3F5WB

Kcsa potassium channel in the open-inactivated state with 32 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody heavy chain
molecule tags Membrane protein/metal transport
source organism Streptomyces lividans
publication title KcsA Potassium channel in the open-inactivated state with 32 A opening at T112
rcsb
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB01
5MI0B 3RPKA 3EYUH 4UUJB 3T0BA 1CE1H 1JGVH 1IGJA 3NABH 4UT7L 1A6ZA 4ODWB 1F5WA 5HHVL 1NEZA 5HY9B 1MHHB 3PGFL 5F3BA 4BH8A 2EEBA 1OWWA 1U3JA 3RVXC 2BVOB 3D87B 4LCCC 1JGEB 3V2AR 1JRHI 2EDTA 1ONQB 3B5HA 5C0ND 3NCYP 4MB5A 3VWKA 1A02N 2P42B 1CWVA 4M5YL 4O58L 1I9IL 3KJ6H 3P9WB 2YD5A 3D9AH 4OLWL 1AGDA 4RBPK 1U8KA 3RY6C 4DCQA 3PHQA 4YH6A 3I9GL 2UY6A 3THMH 5F7DB 5C0AB 1G6RA 4XBGB 5DWUH 5T5NG 1DQMH 3KVQA 4Z95H 2QADB 4K7PX 5C7XL 1LNUA 3LKQB 1DQDL 1FPTL 5C0DB 2J88H 4ELKB 1OW0A 4G8GB 1N26A 4IBLT 2AEPL 3NFSH 4MA7H 5GZNC 1C5DB 3KNBA 4ZXBA 4Y16C 5ITBH 3P40A 3RZCD 2X4OB 1H8NA 2HJKA 3VXQB 1A1NA 4PJFB 4HEME 3SDDA 3ZE0E 1H3XA 3QHFL 4NQVB 4RIRB 2BRRL 2QKIA 3KPQA 12E8H 4JN1H 1QBAA 3MRBB 1GZQA 2WBJA 4TUKH 5D1ZB 5A43C 3S88H 5FHBH 3PP3K 3FFDA 2R56L 3MREB 3AVEA 4XHJD 1KB5L 2VE6B 1L0XA 4FG6D 4XNZB 2FGWH 1I8IB 3L3JB 3MLWH 1RUQH 3CC5A 1CDHA 2OL3B 4U1IA 5E8EA 5CJOL 5JPNA 32C2A 4M6OL 4N8PA 2FYYA 4R0LB 1YN7B 4MS8D 2EYRA 2PR4L 1FL3B 5IMKA 4YHNB 1W72A 3MRMB 5H2BB 1KTRL 3C8DA 5FM4A 2WUCH 4HMCA 3UXFA 3IETA 4KZEL 4P59H 2GHWB 3SGEI 1EX0A 1ORSA 1Z6JT 3U79A 5DTFA 2HT4C 5I1IH 3U6RB 1CBVH 1YEHH 3ESUF 2NZ9C 4PRDA 4NNPH 5DMIL 4PV9A 1HDMA 2NXZC 1DE4B 4MD5B 4G8GD 1MF2L 4PJBA 2XKNB 4FS0A 2B1HL 3PWUA 4LCCA 1M05A 3GSNL 4HKJA 3LN5B 4P23D 1H8OA 1EUTA 2VKWA 3F65A 1A3RL 3P2TA 3X17A 1BEYH 4LPWA 4UQ3A 5E24E 1F4HA 3TBYA 3Q48A 4IRSC 1R3KA 2EE3A 3WIIH 3V7AG 1CXLA 2IJ0C 4OZFH 3WLBB 4J3XA 1Q0XL 5DJ8A 1ITCA 2BY1A 4LQ1A 1ETZA 2PR4H 3ARFA 3BQUC 4N8VG 3REVA 3QNYA 4RAHA 5JMRA 4HLZG 3D2UD 4L8DB 1A1MB 1LEKB 3WMSA 4Y16A 1CGSH 1S9KC 3QDMB 2EIZB 1Q0YL 3KPMB 4JZJB 5T3ZD 4OZGB 4PYHA 5GRUL 2EKSA 3P0GB 4KKCC 4HFUL 3TO2B 2EDBA 3JV0A 1E6OL 4U1KB 1BJ1H 3MMEA 2GY7B 4LGPB 4XNXH 1IQDA 3BZEB 3OL2A 4L8DA 2NY6B 1UGNA 4G8FA 1HEZA 3PE9A 4OT1H 2A6KB 3N06B 4PJ7B 4AY0A 5E6YA 5EOCL 3SKMA 3WDJA 5K9OA 4B53A 5SWSB 5HGAA 4ZUSB 1T1ZB 1CVSC 5GGQL 5DK0B 4GG6A 3VXRD 1W8OA 3SE3A 3GSWB 1UXWB 3BQUB 2VJXA 2YD1A 4UB0L 5HHMB 1GL4B 3HI5H 2ADGA 5GGVL 1P6FA 1LEGA 3UPCA 4OLWH 4PJBB 1N5AA 5C0GA 4M1CC 4NM8H 3UTQB 2NW3A 1BJMA 5EWIH 5SWZD 1SYVB 1HCVA 3VG0H 4HBQA 5E8OB 4ELMB 1AQKL 1B2WH 3HZYA 1R3LA 4TULL 4TSCH 4J1UA 4E5XB 1AJ7H 1ZVYA 2J8UF 5SX5H 3U4EA 1G7JA 5C0BD 2FSEB 4ODSH 2WINA 3CSGA 3GO1L 3HAEA 1YNTB 3WLWC 2BC4A 1U8OB 2BVEA 1VKXB 2ORBL 4PJXE 4G6KL 4YDJB 4OQTL 1ADQH 4PJ9C 5JW3H 1Z0NA 3ARXA 5GJTH 3HZVA 3NTCL 1HHIA 4HH9A 3TBWA 5DQJB 3MREA 2DBJA 4MS8C 4UIKL 4MJ4A 3GBMH 1RUMH 1KCVL 1YNKL 1R5IB 1IAIM 4GFTB 1OB1A 2ADIB 3WFDL 1CG9A 2O5ZL 4JLRA 1T1WB 2V17L 3X3GL 3BDXA 3T4AB 4FXGA 5GISL 2D4FA 3PG2A 1VERA 2L0DA 3G04A 4P2YA 3MV01 4JFYB 4ZTOL 1IGMH 5C0EB 3IDNA 4PV8B 4G9DA 2R15A 5C0CB 3UC0H 5D1QD 3CUPA 5JXAH 1MLCB 2W0FB 2FX7L 5D6DA 5I1JL 3QXDA 3PWPA 2BVPA 2FHCA 4LEXH 1P7QD 2I25N 2NLJA 4X6FA 5BRZA 4J4PA 1Y6NR 1ES0B 2A1WL 3GNML 3CX5J 1DSFL 3GM8A 3FFCE 2FJHA 3LRSB 3MJ9A 4XCFL 4POYA 4RGMB 5GIRA 5IK3A 4JFFB 4ZAKB 2XWJB 4HDIB 3GMNA 2LU3A 5TF1H 5FCSH 1ZXQA 4OJFH 5ESQB 4UQ3B 1NCUA 2EIZA 3QDMA 1FCGA 3IT8D 3QEQA 3AMKA 2DLHA 5CSGA 1R3IL 1A2YA 2FD6L 1VFAA 3C5ZB 3PWUB 3DXAA 3J7HA 1RUQL 2HLFC 4NM4L 3KLAA 3ZTJG 4HUWB 2FIRT 4MSWA 4RDQG 4IOIB 2V2WA 1HH9B 4S0SD 4BZYA 3O3EA 3GRWA 2HH0L 1I9JH 4ZFOA 4KHTH 4D8PB 2Q76A 2IPKB 3RNKB 3CFCL 2GK0B 5IIEB 2DIAA 2UWEF 3RVTD 3LDBB 1C08B 3J8F7 1NFDE 3BPOC 1BX2B 2E6JA 2ZCLL 1T0NA 5FGCB 3SE9H 3HC3L 3D39B 3G6JA 3S36H 4XI5D 4KJYB 3EFFB 1LO3H 1FO0L 2CIKA 3HE7A 2AJZA 5D5MF 4PGJA 5JPNB 1ZT1B 3GNMH 3VW3H 5LQBH 4GUPB 1YEEL 4X5XB 5HI4D 5D7IB 3SDCD 5GQBA 1YEKL 4Z77A 3B4NA 3SDXF 5LWYL 3Q3GA 1K6QH 2OP4H 5BXFB 2QKIB 3DSNA 3LHPL 3NZ8B 1PFCA 4XPHL 5GGUA 2DYPB 3EAKA 1AGCA 2AXGB 2BDNL 3FQXB 1FFNA 4OM1L 3CFCH 1JHTA 5I0ZA 4Z7UB 5C1MB 4PR5A 2HVKA 2A9NH 2VC2L 4KH2A 4BFBD 4WTZA 5D1ZD 2AJSH 3I6GA 4OZFB 2VDRH 1FVEB 5D8JH 4JFOB 5A2FA 1OGTA 4NRYB 4NJAH 2VWEC 3HI1A 1ZHNB 5E56A 4NQVA 4RIRA 4KK8D 2ZG1A 5DJAA 5E6IA 1V8HA 4C4KT 4MMZC 3U7AA 4WV1A 5IEHB 5GJTL 3OX8B 4JN2B 3VXQA 3K74B 2W9EL 2Q3ZA 5CIPA 5IESH 3QIBA 1SYSA 3FKUS 4JDTH 3TZVC 4APQA 3E1F1 4XVJL 3VWKB 1HCFX 3LD8C 1JGVL 4JHZA 1SY6L 5FKAA 5FYKL 1N64H 2NR6D 5F7EL 3CH1A 3MLTB 4OM0L 3O4LA 1KFAH 4GH7B 4JRXB 1BZQK 1L4IA 2FB4L 5DS8B 4FFYL 1Q8MA 2BNQA 3EO0A 4XVSH 4OZIB 2Q6WB 4M43H 3ULVL 2IBZX 1P69B 2AV1B 2R2EA 2XZAL 1NEZB 3QQNA 4RMUA 5IVXF 5E99H 3U9PH 2F15A 5ACZA 3VG0L 3IKKA 2FH6A 4EDWL 3SDCB 4MZ2A 3JTSA 4Y5VC 2AJXL 3T3ME 2R4RH 2NXYB 1N6QH 4QHNB 2E7LC 1FNGB 3BEWB 4M9OA 4N5UA 4YHKL 1ZLWH 3BYYA 2PXYA 4KI5E 5CZKA 1AR1D 3OSKA 5D1QC 2YHGA 4KUZL 1GOFA 4RDQF 1TNMA 3S96A 1PX4A 1HHGB 4XGZA 3BESR 5F3BB 3D39D 5F7FA 4E41E 3V0WL 4G6JH 1YDPA 2YRZA 3MCG1 3OTTA 4KRPD 1FCCA 1CK0H 2X70B 2IANA 2A9ML 4IIQB 3WS3A 4AMKH 1CGYA 1NC4D 1MJJA 3IVKA 1D5MB 1FVDB 4I5BA 4NSKB 1HI6B 4Y19E 1IM3A 4WFGD 2A9MH 3T3MF 2VLLB 3VFGH 5GSRA 2HTLC 3QPXL 2CD0A 2QADD 1CDGA 4J6RL 5GS0H 5ENWA 5KZCD 4M7LT 3EO1A 3LEXA 1SEQH 4NGHH 3UTPD 2IFFH 4NQDB 3LMJL 2WW8A 3EBAA 3QG7L 4AG4H 4TTGA 5FA3A 3EYFB 3KXFA 3V79C 5LBSL 2O61A 3EUUA 1AY1H 2NNAA 4ZUTA 3WXVL 4N0UE 1ZMYA 4RFNB 3Q6GL 2VKXA 4I0PB 5A16A 5JO5A 2PO6A 3QULA 1LO2L 3QEQE 4KUZH 3OPZH 3H9SE 4L1DA 3RDTD 1N6UA 4JY4B 3V0AC 1YYML 2BNQD 1NGZB 5BMFH 4H8WC 1DQLL 1CZ8H 1J18A 4LNRB 3K1KC 5BXFA 1YEFH 2B1HH 1OVZA 4G6MH 4YWGH 2GSGA 3UYRH 1IILE 4EXPX 5EH1A 1AE6L 3BZFA 2VZTA 3QIBD 5FO9A 2DQFA 2DLEA 1AC0A 1D6VH 3NACH 4ZUTB 4GRWB 3IDGA 4MQ7A 4HPYL 3HCVA 4U3HA 4U1GC 3FONB 1VADB 4N0RA 4Q74A 4YX2H 5F1NB 4MQSB 4K94L 2VAAA 2AJYH 4K7PL 1YYLL 3FB8B 4S1SL 2OZ4H 1NBQA 3PIQB 3TO4A 5FUCC 5AG9A 4H1LB 2A6IB 3QBTB 4X7TB 2LU4A 4YFEA 5CILH 5KSUB 4FN0A 3VFTB 4JFXB 2XWBB 5JMOC 2NY3D 4PRAA 5FUOL 4ZYKB 5L6YH 3T2PA 1GH7A 4J8RB 1DN2A 3FOLB 1CXFA 2VC2H 3IKCB 1FDLL 1FN4B 1I8KA 1PLGL 3QWRA 2Y72A 4Z7VA 5JNYA 3NN8A 1U3HB 4YZFE 5C0BB 1RZJL 3SDAD 1QLEL 3SDCA 1FFOB 2YZ8A 2HTKD 4ORGB 4LSTL 2R23B 3G5VA 5C86A 5BZWA 5FYJL 4LSQH 4PLJC 2Q6WA 2DQEL 1O0VA 1FZOB 2JCCF 4PJXA 4JFZH 1MWAL 3V8CA 4J8RA 2P49B 2CGRH 1R0AL 3MTRA 2J4WH 4JFXA 4RMQA 1XR9B 3IDJA 4M93B 2EH7H 2DQTH 5INDA 1TVBB 3QXTA 1KJ2H 5DYOB 1IGCH 8CGTA 3GSQA 4FQCH 4Z76B 3MRGA 2RAMA 5IVZB 3HUJE 4JR9H 3CDGB 4HJJH 3LRGA 5GJSL 1RZFH 4K94H 5LGHH 1KLUA 4P2RD 1ZTXL 3PP4H 3VXUD 5HVHB 1HXYA 4OZHB 2ZUQB 2ESVD 3ZKSD 4KTDH 4BSVB 4TOYH 3FMGH 5IF0B 4MQ7B 1J8HE 1LK3H 3IFPB 2OXGA 5KZCB 3RWGB 4KTEL 2KZ1B 4BQBA 3EDEA 3QEQD 5E9DA 3QDMD 3H2WA 1I3RB 5HHOA 1U8PB 2BK8A 3EOAB 3S35L 1F6FB 3RVXD 2EH8L 3MXWH 5HD8D 3TPUB 4XH2B 3DSFH 5F72S 1NCBL 5J6HB 3Q3GB 1D6EA 1LD9A 5DR5L 2LU7A 5E5RB 5F7KC 3CVHA 1BQUA 5D7IA 3OXSB 3MLSL 4D9RE 5C08A 1TNNA 3VFRA 3MLZH 1J5OH 5J1SC 3B8YA 3TM6A 1WZMA 5CBEB 1Y0LA 3PWPD 5FO8A 1TJGH 3O8XD 3MNZA 3QJFB 3T8XA 4JM2B 4CW1B 5SX4H 4KKLD 1U0QA 4BZ1L 1IKFL 3SKUD 1E28B 4M4RA 4AIZA 1D3CA 4OAWB 2PF6A 4H0HB 5FYLH 1QZ1A 1XGRB 2P4AB 4NQXB 3UJIL 3IDYC 4PJXF 3DWTA 3D18A 3CMOH 5LXGL 5I71C 1IM3B 4OLUL 1A6AA 5M94B 5AWNL 4QY8B 3OJ2C 4PJ8D 1ZHBA 4TSAH 2V9QA 4MQXC 4P5MA 5E8PA 4A6YB 3L5XL 4OQTA 1C1EL 4Z7OF 2C3WA 3L1OL 1QA9B 3OQ3B 5EO0B 4OUUA 2H2SD 4F57L 2FX9L 3SE4C 2EICA 1RJLA 3WDHA 2EH8H 4F58L 3O0RL 3STZB 4Y5VB 1UKTA 3GMMA 4Z78A 3FQNA 2PKDA 3WIHA 3BDBA 1J1PL 3W9DA 5HYFA 4Y4FB 4NO0D 2MQ0A 3KPSE 3L5JA 4KTDL 4TOYL 5BRZB 1UKQA 1ERNA 2F5BH 4X6CA 1NDMA 1FGVL 1RZFL 2EYSA 1T4KB 3CUPB 1A6WL 1Q72H 1I3UA 4NZRL 1OSPH 4NRXB 5J0BA 4TNWF 4PV8A 3GFUA 4HKZA 1LEKA 2JJTA 2UZYB 2YD2A 3T0ED 4JGMA 4Y89A 1MJ7H 1L7IL 2Y36L 4Y5YB 4I1NB 1CR9L 2APXA 1JHKL 3EDDA 5K93A 1SYSB 3BVNA 5T3ZL 4G8IB 2K1MA 3VD7A 3QYCA 4QXGH 4HF5L 1XF3B 1NC4B 3ALXA 5DJ6B 3FB6B 1UWGL 1OGAD 1NKOA 1UWXK 3MNVA 3CK0L 5EOCH 3DURB 5A1AA 5E94A 5DHVA 2H3NA 2JK5B 5F7EH 5T1DH 1L0QA 3F62A 5C0EA 3MRRA 5IBTH 2GI7A 1FO0H 1FH5H 4KI5C 3UTTE 3TVMC 1ORQB 4LSVL 3D3VE 1FLTX 5DLML 1WFNA 4X8XA 1JYVA 4G9FB 4QTIH 3PP4L 2Q8BH 4X0KA 3WIHL 1MY5A 4PJGB 4QHLA 4CADB 3RWDB 1VFBA 1S5HB 3QDJA 4ISVA 1IGYA 4DTGH 1ZK9A 4NKIL 4X5XA 3QQ3A 3HLAB 2AKRA 2NY0C 3SE4A 1SYVA 5C09E 4XNQB 4M7ZC 4R0LA 2P5WD 3MV9B 2BNQE 1T7VA 3ZTNH 4JFFD 2WBKA 5EUOE 4HWBL 2X9WA 2IH3A 2BVYA 4YPJA 2WINB 4LRIC 4RGOH 4YBLB 1UXSA 3RKDD 5IJVB 5DHVH 2JIXA 3SQBA 3CZFA 4XP1L 4CADA 2EC8A 5HYSB 1Y18A 1WVZA 1I9EA 4WJ5A 5FM8A 3VRJA 5IB2A 4HWBA 3FT2B 4EQ3A 4OTXL 3WHXA 2E6QA 1LEGB 4LIQL 2FD6H 3VWKC 2ADGB 5HYIA 3NPSB 4NZDA 4EDXA 4F7CB 3WUWB 2BMKB 3M8OL 1P7KB 2AQ1A 4WFHE 4XCYB 4P3DA 4EEEA 4F80A 3NGBB 3NIDE 5IOPA 1RY7B 3MFGB 4M6OH 3BP4B 4QRPB 1BM3L 4ODTL 3D25A 4K8RC 2VR4A 1BQHB 3G08A 4NN7C 1IGFL 2Y6SD 4HF5H 1QD0A 4RAUA 2AABH 5C9KA 1DEEA 3KPRE 2XZCH 5EU7E 3O2DA 3RNQB 3OPZL 3EOTH 4WI8A 2EE2A 1MFAH 3WLBA 3NMEA 3VXRE 5DFWH 3LEYL 5D7JB 1B4JH 1M7DA 4NZUH 1R3KB 5DK3A 3ZE1E 1ZEAL 4P2QE 3RZCA 1S7RA 1MLCA 2ZWLT 4XX1G 2GSIB 5LAXA 1P7KA 1JK8A 5DT1L 3LOWA 3PWNB 4RGNE 3LQZA 2D0HA 1YUHA 2CR3A 4KDWA 4OQTH 2PUQT 2W9DH 4JB9H 5J06A 1LE9A 1W0VB 2K7PA 4WTZG 1HYSC 1KTLA 2FWOA 4ODXB 3JWOH 1IVLA 4CVZA 4PV9B 2HTKC 2FHFA 4KGJA 5F7NC 2FO1A 1S7VB 1TZHB 4NGHL 3MODL 1QTYT 4MNGE 3DXAE 3O3DA 1I9RL 5J11B 4MJIA 2EE6A 1IGML 2PTTB 2D3VA 2P5ED 4R4FH 1X9QA 2MTPA 5IMKB 2M2DA 3TF7C 43CAB 1TETH 2XZCL 5GRJH 4WW2B 1F58L 5HVFB 4MVBC 1P84K 5DF0A 5HGHA 3V0WH 3LKSA 2ADJA 4PJEE 4G7VL 3B2UC 4LGSB 2X1PA 4ETQB 4PP1D 1OAZL 4W6XB 4MNQE 1UH4A 2G9HA 3JV5A 3KPRA 5C0JA 3MLRL 1KCKA 1XZ0B 2KUTA 4G8EA 3EGSB 5DRXB 4MXWH 5IB3A 3OKKB 3FTGA 4ONFL 3WO3B 4NZTH 4JDTL 2CO7B 2UYLB 4DVBA 5B8CC 1GGBH 3QDGE 4MB3A 5TQ2L 5IW1B 2ZZUT 2P46B 1BWWA 4X0KB 4DEPC 4PRID 3C9NA 4CW1A 5I8CB 3RFZC 1KJVA 3PWVB 1URLA 1GGIL 4HS8L 2F54A 1QBLH 4I4WA 3GJFH 4JQXC 4WU7B 5FKPB 5D7KD 1U3ZA 3LB6D 2BRQA 2GJJA 3MRHB 3QO1B 5ANME 2B2XH 4HKBB 3LKQA 5CHNB 5GS2D 4WFHD 1CDCA 1IC5H 2I9LB 2H3NB 2JK5A 3SO3B 3QUZC 3K8KA 1N4XH 2NCMA 3ES6A 4LPXA 4C56E 3U7YL 1OTSD 2BSRB 3EOBA 3EOAA 3VFSB 3TYGH 3E6FB 1KN2L 5I18H 4P99A 1NLDH 4AT6B 5F89A 1T22A 2Z31C 1L9MA 2W0PA 3TBSB 4NWTL 1KPUA 2XZQL 4QHUA 1CFTA 2VZOA 1NDGA 3O6FC 3QUYC 4KK9D 1NC2D 4R3SB 2ICEB 2XIDA 3KYNB 1J11A 2XWTB 4NN7B 2YBRB 2Z91B 2Y07H 4GQPH 3SE8H 3TBVA 4CMMB 3G5VB 3CIQA 4NKOB 3BKYL 4QGYA 3IU3B 2E9JA 1GJIA 1U3HA 3S3SA 2D03L 5EBMB 4JR9L 3VJ6B 5IMOA 3VGAC 5F96L 3P73A 4YUEH 4P4KA 2R8SH 4WI9A 4C59B 1FFQA 1FG9C 4LSPH 4KHTL 1KIRA 3T09A 2DOCA 1JZ2A 1RZ8B 4PJHE 4QLRA 5SX4I 4Y5XB 4WEBL 5I1CL 4HKJB 1U8QB 3CLFH 2ZCLH 3GEWB 2H1PH 1B88A 1ZAGA 4Z7VB 3K1DA 2Y36H 4K71B 1DQLH 3HE6C 1KOAA 3TV3H 5FUZL 3IDXL 1RZIA 4KI1A 3RWJB 4XMKL 1YEHL 3QI9A 1HE7A 4M3JA 4JQXA 1FNEA 1OAQL 1EEUA 3JTTA 4OKVB 4KWUA 4O5LL 3LH2H 5DVOA 4ZFFB 4G43B 4N9GB 1JNLH 2VZ3A 2FX8L 2YPLE 4XPFL 2R0ZH 3AS2A 2X9XA 4U3XA 2X4NA 1DANT 2VITA 3RGVA 3QUZA 4OBRA 5T1LB 3O41A 1PBYA 3BZ4B 2E27L 3D85B 4S1DC 1EAPB 2EDHA 4O9HL 5JO5B 4JFEB 4LSPL 3Q6FB 4YGAB 3GB7B 3MO1B 4PRIE 2ZUSA 1DDHA 1MCIA 2R56H 2HKHH 1U91B 4P5TA 3QCUL 4B41A 2Q87A 1UEYA 3ZKXC 3B9VA 4AYFA 3TYFA 1D6EB 2H26B 4KRPB 5FHAL 3BT2H 1KACB 3AU1B 3OMZA 1PYWA 1OW0C 3SO3C 3C8KA 3TEUA 1T7ZA 4Z7NF 2NY2B 3MRQB 3VWJB 2P8LB 4WY7H 1CGWA 4YJZL 4CJ0A 2JKXA 3BPLB 4AK1A 2ITDB 4HGWA 4C58B 2Z35A 4LLDA 2KDGA 4OLYH 2R0WH 1OF2B 2QEJA 3V4UL 2DQHL 4O2CB 2NQCA 1HINL 1KJ3H 4ONGL 3HC0B 3OG6B 1OAYL 1I8MA 5EZLB 2NY7L 2YN5A 2V17H 4OIAA 4PJIB 5ENWB 1V7NH 1TJGL 5D96C 3HFML 3NCJL 1BFOA 2P8LA 3GSQB 4CL7A 1P5UA 5AZ2L 4CU7A 5CSBA 4CN6A 1JWSB 5EU3B 1KCVH 3TWCL 1E4KA 1QRNA 3DHMA 4QO1A 3UDWA 1HIML 3UTSE 3FHQA 5TPWH 1BZ7A 4E0RA 4TN9A 4UILH 3I9GH 5KVEH 4IJ3B 1EUUA 5FYLD 4UV4L 1XGQA 5IEKB 3BD3A 3GKZA 5C08E 1F2XK 4LRIA 3DMMB 5IW6B 4KROC 4NM8L 3DIFA 2ZUXA 4U2ZA 3D85A 4WDIA 2AV1A 2R2EB 4Y88A 1MCKA 1PG7W 3B9KB 3FOMA 3V52L 5IB1B 1FN4A 2HWZH 1IMHC 2R0KL 3P4OB 1UJ3B 4E0RB 2HT4D 4TRPL 5HHOE 3ULVC 4OFPA 4PRAB 4GS7C 2VWEE 3QEHA 1QPPA 3I02B 3MLVL 1EGJA 1HNGA 2BCKB 4LLUB 3W2DL 5IWLA 2R0KH 1OTTD 1TCMA 1CF8L 4XCCH 1T03H 4C83B 1PAMA 1XH3B 1I8MB 5DEZA 43C9A 4NN5C 3FB8A 3N1QC 4EDWH 3H7BA 2OL3L 5HVGB 4EOWL 1WIUA 2VQ1A 1VADA 4TQEH 5GJSH 2FL5B 3C6LC 4MNHA 2HJFA 1CD1B 3H3BC 4DKEH 5ID0A 2L7UA 2B2XL 5GRVL 1WZ1H 1NUFA 1YEIH 4FXKB 4LLMB 5F6HJ 5D96B 1TENA 1UYWH 2AK4B 4CU6A 1BD2E 3WSQL 4APQB 2X41A 2YPVH 2UZXB 2MQCA 1CICA 1MAMH 2DL2A 3NAAL 3HMWH 4OF8A 3R0MA 2VLRE 2AAVA 3L95A 4NRYA 4XBEH 5D7IF 5F1IB 3IJHA 3R8BB 2A83B 4BFIB 4LSTH 5CZXC 3QFDA 5DMJB 5L6YL 3IJYB 4P5TB 3GSNH 1B4JL 2AXFA 2BSSB 2Z93A 3Q6FA 1IQWL 5BS0E 4P2RE 3RIFK 5HYJB 2ERJB 4KZDL 4WCYH 1RHHB 1MCOL 1JPFA 2R69L 3FQWB 3IRZA 2F53D 3IDIA 4DQOH 1F4WL 2YXMA 1G0XA 3NIGF 3MJ8A 2NY4B 3QI9D 5HHOD 2GT9A 5DO2C 1K8DA 4PJDF 4FQXB 4P9HL 2DLFL 1IM9B 2C9AA 3RNKA 2VDNH 3O3EB 1U2CA 4X9GA 1FAIL 1WCBA 3VDBA 3C08L 4AENB 1KIQA 5BJTA 1XMWA 3E8UH 1OD9A 2ICCA 4P2RA 2MKWA 5CMAA 5DJDA 1A7RH 5KVDL 5F88A 4NWUL 4M1GH 2NY1B 1S3KH 3NCEB 1BOGA 3B9KC 2ZUWA 5D7IE 1RZ8A 3WFCL 3IDUA 3G5YB 3RIAK 1VB9A 5TJWK 1DSFH 3SJVB 2APVA 5D1QB 2MHAA 4HDIA 3WNMA 4C55A 4P2OD 5A40E 3DMMC 2QR0B 4NZUL 3PWLB 1FC2D 4OCMC 5KSAB 4ODHL 4I2XE 4DW2H 3V5DA 1FFPA 1PG7L 4PRHD 3RUGF 3EJZC 2IAMC 3VJ6A 3MRFB 1UACL 1T21A 1I85A 1WWWX 2YD7A 4GW1A 5I16A 5C0CA 3MJ9L 3QWQB 1NC2A 2WP3O 1CGUA 3SDAA 2IALB 4XC1L 1TJHL 2BY2A 2R69H 1AIFA 3QIUB 1KSRA 4NQCD 1I85C 4XXDB 2VMFA 3S37H 1B0RB 3F7YA 4OJFL 4PJAB 4FRWA 1RK0A 1A14L 4DUXA 3CVIH 1IAKA 1P4IH 1KPUB 4U1GB 3HB3C 4H26A 3V5HB 4NDMB 5CJQH 1TZHA 3G08B 4GQ9H 1X5XA 3TO4D 1V3LA 2AI0H 2EEDA 5B38A 2O26U 1I9IH 3KJ6L 5ESVA 2X1OA 1U3YA 3LRHA 1JJUA 5IBUB 5EA0H 1EEZB 3OKDB 2F54D 3QDAA 1UWGH 3S4SA 3RRQA 1KLGA 5SWZB 3QO1A 5I73C 2DQGL 3O4OC 4CGTA 3SE3C 5EULV 2GSIA 1O7VA 5LAXB 3KLHC 4FQJL 4NRZA 5IG7A 5CZVH 3RZCB 4WI2A 1GSMA 5E2UH 1U95B 5MEQA 3X11B 1P2CB 1G7IA 5FOBA 1WBYB 4LARL 3C6LB 4QOKE 4XT1C 1F3JB 3TO4C 1K4DA 3RDTA 3LKNB 2XKUA 5KVEL 2PO6D 4LP4A 4S2SA 2ZJSL 2O5ZH 1FLRH 4RWHA 4B50A 3Q5TA 5IMMB 3GJEB 3BRDA 1XZ0A 5CCKL 2DQIL 3KPTA 4GKZA 3UBXG 4NOFA 1YPZB 4G5ZL 4EOWH 5F7YC 3QIWB 3SKNB 1A9EA 3HI6H 5C0GB 2FR4A 1MFNA 3F8UB 3LS4H 3DBXA 5JQ6L 1N7MH 4N0FB 1GHFH 2YPVL 2APWA 1EBAA 1ROWA 2BERA 3MV7E 1WWCA 3RGHA 1JI1A 4WUKH 5DD5H 4ZFOB 1AP2B 4XX1E 2OQJB 3V52H 1S5IH 4XVUC 1SEBA 2HT3D 3MBXL 1K4CB 1XF4B 1QLFB 3ISWA 4HUWA 2A6KA 4PJ7A 5T5NF 1LP9B 1MVFA 1E6JH 4G8FB 1G9EA 3U0WH 2R29L 2Y06H 5E8DL 3OZ9H 2VL5A 4NOBA 5HGDA 4YR6B 1IJ9A 2A2QT 4QT5B 2V7HA 3VGAB 3WN5A 4MHHI 1OAYH 4P5KB 2I07B 3I50H 1AHWB 1WITA 4JG1H 3EJZD 1UXWA 1CDJA 3U36B 3QUKA 4Y2DC 4AZ8A 1I7UB 4KHXL 1I9RH 4QRRB 2NY4C 1KPRB 4P2OC 4IRSD 1BEYL 2Q1EA 1WK0A 2X5PA 4PYGA 1MPAL 1I1RA 3WE6A 4KXZH 4WFEE 3NA9L 1G7PB 5T3XL 4JDVA 1FZKB 2CMRH 3ULVE 4LCYB 2VR5A 4HUXB 4UNUA 2DS4A 5FDWA 1JGLH 1VACB 3EYSL 2BNUA 5IKCB 1MOEA 5DMYA 5F7HA 4P3DB 4JRXD 4BSWA 1VGKA 2R4SH 2JJTC 4HCRL 4Q9RL 1OCWL 3MFFA 4N90D 4UU9B 3IDXH 3WUWG 2WSKA 3BO8B 3MFFB 4F7MB 2HT2D 2L7JA 4DVRL 5H8DA 1YECL 4X4ZA 3S35H 1MIMH 4Z78B 5IB2B 4QRUB 1Z9MA 2WWKO 5FK9A 5HHMD 1QHPA 4K9EH 3WCYA 1JZ8A 4NUJB 1N5YL 1KCRH 1KJ3L 1B0WA 1M4KA 4I9WD 1OB1B 2ADIA 3QCTL 1D5IL 3VG9C 4LCWE 5FFLA 3HR5B 4YUEL 1KLFA 5JPMB 3TT3L 4S1RH 4U7KA 3U0PA 1BD2D 3SY0A 3TA3B 1T4KA 4X83A 4DOHE 3CSPA 1V3JA 4IDJL 32C2B 3TP4A 3UZVB 2AK1H 1NC2B 5DSCA 3LN9A 1DP0A 2ZSWA 3D18B 4IRZH 4YHOH 5E4EC 4YQXL 4XPAL 1G1CA 3W9DB 2CLVA 1PZ5A 4D2NA 1EXUB 4J3WA 4FTVB 4MA8H 4Q2ZA 4XPGL 4HKXA 2VIRA 4KV5E 1OTTC 3BIKB 3LKNA 3FRUA 4BQ8A 3I3DA 4HIXL 4LSDA 4GXVL 4MAUL 4L8SC 1DUZB 3V6OA 3EYQD 4JM4H 1AGFB 1QLEH 4OZHE 2OR9H 5E7BA 2H9GB 2IGFL 3DOSA 5A2JH 3QCVH 3O2VH 4J3UA 1OGAA 3VCLA 5HJ3B 1S78D 4XB8A 1JV5B 1RZKL 5F88B 5GGTA 4ZOEA 2FZ3A 5C07B 1EEZA 4GW5A 1QFWI 4PS4H 5T1LD 2VLKB 1MHEA 5T33L 1ZTXH 4GAJH 1FSKC 1I1AB 5DLMH 1A47A 4P57A 3T0EA 5FM5O 1L6ZA 4QXWA 5K9OB 2F53B 3MRDA 1E4XI 4ZXBB 1HEZB 2RCSH 3ELAT 4ZAKC 3AREB 4JANA 2VXUH 4WV1C 2CDEB 1MFEL 3X11A 1MCFA 1FRGL 4QHMB 5HPMB 1H9VA 1YMHB 2J88L 4G6AD 5CBEA 4HS3B 4LSQL 2HFGH 2J8OA 3MGOB 4CRPA 3MV8E 4GXUN 3P0VL 2F19H 4OLVL 2FO4B 3QUXB 5JW4N 3CVHB 2JJSC 1PW3A 4OV5B 3QZWB 3KWWA 4MJIE 4EUPA 3BWAA 4MNGA 2FLRT 4DGVL 4H88H 3CSBA 2Y06L 1ZGLB 2OL3H 1P7QA 4UT6H 3MLVH 2AJ3A 5B39G 1DCLA 3REWB 4L4TB 5D1QA 2DB8A 3MODH 4NKMA 4JO2L 2R23A 2Z0BA 3DI3B 4PJ8A 4PJBF 1RK0B 1FO0B 4RBPH 1FFOA 2I9TA 1YEGH 4A6YA 2VQ1B 1BVKB 4S0TD 1AFVH 2WBJC 4W70A 2V2TB 4UIMB 2ZSVA 3JWDC 4GG6E 2B4CH 2ZOKA 4C54A 1JGDA 1HK6A 1J1OL 5DD1L 3QXVA 4LVOB 1NMAL 4C83A 1IT9H 2BXYA 3F58H 1K8IB 4PBVC 5KSUA 3VXSA 2X7LA 4H0GA 2UZIL 4I3SH 2HMID 3L1OH 1N4XL 1ORSB 4QXTB 3LN4B 5BRZE 3C60D 3I6KB 3V5KA 3OHXA 2VDML 2FYYB 4PD4K 5J6GA 3PP3H 2VNCA 2FDBP 2NXYC 3MNWB 4JZNA 4KY1H 4K9EC 1QSFE 4XZUB 3GSVB 4AM0B 1A6PA 2VE6A 5C0BA 1IKNC 4OCRL 3TH3T 2CR6A 4XWOC 3MGTB 1W72H 3WKNA 2IMMA 2DKMA 2D31A 4FNLH 1I8KB 2LVCA 5KAQF 1C7SA 3M8OH 3L95B 5F6IC 1B6UA 4MCZB 1IAOA 1K2DA 2DM3A 4U6XA 5E9DD 1E4WL 3V4PL 4R6UA 4LSUL 1BMGA 4AH2A 5BW7A 2EO9A 1IC1A 2OXHA 4X4XB 3BT2L 3KYOB 2UUDH 1A7PL 1CE6A 4KDVA 2NNAB 3RWGA 3TN0C 5HDBE 5IF0A 3MV7D 4R4FL 3A6CH 1S9WA 1WAAF 1UJTA 2VZSA 1TDQA 1TCRA 4LEOB 3HB3D 4DZBB 3RL1A 4N0CC 5F7DA 1JGUH 1KN4H 2QV2A 3GKWL 4I0PC 3IYLW 3IJYA 4MXVE 2GUOA 3OR6A 4CBPA 1P1ZA 1JZ5A 4X99B 3QB7C 4OLXL 3B5GA 1BGXL 1XR9A 3AU1A 4UAOB 1D9KA 4Y4FC 3CVHL 5B39B 1YY9D 1P4BH 3G6DH 5K9QI 5C09B 1NMCC 5MENE 3IXTA 4MD0B 5CJOH 3QNXB 4YHIA 3AB0B 1U91A 1D9KC 1MQ8A 4KRLB 4PRNB 4D9LL 4KQ3H 5H35A 2A0LD 5I66A 5I8EA 3KXFB 1YDPB 5LGHL 1KG0A 4S1DD 1QVOB 1LDPH 4K2UL 1UH2A 1U9KA 4Z6AT 4KK6D 3RPIB 4GMTL 4HS6B 3P9MA 3UTOA 1OPGH 2YA1A 4CDHA 2GJ6E 5ITFB 1AR1C 3P0VH 4LDEB 1QFWH 1KNOA 3RWHA 3QUZD 1H3UA 3G5XB 2BOCA 3H9ZA 4H5SA 3G5XA 3O6KL 4ZG1A 2O5XH 4WTWA 5B8CA 1MCNA 4LPYA 1UJ3A 1R5WB 2ZSVB 3HNSH 1MHPH 3B8SA 4PS4L 2VLJA 1QVOA 4M8QB 3DX9A 4EI5C 3LQMA 3HCVB 4X4YB 3CH1B 4WHCA 4H5SB 1MUJA 2BOCB 3SJVD 5DA0B 3REWA 4QRSA 4XNYH 5HHVH 3PL6A 4XMPH 4EI5A 1BREA 1KJ2B 4HPOH 1KC5H 4JREB 3PQYB 5GRWA 1KCUH 5AEAA 4L9DA 2AEWA 3VXOB 1ZWIA 1I7ZB 3QAZC 3B2UD 1CLCA 3DO3A 5IFHH 3AY4A 2V5RA 4OF7A 5MERA 5DK2A 1FNGA 1H3VA 3QG6B 3CDFA 4NCC2 3JTSB 1HH6A 1UQSA 2Z4QA 5JDSA 4IRSA 2SEBA 2FCBA 4G6FD 4YFLI 5ILTH 2OTUB 3S3JA 4JGJA 1UM6H 3P4MB 5I9QB 3JSSA 3RHWF 4XCEA 4B7LA 2RHEA 1LO3L 3QUZB 3RIAF 3KR3L 3CSYB 1NBVH 1U8MA 1MCPL 2HG5A 1CL7I 3GUTA 4X99A 4ZXBD 2XICA 3A0OA 3QIBB 1N0LA 2GW5A 3BHBB 1QFUL 4L5FL 1N0XL 1S9YB 3CFJA 5F3HA 2CSPA 2PNDA 2DQHH 1Q9KA 4DZBA 4P4KC 5EC2B 4JO3H 1RFDH 1SEQL 3IRPX 5CGYC 4HJ0C 3W9EA 1PVHA 3TFKC 3DGGB 3QCTH 2VZ1A 4OCLC 3VXPB 3D39A 2BY3A 5DHYB 3ZKNC 3ULVF 4LSSL 4AEFA 1I1FA 1JUFA 2DMBA 3U7WL 2EKJA 3QDGB 1RZGB 3UYPA 2IBGA 4D8PA 1F90H 3DECA 5FYJD 2X4NB 3MA9H 4NQDD 3W11D 3TCLB 3WEXA 4H20H 1B0GB 3DV6B 4FTVA 1T2XA 1D5ZB 3MUJA 5BV7H 2YRLA 4HXBL 3KJ4B 1BAFL 1CL7L 3R8QA 5ANMB 5FOJA 5DD6A 1ZT1A 5TFSL 2DQCL 2X42A 3T1FA 5I15L 1JZ7A 4HZLA 4PJCF 4HJGB 5IVXA 3RGVC 5FIEA 5I2IB 2V2TA 3KYNA 1UH3A 4LCIL 1J0YA 4AEIL 3T77A 1A6UH 3DTXA 3O4LB 3OKNB 1T1YB 1MFCH 3BX7C 4NKMB 1WIOA 4N5EC 3NOIA 3TBSA 1JI2A 3QHZH 5HHXH 3MRCA 5HHQA 1GC1C 4EUPG 2A77H 4NUJA 4PJ9A 4JRYB 4NQEE 4JCMA 5E5UB 2R1YB 4MSWB 1YMMD 1E4JA 1U8JB 3SGDH 1IGIL 3TCXA 3O9WC 5KVGH 5B22A 2HFFB 4WEMB 2BNRD 4GRLC 1JBJA 3T2NL 1U41A 4LVHB 1N8ZB 2HVKB 4PJFF 4F9PC 1NMAH 1T66D 5IKCA 4DK6A 1WLHA 4NQCA 4PJ5B 2IPUK 3OKMB 2GFBB 3QXAB 3EYQC 3PHSA 4ENEC 1NCWH 1KUMA 4KRPC 5KJRH 5I76B 4P23B 1WFUA 3WXWH 2HRPH 1W0WB 1F42A 2HYMA 4M5ZH 1R5IA 2YWZA 2QADC 1TVDA 2FECL 2VDQH 2FATH 1U8LA 4EUPB 3MC0A 3W5NA 1CLYL 2PO6C 3MCLL 4PJHB 4FQ2H 5DQJA 2J4WL 5D5ME 2JB6B 1PD6A 2P48B 4KKAC 4UZGA 3QXDB 3U36A 1P53A 3QIUD 4DAGH 4BUHA 5D2NA 5TQ0H 4NQCE 5JORA 2BMKA 1U58A 3M17B 4X7SH 3MYJB 2YR3A 1ZANL 1CTOA 2HVJA 1KCUL 1IGCL 3HI5L 1R3HA 4OIIH 2NPLX 1NL0H 2R0LL 3ME0A 3U48A 2ILLA 4YGVB 2PW1B 4LRNH 5FGRA 1K4CA 2WBWB 4NKDB 3GJFK 1NAML 3H9YA 2E8YA 4ODVH 3EYVA 4G9FD 2O5XL 4XTRC 2CDGB 1YMMB 1NAMH 2E7LA 1CGTA 3ZE0F 1MCDA 4RRPA 3UPAA 4F7TA 3DO7A 2FZ3B 1OHQA 1F2QA 1RZJC 2DQJL 4UOJA 1A3QA 4LFHG 4PRIB 1VFAB 2XG4A 2J6EA 4TUJB 4D0CB 2JIXD 1U58B 3M17A 3CXDL 1JK8B 2H9GA 3VXTB 1S7RB 2NY5L 4KUCF 4R26L 2HMIC 1CFSA 4FQXC 4ZS7L 4JFFA 2JB5L 5DQ9B 5JW4M 4JFPB 3OB0H 1WF5A 5DGRA 4H0IA 3VFNB 1INEH 5IGXH 3TZVD 2VIRB 1J0KA 5FF6B 1U6AL 4J1UB 2IFFL 1M71B 4NKQB 1OAKL 1JF6A 5ICYB 4DK3A 3UTQA 4FMFA 2EKSB 5GS0L 3UO1L 5JIHA 5CGTA 1HHJA 4KI5D 5FHBL 4IOSD 4Y0GA 2PN5A 2ATPB 2Z31A 2XACC 3AAZB 3B9KD 3LQZB 4XP5H 2WUBH 4PJIE 3L3OA 2ZOLB 3EJYD 4Y1AD 4OFYD 1H3PH 4L4JA 1M1SA 3JWDL 4G42B 4QWWD 1CLOL 3ZDXF 5E03A 5ESVB 3UTSB 1BF8A 5KSVA 3WFCH 1NUDA 2UY7A 1DQQA 3UTSA 1P4BL 3G6DL 4OD2B 1X44A 1DBJH 1G7PA 4H26B 3V5HA 1JTOA 4PTTA 2ZOLA 4LK4A 5TQ2H 4PFEA 1D5IH 5DQ9A 3BP4A 2RB8A 4UQ2B 4I48B 3TNMA 2ATKB 1IC4L 5DRNB 4AJ0A 4OCRH 3LS5H 3ORJA 2R4RL 1N6QL 1OAUH 2D9QB 2P8PA 3OZ9L 5JOFA 4D0CA 5B3JF 1MRCL 4JDVB 3LS5L 2VZVA 2VYRE 3S98A 5AG8A 3OAYK 2HP4A 1XIWD 4H20L 1MRCH 1J05A 5CLWA 4MVBD 5DJ8B 4PB9H 2R1WB 1YEJL 3DX7B 5EOCJ 1S78C 1DBKH 1F90L 5DDHA 4ZO8A 3TPKA 4AMKL 5CP3H 1DBJL 4LKXB 1T6WA 5HGGS 3ARZA 2GQHA 2IAMA 1QA9A 2FEDD 2Q3AA 1SM3L 1TVHA 3DVGA 4PRHE 2ID5A 2XI9A 4OUOA 1OQOA 3ILQC 1FIGL 4FHBD 3TC9A 4LBEA 2BVTA 3FB6A 3WD5H 3SDCC 2P8MB 4M43L 3H3KA 2ZJSH 2GIYA 2JB6A 3CFJB 3CGTA 1T03L 3SKMB 5I1LA 2GT9B 5DRWB 2P5WB 3MV9D 4N0FA 4ZTPL 1F4XL 1HQRB 1IQDB 2R2BB 3QSKB 5BS0B 3TO2A 2B4CL 4V1DD 2MCPH 3HG1B 5EC1A 4UNTA 5C9JA 1BQLL 5E8NA 2OTUA 2Z93B 4ODTH 3QIWA 3SKNA 4DCQB 2AXFB 1YEGL 1VFUA 4PJHA 3CJJA 2DM7A 4X5WB 3ARPA 3Q0HA 5JQ6H 2W9EH 5IESL 3LS4L 1I7TB 3BW9B 1NFDF 3QNYB 5B21A 2I60L 1UG9A 3WJLC 2GY5A 4HHAB 3H7LA 4IMKC 4OLVH 4YNYA 1HSBB 2BP3A 1QQDA 3D2UB 4MXQD 4Y7MA 5J13C 4HGKC 4OFKA 4JRYA 3F7VB 4FABL 2VH5H 5DJ0B 1J1XL 1MH5B 1DN0B 1S7WB 4LHUB 1RZKH 3DUSA 4ODWA 3OJVC 4G8GA 4X6CF 1ZGLP 3DTXB 4ZOBA 2NY6D 1FZMA 1DL7L 2VLJB 3MROB 2NW2A 2ATPA 2OR9L 5IJKC 3CK0H 2ZPKL 3MRNB 3KPOB 2LQRA 3P3YA 3MLXL 4LMQE 5KSBB 3L7EB 1DLFL 3MJGX 4M61A 3DYMA 4X9BA 1XF2A 5K9JH 4PJ9B 2M1KA 3FN9A 3D69B 4UMGA 4W6WB 1NL0L 2R0LH 2X4RA 3DROA 3M45A 4NN5B 2BCKA 3HUJF 2X4UB 4KJWC 3WIIL 1FFPB 1C5CH 1CFVL 5FO7A 3RBSA 4YHNA 1FJ1A 3HRZB 1SJEA 1RAMA 1FGVH 3BISA 5F9OL 4OF3A 2PXYC 3QIUA 4NNPL 3OKEA 3OGOE 4M02A 5DMIH 5GRZA 2OSLA 4BK4A 4HZLB 1U3HD 4Y19D 2WBJD 3SE9L 3PABA 1HHKB 2VDLL 5EUKA 3CC5B 4PD4J 2BNRB 2YD6A 5C6TL 3SDDD 1MCSA 3R1GH 3OR7A 4XVTH 4K9EL 1JGUL 3CFKB 1N5YH 1HSAA 5F93C 3F6LA 3T65B 4JM2C 2XWBA 1LE5A 1VCAA 4NQUA 4L3EE 4NQXA 3QWRD 3S4SG 5BOPA 1CLZH 1I3RA 4NQSB 1KCRL 3B3IA 1E28A 5SWZE 2YS4A 2HVJB 4KKCD 4RGMC 2WWKT 4JN1L 3DGGA 4XHQA 5TF1L 2BOBB 3EHBC 4HQQL 5EOTB 1FV1A 2KH2B 3HE6D 3LY6A 5DURB 1T04A 2P1YA 5CWSB 3MRPA 2WWMC 5CBAA 3VFRB 2ED7A 4P23C 3DUUB 3GSRB 1ZHKA 5I0DA 5C8JA 1IM9A 4KJWD 5FYJU 4JO4H 3VWJA 1LK2A 3WXVH 4CMHB 5JHDD 2HG5B 3ARQA 3SDXE 2YRPA 1KYOK 1YPZE 5DWUL 5BZDA 3VWJC 3FO1A 1YY8B 1AJ7L 2OK0L 1TQCB 5BQ7B 4O2FA 3QAZB 4M7JL 1E4KC 5F9DC 1S7UB 2VRAA 4NNYB 4JFDE 2C1OB 3LEVH 4DVRH 3KPRD 4HIIA 4YPGA 3MNWA 3BI9X 4OGYH 2APBA 2KQMA 4JEGB 5F96H 3RI5F 3IJHB 3NVQA 3SE8L 2DD8H 2D03H 1MPAH 4NQDA 5JZ7C 3RQ3A 1MI5E 4YK4B 1HNFA 4G80A 3CD4A 1UC6A 2QL1A 2P5EA 3TBTA 3CXHK 3HPJB 1T5WB 1ZVHA 2C4XA 5L88L 2NY0B 1YPZF 4FQQB 2VLLA 3PV7A 4I0KA 5ITFA 1MCWW 2QJDA 5IB5A 4YHKH 4TSCL 4M8QA 4U0RC 4XNUH 2XZQH 3L7FA 1QBMH 1DUYB 1GHFL 2E7CA 1BJ1J 1CFNB 4R2GD 4JY5L 4HJGA 3GO1H 1A6VH 3IDYB 1FO0A 4ACPA 4FZ8L 1NGYA 1EO8L 1OLZA 4FQQA 1P7HL 2LV4A 1UFUA 4KVCL 3NCCB 4WUKL 4FZ8H 4OB5L 2YOCA 5CEXB 1HYSD 2DQTL 2E3VA 5BQ7A 1A6VL 4YXKH 1G7MB 1NGWA 3QEHB 4PJDE 1RUML 5DJCB 5IM7A 5LKNA 3K46A 5DR5H 3IXAA 4H88L 1TQBC 4YFLF 5ESAA 1N2RB 4FFYH 1OT2A 2BX5A 1GGBL 3S5LG 3UO1H 1WTGT 5A16B 4OLZL 5I8EB 1FG2A 3SDYH 2HT2C 3PIQA 3TO4B 3RU8L 5JA8B 4RMTA 5BVPL 4ZNEE 4EN3A 3HAEG 1OP5K 5SX5K 4MA3A 2Y5TB 4Q58C 1MNUH 1SHMA 4PY8J 3TN0D 2WLYA 4EI5D 2FGZA 1A9BB 1OAZH 3BZFB 5I73B 1ZLUK 1CQYA 1A1OB 3WFEL 1ZS8B 5C8JB 1NFDB 4F7PA 1WIPA 5FGCE 5HHPB 3ZE2F 4XB7A 5KS9F 4NHCH 3ARDA 4YC2C 4DOHB 4OKDA 5IVXE 3SN6N 4MAUH 3D5OF 3UTPE 3UTTA 4ERSL 1TMCB 2DL9A 1JV5A 3WS3B 4PJEF 3ULUC 2UVFA 5EIIA 3HFMH 1MELA 4ZODA 5EU6A 3P0YH 2NY7H 3B3IB 3BZ4A 3ZKXB 4QOKD 5LQBL 3V5KB 2AP2A 4I18A 3RGVB 1U8HA 1DBBH 2A0LC 2HJLA 1WUNT 3OJDB 4OV6F 3MOQA 5DD0H 3BIKA 4S1RL 3HG1D 1RUKH 3DV4B 1UCTA 2HKFH 1EHNA 4ZFZB 5IHBA 1B4RA 3AFLA 5F1KC 3VGGA 5ACZB 1HI6A 2F74B 3GJFA 2EC9T 4AG4L 1RK1A 3O41B 4WUUD 2VABB 4XVTL 3WXWL 3JV4A 5E4EB 3LN4A 1BX2A 4RA0C 1NCWL 4UINL 1QFOA 3SGJA 3G5ZB 3I84A 1JWMA 5GHWH 2F53E 2OJZL 3O11B 3PDGA 3QUMA 1AH1A 4FA8A 4BZ2H 2CDFB 2X4RB 3DROB 1UACH 5I75B 1H0DB 4TTDC 4PJ7E 4F15C 4W81A 3TVMB 2V2WB 4HBCH 4GRLD 4Y2DA 1F11B 4OZIE 1G7QB 2R2HB 4NN6C 3KPOA 4I13B 3A67H 4DN3L 4XPFH 4EVNB 3MV7A 4M1CD 5BW7C 4TSBH 3MROA 3QZWG 5IROA 4LDOB 3BSZL 5HHME 4YZFF 1OY3B 3AXLA 2HKFL 4RSVA 2X4TA 4YFDB 5J89A 1AGBA 2QQLL 3DXAD 3VGDA 3ZDXE 2A77L 3FT3B 4JO1L 3LB6C 2Z91A 4FP8H 1KXTB 4PJBE 2CLRB 2RFXA 2EDRA 1ITBB 1AGCB 1M7DB 1RIHH 3S7GA 3ARUA 3T4YB 1NDGB 4JG0H 4LCYA 3NZ8A 3TA3D 1IAIH 3F7RA 2NY6C 3MUHL 4OCWH 5TE6L 1UT9A 1WSST 2ZUQC 1G7HA 5K59F 1PKQB 1SMOA 4G6FB 5F89B 3NFSL 4MA7L 4XNMA 4JHAL 5D2LB 1GZPA 5GS1A 1LK2B 4Z77B 3KLHD 3E6FA 4K3DL 4XAKE 3T0EB 1BECA 4RA3A 1U93A 4L4VD 2I5YL 1I7UA 2VH5L 4YO0B 4CMMA 1DL7H 4I3GA 3MCLH 4PJHF 3K2MC 1G9NC 5ADPH 2XWTA 2YEZB 2VOTA 1DZBA 3X14B 5EOTA 5BRZD 2FJGA 1H5BC 2X6MA 4Y19B 1ZA3A 2EYTA 3RVVD 4YR6A 4OZIF 4PGEB 4Y4FD 4GAGH 4JANB 4TQEL 1RIUH 2ORBH 3WIHH 4OI7A 1S9VB 1I1AC 1WZKA 4K7FA 5GS3A 3WHE1 4MJ5A 1KCSL 4AT6A 5I1LB 4NQSA 2F54B 4JKLA 2WIMA 1SQ2N 3VRJB 3NTCH 4LSSH 3VFSA 5HI5C 4J23A 4MDJA 4Y8AA 3O6FD 4V2BA 2OR7A 4JLRB 3BPNC 3U4BH 3HI6L 4NQDE 1EFXA 4JPWH 4U6XB 1EEQA 1UB6A 5KVGL 3WL9B 3O3AA 2UYLA 4DVBB 2WANA 4OCYH 5EU7C 1FVCA 5E9DE 3ILPB 3WNPA 4HC1L 4G7VH 5DVKA 2DM2A 4JFDA 3GSVA 4AM0A 3MX0A 3PGCB 4X7DC 4ESKA 4RFEA 2FECI 2K7QA 2IAMB 3U82B 3QEQB 1KXVC 4YBLC 4BKLA 1CR9H 2YPKA 3C9NB 1ACYH 1WJ3A 4TPRL 3BGMA 2HFGL 4CUCA 1XF5A 2NX5D 4AEIH 4XCCL 3FFCB 5FA4A 3QNZB 2X4UA 4WRLA 3O3DB 1G7LA 2IPTH 1PKOA 4G8EB 4NQED 2B1AL 1K8IA 3QI9C 4IOIA 2FRGP 1AO7D 3V4UH 5C0FA 5GGTL 2UWEE 4MJ6A 3PWPB 2NY2D 3F6IA 4ZPTA 2HLFD 3TA3A 4YBHA 1ZLWK 5DUBA 5GSVA 1EH9A 5C0NC 2NW2B 3CAFA 5SWZA 3BGFC 2G60L 1TFHA 1EA9C 4YEFA 4UU9A 1PQZA 3OKDA 2B8OT 4NFDA 3WNLA 3LSOA 5DHVB 3CVIL 5E94B 5BS0D 1CXHA 1LQSR 1FE8L 1ZE3C 3VXUA 1GC1H 1X5AA 4JHAH 3FJTA 4QXUH 5GIRB 5IK3B 2Y1VA 4PJDA 4NM4H 3RWCA 3BUYA 3ZHDA 5C0BE 4GRLA 4JO4L 4X5WA 4RGND 4U1KA 5CZVL 5HYJD 1ES0A 5LXGH 4HT1L 2ESVB 3PWJA 3QEGH 1FNAA 4OF0A 3C6SA 3DYPA 4PLOB 3MBEA 4XCYA 1AHWA 3BP5A 5IV2B 4PTUA 2GJ6B 3VRIB 5EPMA 5C70A 3RP1A 2VL5B 4U1NA 3QJHB 1CDUA 2VDKH 4HBCL 4Y16D 1P4LA 4KJQC 3UAJC 3SO5A 3HUJB 2VLRA 3EDJA 3BGMB 4WFFD 3E8UL 5FM5M 1WICA 1ZLVK 2NW3B 1TZGH 1I9JL 3G9VA 1N5AB 4X4ME 4PGDB 1BD2A 4Z0BH 1J9CT 4MNQD 3FQUB 3RIFF 3F12A 1LK3L 2UVEA 5D6CB 2IQ9L 4NBYB 3FT2A 1ZHBB 1EHLL 4R4NC 3V0VA 3TT1H 5KBNC 2CDGA 2BC4B 1YPZA 2UUDK 3UTTD 1YNTA 1V05A 3HUJA 3QHFH 2JB5H 5DO2D 3X12B 4YGVA 1J1XH 5EO9B 5LVEA 4ODUA 3S36X 1MHPL 5H2BA 3R0NA 1OAQH 2EH7L 2NX5E 2YA2A 5FOBB 3AB0C 2Y07L 4JRXE 5JW3L 1YN7A 4YDVB 3BPNB 1NQBA 4NPYA 1DLFH 4FQCL 2QHLA 4EZMA 4M48L 5DRNA 4RNRB 4LRNL 3SY0B 4Y16B 1YQVH 3U0PB 3GJEA 4JE4B 3RVUC 4BFIA 4JG1L 3NIGE 4S2SB 3CFDB 3TYGL 1UB6B 4XBEL 3GSUB 4NP4L 1CICB 1IEHA 3O6ML 1INQA 5B38B 4YC2B 1KV3A 5I30H 3BVNB 4Z7WB 5TE4H 1YN6B 5C2BL 4QTHB 3BXNB 4ZPVA 3ARED 3VI3E 5ID0B 1X6LA 4ZO7A 5C0DA 3SDDC 4HWNA 1PQZB 1MQKL 35C8L 3U0WL 3GM0A 1CXKA 4NCC1 2D9CA 4EVNA 1HXYB 2EYSB 4OZHA 5DUPH 5IB4B 1TQBB 3V6OE 1NC4A 4PJ8C 5E2TL 4JREC 1WZLA 3U1SL 4NYLA 3L3HA 4KGLA 1FH5L 4M6MH 4UV7L 5ICXB 1LHZA 4BH7B 1KCSH 3O9WD 4Z7WF 4ZTPH 2KL6A 4Z7VF 1QEWB 4BYHA 4W4OA 3G5ZA 1Q94B 3SCMC 3VFNA 4RISH 5CJBA 3PV6B 3CFIC 2E5EA 4RQQA 3PWLA 2MCPL 3FB5B 3VWKD 2Q7YB 2CQVA 1K3IA 1VFMA 4KXZI 5EUOF 3QUKB 2PXYD 1Q0YH 5BZWB 3VXTA 3VI3F 1KB5B 3RDTC 3WS6C 2JCCA 5CCKH 3BE1H 2I07A 5BO1H 5I1GL 2MWCA 2DAVA 1JWUA 4GW1B 3VA6A 4XNUL 4R97B 1KB9K 4Q6IB 4JFHE 2W91A 1C5BH 5TE6H 5DZLA 3BH9A 1F58H 1GZQB 1Q72L 4KROB 3W0WE 3C5JA 5FB8B 1A6TB 4XP9L 1HKLH 4JRYE 4NQEB 4WWID 2PYEE 2XN9E 1CFQB 2CJUL 4KKNA 5I1KH 1UCBH 5GZOC 5EBWA 4HZAA 4F9LC 1Q9LB 2VDMH 3WIFB 3KNBB 4KPHL 1N59A 3MXVL 1LGVA 3BSZH 5DT1H 5TDOA 5EO1B 1X7QB 4ONGH 4MA1C 1ZA3B 2EYTB 5DJDB 3BN9D 4OGYL 3UTTB 1MF2H 4ZQKA 5JORB 4OZGE 4JB9L 1P4IL 3FONA 4LPTA 2CKBB 4Y4HC 1LO4L 2E7MA 2DD8L 3OGCA 1NBZA 4X6EB 2AEIT 2X4SA 3O6LL 4HWZA 2BSSA 1WCBB 2FIKB 5CJQL 2DLGA 3QFDB 4KQ4H 3MPCA 5TPWL 5ADOH 4GBXA 4WWKB 3GZKA 3GMQB 3IDMB 2XRAH 2XXMB 3LPGA 5E08H 1I8LA 5T3XD 1SBBA 1A9BA 1JCKA 1NGPL 3SQOL 4K3DH 3SDDB 4GMSH 3C6LA 4PJ7F 3O4OB 3FN0H 5FHAH 2Y5TA 1KJ2A 2AABL 3RTQC 3OKMA 3GI8L 1UVQB 1A7OL 1I8LC 4DW2L 3FMGL 4LVEA 5FYKU 5I6XC 3QPQD 4Y5YC 4EQ2A 4F8TA 5JIIA 3GB7A 3AREC 3MO1A 3WNNA 2X4TB 1HILA 1IAII 1CICC 1UQSB 2Z4QB 4KVNL 3K8MA 5F44A 4QRRD 1OARH 2VDKL 4PRPE 5ISZA 5SWQB 4HAGA 3HE7D 4V1DE 2KBGA 3BD4A 2MPAH 1CLZL 1YMME 1KJ2L 4AQ1B 1I1YA 4N90E 3QEUA 5CSZB 4LMQI 4OF5A 3S9DB 2GAZA 4ZAKD 4EBQH 3ULVH 2BJMH 3QI9B 4LKCB 3ZDYE 1A7RL 2OJEA 5KVDH 1INDH 3EDFA 3IFLH 4PJXB 2BVOA 4YHZH 1D5MA 4XBPA 5AD0B 3S8WA 3RPIA 4P4RB 3KHOA 2Z9TA 3GMLA 4QCIB 4IIQA 3BEVB 4MLSA 5M95B 1MAKA 5DMKB 3GHEL 1QNZH 1QSED 4HEPG 3D0LB 3ECBB 3MGAA 5DZNA 2AV7A 5IB5B 2EDWA 3ZTNL 5IVZA 3IAQA 2DTMH 5JNYB 3H6JA 3WFHA 4XP6H 4IIQC 3W0WD 1T0PB 1B0GA 5ESAB 1UWXH 4J3VA 2A6JB 4ZUUA 1JNLL 5D8JL 4HUVA 4Q9QH 2AXHA 3FQTA 4FG6C 1QRNB 1D9KB 1QR1A 2O5YH 3T0WA 3QDGA 1MEXH 1P1ZB 2HRPL 4ZSOA 1FYTE 4PJIA 1FL5A 2AV7B 3ECBA 3D0LA 5LCVL 2B1AH 1CFNA 4G7YL 4M6NH 3QNXA 1TCRB 4LEOA 1BLNB 2J6EL 5EN2A 5KVFH 1AXTL 2X89A 5BZDB 5GZND 1NBYB 1CICD 5K59E 3OXRA 4TVPL 4KKLC 2Z35B 1VDGA 5ELIA 1IC5L 1ZHLB 2C7UA 1EGJL 5I74B 1EJOH 2P5EB 3TBTB 5CIPB 1OPGL 1T1XB 1II4E 2GUOB 4H1LA 1G9MH 5IHUL 5KTEL 2BSRA 4JFFE 3IF1B 5GGRB 3DVFA 4U1JA 2NY3C 4BA8A 1NBYA 2AEQH 3MLUH 2MMXA 2EZ0C 3ULUH 2JF1A 5FUOH 1RSFA 5EN2B 4XCEB 3MGTA 3B43A 1T7YA 4MCYA 3VFMA 4BUGA 4U1LB 3MRHA 2H6PA 5CJ8A 4KI5F 2DQFB 4QRTB 1JHLL 1JHTB 1ZT7B 3MUGB 3ULSB 3VI4F 1JRHH 2AXGA 3CVHH 4ZSOB 2DQCH 5IJKA 4YBQC 3IU4H 1N2RA 5C92A 4GAGL 4PB0L 3I75A 4YDLC 4HFWB 4EI5B 3PL6B 5DQDL 2APFA 1A5FL 3O3BB 3GSRA 2CO6B 2OR8A 3D39E 3E2HB 4KC3B 2D2OA 1XIWA 2YN3A 4PRHB 3U7WH 4Z7OE 5BV7C 3GIZH 1NGXB 1RHFA 2FJFA 3GMLB 4QCIA 3ZKMC 1U8QA 1X7QA 43CAA 1TETL 5GRJL 1QRND 1JFQL 2P24B 1XH3A 3HS0B 2C5DC 1DLHB 4FQHA 2V2XA 3EOYG 4BQ6A 5IWLC 2PTTA 5C09D 2YD9A 5GGVY 3SBWC 3QRFM 5DVLA 3CDYA 2ADFL 4OLYL 3ARWA 2C4FU 1EMTL 4B0MM 3TIDB 3DYOA 3U46A 3WO4B 4XMLL 4JFHD 4CVZB 1U92B 1U36A 3L7EA 5ICZB 1XCTA 3HG1E 4HS6A 3IVKB 3BD5A 1M6OB 4X6DA 3SCMB 3RAJH 3INUH 5C0IA 2XZAH 4XAWH 1ZOXA 5ID1B 3NCMA 3EFDH 1RQ5A 2VLMD 4XVSL 1NFKA 5DMKA 3VFGL 3QRGH 1S7UA 4NNYA 2BFVH 5ESQA 3RAJL 1OLLA 4U1SB 2XWJA 3D3VB 1YNKH 1MH5A 4XBPB 3IAGC 1CTNA 2OMNA 5C09A 1QQDB 1BZ7B 1QSVA 1NAMB 1Z5LB 2GCYA 1Q94A 5IBLC 1T5XB 3MA7B 3RL2A 5J1TC 3CFEA 5D7LB 4XPBH 1I7TA 3BW9A 4D0DB 5JOPE 1Z0MA 2FJHB 2V5TA 3DX6B 1J8KA 3KWWB 4XC3H 3JWOL 4WWKA 4P5TD 1IGFH 3UBXB 3SPVA 5JHLH 1I1YB 1RZ7H 3RVVC 1AFVL 1SJHB 2XFXA 3T0EC 4CNIB 5L9DH 5AUMB 5KS9B 4F7EA 3TZVA 3KG5A 3BP7A 5EWIL 4DFIA 2L4OA 5KSBE 1C12A 4GKSB 4FQIH 5GZOD 1CLOH 2R2BA 3IFNH 1CFTB 5FUZH 5EUOB 4RFNC 4YXHL 1GVIA 1OGAB 3VCLB 4CMHC 3MLSH 5ERWA 4IMLB 1MCPH 3MCKA 1FFNB 5EBWB 5F6IB 3F7PC 1NCAH 4PLKD 1WCQA 4U0QB 5DVMA 4GKNA 1Q9WA 2J12B 1H15B 1RIVH 2FB4H 4GLRH 2YC1B 4TTDD 4LVNB 4GW5B 4E41B 1OAXH 1BQSA 1FVEA 1UXSB 2BHYA 4JFEE 1PZ5B 2NMSA 2XA8H 2WIIA 2IH3B 5DJXA 3C08H 1FGNL 2FIKA 2XPGA 2IG2L 5EORH 5JW5A 3N9GH 4L29B 3RUGA 4NBZB 4YDJA 3JV6A 3OHXB 4DKFH 4N1HB 5FCUH 4P4KD 1NSNH 3QQ3B 1UM5H 5L0QB 1F97A 1SJEB 2VO5A 4X80H 5KTEH 1GAFL 3DETC 2X4QA 1JNJA 1N59B 15C8H 5I19L 1FDLH 2X89D 1BZ9B 2NY1C 2X7LB 2GTWA 3RWJA 1RZIB 5AYUH 1NLBH 4HJ0D 4WO4D 4ZNEA 1OWRM 5E2WH 4LSVH 5D1ZC 5FYJH 4I48A 1CYGA 3NACL 2V7NA 4A6YH 5HI4C 4OD3H 2JELH 4OD1H 5H94B 4GBXC 3VD4A 4PUBL 5JXEA 1YEEH 4LKXA 3OAUL 5TDNA 3QWOA 4X7SL 3U9UA 2IPKA 2B0SH 4PGCA 3TJEL 4IDJH 3T2QA 3D1MC 3F5WA 5JXEC 3DRTB 1HSBA 3MLYL 4JDZB 2YSSA 3MRKB 5FYKE 3GSUA 1UB5B 3DXAB 4Y5YA 4LSUH 1LE9B 2DLIA 1E4WH 4AEEA 4OV5A 1YUHB 1MY7A 4HG4J 4HKZB 3D25B 1T20B 3AAZA 3IFNL 4K8RD 3P77A 1QNZL 4KAQH 2J5LB 3GMPB 1X5KA 2EDQA 2BVPB 5MEND 4RX4D 3FN0L 2KPNA 4U33A 3LVEA 3KDMB 3UYOD 4P2OB 1AY1L 4ZAKA 1YEFL 2DI8A 4LPCA 2DQDL 1IAMA 4ZPVB 3VMNA 3G04B 5JIKA 2X10A 4KZDH 3REVB 1LP9A 2G2RB 4LOUD 2ARJB 4JDZA 1DEDA 3V6FA 3CU7A 4O02L 4QRRA 1XGUA 4OFIA 4HUUA 4R4BB 4NO5A 1INQB 2FGWL 4FTVD 5HYSA 3UP1A 3QA3B 2OI9C 3LZFL 3LSOB 4UILL 4U31A 1B3JA 4P5KA 5CHNA 3VD9A 4JHWH 4TUJA 5IHZA 5SV4A 1PEWA 2MKLC 4XHJC 3OBAA 1HZHH 1NH6A 1IKFH 4M93C 1BD2B 4MJID 3EKCA 1MREL 4L9LC 1X5LA 5ACMA 4JVWA 3WSQH 3HE6B 4WI4A 2AKRB 3RTQD 4C56B 5KN5A 3GMOB 1QFWM 3DPBA 3UJIH 3NCBB 1IC7H 4ZD3L 3D9AL 2B4CC 2C3XA 2FSEA 5FF6A 3B6SB 3VFUB 2DWDB 3U4EB 4ZTOH 4WUUE 4JFQB 4E5XA 3DVNB 3B6SA 2X4QB 4Q2ZB 2NTFA 3MRMA 1OT1A 3QISA 2UZIH 4I3SL 2R0WL 3BKMH 1C7TA 4H1LG 5F9JA 4LHJB 5C0JB 5E1AA 3S5LA 4JM2A 4WY7L 3RX5A 3RUGB 4WW1B 1H3GA 2E7BA 3OF6A 5E8EB 1U8OA 1T7WA 2WQRA 4HSQA 4M1DH 4UQ2A 3ZT6A 2G60H 3HR5A 2WBJB 1G9NH 3MZGB 1VFOA 3UCRA 4HMEA 3ESVF 2LTQB 4YLQT 3HC4H 1B9ZA 4NNXA 3UJJH 4UT9L 4N8VB 5GGTH 4LIQH 4JO3L 1A22B 4WU5B 5JOEA 3EZJB 4O9HH 4XNYL 4NDMA 5C0RH 2CIIA 4BJLA 5D1XB 3U0TB 4U1NB 5GRUH 4PGEA 1Q38A 5C2BH 5BO1L 5I1GH 3JWDH 1CFVH 4X7EC 5I8OL 3KPLA 3KLDA 3SJVE 4PLKC 4ZPTB 4URTB 3BP7B 3ARGA 3O6MH 5CP3A 1JMZA 2A9NL 3LV3A 4HWBH 3QQ4B 4YAQA 1U93B 5D7JA 3O2WL 2FBJH 1EERB 2VLJD 3VD3A 1NCBH 2C3GA 3O9WA 4G3YL 5J1AB 4Z76A 1SBSH 5FYKH 5TE7L 4GRLB 4PUBH 5FA4B 5D7LA 5FGSA 1UB5A 4M3KB 4M6ML 4ETYA 1HWHB 1RVFH 2J2ZA 4Y5VA 4X98A 2O5YL 5TQ0L 2A38A 2J6EH 4BH8B 3KDMA 1KIPA 4TUOB 4Z7QF 2C1PA 5HY9A 4K2UH 1A6ZB 1XF1A 3DGCR 4DKFL 3MJ7A 3Q1SL 4HK0A 4QTIL 3BGAA 1GPOH 5K9KB 1JF5A 3QDJD 5CMAB 2OP4L 1BFVH 5IHUH 5EORL 1DFBL 1FIEA 3S37L 1G7QA 4U7MA 5FGBA 3AMLA 5I30L 5D2NC 4L8SA 4ALAL 5EU4B 4RZCB 2EO1A 4QNPF 3ARVA 1Y18B 5KANI 3EYVB 3GHBL 1IGTA 5DC4B 1F45A 3HRPA 2HH0H 4ODVL 1X3DA 1FZJB 1OP5H 3OKNA 2XTLA 1LILA 2VLKD 5H37H 3STLB 3ZL4L 1RHHA 4P2QA 3MJ9H 3X14A 2FR4B 1RZJH 5BJTB 1J88A 4N5ED 5JW5B 4L4VE 2P7TB 2Y7QB 2ZKHH 1QSZA 4I8DA 1WEJH 4K3HA 5C2UB 4HMDA 4U6YB 5CP7A 5J12B 1XGRA 1FYTA 3DV6A 3KYKL 5GS1B 1T2QH 5D2LE 1K8DB 4E41A 4S1QL 1EJ6A 3A67L 3T0EE 1G7HB 4DN3H 4IDLA 3C60C 7CGTA 5IMLA 1NGZA 4K23H 2PYEA 2XN9A 2HJKB 4GMSL 1I1FB 3E3QE 4S1SH 4M62H 4GG6F 1XGYL 3SQOH 1VEMA 4FFWD 4K7FB 4O51A 3GSNA 4QYOB 5J13B 3HPLB 5CEZH 4UTAH 3W39B 4UINH 4P48A 2FL5A 2VLRD 5F1IA 4HT1H 1DBML 4NZTL 3JBG7 3BH8A 1H15A 43C9B 3WFEH 1ZWIB 4IRJB 3SEPA 5HHPA 2WNGA 5SV3A 4JY6B 4PP2B 5I1HH 4QRSB 2BHZA 3ZSTA 3QPXH 3SGKA 1EMTH 3G9AB 2J8UA 4JKPL 5L2KA 2I24N 4R90L 3HN3A 3VXSD 2VABA 4LU5H 4UIKH 3P4MA 1XGTA 4OGXH 3SGKC 1WGOA 4NZJA 4LPUA 2G5BA 3ARBB 2Y23A 5DVNA 1W8NA 4WENB 3UJTH 5FYLL 1NGQH 3DMMD 4G8GE 2AJVH 5IQ9A 1FHGA 4RGNC 5I1AA 2EEAA 1MRDL 5INDB 4PRPD 3U9PL 1XCTB 3VFOA 2OTPA 2EDYA 3ETBF 1EHXA 5DFVD 5BV7L 3GMMB 4JFED 1HKLL 4W6YB 3GI9H 4QXUL 5EG6C 2X44D 5DD5L 6FABL 1FBIL 4PJIF 2DI7A 4OFVA 1MHHA 4KMQA 4TULH 3C09B 2NTSP 4ORGA 5C08D 4FFVD 1E4XL 1BQHG 4PRNA 3EOTL 2G5BB 3L5HA 3H3PL 1KB9J 4RMRA 4YK4C 3ROLB 5IEKA 5MP6H 1JPGA 1ADQL 1LEIA 3RWIA 4P2RB 1J0HA 3EO0B 2VTFA 5IGXL 2VQTA 5HYJE 4G6KH 1KIQB 4QRPE 5TGBB 5ECJE 5L2KB 1RJZA 3D6GA 2NX5A 2OTWB 4N1EA 2AQ2A 2MFNA 1JRHL 3FB7A 4YBQD 2NY5H 3O3BA 4MZ3A 1KELH 1F4YH 1RIUL 3BP6A 1R24A 3V6ZB 4FQXA 4OM1H 4H8WH 1J12A 1S7XB 3R06A 4O00A 1LDSA 2ESVE 2WLZA 3IDIB 5CZXD 3RL1B 5HGBB 1AI1H 4Y4HA 3TYFB 1HIMH 4PJAF 5HYSG 2M8XA 1A14H 1KG0B 4I0PA 4HIIB 4UV4H 4YPGB 1I7RB 1UZ6F 2GJZB 1MLBB 1BIIB 2R9HD 4R8WH 2V5YA 3AY4C 3ZDZE 2SEBB 4N0YL 1EFXD 2BVUA 2VERN 3TGXA 2Z8RA 3MRQA 1F8TL 3O6FA 4HFWA 3RA7H 4PY7B 5HGBA 2VSDA 1AO7E 5E2UL 4CU8A 3M07A 4U7SA 2J5LC 1T0MB 4RFOL 1G7MA 1NGWB 2RIKA 2A74A 1K5NB 4AIXA 5EU5A 5LCVH 2JJWA 2V9TA 3ULSA 4MDIB 2VL4A 4PG2C 3DARA 2ICWI 1IFHL 1MLBA 3LEYH 1F6LL 5CWSA 4C4KO 2IBBA 1TTGA 4MA3B 5EB9A 5C07E 1OOAA 2QQLH 4PJEB 2VLKE 4LNVA 3TJHC 2G75A 2HT3C 4D9QD 5T33H 1S7QA 4MNQB 3ROOA 1GGTA 4GQ9L 2EDNA 4PJAE 5B8CB 1FG2B 1T80A 1T1XA 9CGTA 1MFDH 4KKBD 3FRPG 2YUZA 5F7UA 4M62L 2NY5C 3UPRB 1OM3L 5HHNA 2XN9D 1HHGA 1RJZB 2PYED 1MI5D 1Q0XH 3T65A 5J8OA 4JVPA 3CU1A 2IC2A 4L8SB 4X6DF 1LVEA 5HI3C 1MFDL 1MCWM 3C09C 5B3JE 4GXVH 3A6CL 2FHBA 5EBMA 5BV7B 4QKXB 4WDIB 1JZ3A 3MV8B 2J8HA 1A2YB 1A8JH 3A6BH 1X5HA 2X70A 4QXGL 3LIZL 1XGPB 4UBDC 1OARL 1V3MA 1WEJL 1NCAL 4Y2DD 5J6GB 4LVOC 1AD9A 2JJUA 3DLQR 4KJPD 1MJUL 5ALBH 4YDLB 2Q7YA 3CLEH 3FO1B 4K8RL 3W82A 1A6UL 1I3VA 5DS8A 3TA3C 4JRXA 5TH2A 1RZKC 4ZYKA 2J8UB 1FAIH 4TUKL 3WJJA 4ZUUB 4MAYB 4JPKH 3VFWB 4Y1AB 3WFHB 2GAZB 5C0AD 5I1AB 3FZUC 4WUUA 3LKPA 3VXME 4YIQB 4G80B 3X3GH 5AYQA 3BEVA 1DBAH 1T04B 1WT5A 3L3DA 1OF2A 7FABH 1S9WB 5CUSL 2E7HA 3QUYA 2XRAL 4Z95L 1OP3H 3VA2C 2VDLH 4XCNB 4WU7A 5FKPA 5JUEH 1I4FB 2H2SC 1ND0A 5E5MB 3RY5A 2H32H 3NCYS 4KPHH 5F9OH 1BIHA 4HHAA 5DMGC 4IRJA 3NGBC 1I1AA 4FFZL 2HFEA 2QTEA 4A2LA 1FFRA 2D7MA 3GRWL 2OX5A 5D7LD 3QZWA 1S9XB 1RFDL 3PNWB 1LP9E 1CK0L 1NANI 3FTGB 1ZV5A 4U6TA 1QSFB 5DRZA 4CVUA 4PR5B 2HA1A 1I7RA 1BFSA 2O61B 4JZOA 5I75C 4APQC 1YMHA 2AJXH 3ARGD 5D2NE 3W0WB 1AD0A 4QHMA 4ZQKB 4BFGA 3EFFA 2PYEB 2XN9B 3DRQA 3T0DA 5E1AB 3G6JB 3HAEB 5IMLB 5JIPA 1YC7A 3NPZB 4Z8FH 1UYWL 5FO7B 1FLRL 1FZJA 1IBGL 1JYNA 4AIOA 2VN4A 4R8WL 4JJHA 3O8XC 3RVTC 2W1NA 4G43A 4N9GA 4PJCB 4DGIH 1ZT4B 3WFDH 4Z8FL 1IGTB 4MMXC 2WZPD 3HZYB 3GMOA 1LE5B 5EU4A 3NIFE 2W38A 1LP9F 5DC0A 2CKBA 4GG8B 1RURL 4XWGH 1O7SA 1EO8H 3DSFL 3FCTA 3KYMB 5T1KD 1KT2A 4ONFH 1KGCD 1DJSA 1AXSB 1HHKA 5EUKB 3TIEA 1HN1A 1QBML 3MLRH 3EYUL 5HTSA 3WIFA 2JCCB 3N0PB 1KB5A 1AR2A 4QRQB 2VUOA 4HFUH 1T3FB 3IJSA 1OD7A 3QRGL 4L8BB 3C5ZC 3RX8A 2AJ3B 3CZJA 2M26A 2A73A 3L3GA 3HRZA 5E6ID 1JNHA 2R1WA 4MXWL 3S96B 3BKJL 1U8NA 5GGRY 1A6TA 4W68A 4KDTA 5FB8A 1H5BB 4YXKL 3VFOB 4XPHH 5E2VL 1W0VA 3L6FA 4GSDH 3NCJH 3VE0A 1BQHA 5J1AA 4HK0B 3ARTA 3FO9A 4LLWA 3JXAA 3U4AA 2DKSA 3ARBA 1MVUA 2ITCB 3QCUH 5L8KB 4JG0L 3MR9A 2YBRA 5HDOA 3X13B 4LHUD 5LGJB 4HUXA 4LQFH 3MLTA 3QUXD 3DUSB 4WWKC 1DVFB 4LASH 2DBLL 2IF7A 3ARSA 4GO6B 4FTVE 1MFEH 4FXGB 5KOMC 2ED9A 3QFJB 3DRTA 5TFSH 2RJMA 5I15H 4ODHH 5IEHA 1BAFH 1CL7H 1M7IB 2VZUA 3QQ4A 1NEZG 4YE4L 1QSFD 5IOPB 4O5LH 4R90H 3QP3A 1MCQA 5IB4A 2I9LA 5H94A 5C3TA 4G9DB 3K4AA 4W4OC 3LN5A 3KLSA 3GK8L 3ZYIA 5DUBB 5GSVB 4TSBL 5ALBL 4NO2A 4MHHG 1YN6A 4MJ6B 2F58H 4I4WB 2PYFA 1C8PA 3PWVA 1KJVB 4GRMB 3FQRA 4RX4A 3E6HA 5MENA 5I8CA 5JHDA 3PQYE 3WS6A 3MRLA 3VWJD 1OM3H 2GEEA 2VDNL 5DEFA 4UDUB 1UADC 3QNZA 2JIXB 4S1QH 3QDJB 4ISVB 1RIHL 3VMPA 1S5HA 3JVGA 3ZYOA 3WBDA 2QSVA 4QHLB 1NUGA 4U6YA 5CP7B 2EYRB 5KN5B 3HZVB 4ZO9A 5E8OA 2Y7QA 5C0AE 5JHDB 3JV6B 4XPAH 2DRUA 4RWYH 1AKJB 2YUVA 3S6CA 2XPGB 3ZL4H 3DX8B 4L3ED 2P44B 5F21B 1V7ML 5F9JB 5ITBL 4KDTC 5IHZB 1KEGH 1JNNH 2DICA 3V4VL 1UM4H 4PGBB 1CBVL 1VFBB 1XT5A 1QLFA 3HNTH 3Q5YA 4KVNH 1RVFL 4WO4A 5DEGB 2GK0A 5IIEA 5IUSA 1F3RB 4HAFA 4ELMA 4C56A 4FZEH 3SKOA 2VLRB 1T83C 4I9WE 2AERT 2KKQA 3TNNA 3SGJC 2CLZA 3QG7H 4L4TE 1S9VA 1BP3B 3QO0A 3BYTA 5D6CA 3LD8B 2CK0H 1T2JA 2QQNH 5FYJE 5E7FA 1T89A 4DKEL 1JYXA 4GLRI 3FQUA 4J3SA 4QRPD 5JOFB 3OAZH 1E27B 1YNLH 1U8IB 3H0TA 4IHOA 2DTML 1X5ZA 4X6CB 5FYLE 5E95B 3PQYD 5FDWB 5DD0L 5C6WH 5HGAB 3BMWA 1KJMA 4NO0B 5D2LA 2J7LA 1UM5L 4YE4H 4PG2A 1K4DB 5BVJA 4BM7A 1GXEA 1IAKB 4P3CL 3S97C 2YSSB 3MRKA 5I76A 3MRIA 1KPRA 2GKIA 3F5WB 4NRXA 3KYAA 4XXDA 4PGCB 5IBTL 4ONOA 2RR3A 3MR9B 1DQDH 1MVUB 5IG7B 1NDMB 4OZGF 4P9ML 1GRWA 1N8ZA 3MSPA 1IGJB 2DYPD 2VDPH 3MACL 4KRMB 1T20A 2OBGA 4S10A 1FP5A 5EU6E 3SKJH 4BQCA 5I16B 1R6VA 2YMXH 1WFTA 2F5AH 1MFBL 4D3CH 3L6FB 3LCYA 4YHLH 3U0TA 1HHHA 5GGVH 1FNSH 2F5AL 4HW6A 5HVHC 2R1YA 4L3AA 3U46B 1AI1L 4UBDD 5E2VH 2EDKA 2LAGB 2OQJA 3S34H 3AS1A 5CD3A 3PGDB 3MLPA 1U2HA 4NKDA 1OSZA 3O11A 2C4FT 4PBWD 5HYQB 1HHIB 4HH9B 4P3CH 3TBWB 4GRWE 4GAYB 5B3NA 1QLRB 1I3GH 4IJ3C 4L8CA 1DBKL 3HMXH 4MD5A 3MV9A 3VXRA 4XNQA 5F70A 4R7DA 4PRDB 3VRLF 3DHJA 4OT1L 5JLZA 1MWAB 2EIEA 3SOBH 5D7LE 5L0QC 1PG7X 5IMMA 1G7LB 1HKFA 1C1EH 3BN3B 3FFCD 3FFCA 3FZUD 4A2MA 5CGYD 1JZ6A 4RMWA 5A2IH 2HFEB 3T0XA 4OB5H 3E2HC 1Q9WB 2YWYA 4PJGA 2HN7B 4ZNCD 3C5ZD 2CK0L 1X4YA 3MRLB 1NFIB 3EFDL 1U8PA 5CS7A 2X4OA 2MHAB 3E6HB 4MAYD 5MENB 3QIWC 5CKGA 5L7XL 2Q7NA 1Y0LB 2IAMD 4JPVL 4HV8B 4IMLA 4OGXL 5DHYA 4JZOB 4QRTA 2HKHL 3V6BR 3BDYH 1UENA 2C3HA 3L3JA 3OKYA 3VXPA 2CK2A 2EDFA 4XP4H 1JFQH 1J87A 1IC4H 4BZ1H 1XGYH 1IC7L 4ZD3H 3DVIA 3MYZA 3GSXA 1QO3B 1CQKA 2H8PB 3AS0A 3O3AB 4XPGH 5J6HA 2MJWA 1G6RB 1WV7T 4XBGA 2EIBA 1JP5A 1CT8B 3ULUF 3GSWA 4U1JB 4F7EB 1KPVA 3PHQB 4M8VA 4YHYB 1U8KB 4GKNB 3U2SB 1X5IA 2AK1L 4JO1H 4X8JB 3VXMD 2Z92A 3OAYH 4XNMB 3RGVD 3L3IA 1WC7B 1C5DA 4LVHC 3V4VH 3LIZH 1AC6A 4JZJC 3ZKQD 4P23A 5JUEL 3UROR 1ULVA 5I1HL 1QHOA 3QXAA 1NCCH 1B0RA 3F7YB 3ARGC 5L8JB 3K2UH 5CINH 1OTUD 4M7JH 3TJHD 5ISZE 2PETA 3IS0X 4E9LA 5TDPB