3F5WB

Kcsa potassium channel in the open-inactivated state with 32 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal transport
molecule keywords Antibody heavy chain
publication title KcsA Potassium channel in the open-inactivated state with 32 A opening at T112
rcsb
source organism Streptomyces lividans
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB01
3MRLA 4NDMA 2AABL 1LE5B 5F89B 3ROLB 1G7JA 3VXRD 5JO5A 2EKSA 1IAKB 4L4VA 2BJML 4DGIH 1AGFB 3E0GA 1MI5B 1FDLH 2MKWA 1A7BA 2CRMA 3RUGF 1GJIA 3DXAD 4M1DH 5ILTL 1D3CA 2B1AH 2XOTA 5BS0B 1MCBA 4X98B 3VXQA 3NA4A 3MLYL 2BRRH 5H2BA 5DQJA 3ARQA 3HB3C 4Z76A 1FG9C 4PLJD 1V3MA 4G7YH 3P77A 2FEEI 4RX4A 4LLDA 4WEUD 3MUHL 1T83A 1AY1L 1UB5A 1YMHA 2Y5TB 5HGBB 5F88B 1HDMB 1OSPH 4MJID 3QQ4B 4NN7B 1LHZA 4M6NL 4QOKB 4GOSA 1OSZA 1DUYB 1DQJA 3OAUL 1OCWL 5C0IA 2BZDA 2GTWB 2AJ3B 4G9DA 4JRYA 2PW1B 1U3ZA 4YO0A 3P73B 3VRJA 5C08B 3CZFA 3ZKXC 4O00A 2WP3T 5EIQA 4HWZA 4Z0BH 5F9JB 3AU1B 3TIEA 1INDL 3WS3B 2QHLA 1FFOA 4G6JH 4F7TA 4X4XA 1MREH 1VEPA 3L5IA 4ODWA 4Z7NE 2X4PA 1A5FL 1K8IA 4YHML 4GXVH 4HEPG 1TCMA 3VXOB 4JRXD 2NY4C 4NQSB 3TJHD 3KPMB 5DHVB 4S1QH 1AFVL 2PXYD 3C5ZD 3CX5K 1E6JL 3GSWB 2V5TA 3BPNC 1AHWA 3RWJB 5KVDH 2CXKA 4N0RA 4OLXH 3TWCL 3LV3B 1I8IA 1LEGA 4V2BA 2F58L 1NBZA 3WIIH 4B5EA 1IM9B 1JZ4A 3BZ4B 5FOBA 5KSUA 5EO1B 3S35H 3F62A 1N5YL 4MXWL 5EUKA 3QZWG 5CCKL 3DMMC 2XTJE 2OXHA 4MWFA 1AR1C 4L9DA 4LCWA 4WTZA 4LSTL 4PRPA 1C5CL 5F9OH 2YWZA 4YHNA 1T7WA 3U79A 6FABH 1MFCH 5EC2B 4Y8DC 1PLGL 1R3KB 1TTGA 1JK8A 1CD9B 1JRHH 3KPSA 1X4XA 2UUDH 5SX4H 3RVXD 5B22A 2BNQE 1DQLL 1L9MA 3D3VE 1YJDH 1CFVH 3BH9A 3T0XA 1B90A 5JA9A 1QRNA 3BW9A 4G6FD 2IPKA 1IM3A 1NEZA 3MGAA 2NTSP 4LEXH 1H3TA 3WIFB 1FCGA 4HSQA 4LVEA 4NZRL 1I3VA 2ADGB 5KSAB 2VQUA 4C57C 1OD9A 4OLWH 1ZVYA 4OKVB 3VXRE 3CZJA 4IOIB 5A2LH 1VA9A 4YDJB 1SY6A 4FP8H 4S1DC 1X7QA 2XYCA 4GG8B 4Z9KB 5C0RL 4HKXA 1WT5C 2BSSB 3OG6B 3ZHDA 3TYGH 4ETYA 1TZGH 3DXAE 5EO9A 4ZFOB 5B39B 3U6RB 1RZ8A 3OF6D 3ULSA 4LEOB 4H8WL 4CVZA 3VFSA 5IP4A 2JCCF 4Q9BA 2PO6B 2BVTA 4NM4L 3S34H 4DKFH 1J5OH 2G5BA 1NMAL 2D7MA 2MPAL 1EBPA 4ZS6C 4RAVA 4PV9B 4OZIA 4EQ3A 4IOSD 4MJIE 4ODTL 1KB9J 3TCLA 4RFNB 2DB8A 5ESAB 1LILA 3R06B 1Z2KA 2G2RA 4GW5B 1CDJA 1CTOA 2MCPH 4A6YA 3WNPA 4FQCL 2AABH 1YN6A 4KKBD 5CEZD 1CG9A 2WBJB 1YDPB 2CKNA 1EAJA 2BJMH 3LPFA 2DMBA 1KB5A 5JHDB 1HHHB 3QUYA 4GUPB 3VGEA 4WW1A 1AGEA 3ARPA 3GM0A 5ILTH 4JRXE 5B4MD 3F65A 4PB9L 2C1PB 3BEWA 4JPVL 3GHBL 2R9HD 3QFJD 4NQCD 4HUVA 2Y36L 3F5WB 4GXUN 5ITBL 4JQIL 2HG5A 4G7VL 5F6HI 4R96A 1YEDA 2VNCA 2ENYA 4R7DB 5DHXB 1AY1H 4JZNA 5F7DB 3HHRB 4AENB 4M6NH 3HMXL 4R2GC 1OB1A 2UYLA 3DYMA 3OAUH 1OCWH 4URTB 1KACB 1T1XB 1MPAL 4FXKB 4J4PC 3RY5A 3ETBF 4I0PA 3MACL 4ENED 1PZ5A 3QXAB 3HE7A 2GJ6D 1FNGB 1EFQA 1MHHB 4AEIL 2DQFA 2XA3A 5TF0A 2DWEB 4MMXC 1INDH 2ARWA 1HE7A 3REWA 4MVBD 4UU9B 4G43A 4WIQA 3RWHA 5BQ7A 2QADC 3L9RB 4BFBD 1A5FH 4YHMH 3L6FA 4WDIA 1FSKB 4U7KA 3U36A 1JZ2A 1EJ6A 5IEHA 1AFVH 1E6JH 3BIAX 4HPYL 5FK9A 3ZYJA 4XWGL 1TTUA 2KZWA 3TWCH 4P2OA 4U1MB 5A16B 2F58H 1U8HB 3AREB 2LFGA 4YNYB 4JGUA 5F7MC 2WM0A 2EDKA 2WAHA 1N5YH 1HHIB 4MXWH 4QHKI 1T22B 5I8OL 5CCKH 3SJVA 3SDYL 4K71C 1KOAA 2IAMA 2XTLA 4GQ9L 4Q6IA 4LSTH 4ODUA 3DRTA 1C5CH 3C6SB 4JFOB 4PGJA 2OL3L 5GGRB 3ARZA 3STBA 2ZCKL 3O3AB 1JGUL 3IJYA 3G5YA 1PLGH 3WJLC 5D1XB 3BGAA 3FHAA 2AXGA 3MREA 4YXLL 2BNUA 5CUSL 5JZ7D 2YPKA 1IEAB 1DQLH 3VDAA 4WEBL 2M1KA 4PJ5A 5EOTB 4IDLA 1WFOA 3RNQB 5GZOC 3VE0A 4NOBA 4XBGA 5K9JL 2B5IC 3SDDD 3CFKB 4P59L 5FF6A 3STLB 1VESA 5E8EA 1CU4L 1R3LA 2OJZL 3UYPA 4NZRH 5CEZE 4JKPL 5F6IC 1WTLA 3T2NL 1CZ8L 2VZ3A 4NUJB 2VKWA 2IFGA 1M4KA 4WNQA 1N59B 3BPOC 3ARGB 1HINL 4AIZA 1NFKA 4APQB 5D2LF 3MJ9A 2JIXB 2OYPA 5C0RH 4FQ2L 1I1YA 3QWRD 3CSGA 1NC2B 3P0VL 1CGXA 1J8KA 3MLTA 4MLSA 4KK9D 3D2UB 1BOGA 4XPGL 4P5TA 3FO1A 4H8WH 4WO4A 1KUMA 2QKIB 4K8RL 2JTDA 4RZCA 1OP5H 5J1AB 2FECI 3QFJE 4NQCE 3UJIL 1RZGA 4NM4H 2RCSL 2DYPB 4EDWL 1U8NB 2A77L 4PJ8B 1NMAH 2MPAH 4YXKL 4X6CE 4QGYA 2CUHA 3NPZB 3V79C 4ODTH 3IFPA 5EPMA 4WWKA 1B0RB 3MRGA 2R29L 3H9SD 1H3UA 2X4QB 4LDLB 4LCCC 3GBML 3M07A 1GZQB 3TH4T 5E9DA 4FQCH 1IGFL 1Y6MR 5K59F 4O2FB 1S7WB 3GSNB 4XB8A 2GJ6E 5T1KB 5FM8A 3DO7A 3OKNB 2VOTA 4L4TA 2Q7YA 2H32B 5GGTA 3BH8B 1KIPA 2F5BL 1KXTB 3RWFA 3HB3D 3VGDA 1M7DA 3DURA 2LU4A 4X5XA 4KV5F 3KPLB 3HZKB 4K9EL 4MCYA 1IAOA 4U1HA 1PGRB 4F9LC 1OAYH 3E3QE 4JPVH 3GHBH 1A1OB 1HEZB 1BF8A 2Y36H 1BZ7A 5ITBH 4JQIH 3BE1L 2FJHB 1ZA3B 2J3SA 4HIHB 3DWTA 1EAPA 4G7VH 3I85A 4E9LA 1U8MA 2FYYB 4OUUA 5EBLB 2GQHA 5ID0B 2KQMA 3OKDB 5HHPB 3MV7B 3QUKB 4XXCA 3DVNA 3BP4B 4Z7VB 3HMXH 2R2HA 3GB7A 4PJBB 1MPAH 4OF7A 3EAKA 1LVEA 4BELD 4WHYG 3QUZD 4HLZG 4KMQA 3KPOA 3MACH 2L7JA 5C0DB 1F4AA 3Q48A 2R69L 3QPQC 4XTRD 4AEIH 2NXYC 4HWUA 1A02N 3VXUD 3FFCA 4L3CB 1II4E 1P7QD 1MCHA 3RZCB 1MCWM 4FQXB 3K2UL 2GITA 2GYSA 2PETA 4M00A 1Q9OB 3ZYZA 3ZE1F 5FYKL 2HJKB 1UXWB 1MIML 3H7BB 4OGAC 5IF0B 1GOFA 2IALA 1TJIL 1NCDL 1KENL 4F8TA 4HPYH 3GJEA 4JM2F 4XWGH 4PJFB 2D7NA 4HEME 3DVGA 5IV2A 1KLUB 3DMMD 4MQSB 4OGZA 4P5KB 1AR1D 1W0WB 3GMQB 4F7PA 1TVBA 1QACA 5DRZB 3C2SA 5IM7B 5I8OH 4G8GD 5ENWA 3SDYH 4TTDC 3CVIL 2W0KA 3WS6C 3KXFA 4Q9RL 4GQ9H 5F97E 2C1OA 2VYRE 5IBUB 2OL3H 5MEQB 1XCQA 2ZCKH 3PXHA 1JGUH 5DRXA 5DFVD 3RKDC 5CLTA 1Q0YL 3MRDA 3Q5YA 1T20B 4H26B 2FHCA 1YUHB 5DK0B 5BXFB 4YXLH 4JFYB 5CUSH 1MCPL 4WUKL 3RL1A 4B0MM 4P2QB 4WEBH 3PF2A 3HI6L 4IS6A 3OKKA 2OMBA 3GSQB 1PY4A 5DVLA 5CIPH 3SKNB 1IC4L 2YRLA 5C07B 4PJ9D 5F7LB 3WFEL 5K9KB 4QYOA 1CFNA 4PY8J 5K9JH 3BYTA 5M95B 1RK0B 4P3DB 5DSCA 5GGUA 4P59H 3DXAB 3H9SE 3KPQA 1CU4H 3B9KA 1MWAB 2W60B 3SO3C 2OJZH 1W72H 4ZUTB 1OL0A 1XGYL 2P5ED 4QHNB 4JKPH 4C4KO 4S1DD 3T2NH 3U4EB 1CZ8H 3WNMA 3FB7A 1HH9B 3V4UL 4M6ML 3ZKNC 1FRGL 2DQEH 1JF1A 4O4YL 2N1KA 1HINH 2DICA 5J3HC 2F74A 4EN3D 3U4AA 4FQ2H 1BM3L 5ERWA 3BRGC 4MJIB 3P0VH 1MEXL 3L3OA 2FO4B 4U6YA 3CXHK 4XPGH 2WQ8A 5DFTA 2V7NB 4K8RH 4MXQC 3QXDA 2YZ1A 1ZLWK 4YDVB 4ZS6D 3UJIH 1E0OB 4QRPA 2RCSH 3WNNA 4IHOA 4EDWH 2A77H 4GW5A 4ONGL 5KN5B 3ABZA 2NTFB 1LE5A 1VFAB 5F89A 1YQVL 4YXKH 1BGXL 4RA3A 4KKCC 4RGND 3NACL 4Y2DD 5EDXA 3ROLA 1IAKA 2VZTA 2R29H 4AEFA 2HRLA 2CH8A 3PWPB 3GBMH 1MI5A 2X5PA 5H35B 4G9FD 1IGFH 4OF3A 4ZAKD 3FRUB 2PXYB 4M48L 3IYLW 5B3NA 5BS0A 1VKXB 4X98A 3O41B 3VXUE 2XWTB 4M5YL 4FFWD 2OZ4A 4MJ2A 2DJSA 3VI4E 2F5BH 2Z31C 4YUEL 2YXFA 2Y5TA 2BVYA 5HGBA 5F88A 1HDMA 4MHHG 4K9EH 3QQ4A 1UG9A 2NXZC 4QOKA 3MLZL 1G7LB 1DUYA 5HDBE 2V7HB 4PJDE 3S4SG 1JF6A 2GTWA 3QULA 3BE1H 2AJ3A 4QXUL 4XH2B 3WNOA 5C1MB 1T1WB 4R2GD 2PW1A 4RGOL 5FV1L 3P73A 2JE8A 4L3EB 5C08A 2AS5M 5AYQA 4OLZL 1ZLVK 2D0FA 5F9JA 5HVFB 3AU1A 3CU1A 5EU5B 4G8GE 3KJ4B 3WS3A 4FG6C 3K46A 2VH5L 4WI5A 3OV6A 2ZCHL 2AK4B 4G6FB 2UWEE 2DOCA 4WWID 1QLRB 3VXOA 4GLRI 3R4DA 2R69H 2LTQC 4DQOL 1CT8B 2QADD 4NQSA 5CD5D 3KPMA 5DHVA 3I6KB 1GGYA 3G5VB 2V2XB 3GSWA 4R4FL 3RWJA 5C0CD 3C8HA 3LV3A 3K2UH 2W9LA 4RGMB 3CDCA 3HMWL 3PIQB 5GRWA 2X4UB 1IM9A 2Y6SD 3F8UB 5FYKH 3BZ4A 5GJSL 5EO1A 3LQMA 1NGWB 1MIMH 4RRPA 5I30L 3O2DA 1JIBA 1TJIH 2NY6C 1NCDH 1KENH 3GJFK 3TBVB 4MB5A 1GL4B 4P57B 1YJDC 3H0TB 1X4YA 5CJOL 1D5MB 1AGBB 2P5EE 4U7SA 3UJTH 1Z9MA 5EC2A 2DQTL 2Q76B 1R3KA 5IBTL 3SPVB 3CVIH 4Q9RH 4U6HB 5IB2A 2RQ8A 2R1WA 3SDXB 2DBJA 1G6VK 3BIBX 5EBWB 3G6JF 2KUTA 1CFBA 5K93A 3DHJA 1Q0YH 3X17A 3KLHD 4ONHB 5ELIA 3T4YB 3WIFA 2LAAA 5GZOD 3BQUC 1MCPH 4WUKH 3HI6H 2ADGA 2W65B 5K9OB 5KSAA 2FCBA 4OKVA 1IC4H 4RGNE 3WFEH 4CUCA 1I8KB 4YDJA 4IRJC 3DJ9A 4GG8A 5IVXE 1I4FB 4M6AA 2X6MA 2BSSA 1WGOA 4G9FE 5E56A 3RY6C 1XGYH 4HFUL 3V6ZB 4ZFOA 1F58L 1QYGL 3HAEB 5B39A 3U30B 3U6RA 3VFTB 4J2XA 4OV5B 3V4UH 1G1CA 2JB5L 4LEOA 4M6MH 4NQCB 3MMEB 4ZTPL 1FRGH 4U7MA 4O4YH 1TPXC 3PV6B 4YHIB 2PO6A 3WFCL 5CHNB 1BM3H 4X6CB 2F54B 1MEXH 2J8OA 2QSTA 3NZ8B 4PV9A 1T89A 3C60B 1FG2A 3QQNA 4OBRA 2R4SL 4PYHA 4PBXA 1DBBL 5IUSA 5ESAA 4MA1B 3R06A 2OI9C 2NY3C 2PTVA 1CVSC 4ONGH 3KJ4C 2XRAL 1KJ3L 2GJ6B 4P4RB 1YQVH 1BGXH 3CFIC 2WBJA 5DJ0B 1JGDB 4UOJA 2HJFB 1YDPA 3NACH 4QO1A 4LLQB 4IJ3C 2BXZA 4EI5B 3ARDC 5A3IC 4I0CC 4K7PY 5CJXC 4ESKA 5JHDA 1HHHA 4GUPA 5D96C 1WLHA 3MV9B 1KBGL 4MZ2A 2BOBB 1KULA 4M48H 4HK3N 1E28B 3MV8D 2HWZL 1M6OB 2C1PA 4BQCA 4M5YH 3OKOB 5I1LB 3F5WA 3KLSA 1YC7A 5C0CE 4YUEH 4R7DA 2WANA 5F7DA 4AENA 3JWNC 3MLZH 1ZAGA 4OZFH 4GKSB 1T1XA 4FXKA 4MS8D 4QXUH 1DUZB 1I7UB 3P4OB 1A6UL 1MVUB 3AY4A 4RGOH 1OP3K 5TF1L 4JJ5B 4KJPC 3ARFB 3V5DB 4OLZH 3QXAA 3VFWB 1FNGA 1MHHA 3LRHA 3NN8A 3KWWB 2DWEA 4UQ2B 5DD6B 3EYUL 4GS7B 4X9IA 2R1YB 4UU9A 2B20A 3QPQD 2VH5H 4NYLB 2NXYD 3L9RA 4WTXA 1TIUA 4HG4J 2ZCHH 35C8L 2K9UA 3SDDB 3F7PC 2CKBB 4DQOH 2Q20A 1Z6JT 4RIRB 2BERA 4R4FH 1CI5A 1NGZB 3QI9A 1E4WL 1AD0B 2KKQA 3MA9L 5FCUL 1BBDL 3BMWA 3HMWH 4RMTA 4U1MA 5A16A 3AREA 1U8HA 5I6XB 4YNYA 3Q2CA 3V0AC 5BV7L 5GJSH 4F7CB 1HHIA 4NCDA 5HDOA 5I30H 1T22A 1P7KB 5HYJA 1WWWX 4K3GA 3B9DA 3RWDB 5CJOH 2YA2A 4MX7B 3UBXB 1WZKA 3C6SA 4JFOA 2P5WB 4TTDD 5GGRA 3O3AA 3QDMD 1I1AC 3QJHB 2DQTH 5B38G 1UM6L 5D1XA 1CK0L 3FZUD 5IBTH 3SBWC 3D48R 2P43B 4JM2C 3TV3L 4QRQB 1IEAA 1FFRA 5EOTA 3NFSL 3RNQA 3WD5L 3A6OA 5D5MF 3MJ7A 4XNZB 1BFVL 4CAGA 1M1SA 1OWWA 2NYYC 4YHPB 3CFKA 4C56B 3STLA 4U6XB 5D1ZC 3TBYB 4EVNB 4QXTB 4PJAE 3V9FA 4YFEA 2ZUUA 2QQNL 2P46B 4PJIB 5GGVY 3SDCA 4Z5RB 5D7JB 3ULVL 3GMOB 4NUJA 3BT2L 1N59A 3O2VL 3MJ6A 5A2JH 3ARGA 3KYOB 4APQA 2OR7A 2JIXA 1GRWA 4B50A 1N2RB 3ZKND 4K55A 1NC2A 4HFUH 2EIZB 4DFIA 4LVNC 1F58H 1BMGA 1QYGH 2BVUA 3D2UA 4Y4FD 3BX7C 3QA3B 5J3HD 1QG3A 5F9AC 2E6JA 2JB5H 4ZTPH 3MV8E 2QKIA 4YFLF 4U0RC 3NFNB 2O5XL 2C3HA 5J1AA 3FTGB 1PJ9A 3WFCH 4JCLA 1OQOA 2DYPA 1U8NA 4PJ8A 4MXQD 4Q6YA 5DD5L 3HCVB 2EICA 3GSVB 3L3GB 2HRPL 3SKUD 2ICCA 3TZVC 4JZOB 2XKNB 2XXMB 2R4SH 3RUGE 1B0RA 1DBBH 1P69B 4NHCL 5DQ9B 4IIQB 2X4QA 2DIBA 2AQ1A 1R24B 1GZQA 3TC9A 1F3JB 4X6DB 2XRAH 1KJ3H 1C1EL 2H8PB 4O2FA 1S7WA 3GSNA 4AL8L 4R4BB 5GSRB 5CWSB 1A8JH 4P46C 2ITCB 5T1KA 2MNUA 3OKNA 3BGFB 2YWYA 1L7TL 3DRQB 4M02A 1FL6B 5D1QB 3QSKB 1FZMB 2H32A 4W4OA 3BH8A 3F6IA 1KBGH 1BQUA 2R56L 2VZ1A 4J3XA 5E00B 3KPLA 2EDHA 1NANH 3HZKA 4PJEB 1WTGT 5CINL 2HWZH 3SQBA 5T1LD 5K33A 1A1OA 1HEZA 3T04D 2FJHA 1ZA3A 1ZANL 3T8XB 2NXZD 4HIHA 4CRPA 5I1AA 2FYYA 4EDXB 3DUHA 4KU1A 3FQTB 5EBLA 1C12B 5SX5K 5ID0A 2GTZB 1OWRM 3OKDA 4HF5L 3MV7A 5HHPA 3QUKA 4Z7VA 3BP4A 3QEQD 2XQBL 3WBDA 4X80L 1DQTA 1H0DB 4RMWA 4PJBA 5CGTA 2V5SA 1TZHB 3VXMD 1G6RL 1A6UH 4OCXL 3T08A 1X5IA 4KUCD 5C0DA 3MLWL 3QDME 1T6VN 4UNVA 1SJXA 4CU8A 1X5HA 4L3CA 3RBSA 2VDOL 3EYUH 3SO5A 3RZCA 2J12B 4WI2A 3QEUB 1OLZA 4FQXA 4QTHB 2ZJSL 1K4DB 2VL5B 3N1GC 1Q9OA 4PJ9B 2E6QA 4UT7L 3PHOB 5J6GB 4K94L 3C6LB 1CF8L 2HJKA 5C9JB 1UXWA 4LNRB 5DEGB 3H7BA 5ESQB 4KKAC 5IF0A 4JANB 4PGDB 4MZ3A 1P5VA 1E4WH 4PJFA 4CVUA 3MA9H 5FCUH 1BBDH 4D2NA 1KLUA 5E94B 4Z95L 5BV7H 4XBEL 4P5KA 1W0WA 2BFVL 3GMQA 4P49A 5F7FA 5FGBC 5DRZA 5IM7A 1AC0A 4L4JA 1IL1A 1XGUB 1RZFL 1EHLL 3ZO0A 2W9EL 4F80A 1QBML 3OJDB 5C0EB 5HYEA 2EDJA 5IB3B 2A74A 1UM6H 5L0QB 5DO2C 1CK0H 1T20A 4BQ8A 4H26A 2X44D 1BD2D 1YUHA 5DK0A 3RP1A 5BXFA 1NUDA 4JFYA 3TV3H 4X4MA 1G0XA 4RGNB 4P2QA 4Y2DB 5CJQL 3S96B 4IIQC 3GSQA 2DMKA 3NFSH 4BFEA 1X5LA 3WD5H 3BQUD 5C07A 5K9KA 3ISWA 1BFVH 3VWKD 1CXKA 1RK0A 4P3DA 4PJHF 3FJTA 3ARWA 3DXAA 4M62L 2B7DT 4ZAKB 4H0HB 3RDTD 3NCFB 1MWAA 2W60A 2I9LB 3VGAC 4ZUTA 4IRJD 2QQNH 3BGFC 1FLTX 2JCCE 2ZCLL 4QHNA 3VWJC 3NH7L 3U4EA 5IWLC 3ULVH 1HH9A 3BT2H 3CFDB 4Z7UB 5IK3B 3O2VH 1A6VL 4ONFL 4D0DB 4JFZL 3TO4B 1OAKL 4DFHA 4R0LC 2Z8WC 1WZMA 1EO5A 1WFTA 3LQAC 1FO0B 4MJIA 4OFKA 5CGYC 5FHBL 2HT4D 2FO4A 4POYA 1I3RB 4MQ7B 4JFDB 3FO0L 2PYED 1HYRC 1CD1B 1EJOL 2V7NA 4ZOAA 3GMLB 2O5XH 1KTDB 3EJZC 1K4CB 3BIKB 4YDVA 4LSSL 4OZGF 4Q0XH 4F7MB 2ZOKB 3ELAT 4X7TB 5KN5A 5DD5H 3ULUF 2NTFA 5GHWL 2WUCL 1VFAA 5SWSB 5A2IH 5BRZB 5HDQL 2HRPH 3ZT7A 2HFTA 1HWGB 3QEQE 4NHCH 4Y16C 5D7IF 4WV1C 3PWPA 2ZNXA 2E9BA 3GO1L 3VXME 2I07B 5H35A 3IT8D 3ARDD 4K9EC 5C0ND 1C1EH 5A3ID 3ZZ1A 4RAUB 3VRIB 3FRUA 2PXYA 5C0GB 4AL8H 5DD0L 4NQED 1VKXA 4GG6F 3O41A 4K07A 3WUZA 1IJ9A 3ROOB 4G6ML 1U42A 2XWTA 4WFFD 1L7TH 2QBWA 1GGIL 3QRGL 1IZJA 1GGTA 4KMTL 5GS0L 3UTTD 4OAWB 1XR8B 2R56H 2DQCL 4HKZB 2ICEB 4POUB 3ARTA 5CINH 2OP4H 3PGCB 1G7LA 2V7HA 1OT1A 2VDQL 2L7UA 4JPKL 1L4IA 1G7HB 1TVDA 4LMQI 1J05B 3EFFB 4XH2A 1ZANH 2BX5A 5HYSB 1T1WA 4F37F 2FDBP 1IGML 4FA8A 3CX5J 1IFHL 2EIEA 1J0JA 3FOLB 4L3EA 4HF5H 1U92B 4ERSL 5EFIB 1KV3A 4X80H 3BDYL 5EU5A 4F33B 4KJPD 1MOEA 5JMOC 3NAAL 3VD5A 1T6WA 5L0QC 1CFQB 4MJ6B 4KUZL 5IVZB 1G6RH 1U2HA 4OCXH 4ZFFB 1N6QL 1Z9OA 2AK4A 5L8KB 5DVNA 1KIRB 3MLWH 4DGVL 1QLRA 4N0YL 1CT8A 3VI3F 3I6KA 3PHSA 4IRSB 3G5VA 2V2XA 1MCQA 2VDOH 1BD2E 3L3JB 1AR2A 2A6KB 5JXED 4OIBA 2ZJSH 1DVFC 1P9MC 5FUCC 2GUOB 3PIQA 1WIOA 2X4UA 4UT7H 3V5KB 4K94H 4YLQT 1CF8H 5JLZB 1NGWA 3C09B 2E7LA 2VE6A 3K80A 4OZHB 2AJSL 3L5WB 1WSST 4MDJA 4BH7B 3TBVA 3KYNB 4P57A 3ULVF 5D2NB 4DUWA 3H0TA 5DURD 1QFPA 3U1SH 3OF6A 1D5MA 1AGBA 1WWCA 4Z95H 4JHAL 4XBEH 1NDGB 2BFVH 4MA3B 3DOSA 3VMPA 2Q76A 1CD0A 4QTIL 4HWNA 1BREA 1RZFH 1EHLH 4NRXB 1J1PL 3SPVA 1I1AD 4NKMB 3B4NA 2W9EH 4U6HA 1CIDA 1HHKA 2NY5C 3SDXA 5IFAL 1QBMH 1R3JB 3ZYOA 2VZSA 1HHJA 5EBWA 3LHPL 3K4DA 4JM2D 2Z35B 2PYEE 1W8NA 4U1GC 4YHYB 4ONHA 4PJAB 5TQ0L 3RA7L 3T4YA 4LK4A 5TDOB 3I9GL 3NZHL 5D7KD 1NAMB 3OHXB 5CJQH 5L6YL 2NYYD 1FJ1B 4NKDB 4N9GB 3A6CL 5K9OA 1VEMA 2W65A 5D93B 1A4JB 5I16B 5D1ZD 1JZ5A 4CN4A 1I8KA 4N0FB 5JORB 3BN3B 4M7LL 1I4FA 4M62H 3U4BL 4XP9L 4RMQA 1H3WM 3V6ZA 3G6DL 3NH7H 3HAEA 4Z6AT 5GXBB 4OV5A 4NQEE 4NQCA 1A6VH 1DQML 4ONFH 3PV6A 2DAVA 4V2CB 4WFFE 4JFZH 1OAKH 5CHNA 4X6CA 2F54A 4NP4L 3UTTE 5J89A 4TUOB 5FHBH 4ZXBB 5E7FA 43CAB 1CLYL 3NZ8A 3FO0H 3C60A 3SGEH 1EJOH 1VFBB 4LSSH 5K59E 2ESVD 4M9PA 3TZVD 3LCYA 1XIWC 5LAXB 3TJEL 2ARJQ 4X5WB 5GHWH 2WUCH 2GJ6A 4P4RA 3TPUB 5HDQH 1LEIB 3FO9B 4QEGA 2CLRB 4NKQB 5DJ0A 2BXYA 1JGDA 4N1HB 2HJFA 3RWCB 4NJ9L 4LLQA 2I26N 2NY1D 1RJLB 4EI5A 1A64A 3JWDC 4ODSL 4EJ1C 1W8OA 3GO1H 3QXVA 2G60L 4KV5E 1NSNL 4CDHA 3MV9A 2BOBA 1KJ2H 1EDQA 3LRSB 5DD0H 1MFAL 1E28A 2XZQL 3W2DL 4N0CC 3IF1B 1M6OA 4S0SD 4QRRD 5L8LB 4G6MH 1INEH 3OKOA 3H2WA 5MEND 4BQBA 1AO7B 1GGIH 3QRGH 5I1LA 5IOPB 4KMTH 1JUFB 2NNAB 5GS0H 1S7XB 2VLRB 2AXJA 1QFHA 2DQCH 3VXSD 4OI9A 4X6FA 1ES0B 2VDQH 1ZHNB 4JPKH 4P48A 4GKSA 1A22B 4DW2L 1DUZA 2BY0A 2ED8A 1I7UA 2Z92B 3P4OA 4ETQB 1MVUA 2YC1B 2F53D 1IGMH 4JJ5A 1IFHH 3ARFA 1MFBL 2VWEC 3V5DA 3P2TA 1GC1L 1YY9C 4HX1B 3VFWA 4ERSH 1HNGA 3BDYH 3KWWA 4UQ2A 1G9ML 5DD6A 4HFWB 3NAAH 2R1YA 4NYLA 1TNNA 4KUZH 3FN0L 4UB0L 1N6QH 2EDLA 4PGBB 5E2UL 1RUAL 2HT3C 1WITA 5ALCL 1LP9F 3SDDA 4DGVH 4N0YH 2CKBA 1WWAX 4PRHD 1WZLA 4RIRA 3RJDA 3BD4A 1GZPB 1NGZA 4GAYB 2COQA 1AD0A 1JGVL 4LDEB 5D7KE 1FYHB 1EA9C 5J9PB 4ZMAT 4F7CA 3CK0L 4HBQA 3EO0B 1P7KA 2AJSH 5ISZD 5FM5M 3RWDA 4Y4FB 2J8HA 4MX7A 3UBXA 3TIDA 4EUPB 2ERJB 2P5WA 1YMMB 4JHAH 1H5BB 4S10A 3QJHA 2P24B 2MMXA 4LAQL 2BCKB 4ZXBC 3X3FL 4QTIH 1QSZA 4KTEL 2Y06L 4MA7L 3OXSB 2AEQL 5MHSD 2ZOLB 2VZUA 4NNYB 4QRQA 5DO2D 5IFAH 2ED9A 2PW2B 3S5LB 3LHPH 4Y5YB 4HC1A 1OW0C 1NFDE 1P4LB 5TQ0H 4YHPA 3P0GB 3P0YL 4PJXF 3MRFB 4C56A 2ESVE 3MRJB 1T7ZA 1ZV5A 2Z4QB 2JLLA 4U6XA 3I9GH 3NZHH 4QXTA 4MNHA 5L6YH 1HIML 2B0SL 5EU7E 3A6CH 3VXPB 4PJIA 5D7LB 4Z5RA 5D7JA 3GMOA 1LMKA 4LGRB 2FL5B 4K8RD 4C83B 5GRVL 3VWJD 3KYOA 4M7LH 3U4BH 4OGYL 3QQ9D 4XP9H 3WO3B 1U8QB 1N2RA 4RBPH 3PXJA 5HGDB 2EIZA 3G6DH 2DLIA 1RK1B 1FE8L 1A7OL 3SGDH 1F3DJ 3QA3A 1F4WL 4OQTA 1LO4L 1DQMH 1BVZA 3NFNA 4QRRE 2HYMA 5ADOL 3FTGA 5MENE 3MC0A 1EEZB 3DI3B 3QG6B 4NP4H 1N0LA 3HCVA 3C8DA 3LAFA 4JZJB 3SKJL 3GSVA 3CIQA 4NUGL 1CLYH 3L3GA 3VXSE 1KJMB 4WRLA 4PUBL 4JZOA 1WBYB 1IVLA 3AB0B 2BVOB 4RCAA 1IEHA 4NPYB 5DQ9A 1R24A 4WFED 5HJ3B 2YMXL 2EH7L 4KH2A 5IROC 1F3JA 3TJEH 1XZ0B 4X6DA 3OKYA 1B3JA 2F53E 3AMLA 3B5GA 2H8PA 5I1IL 4PIRF 4AQOA 5IMLB 3HNVL 4R4BA 1PZUB 4LLWB 5GSRA 5JPMB 5CWSA 4NJ9H 4Y5VB 1JYNA 2ITCA 3R8BB 4BK5A 3DRQA 4ODSH 4YZFF 5CSBA 1FL6A 5D1QA 2G60H 1FZMA 1NSNH 3TVMC 4MAUH 4YHLL 1F42A 4JFQB 2MWCA 1J87A 4LIQE 5E00A 2RR3A 1MFAH 1NBVL 4PJEA 2XZQH 2MKLC 4PRHE 3W2DH 3ZHLA 4JY6B 4GBXC 1BWMA 3TA3C 4O51B 2IH1B 1DBAL 1WAAF 3DVFA 4EDXA 3B8SA 4PJGB 4ZS7L 1SEQL 3FQTA 5IQ7L 2YXMA 4OF6A 3MRCB 1C12A 1BFOB 2GTZA 4G8GA 1SY6L 1RY7B 4CADB 5KSBE 3BHBB 5CBEB 5ISZE 4JVWA 1H0DA 2FEDC 5BZDB 1TZHA 3KR3L 3VD4A 5GGQL 3EOYG 4DW2H 4R97B 4HS8L 4M9OA 3DYPA 2CR6A 1MFBH 4HJ0C 1GC1H 5HD8C 1AQDB 4OBSA 1G9MH 5EU6B 3CVHL 1FAIL 3QEUA 4QTHA 5MHSE 5E24E 4N8VB 4UB0H 3FN0H 1K4DA 2D7PA 5E2UH 2VL5A 5ALBL 5DUML 1RUAH 4PJ9A 5ALCH 3PHOA 5F7UA 3VWKB 5J6GA 3C6LA 5C9JA 2QSQA 5M7QA 3LN4B 1YN7A 3U0WL 1DVFD 4LNRA 5DEGA 5ESQA 3QDJD 4JANA 4PGDA 4PG9B 3RDTB 2WSKA 2BP3A 4YFDB 1JGVH 2W92A 5EUOB 2FSEB 5E94A 3PE9A 2APBA 5IW6B 4QNPF 3CK0H 2DQJL 4Z7OF 3GZKA 2VDML 1KB5L 1XGUA 1D9KD 3G6JE 2A6JB 4ZUVB 1J1XL 4AK1A 3OJDA 5C0EA 5ICXB 5IB3A 1ZGLB 3HZMB 1UJ3B 4XPAL 5EB9A 3RTQB 4LAQH 4HUXB 3X3FH 4YGVB 1OGAB 3JWOL 4KRPC 3KS0J 4KTEH 2Y06H 2NY0C 5JQ6L 4P23C 1A9EB 5J13C 5D6DC 4MA7H 3BISA 3FCTB 3OMZA 2AEQH 2PCPB 2H9GA 4HIXL 5C0BB 2VQTA 4W68A 4Y2DA 5D2LB 3S96A 5E6ZA 3EO9L 4BQ9A 3PWJB 1T7XA 3KYMB 5IVXA 4KMLB 1NLBL 3TEUA 2YD5A 4WI7A 3SCMC 3JVGC 4G9FA 3WHXB 3P0YH 3IJHB 3KS0H 3CXHJ 3D87B 4WFEE 5DMGD 4ZAKA 1HIMH 2I9LA 2B0SH 2Q87A 2A6DB 2KDGA 1B4RA 2R1XB 1UKSA 3QQ3B 2VDNL 5B21A 3CFDA 4Z7UA 5CKAA 5IK3A 1MFEL 1REIA 5IFJB 4D0DA 3HUJB 3TO4A 4OGYH 1HXYB 4UV7L 1Q1JL 1FO0A 2QV2A 4I3RL 1FE8H 1A7OH 5JXAL 1I3RA 4MQ7A 5A2FA 4JFDA 1F4WH 3WNLA 1LO4H 1CD1A 2BNRB 1KJVB 1QA9B 2FATL 3GMLA 4HGWB 1KTDA 1K4CA 3BIKA 1X5AA 3TM6A 4F7MA 4GAJL 4CL7A 2ZOKA 4X7TA 4JFFB 5CJBA 1A7PL 3SKJH 4XPHL 4NUGH 5BRZA 5SWSA 4OIAA 4PUBH 1XIWD 5EG6C 5IVOA 3MRRB 3VDCA 5CS7A 1DBML 2EH7H 2YMXH 3NVQA 2I07A 2H2SC 3G5XB 2VISB 4K7PL 4M8QB 5DRWB 4KK5C 5I1IH 3SE3C 2KZ1B 4RAUA 3PL6B 5F9DC 4ACPA 3VRIA 5C0GA 3PABB 1MCEA 3HNVH 3P3YA 1LO0L 5E99L 5EORL 3SDAC 3ARBD 3ROOA 5KVGL 2KH2B 3FO2B 4U31A 1T7VA 4TVPL 5B8CB 3WSQL 3I50L 4OAWA 1HZHL 4YHLH 1XR8A 4PGCB 4HKZA 2ICEA 3VFOB 4AIOA 1NBVH 5CJ8A 4ORGB 3OR6B 2DN7A 5FUCE 3PGCA 5DURB 3QDJE 2CSPA 4J8RB 1CCZA 3AAZB 3QIUB 4QRUB 1G7HA 3R1GL 1J05A 3EFFA 1DBAH 4JDVB 5HYSA 4ZS7H 4GRLC 1SEQH 5IQ7H 4UBDC 2ZWLT 3FOLA 3LZFL 5A2KH 1U92A 2M26A 1SY6H 3RWGB 5EFIA 3TN0D 1TNMA 3QFDB 4F33A 1YY9D 3RTQC 4RNRB 1RIHL 5GGQH 3BP6B 1CFQA 4MJ6A 3LIZL 5IVZA 4ZFFA 4HS8H 4LSPL 4L29B 1KIRA 4I18B 3ILQC 1JWSB 2EO1A 5F1NB 1T04B 4IRSA 2HT3D 1P4BL 3L3JA 3CVHH 1FAIH 2A6KA 5FA4B 5ALBH 5DUMH 1JI1A 2UY6A 2GUOA 1LO2L 3V5KA 2NX5B 5JLZA 2DLFL 4NSKB 3RI5K 1QHPA 4EIGB 3WYRA 3U0WH 4OZHA 3GJFH 4LHUB 3L5WA 4TULL 4BH7A 3B5HA 1S7UB 3INUL 3KYNA 3J7HA 1RD6A 5D2NA 1OTUC 4L8DB 1S9XB 2A83B 3UTOA 1VENA 3Q5OA 4UOW0 5DJAB 5C3LD 4PD4K 4QCIB 1NDGA 3MLSL 4MA3A 2DQJH 3UXFA 4F57L 2CIKB 2VDMH 1ACYL 3L5HA 3SKOB 1KB5H 5HHNB 3BMVA 4NRXA 4GO6B 4NKMA 1AC6A 3GKWL 3UDWA 5FYLL 5DT1L 5D5ME 2G9HB 1R3JA 4FFVC 1J1XH 4BFIB 5EZIL 4LSUL 3S37L 3ZL4L 2Z35A 4XPAH 2F8VA 3JWOH 4PJAA 5JQ6H 4KK6D 5TDOA 4TQEL 2H26B 4HIXH 1NAMA 3OHXA 1FJ1A 4NKDA 4N9GA 3UC0L 3EO9H 2NY1B 3E2HC 5CSZB 4FABL 3JTTB 1A4JA 4LSRL 4Z7QF 5I16A 1EGJL 1XR9B 2V17L 5HHOB 5T3XL 1NLBH 4N0FA 1IMHC 3GMRA 1FPTL 5JORA 3LKQB 1H8SA 4NQTA 3GI9L 1UJTA 5I8EB 4CJ0A 3ZHKA 3QUXC 4XB7A 2DIJA 3O4OB 4L8SB 2J8UF 2VDNH 1CXIA 2P4AB 1G7PB 1MFEH 3FN3A 3S3PA 5DJXB 5ID1B 4JVPA 1Q1JH 1CL7L 2EC8A 4TUOA 3QIUC 4ZXBA 4I3RH 1I7RB 43CAA 5JXAH 5FXCH 5FKAB 5FM5O 1VFBA 2FATH 3S36X 5J11B 4IM8A 1KT2B 2G5RA 4GAJH 5LAXA 4NC2B 4X5WA 1A7PH 4XPHH 4QKXB 3TPUA 1LEIA 3FO9A 2CLRA 4ZPVB 3RWCA 3F7VB 1HXMB 3NIDF 4E0RB 1RJLA 4E5XB 1HSAB 1QHOA 5ADPL 2VWEE 4OJFL 1DBMH 4XNXL 3SKMB 4K7PH 3RX8A 1I85C 4PRHB 4ZSOE 2ZUQC 2VXSL 3LRSA 4LCIL 4R90L 3MRMB 5JTWA 3TVMD 3TF7C 1LO0H 5E99H 4LASL 5EORH 1CDGA 3IF1A 4F2MB 4NN6B 5KVGH 4OZIF 1AO7A 5IOPA 2IF7A 4TVPH 2OL3B 1JUFA 2NNAA 1S7XA 2VLRA 3WSQH 3I50H 1HZHH 2DM2A 3TA3D 1IARB 3GUTB 2R4RL 5IFHL 5E4EB 1ES0A 1FHGA 1ZHNA 3CGTA 3MUJA 3R1GH 2XY2A 2Z92A 4ETQA 2YC1A 4LNVA 5CIPB 4G5ZL 1FCCA 3N85L 3LZFH 4HX1A 5LQBL 3FB6B 4Y4KC 2NY2D 2VRAA 4HFWA 1NEUA 4KK8D 4DAGL 3M17B 2YA0A 3WXWL 2QLVB 3BEVB 3LIZH 1G0DA 4PGBA 4LSPH 2NLJB 4CMHC 2EDTA 1TVHB 4BSWB 3DHMA 3MSPA 4WHCA 3FONB 2AEIT 2JJUA 1P4BH 1GZPA 4GAYA 1IILE 2FH6A 1KTLB 4PREB 1AXSB 3O0RH 1F2XK 4ODVL 5GGSY 3VD3A 2V5MA 4U6VL 3RHWK 5J9PA 1LO2H 3UTZB 1IRAY 3AS0A 3JUYA 3IU3B 2DLFH 2GJZB 1W2KT 3RWIB 1M7IA 3UZVB 4TULH 2IWGA 3INUH 4TN9A 3ARXA 2BRQA 3PQYB 2J5LC 1ZA6B 2QL1A 2AJYL 4Y4FA 2I25N 4LOUC 3S3JA 4YHKL 4EUPA 3W0WB 2GK2A 1F6AB 3WNKA 1F90L 1H5BA 3MLSH 4QXWA 2P24A 4X83A 1JYXA 2BCKA 4F57H 3MBEB 1ACYH 1FIEA 2ZZUT 1N0XL 1NAKL 3U0PB 3OXSA 3GKWH 3TFKD 5FYLH 2ZOLA 3UEZA 5I75C 4NNYA 5J11C 4RFOL 2PW2A 4KRPD 2J2ZA 4NBYB 4LSUH 4HIJB 1E4KC 5EZIH 1JHKL 2NY0D 3S37H 1MJJB 4PJHE 1NGPL 4P23D 3QIBB 1NC4B 1TXKA 3VFPB 1AJ7L 5HI5C 3ZT5A 3W5MA 4C4KT 4Y5YA 3ZL4H 3DTXB 2DQIL 1OHQA 5JO5B 2DJUA 1P4LA 3MLPA 1T1ZB 4B7LA 5EA0L 3MRFA 1SM3L 3MRJA 2Z4QA 4RMUA 1A6AB 1SBSL 1EEUA 5IIEB 1Q9LB 3LN5B 4U3HA 3DX8B 3SCMD 3VXPA 3UC0H 3RGHA 4FABH 5D7LA 4LSRH 1EGJH 2Z0BA 3THML 2V17H 4OV6F 3MX0A 5T3XH 1VERA 2FL5A 4C83A 1FPTH 1U8QA 3GI9H 1WBXB 1G7MB 5HGDA 1A1NB 2P7TB 2VSDA 1RK1A 2NZIA 4CVXB 1T2JA 4RMSA 4Y4HC 4OZGE 5J06A 3SE4C 4I1NB 1FVDB 2Q3ZA 3VRLE 4XZUB 4AH2B 1EEZA 3QG6A 3O3DB 4U1SB 1D5XB 1CL7H 3FB8B 4FOMA 4JZJA 4ZD3L 3D9AL 2XZCL 1KJMA 1PEZA 3CZFB 4P2RB 4NN5C 4KJWC 1QSFD 1WBYA 2BVOA 4OF8A 4NPYA 3KAAA 1QBBA 5HJ3A 4JQVC 3Q1SH 4Y19D 5DYOB 1XZ0A 4POZC 4LCYB 4GG6E 3GDBA 5IMLA 4P4KC 1UC6A 5ACZB 3AM8A 4LLWA 5JPMA 1H3PL 2C3VB 1YZZA 2H2SD 4Y5VA 3QH3B 2OJEB 4JO1L 4KDTA 4KK5D 3L95B 4U33A 2W07A 5ADPH 2NY7L 2W0PA 4OJFH 5ACLA 5DJ2B 3QDGD 4XNXH 3SDAD 4R6UA 1S78C 4S2SB 4LPCA 1GIGL 4NO0D 2VXSH 4JFQA 1ZSDB 4R90H 5F96L 2MHAB 4LASH 4JY6A 4NZDA 5IJKC 4BYHA 3JZ7A 5F71A 1CICD 3BJ91 3T4AB 4HV8B 2FX8L 4O51A 4Y1AB 2IH1A 5D71L 1GC1C 3NCJL 2FGZA 4PJGA 2V2TB 3FL7A 3T09A 3MRCA 1BFOA 1G9MC 4P3CL 4KJQD 3BPCB 4ZDHB 1FVCB 3J8F7 2R4RH 5E6IC 1D9KB 3BHBA 4GRLD 4CADA 5IFHH 5CBEA 4UBDD 4NC0B 1JK8B 1VFMA 3DETC 5BZDA 2X41A 1FNEB 1M71B 3O9WB 4LKCB 4MNQB 3B9AA 4ZFOL 3VI3E 4DVRL 4G5ZH 3N85H 5DJ8B 2FHBA 3F7RA 4GRWB 4M7KL 5LQBH 2FEEL 2DQDL 2M8XA 1JCKA 1AQDA 4PRAB 4QRSB 5FO8B 3PWNA 5EU6A 4DAGH 3ILQD 2EDXA 3WXWH 4HZLB 2DMCA 4N8VA 3IXAB 3EIFA 1UH2A 4Q9CA 3VWKA 3LN4A 4MLIA 1NKOA 1UWEL 3QIWB 1BQHB 3RDTA 4PG9A 1CE6B 3WFBL 4XCNB 2VLJD 2FR4B 1T0PB 5F7EL 4XPFL 4ODVH 5DVOA 4U6VH 5EUOA 4KRLB 5ESVB 2FSEA 5IW6A 1UACL 5DZLA 5DQDL 4V1DB 3MNVB 3BRFA 3V8OA 1U8PB 1C08B 2H2PD 3GBNL 4ZTOL 4WTZG 4NKIL 3RIFF 2PTTB 2NR6C 4BKLB 5F1IB 4JEGB 1T83C 3ZTJG 2EEAA 2AJYH 2A6JA 4JFXB 4ZUVA 4YHKH 5JPNB 5DVKA 4PJ7B 5ICXA 1F90H 1ZGLA 3HZMA 1UJ3A 2J6EL 1G7QB 4HUXA 4FFVD 4YGVA 1OGAA 1N0XH 4JLRB 1NAKH 3O3EB 4XCEB 4L8CB 5I19H 1A9EA 1MFDL 3FCTA 2PCPA 1I9RL 5C0BA 4RFOH 5CMAB 3LH2L 5D2LA 1L9NA 1JHKH 1NEZG 2O5ZL 1NGPH 3PWJA 1AJ7H 3P9LB 3WLWC 2DQIH 3KYMA 1QSFE 2A2QT 4PRIB 3WXVL 1ZK9A 5E95B 4X6BA 3WN5B 5I1GL 2FLRT 4TPRL 5HGAB 3WHXA 5EA0H 3TCXA 1SM3H 1X9QA 3MYZA 4QXGL 1SBSH 4Y19E 2A6DA 5CBAB 2R1XA 1AHWC 2YD4A 3ARBB 3GSOB 3QQ3A 1IGJB 4OZFB 3DO3A 3QUXD 5IFJA 3BEWB 3HUJA 1NCUA 3D85B 2LU3A 2X89D 5L2KD 1HXYA 4RAHA 4F7EB 3AXLB 3QDGE 4DOHB 1YECL 4PY7B 2QQKL 5ACMA 5DHVH 1B0GB 2VR5A 1J11A 3CUPB 2BNRA 1KJVA 1QA9A 4HGWA 4IRZL 4OT1L 4YXHL 4XBPB 4JFFA 4NZTL 5DJ6A 4ZD3H 3TN0B 2X2YA 3D9AH 2XZCH 4PJDF 2WWKO 4OF5A 3UJJL 4EIZC 4OD3L 2WBWB 1DSFL 3MRRA 4Y0GA 5GIRB 5GS0D 3G5XA 4M8QA 2VISA 5DRWA 3PL6A 2EEDA 3PABA 4LQ1A 1QEWB 1H3PH 4Z7WE 1F4XL 1EEYB 1A3LL 4JO1H 4UIKL 5JXEA 4W4NA 1TETL 3ZE0F 2NY7H 3FO2A 2UWEF 1P4IL 1TCRB 4LPUA 4X7DC 1BQLL 5B8CA 1MAKA 3C5SB 2X4NB 4CNIB 1GIGH 4NNXB 2MQ3A 4PGCA 3RX7A 3VFOA 3G08B 3QUML 1J8HB 4ORGA 3OR6A 5GZND 4Y5XB 1YYLL 4WU7B 4J8RA 2VLJE 3AAZA 1UH4A 4QRUA 2FX8H 1JMZA 5D71H 4JDVA 2SEBB 5SWQB 1ZWIB 3GKZA 4QT5B 1NJ9B 3QCUL 3T2OA 4P3CH 4XC1L 3RWGA 4JJHA 4DUXA 3QFDA 1Z0NA 4LL9A 4M93B 4Y8AA 4RNRA 2AXGB 4Y4KD 4HIEB 2YPKB 4DVRH 4L29A 5I1CL 3TO2B 4HQQL 3D39B 4L5FL 4M7KH 2MCG1 2GI7A 4I18A 3BGMB 2DQDH 1KELL 2IQAB 1JWSA 5HYQA 1XF2B 1PW3A 1S7SB 5F1NA 1T04A 2GK0B 1BIHA 4GSDL 1N26A 2UZIL 3OL2A 5JW5B 1RU9L 5FA4A 1MY7A 2NX5A 4NSKA 3QUYC 4LP4A 1QBAA 1JBJA 1H3VA 1X5ZA 4LHUA 4AQ1B 3WFBH 4XWOC 4LLVB 1S7UA 1BBJB 5DK3A 5F7EH 4XPFH 4L8DA 1S9XA 2A83A 2YZ8A 1CGTA 3HNTL 4HAFA 5IB1B 5DJAA 1FNLA 1UACH 1EVUA 5DQDH 3L3IB 4QCIA 3S97C 4ZTOH 3GBNH 4NKIH 1B4JL 3K3QA 2CIKA 4LOUD 5F72S 5BJTB 1BJ1H 3SKOA 4RZCB 5HHNA 3OGCB 5HHMB 5L2KE 4CW1B 2HN7B 5HVHB 2G9HA 4PLNC 2I9TB 4BFIA 3BJLA 2ENSA 4PJXE 5EBGA 2J6EH 3TT3L 1RMFL 2ICWI 3NIFF 1F8TH 4MA8L 4YDIL 4I0PC 1MFDH 2Q86B 2H26A 1IGTB 1I9RH 4LAJH 5E9DB 3LH2H 2O5ZH 2HVJB 3G6AB 4PJCB 5CSZA 4YDLC 3JTTA 1XR9A 3IFOB 3WXVH 5HHOA 3ZDZF 1FVEB 5I1GH 1CBVL 3K8MA 4TPRH 2N7AA 3PUCA 2EXWC 3LKQA 5KW9L 4X5LA 4M1GL 4QXGH 3HE6B 1MCLA 2DBLL 1A6PA 5I8EA 1BOYA 1YEKL 4OZGB 4WHTB 1KIPB 4L8SA 2B4CC 3UPAA 1Q94B 2L0DA 4FQJL 2DKSA 4P2OC 1G7PA 4MCYB 2EDRA 4U1HB 5GRJL 1ZTXL 5DJXA 5KZCB 5ID1A 2VXQL 4N5EC 5D7IB 3DBXB 1YECH 4XNMB 4PFEA 2E7BA 4UQ3B 2ATPB 2VKXA 2QQKH 1I7RA 4UUJB 3DECA 2IAMC 5KTEL 1EO8L 4U05A 4Q6IC 2E9IA 4FZ8L 4IRZH 4OT1H 5I76B 4YXHH 4MNGB 5I71C 3OB0H 4U2YA 4KJWD 1XF3B 1KT2A 4HIIB 4P9MH 4NZTH 2EDWA 5C0AD 2NY2B 3VFNB 4OGXL 4G8EB 4ZPVA 4QHLB 4YZFE 3F7VA 1U0QA 5DD3L 3UJJH 1HXMA 1CXHA 5MI0B 4OD3H 1QFOA 4E0RA 4E5XA 1JPTL 1DSFH 1HSAA 3WO4C 4P4KD 1VEOA 1BEYL 5H94B 4R3SB 3DX7A 2X9YA 4OLXL 3SKMA 4OB5L 4PRHA 4YK4C 3SGKA 2R15A 3MRMA 4GRMB 5DTFB 3FT2B 1A3LH 3MCKA 1WAAE 4UIKH 4F2MA 5TGBA 3VGGA 1TETH 2X1XR 2YD3A 1QSEB 1P4IH 2OL3A 1FL3B 1EXUB 3TT1L 1BQLH 2VR9A 2IPTL 3QAZC 3AS2A 4HXAL 3QUMH 2OS7A 3GUTA 1YYLH 1CS6A 1O7SA 3NABL 5ENWB 4F37K 4P5TC 1RURL 4WO4C 3U82B 5E6ID 5CIPA 3VCLB 3QCUH 3DETD 3EW3B 3RVTC 4XC1H 3T2QA 3FB6A 1N4XL 3NFPB 3EO1B 3IDNB 4H1LB 1SQ2N 1MRDL 2J88L 3M17A 2ICWB 3BEVA 2VQ1B 1JWMB 4HK3J 4MJ4A 1RHHB 4WWKC 5ABDE 3RL1B 2NLJA 5I1CH 4HQQH 1TVHA 1IAII 4L5FH 5A40E 5LGKA 3BN9D 4BSWA 2VC2L 1KELH 3O6KL 3FONA 2C26A 3LQZB 2XTJD 4GSDH 3V4VL 4QNPE 1XCTB 2UZIH 1KTLA 4PREA 1AXSA 3O6LL 4U49A 3B8YA 5DZNA 3S8WA 4Z7OE 1RU9H 1I1RA 4AIXA 3VG9B 3UTZA 3IU3A 2GJZA 2FZ3B 3RWIA 4WHYH 3BXNB 3ALXA 4UV4L 3LB6C 4J12A 3PQYA 1CQKA 1ZA6A 3MLXL 3IFLL 1EFXB 2PNDA 1Y6NR 3B2UD 4JKLA 4NZJA 3MZTA 3W0WA 2QQLL 3HNTH 4PRNB 3IVKB 1F6AA 1LDSA 3LN9A 4CN1A 1B4JH 3MBEA 5T5NG 2DF3A 3U0PA 1RJZB 5SV4A 4R4ND 1BECA 3QJFB 4XXCC 3QRFM 4JRYD 2XT1B 4HIJA 1WIPA 1F4YL 1MJJA 1IC5L 1NC4A 3QIBA 4FRWA 4XNUL 3VFPA 3LKNB 3ZDXF 3DTXA 3TT3H 2FLBT 5AYUL 1RMFH 3GK8L 1T1ZA 4MA8H 4YDIH 3WLWD 3EYQD 1A6AA 2APWA 5IIEA 1Q9LA 2CO7B 1I9JL 3LN5A 1P7HL 4WUUB 2R2CA 3DX8A 3OZ9L 5C0AE 3ZKSD 5GRZA 4XI5D 4DKEL 1JTPA 3IKCB 3GSRB 4ZNEE 4CVWA 1CBVH 1XF1A 3ALPA 3V2AR 2HKHL 5KW9H 3L3KA 3WHE1 5JW3L 2UV3A 3SGEI 4M1GH 2DBLH 1WBXA 1G7MA 1YEKH 1A1NA 2P7TA 4CVXA 4HGMA 2XZAL 4FQJH 2QQQA 4O5LL 4I9WD 4LP5A 1KCKA 5FYJU 1LQSR 5GRJH 1ZTXH 2C7UB 2Q6WB 1XGPB 1FVDA 3FQRA 4LLMB 3WLBB 4XZUA 4AH2A 4LCWD 2VXQH 3BKYL 4QY8B 4N0UE 3QULB 2EZ0C 2XKSA 4PRPD 3O3DA 4U1SA 1D5XA 3FB8A 4RMRA 3QO0B 4UAOB 1HQRB 3MROB 5H37G 5KTEH 1EO8H 4P2RA 4KTDL 3W9EB 1B6UA 4FZ8H 3KPSD 3ZSSA 4OI7A 1NMCB 5DYOA 1L7IH 4HH9B 2YPLD 3PP3H 4LCYA 4OGXH 2DKUA 4XPTL 1QRND 4ZO6A 5ACZA 4ZO7A 3OTTA 3GRWA 5DD3H 4Y89A 2C3VA 3QH3A 2OJEA 3L95A 1JPTH 4GAGL 3BKML 1F00I 1BEYH 1UB6B 5DJ2A 1E4JA 4OB5H 4S2SA 3VFUB 2F8XC 5GRYA 1ZSDA 3BPLB 3JV5A 3B9KC 2MHAA 4J3VA 4ZQKB 1T0NB 2F5AL 1TTFA 2XNAB 2JF1A 5I1JL 3T4AA 2A73A 4HV8A 3O45B 4Y1AA 5ANME 3TT1H 5IEKB 2IPTH 4U1JB 1G9NC 2V2TA 4XX1G 4HXAH 2FIKB 3BPCA 3MRBB 1ZKAA 2ORBL 1LP9B 1FVCA 4ZDHA 1MFNA 1D9KA 1TQBC 3NABH 1BFSA 5AG9A 1MWAH 1RURH 2BY1A 3T3MF 1M71A 1FNEA 2OQJB 3O9WA 4LKCA 4MNQA 4DWHA 5IB2B 4IMLB 4NQDB 2R1WB 1CDCA 4H0IA 5DJ8A 5I9QB 5F1SA 1S7RB 3NGBC 1N4XH 3WKNA 4TOYL 1C7SA 1TQCB 4KGLA 4PRAA 4QRSA 5FO8A 1O0VA 1MRDH 1WQVT 2J88H 3M8OL 3T0EB 4KROD 4KHTL 3OJVC 1V7MH 4HZLA 4JRYE 4RMVA 3IXAA 1AE6L 4HUKB 4JKWA 3CH8A 4LLAA 2VC2H 4PTTB 3JTSB 1F3RB 3O6KH 4HMCA 3QIWA 1B88A 2DTML 4TUJB 1BQHA 3KPNB 1CE6A 4XCNA 1YEGL 3QUYD 4Z7VF 3V4VH 2FR4A 4D94A 3O6LH 3FRPA 4RRPG 4DZBB 4NCC2 1XFPA 3I6GB 5ESVA 3O8XB 4HKBB 1X6NA 3UO1L 4V1DA 1RUKL 3MNVA 1U8PA 1C08A 3V4PL 5DUBB 1SHMA 4M8VA 4UV4H 3GIZL 4HWEL 2PTTA 4BKLA 5F1IA 4BH8B 1V3LA 3MLXH 1PY9A 1NGQL 2X09A 3G04B 3IFLH 4NN7C 3MGTB 4JFXA 4PJXB 5TJWK 2HKFL 3Q0HA 5JPNA 2QQLH 1MHCB 2BHZA 2EKJA 2Y07L 4PJ7A 2OSLB 4XP6L 4FZEL 4OUOA 5CILL 3SGJA 1G7QA 4ISVB 3WIHL 2HLAB 1FG2B 4I9WE 2QTEA 3QB7C 3UTSD 4UAOC 4JLRA 3ARRA 3O3EA 4XCEA 3WKML 5JOFB 4L8CA 5CZKA 1AH1A 2ZUVA 4Z7QE 1WBZB 4LCWE 2R0KL 1KLFA 4PRPE 5CMAA 4YDKL 4I0PD 3X14B 1F4YH 1KCSL 1CVRA 1IC5H 4XNUH 3P9LA 3HE7D 5J1SC 2IMMA 1L6ZA 4PRIA 5AYUH 2AQ3A 3KPSE 3GK8H 4X7SL 3WN5A 1UKTA 5HGAA 3H3PL 3L7EB 5EOCL 2J8UE 3ZKMC 1V3JA 1I9JH 2YPLE 1S5IL 2R23B 3OZ9H 5CBAA 2EXWD 3RGVD 5LWYL 3ARBA 3GSOA 1QRNE 3MUY1 1IGJA 1NCNA 4DKEH 1DTUA 4OZFA 5F21B 1OGTB 2HKHH 1OAYL 3D85A 5B39G 4KUCF 5JW3H 3K8LA 1MCCA 2VABB 4F7EA 3AXLA 4MGXA 1U3HB 4OCRL 1KCUL 4PY7A 1J0YA 3FQNB 2CKBL 4ZFGL 3SQOL 4N5ED 1B0GA 2XZAH 3IRPX 4O5LH 3CUPA 3QEGL 3SJVD 3V6FB 1CXLA 3P4MB 4QGTA 5EN2B 2IAMD 1QRKA 3BKYH 1W0VB 4XNQB 4XBPA 3NIDE 2WK2A 4I2XB 3TN0A 5KS9B 5I1HL 3AS1A 4ZNCD 4KTDH 4UDTB 3QISA 2HTLC 2DS4A 3NN8B 4UIMB 2FJFB 2XY1A 3O6FB 4TVPD 5GIRA 4PJ5D 1R3HB 1BJ8A 1ZVSB 1XAUA 1A1MB 3OG4B 3V7MA 4XPTH 3FKUS 4OZIE 3QNYB 1QEWA 1JYVA 1NUNB 1EEYA 4GAGH 3GI8L 3BKMH 4PP2B 5KSAC 3LKRB 3ZE2F 1UYWL 2FH8A 3QI9B 1FFPB 1TCRA 3C5SA 2X4NA 1Y18B 4CNIA 4NNXA 1WC7B 4LIQL 3G08A 1PFCA 3VXTB 1J8HA 4LVOB 4Y5XA 1J18A 2F5AH 5HYJB 1QR1B 2B1HL 1TJHL 4RDQG 1K5NB 1P5UA 4WU7A 1IKNA 4WU5B 5I1JH 4FTVB 1X5GA 2SEBA 5SWQA 1ZWIA 3SOBL 3G5ZB 4QT5A 1NJ9A 2PO6C 3OBAA 5IMKB 4P5TD 2RFXB 1B2WL 2ORBH 3O4LB 2J7LA 4C58B 3VH8B 3BRDA 2YRZA 2D0HA 5FOJA 3QR2A 4NRYB 3RVTD 4GMTH 1T89C 3KLDA 4PTUA 4RFNC 4HIEA 2YA1A 3H9HB 4OQTL 3TO2A 3F6LA 3HC3L 3D39A 1BQSA 3BGMA 1MNUL 4JB9L 2IQAA 4G8FB 4WWKD 4TOYH 1XF2A 3MJ7B 5DXWA 1S7SA 3UTSE 4MAYD 3L1OL 2ZUXA 2WBJC 1E4XI 1QKZL 2GK0A 2WW8A 2X4TB 3M8OH 5GS1B 4PD4J 5C0JB 3KPPB 4KHTH 3LRGA 5JW5A 3R0NA 1AE6H 3QT2A 1W72L 1DZBA 2IANB 3DNKA 5BVJB 3SDCB 1QLEL 2DTMH 1VFUA 2DQEL 4LLVA 1BBJA 3MLUL 1A7NL 1YEGH 4WGWB 4WJ5B 5FDYA 2B2XL 3D6GA 4JGMA 3EYSL 5FYLD 3LB6D 4JVUA 4F15B 5IB1A 4RBPK 3UO1H 3L3IA 1RUKH 5J7CC 3V4PH 4UI2A 5BJTA 3GIZH 3M1BB 4HWEH 3O3BB 2FRGP 3OGCA 1NGQH 4CW1A 1A6TB 2YN5A 2HN7A 2I9TA 2HKFH 3LVEA 4CJ1A 2Y07H 1P1ZB 2I27N 4XP6H 4FZEH 5CILH 2AP2A 3LQAL 3AY4C 5EOCJ 5T3XD 3WIHH 3SJVE 3FT4B 3WKMH 3V0VB 1EX0A 1QFWI 5C09D 1FZOB 2Q86A 2R0KH 1IGTA 4KI5C 3WFHB 4YDKH 2IEPA 4PJCA 1KCSH 2HVJA 1RVFH 3G6AA 3NCYP 1CN4A 4S11A 3CNKA 5I1DA 3IFOA 3D0VB 3V95A 1H9VA 1FVEA 3JUZA 4X7SH 4E41D 3WEXB 4X8XA 3H3PH 3WFDL 5EOCH 1JPFB 4QHUB 2VN7A 1FSKC 1YPZF 3HE6A 2ZSVB 1D5IL 4TVPE 3FB5B 4PJ5E 4OZGA 4WHTA 1S5IH 4M5ZL 5LWYH 1Z3GL 3QI9C 1Q94A 3LEYL 1CDIA 3CMOL 3SDXF 4JKMA 4N0UB 3AREC 5FGRA 4K3HA 4DK6A 5LCVL 4H25A 1JYWA 5FGCE 4L9LB 1VSCA 5D7IA 3DBXA 4M6OL 3FAXA 5A1AA 4XNMA 4OCRH 5I1AB 1X3DA 1KCUH 5LGJB 4UQ3A 2ATPA 5IHBA 1FNSL 2CKBH 4UUJA 4ZFGH 3HRZB 1WCBB 4O02L 3SQOH 2EZ0D 3QEGH 5IESL 2UY7A 3ME0A 4N9OB 5I76A 2D4FA 4MNGA 5JHLL 3KXFD 1XF3A 1QO3B 4HIIA 1MY5A 5D1XC 2NCMA 1INQA 1DLFL 3ZMRA 3VFNA 1BVLB 5I1HH 3DSFL 4G8EA 4QHLA 2IBBA 3MRPB 2WBKA 4HH8A 1MCSA 5IBLC 3K8KA 5H94A 4R3SA 2NY4D 4WI9A 1LO3L 2AXFB 2BSED 2DKMA 4TTGA 2AV7B 1EZVX 1R3IL 2FHFA 4GRMA 5DTFA 3FT2A 1TENA 2XTJB 2EE9A 1OM3L 1DCLA 3GI8H 4ZOBA 5ANMB 3EBAA 3RI5F 1QSEA 3SDCC 1EUTA 3KYAA 3RVUC 1UYWH 3KPRD 5IR1B 1FYTD 1FL3A 1EXUA 5KANI 5FUZL 5I1KH 4L3AA 3QWOB 1IQDB 3ARGC 4APQC 3I3DA 4LIQH 1P6FA 2D7TL 1WUNT 3UJTL 4JY5L 3E6FB 2YR3A 3QDAA 1DEEB 2CO6B 4PP1C 2B1HH 1TJHH 4IMKA 1IL1B 1U9KA 2BNQB 1IBGL 4CGTA 2X1PA 4PB0L 3OKLB 3D3VB 1NBQA 3G9VA 4HXBL 5FYLE 3SOBH 4DEPB 3VCLA 1XGTB 4ODBD 4ALAL 5T1DL 2AAVA 1B2WH 4PJ8C 3NFPA 1F5WA 1RZKC 2A74B 2IMNA 3EO1A 3IDNA 4H1LA 2HMIC 4LVHB 4TNVF 5AUMB 2ICWA 5TE7H 5I8CB 1FO0L 1JWMA 2VQ1A 1RHHA 1U3YA 2D7OA 3TBSB 3IDYB 4PRBB 5DDHB 3VXRB 4OQTH 3HC3H 1YEEL 4QHMB 1MNUH 4JB9H 2NY5L 1PQZB 5T3XE 3FAWA 3LQZA 1PDKA 3L1OH 5DMJB 1BF2A 1QKZH 2JJSC 1FZKB 5C09E 2YPVL 4PLKC 1XCTA 2PTUA 1NFDF 4LPXA 4MD4B 1WFNA 3BZEB 5BS0D 2FZ3A 1DN2A 2EDFA 4GJTB 4W4OC 2W9DL 3BXNA 1QLEH 3WDIA 3RRQA 4E41E 4JN2B 3MLUH 1A7NH 1DBJL 1AGDB 1EFXA 5GRVK 2B2XH 1R0AL 1K6QL 3EYSH 4I77L 1CFSB 3BZFB 4PRNA 3IVKA 3V52L 2HVKA 2WV3A 4QOKD 2P8MB 3V7AG 5DR5L 1X6LA 4FQ1L 5IBUG 1RJZA 4JFED 2O61B 3GEWB 3QJFA 1QSFA 5FIEA 5C08D 1SBBA 1RUML 3LKNA 4F9PA 1FQ9C 1GOHA 2J8UB 3LQAH 4D3CL 4H20L 2APXA 2ZUWA 5F9WB 2YPLB 5BW7A 2V2WB 5I18L 3KXFE 1CR9L 5FV2A 3ET9F 2JK5B 5BCAA 2EDDA 4WUUA 4JRXB 3RZCC 5CGMA 3C5ZB 4M7ZB 4FQXC 3IKCA 3ZKMD 3GSRA 5L7XL 4PR5B 4GKZB 4YH6A 1J12A 5ECJE 3WFDH 4PBVC 4ZUUB 4HGKC 5AAWA 1VDGA 1D5IH 4A2MA 2NW2B 2CJUL 1NH6A 2Y4SA 4M5ZH 4OFVA 1IM9D 1CLZL 4KVNL 3UMTA 3JWDL 1Z3GH 3DV4B 4G6KL 3LEYH 1CGVA 3CMOH 4HDIB 3D18B 4OTXL 1KYOK 3S37X 3MFFB 2Q6WA 1FC1A 2C7UA 1XGPA 2VTFA 4LLMA 5LCVH 1XF4B 3WLBA 1U58B 3KPRE 2B39A 4QY8A 1FYTE 4M6OH 5F44A 3QO0A 4HKJB 1FNSH 1HQRA 3MROA 4O02H 3IKKA 3W9EA 4KVCL 4WTWA 4J4PD 2NZ9C 1BX2B 3CVHB 1K2DB 5IESH 5JHLH 2O5YH 1AXIB 4XNYL 4KKNA 3ZTNL 4HH9A 5KSBF 2HTLD 3F7YA 1FNHA 3HPJB 4YBLB 3V6OA 1DLFH 1F45A 3EOAB 5JIIA 3DSFH 3GJFB 3OAYK 3ZE0E 4UMGA 4J23A 3KJ6L 1JZ3A 1KGCD 3PJSB 1UB6A 2EXYC 1CIUA 4ODXB 3RWEB 3LD8B 5KOMC 1LO3H 2EDQA 3VFUA 3B2VL 4MD0B 3LKOB 1PKQE 2GT9B 1A0QL 2ARJB 1O5DT 1R3IH 3RHWF 4ZQKA 1T0NA 3O3UN 2VE6B 1OM3H 2XNAA 4MDJB 4OIIL 1U2CA 1Y0LB 2BVQB 3O45A 2Y1VA 1X44A 2VMFA 1N7MH 5FUZH 5IEKA 2ADJB 4U1JA 5BS0E 2D7TH 2FIKA 2CUIA 4UZGA 4JY5H 1A14L 1MJ7L 3MRBA 1LP9A 3TYFB 2MJWA 2PO6D 5AWNL 1IBGH 1DE4B 4PB0H 4U1LB 2OQJA 4HXBH 1OVZA 3BP7B 4IMLA 1HHKB 4NQDA 3B5TA 1RPQA 4ALAH 1HHJB 3UTSB 5CZVL 5T1DH 3P9MB 1S7RA 4QOKE 4XX1E 2FIRT 4JFEE 3FFDB 2VERN 2YD2A 3T0EA 2BHYA 1S5HB 1FO0H 3WJJA 1KCRL 1I1CA 5C08E 1A6ZB 5J12B 1YEEH 4PTTA 3JTSA 2NY5H 4P2YA 4TUJA 1RIVL 3KPNA 4M1CC 2PXYC 4R8WL 5JHDD 2YPVH 5IW1B 4DZBA 2P47B 4EXKA 1VHPA 1MCKA 3I6GA 2RJMA 3O8XA 4HKBA 4TNWK 4F3FB 1UADC 4JG0L 1QFUL 1A3RL 3DUSB 1F6FB 5I66B 3UTPD 5DUBA 2R39A 2W9DH 3QFJB 3ESUF 3UBXI 1D5BB 1DBJH 4BH8A 3G04A 1UEYA 2BY3A 1R0AH 1NDMB 3MGTA 4PJXA 1K6QH 4I77H 4YC2B 4HAGA 3NIFE 3KPTA 1MHCA 4XCCL 3V52H 2OSLA 2BSTB 3PNWB 4LLYB 2AJXL 4M61B 4ISVA 4JCMA 2PR4L 2VSCA 2HLAA 5DR5H 4FQ1H 1XGRB 5JOFA 2WINB 1A6WL 4EI6B 1WBZA 3RPIB 3O81A 4LDOB 3ZDZE 3X14A 3DVIA 1RUMH 3W9DB 1RAMA 1KXVC 4KI5D 4KQ4L 5FB8B 4D3CH 4H20H 4LF3B 5I73B 1O7VA 32C2B 5DMKB 3L7EA 1I8LA 3F7QA 5I18H 1CR9H 3IAPA 3V8CA 3I3EA 1KF9B 2R23A 4OFDA 1DLHB 4WW2B 1RJYB 3CD4A 1GGBL 2EC9T 3LD8C 3IDGB 4RGMC 4WFGD 4DUVA 1OTTC 5FGCB 5L7XH 1OGTA 3GIVB 3HAEG 4I0KA 3T0BA 1KGCE 2VABA 2E7LC 1UXSB 2IBZX 4X6EB 2CJUH 3ARED 1U3HA 3TGXA 1CLZH 1KCLA 4JQXA 3JWDH 4KVNH 2OBGA 3FQNA 2ZKHL 4G6KH 4HMEA 2I5YL 4I3SL 4OTXH 4X6FB 3V6FA 3P4MA 5CP3H 1ND0B 5EN2A 4N1CA 1T1YB 1ROWA 1W0VA 4XNQA 3ARYA 3MPCA 4I2XA 2QHRL 5KS9A 4UDUB 5F93C 1NLDL 3IS1X 1EPFA 4U3XA 4AYFA 1LWRA 4KVCH 4UDTA 3BKJL 4UIMA 2FJFA 1NBYB 4XNYH 3O6FA 3V6BR 3ZTNH 4LHQB 2XG5A 1R3HA 1ZVSA 1A1MA 5IBLD 3TNNB 4ELMF 1WAAA 4KKBC 4MAYB 3QNYA 4HUNB 1NCAL 3U46B 3KJ6H 4PP2A 3LKRA 2DLGA 2P8LB 3T0DA 1FFPA 4TVSa 3IDMB 4O2EB 4R7NB 5DA0B 3REVB 3VGBA 4OGAD 5E8DL 1Y18A 3B2VH 1WC7A 4LGSB 3RVUD 3WL9B 1GVIA 1A0QH 2VDKL 3VXTA 1E6OL 2W1NA 1HYSC 2Q1EA 3MZGB 2LVCA 1QR1A 4WI6A 4OIIH 1K5NA 3U30C 4WU5A 5JHDE 3BD3A 3D25B 1RZJC 2R9HC 1LDPL 4FTVA 3RVWC 1NC2D 3G5ZA 3D2UD 3TIDB 1CD8A 1KTRL 2XPGB 5IMKA 5DJZB 2RFXA 1A14H 1MJ7H 3UTPE 5DFWH 3VFMB 3O4LA 5DI8B 4X4YB 3VH8A 5AWNH 4NRYA 1RUPL 2DYPD 5C7XL 3C60C 3RKDD 3H9HA 1LK2B 4J3TA 2HMID 4MA1C 4I13B 1QNZL 5CZVH 3MXWL 2X4RB 2MOVA 3BDXA 4G8FA 4M4PA 5C09B 2E27L 3H9SB 4PPTA 5DRNB 2C4FT 3EJYC 5JA8B 2X4TA 3MOQA 5GS1A 1I7ZB 5C0JA 3KPPA 4MVBC 4EI5C 5I73C 4MNHB 1KCRH 5MERB 2IANA 4X9BA 2ED7A 5BVJA 3MO1B 4PLKD 4KI5E 2AV1B 5HDLA 5T1KD 1RIVH 3C9NB 2DQGL 4R8WH 3E3QC 4H88L 4GMSL 3W82A 4WJ5A 1SVZA 1R5IB 2YKLL 1BWWA 2KPNA 4P2CG 2IPUG 4JG0H 5JOEA 4OFYD 1R5VB 1QFUH 1A3RH 3RIFK 5C70A 4LKXB 4WFGE 3UBXG 3M1BA 3Q3GA 2EE6A 3ES6B 3BUYB 3O3BA 2Y23A 3P9WB 1A6TA 3ZDXE 4Q0XL 4O2CB 4HCRL 2YS4A 3CH1B 3ZT6A 2XZZA 4XCCH 1P1ZA 2A0LC 2AJXH 2PR4H 3ZKXB 5I2IB 1H15B 1UGNA 3FT4A 3V0VA 2Y25A 1JNLL 1YNLL 3ARFC 5C0AA 1A6WH 2DL2A 1FZOA 4NM8L 3QUZB 4KKCD 4DJMA 4NGHL 5JIPA 1WK0A 3ALWA 3WFHA 1LO5B 1MIEL 4GS7C 1X5FA 2GHWB 3VXUB 2JJSA 1UM4L 4XMPL 3D0VA 4KQ4H 1P7QB 4D0BB 3GHEL 2EH8L 1E27B 3DX6B 2NY4B 3WEXA 3SDDC 1JPFA 1KN4L 4FQXD 4QHUA 3X11B 4HWBL 2ZSVA 3BPNB 3FB5A 4XPBL 4UILL 1EO7A 2Z9TA 1GGBH 4LRNL 2C3GA 4PJDB 5I15L 1HI6B 4K2UL 3KPRB 2K1MA 1FYTB 4N0UA 5I6XC 2Z31D 1LNUB 1XGQB 2OP4L 2ITDB 1SMOA 5AZ2L 4MJ5B 3EDFA 4AEEA 3GSXB 3MV01 4L9LA 3DMMB 2D03L 2XICA 5LGJA 3WUWA 2ZKHH 2XI9A 3HRZA 1WCBA 4KK9C 4G8GB 4YR6B 1T3FA 2I5YH 3LEXB 4I3SH 4KZEL 4RFEB 1AXTL 3G9AB 2IGFL 5D4QA 1I8MB 1MLBB 1QO3A 2NZ9D 3OAZH 1BVKB 2UWEB 1JZ8A 1HKFA 2QHRH 4YHZH 1BVLA 1NLDH 4FG6D 3KG5A 3MRPA 3BKJH 3IDXL 4LRIA 4B7IA 3UYOD 2H45A 1PKQB 4JDZB 4P2QD 4XNZC 2VIRB 4EUPH 2AXFA 1CGWA 5IMOB 2AV7A 2EXYD 5C07D 4Q58C 1NCAH 1YN7B 5ANMA 4N8PA 5GQBA 1FORL 5D7JC 1JN6A 4MYWB 5IR1A 2P5EB 5EBMB 5D8JL 3QWOA 3U1SL 1IQDA 5E8DH 4EZMA 2NY6D 2A9NL 2VDKH 5IHZB 4JDTL 2Q8BL 1E6OH 1OAZL 3E6FA 4HJJL 3T3ME 1DEEA 4NIKB 2DIAA 4EN3B 2BNQA 4HLJA 3QZWB 1LDPH 3OKLA 4JO3L 3D3VA 5I74B 3RX5A 1XGTA 2GW5A 4JFEB 1ETZB 1X4ZA 3BI9X 4YJZL 2VDRL 1PG7X 1IQWL 1RUPH 1IT9L 2AW2A 5AUMA 5C7XH 5I8CA 3NPSB 2H9GB 2ICWJ 3TBSA 4DCQB 3Q6FB 4PRBA 3U83A 4LPYA 5C2BL 4KRNA 5DDHA 3VXRA 4DZ8B 3QUZC 4Q74A 1QNZH 3AMKA 3MV7E 5SV3A 3MXWH 3OQ3B 3P4LA 4QHMA 4Z7VE 2E27H 1PQZA 5IVXB 4E42B 3U9PL 4XTRC 3VXNB 4PJBE 2DDQL 3PWPD 2CK2A 2GJJA 1FZKA 4G9FB 2E8ZA 5I8KL 2FGWL 3D69B 4MB4A 4HK0B 4MD4A 4M1CD 1MH5B 3BZEA 2EC9U 4KXZH 5TE6L 5D1QC 4ZFZB 2F19L 3EYFA 2CMRL 2DQGH 4LBEB 4JN2A 5IB5B 5B3JF 5E5MB 4H88H 1AGDA 4GMSH 5TH2B 4S1SL 2YKLH 2VXVL 3W11C 3C8KB 1CFSA 1Q8MA 1U8LB 3BZFA 1CLOL 4MSWB 3MJ8B 3N06B 2P8MA 4HW6A 4PG2A 1ITCA 3DGCR 3CDYA 2AGJL 3I2CL 4PJFE 4R2GB 5F7NC 2O61A 2JJVA 1ONQB 4HCRH 2AI0L 4L3ED 3WCYA 4XC3L 3VRLF 1CE1L 4OSUL 2NY3D 4MMZC 1MHEB 2J8UA 1HSBB 5DFVC 2APVA 1JNLH 1YNLH 2EE2A 2YPLA 3O11B 3R8QA 2V2WA 4NM8H 4NGHH 2JK5A 3VMOA 3V7AE 1Z5LB 5FO7B 1A9BB 2AK4D 4JRXA 4CDGC 2QADB 1MQKH 3LMJL 1MIEH 5IVNA 1KJ2L 3C5ZA 2A1WL 1UM4H 2MSPA 2IBGA 3QDHA 4XMPH 3H42L 3GHEH 2EH8H 4PR5A 4GKZA 4PJ9C 1QLFB 5C0CB 4ZUUA 3C6LC 1INEL 1KN4H 4HWBH 4X4ME 2NW2A 4P2QE 1OTTD 1MCWW 4XPBH 4YIQB 1SYVA 4UILH 3DV4A 3OJ2C 3IRZA 1YEJL 5C07E 2WWKT 4LRNH 5I15H 4HDIA 4K2UH 3D18A 1IE5A 3MFFA 4ZUSB 5AZ2H 2OTWB 1U8IB 4P9HL 5LBSL 1XF4A 1U58A 4LQFL 2D03H 4K71B 3GGWB 4EN3C 2X7LB 1GAFL 4K3DL 4HKJA 1UZ8B 5I74C 2D4DA 4KZEH 1A4KB 1BX2A 3CVHA 1CDBA 1AXTH 1K2DA 3K7UA 4WHDA 2IGFH 1MCFA 4BM7A 4FXGB 5ITFB 3HPJA 5C0FB 3E1F1 2AEPL 3EOAA 1VFOA 3GJFA 3FQWA 3ZE2E 1YEHL 3E6HB 3NIGE 3NPSC 5DJCB 5E8NA 2MQCA 4RGNC 2C4FU 4Y2DC 3IDXH 3EYVB 3HI1B 2EE3A 2B5IB 3GMMB 3PJSA 4JY4B 4LSQL 4ODXA 3RWEA 2PYFB 4MD0A 3LKOA 2GT9A 3Q6GL 2ARJA 4JAMB 4ZAKC 1M05B 2Z8SA 1P2CB 3CAFA 5F6IB 2R0WL 2BC4B 1FORH 4U4BA 1Y0LA 3PWPE 3BPOB 1DR9A 2BVQA 1HYSD 3DIFB 4FFWC 5D8JH 2ADJA 1FH5L 3MLYH 2KL6A 2A9NH 3TO4C 2EECA 4JDTH 2Q8BH 1OAZH 1S8DB 3RVWD 4HJJH 5HYSG 3TYFA 25C8L 1D7FA 1DE4A 2L4OA 4U1LA 2F54D 4JO3H 1H8NA 3BP7A 4GAFB 1AP2B 3QP3A 4XP5L 1IC1A 5GPRA 3UTSA 3VU2A 3P9MA 3C60D 4GW1B 2VDRH 3B6SB 3MGOB 1IQWH 5JUEL 3FFDA 3S35X 1IT9H 4TRPL 1S5HA 1CFTB 4LCCB 4BUHA 3EJYD 5C2BH 4L3EE 1A6ZA 4J3OC 1DQQB 3S98A 2FJGB 2D9CA 4PJGF 4U1NB 3CDGB 4EI5D 3U9PH 5CD5C 3DSNA 3HR5B 2DDQH 3GMRB 2GFBB 3MLVL 1ZLSL 5I8KH 2FGWH 3QG7L 3RGVA 5IW1A 3CPLB 4U2ZA 2EYSB 3MV9D 2AK4E 4F3FA 3MV8B 3T3PF 5TE6H 3DUSA 3HG1D 5I66A 5DJDB 2Y6SC 2F19H 3QFJA 2C3WA 2CMRH 3EDJA 4YBHA 2NPLX 1Q9KB 5E0QA 1D5BA 5HI4C 2XG4A 4S1SH 1GPOL 1TJGL 1NDMA 2GEEA 2VXVH 5C6PB 3RBGA 1CLOH 3RUGB 3PGDB 2BSTA 2RIKA 3PNWA 4BZYA 4LLYA 4M61A 1C16B 4QLRA 3DGGB 1XGRA 2WINA 2AGJH 3I2CH 5FECB 4EI6A 2A0LD 4P0DA 3VFVB 3RPIA 1Z9LA 2AI0H 3OB0K 4OCMC 3ARFD 4XC3H 3W9DA 1NCCL 1CE1H 4OSUH 1YPZE 5EUOF 5FB8A 1U93B 4LF3A 32C2A 5DMKA 3KLHC 2NXYB 1B0WA 3N0PB 5GGRY 4OCWL 1X5KA 5IG7B 5DC4B 3SDXE 4P46D 3QUMB 4IRSC 3RY4A 4MAUL 1DLHA 4WW2A 3JSSA 3LMJH 1RJYA 4NNPL 5EC1B 2A1WH 3EHBC 3IDGA 3H42H 3EDEA 1GSMA 1JP5A 1UVQB 3GIVA 1JF5A 3P4NB 4EKXA 3C09C 2QSCL 1UXSA 4X6EA 4Z7WF 1HOCB 5D2NC 1YEJH 2DQUL 1I1FA 4RQQB 1NCBL 4MCZB 2BDNL 1ND0A 1NUGA 4P9HH 2D2OA 5LBSH 1T1YA 5D9SB 1MCDA 1OAUL 4LQFH 3U7YL 3BD5A 2CIIB 8FABB 1F4HA 4D9QD 3QDMB 1GAFH 2P5WD 4K3DH 3CFEB 4UDUA 5ICYB 3UDWC 3HZVB 1JJUA 3UZEA 1MCOL 5C86A 1NBYA 4BSJA 2F54E 3S6CA 2EIDA 4YHYC 3HUJF 3TNNA 2AEPH 4I8DA 1WVZA 1YEHH 4MAYA 2X70B 2ZUSA 2BK8A 3U46A 2CLVB 5D93C 4C56D 2A6IB 2P8LA 3OR7B 1N5AB 5HBBA 5INDB 4LSQH 3IDMA 4O2EA 4R7NA 3REVA 1JRHI 4KKAD 1NUFA 3STZB 5SX4I 3ARSA 1ORSB 5D7JD 3SO3B 3WL9A 3Q6GH 2EDEA 2R0WH 2Y9RT 1UT9A 2X40A 1M7IB 2JJWA 3F58L 1JNJA 3QWRA 5DVMA 3D25A 3ZDYF 1KIQB 1R6VA 1WWBX 2OCFD 3MV9E 5CEYB 3RVVC 2KBGA 1FH5H 4PB9H 4MHHI