3F5WB

Kcsa potassium channel in the open-inactivated state with 32 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody heavy chain
publication title KcsA Potassium channel in the open-inactivated state with 32 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB01
5HGHA 4ZS6D 4O58L 2VIRB 4LCWA 5DDHA 4GW1A 1KXVC 3ARZA 1QLFA 3LSOA 4AEHH 5BVPL 3MLYL 3MRQB 5HPOA 1J9CT 3PP4L 4QRRD 3VXMA 3OKNA 4L8CB 3MJ8B 2VZVA 1JN6B 3FT4B 2F54D 4OZHF 4XX1E 2IAND 4HKXB 2D7PA 4HKZB 5T3ZE 1KTLB 2VKWA 2Q8AL 1AXIB 5IV2B 4JHAL 3OKOA 5GS2H 2ADIB 4YAQA 1GIGH 1LE9A 4UT7H 2AQ2A 3QDGD 3IJYA 2YMXL 5DRNB 5BXFA 1SJEB 2AQ3A 3L3IB 3WN5C 5KG9A 1JK8A 5I74B 4JRXD 4CNIA 4FXLA 4BFEA 4OSUH 1HZHL 1JUFB 2HJLB 4S1QH 4KI5D 4WFED 3JZ7A 3A6BL 2FYYB 1KN4L 4X83A 3UJJL 1S9XA 1MWAB 1L7TH 2GHWB 1J1OH 3EYVA 1AO7A 2BVQB 4LF3B 4PJHA 1WFNA 5EC2B 2RHEA 4ZUUA 1QSVA 4CVWA 2HFEA 1BFVL 3MRRA 3QCUL 5SV3A 5DWUH 5D1ZC 1WZ1H 2H2SC 4PGDA 1J10A 4LSQL 2NCMA 2DICA 2L4OA 3CZFB 4NZTL 4JVPA 5ICZB 1SQ2N 4XBEH 3QIBD 4NQUA 2PO6D 4ZTOH 3LDBC 4HD9A 1CDBA 3CFIC 4E0RA 4YK4C 1GGCL 3MNZA 2GAZB 4JPVL 5DQDH 3S6CA 1AD0A 4FFVC 3PDOA 1NBYA 2IH1B 3P4OA 4JGUA 5TE4L 4KRPC 1MAJA 3OJ2C 4Y5YB 1Z9MA 4GG8A 4LIQH 1ADQH 4PJIF 3BXNA 4Y2DD 3SCMC 1HKLH 1AH1A 4HG4K 1J11A 4YDVB 1FCCA 4O9HH 4PJ7F 2MCPH 3MRCA 4PLKC 2ITCA 3D48R 3QDMB 2CRMA 1KPVA 4K2UL 4NO3A 4FTVA 2VDKL 5D7KE 1WC7B 4NJ9H 4LEOA 5MEND 3FFCD 4HUXB 4PV8A 1I8MB 5K59F 5IHBA 3EO1A 1ZOXA 4K8RC 4NNPL 4KHXH 1C5BH 4OD1L 3C8KB 4YFDB 2HMIC 2Y36L 2YPKA 1J0ZA 3MZTA 1I3RA 2ADFL 4W4OC 3S34H 5KAQG 3O45A 3NGBB 4BQBA 2Z91A 1IKFH 5DRXA 1A6WL 1MRCL 5HYJD 4PPTA 3D25A 1DN0A 4BH8A 4KQ4L 4XCCL 3NPSB 3M1BB 1UA6H 3FO2A 3TO4D 1VHPA 2VXSL 4F15B 3QUXD 3FZUD 3B2VL 1QLRA 3ARFA 4OKVA 5D7LA 1OD7A 3AC0A 3I6KA 3B9KB 4PG9B 4M7ZC 2AAVA 4I3SH 3HI6L 3MBXL 1D5MA 2LTQC 1FVEA 4A6YL 4CN1A 4PJHF 2HKFL 1CFNA 2LE9A 4LL9A 4ZAKD 2BMKA 3V9FA 2J1KA 3NAAH 1E4XH 3P0YL 2R69H 1NC2D 2XNAA 3QCTL 2BXZA 3O4LD 5SWSA 5C08D 1R5WB 1NCDH 3CSGA 4R97B 5HHXL 3HPJB 3P0VH 5E56A 1G9NC 4X4YA 1YEJH 4O2EA 4WW2C 1DUZB 2LV4A 1NKOA 4TUJA 1LGVA 1AKJA 4FQ1H 5DA0B 1CG9B 2UZIH 2ATKB 2VLJE 1GGUA 4M1GL 5DS8B 3RWJB 4JDZA 1FLRL 3BP6B 3VRLE 4XP6H 5SWZB 1NGPL 3ARDC 4F33B 1D5BA 4WU5A 3BH8B 3W9DB 1K4CB 4N8VA 5HHOD 1UWXK 2A6JA 4XXDB 5IB4B 1IGML 5FUOL 2WLYA 4MDJA 3TFKC 3VD7A 5KS9A 4NHCL 5CZVL 2ESVB 4TVPE 1QNZL 1TQBC 2DYPA 2FO4A 3V52L 5EDXA 4ZOAA 1A7BA 3HAEA 1A7RL 4IRJA 1TCRA 2XI9A 1DZBA 4KKAC 1K6QL 4BZYA 4HS8H 3DX7A 4YFLF 3MV01 4RBPH 1DBKL 5CWSA 3WJJC 2JLLA 1INEL 3HUJA 5JIHA 1T5WB 3P11L 5JIIA 5L9DH 3ZL4H 1YEDB 2AXFA 5T1MA 5E94A 5TQ2H 4MSWA 1GJIA 2BZDA 3OKMB 1IC5L 4RAVB 2DLFL 5DD6B 3KXFD 1FL5B 4I0CC 5KVFL 2V2WB 1W8OA 3QH3A 5GISL 2P5EE 4IOFC 1Q9KA 3K2UH 4MB3A 5FYJE 4HWZA 3AS0A 3DOSA 3ZZ1A 3ZHKA 2ED8A 2W9DH 1DBMH 4PBWD 3I84A 3RY6A 3NZHL 3L3GB 1OB1A 1U6AH 2EXYC 5DLMH 3TO2B 3OSKA 4IOIB 2R4RL 4OCLC 3LKRA 2XN9A 1YNKH 3I9GH 4LVOB 1SY6A 3GK8H 4RMQA 4JY6B 1FLTX 2ZUWA 2VZTA 1IGYB 5FM5O 1X5FA 3L6FA 5KTEH 3DVNA 5D6DA 2ZUUA 5HHNA 1IQDB 1U3HD 4XWGH 3VFUA 1V7NH 2OL3A 3W0WB 1DJSA 5KSBF 2BHYA 2VITA 4RFNB 3EFFA 4M00A 3PDDA 5LCVH 4R4ND 5F1IB 3KWWB 5ABDE 5SV4A 4DEPB 1PYWA 4Z7WE 5FYLE 4M5ZL 3KLAB 3SKJH 4OFKA 4F9PA 4LCIL 5H94B 5EG6C 2ARWA 3DV6B 4OZ4A 3ULSA 3PIQA 3GUTB 2G9HB 4P4RA 1RJLA 1I4FB 1IEHA 3K8LA 4U2YA 4OLEA 5DVLA 3QISA 4ONFL 4IEFB 4K8RH 3SDCB 3MBEB 1MUJB 3TBYB 1EHAA 3PGDA 4GKZB 1CF8H 3FOLB 4G42A 1TPXB 1V3JA 4W6WB 5E1AA 4X5LA 4GRMA 4GQ9H 3DSFH 3SDAB 4CMHC 5DVKA 5C09A 4NM4L 1K8IA 5MI0B 1I1YB 4JR9L 1YDPB 2YC1B 4M6AA 3QUYD 1X9QA 1JGLH 5K9QG 3BE1L 4K7PL 2Q76B 4X7SH 5HHME 2FIKB 4XHJD 3ZTJH 2B5IB 5FKAB 4F3FA 4FQJL 1Q8MA 3RWHA 5IBLC 3PWVB 2WBJB 1QRND 3RWIA 4DN4H 4QYOB 1KJ3L 1BQSA 2AJ3B 4DGYL 3CNKA 4ELKA 2WBWB 1G7PA 1W72B 5IB5B 4NGHH 1CE6A 4HLZH 4UB0H 3MC0A 1U93A 4N0FB 1NGYA 4J3SA 4LSUH 2VDML 5JHDE 1P4IL 1SJHA 1RZ8B 3BP4B 1PFCA 4P59H 5LWYH 2AEIT 4EIZC 5I18H 3U9UA 5I1DB 1BJ1J 1QYGH 2MHAA 3WIIH 1GGBH 3GBMH 3QHFH 2D7TL 1H3WM 5CJQH 4J8RB 5FCUH 5A2JH 5I66A 2C1OA 3BN3B 5L6YL 3JVGA 1A1NA 4PUBL 1P4BL 3MOAH 3SO3C 2GW5A 4NPYA 3WSQL 4I77L 1MELA 2J2ZA 2FR4A 1ZT1A 2Z92A 2D2OA 4QOKD 3HRZA 5FV1L 2YKLL 1I8KB 4TSCL 5DK2B 3WXVL 2AABL 2G5BA 1N2RA 2R9HD 5AUMA 3ZE0E 2X4NA 3HPLB 3P9WB 4KUCF 4DCQB 3WE6B 1RMFL 3VFMA 1WCBA 4I2XA 4P4KB 1CD1B 3FQRA 3ARGA 5L7XH 2WNGA 1ZGLB 2VLKE 3TM6A 3HFMH 2VB5A 1BLNB 5DVNA 1DQJA 4YBLC 1TZIA 3LRSB 3ESVF 2EYRB 4IJ3B 4DGIL 3DO3A 3T77B 2XV6B 2DI8A 5FA3B 1TZHA 2QSCH 1DP0A 5F44A 5EU5B 1HHHA 4L4VB 5IK3B 2HT2D 4KXZH 2JTDA 1W2KT 5L8JB 5F6IB 5MHSD 4KC3B 4I5BA 3DX8B 3B8SA 5F9JB 4BA8A 3QEHB 1ETZA 2W9EH 4OCNC 5I8EB 4I8DA 1FZKB 2KKQA 3KPNA 3HB3C 3IDGB 3PHOB 1H3XA 3QHZL 4WTZG 3C2SA 2FECI 3O6FD 4PGCA 5CJXC 2GTZA 1T7ZA 4PGBA 3PWUB 3F12B 5BV7L 4MJ6A 3V4UL 1RVFL 4XAKD 1NSNH 1S9YA 3BZFB 1EHXA 3STZB 1JE6A 2BSTA 1MLBA 5KVDH 3WKML 1CE1H 4IMKA 1X6NA 5C0JB 1UB6B 3IYLW 4JG1L 1L4IA 1VFOA 1W8NA 1A64A 5HD8C 3EO0B 2SEBB 1CK0L 2DQFA 5GHWL 5DF0A 2EDBA 5DHXB 3KPRD 2GK2A 3WXWH 5D2NC 3VWKA 2D31A 2BVUA 3TVMB 4E41A 5GS0D 2ZUSA 3R1GH 1BWWA 2QHRH 3SDXB 3T3ME 5F7UA 4G9DB 4B7LA 3VGFA 4U1SA 1IC1A 5INDB 3MV8B 4OCMC 1FIEA 2AV7A 4LLQB 1RZKC 1QO3A 4K3EH 4DAGH 3PXJA 5E9DB 4JN1L 5DA4A 5CINL 3JV6A 4YNYB 3V4VH 4OB5L 4J7RA 4O51B 4OZGA 1WTLA 3FB7B 2AVGA 4K3DL 1FNLA 5HVFB 3HZVB 1WCQA 3NFNA 1BVKA 1IT9H 3H3PL 4WI8A 4EBQH 2APVA 5IJKA 5AZ2L 3WS3B 1FQ9C 1P7KB 3WUWG 3ZT5A 1YMME 4ZUVB 2CIIA 5C0CB 1UJ3C 4FNLH 3NCCB 3RVXC 3FB6B 4A6YA 5JOPD 3G6JA 5A40E 3P30L 1YYLH 4P2OB 4HULB 1DQMH 3V2AR 4U1LA 2DIBA 5I1CH 5H37G 3HC0B 5J6GA 1V7MH 4JRYD 1NFKA 4Z7VA 4LEXL 5DMIL 3MRFB 4Y4FB 3AY4A 2ADJB 4NQSB 2FO1A 2WINA 1IC7H 4OUUA 3ESUF 2YD5A 2AJYH 3RP1A 3TBTB 3U7YH 3VXUA 4NKDA 4OLUL 3IKCB 3LEVL 1QBAA 4LU5H 4Q9QH 1FE8L 3FQTB 4NSKB 3VFOB 1TJHL 3LAFA 5FXCH 2CKNA 2DQGH 3HE7C 1MFDH 4JFYA 3PWJA 5K9KA 1XCTA 5EFIB 1V5JA 4M6MH 4NZUL 1IM3A 3DO7A 3D0LB 3NCJH 5GRJL 3GMQB 2I9LA 2NW3B 5JXEA 5IT2L 5DQJB 4PGZA 2IAMB 4NKMA 3VG0L 5D72L 2J8HA 4C83A 1ZLUH 1J1XH 4EI6B 4POZD 3V4PH 3L3DB 1MI5D 1C5DA 3DROB 4OGAD 1XIWB 5E70A 4ENED 5I15L 5DXWA 1Z3GH 1FRGH 1KNOA 4I0PB 4X6EA 5D2NE 5FHAH 35C8H 1T1WB 1S7SB 2GFBB 4W4NA 2YR3A 3ZKNC 1CICA 3D39B 2P5WE 1UKSA 3L3HA 4YZFE 4RISL 2D7QA 4MNGE 1CXKA 3NABL 2WK2A 4JCLA 1R6VA 1NGQL 3OX8A 3DXAE 5GJSL 4WEUD 2X4RA 3MREB 3MRDB 3PABA 3QQNA 5HHVH 4JPKL 3RUGF 2ENYA 2P44B 1FNEA 2BOCB 1MIML 5EC1A 1X5XA 3O41B 2E7LA 3E6FA 2R56H 4NN5B 4WUUD 4LCUB 5LGHH 3KLSA 4YC2C 2DTMH 1YEHH 4DJMA 4EI5D 4JFDE 1S7UA 5B8CA 4P5TB 2FATL 1K5NA 1CGUA 5F21B 3DV4B 1F58H 1QBLL 3THML 1BWMA 3L3KB 3G6JF 3CMOH 2RR3A 4PRNA 5IW3A 3O6LH 4JPWL 1DR9A 1MFCL 1CBVL 4XP5H 4PJGA 1RUQL 3FTGB 4WHTA 1R3LB 4U49A 4CGTA 5I0ZA 1ZEAL 5B22A 1Q1JH 4RAUA 4YHYB 2VN4A 4G6AC 4EXKA 2VZOA 3O2VL 3R8BB 4Z7VF 5LBSL 4F7CA 4YDLB 2DM7A 3DPBA 5B39A 4TTDD 1MJUH 3DGGB 3ZKQD 2ZG1A 2R1YB 3EDDA 5JPMB 2F5BL 1MCQA 3QDJD 5EO9B 1WVZA 1RJYB 4X7FC 5I1JL 4YFLI 1GZPB 4RQQB 5IW6A 4QXUH 4OIAA 1KPUB 5KSAB 1JGEA 5TPWH 3K80A 3H7BB 2E9WA 4NFCA 2OI9B 5CBEA 4JREC 5D2LE 1HHKA 1MOEA 3VGEA 2XZAH 4CVUA 4D94A 4OGYL 3SKOB 4GMSL 3SDDD 4OI8A 4JRXA 2H3NB 1RZKH 1CLZL 4HS6A 3NA9L 1OTUD 3TN0A 1UH4A 3ZO0A 1D5XA 1S78D 4Q0XL 4FQCL 4YPJA 5FYKH 3TA3D 4M6NH 4LSPL 4F7TA 25C8L 3VXRD 4ETQB 1XF2A 2DQCH 2VR5A 3QULA 1FVDA 1VDGA 2FLBT 4PB0H 4PJFE 2CIKA 1B88A 3SJVD 2ZUVA 1IE5A 2EEAA 4P2RE 4ELMB 2EYSB 4WV1C 5FUZH 5I1EL 3VDCA 3HI5L 2O5YH 3IDUA 2GJZA 4B7IA 2UUDH 2YHGA 4WVRA 2EXWC 4XCNA 3LS4L 4R96A 5CD3A 2UY7A 4PR5A 1KEGL 4MNQE 3HE6D 1A47A 3KR3H 2BRQA 3T0AA 3FO1B 3LPFA 4V1DD 5EUOE 5SX4I 2L7JA 3VXPA 4JM2D 5CFHA 3L7FA 3VDAA 2NY5L 5J1TC 3SN6N 1KBGH 4XPAH 1J86A 4MXVE 3QEGH 1A6VL 3I3EA 5HSFA 2BOBB 2ERJC 3T08A 4PJ5E 1EEZB 2CK0H 5EIVA 4UT6H 1BQHB 2O26U 3BD5A 2NX5E 4Y2DA 4N90E 4TNWK 5I76B 4Y4KC 5FHBH 1T0PB 5ISZD 3T1FB 1KLUA 1SBSL 2R4SH 4GQPH 5EO1B 3SOBH 5DTFB 2YA1A 1FNGA 2IADA 4F80A 2HTLD 2ICES 4PJGF 3ZKMC 4OZIE 4K7FA 4G8EA 1UACH 3WN5B 3UZVB 4RRPA 4CADB 4RBPK 3ALWA 3F5WB 3FMGL 1QFWH 3G5XB 3VFGL 4FRWA 5C0AB 5D71L 5GS0L 1JVKA 3B9EA 4XT1C 4OCSH 3WDHA 1DFBH 2KZWA 1B6UA 3MOBL 4JB9L 3MV9D 3RNKB 4XCYA 3STBA 3I6LD 3RWFA 4NZJA 5E2WL 4JFED 3D3VD 1A6ZB 1JHLL 2EKSB 5CUSL 3JWOH 5B4MC 5IROA 4YXLH 2VQ1A 1YY9D 4MGXA 5FF6A 5D1ZB 5D8JL 2NXYB 2VLJB 4DTGL 2FJHA 1RULL 2GI7A 3SKNA 5KSVA 3IFOA 2N4IA 2HAZA 5I1AA 1BECA 4JQVC 4HDIA 5HHPB 2HN7A 3OR7A 4U6YA 1D5IL 5E99L 2HWZH 2VE6B 1QQDB 1OVZA 4X7TB 3NIGF 2X9YA 2LAAA 2JCCE 1ZVSA 3QIWC 5K33A 5HI5C 3HR5B 3ZT7A 1AJ7L 2CDGB 4X4ZA 4B41A 4KRPB 5DD0L 1UZ8A 2CXKA 3T4YB 4QHUB 3LB6D 5GGSY 1T66C 3X14A 1UWEL 3ZMRA 1IEAA 2BDNH 3AUVA 3GSNL 4QXGL 4YHPB 3ULVD 2VDRH 2Z31D 2AERT 4WI7A 3O4LA 1SJVA 5C08A 1QLEH 3UYRH 2I5YH 3I3BA 2VC2H 1QFUH 2QADC 3F58H 3CLEL 4N9OB 1IL1B 3HZKA 3VE0B 2JF1A 3RY5A 1F11A 3HMXL 3QEUB 2ZNXA 4FQXD 2P5EB 3AB0C 2QSTA 1G6RL 5CP3H 4JZOA 1U8QA 3TLRA 1FZOB 2EC9U 4RFEB 3R06A 1JPTH 2P1YA 3HC3L 4XNXH 1Z0MA 1CIUA 3MRPB 1JGUH 2VNCA 4G8IB 4WI6A 3TZVC 3V5KA 1AQKL 2FLRT 4NYLA 1U8IA 2CRYA 1H15B 3RVVD 2BHUA 2BHZA 4F2MB 1KJ2H 3CU1A 3WV0A 1SYSA 2CJUL 4J23A 1MCWW 5IJVA 4OD2A 3BH9B 1SYVB 3W5NA 5GJTL 3G9VA 4M7ZB 5DJDA 2BJMH 2E9IA 4HF5H 3CFCH 4U6VH 4BUHA 2LTQB 2WBKA 1KCUH 1PDKA 5FOBA 2AKRA 4L8CA 3NCEB 5CMAA 4BSWA 1TNNA 3KXFA 2CQVA 2A74B 1RV6X 4Z7QE 4RDQF 2OR9H 2E6PA 3CIQA 3DVFA 1TIUA 4Z7WB 2ZCLL 2F53A 1S5HB 3GI8H 1XGUB 2QL1A 3PL6D 4X6DE 3F7RA 4G9FE 1NCCL 3L3IA 1N4XL 1PX3A 5IW1B 4G6FB 5KBNC 5T1KB 3WFEH 1LD9A 4WW2B 2F8VA 5CEXB 3WLWD 2BNRE 4MJIA 3SE3C 4BQ8A 5FGRA 1MWAA 2YPVL 1FH5L 3SQBA 3ARDB 1T3FA 4MA1C 3HS0B 4GUPA 5DT1L 5EC2A 3GBNL 3GRWH 5HDLA 2FBOJ 1OP5K 4FMFA 5D96C 4X6FA 2RFXB 5JUEL 1CCZA 2FX7H 5EZIH 4GS7C 5AYQA 3T2NL 5DD3H 4NIKB 2YD7A 5J4MA 4G7YH 1NCAL 4KROD 4FXGB 2F19H 2XKUA 1A6UH 1YN6B 4JY5L 4G8GB 4F9LA 4YR6B 3FB5B 3LHPH 3BQUD 3TEUA 5ELIA 4ZDHB 5F1NA 3RTQB 1T1YB 1YY8B 2X4OA 3O0RH 1JP5A 1FJ1B 5C0RH 1OAUH 4BFIB 1NFIA 4HIJA 5C6PB 2D0GA 4DK3A 4N8VG 2QKIB 3CDGA 3HG1B 2FJGA 1DDHA 5JHDB 1NL0H 2DWDA 1GPOL 3LQAC 1F13A 1ZLWH 1EGJL 1IGIL 1MCJA 4OBRA 4P46C 3ZE1E 4JDTL 5IVOA 1FDLL 5TFSH 5L2KB 4JG0H 1TENA 2ZUQC 5T1LB 3OGCA 2HTKC 1GOFA 3QUKB 3PWPE 4XRCB 2PCPA 4QXTA 2BSSA 1FYTE 4JKPL 1WBYA 1X4XA 3RFZC 3U4AA 3H9HA 5BRZE 4HUXA 4MXWH 3RWEB 2N1KA 4YBQC 3MYJA 1TTGA 4KK9C 1MF2L 2NY7H 4M7KH 2HKHH 1JF1B 5J57B 5GS1B 4G6JL 3C8KA 3MLVL 2JK5B 4Y5XC 4E9LA 1DANT 1RY7B 4AG4H 5I73B 4YEFA 1QRNA 4H20L 4GG6E 1I7ZA 3B9AA 3REWB 4OAWA 1VFAA 2E8ZA 3ZDZE 4JFFA 2NY4D 1RZFL 4ZNEA 7FABL 3MJ9L 3OZ9L 2VLRD 3IDXH 4HIIA 2PXYC 1EEYB 3U46B 3M1BA 3E0GA 2WQ8A 4MLSA 4KKBC 3KVQA 3TNNB 3M07A 2Y5TB 4HUNB 4JFXB 4O02H 4K9EC 1R3JA 1FFPB 2NW2B 4PD4J 1U8MB 1MRFH 3O3AA 4TVPD 3SBWC 5TDNA 3QFJD 1HXMB 1FORL 1HHJA 5DJ8B 1TVHB 1FFOA 4QRPB 4PLJC 4AEFA 4ODVH 4ERSL 1NAMH 3FL7A 2NXZD 2DM4A 4HUWA 4R0LB 1HNFA 5KN5A 2XZCL 3CGTA 3Q6FB 5FGCB 2J7LA 5AG8A 3HNTL 1ERNA 1JMXA 3MRLA 4OLZL 2ZG2A 4NC1E 5CJOL 2D0HA 1D6VH 3ZTNL 3QJHA 1OAKL 4TPRH 5CLWA 3HPJA 3LS5H 1MNUH 5LAXA 4CMHB 1TVDA 4I9WD 3TPKA 1R0AH 1Q38A 1JTOA 1A7PL 1QSEE 3JV4A 2FSEB 1KYOK 1KUMA 1A0QH 5F7NC 4B5EA 5EO0A 3BRDA 4HC1L 2FCBA 3H9SD 4HFUH 4MA8H 2X4PA 3M17A 4PJ8C 1T04B 1LP9E 3ZSSA 3BH8A 3MA9H 4PJDA 2E8YA 2AEQL 3NH7H 5IB4A 4OLWL 4XXDA 1FSKB 5C0BD 3DRQA 1WFTA 4HIHB 1PY9A 3RKDC 3C08H 4ORGA 4PTUB 5J9PB 4ODWB 4QWWD 3VWJC 3WFHA 4Y19A 4LNRB 4Y5VA 4X9HA 5IM7A 4JFQB 4QT5B 2R23A 3O3UN 3S37L 4WGWB 2Y1VA 2NR6D 1UM4H 2BFVH 3VFTA 3W11D 4WWKB 5D6CB 1MJJB 5D7JA 5D7IA 1HSBB 2LAGB 3QXDB 4WTWA 5TDOB 2P7TB 2XFXB 4FFYH 3HCVA 3OKMA 1VGKB 1KCSH 1FL5A 3QRGH 3ULVL 5T33H 2VDOH 3SO3B 1IFHH 2V2WA 4R8WH 5INCB 2X70B 1MRDL 3FRUB 4D0BB 1AXSB 4L3CA 3MJ6A 4X98B 4NQDD 5C0GA 1LMKA 4LCWE 2GJ6E 4Y16B 1BBDL 2HRPL 4APQD 1KGCD 1RURL 1RU9L 1RIHH 4P3DB 2XKNB 1UT9A 2OYPA 5HI3D 1MHCB 3DYPA 4JO2H 1YMMB 1DQTA 1JWMA 3H7LA 3HN3A 4NQEE 2H2PC 3RGVD 3RWDB 3IT8D 3NCMA 3S4SA 5HDQH 1MFEH 3ARFC 2IBGA 1MPAH 3KPRA 1ZLUK 4YBLB 1ZVYA 1J8HD 1ZKAA 5ETUB 4RA3A 4R2GD 5JHLH 1LK3L 5CHNA 4YWGH 3S88L 1ZANL 2HH0L 4XAWH 2KBGA 5ID0B 5JNYA 4LLUA 1OSPL 5CGYC 3LQAH 5L2JA 1QHPA 4PY8J 2P24A 4Y4HD 4N8CH 4P57B 3KWWA 1EA9C 3EHBC 4KDTA 5ICYB 2G5RA 3KLAA 1Y18B 5AZEL 5GSVA 3DHMA 4LLYA 5D70L 4I48A 5HJ3B 5HGBA 2UY6A 1REIA 4UIMA 2G9HA 5T1DH 3CCHA 3P9MA 3P77A 1U8JB 1NUDA 4ODSH 3UJIL 2M26A 1H5BC 1T7VA 2NYYD 4GKZA 3VGBA 1ZGLP 2ORBH 3LN4A 3IS0X 3O4OB 2R2HA 3H42L 1FBIH 2WUCH 4HKJB 3V7AG 3KLHD 4L3EE 4NQCA 1C12A 1BOGB 2YUZA 3C60C 1JYXA 2ZJSH 2Q20A 4D9LH 4XC1L 3RDTD 5C0ND 3QWOA 4L4TB 2E7BA 3G6AA 4IRJC 5D7IF 4QY8A 1MJ8L 3EGSA 3IDJB 2WWMD 4LHUA 4K9EH 3IRZA 5FO7B 3PWVA 4RMUA 3UO1H 1ND0A 4QYOA 2VXUL 4OF6A 3DMMC 1YMHA 2KDGA 2UWEB 4M1DH 3HMXA 1KLGB 4LLWB 1F6AB 4JJHA 5MEQA 1G6RA 4D3CL 1BFOB 4YDJB 4PRIE 4MNGB 5CEYA 1M4KA 1EMTH 2PR4L 3PNWB 5ESAB 2VJXA 1X4YA 1RZ8A 1QEWB 2BVOB 3HTLX 4ZD3L 4MA3B 4RGOH 4X5XA 4XBPB 5IB1A 5I1DA 3AAZA 1OY3B 3KJ6L 4BKLB 1UENA 5EZOH 3VD3A 4J8RA 1NCUA 3ARWA 2CO6B 5DK0B 3FT2B 4JFDB 4NDMB 1P5UA 2BK8A 1JPGA 5JLZA 4WEBH 2NY2D 2GCYA 4Z8FL 5EUKB 3EYFB 3QQ3A 5DJAA 4XTRD 1FGVL 5ITBL 1MI5A 4LAJH 1YJDL 4X80L 1UYWL 3GJFK 1SM3H 4M9PA 5EH1A 3RWGB 5F8QC 1JWUA 4OCXH 2XYCA 3UAJD 2BSED 2UUDK 4XCEA 4BYHA 5D6DC 1LDPL 4HXBH 5C92A 1RZ7H 4LSSH 2FB4H 1E0OB 2IALB 3C6SA 2R0KH 4QHLA 5BQ7B 2VUOA 3IB4A 2X6MA 1A4JA 3VFWA 3LRSA 2A6KA 2C4FT 1GC1L 4HIEA 5SWSE 2VDPL 4ALAL 5EN2B 3STLB 5EU5A 2ZPKH 2RAMA 4EI5A 3C6LD 4LCYB 1L6XA 1GZQA 3TWCH 4GMTH 3ME0A 1WBXA 4DVRH 4YE4H 4J3WA 4JFHE 3TBVB 2EH7H 2NY1C 3VD9A 3WFDH 1YPZB 5EU3B 1NMAH 3HE7B 4TVPL 5ILTL 3IXTA 4HFWB 1T21B 3UTOA 2CUHA 2EECA 2GSIB 5I1KL 3WUZA 4PJFB 1S7WA 4PJCA 3U4BH 4UBDC 5ITFB 1OHQA 3FQWB 5I8EA 5IQ7H 4XPTL 2ZNWA 5IQ9A 3QAZC 2ZCKH 3IDGA 4FFZL 3QDJA 2E3VA 5EPMB 2HFGL 5ALCH 4PP2B 3S96B 5C0EA 3BYYA 3MQIA 1N5YH 1XCQA 1OQXA 4UV4H 5TH2B 3C09C 4FXKB 5L88L 2PYFB 1VB9A 3K46A 4MNQB 3WHE1 4LPYA 1CQYA 2IG2L 3HUJE 4G6ML 3ARBC 1CZ8L 1EGJA 3N85L 3WFBL 1LEIB 1R3HA 1UB6A 1E6OL 2AEPH 2VABA 4LOUC 1BD2D 1KF9B 1UGNA 3Q6GL 1C5CL 4ODHH 4PS4H 5SX4H 2XWTB 2OXHA 3QZWG 4L1DA 1YEEL 1SMAA 1MREL 5C0DB 2YA2A 1F3DJ 4ZFOL 1CL7I 5I19H 4KRMB 5DVMA 3ZE2F 3QIUA 3DJ9A 3VXRA 1ZHLB 4YC2B 2O5XH 3JVGC 1KSRA 1CLYH 5INDA 1S5IH 3MV8A 1AXTL 5SWQB 5GPRA 1Q0XH 4LLQA 3VRIA 2VISA 3WJLA 1ZTXL 4M5YH 1F02I 1FAKT 1KCRL 2VXQH 1R3KA 1DEEA 3IFLL 2X4QB 3QI9B 1JNHB 4QHKI 3MJ9A 5DYOB 3RAJH 1AP2B 1NC4B 4S0SD 4RGNC 4V1DA 3HNSH 2DBLL 2Q86B 2CDEB 2QR0B 1L0YA 2F74A 4JM2A 3HAEH 3VGGA 1YNLH 1T1ZB 1M71B 3AREA 3KPOA 2IPKB 1E6JH 2PYEE 1AGCA 1KACB 3G5VA 4JO3L 4J6RH 2P42B 4XPFH 3ARGC 3FB6A 5BS0E 1BGXH 2CLRB 1KN2H 1KJ2B 3U4EA 4JREB 4X0KB 5ADPL 1JZ5A 3EFDL 1OAXH 2AK4D 4RSVA 5ACLA 5EOQH 1DQDL 3MNWB 4NO0A 4CVXB 2OZ4L 1XEDA 1NGWA 3SQOL 1GGYA 3GSXA 4Y4FA 2ADJA 2DJ4A 3V6OC 1EAPB 3DGCR 5D1QC 4L8DA 1I3UA 5IVNA 4NWTH 1DE4B 5CSGA 4PLNC 5C7XL 2ZSWB 4M6OH 4HC1A 1H9VA 1MJ7H 1LO5B 4LAQL 1A6TB 4MZ3A 3IKCA 2FBJH 5IWLA 1HI6B 3INUL 3DXAD 3HNVH 3D3VA 4JFEA 3CU7A 2A0LC 3T8XA 1HIMH 1JV5B 2C3WA 1BJ1H 3CXHK 5FA4A 1NMBH 1QSFE 1SY6H 4OTXH 3V79C 2DL2A 2XQYG 3I02B 3D0LA 2VWEC 2ICEA 4U3HA 1CFQA 1KCKA 5IVXB 4MX7B 2OSLB 3IF1B 5F7WC 2FD6H 12E8H 5TE6H 4IMKC 4YX2L 4PJ9D 2OL3H 5CD5D 1EFXB 3U7WH 4K71B 5BVJA 2QQKL 3BGAA 1TJIH 4NKOB 4BELD 2R8SL 4K3HA 1A1MB 5D9SB 3S35L 4GAFB 1DVFC 1ED3B 4YUEH 1T1XB 4J1UA 4I0PA 4Y4KB 3VWKC 1LILA 2ED9A 1F6FB 4LSTH 5CZXD 4U1MB 1Q94B 3LKNB 5DR5H 4XB8A 2Q6WB 5ID1B 3WUWB 1F45A 4PRBB 4Z5RA 3QEQE 1L6ZA 4JJ5A 4LDOB 4H1LA 4PJBB 1AGEA 3MRMB 1FG2A 4DKFH 3CFEB 5FOJA 1JZ7A 1YQVL 1PEWA 1D5ZB 4M61B 1QP1A 1B0GB 4IRSB 3BFOA 5CILL 4D8PA 1SBBA 4FA8A 4FQXA 2MNUA 3EAKA 4H88H 3IFNH 5I30H 1EO7A 3EYUL 5D5MB 4LARL 3TGXA 5JW4M 3KPMB 3BN9D 1SEBB 1FL6B 1ZT4A 3DV4A 3ARSA 3W0WD 2YD2A 5IJKC 3AS1A 3VDBA 1J0HA 1KG0B 3G5ZB 3T3PF 1RIUH 4LRIC 2V7HB 4HQQH 3H6JA 2JJVA 1CXFA 4RRPG 4ZPVB 1INQB 1AGBB 3SPVB 4B53A 5ACZA 4P2RD 4BUGA 1VA9A 4I4WB 4WHDA 1HH9A 3ZDYE 2FX9L 4K3JH 4MA7L 2NY0D 2RQ8A 3QIWB 4NQXA 1K2DA 1BZQK 1BZ7A 4B0MM 1F4WL 4C56E 2P8MB 1MQ8A 3MBED 5DK3A 3HMWH 3BIKA 4XNQB 3AY4C 1GRWA 5DSCA 2IJ0C 3V6OE 3V7AE 1NJ9A 1BREA 1R3IL 3VG9C 3U2SA 4HAGA 4UMGA 3SDAD 3NTCH 1BMGA 1BZ9B 3CSYA 2OJEB 5EBGA 1J05B 1I3GL 3KPQB 4XH2B 3PQYB 3RVTD 1IAKB 2BY0A 3VGAC 2QADB 3L5IA 3TNMB 2AV1B 2NX5D 4XGZA 1PG7H 2WANA 5IB2B 4K3GA 3VFVA 5B3JE 3QJFB 2RB8A 1NAMB 5BVPH 1QVOA 3PP4H 2Y4SA 3AB0B 3RL2A 3L5WA 1NCNA 2WBJD 1CFTA 4JHBA 2I24N 4KVNL 3D85B 5JXEC 1AC0A 1OF2A 2V5RA 3PWPB 3MXWH 4OF0A 4LSVL 2E27L 4FMKA 2Q8AH 1JRHI 1H3GA 4WI3A 2EDYA 1K3ZA 4JHAH 3EYQC 4N0UB 3WLBB 3KHOA 3TZVB 2YMXH 4NBXB 1K4DA 5BRZB 2BNQE 3FQXB 3QQ9C 1HZHH 2HLFD 3C5SA 3V95A 2EH8L 1FFQA 3DUSB 3A6BH 4ZFZA 4UUJB 2VR9A 3BQUA 3DVGB 3CSPA 3UTSB 1XGQB 1Q0YL 1LQSR 4YHLL 1CICC 2JELL 4GG6B 1MCIA 1BFVH 2MPAL 5EIIB 3MROB 4MJ5A 3QCUH 2C1PB 3G6DL 3QCVL 2IMNA 2WQRA 3QBTB 2Y07H 4I3RL 1UVQB 2UYLB 4LSQH 2CGRL 4UILL 4NZTH 3LY6A 2E7LC 1N5AB 3MODL 1KIPB 1DLHB 3KPSB 3OAZH 1JYVA 1NFDB 5B8CC 4OZHB 1GGCH 4JPVH 5E5MA 4YGVA 4H26A 1NBQA 2YWZA 3MRIB 5GSRB 3T2PA 3NPZB 4P4KD 3ARUA 1LO4L 3LN5A 1MFBL 2NZ9D 1LE5B 2VYRE 4QTHA 1G1YA 1UKTA 2ENSA 3SE4A 4MA1B 4U1NA 4ZS6C 1XGYL 1BQLL 5ENWB 4L3AA 1FPTL 5D96B 2WUBL 3SGDI 5MEPB 1A6ZA 4OLVL 4JPIA 4GH7B 4L8BA 1EJOL 2DMCA 1M7IB 1OTSD 1QSEB 4N1EA 1U42A 3LEXA 1AY1L 3P0GB 1AE6H 1S9WA 4K2UH 2EDNA 3MLTA 2OTUB 4HSQA 2VLRA 5DRWB 2NZIA 2H6PA 2R15A 3MCKB 4GXUM 2I07B 3GFUA 4W81A 2WMPA 2VE6A 4X7TA 1XGPB 2XG5A 4NNYA 4NNPH 4JKWA 4XPHL 3GDBA 4U1JB 5IBUG 3X17A 3L3JB 4WTXA 1MH5B 3VXSB 2Y36H 1HEZB 3T4YA 4QHUA 4XNMB 5E00B 2Q7YA 1INDL 4KI5C 5C07E 1B9ZA 5J12C 3SCMA 3F7YB 1U3ZA 5D93C 1A6WH 2IQAB 1GHFL 1MRCH 1XGRA 3OKKA 4KFZC 4P46B 5DQ9B 2AGJL 2PTTA 4KQ4H 5DJZB 4XCCH 2ZUQB 1MCLA 4OCWL 1RHHB 1CXIA 1RZGB 3D0VA 2DDQL 4XPGL 2C26A 4TRPL 5FGBA 1G7QB 1X7QB 4GBXD 1FIGH 1EFQA 1EDQA 3HI6H 4PRHB 3BEVB 3MBXH 5FO9A 4A6YH 5GGUB 2P5EA 4OZFA 2ICWA 1J0IA 4QCIB 2HKFH 3TVMD 1O7VA 5HPMA 4TNWF 5F96L 1QR4A 2YK1H 3QIBC 5E6YA 4LCWB 3W2DL 4MXQD 2PO6C 4HIXH 3P0YH 4NUJA 4ZNCD 5DDHB 2XY2A 3T2OA 1IBGL 4GW1B 4YBHA 4Y1AD 5HHXH 4W4OA 3EOAA 4WY7L 4ZFOA 4J4PD 2ICCA 3LSOB 1KEML 4BFBD 3LD8C 2N7BA 2OK0L 1H15A 1DQLL 4OI9A 1ONQA 5CLTA 3V5DA 4OV5A 3KHQA 4MQXD 4HCRL 4Y2DC 3I2CH 2DLIA 4U2ZA 5TGBA 1FLRH 2ATPA 1YYML 3V6ZB 1NGPH 1DBJL 3OKOB 4YAQB 1LE9B 2OMNA 3IJYB 3MRGA 4CU8A 5BXFB 1IGMH 5FUOH 3QXUA 1JK8B 5KG9B 2W0PA 3BKCL 3RRQA 4CNIB 3GSWA 3KYKL 4P48A 4WENB 2CMRH 4NHCH 4QTIL 5CZVH 3V52H 1YC7A 1RUAL 5GRUL 1A7RH 3EYVB 1AO7B 4Z9KB 5L8LB 5DMGD 4ZUUB 1K6QH 2HFEB 3MRRB 1UEMA 3VRLF 1CLOL 4NP4H 1DBKH 1INEH 4WW2A 1AQDA 5IROC 3LKQA 5C8JA 1MCOL 4O2FA 5DFWH 2YEZA 3GSVA 1T0NA 2CLZA 4QRRE 2DLFH 5DMJB 3O2WL 2OZ4A 3TO4C 3RGVA 3QUXC 3FZUC 2F54E 5CEZE 5GISH 2IANE 3MNZB 5GS2D 3PDOB 2Z35A 1NBYB 4JLRA 2VXTL 3P4OB 3QDGE 1OCWL 3VWJB 4HJ0D 5C0FA 1EO5A 4GG8B 4DVBA 2GJJA 3BXNB 1FNFA 4KI5E 3NZHH 4G80A 4ZAKC 5I2IA 4D9RD 4WFEE 2E6JA 1A2YA 2HRLA 3EJZD 1BAFL 2ICWJ 4MD0A 1TFHA 2W65A 1BP3B 1NBVL 2IAMD 2UZXB 5KVEH 4BFIA 3DETD 2Q3AA 3MRCB 4Z78A 2ITCB 2H32A 1RUPH 1KPVB 2EDKA 2QKIA 1FNSH 4NO3B 4FTVB 3TJHD 1PQZA 5BV7C 3A67L 4HUMB 4QNPE 5JHDA 5JOFB 4LEOB 2DOCA 5E2UH 4PV8B 5F9OL 3EO1B 2IFFL 1P7QB 3EO9L 3QFDA 5A2IH 4HJGB 3WFCL 5T1LA 1ORQA 2O5ZL 3D39D 1P5VA 4ZUWA 1WTGT 4DZBA 1JGDA 4X6BA 4M5ZH 2YPKB 3MV11 1GGIL 3VFNA 1I3RB 4LCIH 4EQ2A 1PKQE 1ZK9A 3O45B 4MD4A 1IAOA 2Z91B 1E4KA 3T04D 5DRXB 3RDTA 1Y6KR 3D25B 1DN0B 2AJSL 4BH8B 1R5IA 5JA8B 2WV3A 4ONFH 4GSDL 3ARFB 1NGZA 5D7LB 4KPHH 1M05A 3I6KB 4J12A 4P5TD 1FCGA 2OJZL 4XNUH 4Z7WF 1J1PH 4NN6B 2O93L 1D5MB 1K8DA 4X4ME 4RFOL 1CWVA 1EEYA 4JR9H 4TNVK 4Z0XA 1XH3A 1CFNB 2BMKB 2VLKA 3O6KH 4K7PH 1E28A 5MENE 1V3LA 4WW2F 1QUNA 1OGAD 2Y5TA 1QTYT 3FFCE 1FFPA 1MHPL 2NW2A 2XNAB 4J3VA 5SWSB 4FQJH 4NCC1 4AM0A 1HCFX 4OLYL 1YEIL 1TITA 3S4SG 4ZUSA 4KKNA 4P9ML 1KJ3H 4P49A 3RU8H 4DGYH 4TUJB 1AKJB 1PZ5A 2EE2A 4JHZA 1D9KA 1U95B 4JDZB 1H5BB 5HYJE 4XP1L 2CKBA 1D5BB 3WDIA 4WU5B 2QTEA 1P4IH 2B1HL 4N8VB 2E9BA 4X7CC 2A6JB 1L7IL 1QD0A 3UPRA 2W1NA 4MDJB 3MLPA 5KS9B 3RNQA 2D7TH 2FO4B 2DQJL 1U3HC 2XA8L 4FP8H 3HAEB 2IQ9L 5L6YH 1HYSD 4IRJB 3D2UA 3B6SB 4PUBH 1P4BH 2F58L 3QRFM 4R4NC 1IJ9A 3WSQH 4I77H 3DX7B 5CWSB 3K3QA 3HUJB 4NZRL 4BSVA 5EU6E 4HIHA 1OD9A 2BC4A 3IDIA 5E94B 2J88L 4TSCH 4JFZL 4MSWB 2IF7A 3MCLL 5E8PA 5I1IH 3FQNA 4TUKL 4QLRA 1YEKL 1HCVA 5D6CA 1RMFH 3MFGB 2BXYA 2V5TA 4HWZB 5HHOE 4G6KL 4DGIH 5J0BA 1X5LA 2COQA 3PWLA 3U0PA 3QUYC 1NAKL 1OB1B 2XQBL 1S7QA 5I8OL 4Z95L 4GRWE 5CBAA 3DSNA 1J7VR 1EBAA 4XHJC 1J8KA 2EDWA 2OM5A 4Z7NE 2VDQH 3LKRB 5E6ID 2D3VA 2ZZUT 3L6FB 1VCAA 3DVNB 1CD0A 4H8WH 1Q9OB 3RA7L 3VFUB 4P3DA 3BD4A 2OL3B 3BT2L 5C0AD 4HUUA 2YPLD 3EFFB 4PJEE 1BD2A 4ZO7A 3KXFE 1CQKA 5TE7L 3H3KA 5BS0B 3QHZH 1DSFL 2A6DA 4KRNA 5EOTA 2AJVH 5ETUA 1ACYL 1A3QA 1U8OA 4PRAB 1PD6A 4UQ3A 5BV7H 3BRFA 3V4UH 1RVFH 4OZ4B 3ULSB 3PIQB 2J6EL 4P4RB 1NCTA 1RJLB 2NXYD 4O2CB 2ZSVB 1S8DA 3WKMH 1WWWX 1TCMA 4P57A 3VFRA 4JG1H 1ZHBB 2NY1B 3DIFA 3OPZL 3PGDB 4G42B 1WAAE 1CK0H 3O9WD 5GHWH 2A9NH 5E1AB 4UT9L 5HJ3A 3PP3H 3RVUD 4OM1L 1OSZA 2B2XL 4PRID 1QPXA 5C09B 4CMMA 1C1EH 2GK0B 1K8IB 1JF6A 2R9HC 3TH2T 1IGTA 3QAZB 2XZQL 4XMKL 5DZNA 4F3FB 5DFVD 4JHWL 3GHBL 4PREA 1ZVHA 3C09B 1JFQL 4NN7B 4C4KT 5LXGL 2CLVA 3RWIB 1JHTA 4JN1H 6CGTA 5CINH 4ELKB 4OFPA 1G7PB 5C6WH 1CE6B 4K3DH 4Y5VC 1U93B 5KAQF 3EDFA 1NGYB 1PKOA 4G5ZL 4WHCA 3LKOA 3ZDXE 1T2XA 2B7DT 3T3MF 1SJHB 3H3PH 2HT2C 5AZ2H 4K8RD 5EOCL 5D2NA 1GIGL 4WO4A 1D3CA 4JDVA 3U9UB 2MHAB 2QHLA 2EIBA 2P5WA 1F4XL 3UTTE 3WDJA 3ELAT 1KPRA 1PLGL 2C1OB 5I66B 4MNGA 3K7UA 3LH2L 2BX5A 4AY0A 4DKAA 1KENL 4UIKH 7CGTA 1JMZA 3DXAA 1A1NB 1QEWA 4Y7MA 3JWDL 4MA3A 3VXTA 2NY5C 1TNMA 1HSAA 3BYTA 2JE8A 2FR4B 1ZT1B 3O6FC 4LEXH 2Z92B 5DMIH 3S5LA 5GGRA 1EPFA 3QXTA 3HRZB 4MJ2A 5DK0A 4NDMA 4RGNB 4R26H 2G5BB 4OJFL 5AUMB 2X9WA 3KS0J 3NFPA 2X4NB 2I26N 4OLUH 2XTJD 3GJFA 3CK0H 3LEVH 3QG7L 4C57C 1RZJL 1IM9D 5EUKA 3VFMB 1WCBB 2UVFA 4I2XB 3IAPA 1FE8H 4XBEL 4LPUA 3ARGB 1W0VA 1UJ3A 4ZTOL 4GKSA 2W92A 3KJ4B 3ZYZA 1DQJB 4DFIA 3L7EA 2X1XR 1AD9A 3MX0A 5GS0C 1E4XI 3NVQA 4KK5D 5DUBB 5T1KD 2OS7A 4NZUH 1TZHB 1Q9LA 1NANI 5GRJH 1LNUA 1HHHB 3S98A 3VG0H 1G7MA 3ARDD 1G0DA 1TDQA 4KDTC 4OD3L 5DC4B 2DM2A 5D2LA 4I5BB 3F8UB 5EN2A 1ULVA 5IP4A 4KK8D 1I7TB 4QOKE 3CJJA 4CN6A 1ETZB 1N3NA 1MAML 4NNXA 4OF3A 5GIRA 4Z7UE 3BGFB 5F89A 5LQBL 3VW3L 4G8GD 1B90A 3KPNB 1N8ZA 4RISH 3U0WL 3OAZK 3ORJA 4YFEA 3HE7A 4KHXL 3NABH 2KH2B 4HFWA 1T21A 3ZYJA 5C70A 5LJYH 5HYIA 2R0ZL 2R2BA 4PGCB 5GJSH 3TIEA 2GTZB 5F72S 3RTQD 4FZEL 4PGBB 2P8PB 3T4AA 4PJFA 4JPKH 5DJ6A 5T3XH 1S9YB 3C5ZD 1MIMH 2BSTB 1MLBB 4KTDH 4P2RA 3QO1A 1QBBA 5GGTL 4R7NA 4PP2A 1QBLH 4KJPD 2DQFB 4YZFF 2JJTA 5GGSA 4JPWH 2PYFA 4MNQA 5L2KD 1OW0C 1CBVH 4GLRH 3VWKB 2D31B 5EUOA 5JW4N 4KH2A 4E41B 5MHSE 4I3SL 3O3DB 3T2QA 1G9ML 2OP4L 5DO2D 1LEIA 4UTBH 3O2VH 5IMLA 1MCWM 4PJ5A 4U1SB 4RWHA 5LBSH 4FQQB 4OM0L 2QQQA 5FCSH 2NX5A 1EHNA 1YEGH 2F5BH 2QEJA 2XWTA 2AV7B 3BEWA 3EJJX 3MFFA 3DX6A 1QO3B 3QNZA 2NPLX 3JV6B 3IAGC 4OZGB 4OZIA 2OTPA 4X4XA 4XAKE 2AXGA 4C55A 3NFNB 2UZIL 1BVKB 4YXKH 5SWQA 3S36X 4OGYH 1T2JA 2C3GA 4POZC 4GMSH 4W6XB 4M8QA 3VGDA 4KAQH 3MUHL 1O7SA 4ENEC 2CIIB 3BWAA 5A16A 4H1LG 3OKYA 5KANG 4A6YB 3MV7D 3NA9H 1WWCA 3G6JB 3NCYS 5KZCB 4Q0XH 1I9RL 4FQCH 1TETL 2QR0A 4LSPH 25C8H 4QRPD 4LKXA 4U1LB 3F6IA 4LQFL 5IMKA 3TH4T 1CLCA 4D0DA 5D2LF 3GB7A 5J6GB 2ZCHL 1OP9A 2QJDA 4HWBA 3GBLA 1LHZA 2AW2A 5I1EH 4HS8L 3SGDH 3HI5H 1H3PL 4XVJH 3RHWK 4U7MA 2WINB 5L9DL 4OUUB 3Q48A 1A9EA 4X0KA 4U1HA 3EDJA 1AFVL 3VG9B 3LS4H 3GM0A 1JZ8A 4KK6D 5TQ2L 1KEGH 4P2YA 2JCCA 3VXUB 4WTZA 4HWNA 4NZDA 4EI5C 1A9BA 5F1OB 3CFJB 2CH8A 2D7OA 1DL7H 1YZZA 3KPLB 4HJJL 4OI7A 4NFDA 1EK3A 4QRTA 3VGAB 5BZWA 2DM3A 4MNHA 5CJBA 4UDUA 2NY5H 4J3UA 4PJFF 1EAPA 2Y5EA 1A6VH 5HVHC 3SGEI 3UPCA 1WV7T 4JFYB 3PWJB 3T0ED 5K9KB 1XCTB 3IRPX 1LO5A 1A6TA 1IM3B 3DO7B 1CDYA 1IAIL 5JOPE 2I9LB 3S8WA 5CS7A 4MHHI 4NKMB 2J8UE 3ULUD 3LV3B 4WV1A 1QKZL 4C83B 1U6AL 4TTDC 4XPBL 2PTVA 3T0DA 3FOMA 1C5DB 1YNKL 4WWKD 3WS6A 3I9GL 4JRYE 4JQXA 3WHE0 1PG7W 3FMGH 1I75A 3I02A 4MXVF 5EB9A 1KNOB 3F7VB 1I9JL 4GXVL 5D71H 5GS0H 4X6EB 4GAYA 2ARJQ 3SDYL 3WIHA 3MOBH 3OF6A 5D7SL 3OB0H 1CICB 1GVIA 1NBZA 3D69B 3L3HB 4P0DA 3IVKA 1F97A 5EWIH 5E2WH 1JHLH 5CUSH 3SDDC 5JPNA 1J0JA 5IUSA 3OX8B 1C16A 5D8JH 1RZIA 4OZIF 3L5XL 4MAYD 3PABB 1UQSA 4DTGH 1S78C 1WT5C 4XCFL 2X7LB 4Y16D 5EC1B 3TA3C 4ZQKA 3E6FB 2Y23A 2V5MA 5ID1A 4PRBA 1S7UB 5E99H 5B8CB 4POUB 1K5NB 2BRRL 1A14L 4PRNB 3CFEA 4GBXA 4TQEL 1D5ZA 4PJGB 2IMMA 5DD0H 3VD5A 4X9IA 1MI5E 1F90H 4L29A 1UWEH 5T5NG 4NWUL 4Y89A 2WIMA 3BMVA 4RAUB 3LVEA 4X6DA 4DW2L 4QXGH 3D9AL 4G9FA 3HE6C 4OCRL 3HZMA 1JGLL 4F7CB 4JM2C 4X99A 5B39B 2BNRA 3AREC 3SGJA 3PGFH 1AHWA 2MKLC 4K94H 4EDXB 4R4BA 1PW3A 2JCCF 5IW6B 5A3ID 1A7QH 1KC5L 5C3LD 1JGEB 3SPVA 1AIFB 3B5HA 1ZV5A 3HMXH 5CBEB 3W82A 5C3TA 1G6RH 1HHKB 1I9IL 4UB0L 3LQMA 4JVWA 1KXQE 1M6OB 2HTLC 4WUUE 4EIGB 3IU3A 4LSUL 3HC3H 1S7RA 4JRXB 1IGJA 3B9DA 4YPGA 1R24A 1MSPA 3T0WA 1AQKH 4HS6B 4UQ2A 5J12B 3TN0B 2XQYK 1GGBL 4U6HA 5CJQL 2NY3B 3VFPA 4F7TB 5DEFB 1XF2B 3QULB 1FVDB 2CJUH 2CIKB 5TF1H 5IWLC 4PJCE 2D0FA 2Z0BA 2HLAB 3P9LA 1VFMA 5GJTH 1Q9WA 4GT7A 2XWBA 3OAYH 5IVXF 2PUQT 1T2QL 1JI1A 3QJFA 3QDJE 5JZ7D 4XCNB 3UP1A 4R96B 5CD3B 2ZUTA 3C5JA 1NLBL 4PR5B 2D03L 3MSPA 4G7VL 1EXUB 1MCPH 1RQ5A 3VXPB 1HDMA 3L7FB 3WLBA 1FYTA 3UYOD 3N1GC 2EDDA 4DGVH 2EO9A 1NCCH 1N4XH 3UZEA 2DI7A 5EORL 1F3RB 3LB6C 3HFML 3KYOA 3FRPA 4Y2DB 4FABH 4ESKA 3ULVC 2YPVH 4PJBF 5FYKD 3WNNA 4BFGA 1JWSA 1KLUB 5HGAA 1LO0L 3REVA 5DT1H 4OZFG 2VKXA 1EVUA 3CLFL 3GBNH 4Z7QF 3OAUL 5EIIA 4K7FB 4G8EB 5JUEH 1V3KA 3PWNA 2PETA 5D5MF 3SJVE 4HUVA 3T2NH 4X6DF 3TV3H 1CDCA 1OP3H 3ZSTA 4YQXH 3GMRA 1YC8A 1FN4A 1NCAH 3QNXB 2GY7B 5MENB 2EDJA 2K7PA 2Y06L 4JY5H 4FQXC 1N5AA 3PUCA 4XCYB 5J13C 3ARYA 1BM3L 5F93C 3IETB 3RWFB 3S97C 4CW1A 4HK3J 4KTYA 2VQ1B 5FF6B 4MHHG 3LKSA 4P5KA 4RGMB 4RWYL 2QQLL 2CDFB 3PHQB 3T0VA 1I1RA 8CGTA 5CIPA 5J6HA 3B83A 3SKNB 3RVVC 2GITA 2D4DA 4PBVC 5I1AB 4JVUA 1NSNL 3MRNA 1IC4H 2DJUA 5BOZG 1GPOH 4HDIB 2HN7B 1EGJH 1IGIH 3OR7B 1GSMA 4OT1L 4U6YB 1N64L 4JDTH 1FDLH 5ISZE 3E2HB 4FQLL 2A6IA 5DURD 5DJCA 1G7JA 2YD6A 2BNUA 2E9JA 2IPTH 3GSQA 4ZSOE 1D6EA 1UZ8B 4ZS7L 4P5MA 1LP9A 3X14B 4JKPH 2DL9A 3BSZL 2APFA 3MCKA 4X8JA 1IEAB 3CAFA 3TESA 2WSKA 4S2SA 5IVZA 2OCFD 3R1GL 3K4AA 4F7MA 1G9EA 3MV9E 3O4LB 1IKNA 1MF2H 5C08B 4U1JA 3PL6C 1P7HL 4QHNA 4G6JH 4UZGA 3ZE1F 5J1SC 3I6LE 3MLVH 3MXVH 4LBEA 5GGVH 1I1AD 4H20H 5DD5H 4JFEE 5EOCJ 2MQCA 5BV7B 2WLZA 3OKEB 1I8IA 3WLWC 4XVSL 1ZT7B 2XRAL 5JO5A 1F11B 7FABH 3MJ9H 3OZ9H 4YHZH 4AQ1B 3ARQA 5GGTA 4JZOB 4MMXC 1U8QB 2DKUA 1RZGA 1NCBL 4ZUTA 1L9MA 3R06B 4G3YL 3TT1L 1IT9L 2DQUL 1P84J 4HGWA 4BH7A 3OXRA 3V5KB 4KROC 2P8LA 3FB8A 2GKIA 4FNLL 4NYLB 4ERSH 4HHAA 4GG6F 3L1OL 2R0LL 2YA0A 3UTQA 4YHIA 3ZDZF 3B5TA 4PRDA 1YYLL 2XZCH 2FHFA 4JQIL 1SYSB 3BQUC 3HNTH 4MWFA 2GJ6A 3HI1A 3MA7A 3ULUL 3ULVE 5ACMA 5IJVB 4OD2B 4OLZH 1DQML 4Y5XA 3X13A 3RI5K 1Z0NA 8FABA 5JQ6H 5CJOH 5I1CL 2QQNH 3ZTNH 1OAKH 5DJDB 1UH3A 3EW3B 5DD1L 1C8PA 1V7ML 4FQHA 5FOBB 2AKRB 4JANA 5FO8A 1A7PH 2PXYA 5CMAB 4NQEA 4OCYH 4PJEB 4BSWB 2CR3A 1NFDF 1IC7L 3KXFB 3Q0HA 3O8XD 4HC1H 5CEZD 3QI9D 1NC4D 3L5JA 3U7YL 3V6ZA 1X5GA 2F53B 3VXQA 3WNLA 4YHNA 4X9BA 3SBWA 4WFFD 2AEQH 1MEXL 1YJDC 4WCYL 1M7DA 1LD9B 2VDNL 4LRNL 1YUHA 3GSRA 4MJIB 2G75A 3WCYA 3BZ4A 3PG2A 3SE4C 3AFLA 1T3FB 3S37H 4GUPB 4XI5D 4E5XA 5IBUB 1XZ0B 1V8HA 5CAYB 4Q9CA 4X6FB 4PJAE 3KNBA 5E6IA 4HX1A 4PD4K 1LP9F 3KPPA 1J1XL 1BX2A 4HH8A 3V4PL 1MCRA 4JCMA 3CDYA 1GC1C 3RUGE 2NY4C 1I85C 1U3HB 4WJ5A 2EO1A 1IRAY 1Z3GL 1FRGL 4PJ8A 5H35A 5JORA 3LZFL 4PBXA 3MUJA 5FHAL 1LVEA 5I6XC 4U31A 1MRDH 1N0XL 4ONGH 4L3EA 5F1NB 5CJ5A 3QUZA 2X4OB 4IIQA 4QRUA 3GMOA 1GAFH 1IGCL 1NFIB 3L9RA 4H1LH 4HIJB 3VWJA 1BBDH 2HRPH 3AU1A 3CDGB 5GRZA 2FJGB 2DIAA 2NXZC 1DDHB 5E2TL 5T3ZH 4KZEH 2DWDB 1RU9H 1DUYA 2R56L 4DUWA 4LPXA 4POYA 2YXMA 5FFLA 5F6HJ 2HG5A 1NCWH 3O9WA 3OGCB 1RSFA 3U7AA 4PB9H 2PCPB 4PRIA 4IDJH 4QXTB 4S10A 5AD0A 2BSSB 1CFSA 3CMOL 5FGBC 4Z0BL 5JMRA 4XP5L 3T0XA 5JOFA 1WBYB 4PRPD 3S88H 1ZANH 2HH0H 3QUYB 3H9HB 4F7PA 5F7LB 1T5XA 1OSPH 3MYJB 1P7QA 1Q1JL 4Q6IA 4HJGA 3UTZA 2WZPD 5F1SA 4LDEB 4EN3D 5GRWA 3GZKA 1QRNB 5K9QI 1I7ZB 5D70H 4OAWB 1VFAB 3DVIA 2JJWA 2X41A 4JFFB 4QWWC 3U9PL 4NOBA 4HIIB 2DTSA 3O6MH 4IRSD 1XF1A 2NR6C 3UJIH 2DQDH 2IGFH 5FECA 5E8OA 1QFWI 1R3JB 5E0QA 2V7NB 3O3AB 5AAMA 5I1LA 1CI5A 5TDNB 1FO0L 1T89A 3QWRD 3H42H 3VI4E 1HHJB 1FFOB 1A6PA 3ILPA 3RJDA 2HP4A 2X89A 4HUWB 3DTXA 5KN5B 4XC1H 5FYKL 4U6TA 1O0VA 5IKCA 2DQCL 3MRLB 1BFSA 5EU6D 1NANH 1OWWA 4NQTA 1MJ8H 3IDNA 4PB0L 3QJHB 3MJ7A 4XVTL 3V8CA 1UM5L 3ABZA 5LAXB 3MGOB 2DF3A 2VXUH 3ARRA 5HI5D 2K1MA 4XP9L 2V9QA 4APQC 4Z7UB 3JV4B 4HK3N 1U95A 4D3CH 1XF3B 3QHTC 5EO0B 3K8KA 1MLCA 2HVKA 2Z8WC 2EDHA 1H5BA 2X4PB 2VLRE 3M17B 5HI3C 5TJWK 4ZFGL 2PR4H 3AGVA 4PJDB 4YHOH 3RGVC 4URTB 4BK5A 4ZD3H 4ODXA 1H8SA 1HKFA 3DRQB 3V0WL 2P4AB 3LMJL 3WNKA 3QEGL 3KJ6H 4BJLA 3C60A 4PYHA 4R2GC 4ORGB 2CK0L 1F4AA 3SY0A 3QFJE 4UT6L 3MLXH 4N8PA 3WFHB 4Y19B 4Y5VB 5IM7B 2JB6A 1WZMA 2R23B 4KY1H 1B6DA 3B6SA 1JIBA 4Y4HC 5FHBL 5H8DA 3SKMB 3VFTB 5D1XA 3H8NA 4Z8FH 2X9XA 3D85D 5D7JB 5ITBH 5D7IB 3DMMA 4X80H 1G7IB 1UYWH 2XA3A 1FV1A 3A6CL 5HYSA 3HCVB 1FVCA 4ZXBD 1NUFA 4I9WE 1W0WA 3HRPA 3VMNA 4GJTB 1II4E 5ANMA 5JIPA 3UEZA 4P23D 5LGJB 4L3CB 1YA5A 2NYYC 3H9SE 5FYKU 3RJQB 3O6FB 3VJ6A 3R4DA 5C0GB 4R9HA 3JWOL 2DKMA 3LPWA 3V0VA 3MR9A 4CU7A 3KLHC 5C0BE 1GC1H 4XNZC 4ALAH 1DQQA 1A3RL 2XTLA 3JSSA 2JIXA 1E4KC 3RDTC 2IC2A 5C0NC 5IFJA 2Q8BH 1KCVL 1GGTA 4TNVF 1P69B 1JWMB 3NN8A 4L8SA 4HPYH 4RX4A 2WWMC 3S4SB 1WBZA 1WEJL 3LPGA 3KPRB 3KPSD 3M8OL 4LCCA 4TVPH 5ILTH 4ZYKB 5EIQA 3X3GL 1QFWM 5CHNB 5I1KH 3S5LG 1Q9OA 2PYEA 4S0TD 5JNYB 4U1KA 4EEEA 4LLUB 4N9GA 3KDMA 4M3JA 4OFDA 1IZJA 5L2JB 2P24B 4XPTH 2VDRL 3OB0K 4FFZH 5BS0A 2Z8VC 3LKPA 1QLEL 5GSVB 2HFGH 2I5YL 4LLYB 4PRAA 4CBPA 2VC2L 1QFUL 4I48B 4NQDE 5HGBB 4UIMB 2R1XA 2IG2H 4OF8A 3CCHB 4O2CA 3TPUA 1CZ8H 2ZSVA 3P9MB 2VO5A 3P77B 4C54A 3L95A 5CEZL 4OZFH 1KGCE 1D9KC 1E6OH 1ZHBA 2NY2C 4NRZA 4EQ3A 5DC0A 3P73A 2MTPA 5FYJH 5KS9F 4XTRC 3Q6GH 4LHQB 3GMPA 1CGYA 3TT3L 3LN4B 3UTTD 5J1AB 1LK2B 2R2HB 3OTTA 3MV7A 1NLDL 3Q1SL 5C6TL 1YEEH 5F7MC 1MREH 2GK0A 2H41A 4MCZA 1MHEA 4NQCB 4X5WA 4HKBA 3UMTA 1J8HE 3UAJC 5E8NA 1C12B 3SGEH 2HJFA 1YN7A 5F88A 3QWOB 3HUJF 5TDPA 3W39A 3SO5A 4AH2B 1LEGA 1QSFA 4UINH 3G6AB 3WIFA 4F58L 4QY8B 3EGSB 1AXTH 4LHUB 1WISA 1KT2A 4EKXA 1ND0B 3MUZ1 1ZTXH 3ARBA 1VADA 3JV5A 1KCRH 4O4YH 1L0QA 4JKMA 1YMHB 3CFCL 3IFLH 4MQ7A 4U6VL 5MEQB 1KCUL 1G6RB 2EKJA 3C6LC 1F8TL 5CEYB 4PRHD 1SJXA 4S1DD 5FYLH 1QBML 3QPQD 2YUWA 3GI8L 3GMMB 3IFPA 4X5XB 5IB1B 4NQVA 1G9NH 3AAZB 4D0CA 3IXAA 3QUML 4KV5E 3K4DA 3QEQA 5FIEA 4AENA 5ADPH 3EFDH 1OP5H 4PTTA 1BPVA 3VXMD 1AGDA 4NKQB 4WFGD 1JPGB 5JLZB 3KGRA 1CXEA 5EBMA 2YRLA 2GCYB 2DIJA 2OZ4H 3QQ3B 3GRWL 5DJAB 3SQOH 1MI5B 2EC8A 4KKBD 2FX7L 5EZIL 2YSSA 1NEZG 3OAYK 1JWUB 5DD3L 1F4HA 1RJCA 5IGXH 2GEEA 5C7XH 2LU3A 4XCEB 1A6UL 5IIEA 4CAGA 2YBRB 3Q5OA 3C6SB 3UJTL 4QHLB 2IFGA 1IQWH 3DHJA 4O5LH 1V05A 4MQSB 1A4JB 3VFWB 1UB5B 3O0RL 2WW8A 2A6KB 4KMQA 4HMCA 4HIEB 3PV6A 5DUBA 2H32H 1KIQA 4EI5B 4WNQA 3AVEA 1GZQB 4C56A 4YX2H 1WBXB 2OQJA 4HAFA 3V6OA 5GS3A 4HV8A 2A38A 5D1QA 2QQKH 5TFSL 2GUOA 5HVHB 3NPSC 2R8SH 4RCAA 4LLVA 2V2XA 3IXTB 3R0MA 2AI0L 3S35H 1U92A 2OR8A 2ED7A 4ZTPL 5ECJE 4N0CD 1I7TA 4OUOA 3BPNC 4HBQA 1OP3K 1JHKL 1NDMA 1S7WB 4PJCB 1ZA3A 2V5SA 1CGTA 1SHMA 2AP2A 4TTGA 1QFOA 5IQ9B 1P2CA 3S3PA 3FFDA 3QDJB 4QO1A 5DJXA 4M7KL 1UXWA 5C0EB 1XCQB 3F62A 3WHXB 2P8PA 4AK1A 2X1PA 1HN1A 1U8KA 1F3JA 5HVWA 4TVSa 5CILH 5F3HA 3EYUH 4HMEA 1R3HB 3IDXL 2FH8A 2FL5A 2VABB 3GIZL 5IEHB 1XR9A 2BNQA 2I60L 4MCYA 3OXSB 1CVSC 1DLFL 2IEPA 1DVFA 3MLSL 4O02L 3BKMH 2ZUYA 5K9JL 3OBAA 4WO4C 1G7LB 1B0RB 2VZ1A 3O3DA 4CVZA 3QIUB 3VXRB 1JCKA 3RQ3A 1A3LL 4FQQA 3OR6A 2NTSP 1FFRA 1U2CA 5KJRH 2FX9H 3RX7A 5CJ8A 4JFPA 4MA7H 2CKBH 5F7DB 3VRIB 2Y72A 2VISB 1F4YL 3SE9L 4TPRL 1FNHA 5LKNA 3RZCD 5D7LD 1R3KB 3PHSA 1DEEB 4JO1L 4UI2A 4KRLB 1R3IH 4V1DB 4U0RC 2F74B 1HNGA 4JM2B 4PJ9C 3QDME 5FKPA 5CD5C 3AREB 3KPOB 1I3GH 4S1SL 1AGCB 3G5VB 2VAJA 1UCBH 1FO0A 3ZDYF 2DS4A 4LRIA 1BD2E 3EHBD 4GW4B 2FEDD 3HLAA 3OJMB 5BW7C 1S9VA 3U4EB 1BIHA 5CZXC 4KVNH 4M1CD 1AKJD 4GAGL 3OHXA 3F7PC 4NO0B 4LSVH 2E27H 2VAAB 4ZSOB 4BM7A 1NGXA 3BPLB 1NGWB 1WQVT 3I50H 2BFVL 3GSXB 2FHBA 5F7HA 4L8DB 4FQ2L 2GT9B 2APBA 2FZ3A 2P46B 5EBLA 2EDEA 3LCYA 2YZ1A 2VXVH 3CFJA 3KPLA 2DYPD 5E1HB 1HQ4A 1Q0YH 4JFEB 3D3VB 4YHLH 2JELH 3T8XB 3C8HA 5C07A 1EZVX 2DQHL 3BZEA 1EERB 1WFUA 4RFNC 5FA4B 4GKOA 3G6DH 3QCVH 1VEPA 2Y6SD 5TQ0L 3NCBB 3CXDL 2ICEB 1CFQB 5LGKA 2EDFA 5T5FH 2Z93B 2H8PA 1VPOH 3MODH 3LV3A 1VKXA 1FL3A 3QZWA 2AK4E 1U58B 5BVJB 2NY0C 4TSAL 3MYZA 2Z8RA 4NO2A 3UPAA 2JJTC 5DMKA 3MBEC 3F7VA 3RZWA 1T7YA 5SWZE 1LO4H 4J1UB 1MFBH 3KS0H 4OQ1A 5A2LH 1E4WH 4YWGL 1EHLH 1U8LA 1XF4A 3L5HA 1MCCA 3SDAC 3D69A 1I8LA 1XGYH 3FN0H 5MI0C 2WUBH 4Z5RB 4OLVH 2ESVE 4N8CL 3RVTC 2ZWLT 4JJ5B 1EJOH 4OZGF 1I1AA 4H1LB 1AGEB 1FG2B 3F65A 2B5IC 4H0HB 1AY1H 3NACL 2DQIL 4KJWD 2LU4A 4Z77A 2XN9D 5FM8A 3FAWA 2J12B 3EOYG 4M9OA 4D8PB 3N1QC 2X7LA 4FQXB 4OFVA 2WBJC 2RJMA 5J13B 2HT4D 1N6VA 3FRPG 5M7QA 2L7UA 3T1WA 2BCKA 1QZ1A 5ESVA 1JBJA 1ZT4B 3BW9A 4PGEA 4I13B 4XPHH 1KLFA 5E24E 1TJGL 3N1MC 4KUCD 2HLFC 1INDH 1RI8A 3RHWF 3ROOA 1N7ML 5ACZB 1GHFH 3IKKA 1JGVL 1BFTA 1HH9B 4CDHA 5GZOD 4OCWH 4NQXB 1K2DB 2ARJA 2DDQH 1BZ7B 4EDXA 4XPGH 4QRRA 4YXHL 3G5YA 3BIKB 5DSCB 15C8L 1NJ9B 1AIFA 4JM4L 3D5OF 2F54A 3O8XA 5GZND 2IANA 4M1DL 3U2SB 1UEYA 5JDSA 1M6OA 3CSYB 3QDGA 3W2DH 3T65B 5C9KA 3NOIA 2W0LA 2FWOA 1IBGH 2N56A 4WW1B 4XGZB 4WY7H 3W0WE 1UWGH 2AJXL 3O3BA 1JPFA 1QOKA 4P4KC 3VFVB 5CCKL 4GRLD 1QVOB 2Q87A 2NZ9C 2OK0H 3RL2B 4GAJL 3L5WB 5EZOL 3JXAA 4U4BA 1CFTB 3QG6B 5DEFA 1L9NA 1JZ4A 4IJ3C 5CP7A 3CVHL 1OF2B 4FG6D 3HKFA 4ACPA 1YYMH 2HLAA 3GJFH 1DBJH 3FO0L 4WEBL 2CUMA 5CKAA 1HYRC 1OTSC 4UOW0 3H9YA 2HT3D 1P4LA 1C08A 4Q2ZB 1UG9A 1K4DB 2KZ1B 3BKCH 3DBXA 3KYKH 3WD5L 3WS6C 4XWOD 32C2A 4JQXC 1SM3L 3C5SB 4HT1H 1EXUA 4ZFZB 3BQUB 1RUAH 3QIBA 2PO6A 2DQTL 2J4WL 3EJYD 4B50A 1OAZH 4Y2OA 3DUHA 1MVFA 1ACZA 1PKQA 2B1AL 4YH6A 4MJ5B 1CLOH 2EZ0D 4U6XA 4KVCH 3QUMA 3GGWB 3RX8A 4NBZB 4XB7A 3DWTA 3TYGL 4XMLL 3BVNB 5I17A 1PSKH 4RGND 4KGLA 3QO0A 4R7DA 2ZKHL 2CUIA 5E08L 4YE4L 4X4MA 5E5MB 4YGVB 5K93A 4H26B 4RZCA 4JN2A 1S7TA 4GBXC 4M4PA 3QNXA 3LN5B 3ARGD 5MENA 3GJEA 4XP4L 4F37K 3FFCA 4QTHB 4U1NB 3K81A 3TVMC 4NKIL 3IETA 3IDMA 1BAFH 1CXHA 4JPIB 4L8BB 4NHUA 4EN3A 1ES0A 4EOWH 1NBVH 3SGJC 3LEXB 2D4FA 4S1RL 2C4XA 1EIBA 4J4PC 1AHWC 5ALCL 2CDFA 3PHQA 3QDHA 1S9WB 2NY4B 2G2RA 4UV4L 5HYJA 4NRYA 3MLTB 2NTFA 2VLRB 3A67H 2H6PB 4MQXC 3TO4A 4PYGA 2OBGA 3QUXA 5I6XB 2IH3A 4L9LC 3MLUL 3LDBB 4YK4B 2VSDA 1FZJA 2IFFH 4R90H 3N06B 4NNYB 4KI5F 3WFCH 3NMEA 2O5ZH 1A22B 1PGRB 4PFEA 3TP4A 4HS3B 5IFAL 5JXAL 2F8OA 4OIBA 4UU9A 1GGIH 4JAMA 2Q7YB 2NXZB 2OR7A 4ZAKA 3SCMB 2C5DC 1KIUA 3QXAA 3OKKB 1XGRB 4WI2A 4Q97A 5BMFL 2M8XA 2AJSH 1NC2A 2PTTB 4QNPF 5EU6A 2O5XL 3EOBA 5DMGC 4L5FL 2IBZX 4CRPA 3BJ91 5GQBA 3D0VB 4ISVA 1CLYL 4HMDA 1S5IL 5DRZA 1U8PA 3JWNC 3OKEA 2OJZH 4L4VE 1ZT7A 5FO9B 3UZQA 5I71C 1AI1L 1G84A 1Z6JT 3GNML 1Z9SA 4P3CH 4OZFB 3QNYB 2ICWB 4RFOH 2ITDA 3VWKD 1N0LA 2DQEL 4E41D 4P99A 5HPMB 3G08A 3HNSL 4LLAA 5HHOA 1FC2D 1YNLL 1ZAGA 1MHPH 4NUJB 1XMWA 3EOAB 4OLYH 4ZFOB 4HWBH 2R1WA 1YEIH 3UBXG 2VQUA 4P9MH 1WITA 1MQKL 4I18C 1A6AA 1ONQB 3V5DB 4OV5B 2RCSH 2EDOA 4HZLB 1KN2L 3ECBA 3EJZC 5TGBB 2EC9T 2ATPB 4XP1H 2CR6A 3JWDC 5EOQL 4W70A 3CFKA 1FFNA 4LVHC 3RWCA 1RK0A 2B1HH 2IAMC 3MRGB 3HC4L 3DETC 1L7IH 1QHOA 3GSWB 2A2QT 3TJHC 4ZXBA 3T09A 3QQ4A 4PJEA 2EIZA 3BPCA 3ROLA 2DQJH 2XA8H 3D1MC 1CFBA 5J3HD 2IQ9H 4KJQD 5DJYA 2XXMB 4P23A 4KUZL 1RZJC 4NFBA 2FBJL 2E5EA 5IR1A 4XVUD 3MRKA 3HNVL 1T20A 4F57L 2DJSA 5JW4Q 3SDXE 1AQDB 1HIML 2VL5A 3LKQB 4WFHE 5C8JB 4Y1AE 4O2FB 2XG4A 4JFZH 2YEZB 3GSVB 1T0NB 2CLZB 3ZKXC 2B39A 4NC1C 5F71A 1WAAA 4TUKH 4I1NB 3IGAA 1XZ0A 3RGVB 3WIHH 5FK9A 1YEKH 1AR1D 4NN5C 4DQOL 1J8HB 3RY4A 2Z35B 1TJIL 4P5TC 4JLRB 3UC0L 3ZTJG 1HOCB 1TQBB 1BOYA 1EVTC 3GMNA 3N1PC 5HHMB 4KTEH 1U3HA 5C0FB 5IFHL 4G6KH 2WWKO 5DJ0A 4DVBB 6FABL 4YUEL 5A2KH 4CJ1A 3MMEA 4G80B 5I2IB 1E4JA 5J11C 1A2YB 1NAKH 2XQBH 3L3OA 2GSGA 5I8OH 5C0CE 3U36A 3MACL 3TJEL 4Z95H 2AJUL 4P2QD 2MKWA 4YHYC 5DR5L 2VN7A 3JUYA 3CH1A 5BJTA 4MD0B 3S7GA 1IKNC 1OLLA 4MDIA 2W65B 1Q72H 5DI8A 3TBSA 1ZSDB 3EYQD 4YDLC 4HXAL 3T3PE 4Z78B 2H32B 2Y9RT 4QF1A 1PQZB 1Z5LA 5IF0A 1QA9A 3QQ9D 3RA7H 1KV3A 4H88L 3IFNL 5H37H 1MY5A 5IHLB 3QFDB 4XHQA 2W0FA 2OI9C 1ORQB 4AIZA 3UTTA 1DSFH 4JZNA 4ZUWB 4DZBB 1JGDB 3N50A 4X6BB 3RI5F 4RNRA 1ACYH 4XNZB 3VRJA 3VFNB 1G0XA 5IHZA 4MD4B 1IAOB 2KQMA 4V2BA 1RIUL 3ZKSD 3QUYA 2P45B 3RDTB 1G9MC 2BVEA 5HYSG 5JR1H 1HYSC 4RMRA 1R5IB 5I1GL 5F9AC 4D9RE 1NGZB 3BKJH 2AJZA 4JKLA 4PJEF 4NUGL 1M05B 3E8UL 2R0WL 5JW5A 1CGSL 4M62H 4NBYB 4OM1H 2B2XH 4CJ0A 4TULL 5GGVY 1K8DB 1S7XA 1XGTA 4YIQA 1VESA 2XKSA 1XH3B 4Z0XB 2EE6A 5IHUL 3FCTA 5DJ2B 2VLKB 4RIRB 2XZQH 4XMKH 1E28B 2BY1A 1RAMA 1BBJA 5DEZA 3D18B 2P47B 1DBBL 1WICA 2V7NA 4JHWH 1KB5L 3GHBH 4AM0B 2N7AA 1JFQH 5LXGH 4ZPTA 1T80A 4BQ9A 3KPTA 3D39E 4ZUSB 1WAAF 1PG7L 2EDLA 3BUYA 1PZ5B 1D9KB 2VH5H 1BVLB 2NY2B 4A2LA 3UDWA 4LSRL 4H5SA 4LIQE 2CKBB 4G5ZH 3C9NA 1L0XA 3MXWL 2I9TA 4QOKA 1UADC 5EOCH 5E6IC 2GY5A 3MGOA 1JNLL 3UPRB 1OPGL 4Z7UA 3RNQB 1A1OA 3LRGA 1F4XH 4L9DA 1XF3A 2A73A 3DURB 1PLGH 1ITCA 2OXGA 3LH2H 1KENH 3NIFE 3D2UB 3TN0D 5IOPA 4WUKH 5E8DL 5IB3A 3BO8A 4N0RA 2NY3D 3JWDH 4QHMA 1URLA 4QRSA 1OGAE 1UH2A 2DN7A 3ZDXF 2EDXA 3QUZC 4BSVB 4BZ1L 4IIQC 2BC4B 3SHSA 3IDIB 2C7UA 3SGKC 5B21A 4M7LL 4ZO9A 2Y07L 5C2BH 3WMSA 3C6LB 5E8PB 4OJFH 2NXYC 2RGSA 3FQNB 3CVHA 4FQIL 3SKMA 2Y7QA 3QG7H 1RZJH 2ZP0T 3ET9F 2M1KA 3MLRL 3O9WC 1G7IA 1MFAL 2PF6A 4NT6A 3RVUC 1EO8L 2Q7NA 3VMPA 4EVNA 3PWLB 3U0PB 5CIPH 1S7QB 1UM6L 1N6QL 5LGJA 5CBAB 3NIDE 4Q6IC 5DFVC 3O6FA 1IVLA 4XMPL 2PTUA 4OD3H 2B20A 4UNUA 5BO1L 1R5VA 1AE6L 1BEYL 1Z2KA 4ELME 3GEWB 3PJSA 1MAMH 5CGMA 4HUUB 4D9QD 1T7WA 4IS6A 5LQBH 3VW3H 1BD2B 3KYNA 3OJDB 4WU7A 3U0WH 2A6DB 2C3VA 5EOTB 3LRHA 2G60L 4ZYKA 2R0ZH 2R2EB 1T89C 1U8OB 5I8KL 4FZEH 4O00A 4UQ3B 3BISA 4HGMA 4YO0A 2GQHA 5HGDB 3MRHA 4KGJA 1S8DB 1RJZA 1LEKA 5GGTH 3VFRB 3DIFB 4Z7UF 4FN0A 1TQCC 4KI1A 3RZCA 5AWNH 2D9QB 3Q2CA 3BPNB 1OSZB 1Y0LA 3DECA 4CMMB 5C0IA 1T03L 1FIGL 5M94B 5HHQA 4PJDF 1G9MH 1IGTB 1YNTB 2OP4H 2XTJC 3VFSA 4M7LT 1J0KA 3OL2A 1KELL 1IGFL 4OM0H 5C0AE 2YK1L 2YPLE 3DRTA 4PREB 4HIXL 5J1AA 3N1FC 1LK2A 3R0NA 2CLVB 5KSBA 1JHTB 3GSNA 1SEQH 2J8UA 4ZODA 3TIDA 4MAUL 4KK5C 5MEOA 2AK4B 2P43B 2Q3ZA 2A1WL 4AH2A 3BDXA 5ESQA 4JRYA 3LKOB 3PV7A 3I2CL 3O11B 5D1XC 1EJ6A 1OW0A 2HA1A 5D2NB 2VL4A 1EEQA 4WO4B 4JDVB 2P5WB 4KK8C 4LKCA 4Q58C 1KPRB 2CMRL 4JKKA 1I9RH 1TETH 3VXOA 1ODAA 3FONA 3DXAB 4LQFH 1K3IA 2B0SL 3VXTB 3GO1L 3GMMA 2ZCHH 1HSAB 4KKCD 2V6HA 1CDHA 3I85A 3J7HA 3S5LB 1EAJA 5GGRB 4OQTL 1H3PH 4NP4L 4PV9A 3LOWA 5J06A 3RTQC 2H9GA 4BZ2L 1AFVH 1X5HA 3C5ZC 4U0RB 1J5OL 3EOTH 4IHOA 3NFPB 4PJ9B 1YECL 2L0DA 4ODUA 3GJFB 1CR9H 3MCG1 4Z18A 4HJJH 2EE3A 1FG9C 3G9AB 4L8SC 3O81A 1W0VB 1UJ3B 4KJPC 4GKSB 2F53D 2FJFA 1VEOA 1VACA 3O3EA 4MS8D 4LCCC 3L7EB 1OL0A 1AD9B 4PJXE 3VI3E 2PW2A 5DHYB 1Q9LB 1IAIH 5DO2C 1LNUB 1P9MC 1JZ2A 4MJID 2YBRA 4Q9RL 3WL9A 1G7MB 3BKYL 1QR1A 1QKZH 4WHYG 4XPBH 1HINH 5FDWA 1UB5A 4ZO8A 3SE8L 4NM8H 5IESH 5D2LB 3TYFA 5KVEL 4LNVA 5DHVH 5GS1C 3R8QA 3KYMA 5I73C 3DI3B 4WUUA 1RUPL 1I9JH 2BSRA 1FNSL 4GXVH 1KTRL 3MLZH 3IJHA 1KJVB 1N3NB 4NNXB 3SDYH 5J56B 5GIRB 1HQRB 5D7SH 4LLMA 5E2UL 5F89B 4GW5A 1N8ZB 3B8YA 5IMMA 2XTJE 1I3VA 3N9GL 4Q7DA 2J8UF 4DN3H 4KZDL 2JB5L 2R2BB 3TIEB 3L5XH 3T4AB 5DJ6B 4LLDA 1N26A 2DWEA 4XCFH 4JY4A 2VLME 1PG7X 4P2RB 1YEFH 2XZZA 3QO1B 3PGCA 1I7RB 1ZS8A 2NY0B 1FC1A 5B3NA 4R0LC 5DUPH 4TN9A 2BRRH 4R7NB 1OAQL 3X11A 4FZ8L 2JJSA 3WHXA 1A14H 4MJ4A 5GGSB 5EA0H 4KPHL 3GHEL 4TQEH 2NNAB 2X4SA 5EUOB 1T22A 4F7EA 4XNUL 1J1PL 3QDMD 4NWUH 5ERWA 2LFGA 4KK6C 4DW2H 2J5LC 3D9AH 1LO3H 1ITBB 1YQ2A 2H1PL 4OCRH 5GRVL 3VH8G 5IEHA 5IMLB 4PJ5B 3X3FL 3BHBB 3OXSA 2MCG1 3SDDA 3O6KL 2NX5B 1NEZB 1XF5B 4G8GE 5ANME 5EZLA 3BEWB 3MFFB 2QSQA 3DX6B 3GI9L 5DUML 4GRLA 5DVOA 3QNZB 1RPQA 1VFBA 1WT5A 4DZ8A 1G7LA 1B0RA 3T0EC 3ZT6A 3TA3A 2WP3O 1FSKC 1KC5H 2XPGB 2XXCB 2O61A 2W07A 3W81A 3RU8L 4OZIB 4ODTH 1RUKL 5T3XD 4X4XB 2VOTA 2AXGB 3SJVA 4JFFD 1I9IH 3ULUC 3QA3A 3HG1E 5F7DA 4M8QB 3CFBA 3P4MA 4WWKC 1VFUA 3BWAB 5A16B 1VGEL 3KLDA 2YS4A 3B9KD 5KSUA 5L2KE 3HE6A 2UVEA 3Q5YA 2K9UA 3LN9A 2VDLH 1GCFA 2D9CA 4FP8L 4LKXB 5IMKB 4WI5A 4D0DB 1KB5A 3HZYA 3GB7B 4YHMH 5H2BA 1A8JH 2DRUA 4X6CE 1T2QH 3B2UD 4GW4A 1UCTA 4MAYC 1P1ZB 5F70A 3MOQA 1A9EB 4U1HB 5E7FA 4HWEL 5MP6L 5ISZA 4DKEL 4Y16C 1NLBH 2JCCB 2D03H 3U83A 4G7VH 5I1IL 1A9BB 3AS2A 4ZSOA 2VAAA 4QRTB 3AMKA 5BZWB 3BP5A 2GTWB 4MNHB 4HUKB 4UDUB 4YDIL 5SWZD 4MB4A 3BPOC 4LP4A 4PJCF 2GT9A 3UXFA 5EORH 5FB8A 3QXWA 1DBAH 3MV9A 4ONHA 2QLVB 5A43C 3MV7E 2ESVD 4M48H 1LO0H 1XFPA 1CL7L 3FO9A 4Y19D 1S3KL 3CLFH 4WV1