3F5WB

Kcsa potassium channel in the open-inactivated state with 32 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody heavy chain
publication title KcsA Potassium channel in the open-inactivated state with 32 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB01
5D5MB 3OG6B 2YD7A 1AD9B 4X9BA 3RHWK 4P23A 2CJUL 4LAQH 2D7NA 4O2CB 5EUOB 1V7NL 2WZPD 5FDYA 1UXSA 4Y5XC 2ORBH 3ARFB 3FO9B 3T08A 4HCRH 1H5BB 3O8XD 3O6KH 3VXNB 1FNHA 1UACL 5I2IA 2AJUL 4PLJD 1GSMA 5IW1B 4QXWA 5D6DC 1VEOA 2P8LA 4JFDE 4NDMA 1PFCA 3AGVA 3BOVA 2Q76A 1WBZB 4UDTB 5FUCE 1XGUB 5C07B 1F45A 2EDNA 1K5NA 3GK8H 5JO5A 3CJJA 1H3XA 3C5SA 2H32B 1VGEL 2FJHA 2P45B 4YPGA 3DTXA 3C6LA 1QG3A 1JHKL 5FKPA 3DSNA 1WEJH 3KXFD 2IADA 4YHZL 2A77H 2D0HA 5DO2C 5LKNA 1WFUA 2FSEA 1QSEB 3Q6GH 3HC4L 2ZSWA 5H2BB 4U1MB 4R4FL 4D3CH 4YFDB 1CFBA 3FQXB 4H88H 2DLEA 1BM3H 3CFEA 1T2QL 5IVOA 4ZS7L 4BFEA 3UTTE 2MMXA 3DURA 5IM7A 4LBEA 3WUWB 3BD5A 1EFXB 5TE7H 1GIGL 2VLRA 5KG9A 1EJOH 2EZ0D 1LP9F 1ZGLB 4DZBB 5LQBL 2GSIB 4KRPB 4ZYKB 3T3PE 4Y19D 1JN6A 4LKXA 1IL1B 4RMUA 1T66D 2IH1A 4YHML 4JGMA 3BRFA 3ZYIA 3INUH 4P23B 4YNYA 3RY4A 1UXSB 1I9RH 3L5XH 4M7KL 1XR9B 1IAII 4PJBF 1OW0C 3KPNB 5F9JA 3SE8H 4PS4H 2UY6A 5DMGC 5I2IB 4H1LB 4OZIB 4PGEA 3UBXA 1SY6L 2IANE 4NOFA 3FAXA 1NCAL 5C6TL 2P8LB 4NDMB 3ULSA 1MIEH 4NWUH 5ISZE 3V8OA 4PLNC 3WS6A 3O2WH 4C54A 3RWJA 1K5NB 4U1GB 5JO5B 1ZHLA 4ERSH 1Y0LA 5CD5D 3MLXL 3V7AG 1BBDH 4M1GL 2FJHB 4GG8A 4YPGB 5FHAH 3DTXB 3C6LB 5FKPB 2IADB 3NIFE 4Q2ZA 3O41A 3U82B 2ED8A 4YXLL 3O6ML 1D5BB 1WT5A 4HWBA 3CDFA 4WFHD 2ZSWB 1SEQL 1KYOK 4YFLF 1A64A 1YUHA 2MQ3A 3RIAK 3HA0A 2VLJB 3A67L 1MCQA 3CFEB 2D7PA 3L3HA 3P9MA 3QCVL 5LGHL 4DUVA 2NXZD 3DURB 3HMWH 5F6IC 5IM7B 4LBEB 5FYLL 5D7IF 3D87B 3EDEA 3P0YH 2DQDL 4M43L 4ODVH 1YMME 2XA8H 2VLRB 5KG9B 3UROR 5IWLA 3WFCL 4NC1C 5AYQA 1MHPH 1QSFA 1NFDF 5DEGA 1JN6B 2EDOA 4LKXB 4LPTA 2P1YA 4PRHB 1BJMA 4PLOB 1JPSH 4YNYB 2CRZA 5ADOH 5HSFA 3NABH 3ZDYF 4TRPH 4R0LC 5BV7H 4XP5L 4NQEA 5F9JB 3LZFH 4OF0A 4YXKL 4ZO8A 4U6HA 2BVTA 1DQLL 2L4OA 3N85H 4IRJD 4PGEB 4S1SL 4OIIH 3O45A 2X44D 4WHYG 4JFFA 3O6LL 3ULSB 4X7EC 1PG7L 1Z0MA 1ZANL 2EDXA 3U48A 3RWJB 1ZHLB 1Y0LB 5JDJA 4MD5A 4GG8B 1A3LH 5KW9L 5LBSL 1SVZA 2Y06L 3QUMA 3QIBD 2LU3A 4Q2ZB 3B43A 2XRAL 4PGCB 2YRPA 3O41B 1D7FA 3QQ4B 5CIPA 4TN9A 1N5YH 5BCAA 1J0IA 2FEEL 3TO4A 2VE6A 3P77A 1LDPH 3OKEA 2B1AH 4JHWL 3BRDA 2ZOLA 4Z7VF 3ULUD 3L3HB 3P9MB 4MD0A 3ZDZE 3OGCA 2MPAH 4NJAH 4OKDA 4P9ML 1WWAX 3R06A 4OFYD 2HJFB 1V3JA 1YNKH 2BNQD 1L7TH 5DEGB 5E4EC 5A2LH 5SX5K 1SBSL 2XZAH 3ARSA 3SDXA 2ARJQ 4R4NC 4R90H 1A7RL 4XCYA 4KROB 5JHDE 1JMZA 3S34L 2EDQA 2QTEA 4Z0XA 1WJ3A 3QEQE 3U36A 2DQTL 4N68A 4FQLL 4NQEB 3F8UB 5CWSA 1QFWM 4J4PA 1U8NA 2EIBA 1YYLH 1JHTA 5LAXB 1Q9OB 4JFFB 4OSUL 2FO4A 2DBLL 4EI5A 2AJXL 3KYAA 2FWOA 2DDQL 2FR4A 1TIUA 4MD5B 3LEVH 3UJIH 3GI8H 3QUMB 4JHAL 4R3SB 4XXCC 3WO3B 4DAGH 4PP2A 1G84A 5CIPB 2AXFA 4NN6B 3H6JA 5FYKE 2YXMA 1I9JH 1OPGL 4LLUA 5F1IB 3TO4B 2C5DC 1T1WA 2VE6B 3P77B 2NY2B 1WCBA 1XGTA 4X6CF 4FXKA 3OKEB 2DN7A 4C58B 2ZOLB 5IOPB 3BDYH 4P49A 4UT7L 1I85C 1MFAL 1J11A 3OGCB 2BXYA 3OB8A 1MHHA 5E56A 3R06B 5K9QG 1KN2H 2P43B 2P24A 5I1JH 1P2CB 5E9DA 5J13B 4JN2A 4OJFL 3SDXB 4I3SL 3E2HC 1N6UA 2GY5A 1P84K 4O2EA 5D7KD 1MSPA 4J7RA 5K9OA 3ULVF 1YEGH 3BPNC 4XCYB 3VXSB 2APFA 1K8IA 3WD5L 3BEVB 4AIXA 5FUOL 2Q86A 4QOKE 4Z0XB 3U36B 1T04A 4N8CH 2CO6B 5I18H 1TZHA 1U8NB 2GTWA 1JHTB 2XQBL 4HX1A 2FO4B 4CBPA 4EI5B 4QHLA 2FWOB 5JW4Q 4LPXA 4Q97A 4JPWL 5DWUL 4KU1A 4NM8L 3BT2H 1LO3L 1FRGH 1A4JA 2FHCA 4X4ZA 4FZEH 3SKJL 4PP2B 3O2DL 4U0RB 2AXFB 4LRNH 3VXRD 1AC0A 1T1XA 4PJIF 4LLUB 4JN1H 3C9NA 2HKHL 1T1WB 4OCNC 5TQ0H 1XGTB 2YD8A 4MXVE 3U9UA 3UTSA 4F9PC 1IBGH 2X41A 4FXKB 1Q9LA 4DK3A 4OZHA 5F9DC 15C8H 3ME0A 1K6QH 3MOBL 1FZOA 3CC5A 3T4AA 3BPCB 5D6CA 1C1EL 4BM7A 2MCPH 3C8KA 4KTEH 5HHVL 3QUZA 3QDGD 2G2RB 4PLKD 2P24B 4XWGH 5E9DB 8FABA 4J3TA 4RISL 4JPVH 4KJWC 5I8OH 5H35A 5HYSG 5K9OB 3SCMD 1EHNA 2DQHH 4WI7A 4CU6A 3FB5A 3BYYA 2EDYA 4BH8A 3UBXI 4NQDD 5FV2A 2Q8BL 4G7VH 1UYWH 4LCCA 1P1ZA 4OM1L 4HFUH 3MXVL 4FQ2L 4F8TA 1J0YA 2P5WD 4RMTA 1TZHB 2GTWB 5IFHH 3WLWD 5L88L 1S7TB 4HX1B 2D0GA 4EN3A 4M6NL 4QHLB 1X6NA 4OI8A 1QBLH 5EORL 4QTHA 3GZKA 1KCRH 1IGFH 1W8NA 1Q72L 2HVKA 5LGKA 1KENL 3QUXA 4FFWD 4D2NA 1A4JB 4WO4A 3BUTA 5HY9A 2EDLA 3CLEL 5I8CA 4BQ6A 3ISWA 3V6ZB 1A0QL 1BF2A 1C08B 5IBLC 1Y6MR 1T1XB 2WWMD 3SKNA 3C9NB 3UTSB 2J6EA 4Z7QF 3AMLA 1Q9LB 4OZHB 4AEHH 3DETD 4DW2L 3CZFA 2R0KH 1FZOB 1R3LA 3WFZA 5D6CB 2E27H 5CGTA 1JYXA 1UENA 2JJTC 4Q6IC 3C8KB 4MJ4A 3RA7H 1B90A 4PJFF 3EJYC 3B4NA 3N06B 3QUZB 1RUAL 4GAJH 3QXTA 2C4FU 4OB5L 3QA3A 4K8RL 2EXWD 3VFUA 8FABB 4JZJC 3QDJE 2E3VA 2FX9L 1EIBA 5H35B 3EDJA 4OZFA 5HHPA 5MERA 2DYPD 3TVMC 1T89C 3FB5B 3SO5A 3FO0L 4BH8B 3NBNA 1OAZH 2R23A 4LCCB 3KS0J 1P1ZB 4PJGE 1DUZB 3QHFH 2DMBA 1A14L 3K2UH 3VE0A 3ZKMC 2AVGA 1HOCA 1DANU 4EN3B 4QTHB 4UT6L 1RZKC 3HNSH 2PO6C 3MBEC 4HV8A 5GJTL 2HVKB 3QUXB 1IKFH 3EO0A 4WO4B 2R1WA 4HIIA 5CZXD 5HY9B 5KTEH 5CJXA 5I8CB 1OD9A 4PB9H 4NQCD 2AXHA 4FTVA 1KYOJ 3QJHA 3SKNB 1QBAA 1A7QL 5ANME 2NX5D 4KI5F 4DGVL 4K3EH 4WW2A 2AABH 1G7PB 1P4BH 2ITCA 3CZFB 2DM2A 1R3LB 3FFCD 3PV6A 4M02A 3CH1A 3EFDL 3MSPA 4LLDA 1WGOA 2FCBA 4WY7L 3MJGX 4N0UE 3VGEA 1BWMA 3T3PF 1A5FH 5D7SL 1JZ6A 3QA3B 4Y5XA 3IAPA 4JRXE 5FO8A 1JYVA 2ARJA 3LIZH 4BQCA 2HLFC 4X4MA 2DS4A 5T5NF 3CXDH 4WHYH 4XMKL 3MV9D 4GG6A 5I1IH 2E6PA 3QDMD 4GKZA 5E2TH 1HINH 1FL3A 1TTFA 5D6DA 4OZFB 3O11B 5HHPB 4U49A 1I1AD 5MERB 4ZODA 2WIMA 1KLGA 3PWNA 3VGGA 1JNLH 4HSQA 4X5LA 4OLVH 1CIUA 4MCYA 2IC2A 3QPQC 4AM0A 1JF6A 2HTKD 4JFPA 1ULVA 1FVCA 2F19L 5GJSL 3RI5F 3WIIH 1FYTA 4ZD3L 4J3VA 4XCNA 4OCLC 1MJ7L 4MA7L 1NGPL 2YA2A 4HIXH 1YYMH 2HP4A 4HV8B 1OAQH 1DDHA 3EO0B 3MXWH 4AENA 3OF6A 1CLYH 1RFDH 2BY2A 2R1WB 1G1YA 3KJ6L 1AO7A 5C0JA 5B39G 1MFCH 4ALAH 3R4DA 4IRZL 4XCFH 4GMTL 4AEIH 4OLZL 1Z9SA 1X7QA 1S78D 2YZ1A 3ARTA 1IZJA 2FL5A 3I85A 1M7XA 5DFWH 4HBCL 4X9HA 4WW2B 5LCVL 1CXKA 5I1HL 1IM9B 2ITCB 1BMGA 2VXVH 1D3CA 4IOSD 1NH6A 32C2A 3PV6B 1RZFH 3TGXA 3O0RL 1DBML 2OMBA 4PJ5E 3CH1B 1IE5A 2QADD 3H9ZA 3CX5K 4JKMA 3U1SH 3NPZB 4Y5XB 1EXUB 5FO8B 2ARJB 4HK0A 3FHQA 1CS6A 1OW0A 1GGYA 3GKWL 1I1CA 4GG6B 1R3IL 5E94A 4GKZB 1FL3B 2VDPH 3K1DA 3NACH 1XCQA 5DD5H 3H42H 1KLGB 1MF2H 3PWNB 3RBSA 4HMEA 1A6VL 5I1LA 2UWEB 4PGDA 4MCYB 4AM0B 5I75C 1FVCB 4HKBB 2DBJA 1UFUA 3L5JA 2JELL 1NL0L 1FYTB 3V4PL 4XCNB 3ZHDA 3PWVA 5CJ8A 4E41D 2KPNA 1DDHB 1PKQA 5FOJA 4IS6A 4ONFH 4AENB 4HCRA 4P4RA 1AFVH 4NRYA 5GGQL 1AO7B 1OCWH 5GGSA 1OSZA 5C0JB 5D1QC 3H3PL 3EOTL 4OCWL 4RGMC 3QUYD 3HFML 1X7QB 1HKLL 2FL5B 5KSAA 1NCDL 5FUZH 3OX8A 3T2NH 3ZL4L 4E42A 4KZEH 5KJRL 3V95A 3ZDZF 1SJVA 1J8HD 4XMLL 2FYYA 3FRPG 2DL9A 32C2B 4OLXH 4IMKC 3BQUC 5HYFA 2HAZA 2H1PL 2R0WH 2ZNWA 1S5HA 3STLB 3G6JA 1MVFA 1HH9A 3KGRA 1ORQA 4HK0B 1SEBA 5JIKA 1P84J 3WSQL 5JW3H 4R0LA 2P47B 1NC4D 3FQUA 3K8LA 3Q5YA 4X6DE 3REVA 4WW1A 3PGFL 2HT2D 2CGRH 1OAYL 1XCQB 4QHKI 2JB5L 3UAJD 3T8XA 5B3JE 2YZ8A 5T1LA 4DKEL 4PGDB 4R26L 2DQEH 2D4DA 5D2NE 2N56A 3C08L 2OL3L 2QJDA 5DJCA 4P5TC 1YY8A 1KIUA 3W5MA 4ONGH 1S7VA 3PWVB 2IBZY 2Z8WC 1PKQB 1WAAE 3O2VL 4MNGA 1IGIH 4IS6B 3KXFE 1N4XH 1OGAD 4LMQI 5D71L 2AQ3A 4P4RB 5GGSB 1GC1H 4NRYB 4OM0L 4G8EA 1OSZB 3V79C 3SOBL 5C0IA 2DQUH 2LU4A 5F6IB 1VERA 4MCZA 1JI1A 3OB0K 4HEPG 3OX8B 3MV7B 4E42B 2OZ4H 8CGTA 4CW1A 3GEWB 1LE9A 1GGCH 3ZHLA 1YN6A 1ZT7A 4JCMA 2FYYB 5T5NG 3BRGC 4N0YH 5JUEL 4G7YL 4LHQB 4OCSL 5J9PA 4HUXB 5DD3L 4X83A 4A6YH 5F7DA 1S5HB 1DBKL 4JDVA 4Y5YC 3G6JB 4Y19E 5DHVH 1HH9B 3NVQA 1ORQB 3VH8G 1SEBB 1JJUA 4R0LB 1JGLH 2OCFD 4POZC 3REVB 1CE6B 4WW1B 4NZUH 4O5LH 4O02H 4P2QD 1A7BA 1Z9OA 3DMMD 3S3JA 1Q0XH 4GXUM 3T8XB 4NUGH 4L9DA 5KVEH 5T1LB 5H94A 3J7HA 1ADQL 1J88A 3M07A 4KKBC 2CKBB 3U2SA 1IMHC 4QCIA 3MODL 4XXCA 4EEEA 1CFNB 4LCIH 5DJCB 4JFED 5I6XC 2ZCKH 1NGQL 5KVFL 5HHNA 1S7VB 1XCTA 4XPHL 1YPZB 4W6XB 4MNGB 4XPTL 5D7JC 4PUBL 4NFCA 2EYTA 4XB7A 1I85A 1ND0A 3TH2T 1ROWA 3U7YH 1QFHA 3EFFA 2FJGA 5C0IB 2VKXA 4WFHE 4MXVF 1J1OL 3X3FH 4MCZB 4HLZG 4DN4H 4CW1B 4WFGD 3F6LA 3WFDL 2VSDA 1LE9B 1YN6B 5E4EB 1ZT7B 9CGTA 4KDWA 2GYSA 3G08A 2RHEA 4LP4A 4P2OC 3RVUD 3WFBH 2AKRB 5IVNA 5MP6L 2HWZL 2X09A 3ZT5A 3T0VA 4QTIH 4JDVB 2Z92A 2KH2B 4I18C 4OV6F 2NPLX 3SGEI 5TF1H 3RPIA 3RKDC 1AI1L 4AT6A 2ERJB 1EEYA 3GUTA 1AQKH 1KXQE 2HT4C 5LGJA 3VDAA 3V5DA 3VXUD 2GAZA 1GC1C 2B7DT 4PJEE 4JJHA 3P11L 4TOYL 1MIMH 1YEDA 1G9NL 4C56D 3MGAA 4DFIA 3BUYA 2Z8VC 1DQQA 3KDMB 3QO0A 4UOW1 4HIHA 5H94B 4K3JL 4QCIB 4RX4D 3H7BA 4YIQA 2KDGA 5F70A 3JV4A 5KSVA 3CFJA 2W60A 5HHNB 3KLDA 3GGWB 3Q2CA 3TESA 4LARH 1LHZA 1XFPA 4K7PY 4WEBL 3OHXA 4F9PA 2BSRA 2EYTB 5FCUH 4ZFOA 5L6YH 1ND0B 4KGLA 2ZSVA 3EFFB 3VXMD 2I26N 1KACB 4ORZC 4UTBL 4ZNEE 4JREC 4W6WB 3MGOA 4DQOL 5CUSH 1I3VA 2HJLA 1MCOH 1MJ8H 4LHUG 4BQBA 3QEUB 3ULUE 2DD8H 1M7DA 4J8RA 4NYLA 4PRPD 2XKSA 5DUMH 5BS0D 3G08B 3E2HB 5CSGA 3M17A 2BNQE 2P42B 3BPNB 1MQKH 1KXVC 2FBJL 2Z92B 1F4WH 4P46C 7FABL 5E5MB 3RPIB 3IVKA 2CR6A 4AT6B 1EEYB 3GUTB 1CD9B 1EA9C 5T1DL 5LGJB 1FSKC 4RWYH 1WBYA 4HIEA 3V5DB 2GAZB 5J1AA 3HG1A 1S9XA 1YEDB 3ELAT 3BUYB 4PJXF 1NCWH 1DQQB 3I9GL 3MRNA 3QO0B 5IBTL 4XRCA 1RVFH 1CXIA 2BJML 2OR7A 3H7BB 2EC9U 4YIQB 3THML 1FGVL 3PGCA 4Y4FC 3JV4B 3CFJB 1RIVL 2W60B 4G6AC 1J1PL 2V9RA 4JQIH 3P73A 2XQYK 3BMVA 2VIRA 3OHXB 4D8PB 2P44B 1LO4H 3SQOH 3HB3D 2BSRB 1F4AA 4ZFOB 1PBYA 3CVHL 3D69A 3CFBA 1N5AB 2ZSVB 2ZJSH 2GI7A 2JJTA 4Q6IA 3MGOB 5HHMB 2HJLB 3VWJC 4YC2C 4JM2D 1UA6H 2ZWLT 2QQLH 5CJQH 4MA8H 1G7QB 1M7DB 2J7LA 4J8RB 1LD9A 2UVEA 4NYLB 4JZJA 4UV4H 3CX5J 1TVBA 2A1WL 5E2VL 5IEKA 1YJDL 2N7AA 1BJ1H 4Y5VC 3M17B 1CGSL 2CLZB 3W9DA 4XVTH 4OGAC 3TVMA 1T89A 3D9AH 3OGOE 2ZOKA 1N26A 3IVKB 1GL4B 3MJ9H 3B9KC 1QRNB 3Q3GA 1WBYB 4YQXH 4ONHA 4HIEB 4OQTL 5J1AB 1RIHL 1S9XB 5A2JH 5IMOA 5IGXH 1FH5L 3QXVA 2PO6A 3MBEA 2IQ9H 3CCHA 4XRCB 1Q9WA 4FQJH 3PG2A 2O61A 3LQZA 4XGZA 3ORJA 3PGCB 4LEXL 5MEPA 4XPAH 4LSPL 4BFGA 1P4IH 4O51A 4P9HH 5E0QA 3PABA 2E7CA 5C0RH 5IUSA 3P73B 4A2LA 1F3JA 1CL7H 2ITDB 1RV6X 1FO0H 2VIRB 35C8H 5DDHA 3DV6A 1RUQH 3FT3A 1RI8A 4JFYA 3D69B 5I15H 1YEHH 3CFBB 1RJCA 1JVKA 4ODHL 3VXRE 2LQRA 4BZ1L 2J8OA 1SQ2N 5T33H 4Q6IB 4N1HB 3ARUA 1KTLB 3IDJB 1X5YA 2CUHA 1UM5L 5C08D 5JPMA 2RB8A 4JZJB 1AH1A 4RMQA 4G6JH 4K7FA 4AMKH 5ITBH 1TVBB 2DQJL 2VMFA 4P2YA 5CP3H 1RJZB 2EIEA 3QDGE 3W9DB 2R1YA 1FP5A 3N1PC 5TE4H 5DVOA 1U8HA 1QLEL 3TVMB 2E9IA 2ZOKB 4XI5D 2DTSA 4OF5A 3HI6L 1BAFL 1ZKAA 5FGCE 1T03L 4R7DA 3Q3GB 5E4IA 3ZLQC 1RIUH 3I6LD 4NP4L 4NQDE 1AE6H 2YA1A 5IMOB 4CL7A 1P6AB 1YZZA 4Z7WE 2PO6B 3CCHB 3MBEB 1YEJH 2P5WE 2BRRL 1JNJA 1ZHBA 3ARBA 4X7TA 4S1DD 3O3BA 5I66A 1FC1A 2XTJC 2F54D 5DLMH 5KS9E 2O61B 3LQZB 4XGZB 3QQ9C 5GGVH 2E9WA 2FH8A 3BKCL 4O51B 3QHZH 5B38B 3PABB 2VDNH 1WZKA 1L0XA 3MOQA 3WKMH 2P7TA 4L3EA 1F3JB 1RY7B 5E2WL 3TJEH 1IJ9A 4IOIA 5SWQB 5DDHB 5CGMA 3DV6B 3RIFF 3FT3B 1FFPA 2DIJA 4JFYB 4FQXD 3U4AA 1MFBH 3I84A 2XXMB 3LH2L 5EZOL 3HE7D 4WRLA 4XTRD 5L8KB 4I13B 5ACZB 1KEMH 2O93L 1DBAH 4HFWA 5JPMB 3VFRA 2NYYD 2A6KA 5GRJL 1IGMH 4K7FB 3VXOA 1T80A 2VL5A 2CD0A 2R1YB 1MUJA 1U8HB 1I3UA 2E7BA 3KLHD 3D18A 4M3JA 4XBEH 4P9HC 4FA8A 3BIAX 3MCKA 3LQAL 2NY7H 3PP4H 3M45A 2F53D 3QNZA 3UTOA 4NQVA 5HI4D 2R9HD 3ESUF 4R7DB 4AIOA 3GI9L 5IBUG 1EERB 3EDFA 4FQIH 5HXMA 1MREH 4JRYA 5B3JF 2QSVA 4YHLL 3D48R 2AV7A 2NY4D 3QG7H 4YDJA 1PLGH 4Q7DA 1ZHBB 4X7TB 2IGFH 3OKDA 3O3BB 3S35L 1DQTA 5JNYA 3PHQA 3BN3B 5TE6H 5FUCC 4Z78B 2UZYB 5D1QA 1WAAF 4HLZH 3PJSA 4N1EA 5DJ6B 4JY6B 2P7TB 2FIKA 2IG2H 4L3EB 1ZHKA 4KTYA 3EO1A 1BD2A 1FV1A 4IOIB 5FXCH 1NAML 1FFPB 4NQCE 2ATKA 1BHGA 4POUB 1OWWA 2IBZX 4IMKA 3PDGA 2UZIL 3OR7A 5EU6B 1RU9H 2NX5E 1JNHA 1RURH 1DBBL 2VZ1A 4HFWB 1BLNA 2QHRH 5B4MD 5ICYA 5JOPE 5JXED 3VFRB 3MRDA 5I30H 3FFCE 1A6AA 2QSTA 2A6KB 4GSDL 3MJ8A 3VXOB 4RDQF 4XBGB 1RULL 5HPOA 3IFNH 5F88A 4F2MA 3RUGE 3D18B 3CFCH 2XTLA 5F93C 5C0NC 1KC5L 5HYIA 1LVEA 5E2JA 3VFTA 3OJMB 1FFOA 4TSBL 4NQVB 3MV9E 2O5YL 4FQCH 4DTGL 3QDME 2VR5A 2KL6A 4OCXL 5EBMA 1MNUH 4I2XA 4LLQA 4CUCA 1HHJB 4JRYB 4P5TA 3TBYA 5EZJA 3DUSA 3K8MA 4UNTA 4FMFA 2NY6C 2AV7B 4YDJB 5EO0B 3UYOD 3VD3A 2R56H 1S3KL 3OKDB 5JNYB 3G6DL 3PHQB 5D96C 1OP5H 1OT2A 5D1QB 4R4BB 5DVNA 2AK4D 3PJSB 4L5FL 2C3VA 4RGMB 2R4SL 1V3MA 4PTUA 2FIKB 4HKJA 3V7MA 1ZHKB 3EO1B 3TIDB 1BD2B 3VRLF 1FV1B 3T0DA 3DLQR 3I50L 1OP3K 4ZNCD 3SDCC 1MRDL 5C9JA 4TUOA 2DQIL 4FABL 2GJ6D 2YHGA 4DGYH 3BQUB 1GOHA 3OR7B 4OI9A 3NAAL 1CK0L 5L7XH 1JNHB 1IGTA 4Y5YA 1BLNB 5FM4A 4B7LA 2CUMA 3HC4H 4QRRD 4V1DA 3VFVB 3MRDB 1LNUA 4X5XA 1A6AB 5KOVC 5F9OH 5D70L 3GSNH 3MJ8B 4U7KA 4YHOL 3UC0H 2VSCA 4DZ8A 3GSWB 4ZS7H 5IVXF 3ARWA 3EYSH 5F88B 4F2MB 4YDIL 1FL5A 2BZDA 3VFTB 2VXUL 1FFOB 4U7SA 4GW4B 3SJVA 5LQBH 1JZ2A 3BDBA 5FYKH 4TSCL 4QRSA 4PJEF 1TPXC 5EBMB 4M6MH 5D1XC 2AEPH 4LLQB 3G5YA 4XB8A 1TETL 2YBRA 4P5TB 1WIUA 3TBYB 5EZJB 1FYHB 1HCFX 2GUOA 4LCWD 3X3GL 2R1XA 3B2UC 3R8QA 1CZ8L 3MLSL 5C2BL 5D7JA 1WVZA 3K4ZA 5GZOD 4MJID 5HPMA 4CVZA 1BECA 4UMGA 3KPTA 4E41E 2C3VB 1SMAA 2VQUA 3DX9A 4HKJB 4FNLL 3VFWA 1KIQA 3OAZK 1UKSA 4TTDD 2IF7A 1FE8L 1NAKH 3BIKA 2V5TA 4TUOB 4JKPL 1FPTL 3R1GH 3NIDE 3RVTD 4HIJA 4P2OA 5SWSD 4K7PX 1MCDA 5FYJU 1CBVH 4IDLA 4XNZC 5D7IA 4Y2DD 5FA4A 1J8HE 1IGTB 4Y5YB 4I18A 2BHZA 4V1DB 4LAJH 1LNUB 4X5XB 2W1NA 3LKNA 2Y5TA 1A1MA 3S7GA 2VLKA 2GT9A 3QCVH 4DZ8B 3DRQA 5IT2L 5F7UA 4JFXA 2Y6SD 4HJJL 4X0KA 2GSGA 1FL5B 2YKLH 4NO0A 4OGYL 2EDFA 1CICC 2VUOA 1CD8A 4QRSB 2BNRA 4Y16C 2OZ4A 1NBZA 3G5YB 2WQRA 2YBRB 4PJ7E 2G75A 3JTSA 5HYSA 5I6XB 2HLAA 2WWKT 1EO7A 1M1SA 5JMRA 5D7LD 4U1SA 4A6YA 1ERNA 2GUOB 2R1XB 4P4KC 1ZGLM 4CMMA 1HZHL 4XP5H 5D7JB 1CQYA 3QFJD 5DHVA 1IM3A 5BQ7A 4CVZB 3ZZ1A 4JGJA 2I5YH 3LRHA 4S1SH 4HK3N 4H8WL 3MR9A 3DX9B 2MQCA 4M3KB 1CQKA 1MRFL 1OGAE 1KIQB 2G60L 3BIKB 1CE1H 4Y89A 3RY5A 2YD3A 5KW9H 3TN0D 2Y7QA 1N59B 4Z7VA 1YDPA 4YK4C 4HIJB 4P2OB 4EDWL 4NZTL 4JVUA 4PJDE 1MY7A 1ODAA 1FGNL 1RZIA 5FA4B 5FF6A 3KHOA 4BJLA 4P46A 4I18B 4QRPD 4G8GA 1HQRA 2APVA 5MEQA 5SWZD 3LKNB 1OQOA 2Y5TB 1A1MB 2VLKB 4BFBD 5TFSH 4XX1E 1EHAA 2ZUSA 3TA3D 3DRQB 3KPOA 1P7QA 2WBJD 4JFXB 4ELME 5KZCB 5J0BA 4X0KB 2GSGB 1TVHA 1IQDA 3KPRD 4HHAA 5I0ZA 4MSWA 5AWNL 2BNRB 3SDYH 1CFVH 4P2QE 2F5AL 3FQNA 3WXVH 1NBZB 1AY1H 3FN3A 3JWOH 4XP9L 3VRIA 2G75B 3JTSB 5HYSB 5MEND 2HLAB 4Y4FA 3VU2A 4AL8L 3D85D 2YD2A 5DA4A 4U1SB 4A6YB 4LCYB 4LKCA 4EQ3A 4PBXA 4CMMB 4FQLH 1MOEA 2K3TA 4JFEE 5HI3C 3RHWF 3HNVH 4JR9H 5TDNA 5BRZE 1IM3B 5BQ7B 2I25N 4U1KA 5E5RB 2PYEA 4ZS6D 1FORL 2GCYA 4JREB 3S96A 4KVCH 2VC2L 4IRSD 3VWJA 1FZKA 3ILQD 2EXYC 2OTWA 3HI5H 5BW7C 4LDEB 5IHLB 1CVSC 4MDIB 1YDPB 4PB0L 4FP8L 4Y5VA 3OJ2C 1RZIB 3AS3A 4H0HB 2W07A 3LEYL 5FF6B 4TVPD 4P46B 4G8GB 1HQRB 2D0FA 2JE8A 3EKCA 2P5EA 4XCEA 5TDPB 4LVHC 4S0TD 2D7QA 4B53A 5MEQB 1KELH 1MCCA 3D0LA 4QHUA 3DVNA 2RFXA 4ODUA 3B9KA 1FSKB 4Z7OF 4MQXD 1ZA3A 3KPOB 4W81A 1TVHB 1IQDB 5C7XL 2FX8H 1H3TA 3CNKA 1K2DB 1PY4A 4MSWB 5C07D 2YMXL 4M4PA 3S3SA 3VXUE 3FQNB 4I3SH 5CZVL 1G7HB 5GS0L 3VRIB 4Z7WF 4C56E 1VFAA 5DRNA 2DM3A 4KKCD 1EUUA 4ZMAT 1T7ZA 1EEQA 1QSED 4LKCB 4PRID 2F5BH 5TDNB 1JFQH 4OT1H 1CDUA 1NBYA 2PYEB 2VABA 4EI6B 2GCYB 3RGHA 3S96B 2O5XH 2HVJA 3B8SA 4OCRL 3VWJB 3EYFA 4YC2B 5I1KL 2NQCA 1DZBA 4H25A 5DWUH 4V2CB 4NNPL 4YX2L 2OTWB 3MLZL 4FFYH 3VXME 4O9HL 2KKQA 3WXWL 4YPJA 3TBSB 4OCMC 1P53A 4Y5VB 3WHE0 3O2DH 3HHRB 4LGPB 1SJEA 3JWOC 4OF8A 4L4VA 5DC4B 4GOSA 1X5XA 3D3VD 1JGUH 4HJGA 4JY4B 3GFUA 5IFAL 2MQ0A 4M93C 4PRPE 5BS0E 1KTRL 3RVWC 1XGPA 3D0LB 4QHUB 3DVNB 2RFXB 4WUUA 3B9KB 2EIZA 4X80H 4CDHA 4U6VL 5K9QI 2VZSA 4KUCD 1B6DA 5IB2B 1L7IH 4NNXA 1U8PA 5IKCA 1TDQA 3W11C 4F58L 1ACYL 3E6FA 3RIAF 4XPFL 1I8LC 2BHUA 4JG1L 4W4OA 4JKKA 4GKSA 1UKQA 1I7TB 1J0HA 1KCUL 1VFAB 3VW3L 3QJFA 4P2RA 2VDML 1VEMA 3RTQC 2C1OA 3B6SA 4LK4A 5T5FH 1B88A 4S1RH 1YECL 3P0VH 1CU4L 5EA0H 1R3KA 3MJ9A 3DROA 1H9VA 1NBYB 5L88H 2VLJD 2HRPH 2VABB 1I4FA 2P49B 4YFLI 3G6AA 2HVJB 2XZQL 2WNGA 3ZYZA 3GNML 1Q72H 4H25B 3ES6A 2Y07L 1S9WA 1XIWD 1YEFL 1N64L 1SJEB 2OQJB 4L4VB 4PRHD 2IPTL 2OR9L 2GIYA 4D0CA 4ODXA 5DR5L 2BERA 2CLVA 1V7ML 4WUUB 1FO0A 2EIZB 3MUGA 3FRPA 2R15A 3RUGF 3AREC 4DW2H 1BBJA 1CTNA 1U8PB 5DFVC 5IKCB 4XC1L 2AJYL 4OB5H 3E6FB 4HG4K 1NUNB 3WIHL 2XPGA 3GM8A 1RZJH 3QIUC 3SKUD 43C9A 3F7VA 3A6CH 2XTJB 4JFDA 2FX9H 1H3PH 3QJFB 1PKOA 1NBQA 2X9XA 3IYLW 2HTLD 3V5KA 3LS5H 5KANG 5CP3A 1J5OH 3B6SB 4YHKH 3FO0H 1LK2A 5C0AD 3V6FA 2HMIC 1EHLH 3ZT6A 1I9EA 1R3KB 3BJLA 3DROB 2GQHA 2J4WH 3MRCA 4CJ1A 4HD9A 1I4FB 4UOJA 5CMAA 3G6AB 2ENSA 1MLBA 5EOQH 4ZFFA 4LIQL 3ES6B 1EMTL 3T1WA 4U3HA 4JZNA 4YLQT 2O26U 3UTTA 1ZLVK 1JPST 1S9WB 4KDVA 5EOTA 3T77A 4IIQC 1WSST 2O5ZL 4GRLC 5DJ0B 2V9QA 3NCBB 2FX7H 1RUPH 2QL1A 3N1QC 1O7VA 2OS7A 3KR3H 3T2OA 5C08E 3T2QA 3U9PL 4PD4K 4D0CB 4ODXB 4J3WA 1A7QH 4NHUA 2VWEC 3CVIH 1OAKH 2CLVB 1FDLL 2XNAA 4FG6C 3MUGB 2KQMA 3AAZB 3QZWB 1U8QA 2HYMA 1BBJB 4YEFA 1DQML 5K9JL 3HC3H 3TPKA 3TIEA 2IANA 2NZIA 43C9B 3F7VB 2YRZA 1QFPA 3I6LE 4JFDB 5HGBA 1DCLA 5ISZA 4LQFH 1IQWH 2CPCA 2ZZUT 3V5KB 5BJTA 1VKXA 3QRGL 1UEYA 4HMCA 5EU5B 1LK2B 2F54E 4UQ3A 3V6FB 2G5RA 2D4FA 3DIFA 1RZGB 2VXSH 4DKFL 2ADJA 5IMLB 3MRCB 4FFVD 1NC2D 4RQQA 3LRSA 2ADGA 4HC1L 5CMAB 1XGYH 1UH3A 1YEEL 2R2EA 3WFEL 3T1FA 4ZD3H 1MJ7H 1MLBB 4ZFFB 1UADC 4NZJA 4OCYL 2NTSP 2BHYA 4MXWL 4Z77A 1T0NA 1UM4L 4U31A 4X99A 3T04D 1ZLSH 2VQ1A 4WI6A 1RZJC 5EOTB 4UT9L 1YMMA 25C8H 2CMRL 2FJFA 2P48B 2MKWA 4JCLA 4JO2L 4UILL 3VXSD 2FLRT 4NHUB 1HKFA 3ARQA 3K81A 4X8XA 2YWZA 5LCVH 2XNAB 1F11B 5J12C 2DTML 1L9NA 5D1XA 5JA9A 3LEXA 1U8QB 3RZCC 5HI5D 5C92A 2F53E 1PZUB 1KCLA 1N3NA 2RCSL 3L1OL 4FZ8L 3S37H 2NY6B 3BVNA 3T4YA 3TIEB 4LPWA 2I9TA 2IANB 4FFZL 3DXAD 3HNTL 1VEPA 1I7ZA 5D96B 5HGBB 5FYJL 1U3YA 1HXYA 3O8XC 3MRIB 3P4OA 3T0WA 3Q6FA 5BJTB 1BQHA 4EVNA 1BOYA 4EIZC 4PLJC 1IAIL 3QXWA 1U3HD 5D2NC 4UQ3B 2Z0BA 1KIRB 1EVTC 1N0LA 4XP6H 4ORGA 4ZPTB 3PL6D 4O58H 3MLRL 3SDCB 1EGJH 5CEYA 2ADJB 1PSKH 1OWRM 1LE5A 1NEZG 2OSLB 4RQQB 3LRSB 2ADGB 4LLAA 3K7UA 3T1FB 5E24E 3B2VL 3EIFA 4XP1H 3ZYJA 1U58A 5EWIH 4OLUL 3QB7C 4U33A 3BPOB 4NBXB 4IDJL 4LHJB 4MMXC 1T0NB 4X99B 2VQ1B 5DMKA 5ALBL 5GGQH 1YMMB 4QO1A 4EDXA 1RJYA 2FJFB 5EULV 3H3PH 1R0AH 1WZMA 1N0XH 5FO9B 3MNZA 3VCLA 5KJRH 5F7EH 1ZSDA 1CICA 4GKNA 4Y16A 3L3DA 1TPXB 3AROA 4ELMF 3LEXB 2A9ML 3ZKND 4XNYL 5JHDA 3FB7A 2OX5A 4LLVA 4ODTH 2D3VA 1DVFD 3QEQA 1T66C 1N3NB 2H1PH 1BIHA 1CF8L 2EEBA 3BVNB 5DQDH 3T4YB 2I9TB 2QSQA 3O4LD 3RL2A 1BF8A 1I7ZB 5DURD 1EUTA 4JO3L 1I9IL 3IDMA 1HXYB 4MAUL 3ULUH 3GSNA 4LIQE 2AJVH 3P4OB 1BQHB 4EVNB 1UWGL 1INEL 1P9MC 1UZ6F 2ZP0T 4N5ED 4XVUD 4X9FA 4CADA 2AK4E 2R8SH 4LVOC 1LE5B 3C08H 2OL3H 4NJ9L 4KUZH 2GTZA 1VCAA 5JQ6H 4G43A 4ESKA 4XNZB 5FHBL 4HJ0C 1U58B 4QLRA 3NCJH 4J6RH 2CK0H 5EU7E 2GJ6E 4Q9RL 2JB6A 2L0DA 5IB4A 3GRWL 4EDXB 1RJYB 2Q7NA 3IJSA 3MV11 3P4MA 2RJMA 4Y4HA 2VLMD 4R8WL 3NTCL 4QRRE 1CL7I 4F15C 4Z7NF 3MNZB 1RUKH 2NXZC 3VCLB 1KBGL 4KQ3L 5F7KC 1U2HA 1CICB 1ZSDB 3D0VA 4GKNB 4Y16B 3L3DB 5IMKB 4B50A 1X5AA 5JHDB 2X05A 1KCVH 4LLVB 1GGBH 4OCSH 3QUKA 3OZ9L 1U8JB 4QOKA 4BQ8A 5HHXL 4F37K 3GSQA 1DBKH 2W91A 2Q8AL 3RU8L 2QBWA 3OKKA 3RL2B 4P4KB 3UTQA 1IEBA 3ULVD 4ZTOL 4XVJL 3G04A 3IDMB 4RFOL 3GSNB 3VGAC 4NWTH 1IAMA 3VD7A 1VFOA 3GBNH 4IRJC 4LCWE 3K0WA 5DUPL 2LVCA 2QR0A 3FQRA 4S1QL 1E27A 1QNZH 4F8QA 4LVEA 4MJIE 1ADQH 1IT9L 1IAKA 2BP3A 4CADB 5BW7A 5IF0A 3W0WA 3V52L 1GOGA 3L5WA 4YK4B 4OF3A 2NY5H 2GTZB 5D2LE 4QHKJ 4G43B 1UB6A 3HZVA 1QFUL 3T3ME 2VDRL 1D5IH 3K80A 2EEAA 2JB6B 1S7WA 5SWSE 1X6LA 5FKAA 3JZ7A 1MI5D 3IJSB 5JPNA 5DK2A 4G3YL 5CS7A 5JW4M 3ULUC 2AAVA 5IV2A 1D6VH 5FYJE 2EE9A 3VA2C 4XNMA 2XZCL 3D0VB 2ZUQC 1I3GL 5J06A 1E6JL 3OMZA 1K3ZA 1HHHB 2RGSA 1H3WM 4PJCF 4DN3H 3U4BH 1LK3L 3QUKB 3QIWD 4Z7UE 4HG4J 4QOKB 2FNBA 3CD4A 3DSFL 3GSQB 1ONQA 4KPHL 3OKKB 3L7EA 3UTQB 1IEBB 2DOCA 1ZLWH 2HKFL 3G04B 2E7MA 3NZHH 3TM6A 1KCKA 5ADPL 3S88L 2ZCLL 5D7LE 1PQZA 1G9NH 2QR0B 3FQRB 1CDJA 3QFJE 4F9LC 1E27B 3GBMH 3HKFA 1IAKB 4BELD 1T1ZB 3W0WB 1JPTH 4AG4H 2VH5L 1I1YB 1KTKE 3L5WB 1PY9A 1IM9D 4H5SA 3KPSD 3L3JA 1UB6B 4OD1H 1PEZA 4EXKA 3HZVB 1R3HB 1BX2A 5FOBA 5IHUL 4LVHB 4K3GA 1MJJA 4XX1G 4NRXA 5C0BE 2X4SA 2W59A 2Z31A 2CXGA 1S7WB 4JM2F 3BESR 5FKAB 4WUKH 4N1CA 1U91B 4FXLA 4M1DH 5F96L 5JPNB 4PD4J 4QRPE 1T7XA 1Q0YH 4MS8D 5IV2B 4KV5E 5SWZE 1VENA 4RFNC 5HYJD 4NT6A 3QDJA 4XNMB 2EDHA 5GHWL 1I8LA 4LFHD 1UT9A 1QFWH 2DIBA 5F97E 3KPRE 2PW1A 5IJVA 1JRHH 5JHLH 4K9EH 1K3IA 4CU7A 3Q5OA 2NY5C 4K7PH 5ALCH 4PJGA 2CSPA 1P5UA 3RTQA 1ONQB 1DSFH 2BFVH 4Z95H 3L7EB 1QD0A 3L3IA 5GSVA 4JAMA 2H2PD 5MENE 4U4BA 4KVNH 5JA8B 4MNQE 1X5LA 4BQ9A 3BGFC 1PQZB 4NM4L 5J56B 1A6WL 3BIBX 3OWEA 2C26A 1XF4A 3DUHA 2YXFA 1TJGL 3V0AC 3GMRB 4O2FA 1UC6A 1QYGL 3LKSA 1QA9A 2EIDA 2WAHA 4H5SB 3L3JB 4FXGA 3VFSA 3QEGL 1RIVH 4UNUA 1WITA 4GAFB 3HZYA 1OTUC 4M6OL 1BX2B 3IFPA 4M93B 1F00I 5FOBB 5MI0C 3P30H 1MJJB 4NRXB 2X4SB 4HWBL 1E4KC 1WISA 3VG0L 12E8L 3N9GH 1WFTA 4P3WA 3AREA 4N0UA 4LLWA 1U6AL 4KI5D 4TVPE 3ALWA 3DWTA 3STZA 3L3GB 4JRXA 1TJHL 3VI4E 3FN9A 1S7XA 4NT6B 4YE4H 3QDJB 1F4YH 1G9NC 1XT5A 2X89D 1QP1A 3MZTA 3AY4A 4XPGH 3QIUA 5DI8A 2NXYC 4QF1A 4PLKC 5L9DH 4PR5B 1FNEA 3MRMA 2PW1B 3GDBA 1CGTA 4MQ7A 4PJGB 5C07E 1VA9A 3RTQB 3O2DA 3SCMC 2B2XL 5GSVB 4JAMB 2ICWB 4NNYB 4O4YH 4Z8FL 2Q3ZA 2PW2B 5AAMA 5GS2D 5IBUB 5IB3A 3NH7H 5DTFA 3RWEA 2ZUXA 2VQTA 4OQTH 5I1GH 4JDTH 4QNPF 1QSEE 2BNUB 5DD0H 3WLWC 4RIRA 1E28A 1HHGA 3QT2A 3W9EA 5K9KA 1DEDA 3MV7D 4O2FB 3MLWH 4JO1L 1MAKA 1V3KA 3QI9D 4ZOEA 4MJ2A 3LKSB 1QA9B 4LSTH 1ZLUH 3D2UB 4FFWC 1T2XA 4IIQA 4GRLA 4FXGB 3TYGL 3VFSB 3QUML 3HZYB 4K9EC 5GRUH 3IFPB 1KEGH 4OI7A 3B3IA 3U0PA 2WWMC 3W82A 2N7BA 2VAJA 4PJ5A 4EUPG 3AREB 1CT8A 4N0UB 3DVGB 3LS4L 1TZIA 4LLWB 4ODHH 4ZTPL 3D3VE 5E5UB 3TJHD 3HR6A 3JXAA 1G7MA 3GMMA 4JRXB 3DETC 4OLWH 2AJ3A 2XZZA 1S7XB 2HRLA 1IGCL 1UM5H 4JO4H 5I74C 1EEUA 4F7PA 5DI8B 3QIUB 1LO0H 2Z35A 5GPRA 4QF1B 2ZPKL 5AD0A 4OZIE 4JFHD 5HHOD 1NCBL 4JG0L 4JB9H 1FNEB 3MRMB 1DBJL 2EXWC 1WK0A 3FRUA 3U7AA 1TZGH 3HE6D 4MQ7B 4ZFGH 4ZUVA 1B0WA 1QLEH 2XG5A 3WDJA 5T3XL 1YEKH 5JW5A 1KN4H 3OL2A 3NCEB 4OZGE 4OFKA 1IEAB 2BY0A 5IB3B 2WV3A 3RWEB 4WVRA 2YS4A 3ZE2E 4RIRB 1E28B 1HHGB 3W9EB 3QH3A 3VG9C 5K9KB 3JWDL 4MQTB 2YK1L 1MH5A 2VLJE 4HULB 1HHKA 3V8CA 4N90D 1Q1JH 1RZ7H 4IIQB 4GRLB 5GIRA 3OKNA 5CZXC 4HW6A 2CO7B 2VLRE 3B3IB 4QXGH 3U0PB 3O3AA 2FRGP 3DNKA 3KYKL 5DMIH 4PJ5B 1CT8B 4PRHE 1TZIB 2ZUUA 1CFQA 3RZCA 3SO3C 1G7MB 3GMMB 3FN0H 2AJ3B 1KJ2H 3MO1A 3ZSSA 5BZDA 2J2ZA 4X6DA 4F7PB 3WV0A 4P3DA 4CDGC 5AD0B 4LHUD 1UM6H 2X5PA 1LEIA 3GJEA 3FRUB 3O8XA 4NKIL 3GMQA 3V6BR 2LAAA 2DQGL 4ZUVB 5IQ7L 1YY9D 5I1CL 4KAQH 5JW5B 1FFQA 1TCRA 5D2NA 3EGSA 1I1AC 2FECI 4OGXL 3OKLA 1G9ML 1YNLL 3MV8D 3TH3T 3WNKA 1WAAA 1EO8L 3T0XA 5C0AE 2HTKC 5EG6C 5I8KL 2NCMA 2DLFH 3KXFA 1II4E 4LASH 3QH3B 2AQ2A 3HAEG 1MH5B 4RBPH 1HHKB 3SDAD 4NO3A 4ONOA 5GIRB 2ZCHH 3OKNB 5DHYA 3TWCL 2JK5A 1JTOA 3O3AB 4XHJD 3IS0X 3E8UL 4HKZA 1VPOL 3L95A 1S78C 5J12B 5F7NC 3NCMA 3D39B 3TPUA 2P4AB 1CFQB 3RZCB 4Y19A 1HIML 4LCUB 1T1YA 2H26A 1D5ZA 2IJ0C 2J3SA 2B4CL 3MO1B 2UVFA 5BZDB 5C71A 3LPFA 3X12B 1YQVL 2QADC 4N0CD 4X6DB 2VDKH 4GSDH 2OLDA 1LEIB 1XEDA 4ENEC 1RULH 1T21A 2MSPA 3O8XB 3GMQB 4M5YL 2ICWI 3FZUD 5ID1A 1P9MA 1WZLA 1KC5H 5D2NB 4S2SA 3MA9L 4DTGH 3OKLB 3ARPA 5IJKC 4OCXH 2A0LD 3M8OH 5EU3A 5F7LB 3LB6C 1CDHA 2D9QB 5GS3A 1J7VR 1QFOA 2FGWH 3WNLA 1BGXL 4HK3J 4YAQA 4IEFB 4NFBA 4CVWA 4WTXA 2QSCL 3FCTA 3BGMA 3KXFB 2FZ3A 3P9LA 3HZMA 4XAWL 4UIKH 3DGGA 5D2LF 1AGBA 5FYLD 5FAAA 4JPKL 3GHEH 2Q87A 4Y0GA 5DHYB 5E03A 4L5FH 5HYEA 2JK5B 4NBYB 4H20L 3LVEA 4JE4B 1H8NA 1IC7L 3PWPD 2FIRT 3QUYC 5C3TA 4HKZB 2KZWA 5T1MA 5JR1L 4ODWB 1NKRA 1X3DA 2J6EL 5E2UL 2PR4L 3ARDD 3TPUB 4DEPC 1EGJA 1F4XL 2WLZA 4XVSL 1QRND 4GRMA 5CKAA 1T1YB 3VXSE 2H26B 1F5WA 1CK0H 2DI8A 5JIIA 3AXLA 1YNTA 2BXZA 4ZUTA 4CN4A 4NC2B 4GW5A 4PJEA 5D70H 1UWEL 4GKOA 1NFDE 4YHOH 5HVFB 4ODSH 1B2WH 1T21B 2B1HH 3IXAA 2V2TB 5HGDA 4PBWD 5GZND 4IRJA 2A6JA 4YDIH 5ID1B 1A3RH 3DXAE 2HT2C 1C5BH 1A4KA 5TPWL 4S2SB 5ICZA 3BE1L 3UAJC 4ZOCA 4TSCH 1BJ8A 1KFAH 4KKLD 5EU3B 1AJ7L 5K33A 4LVOB 4ZPVA 1QLFA 4YAQB 4YBQC 4LGRB 3FCTB 3BGMB 3NCYP 2FZ3B 3P9LB 3QIBA 5J11C 1LO2L 3HZMB 4JM4H 1U8IA 4BZYA 4G8IA 5F6HJ 3QCTL 4Y7MA 5LXGL 2GITA 1M7IB 3DGGB 3U83A 1AGBB 5C09D 2W0LA 1FVDA 4ZNEA 4G80A 1MCKA 4AZ8A 3NFPA 1N6QL 1GAFH 5BO1L 4LNRA 4F15B 4OIAA 2NXZB 4KGJA 1F2QA 4FNLH 4HGWA 5ABDE 1F58L 1NDMB 1NMBL 4OFYA 1GPOH 4JKPH 2BNQA 1NCCL 4FQPA 4G5ZL 1FPTH 2F8OA 3N50A 4HQQH 3CMOL 2LTQC 4MVBD 5DD1L 1XGRA 1SYVA 2OL3A 3DYMA 3AXLB 2OP4L 5L2JA 1YNTB 4ZUTB 2ESVD 4MDJA 1OL0A 3RQ3A 5J3HD 4XZUB 1WUNT 3PQYD 1ZE3C 2ARWA 3VGAB 4HXAH 1F90L 5HGDB 4HT1L 2A6JB 3O4LE 3WEXA 1A4KB 1W72H 3EHBD 4D94A 1TTUA 4F9LA 4XMPH 4CNIA 3DMMC 4W4NA 1R5VA 2A74A 4EQ2A 4ZPVB 3O9WD 3JV6A 1QLFB 4HPYL 1BFVL 3I2CL 4ZOAA 5JXAH 4IMLA 4OFIA 2NW3A 1U8IB 3I75A 4KHXH 3C2AL 2GITB 1R5WA 5C0CB 1HZHH 1GZQA 3IDUA 1FVDB 4YDKH 4KHTL 2EYRA 4G80B 6FABL 3NFPB 2HLFD 3MLYL 3FB8A 3KJ4C 3MCLH 1DP0A 4LNRB 3EYUH 2RBLA 5HYQA 5JDSA 1QACA 2XQYG 1IC5L 4HGWB 5D5MF 3MUHL 2ZUQB 2YUVA 4X6CE 2BNQB 4KMLB 3WLBA 1ADQA 2VLME 4WCYH 3T0ED 1FNSH 4M48H 1XGRB 1SYVB 4YDLC 1QLRB 3WE6A 3RVUC 5HBBA 2WUBH 4P59H 3CU7A 4W6YB 5L2JB 4F7CA 5FB8B 1NSNH 1XF1A 4WHCA 1IFHL 4ZO7A 1OQXA 1PAMA 1ZGLP 5D72H 1J12A 4M03A 1NMAL 5GISL 3RAJH 3WEXB 3ULVE 5IFJA 1I8KA 4Y1AD 4CNIB 3H3BC 1R5VB 2A74B 2F5AH 2HT3D 5C6PB 4WHDA 3GIZL 3JV6B 4CRPA 1WFOA 3RNQA 4U6YA 1XGQB 5GGUA 3CK0L 4IMLB 3ARYA 2NW3B 5EU6D 4UV7L 2QQNH 3P40A 1BQLH 1R5WB 2DF3A 5IEHA 1MJUH 3VXRA 2PTTA 1GZQB 1E4KA 3DVFA 3PV7A 4XCCH 4OV5A 5EUKA 1AP2A 3FB8B 5I16B 4CJ0A 4HCRL 5HYQB 5JDSB 4J3UA 4RGND 2XICA 3O6KL 5TQ2H 1QR1A 4RFNB 3MOAH 5DD6A 3QDGA 1V3LA 3TO2A 3VFOB 4TQEH 4YWGL 3L5IA 3GK8L 3UZVB 2J88L 3KAAA 2BK8A 2X4UA 1OARL 3IFOA 4OZIF 3SCMA 2F8XC 1WEJL 4F7CB 2A77L 4LLMA 3LN5A 1MCNA 2AEIT 4F7EA 4NQDA 1NFIA 3Q6GL 2WP3O 1INDH 2MJWA 3DRTA 2P5WA 4D3CL 3BGFB 3FFDA 4LF3A 3ZDXE 4NPYA 1I8KB 1FIEA 3WNMA 4H88L 2X70A 1L6ZA 4OZGF 2V17H 5C7XH 5MHSE 5KS9A 1BM3L 1EAPA 2X1OA 1YEIH 1G0YR 1S7RB 3ZHKA 5ESVA 3BWUC 3JWNC 3UJTH 5TE7L 2B8OT 1EJOL 1KPRA 1ZVHA 2CKBL 4U6YB 5GGUB 3BQUD 3JV5A 4KQ4H 4UDUA 1HILA 5MI0B 2M1KA 2W38A 5IEHB 3NA9H 3VXRB 2PTTB 3INUL 3N0PB 3KPSE 4OV5B 1F3DH 2C3WA 5EUKB 5K59E 3OB0H 1C5CH 1AP2B 2EH7H 2BDNH 1I9RL 3L5XL 3HB3C 4L4TD 1KPUA 5DS8A 3SE8L 4K8RD 4PS4L 2E6QA 4HDIA 2YWYA 3MMEB 4EIGB 4U05A 4NNPH 5CJXC 4YX2H 5DD6B 4Z7QE 3QDGB 1MIEL 2NXYB 1OT1A 4NWUL 5AZ2H 1EPFA 3MACH 3TO2B 3O2WL 3KPPA 1S7SA 5HYJE 4ERSL 1BBDL 2HFTA 5FGCB 5FHAL 2X4UB 3IFOB 4PJFE 2BX5A 2UWEE 4LLMB 5CSBA 3LN5B 2ADFH 2DYPA 1AR2A 3MRJA 4WWKD 4F7EB 3ROOA 4PRAA 4NQDB 4U6VH 1LDSA 1NFIB 2BSSA 3DRTB 1U41A 2P5WB 2I60H 4PTTA 2IAMD 1FYTE 3FFDB 3OPZH 1LGVA 4LF3B 4NPYB 1IGYA 2APTA 2X70B 1G7JA 5KS9B 4UBDD 1EAPB 5EBLA 4K3DH 4XPFH 3HMWL 4JG1H 4WDIA 5D8JL 5I1DA 3P0YL 4ODVL 1D6EA 1VGKA 5ESVB 3GMNA 4H0GA 5CHNA 2XA8L 3V6OE 1KPRB 1BZ9A 3CSYA 4DKDC 4U1JA 2VN4A 4NQCA 1DJSA 4UDUB 1QR4A 4I3RH 1CU4H 1E4WH 2A6IA 2NX5A 2DJSA 5ADOL 1NEZA 4F33B 4POZD 3NABL 2X4OB 1KPUB 5DS8B 4OQTA 3LZFL 3FFCA 1MFNA 4HDIB 2PCPA 3SE9H 3TBWA 5I74B 3MNWA 4I3GA 1T7WA 1VFBA 2WBKA 2YEZA 4OIIL 3DX7B 4KI5E 5F7FA 3RUGA 2UY7A 4KKBD 2BY1A 3KPPB 1S7SB 1BQUA 3MV9A 3REWB 3QDMA 4UB0H 1MVUA 3PXHA 5E6YA 4HXBH 5EU4A 2DL2A 1I1AA 2DYPB 3Q5TA 3MRJB 1V7MH 3ROOB 4XI5C 5ILTH 4AIZA 1EX0A 3OKYA 1N5YL 4E9LA 1PX4A 1S5IH 2BSSB 3H3KA 2VUYA 3EZJB 4PTTB 3MLUL 2BVOA 1LDPL 2B1AL 1CDBA 1IGYB 2APBA 1BOGA 3VI3E 4WWID 2YUXA 3CSPA 3VG9B 5EBLB 1J18A 4WDIB 5ESQA 2MPAL 1EBAA 4NJAL 4Y4KD 5I1DB 2DIAA 1D6EB 1TNNA 1KLUA 1VGKB 4OLYH 3WUWG 3P4LA 2YPLD 4S1DC 3QR2A 1YNKL 2Q76B 3CSYB 4BSWA 3BGAA 1FZJA 1JMXA 1L7TL 1J86A 3C5SB 1G1CA 3BXNA 3MV7E 3X11A 2XZAL 4R90L 4KMQA 5I8EA 1DLFH 4WENB 1T4KA 2NX5B 4NCC1 1CTOA 2COQA 3C60D 2FSEB 1NEZB 2HT4D 5JLZA 3EJZD 3SO3B 4ZFOL 1KB5H 1B3JA 4KK6C 1C7SA 1HEZA 3MUZ1 3SDXF 4LIQH 3TBWB 4H1LG 3MNWB 3VGFA 2YEZB 1VFBB 1YYLL 3HE7C 4S0SD 4WGWB 1P7HL 2PF6A 1OLZA 1NGWA 1P6FA 1Y6KR 3LDBC 4WU7A 3RUGB 3BZ4A 3OXSA 4ZFZA 2NYYC 3R0NA 5KSAC 4B0MM 3MV9B 5INDA 1UCBL 3BEWA 3QDMB 1C12A 3LEVL 3TV3H 3U9PH 1MVUB 2PNDA 3JTTA 5EU4B 4JFHE 5HHOE 3FONA 3KLHC 4HWEH 3OJDA 3RWCA 2IH1B 2XYCA 4AIZB 5IJKA 1KCSL 1HNGA 5HI4C 2R9HC 2BVOB 3UZEA 1BOGB 3BDYL 1YPZE 3GJFK 1DQMH 1KJ2A 4PP1D 2A9NH 3IDGA 4L8SC 5ESQB 3U0WH 4E41A 3UBXB 2GK2A 1KLUB 2GJJA 2NY4C 5F1SA 5KANI 3NCYS 2KUTA 2W92A 4DOHE 1MCEA 1KN2L 1KIPA 3BX7C 4CMHC 1P4LA 5IVZA 4BSWB 5I1JL 4BYHA 1FZJB 4K07A 1QKZL 3BXNB 5L2KD 1REIA 3X11B 4HKXA 4YUEH 3AUVA 3QUYA 4RAVA 4N90E 5I8EB 1YEGL 4UTAH 1T4KB 2IEPA 4G9FD 5JLZB 1J8HA 5I1EH 5IP4A 1YEEH 3G9AB 4OTXH 5I18L 1HEZB 3GM0A 1YUHB 3NFNA 1F4HA 2QADB 4XPBL 1P5VA 1I7RA 2JIXD 3IKKA 2AGJL 1H3VA 4ZOBA 2W0PA 5B4MC 3BZ4B 3OXSB 1NC4A 4KMTL 4GRWH 4DUWA 1JWSA 2RQ8A 5D1ZD 5INDB 3QBTB 3BEWB 1FRGL 1C12B 4ZAKD 4AEFA 5E8DH 4HUNB 1HNFA 4UILH 1QSFB 1U8KA 4G6AD 4FZEL 3IAQA 4PJ7A 2FBOJ 4YR6A 3OJDB 4WI4A 3RWCB 3N1MC 3BAEH 4OBRA 1PG7W 1BEYH 2RCSH 2X7LA 3DX8A 15C8L 1KJ2B 2JF1A 5BVPH 1K6QL 3IDGB 3MV8E 4U6HB 3RDTD 2HH0H 1N6VA 4HF5H 4E41B 1RZKL 2MCPL 1QFWI 4KTEL 3O45B 1JRHI 3GSRA 1KIPB 1J87A 1OGAA 5E00A 5IVZB 3OG4B 4XWGL 4EBQH 2QQQA 4M7JL 4HKXB 1IC4H 1ZXQA 4QGTA 2NY0C 5CJOH 4OGAD 5I8OL 3CGTA 3QUYB 5ITFA 5ACMA 3M1BA 2F8VA 4LVNC 2OK0H 3BKMH 3MLRH 2FD6H 1UWXH 2DQHL 4PJDA 1DL7H 4DEPB 1GGIH 1J8HB 4M61A 4NUJA 4G7VL 1UYWL 3U6RA 4HFUL 5EU7C 3B2VH 1AR1D 3NFNB 4OLUH 1FG2A 1F97A 4IDJH 5BV7C 1I7RB 4MD0B 5HDQH 5ALBH 1QBLL 1T83A 5EIIA 3WKNA 3BH9A 1CFSA 3KYOA 2VYRE 1IGFL 1NC4B 2WUCH 3BYTA 4KJQC 2KBGA 5CLTA 3N1GC 4NN5C 4LSVL 1JWSB 1KJ3H 3RVXD 4ZUWA 1KJVA 4YHYC 2OJZH 4P2QA 1U8KB 4PJ7B 4YR6B 5FA3A 1NLBH 3DMMA 5KVGH 3CDYA 2OM5A 2VERN 1QUNA 4JZOA 4GMSH 4Z76A 4U3CA 2OMNA 4QXUL 1URLA 1H15A 4IM8A 4AEHL 3DX8B 5J11B 4JFEA 5CWSB 2R0KL 1DFBH 5EBWA 1K9TA 1ZT1A 1MLCA 3RA7L 4JO3H 3OAUH 3GSRB 3CFIC 4CVUA 4GAJL 1MEXH 1OGAB 5E00B 3CIQA 1BPVA 5GZOC 2FR4B 2P8MA 3KPMA 4N8VG 5ENWA 5ITFB 3ZYOA 5FYLE 1JZ7A 4PJDB 5B21A 1MCHA 2L7UA 4TTDC 3QNXA 4H0IA 4M61B 4NUJB 3HPLA 1OAZL 3PWPE 2VXTH 2LTQB 2X4PA 3U6RB 5FM5M 1HSBA 3MJ7A 3QHFL 5I71C 1WCBB 4G6FD 3RVTC 2Y5EA 3K2UL 1FG2B 3I6KA 4OD3H 5IG7A 4Y2DC 4TPRH 1G6RH 4Q9RH 1QRNE 1KB9K 5EIIB 1CFSB 3BH9B 2AI0L 1MHHB 4NFDA 2RR3A 5DEFA 4ZUWB 1IKFL 1KJVB 3VXUA 4P2QB 4EJ1C 5KTEL 1RQ5A 2Y6SC 4JN2B 4PB9L 4RMWA 5FA3B 4E5XA 3DMMB 2RIKA 4M5ZL 4KRLB 1CFTA 4C56A 4NQUA 5CAYB 4O2EB 1NBVH 3VFMA 3ZDXF 3QWQB 4Z76B 5F7HA 2DICA 1K8IB 4RX4A 4K3EL 4LNVA 2Q86B 1T04B 1P4BL 4W68A 4TVPH 3AVEA 2Q8AH 2WK2A 5EBWB 1ZT1B 4ZTOH 1JWUA 2YR3A 3U0TA 1MLCB 2AJSH 1MFEH 3RY6C 1A5FL 4RFOH 4J3SA 3KJ4B 4YO0A 2AXJA 3VXMA 3KPMB 5ENWB 5C09E 5K59F 5I1IL 5E2TL 1HINL 1W72A 1MCWM 4DCQA 1OAUH 2E8YA 4MAYD 4DVRH 1MFDH 2VZOA 3QNXB 3HPLB 3LAFA 1FNLA 3JBG7 1NMCB 3TN0C 4PRPA 1JNLL 2X4PB 5BS0A 3CSGA 1HSBB 1WIPA 1UB5A 3ECBA 4YDLB 3U9UB 2ADIA 1SBBA 4GG6F 3I6KB 5IG7B 2J5LC 4JPIA 1RUMH 5FV1L 4WEMB 3WIIL 3CC5B 3T4AB 1MCBA 1T5XA 3JVGC 3NFSL 1FLTX 3QPXH 4HIXL 1YYML 3TT3H 3W2DH 4G3YH 3FOLA 3QWOA 3K1KC 1G7LA 5DEFB 2UWEF 2ESVE 1RSFA 3MXWL 1WZ1H 3TA3C 1INQA 1CLYL 1OVZA 2EE6A 1LO5A 1QQDA 4G9DA 1FG9C 4E5XB 1MFCL 5E08H 3PQYE 1CFTB 4ALAL 4C56B 2F58H 4XCFL 4AEIL 1XF5A 3VFMB 4S11A 1DE4A 3QAZC 2WLYA 1JTTA 4R2GC 3UTPD 3V5HA 1T7VA 4RMSA 4XNUH 1J8KA 2BVUA 2W9DH 5KVDH 4MA3A 2VXVL 3UYRL 4PJXE 1RZFL 2UUDK 4CN1A 5F21B 1JWUB 3U0TB 1A7PH 4EKXA 3U1SL 5I76A 2ZCLH 4LOUD 4MQSB 1OP3H 1X5KA 2XN9D 4H1LH 4P5KA 3GSXA 4X4XA 2A6DA 3VXMB 4ZS6C 4KTDH 5C70A 2VDPL 1W72B 1PD6A 4DCQB 3PUCA 3NACL 4IRSC 5DD5L 5JORA 4JM2A 2C9AA 2R4RH 3ILQC 3H42L 4U3XA 4D0BA 1QO3A 1MF2L 4PRPB 5BS0B 1O0VA 3ECBB 1SM3H 3CFDA 1GHFH 2VITA 1EZVY 4NRZA 2ADIB 3VFGH 5JOPD 4OZ4A 4U6TA 1E6OH 2X1PA 1I75A 3T0EE 1T5XB 1JCKA 2ED7A 3FOLB 3OR6A 3QWOB 1G7LB 4MQXC 4ONFL 2W0FA 5F8RC 1INQB 1LO5B 2B39A 1AFVL 5CILH 4G9DB 3VFUB 1MWAH 5A16A 5GHWH 3U46A 1XF5B 1AC6A 4X7DC 3VI3F 3SDCD 5FUZL 3T2NL 4KZEL 2X4RA 4G8FA 5GGRY 4Y1AE 4Z0BL 4GAGH 1VFMA 2GY7B 2R29L 2R23B 4J23A 2LV4A 1I7UA 5GS1C 4PRBA 4OLXL 1BFTA 4J12A 3S36H 3VE0B 1ZT4A 3WHXA 3C09C 2EICA 3UJJH 3V0WH 2ZUYA 4DWHA 1BZQK 1T0MA 1HOCB 5I76B 3LKOA 5EU6E 5JW3L 2ILLA 3GSXB 4CU8A 4X4XB 1CLOH 2A6DB 2J12B 1A6WH 3EOBA 3ARBC 3IETA 2R0LH 4LSQH 4HIIB 3TT1H 2CGRL 1J10A 5JORB 2PXYD 3WDHA 4OAWA 4FTVB 4RGNE 4D0BB 4TVSa 1QO3B 5C08A 3QJHB 1HH6A 1JK8A 4KZDH 2NZ9D 3CFDB 3H9YA 3JSSA 1E4XI 4TNWK 1FIGH 4M6OH 2VITB 3EDKA 2AW2A 1KJMA 2DQCH 4NHCH 2XACC 5DQJA 2EDWA 1R3JA 12E8H 4ONGL 3RX8A 4LLDB 1IAOA 3CU1A 4HWZA 3MJ6A 3DHJA 3OR6B 1IGIL 4KDTC 2W0FB 1N4XL 3HS0A 5FIEA 2R39A 3PNWA 4EOWH 1GC1L 2DWEA 2QQKH 5A16B 3U46B 4DUXA 4N5UA 5F7YC 3WIFA 1PG7X 4BZ2H 1YPZF 3TBVA 1S9YA 2OZ4L 5C9KA 2X4RB 4G8FB 5TGBA 3V4UH 3I3DA 1QEWA 2F54A 3FO2A 1GGCL 3O4OC 1WC7A 2H45A 1I7UB 2QLVB 3KVQA 1BD2E 1HYSD 4PRBB 4N0YL 3ZKSD 5I9QC 2VDLH 1ZT4B 3WHXB 4JFPB 5ETUA 5DF0A 2APWA 4WU5A 1G0DA 4A6YL 4Z8FH 1T0MB 3LSOA 3EAKA 4F37F 3FKUS 3ARGD 4DGIH 4FQXA 1JGLL 2MTPA 2X9YA 2R0ZH 5LWYH 3EOBB 4I0PD 3IETB 4O5LL 2B5IC 3HE7A 4L4TE 1HHIA 2VDOL 4OAWB 5C08B 2VB5A 5KSUA 1Q0XL 4LFHG 1HH6B 2YUWA 4NUGL 1JK8B 4Y2OA 1XIWC 1YN7A 1PYWA 1WV7T 1GZPA 4PRNA 1NCTA 3ZTNH 4ZUSA 1KJMB 3BSZH 4LCIL 5DQJB 2ZCKL 1R3JB 1CLCA 3SPVA 3WFHA 1U92A 4P4KD 2F53A 2XWBA 2CK2A 4YJZL 4HWZB 2DAVA 3S4SA 2Y4SA 3HS0B 4D9LL 4NGHH 3PNWB 5IHBA 1IC1A 4L8BA 3WJLC 1HDMA 4P48A 3UDWC 3T65A 2DWEB 3U7YL 3HRPA 4L8SA 2GHWB 5E94B 4HZLA 3WIFB 3X3FL 1UKTA 1S9YB 3TBVB 5TGBB 2F54B 3FO2B 5BMFH 2ZUWA 1ZTXH 2X42A 3PHSA 1WC7B 3W5NA 5I1LB 1HXMA 2HTLC 3WFBL 4X6FA 3TCXA 1N8ZA 5ETUB 1WCQA 2D03H 4WU5B 5F9WC 3LSOB 4QTIL 1NKOA 3HN3A 5JZ7D 1AQKL 4XNXH 3MREA 1TITA 2AV1A 3JWDH 5HGGS 3H9SD 1HHIB 3LDBB 4QXTA 3MYJA 1K8DA 5JXEA 5KSUB 4PG9A 3B5GA 5KSAB 1YN7B 1PYWB 1R6VA 1GZPB 4GBXD 4PRNB 3AS2A 1B0RA 1KB9J 3BP6A 4IOFD 1A7NH 5DC0A 2QV2A 4AQ1B 1NLDH 3SPVB 3WFHB 1U92B 5DVKA 1YMHA 3FMGH 2XWBB 5IK3A 1MCSA 3S4SB 1WLHA 4OFVA 1DLHA 4ZSOE 1TCMA 3RGVD 4L8BB 1HDMB 5FCUL 5L6YL 3T65B 3FQUB 3UZQA 1KB5A 2JKXA 4L8SB 2CDEA 4X7SH 5CKGA 1CI5A 2WQ8A 3MA7A 2NY4B 2EXYD 5CUSL 1MCOL 1MJ8L 3FTGA 4PV9A 4CMHB 2D7TL 4P0DA 1MCJA 5D9SA 3O3UN 1ITCA 2VDQH 3B9EA 1HXMB 2AK4A 5INCA 2V5SA 1OSPH 4X6FB 1N8ZB 3IFLH 2JCCE 2YPLE 1UQSA 5CEZD 1G9MH 1WIOA 3SGKC 3ZMRA 1MQKL 1YY8B 5BRZD 1F4WL 3CFKA 4Q9QH 2IFGA 3MRHA 4APQD 4G42A 5CLWA 4MB3A 3VWKD 2GJ6A 4FFVC 3MREB 2FO1A 2AV1B 2E9BA 3VRLE 2EEDA 4G8EB 1A9EA 2XG4A 3BKJL 4QXTB 4QRRA 3MYJB 1K8DB 1I1FA 4PG9B 3UPAA 1CCZA 1RVFL 5DRXA 1B0RB 3BP6B 2FB4H 3PHOA 3HUJE 5J9PB 2R69H 1YMHB 2ZG1A 4JQIL 5IK3B 1DLHB 5F7DB 1QPPA 3X14A 5IVXE 4JFOA 3G9VA 3SQOL 2B4CH 1V05A 3BPLC 1F2XK 1HI6A 2E8ZA 5HI5C 5BOPA 1KB5B 1LILA 2ZJSL 2CDEB 4TNVK 3JWDC 4ETQA 3MA7B 4LCWA 1JGVH 3FTGB 5IW6A 4PV9B 1UA6L 5CJQL 2QQLL 5D9SB 5KSBE 4MA8L 4MJIA 4PFEA 1SYSA 5L0QC 4F7TA 2AK4B 4UV4L 5INCB 2NY0B 3U2SB 4F3FA 1CLZH 4LVNB 1JI2A 4LSRH 5D2LA 1U3HC 4XVTL 4HPOH 1NEUA 4HS8H 1IZKA 4YHPA 3D9AL 3PL6C 3CFKB 3EUUA 4XNQA 5IR1A 5L2KE 1XCTB 3P3YA 4G42B 3MJ9L 2GJ6B 4PJHA 2XKUA 4YQXL 3BN9D 5SWSA 4XAWH 4PGBA 2CUIA 1HQ4A 5BV7B 4G9FE 4Y2DA 3MUY1 3ULVH 1A9EB 2FJGB 4GLRH 4QRRB 5IGXL 1I1FB 4JPKH 1JYNA 2DM4A 4FQ1H 4NN5B 2YPKA 4BFIA 1H8SA 4FQJL 5DRXB 4YHYB 1JF5A 1IC7H 4CN6A 3PHOB 3NGBC 1P4IL 4P9HL 5I19L 4G6MH 4Z7UA 5T1KD 2PKDA 5C0RL 5E2UH 2DLTA 1X4XA 1BWWA 1G9MC 1CL7L 4M7LT 35C8L 3X14B 3ZKNC 4JFOB 1AXIB 1RUQL 5E8NA 3ET9F 3EYVA 4NC0B 4KWUA 1HI6B 5I15L 1YEHL 1DVFC 1QOKA 4L3CA 3LMJH 5T33L 2C4FT 5D7LA 1UWEH 4LCWB 5IW6B 3RY6A 2JJVA 3QFJA 4N0FA 3D2UD 3MRRA 4MJIB 1JPFA 1SYSB 4HIHB 4GRWB 4G6JL 2C3GA 4AMKL 4F3FB 1A6UH 2YPVL 4XP4H 3DECA 4K94H 4O00A 5D2LB 2VXQH 1FNGA 2UV3A 5TE4L 5EO1A 4YHPB 5KSVB 5IR1B 3QWRD 4PY7A 4XNQB 4XVUC 4QGYA 2ICWJ 3TN0A 1BZ7A 4AK1A 5I71B 4PJHB 1ZLVH 4KK8D 5SWSB 1DANT 4PGBB 1HQ4B 1RIUL 2IMMA 1CDYA 4Y2DB 4QRPA 1AE6L 3E3QE 4GUPA 3JVGA 4JFQA 5SWZA 1B9ZA 5JTWA 3O6FD 1YEJL 4LSSH 2Y36H 5J57B 5DLML 3TA3A 5CGYD 1LMKA 2WBJA 5GGVL 4P3CH 3B83A 3IDNA 3QHZL 3KPRA 4Z7UB 2VDNL 3WBDA 4D9QD 3WKML 1MCPL 1EZVX 3TJEL 3CMOH 1FC2D 5JOFA 4NOBA 5E8NB 3EYVB 1MPAH 1ES0A 2EDJA 5MENA 2E6JA 4MB4A 2Q6WA 3D85A 5GXBB 2WBWB 4L3CB 1CXHA 3TZVD 4QEGA 3HG1B 3ULVC 1G6RA 1DBAL 3NOIA 3IU3A 1F90H 2C1PA 3QFJB 3GRWA 3LKRA 4N0FB 3MRRB 3MRNB 1JPFB 5ECJE 2W9EL 1IGML 3SDDD 2YN5A 3GMPA 5HGHA 4I77H 2AJZA 4CVXA 1FNGB 1QBMH 4IRSA 4PJAA 3RJDA 4XBEL 5EO1B 5EZIL 3Q48A 3TN0B 1BZ7B 1JTPA 3VJ6A 5C86A 4AEEA 3LHPL 4UINL 1TQCC 3DI2B 3TP4A 1JNNL 2B0SH 4FQIL 5HJ3A 5BOZG 1NUGA 2J5LB 3C2AH 1AD9A 1MREL 2EECA 1U42A 4WUUE 4QRPB 4GUPB 4ELKA 4KHTH 5DJ2A 2LAGB 4JFQB 5SWZB 2UZXB 3QG7L 2M26A 3FO9A 2YD1A 2IGFL 4GXUN 4QHNA 5CCKH 1LD9B 4F7MA 5TE6L 2QKIA 3IDNB 5GS0D 3KPRB 5IEKB 3QAZB 4F57H 3OTTA 5F3BA 4R2GB 2IG2L 4K94C 4LDLB 1X5JA 5C07A 3TF7C 4Z7OE 2BVEA 5JOFB 3QIWC 5GGTH 1ES0B 1S7QA 5MENB 2Q6WB 5GS1A 3D85B 2BSED 4M62H 4BUHA 2H9GA 4ONHB 4A2MA 1RU9L 1QSEA 4RA0C 1RURL 4JHBA 1G6RB 4PREA 1OLLA 2BC4A 4PRIA 2C1PB 4TUKH 1N7MH 3D25A 4U1MA 5H2BA 4MLIA 5I30L 1D5XA 3CSBA 4W4OC 1Q9WB 3S5LG 3O81A 3GMPB 3GMOA 1UVQA 2GW5A 3IFNL 2AQ1A 2AJZB 2NR6C 4IRSB 5MEPB 2CRYA 2V5MA 4PJAB 3R8BB 4AY0A 4RGOH 3CFCL 4WJ5A 3A6BH 1ZEAH 4Q9CA 1E4JA 2RAMA 4WFED 1W2KT 3D39D 3VJ6B 4FQCL 1A7OH 1MNUL 5HJ3B 4LPVA 2HFGL 5ESAA 3D3VA 4ELKB 1X5IA 3SE4C 3S8WA 5DJ2B 1VSCA 1AKJD 1L9MA 2CIIA 4OLEA 4JY5H 5GS2H 3FT2A 3Q1SH 2B20A 2R56L 1XR9A 4KDTA 3C5ZD 4MHHG 3L9RA 1AQDA 3KPNA 3P9WB 4K23H 4QHNB 3LN9A 4F7MB 4OZIA 4H1LA 2H6PA 2QKIB 5ICXA 1SJHA 4MS8C 1MCWW 3EDDA 5B38G 4NZRH 2H2SD 3V4VH 1ZLWK 5F3BB 3LKPA 1KULA 5C0DA 4YWGH 4MX7A 4LSDA 1CR9L 2J88H 4GO6B 2E7HA 1OARH 1S7QB 4OZGA 3MLVH 5GS1B 4DGYL 2H9GB 3UTPE 1XZ0A 2Y9RT 2V2XA 5DA0B 3K3QA 3C09B 2YN3A 4Q0XH 1D5BA 5L7XL 2VOTA 4PREB 1H8OA 2BC4B 4PRIB 2H2PC 3D25B 1D5XB 2V2WA 5F9OL 3QQNA 3GSNL 2XY1A 5CJ5A 2VLJA 3ARBB 4JRWA 4M7ZC 3GMOB 5I66B 5E99H 1UVQB 3UC0L 3TH4T 3V6OC 1VACA 5DRZA 3EYSL 1MWAA 1JHLH 2HA1A 3WN5C 2XN9E 3IKCA 4WJ5B 4TULH 4IJ3C 3MBXL 2CKBH 1WWWX 3MNVA 1XIWA 5FYKL 4M6ML 1VB9A 2AEPL 3ZTJG 4ZO6A 4PRHA 1U0QA 5DEZA 5ESAB 5CINH 3D3VB 4DJMA 2DLHA 4DK6A 3WHE1 5DT1H 1AHWC 2CIIB 4RNRA 1IAIM 3FT2B 3I3BA 4KFZC 4QRQA 4TSAH 1RHHA 3L9RB 1AQDB 1FLRH 1OAXH 1TJIH 2FATL 4KI5C 3WJLA 2H6PB 3UDWA 5ICXB 1SJHB 1FL6A 4YXHH 2VL5B 3LKPB 1MUJB 3MV01 5C0DB 3KPQA 4MX7B 3GHBH 2FEDD 1NAKL 3MCKB 1CXEA 3O4OB 3QNZB 4ZXBD 2EH8H 4OZGB 4Y8DC 3UCRA 2V6HA 3R1GL 1B4JH 4HJ0D 1XZ0B 4PJ8D 5I9QB 2V2XB 1CBVL 4PGCA 1G9EA 5H37G 5I75B 3QQ4A 1W0VA 1JZ5A 5C0AA 2P46B 2CJUH 2V5YA 3IU4L 1V7NH 2V2WB 2JCCF 2B5IB 1UACH 1VACB 5DRZB 1MWAB 2AJUH 5D8JH 4C4KO 3GKZA 3IKCB 1QSZA 2XXCB 2YKLL 4YFEA 2HJFA 4Y8AA 3QI9C 4MD4A 3MNVB 1XIWB 5IW3A 1T20A 1Z5LA 5E8OA 2CKNA 1VGEH 2EO1A 3BP5A 3QFDA 2ATKB 4HWNA 2Z91A 1JHKH 3ZKXC 3W39A 1UH2A 5CEZL 3ZE1F 4YHZH 4RNRB 4V2BA 4PV8A 3ZKQD 2LABA 4QRQB 3HUJF 1RHHB 5ICYB 1LP9A 3TJHC 3HMXL 4R4FH 2I5YL 5EH1A 1FL6B 5LAXA 1Q9OA 1A02N 1T2QH 3S98A 3KPQB 2ZUTA 5GRZA 1XAUA 5HTSA 1GIGH 5BVJA 1CE1L 1D9KD 3HE6C 4PJBA 3NPSC 4XC3L 4R3SA 4I2XB 5FO7A 5KSBF 4YHMH 1W0VB 3SGKA 3DV4A 5F9WB 5C0AB 1FCCA 5C0CD 1QHPA 1ZLUK 5F1IA 3NIGF 3DUSB 4KJPD 3MLUH 2VKWA 4M7KH 2I27N 4ETYA 5IOPA 1O7SA 1IILE 2FECL 1NC2A 5TFSL 1U3JA 3BD3A 4BH7A 1RMFL 3QXUA 1SY6H 3MZGB 1NCAH 5C6TH 1MRCL 1IARB 4MXQD 4PTUB 4MD4B 1T20B 1JZ4A 1P2CA 1R5IA 1CFVL 1Z5LB 3SDYL 3MLXH 4N8VA 3DUUA 5E8OB 4M1GH 3WXVL 1AY1L 5C9JB 3JWOL 3E0GA 4S10A 1QZ1A 3BP5B 3QFDB 5C0EA 2Z91B 3EO9L 4R96A 3W39B 3VXSA 2X1WL 4PV8B 4YXLH 4UZGA 3O6MH 3BEVA 3STBA 2M8XA 2ERJC 1VESA 1LP9B 1SEQH 3HNVL 4JR9L 3F7QA 1UEMA 3RL1A 2CQVA 2NY3D 5C8JA 1NFDA 3FHAA 5FYJD 1NUFA 3A67H 1EAJA 5LGHH 4KVCL 5FYLH 2EYSA 2YOCA 3DXAA 2DQDH 1FJ1A 4M43H 3MRKA 2Q7YA 5BVJB 1F42A 3HI5L 1UCBH 3SJVB 1CWVA 3WFCH 4PJBB 3OBAA 1KSRA 1YY9C 5F1NA 5FO7B 4UAOC 3C8HA 4JHZA 1JP5A 4PJ9D 1KCSH 1U3HA 3DV4B 5B8CC 1DTUA 4URTB 5E6ID 3PL6A 5FCSH 4P2CG 1KELL 1U8MA 1NCUA 1NC2B 4GT7A 4HAGA 4BH7B 4YXKH 1DQLH 5EBGA 3BPCA 5HPMB 2OTPA 2DMKA 3O6LH 2FX8L 1HWGB 2PTVA 1PG7H 1B0GA 1ZANH 2G2RA 3SDAC 2EC9T 3VFWB 1QKZH 1R5IB 3WS3A 4N8VB 3DUUB 3H9SE 4WI3A 3WNPA 1Z3GL 5ERWA 5LBSH 5C0EB 2E5EA 4R96B 2Y06H 4J2XA 4RDQG 5C0BD 2NY1D 4XHJC 2C3XA 4NKOA 2XRAH 5D7IB 2F5BL 5CEXA 3RL1B 3BPLB 2C3HA 4G6KL 1JFQL 2IFFL 4OT1L 4LQ1A 5C8JB 1NFDB 4JHWH 4KKNA 1DVFA 4XPBH 4QRUA 1S7TA 2GT9B 4KK9D 3MGTA 2AGJH 4N0CC 2O5XL 4K55A 3O4LA 4Y4HC 3JUYA 2EYSB 3DXAB 4MJ5A 1FJ1B 4P9MH 4KMTH 3MRKB 2Q7YB 3FT4A 4NO0B 4FFYL 5L0QB 1OTUD 5A3ID 3FZUC 1SBSH 3JUZA 5F1NB 3V6ZA 1AD0A 3W0WE 1U3HB 1C08A 4RBPK 5FGBC 2W9LA 1A7RH 1JGUL 2VL4A 3PL6B 2A0LC 2WINA 4MNQD 3AS0A 3S34H 1U8MB 1FAIL 4HS6A 2EO9A 4X80L 5B3NA 2DQTH 5CEZE 3DYPA 1NGXA 5DHVB 4EXPX 1UZ6E 2H41A 4Y88A 4OF7A 1RZKH 1L7IL 2XIDA 2I07A 2K7PA 1JZ8A 3MR9B 4OSUH 1OM3L 3SGDH 2DBLH 4XAKD 2NXYD 1B0GB 2AJXH 1M71A 2DDQH 3VRJA 3RWDA 3WS3B 4M7JH 1PW3A 4X6CA 3UX9B 3NGBB 5ERWB 3IJYA 2Y7QB 4Z7VB 3VDCA 4JHAH 1Y6NR 4NKOB 1OTTD 1HN1A 3LPWA 5T5FL 1OPGH 4S1RL 3P0VL 3ARDC 1DUZA 2GKIA 5CEXB 2BOCA 5EA0L 4TUJA 1QTYT 3VGBA 4Z7NE 1FCGA 3ARFD 1DVFB 4L3AA 4JJ5A 4UT7H 4QRUB 2HRPL 3MGTB 4RMVA