IS1X 2DJUA 2IEPA 2XTLA 3LN4A 4XCFL 5GISH 2DWDB 1KC5H 5IESL 5B3JF 1UKQA 1N5AA 3EFDL 3QCUH 4HKJA 4PJHB 1H3XA 4JJ5B 2UWEA 1A7RL 3RWCA 1GPOH 4LVHB 4LBEA 4IMKC 2R69L 2EDHA 2PN5A 1ZA3B 5J9PA 1JYNA 4YDVA 5EOCL 4LEXL 1BAFL 1CD9B 2FEEI 4PRPD 1X4YA 3H42H 4X4ME 1CF8L 2WMPA 1DLHB 2XZZA 4CU6A 4MB5A 3I50L 3BRDA 5DJYA 2QQNH 3NIDF 2NZ9C 4J4PD 1IAKB 2NR6C 3BGAA 4W6XB 4E9LA 4XXCA 2IBZY 1A3RL 1I1YB 1X5IA 3V4UH 2JK5A 5EZLA 1FGVH 1CL7I 4QXUL 1MJ8L 4G7VH 1U8IB 1C5DA 2B4CL 1X4ZA 4XVSL 1NAMH 4Y4KA 3AM8A 4XX1G 2V2WB 3QO0B 4YX2L 1NCBH 3C6LA 4GKNA 1FORH 1IEBA 2F53E 4XNXL 3MRQA 5AUMB 5C0CB 5BV7B 1MQKL 1O7SA 3HN3A 3MX0A 4QGYA 1D6EA 1MAJA 4X7TA 2MQCA 4KJYB 3NCYS 4UNVA 5TDPB 5FO9B 3ZT6A 1MY7A 4L1DA 4Y5YA 1NQBA 5TQ0H 1A6ZB 4HBCH 3QAZB 3NCMA 2YK1H 4UDUB 4UIMA 5EDXA 2N56A 3EJJX 4XAKE 1NC2D 3NPSC 3K4DA 5B22A 3RNKB 5AD0A 3CFKB 2ZUQC 1OAUL 35C8H 5ALCH 5T5FH 5DJ2B 4CNIB 1QFOA 1JGUH 5GRXG 1RZKC 1HOCA 1KB5H 1J86A 2JJUA 4TPRH 2R9HC 1DEEB 2CDFB 5CZVL 4PJCF 3OKDB 1NEZG 3AS0A 1OQOA 4I3SL 5GRUH 1W0WB 2F15A 4MX7B 4WFGE 4U6YA 3PWPD 1ZT1B 1RZGA 4GAFB 4LLVA 4YDKL 2E27H 4HX1B 1I85C 2BERA 3O2WL 3V0VA 4ZNEA 1VACA 5GS3A 4GAGL 2IH1B 5KVEH 2ED8A 1ZHKA 3I75B 4Z0BH 2HKFH 1A6AA 4K3EH 4WU7B 1T03H 1IGFH 3GNML 4X83A 1U41A 3TN0C 3CMGA 3VXPB 3VXRA 1YJDC 4P2RD 2CDEB 3RKDC 5SWSA 1GC1H 4WFHD 5TGBB 4WUUE 5CD3B 1RJCA 3ARGD 5KSBA 2P5WA 2FECL 4AEIH 3LPWA 3W5MA 5L0QB 3VU2A 3AS2A 4MNHB 3KYNB 3SCMC 4HT1H 1Z5LB 1T5XA 2J6EL 1RZKH 1K2DB 4U1JB 2DKSA 1XH3A 2VR5A 4WHTB 5FGBA 4ZPVA 2FGWH 1B90A 1RUML 2VXUH 1EAPA 5DD6A 4A6YH 3C5JA 4PLJD 4JFOB 4X6CA 1DJSA 4NBZB 2VWEE 4AEFA 2FEDD 1UXSB 3KJ4B 1BOYA 3FB5A 3WN5B 5I8KL 3G6AA 2WBKA 4HW6A 1SBBA 1JPFB 5KS9B 1KEGL 4BQCA 4J23A 1AHWC 2WBJA 3MRJB 1YUHB 5I1JL 2EH8L 3EO0A 1FNEA 2NX5A 4IOIA 1RIHH 2X4RB 1FVEB 3SY0B 1U8NA 2GUOB 4CRPA 4JDVB 5F96H 4JPWL 1QYGL 5DI8B 3SDDA 5TE7H 1I8IB 2XZQH 2DAVA 4LLUA 4I18B 2CRIA 1TJHL 2DQEL 1YC8A 1QLRB 2RB8A 3P9LA 4UOW1 2EH7L 1FZJA 4BJLA 4RGOL 3O45A 2JB5H 1VCAA 2BVOB 3ZYIA 2Q7NA 3J7HA 3HMXL 1LO5B 3W39B 1WWBX 2NLJA 3OKEA 1P1ZB 5SX5K 5EU6B 3RWIB 1LEKB 1IGJB 4NC1E 2O5ZL 3KLDA 4LDOB 5J4MA 1VADB 2VH5H 1A7QH 3L5HA 3M17A 1PSKL 2AV1B 2NY1C 3QSKB 4HFWB 5FYJL 4XP5L 4N8CH 3LD8B 4U1MB 1CBVH 1QSVA 1CDCA 3V6FB 1ETZA 2FJHB 2VXQL 3MA7A 4M48H 5T1KB 4ENED 4UT9H 3O81A 4PJDA 1MVUB 2XN9A 3GSNB 1Z0NA 3GO1L 3DYPA 4OIBA 3PIQB 2H1PH 1S5IL 1M7IA 1L0YA 3CJJA 3SPVA 1Q0YH 2EIZB 4XCCH 4QYOB 1T1ZB 4P5MA 4ZSOB 4KDVA 3CIQA 5T3XL 1YMHB 3P77A 1VFAA 3B5TA 3JUYA 1G7LB 4WJ5A 5ID1B 4P3DA 1GYAA 2I5YH 5EPMB 5KS9E 1N0LA 5DHVB 3IETA 5BO1L 4LNRB 1UB5B 2V7HB 2F5AL 4ZD3H 4LCCA 4LKXA 8CGTA 4KFZC 4ZOBA 5BRZA 3PWNB 1R0AL 5KSVA 4HD9A 3FOMB 2FX7L 4PPTA 3IJHB 3OXSB 2G60H 3ULVD 3ULUF 4LAQL 2B2XL 3TH4T 3G04A 3GKWH 3PQYD 3NFPB 5EO0A 3TYGH 4OZFG 4D3CH 3CVHH 4U1IB 1T6VN 1Q9WA 3BZEB 1KEMH 2OL3B 2BVTA 4X9BA 1RZJL 4Y7MA 5TQ2H 1CXEA 5EU6E 4TUOB 3GRWA 1OLZA 3N85L 4I5BA 2FBOJ 4WWKC 5JXEA 1H3GA 3UTTD 3IFPB 2AJ3B 4OZIB 3FFDA 3VGAC 2FD6H 3RPKA 1G84A 2VXVH 4LLAA 3P3YA 3HZMB 2OJZH 2D9CA 2C3GA 1BQHB 2Q3ZA 3BO8A 3V7AE 2AKRB 4Z7NE 2IFFH 5I1DB 4N8VB 4PRHA 2ADGA 5MEND 1T66C 2B1AH 3GUTA 5DC9B 1S3KL 1Q9KA 5JW3L 3T65A 3D18A 3QI9B 2X1WL 4YC2C 1JF5A 1ZEAH 1IC7L 2VDML 3QA3A 5EZJA 4ODXA 3U4BL 4H88H 3RVXC 3O3EA 2BVPB 4F37F 5D4QA 2P8PB 2H41A 5IROA 5C6PB 1ZGLA 1TDQA 4Y4FA 1UJ3A 5JNYA 2I60H 5D1XB 3ARDD 3NFNA 4OZ4B 4MD0B 3SGKA 1AP2A 4FQXD 3UTQA 1ACYH 5LGJB 1YYLH 4YXLL 3RTQB 3KPNA 3N0PB 5CBAA 5KVGH 2G2RB 3L5JA 5DO2C 1CGSL 1J12A 1KG0B 2EE3A 3SDCB 3GM8A 4L9LB 4PTTB 1BFOB 3IJSA 4M5YL 4R4BA 1U8MA <