3F5WB

Kcsa potassium channel in the open-inactivated state with 32 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title KcsA Potassium channel in the open-inactivated state with 32 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
molecule keywords Antibody heavy chain
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f5wB01
1ZGLP 1FO0H 3BJLA 3TO4B 3QNYA 3W0WD 3QDMA 4CNIB 3SDXE 5JQHC 4ACPA 5J8OA 4UAOB 4GMSL 3WLWC 2YD6A 5I1JL 2MPAL 3DSNA 3ILQC 3R06B 1WEJL 4EI5B 1OLZA 1YQVL 5M94B 1KCSH 4PJXA 5BOZG 4APQA 4HDIB 4DK6A 4OUOA 2FD6H 1ZHBB 3UMTA 2EXYC 5I18H 2R1WB 3X3GL 1P7QD 4FP8L 1QSEB 1BQHA 1VADB 2R8SH 4CDHA 3UZEA 3SGEI 1LO4L 5EDXA 2EXWD 3GKWL 4KRMB 3ZYJA 4Q7DA 1VFMA 4OV5A 3PDGA 3JWDC 3REVB 4ZO6A 4HAGA 3MLUH 2C9AA 1YJDC 1U8LB 5FHBL 3ZDZE 2ICEA 4FQHB 3OKEA 4BYHA 1ZSDA 1XH3B 5FYLE 4RBPK 1ZLVK 1ETZA 3U82B 4JKLA 3QUZC 1IC7L 5FYJH 1UM4L 3B5HA 3ZKXC 4TULH 2NNAA 3P30H 2EKSB 3NA9H 2C1OA 4LSUH 4ODXA 3BKML 4YX2H 4V2BA 1HQ4B 3CH8A 4HXBH 4LOUD 5CINH 3R8BB 4CVZA 5FO7A 4PB9L 1WIOA 4HV8A 4MJ4A 3CVHL 1NC4B 3SDCB 3VXSE 3MLWH 3GSXB 3JVGC 5HYJE 3QDJB 4Z8FL 4IIQB 5BV7C 5GRJL 3SDAC 3H42L 2OTWA 4HH9A 3JWOH 1IGFL 1R3IH 2ICWI 4QT5A 5CKGA 1G9MH 4KY1L 3N50A 2DIAA 1PG7W 3H3PL 1V05A 3HUJB 1F02I 4NRYB 4RA0C 3MV7E 4Z7VB 2X4QA 5D93C 5TDPB 4GFTB 1F90L 3LPGA 2JIXA 4V1DE 3PWPA 5EZJB 2BOCA 5I1HH 3Q6FA 4RMRA 1FYTD 2PNDA 1NFIB 3O3AA 3T09A 4NC1C 2AXJA 5SWZB 4XNQB 3WXVL 1KXQE 4X6BA 3TJEL 1BWWA 3RUGA 3QUYD 1WFNA 1VFBA 1A7RH 1PEZA 3WD5L 5F3HB 5F1NA 3QXWA 4WFFE 1U58B 3B9KB 4HK0B 1BX2B 5GGVY 5MENB 1EO8L 5J9PB 1QFPA 3IDGA 1VFUA 2X4SA 4WNQA 2WWKT 1HILB 4JG0L 4M9OA 2FIKA 2DM2A 2OL3B 5HHMB 4NJAL 1NCAH 2DS4A 3PHQB 4PV9B 4M7KL 3PWJA 4TYUA 4G6KH 5D7SL 5KG9A 2VDKL 2OJEB 3O8XB 4PJ5D 3NPZB 4HBQA 1I3RB 4EIZC 5GRVK 5CGYC 3OR6B 3ARFC 3U7AA 5DQDL 2V2TB 2FSEB 5L2KE 2X44D 4H0IA 3CFDB 2QR0B 2OL3L 4G6FD 1B2WH 3GSQB 3FT4B 4UV7L 1JGEA 3GI8H 3HG1A 4LEXL 5GJTL 4RFNB 4A6YH 3QFJD 3QDAA 4LSTH 2XFXA 5IFJB 3VFPA 3BGMA 4I18C 2WBJA 4KV5E 1JPTH 2X4SB 4X5XA 2ZP0T 1DUYA 2I5YH 5A1AA 1NBZB 3MUGB 1YY8A 4CU8A 3KPMB 1ZTXL 1MF2L 1J1OL 4OZIB 4HUNB 3V5KB 4NT6B 5D96B 2R69H 3UBXB 3TWCH 4QWWD 3BZEB 1WZMA 5DD3H 4KMQA 3CDGA 4LCYA 5F96L 4ELMA 4FQQA 2GYSA 1A2YB 3ARBC 2Q3AA 3L6FA 4ZUUA 1QLRB 1D5MB 4PRPD 3ZKMD 3B4NA 2R23A 3GI9L 4XAWL 2XQYG 2VXTL 3IB4A 4QNPF 3ORJA 5EWIH 5BS0E 5JOFB 4HFUH 3JV6A 1U42A 5F72S 3HMWH 4ZUWA 5CP7B 2P8LB 1OAQL 5GGQH 3LEVL 4WUUE 2I9LB 2BNUA 4WCYH 4JDTL 4JO4L 4ZYKA 4PLKD 3VWJB 3TT3H 1I9EA 1X5XA 2VLRA 4NRYA 1EXUA 1UJ3A 4AEFA 2QV2A 1NJ9A 5ILTL 2PW2B 1H3UA 1MAKA 2XZZA 4HIHB 2VO5A 4H5SA 3M17A 4J2XA 5JIHA 5JPNA 4B7LA 2K7QA 1XF2A 1AXTL 5EUKB 3SJVA 2GHWB 5EOCH 3WE6B 3EOTH 1J0JA 4NRXB 1JZ7A 1A4KB 3PABB 2WUCL 1Y18B 1QEWA 3O11A 5ID0A 4KZEL 5DLMH 4EBQH 1KENH 3MCG1 2VDPH 3FJTA 2AJVL 2DKMA 3W0WA 2GUOB 5J4MA 3VRIB 3ROLA 5C0RH 4KJPD 2R1XA 4OCXL 4ZS6D 1YEGL 1WISA 3I02A 2X41A 3RY6C 8CGTA 4HUXB 1JRHL 4FQIH 4YIQA 2ZOKA 4YHKH 1RUML 3RDTB 2ICEB 4FQHA 2VDPL 3MO1A 4OLUL 1OAZH 2APWA 1QSEA 1DQJB 1J1PH 1T1YB 3MRNB 4J3OC 5ERWA 4N0UA 3GMPB 1CGXA 1D3CA 5M7QA 3DRQA 3LOWA 1YEEL 2HN7B 4NOBA 3OG6B 3I3BA 4OGZA 4PJBE 3FCTB 5DD5L 5CZKA 3PQYD 2E9WA 5BW7C 2B5IB 4M6OH 4Z76A 4QRTB 1B6DA 3QWQB 4DUXA 1VACA 5KVMC 4R4NC 5CJ8A 3WN5A 4WUUD 2JCCB 2YEZA 3BYTA 3T3ME 4JGMA 4K8RC 2YD3A 4UNTA 1DBJL 1R5IB 3TT3L 1H5BC 3QG7H 3QUYB 1I9JH 4WEUD 2R0KL 5F9OL 2WP3T 1ADQH 2Y36H 3MA9L 1UB6A 4OZIF 1AE6H 4GW1A 5SX5K 4OAWB 4ZFOB 3RI5F 4GKSA 4HBCH 1DN0A 2Y06H 2WBJC 2VISA 1JK8B 1MRCH 2W1NA 3MV9E 4PJ9B 3TPUA 2QQQA 3QDGA 3FT2A 2G5BA 1KGCD 5JDJA 5F7UA 3GI9H 1UJTA 4FXGA 1N5YH 2R9HC 5FUCC 4L4VD 3VFMA 1GCFA 3P4NA 3NIFE 3WFHA 1CFTA 1UENA 5EUOE 3ARFA 3B8SA 2N4IA 2E6PA 3DVGA 3CCHA 1OARL 1ES0A 5I8OL 2JJTC 2NXZD 4OCLC 5I1KL 3HKFA 4JKPL 3VFSA 4ZUVA 3FB8A 5CD5C 4NM8L 2CKNA 5E2UH 2AK4D 5J6GB 4O51A 1GZPB 2XWBA 1J88A 3H3BC 4HSQA 4ODTH 4OUUB 3AS0A 1FP5A 1Q9KA 1CXFA 4OQTA 5GSVB 3SKMA 5JQ6L 5I8OH 3JWOL 1AQDA 1UWGL 3K7UA 2CK2A 4JDZA 2VQUA 4A6YL 1ZANL 4J8RA 3MCLL 4LEXH 2OZ4A 2BX5A 3X13B 3VFPB 3BZDA 2YK1L 3OHXA 4PB9H 4MJ5A 1ZVSB 5HGHA 1C12A 4NWTH 2HMID 2JJUA 1HIMH 4X0KB 4K7PY 2MSPA 1S9VA 2IANE 3BKMH 1OP5H 2I9TB 3EAKA 1BJ1H 2Q7YA 1YYMH 5GGRY 5CGYD 4PREB 4A6YB 4OZIE 4X9BA 2R0LH 1HSAA 4RZCB 2GSIA 2I24N 4OCWH 1RIHL 3VXTA 1A0QH 2Y07L 5KG9B 4X99A 2YMXH 5K9JL 5ALBH 2EIDA 2P7TA 4HS8L 1ED3A 3FO2B 5E94A 5MEOB 1YEIH 3VXMD 5DRNB 1OQOA 2QADD 4XCFH 5D7IB 1MFDL 3C8DA 1JWMB 4L4VE 1IAIL 1CE1H 43C9A 5IB3B 5SX4I 2GSGA 2FL5B 1DUZA 5JW4N 1BX2A 5FM4A 3G08A 4HK3J 5IMKB 2X9YA 3BI9X 4RGNC 3SGJA 1LE9A 1FV1B 4PG2A 4FS0A 4QYOA 1JHLH 2J1KA 4MB3A 1H0DB 4LSVL 4WW1A 7FABL 1FSKB 5C0NC 2FB4H 3N06B 2P47B 2NMSA 2VN7A 4NN5B 3MMEA 4FQIL 3D1MC 3ARBD 5IVZB 2VDRH 4N0CC 3TO2A 3H6JA 5CD3B 4OLZL 1AGDB 2BNQB 4BM7A 4FXLA 1S78C 4PLOB 1TZGH 4JRXD 4Z0XA 4OBRA 3MGTA 3ARPA 2R2CA 1AHWC 3EYUH 2AV7B 3GJEA 5HJ3B 4L8DB 1T1ZB 4P5KA 1U3HA 1QRND 4PJ9A 1UZ6F 2Q76B 3IDJB 3SCMB 1PLGH 5ETUB 3CFBB 3ZT5A 3SKOA 4QOKA 2FX9H 2F19L 2AJ3B 5KVFH 3D9AH 5D1ZA 2IQAB 1BVZA 5HYEA 2CXKA 3QHFL 4M1CD 3HHRB 3SN6N 1U3JA 3GSXA 5I0DA 1OTSD 1V5JA 3QDGE 2YEZB 5IJVA 2LAAA 4OTXL 2CJUH 2JKXA 2V5YA 1RZJC 4OCSL 1MI5E 5C0EB 3LIZL 5CILH 4L9DA 4HHAB 3KPNB 2C7UB 3UTZB 1IC7H 4JPKL 5FYJL 1BGXH 1HXYB 4U1JA 1JRHI 4AMKH 5DDHB 4UIMB 5D2LF 2KBGA 1FBIL 1NANH 2VLJE 1UM6H 2CUHA 3TVMB 5HYQA 3S5LG 4Q6IC 1EHLH 2H8PB 3A6BH 4XVTH 4M1DH 3T1WA 4QXGL 1V7NL 3RHWK 4H8WC 3CLFH 4F80A 5K9KA 4LLAA 3SDXB 4ZS6C 3C60B 4NZTL 3TT1H 3VRIA 3EYSL 3FOLB 5I16A 4LEOA 4LIQE 4LQFL 3VWKD 1VFAA 3GHEL 3WEXB 3T77B 3EHBC 4NZDA 5DMGD 2P5WE 1AI1L 5DRZB 1ACYL 3ULUF 1OPGH 1Q0XH 4C55A 1XF5B 2V7HB 3KPSD 1R3HB 4PGDB 5BVJA 2A9ML 1R3JB 5IW6B 1AP2A 4U6TA 1GGIH 3HG1D 4UT9H 2V9RA 2CIKA 3VXRE 2IAMA 3GMNB 4CADA 5IMMA 1XF2B 3VW3L 2HJKA 2VDRL 3IDXL 3WFDH 1KLGB 1GGBL 3MFFA 4S1QH 3V6ZA 5F9WB 4K8RD 5AWNH 3K74B 2P46B 2QSQA 3MRQA 3E6FA 4FQXA 1B2WL 5D1ZB 1OGAA 4HJJL 5I1CH 3OR7A 3SKNA 5IP4A 4MA8L 4I3GA 4N9OB 1T89C 3WIIL 4B53A 1G1CA 3VD9A 2VC2L 2HFGL 3QRGH 4P57B 4OZFB 3L3DB 1GGCH 4NM4L 1VGEH 1RIUH 4C54A 4X7TB 1KB5L 2X89D 4OLWL 4JRXE 4ZUUB 2R9HD 1HKLH 3AFLA 1LHZA 3DHMA 4PRNB 4KHXH 4MHHG 3LPWA 3UYPA 3GBML 4KKCC 5JXAL 4F57L 3DBXA 3QT2A 2R1YA 2EIZB 2QADB 4NM4H 3VXMB 1PX4A 1TQCB 1TNNA 1BVKB 4JFHD 5E94B 1G6VK 1LK2A 3KPPA 3SDYL 4H26A 1I1YA 4Z7QE 5EBMB 3MODH 4X99B 4M7JH 5CEYA 5E6IC 5IBUG 4EXKA 4P5TD 1KTLA 2B2XH 4Y4KA 4XP1L 1S9YA 1FH5L 3CC5B 4Y1AE 4F7TA 3ZKXB 1T0NA 1NUNB 1OT1A 5FFLA 1JGEB 5JQ6H 5IVXA 1TCRA 5GS0D 3PV7A 3IAPA 4WI2A 3T0ED 1HSAB 5F6HI 4OM0L 3FO9B 3EW3B 5ICYA 3O45B 5C08E 2HMIC 3U79A 3MA7B 5FUZH 3RTQD 5I1LB 5LKNA 3P4LA 2WQRA 1P4BH 4WI7A 2BERA 1Z9SA 4HEPG 4M4RA 4MAUH 1ND0B 5B38A 3EFFB 3V7AE 4JFYA 4KKNA 1EFXD 1J5OL 4KQ4H 4RFOH 1C12B 4XMLH 2XZCL 1ZVSA 3NCMA 1WBXA 4F58H 1XGQA 1I85A 4LQFH 4YUEL 3PGCB 3BP4A 1MCEA 5JPMB 1F6AB 1K5NA 3KYKH 4NQTA 1JPSH 3CLFL 2LABA 4ZUVB 5C09E 1A14L 3BDXA 2H9GA 3IRPX 1K8DB 1MCDA 4QHLA 4XNMB 4H0HB 5BV7L 1QQDB 2XWBB 3FQXB 2BVOA 4GKZB 4S1DC 3WHE1 6FABL 1UH2A 3VGDA 1HQRB 4LLQA 4ZDHB 4RGOL 5LXGL 4HMDA 4FTVE 4XPTH 4IOFD 4GMTH 3OAZH 1U41A 2PN5A 1UA6H 5FDWB 3QDGB 5IB1B 4JFEB 4HGWB 3V6FB 4LF3A 3W39A 4Y5XB 2BNRA 5IROA 4IIQC 5BV7B 1T7VA 4L4TB 5E95B 5FYKL 1FYTE 1KJMA 3BIBX 2ZG3A 2AQ2A 4RWHA 2FJGA 2D7OA 2F54D 3Q1SH 2Y6SC 5IBLC 5IIEB 3DVIA 4QT5B 5DUBA 4TNWF 4WWKA 3GMMA 4IIQA 4FQJH 3E0GA 3GDBA 3HZVB 5DK3A 3QYCA 5DQJB 2UY6A 3Q3GA 4CADB 1JRHH 4NO3A 4KXZI 1JNNH 1RIVL 1MUJB 4WFHE 1CL7I 3V4UH 3LKRA 2CDFA 5ISZE 4W4NA 5IKCB 2X10A 5IW6A 1QVOB 3X3FL 3Q5YA 2PO6B 1HHIB 1V3KA 4PRHE 1YZZA 1S9XB 3HA0A 1DQJA 3MLRH 3P0YH 5FA4A 2UUDH 4FQJL 2IGFL 1Q9OB 4RGMC 4IOSD 5DLML 3MLVH 1ETZB 2QKIA 3FRUA 2F58H 4WI3A 1TIUA 3VGFA 1XH3A 1CGSH 1U8KB 4XWGH 1KFAL 1NCBH 3MRNA 5ERWB 3MLYL 3QXAB 5AAWA 3N1GC 3O3EA 4DJMA 2Y9RT 2PTUA 3ZLQC 1MIMH 4G7VL 1RK1A 5I1EH 4I77H 5F6IC 5KOMC 4KROB 4L5FL 5ILTH 3WKNA 4WI6A 1IT9H 1JYVA 4Z5RB 1FN4B 4TRPH 2X5PA 2NX5A 2HTKD 4N90E 5INCB 1D9KA 5FXCH 3UTZA 1OF2A 4X9FA 3VXOA 3U0TA 5C07B 2EO9A 4WJ5B 4XGZA 2BC4B 4TSCL 2O5XH 1KACB 5DYOA 1ZWIB 4NHUB 1Y0LA 5EO0A 2G9HA 4M6AA 4KDTA 2PETA 3IU3A 1P1ZB 1JPSL 1WF5A 3OAYH 2UZIL 1HIML 5EORH 1CT8A 3MGOA 2ZUTA 1UKQA 5JOPE 5MHSD 2VH5H 2FLBT 2ZG1A 1DFBH 2FJGB 3FMGL 4KTDL 1DQQB 3MNVA 4LU5L 2FZ3B 3WS6C 4POZC 4TNVF 5DTFA 4ZUWB 5DD3L 3IDJA 1X4YA 4ETYA 2H45A 3DLQR 3AGVA 2EYRB 1EIBA 3FFDB 2X09A 5I1AA 4UQ2B 1A1OA 4RGNE 4IJ3C 4Z0XB 2A6JB 1I3UA 3I3EA 1KIPB 2F8VA 3T2NL 3SGDH 4HUWB 2DKSA 1QSFA 3RY4A 4UB0L 4PTTA 4OM0H 2NW2A 2FR4B 1E27A 2B4CL 1IGJB 2M26A 2YXMA 3H0TB 4F7MB 4XPFL 2FX8L 5T3XH 3QQ9D 1NGYA 1WTLA 3ULVC 2H1PH 1QLRA 1T3FB 3NTCH 3ZHKA 3L3HA 1XR9B 3DMMB 3T4YA 2QSVA 3B6SB 1HCFX 3RZCA 3D0VA 3JBG7 3RPIA 3JSSA 3DARA 4XCNB 3IDIA 5H2BB 5FECA 5T1KB 4E41D 4UINH 5L7XL 4C59B 5EOCJ 5I19H 5IFAL 1GVIA 3PGCA 1NCWH 2ZSWA 3BKCL 4G5ZH 3QUKB 4YAQB 1H3TA 2CMRL 2C3VA 3D69A 1NGWA 2AEWA 5IB4B 4PIRF 3BW9B 2GIYA 4KU1A 5DUMH 1UCTA 5B4MD 4F33A 3NIDF 1NMBH 3M1BB 5F9OH 1ORSB 2E8YA 4OQTL 4AT6A 1IBGH 5TJWK 1OSZB 1FQ9C 1Y6KR 2YD5A 5A40E 1CFSB 5HYFA 4NYLB 3TLRA 1BBJB 1SM3H 3O8XD 5E00B 5DHVH 2QR0A 3T0EC 1BBJA 3AY4C 4JFPB 1EHNA 4OT1L 3D18A 1XZ0A 2BFVH 3U7WH 3RTQC 4NP4H 4UQ3B 4KWUA 4Y4KB 2PF6A 2YRLA 1I3RA 3EO1B 5F71A 1EBAA 3CDYA 5HI3C 3VFRB 3QWRA 3JTSB 5KSAC 4ALAL 3KWWB 3R4DA 3UYRH 4FNLL 4PJ5E 3IDIB 5H2BA 2IC2A 5AWNL 1IC4L 2ZSWB 4P59L 1KPUB 3BAEL 3UJIL 4JHAH 3TEUA 3VW3H 3FQNB 1MVFA 3DBXB 4P23D 3RUGB 5I1DB 1Q9WB 1PAMA 4NQSB 1SYSA 4JFDD 4J3SA 3U6RA 4KI5F 5IR1B 1FYTB 3I3DA 3TJHD 4F3FB 2A9MH 4P2RE 3E3QC 2BOCB 3MBXH 1IGFH 4X4XA 1NLDH 2ED9A 2W0PA 3MQIA 3ECBA 1WFTA 4CMHC 2OI9B 2DQEL 1BZ7A 1QP1A 2M1KA 4NQDB 1ZA3A 4CVWA 2F54A 1SY6H 2JIXB 4K7FA 4IDJL 2LV4A 3UZQA 2X4NB 4J1UB 2NY0C 3MOBL 1ROWA 4IRJC 4G6ML 3NBNA 3MRQB 3JTTA 4Z95H 1DN0B 4APQC 3VH8B 1Z6JT 1NANI 1XCQA 5EU3A 2H2PC 3VFGH 2Y6SD 5IBLD 4K7PL 1YC8A 5C0BA 5JLZA 1KBGH 3RQ3A 1I9IH 1D9KB 3EOYG 3UXFA 5HBBA 3TBYB 3GMRB 3D5OF 2XQBL 3QR2A 1B88A 5KW9L 4NNYB 3OF6A 4QEGA 2VXTH 3VCLA 4WW2C 2VLRD 1EO5A 2DN7A 4HXAH 4Y2DB 2EICA 1DBKH 4U6XA 3BEWA 1LO4H 4JAMB 3F8UB 5TF0A 4BZ1L 2HN7A 3HE6D 4NSKA 3K4ZA 5HXMA 2UYLA 4A2MA 4WDIA 2NX5B 4YXKL 1T6VN 2ILLA 4GAJH 3CMOH 4HS3A 3X3GH 4HT1L 1G7LB 3FQWA 3TF7C 3QEGL 3G04A 4MJ2A 1A9BA 1DQDH 4TUOA 1T4KA 4ZUTB 4R8WH 3MV8E 4QHKI 3DETC 4K94C 4Y5VC 4DVRH 5D8JH 4KQ3H 1H15A 1QFWI 3ZDXF 4GT7A 3U4BH 1P7QB 3QXAA 3LKOB 15C8L 4XBGA 5ITBL 1IQWL 4ZTPH 5FGSA 1OWRM 3OKLB 5TH2A 4JRYB 4KHTH 4TNVK 4OD1H 3LDBC 2W9EH 4ONGH 5D1XB 4LGPB 4M8VA 1S9XA 2P1YA 3B8YA 4KUCD 2I27N 3HMXA 2XZQH 2I07A 3QULB 4K9EC 3GMMB 4YDKL 4DCQB 4FQCH 4MXWL 5EN2B 5HY9B 1RJYA 2VQTA 1S5HA 3TO4D 4NO3B 1S8DB 4RGNB 5DJAA 3QA3A 1VGKA 5HDQH 4R4FH 2VKWA 3RU8L 3ZKQD 2V6HA 4U3HA 5F3BB 3ROOA 4MD5B 5ESAB 3KS0J 3G9VA 1XF3B 3IXAA 4CMMA 1MHHA 2BDNL 4L8DA 3QNYB 3D3VD 3PWUB 1WVZA 2H26A 5HGBB 2YPLD 4HAFA 4ESKA 5TFSH 3V6OA 1CDCA 1RUPL 3CXHJ 1F8TL 4ZXBD 4PJGF 2H32B 3WD5H 4NC2B 1A7RL 2Y5EA 1Q8MA 4PLJC 3GB7A 1YDPA 3WO4C 1H0DA 1E6JL 3RWEB 1MH5A 2H9GB 4O9HH 4K3DL 1ONQA 3QIBC 4YR6B 3VXRB 4M8QA 3CFCL 2WK2A 1NFKA 5GZNC 2ZKHL 2BVOB 3T3MF 3JWDL 3LEYH 3IRZA 1GL4B 2A6KA 4MDJB 4FFYH 3N1MC 3HPLB 1G9EA 1P69B 1DCLA 2DQUH 5C3LD 2Q1EA 3NIGF 4LSRL 5H35A 2AJUH 4U0QB 1JNHA 2J8HA 1EZVX 4Z9KB 1EZVY 1H3PL 3BDYH 2OCFD 4JFYB 1D9KC 2VAAA 2NXYC 4JFFD 5DUPH 5KTEL 1R3LB 4JG1L 3HE6A 5FO9A 4ZNEA 1VEPA 4Y89A 3H9SE 3QFDA 2CLRA 1MFEL 1ZVYA 4DFHA 1JF5A 1H8SA 4PREA 3WN5C 1QLFB 3MLWL 4S10A 3M8OH 2GK2A 3PWLA 3U7YL 4LMQE 1CTOA 3K2UL 4P3DA 3SJVE 1TCMA 3OR6A 1O7VA 4X80L 3X11A 3NIDE 1CE6A 5FKAA 5C09B 4DUVA 3DX8A 3CH1A 3O8XC 5DJYA 3ARDA 5CEYB 1WIUA 3ARSA 4QXGH 1INEL 1JZ6A 1BBDH 1DVFA 5E8PA 1RJZA 5I66A 3HI5H 1UM6L 1RMFH 5CWSB 2K3TA 2DWEB 3KPRB 1XGRA 1JGDB 3MA9H 2WLZA 5EH1A 1JUFB 1Q72H 4HIXL 3VFWA 1L6XA 4KRLB 3QQ3A 5EZLB 3FQRB 2DWDA 1OAYL 5E6ZA 3K80A 1A6ZB 2CUIA 2Z4QA 4ONFL 1QFHA 3PDOB 3O4LB 4NQDE 2B1AL 3NPSB 1XIWD 4P23C 4WWKC 4YWGL 2FECL 3ZDYF 3MYJA 4P4RA 4O5LH 3QZWB 1M7DA 3OKNA 5HDBE 2R29L 3LSOB 3ES6B 1SJEA 1FZMB 5C08D 4JO3H 1JF1A 1F45A 3DUHA 3GIVA 3OKDB 4F7PB 3S8WA 4OLYH 5TQ0L 4UOW0 1CFQA 5BRZD 2VISB 5C8JB 4X7DC 3IFOB 3TCLA 2VAAB 2NY0D 4QHMB 2ZSVA 1BJMA 2ICWJ 3QDJA 4APQD 4PY7B 2DQDH 1L4IA 4FQPA 4KKLD 4LSVH 5I1IL 1KLGA 2H2PD 1MCCA 4E42B 1T0PB 4G8GD 3N85L 5F89B 3OV6A 3RY5A 4RNRA 1A64A 1NAMB 1KCRL 3QWRD 1AGFB 1VFAB 5IQ9B 3OKLA 3STBA 1I85C 3ARGD 4BFEA 1L0XA 4XVJH 1RY7B 5IW3A 3C60A 2GCYB 3FZUD 3QUZB 2NY4D 3S5LB 3FFCD 3RAJH 5AUMB 2L7UA 4GBXD 3HE6C 3QI9C 4PYHA 1H15B 5DD1H 3B9VA 4Y1AA 1WCBB 2VR4A 1A0QL 2PYEA 5LXGH 4OCWL 5T1MA 5ESQB 3SDDA 5IV2A 3CFKA 1VPOL 4KMLB 4LDEB 2NY7L 4MCYA 4NUJB 1FL6A 2AEIT 3DETD 2UVEA 1UH4A 3UTOA 4JO2L 3R0NA 2EZ0D 2ITDB 4WHCA 1D6EB 1P4LA 2EDEA 1CGWA 3IKCB 5IMLA 3WDHA 1HINH 3S35X 4KJWC 1IGTA 1ITCA 3U48A 4ZQKB 2F5BH 4JGUA 2B0SL 1XGPB 4X6DF 1XF4B 3S3SA 2I5YL 3RKPA 2YKLH 5T3ZL 4HLZH 1KJ2A 5SV3A 1RHHB 2EIEA 1NSNH 1U95B 4JQVC 4IDLA 1FGVH 2YUVA 2AJ3A 1FL3A 4QRPD 1AGDA 4S1SL 3CFBA 1JI2A 2W92A 4NOFA 1FG2A 2GTWB 3RL2B 3HZYB 4HZLB 5J1AB 2BVQB 1V8HA 2GTZA 4Z7OF 1CR9H 4FZEL 2Y7QB 4HPOH 4Y5YA 5AZ2H 3BH8B 4C83A 1DQTA 1E6JH 2AJXH 3DNKA 5LJYH 1D5MA 4WDIB 4QRPE 3L6FB 4FXKB 3U9UA 3ULUD 5IVZA 1WJ3A 4AL8H 4F9LA 5EO9A 1F8TH 4LCYB 4QF1A 5FO8A 4Q9BA 2OR8A 3GO1L 3WFBL 4FABH 1TJHL 5I1DA 2NCMA 4G6JL 2XRAL 5E4EB 5A3ID 5D2LB 1TETH 3QIBD 5IOPB 1RUKL 2IAMC 2VDML 3VXSA 5A2FA 1HKLL 1U2HA 2UWEE 5GZND 4K3DH 1SJXA 2W0KA 4PBVC 4ZAKB 1XCQB 2DAVA 2AKRB 4JN2A 3KJ6L 1I1RA 3SDAA 1UWXH 3QAZB 4QHUB 2J2ZA 4POUB 1FLTX 2X4NA 2HKHH 4G8FB 2NXYD 1S9VB 2FECI 3MLZL 1T7XA 1UG9A 1QBBA 2P5EE 1OGTA 2A1WL 5T5FL 4I9WD 5FO9B 2OM5A 2RIKA 3ARQA 4NQCE 4K55A 4MSWB 1MI5A 3HLAB 4WHYG 1D5ZB 2ZCHL 2GITA 1NGWB 1CDJA 1G9NH 1CG9A 1AXSA 4L8SC 4MX7B 4DN4L 2FIKB 2OL3A 3AMLA 4PGBA 3GSNB 3F5WA 3I50H 1DL7L 5K9OA 3RFZC 1L9NA 2XOTA 3QJFA 5KN5A 3G6DH 1T66D 1A6UL 4M8QB 1ULVA 1DDHB 1ONQB 3MOQA 1YEDA 3BD4A 2DYPB 3EOTL 1Q94A 4YHNB 1FZJA 5TDNA 2D03H 2SEBB 1UCBH 2KUTA 1XGUB 3A6BL 4XVTL 3B3IB 4PBWD 4Y4FA 3C5ZB 3O9WB 4PS4L 4GRWH 4XRCB 4TUJA 3LS5H 4BH7A 1DQDL 3FO0L 2A6DA 4Z7WE 3PNWA 2FO1A 1A1OB 4KUCF 3FFDA 1NBVL 4HPYH 5I9QB 1A6VH 1HCVA 5E2WL 5D72H 2MJWA 2Y4SA 5IEKB 4QRRE 3X12A 3BKJL 5JW3H 5HHOA 2EIBA 2PYFB 3QEHA 3L3GA 3SGEH 4QHUA 4ZD3L 5KSBF 2XQBH 2YUZA 3BWUC 2BSRB 1BFVH 1IE5A 3TV3L 4OAWA 4Z18A 3VG0H 1EGJA 3OXRB 4MA3B 1A6VL 4EI6A 5E9DD 5F7HA 1WBZA 5ADOL 5KVFL 5F96H 3B6SA 1OAKL 4QTIH 4KKLC 3MV8B 2BRRH 2OSLA 4E9LA 4NZUH 3WN5B 3OKOA 4MJ6B 3RGVA 1NEZB 5GS0H 2AAVA 4YDVB 5KZCB 2ZOKB 4HW6A 3ZE0F 1LDSA 4FFWC 2A73B 3ARGC 4RAVB 3BEVB 3LKQB 2VLME 2R1XB 2KDGA 2DQGH 5IGXH 5GSRB 3N9GH 3BH8A 4C83B 3OZ9H 1AIFA 3D85B 1TQCC 1W72L 3QCTL 1C1EL 4YIQB 3GUTB 1I1AA 3QFJA 2WZPD 2H41A 1IRAY 1KULA 5HPOA 1S9KC 4BA8A 2O26U 3QUML 5F70A 4NRXA 3V0AC 3CK0L 2BNRE 3N1PC 4LK4A 5KS9E 1O0VA 1X7QB 2CRYA 3C08L 4G6AD 4MCZB 1MWAB 4G6KL 4YBLB 2EZ0C 4YHOL 2DBLL 4KK5D 4PJ5A 2GJZB 2XPGA 4OFPA 1L6ZA 1W0YT 4WY7L 5T5FH 4FQ1H 3CX5K 4JG0H 3TYFA 3VXOB 4UMGA 3UYRL 2GJ6B 1ZGLA 3KHOA 2NX5E 1GPOL 4LCWD 2ICWB 1BZQK 4WWKB 5D1ZC 4Z5RA 2ESVD 2VYRE 2BFVL 4HK3N 2JJTA 2EEAA 3EYFA 1KJMB 2YPLA 5GIRA 3O6FC 4HC1A 5ITFB 4J3TA 2GK0B 5AZ2L 2VDNL 1JWSA 4Q9CA 2WV3A 1FO0A 1G0DA 4BH8B 3ARED 1OB1B 4RMUA 2ITCB 4RCAA 1C08B 1FYTA 1TZIA 2QSCL 4MD4A 1NUFA 4LP4A 5J11C 3BKCH 3PE9A 1HHIA 2NTSP 5KSAA 1T5XA 1XGTB 4HCRH 1NCDH 5E5MB 3ULUC 4UILL 3QQNA 3PIQA 5CEZH 3UAJD 2FX7L 2HKFL 5BVPL 1AGFA 2VDOH 4JFXB 5MEPB 1B90A 3LKSA 5F7EH 1GAFL 2I25N 3QJFB 5IBTH 3T0EA 1IL1B 5F89A 2AJSL 4DGIL 1TTFA 5CEXA 3EUUA 1K85A 3KLDA 5DI8A 4UQ3A 4XPFH 3TH2T 1SY6A 1KC5L 4H8WH 2RR3A 2ZSVB 2GT9A 3S36H 1MSPA 1IM9B 1RUAL 3EYQC 4OCYH 3QIWB 1YY9D 2EDBA 5E00A 1HH9B 3T2NH 1FLRH 3BGMB 3ZTNH 1U8OA 1GIGH 3C6SA 2K9UA 3KS0H 3D3VE 4XWOC 4RDQG 1Q1JL 1ORSA 2J6EH 4HGWA 1HOCB 5K59F 2DM4A 2N7AA 3SCMC 2UWEF 4MQTB 5D9SB 3L7FA 2C3VB 2W0FA 3RZCC 3EDDA 1AHWB 3IETA 3T2QA 3UO1H 4R96B 5T1LA 1BM3H 4L3CA 5D2LE 4P9HH 3L3JB 3RNKA 3PL6D 2XZAH 2DTSA 4MNHA 3SBWA 4WIQA 5IT2H 2CIIA 4K8RH 5IMOB 1DE4B 3UJJH 5C2UB 5JIKA 5CBEA 3DX7B 3DUSB 3BP6B 5GZOC 3EFDL 3RVTC 2OP4H 5KN5B 1CLCA 1J1XL 5EIVA 3BH9B 4RAUB 2R0WL 1T66C 4YBQD 3WV0A 4JZJA 1KJ3H 4JN1H 4KI5C 1E28B 3K81A 4PRNA 5E2TH 2UZXB 1KN4L 2HT2D 3IDMA 5L2KA 4LSSH 1KIPA 2V5SA 4ODHL 4P2QE 1SEBA 4LARL 5EBLA 5C0RL 4I5BA 2X4QB 5TDPA 2ZCKL 3LKNA 1LEKA 3S96A 4YHLL 2IPKB 3RL2A 5GRUH 2JB5L 1JPGB 4PG9B 4QHKJ 4EBQL 1YEKH 4KDTC 4F37K 5D1XC 3ULSB 1LO0H 2DL9A 4LSQL 4WTXA 1NKRA 1YJDH 4MXQD 4XHJC 4ZFGL 5ANMB 4JRWA 2XWJA 2NLJB 2XICA 3GIZL 2DMBA 2GI7A 1S7UA 4FQXB 3OXSA 1MLBA 2VB5A 3VDCA 5DFTA 4P4KB 4LSPL 5FOBA 4NQED 5IESH 1CIDA 4J7RA 3HFML 3IJYA 3S88H 2AXFA 1N5AB 1RIVH 1CZ8L 1MHEB 4DZBA 3N1FC 4NZRL 2DRUA 2VMFA 3DO7A 4KZDL 4HKBA 4DOHB 3FRPA 5GGUB 1QNZH 3DV4A 2BSSB 2UZYB 1XCTB 4NNXB 4M7ZC 3MJ7B 4M9PA 3GSRB 3WUWB 5DJDA 4I18A 1AO7A 5C6PB 2HVJA 1KJ2L 1G7JB 4O4YL 1ZSDB 1S5IL 4MA7L 5I16B 3E2HB 4X7TA 2XWTB 5FYKE 1MNUL 1E4XL 1P2CB 4OD2B 4YXLL 3GZKA 1ZHLB 5CZVL 3RY6A 3MGAA 3ULVF 1D6VL 4G7YL 5HPMB 3B9DA 1GXEA 3CXDH 4EUPB 4HIXH 1J8HB 4KUZL 1BIIB 5HGBA 4M48H 3MRRB 3O6FA 5D1QB 3RWDB 4WFHD 1A6PA 2HG5B 3CFJA 4OD3H 2XACC 5MEQB 4NN7B 4W81A 3ROOB 1P4IH 3FB6B 2O5ZH 4OCRH 3V6BR 3V6OC 4AYFA 3H8NA 2NQCA 1FLRL 2B1HL 4XBEH 3BP7B 1T0MB 2XTJE 4KI1A 1EJ6A 2NY1B 1MFBL 2X4RA 3VA2C 4D9LH 3KYKL 4WVRA 5DC9B 4DVBB 1QYGL 4I13B 1TQBB 4K3JL 3VXUD 3DO3A 1S7SB 1X44A 1H5BB 4KJQC 4NWUH 5C3TA 1MHCB 1G7HA 1CFVH 5SX5H 1MWAH 1UT9A 3HE7A 1LO3H 4G8EB 4LVEA 4WI5A 3VFUA 5FUCE 5ACZB 5KSVB 3SCMA 1FL6B 4NO0D 5KVEL 2ZPKL 1T2QL 3S34L 2YSSB 4ONHB 2VLKD 4CNIA 2DJSA 4HKJB 5C9JA 2RGSA 3BOVA 4PJ7F 4Y19B 1JP5A 2AEQL 2R2BB 1JHKL 1WBYA 1JNLL 4WGWB 3VD4A 5IHZB 4MQSB 1NLBL 3KPRE 3AREC 3J8F7 4LVHB 1CFNB 1G7LA 5BQ7B 1KB5H 5LWYH 1QFOA 5FYKD 1RIUL 2F53D 5EU7E 3W5NA 3H9SD 4KKBD 2GY7B 4N0FB 2W91A 1A3LH 5J12C 1JHTA 2XXCB 4K3GA 4TSAL 2VLJB 3LHPL 5IHUL 2AQ1A 3QIUB 2XZQL 4FRWA 4AEIL 4M1GH 1PG7H 4Q0XL 5F1OB 5KSUA 4U1GC 2GAZA 2R2EA 3A6CL 2VLRE 4X9GA 1K3ZA 2VSDA 2X9XA 4XNZB 2EDYA 5GGVL 2M8XA 2XN9E 1RJZB 2WAHA 3RWGA 5EU4A 1INDL 4PGCB 2NY5H 5I1LA 3C9NB 3GMLA 4XP6L 2VDQL 2QSTA 1S3KH 1NMAL 4PJCE 3U4BL 1PQZB 3ALWA 5DMKA 3EYQD 4JZNB 5GGTH 4Z7OE 3QCUH 1YY9C 2EECA 2CLZB 3OGCA 4BSJA 1FIGL 5BMFH 4XNYL 5HD8D 4BSVA 2IQ9H 4Y4HD 4D3CH 2X6MA 5L9DL 3CC5A 4XWOD 3V9FA 4NQXA 4P48A 2X1WL 2R39A 3U1SL 4O58L 4QRSB 4CUCA 4RFEB 4N68A 4OZ4A 1SEBB 4TTDD 1I1YB 5BCAA 1I3VA 1S7XA 4DTGL 1DQMH 3TH4T 4LDLB 1T1XA 1Y6NR 4XB8A 1FRGL 3BGFB 1PZ5A 3X17A 3PL6C 3IF1A 3SO3B 4MXVF 5KW9H 4P3CL 2EIZA 4IJ3B 43C9B 3REWB 1EO7A 2E5EA 2B20A 2CIIB 4MNHB 2X4OA 2M2DA 1Q0XL 1ORQB 3MSPA 4NKDA 1AHWA 1U8QB 5DD6B 3IS1X 1CDBA 4X4MA 5D7LD 5SWSE 4JPVL 4J23A 1CDGA 4TPRL 3L3DA 4MNGB 4N8VA 4GRLB 2FBOJ 2H32A 3GKZA 3WSQH 4LIQL 4YGVB 3L3OB 3STLA 5CKAA 4GG6A 1BD2A 2EE2A 1IAIM 4OLEA 1AD9B 1K8IB 4M1DL 1S5IH 1E6OL 1KCLA 4XC1H 1W0WA 3AUVA 3V5DA 1UQSB 3E6FB 3TA3A 1RZ7H 1XF3A 3KXFB 2R15A 4IEFB 5IF0A 3VFGL 4DKAA 3BSZH 5EU5B 4PY8J 1T1WA 1MCOL 5H35B 1NC2B 1JN6B 4NGHL 1NGPL 4DK3A 3JVGA 3WCYA 5EU6D 2L7JA 5DURB 1F6FB 4W6WB 2CJUL 3P9LB 3UTTB 1XGTA 1KT2A 4Z7UA 2X05A 4NKOB 2D03L 1GZPA 1RU9L 4P46A 2WW8A 5KSBA 3AXLB 2IADB 4N0FA 3KPLA 4XCNA 2Z92A 2VZUA 2DI8A 5FECB 3ZT6A 1YNTB 3KLHC 5FOJA 1FNGA 3VFSB 2C3WA 1YEHL 1FAIL 4GOSA 4KTYA 3PGFH 2Y1VA 2G75B 1S7WA 3QH3B 1WAAE 3FOMB 4NKMB 3GFUA 3LRSB 2DLIA 1KTRL 2GFBA 1NBQA 1IILE 1T21B 4Y5YC 1A21A 1E27B 2C5DC 2R2BA 3RPKA 4V2CB 1NH6A 2H8PA 1NEUA 3QPQD 3WUZA 2F74A 4HJGA 2GEEA 3SJVD 5DQ9B 5E2TL 1A9BB 4HKJA 2CKBH 1OCWL 2IMMA 4PGJA 5FYLH 4IRJA 5EIIA 3ARVA 5EBGA 5GGVH 4DFIA 5HYJA 4R97C 1NDMB 4J4PC 3QCVL 2R0LL 2WANA 3RP1A 1KOAA 1FNHA 2J6EA 5ID0B 4JE4B 5DEGA 4X4YB 1GHFH 3LH2L 1S7SA 3MRLB 2FWOA 1I7RB 1ZWIA 4NHUA 1MCPL 5AYUH 4MAYC 1MAML 3FCTA 4L9LB 4FMKA 3VGHA 2X7LA 1G6RL 1KPVB 1NCCH 4HG4J 4P9HC 2Z8RA 3BQUB 1MJ8L 5EZOH 5E8OA 1OHQA 2BNUB 2I9LA 4MDIA 1VA9A 1MCJA 1A7QL 3GRWL 3WJJA 4HUXA 4X6EA 3MRKB 1HHJA 5T3XD 4P9MH 3QPXH 2PR4L 4CDGC 3EGSA 5J13B 3GK8H 5ICXB 1N4XH 2XIDA 2VKXA 4WW1B 4EOWL 2R23B 3O4OC 1U8KA 3LQAH 2E27L 3LQAL 1DFBL 1HEZB 5I74C 2DDQH 3T0BA 3NIGE 1N5YL 2B4CH 2LU3A 3LDBB 1F2QA 5KSBB 1JWMA 4ODTL 3EYVA 4H1LB 3WIFA 1MRFH 3DO7B 4U1NA 2FEEL 3U0PB 4KKBC 5IKCA 2HT3C 3LKRB 3C8KA 3RWHB 2R4SL 4F9LC 4X5XB 1QRKA 1X5ZA 1GOFA 2PW2A 1T04B 1J8HE 4FFVC 4JJ5B 4KH2A 4PJXF 2HJLB 1G6RH 4ZYKB 3DURA 2ZOLA 3TFKC 1IM3B 1PW3A 1RZKL 3D18B 4D9QE 2FHFA 4HFWB 1MNUH 2ZUXA 4G3YL 4EQ2A 4U4BA 3O2DL 2HRLA 12E8H 4N8PA 1AD9A 3SPVA 4I3RH 5F1KC 2O5XL 5C0BD 4JQVA 3PNWB 2A74B 3MV9D 4X6CE 3JUYA 1MJ7L 3D6GA 4X6DA 1RZ8B 2AXGA 2HWZL 5EFIB 1AQDB 3FN3A 2Z31C 3PXJA 3NABL 4XMPH 5D7KD 5GSVA 2EC9U 3GSVA 3KYNA 4N0RA 5I76A 1AKJB 3QG7L 4YHZL 1Q9WA 1PBYA 5DK2B 1QQDA 1SBSH 5J0BA 3S88L 3IYLW 4PGBB 1R24A 4N5ED 3GM0A 3QEQA 3V4UL 3D0VB 3RPIB 1WIPA 3RWIA 4XC3H 1TVBB 3GJFA 1DUYB 4WO4A 3BP4B 2P5WA 3TN0C 1NGYB 5J57B 1ZVHA 1FZKA 3P4NB 1P84K 4L3CB 1EJOH 3TGXA 3C8HA 3VFMB 3V8OA 4NJ9H 1U0QA 1NDGA 4RMWA 3X14A 5C0FA 2D9CA 4UU9A 3SDDC 5KAQG 2VTFA 4NO2B 4DZ8A 2BHUA 5FHAL 3W5MA 2GQHA 3HLAA 5EZIH 1BFOA 4NYLA 4WRLA 3GMOB 1IM3A 5AEAA 2IFFL 3I6GA 2FHCA 2X4PB 3DYPA 3MFGB 5HGAB 4PJ7B 3KPOA 1CK0L 3CLEL 5C92A 5HHOD 1O7SA 4PJBB 2WBWB 4MQXC 4OGAD 1LILA 1YNKL 4U33A 2IPTL 4RISL 1KCKA 2VL5B 2W60B 4PJIF 4C56B 2OP4L 4LMQI 3MRCB 2GKIA 5B3NA 3IJSB 4OBSA 1LEIB 3TV3H 1XF1A 3O6KH 4S0SD 5HHXL 3RZCB 5IT2L 2BY1A 4JFXA 5MEPA 2LTQB 4Y4FD 2FNBA 4QRRA 4KVNL 4FXKA 3U9UB 1FFPB 1CICB 1MJJB 5DT1H 5IW1A 2AK4A 1PG7X 4GH7B 4YEEA 4DN3L 3NAAH 1UACL 3KLSA 2R4RL 2J6EL 5HHQB 1WC7B 1RK1B 1YUHA 3B43A 5FUOL 2Z31A 1JGUH 2FHBA 3EIFA 1U8LA 3BPOB 2GUOA 1U3HD 4Q74A 1FRGH 1J9CT 3L3KA 1DLHB 4HKZB 3U30B 4FN0A 4LPYA 1HHJB 1X9QA 4X6EB 1U8IB 5HSFA 4CW1A 1MELA 3UROR 1R5VA 5DZLA 4LCIH 2DM3A 5EULV 1FH5H 5IVXE 3DX6A 2V2WB 1BQHB 3CPLB 4Z7WA 3ZO0A 3CZFA 2NY5C 3BESR 1N59B 2K7PA 3BPLB 2V17H 3BFOA 5CIPB 4P2RB 1OTTD 3KNBA 1P4LB 3VDBA 2YPVH 3S35H 4LFHD 5DJ2A 1BMGA 5L8LB 2VDQH 3ELAT 1UZ8A 3MLXH 4HWBH 5HYJB 3NACL 4IS6A 3EOBB 5EZOL 1LP9B 1IEHA 3SGKA 4EKXA 4NBZB 3QDMB 3O9WC 4K71B 2Z9TA 3O6FB 1I1AB 2EYSB 5J6HA 1SVZA 4WU5A 3QISA 4UV4H 3WNNA 1G0XA 4H20H 3QRGL 2Q87A 4AM0B 4WHDA 2EKJA 1FGNH 1QACA 3UTPE 6CGTA 3RX8A 1EGJL 3QDME 3FHQA 5SWSA 3VXSD 1BOYA 2VDKH 4KC3B 4FTVA 3F65A 3PQYA 5FCSH 1CXHA 1UXSA 2ORBH 3C5SA 3MJ6A 5FAAA 5IW1B 1NAKL 1Q38A 3UP1A 4XP4H 4NNPH 4ZMAT 2HFTA 4G80B 1VENA 3VU2A 4CVXA 5SWZE 4RDQF 3ME0A 1ZA6A 4LLMB 2EEBA 4QRPA 3I84A 4Y4KC 1MHEA 4DZBB 3Q3GB 5F7WC 4G9DB 5CEZE 2AXFB 4P46B 3RUGE 4HS6B 3Q6GH 1DBBL 1KT2B 3NH7H 4Q2ZB 3DVNA 3VI3F 2F8XC 5E1AA 5CCKH 2AJYH 2FH6A 4OI8A 5GRJH 3FT4A 5C0AA 1W72H 3QCTH 4N0YL 1S9WB 3C6LB 3C2SA 4OLVH 1PSKL 4S1SH 4QOKB 2FDBP 2YD4A 3MV11 3PF2A 4F9PC 4XNUL 1M7DB 3MA7A 3MPCA 4U3CA 1IEAA 1QFWL 5IK3B 1JGLL 4OZGF 1J0YA 3EDKA 3PDOA 1I8LA 1BZ9B 1B4JL 3QWOA 1IGIL 2XA3A 4GS7C 3MJ9L 2AVGA 4R8WL 3VWJC 1MVUA 2X4OB 3P0VH 3FQXA 4K9EH 4MNGA 1A1MB 4JZJB 3QXDA 1CGVA 4JANB 2ERJC 5D7LB 2Z31D 4JPKH 3VXQA 1JGDA 4LLWA 4M6MH 1UH3A 3FQUA 2ADFH 2NY2C 5JR1L 4LLWB 3I2CL 5DK2A 2OR9L 4LLDB 4GAGL 4RX4D 3ARDB 4PG2C 1UM4H 3KPRA 3TIEB 5MP6H 3QFJE 4F15C 5C0CA 2FJHA 5KAQF 3DUUA 5IVXF 2ARJA 4BUGA 1KBGL 1RZ8A 2AXGB 4W68A 1AJ7H 1TMCB 2Q6WB 3FFCA 3G6JE 3FKUS 3MRDB 4WUUA 3F12B 3RGVC 3LV3B 2X1QA 1ZLSH 4ODVH 3NCYP 1FNLA 3FO9A 1ZLWH 2Q8BL 4P3WA 3SDDD 4P3DB 1UCBL 2DQCH 2RJMA 4DGYH 4JFOA 4U6YB 3VFOB 1MAJA 1SY6L 2FLRT 1OGAB 5D7KE 1DQML 5E03A 1FORH 2XTJB 4DTGH 4XZUA 4ODBD 2DIBA 5IVNA 4F7EB 3ZKSD 3NCFB 3QUXD 3HPLA 5JO5B 3K46A 2FATH 4NHCH 5DJ6B 5L88L 3DTXB 4OF5A 2LQRA 3G6AB 3CXHK 1MFAL 5I73B 3RJDA 1K2DB 3T0DA 2NY1C 2A6KB 4MDJA 1G7MA 4NFCA 5FYKU 5I1JH 1M05A 1EHAA 1UYWH 5A16A 3V0WH 3RHWF 3WL9B 2MQ3A 1MCNA 4Y4FC 1IC5L 3GSUB 1FO0L 2VZSA 4CJ1A 1RUQH 2PO6C 5CUSH 1NAKH 1T22B 4ZOAA 3O6ML 1W72B 4F9PA 2XTJD 2B39A 1N8ZA 3P11H 1JFQL 4Z7WF 1UM5L 1B3JA 2FH8A 1CXIA 4B7IA 4ZAKC 1TVHB 1LK3H 2EH8L 4GAGH 1EAPB 2OR9H 2FO4A 3V52H 5J6HB 1DJSA 3OR7B 4Y19A 1XGYH 2LU4A 3HAEA 2AV1A 2G5BB 4XNXL 5GISH 5I75B 3EYFB 1U3HC 3DX9A 2QJDA 2YC1A 4PRAB 1S7QA 3OB0K 1QO3B 1EEYB 3C5JA 5I8EB 3BKYL 5TPWL 4RMQA 5T3ZD 1YECL 4DEPB 4ODWA 1U36A 2QEJA 1FVEB 1Q1JH 4KK9D 3MLXL 4HWBL 4PV8B 4Z7UF 3OMZA 4P2RA 2XKSA 1F2XK 3L95A 3VGBA 2CPCA 5TH2B 1BAFH 2AI0H 1I1CA 5BVJB 1OTTC 2EE3A 1HZHL 1RUAH 2VXSH 5EC1B 3O3BA 3DX6B 3RTQA 1U8PA 4Y5XC 32C2A 2H2SC 2N1KA 4NPYB 4H0GA 1B0WA 4FZEH 4NO5B 4RQQB 3B5GA 3UJTH 4BJLA 4NUJA 1MY5A 2H1PL 3L3KB 3ZYZA 1TZHB 2C1PA 1UWGH 5E9DE 1G9NC 2XWTA 3DSFH 3HAEB 3PWVA 1AD0B 1DANT 3DV6B 4NSKB 2YA1A 1B6UA 4Z7NF 4I18B 3IFNH 5AUMA 3QUMA 3R1GL 4EDWL 3HTLX 2JLLA 2GW5A 43CAB 3C6LD 1YMMD 4R26H 5JHDB 1MJ8H 5GGUA 3TBYA 1OARH 4PJEF 3C2AL 1AY1H 1AO7B 3LD8C 4R7NA 3ILPA 1U8HA 4PJHE 1EEQA 3GSRA 4LU5H 4YPJA 2FGWH 1W8OA 2Z93B 4ZOEA 3WUWA 4LHUD 3K1KC 4UOJA 3RBSA 3ARYA 1FNEB 1RSFA 3PABA 1MCQA 1BVLA 5IB3A 4E42A 4Y16D 3VI4E 2NZ9D 3SE4A 2E9JA 1N3NB 1SYVB 2DD8H 3OXSB 5EUKA 5EOTA 5F7DA 5I73C 1AO7E 1CLZL 4M6NL 2D7NA 5ETUA 1EXUB 1UJ3B 4PGZA 1F00I 4M03A 4P4KD 5HYIA 2X4PA 4L3AA 5HI4C 3WFEH 1EAJA 1DEEA 1WAAF 1RUQL 4RA3A 4Z0BL 3BN9D 4FQXD 3LV3A 4K3EL 4WV1A 2CKBL 4KZDH 4RIRA 2MKLC 1M6OA 1FPTL 3DYOA 3V0VB 1UEMA 1PKQA 5DJCA 4OCXH 2OYPA 3MMEB 3J7HA 4JFQB 3INUL 1F58L 2BOBB 1A7NH 1I1AD 3U6RB 2CGRL 4OGXL 4RAHA 5FKPA 1KFAH 4M43L 4YHNA 4OB5H 3VGAC 1LE9B 3ZDXE 1IAMA 2RCSH 4QXTA 2CKBB 4UT7L 2YD7A 2FL5A 4XPGH 4KHTL 2GSGB 2VXVH 4LLDA 4PD4K 1MFNA 4OF6A 3REWA 4X7FC 2QLVB 4LFHG 1A02N 1KXVC 5H8DA 3FAXA 4PPTA 5D7IE 1E4KC 2HLAB 4DKFH 1RFDH 3MUGA 1NBZA 2YBRA 4JO1H 4FG6C 1S7XB 4LSSL 1BZ9A 3QWOB 1JL8A 1MHPH 4P0DA 5DO2C 5EFIA 4QCIA 3VXTB 4ODVL 5B38G 3TA3D 5LGHH 3BSZL 1QA9A 3BGFC 3KYAA 1RZIA 2P24A 3MUZ1 1PFCA 2XT1B 4PJEA 4TUKL 4FQLL 4LGRB 3MRBA 5IB4A 4PJGB 3I2CH 4K94H 4BQBA 1OSZA 3QUKA 4JHWH 4AT6B 4KK6C 2HJLA 4P9HL 2CDGA 4O2CA 4GKSB 4EEEA 4TSBL 3C6LA 4HS6A 3KR3H 2D3VA 4TVPL 3ILQD 5D72L 4ERSH 5JZ7D 4GMTL 4GJTB 3UPCA 2GAZB 2YHGA 5IHBA 2ZUSA 3QUXC 3ZMRA 4J3VA 4URTB 5E2VL 2EXYD 4MGXA 5JMRA 1EUTA 2BSTB 5CJXC 4GXUN 2MHAB 4PJIA 4Q9RL 1OP3H 4MD4B 4E41A 4QF1B 5FO8B 4HEME 1TZIB 3RVUC 4GXUM 2XN9D 1XR9A 3T4AA 1JNJA 4HUWA 3GNMH 1KIQB 3DSFL 1R5WA 1PSKH 1WITA 4B50A 1WZLA 4XPGL 2VE6A 3H0TA 3CFEB 4JLRB 2OTPA 3U1SH 1KF9B 4XHQA 4R2GC 3L9RB 1A6WH 4FXGB 2PW1B 3LEXB 4JZOB 1VHPA 1N4XL 1KLUA 4PTUB 4HF5H 5T1DH 3ROLB 2BMKB 2CK0L 4LLVB 1H3PH 3BHBB 3BDYL 2X1OA 1G9NL 4Q97A 2AJUL 1I7UB 3L3IA 4P99A 1S8DA 4N8CH 4L9LA 5CLWA 3CX5J 3DXAD 2Z91B 2JK5B 2DQFB 2ICWA 2ATPB 2HWZH 1OQXA 3A6CH 1KIRB 4OV6F 3G6JA 2FWOB 4O9HL 4XCCL 5AYUL 1BLNA 2X4RB 4C4KO 4NP4L 1OSPL 1VEMA 2ZJSL 4CVZB 2VLLA 4JRYA 4MYWB 1LVEA 2CR3A 2ID5A 3GUTA 1X7QA 4LCCC 1SM3L 3F58L 3LKOA 5E7FA 1Z9MA 1SEQH 3W0WE 4GAYA 4DAGL 2NNAB 3MUJA 3QG6A 2H2SD 1D5BB 1QBMH 4OIIL 5AG9A 1A6TB 3V79C 1FFOA 3BEVA 1BQLH 3H9SA 3CVHB 4OKDA 3VJ6B 1JHKH 1WTGT 5FEBA 2J12B 5D7JB 1TJHH 4IHOA 1X5IA 1F90H 4S2SB 1I4FA 2CSPA 2J3SA 4H88H 3QUYC 5A2LH 3CK0H 3QUZA 1MRFL 1MJJA 4YLQT 3BPOC 4FZ8L 2A73A 5CSZB 3T4AB 1L7IH 3FONA 3MV8A 4JAMA 4KY1H 3BEWB 4XP9H 1UGNA 1RQ5A 4X4ME 3MJ7A 1HHGA 5EBWA 3WXVH 3MV7B 3UTSD 5KZCD 5ABDE 4EI6B 2XXMB 5DQJA 4PJIB 4R0LA 1LD9B 4GRWB 3EJJX 4PRHD 3P9LA 3UTTA 4EOWH 4WW2F 4HIEA 4JY6B 4M3KB 1KEMH 4J4PA 4WFGE 5CINL 5EPMA 2X42A 4QHMA 3IDYB 4YBHA 2NZ9C 4L4VA 4LVHC 4P2CG 5F8RC 3SQOH 2COQA 4FMFA 4Y7MA 1U8JA 4AH2B 2B7DT 1T7YA 2G2RA 2W65A 2XFXB 2KPNA 2W60A 3K8MA 4TULL 5FUOH 3ARFD 4C56A 5IFJA 1I8KA 3S37X 5FDYA 1AGBB 5IIEA 4HC1H 1QBLL 3MRBB 5DJ8B 1KLUB 1YEFH 25C8L 4YHML 5KVGL 3KPOB 1SJEB 4IRSC 3WDJA 4ELKA 3OG4B 3DGCR 4CRPA 5HI4D 2P24B 3VXUE 2BNRB 4PD4J 5CFHA 3W2DL 2F15A 3BN9C 4FQXC 1CQKA 4JR9H 5I8CB 4Y1AD 4X8XA 5GISL 3RWJA 4P4RB 1W0VB 4XNXH 1E4WH 2JJSA 4LSDA 3IDMB 1Q94B 4QCIB 4L8BA 1YMHB 5H94A 3O4LA 1K8DA 3GJFB 2F5AL 2P5ED 3X14B 5C0FB 3WXWL 1DDHA 1N0XL 1NFDB 4LLQB 4XCYA 3QXUA 4GKZA 5J56B 2FBJH 3VFWB 4PRID 3T0EE 1YMME 5CUSL 2DYPD 1YN7B 3DUSA 4MX7A 1TXKA 4PS4H 1JZ8A 3QEQB 5I1GL 3C09C 1B4JH 1JPFA 2WBJB 3OKYA 3R0MA 4X6DB 3AAZA 2PXYD 1TVDA 4P3CH 3V0WL 5I1EL 5DHYB 1DLFL 3NZHH 1JMXA 4MNQB 4UUJA 1C16A 4JPWL 5DJYB 4JHBA 5ISZD 4JM4L 4I1NB 5D9SA 1QKZH 3LPFA 5DO2D 5DJCB 1CGSL 1MQKL 3HR5B 3EO0A 2Q7NA 4HFWA 3ZTJH 4BFIA 1BF8A 5I15L 2BXZA 1QA9B 4OZGA 1KB9K 1P9MC 3S4SA 3NH7L 5CJ5A 2O61A 5D96C 1ODAA 1YEJH 3IGAB 1TZGL 2NXYB 1C7SA 3HNSH 1YPZE 3PHQA 2DQHH 4PV9A 3SKJL 1T0NB 2FYYA 4ENEC 3GM8A 4P59H 2R2EB 4KK6D 3NCCB 4YHZH 1HILA 1QPPA 2FB4L 4QOKE 1GGTA 3PL6A 2X4UA 5BS0B 2A1WH 2WQ8A 3PHSA 4N1HB 2HRPH 3DIFA 3MOAL 5EBMA 5T1KA 1FNEA 1GJIA 4C57C 2Z93A 1DBAL 4QXTB 1H8NA 2YA0A 3B9KA 3Q1SL 2DKUA 5MP6L 3F58H 3DRTA 2XNAB 5D7IF 2F5AH 3JWNC 4UIKH 5K59E 2B1AH 2R1YB 1A22B 2A9NH 1CVSC 3B9EA 3PWPD 4KJPC 1PYWA 3I6KB 4LBEA 3RVUD 1RULH 1C08A 2J8UE 2OS7A 1AC6A 5TGBB 3PWPB 5K9QG 1F4XH 1NMCB 2P8PB 5FGRA 3PGDB 3T3PE 5J11B 3FRPG 1TTGA 4UTAH 5KVGH 2Y7QA 4R2GD 3EGSB 2EYRA 3MJ9H 3Q0HA 3D2UB 3DYMA 3G6JF 2HJFA 1I1FA 5JW4M 4KGLA 1FL3B 1INEH 4G5ZL 1H3XA 1J12A 4GRLD 1U8PB 2JELH 4YHYC 3MCKA 5KVEH 4RBPH 5DJAB 5KANI 3IU4L 4R4ND 1KC5H 1H5BA 5F88B 4BFBD 5HHNB 1VKXB 4GAFB 1HK6A 4TVPD 4XGZB 5CJQH 2E6JA 5DRZA 2IMNA 1T20A 4XCEB 1KG0B 5FGBA 2EDXA 1I7RA 3H7BA 2PXYB 1T83A 3IU4H 3EZJB 2WBJD 5GGRB 1NCDL 2FIRT 3QCUL 5MEQA 4R90H 4MCYB 3BT2L 2MCG1 3U0WH 43CAA 1J0ZA 5C0IA 4LSRH 1BEYL 1IQDB 2ARWA 5ISZB 1NAMH 4OKVA 3GRWH 5D1QA 2O5ZL 4NM8H 4OCRL 3RWDA 2BCKA 3MRRA 3BXNB 3ESUF 2R4RH 3TBTA 1EH9A 4OGYH 4NNPL 4XP4L 4YC2C 1J11A 1QZ1A 2CLVB 4M48L 4HMEA 1P2CA 4DQOL 2YA2A 4W6YB 1FL5B 3IVKB 4A2LA 3AU1A 3RVXD 1FFNB 3QIWC 4DAGH 2VQ1B 1LMKA 2AABH 4QRUA 2QKIB 3FRUB 2XG5A 4YXLH 2NXZC 4Y1AB 4JHWL 2ESVA 2XA8L 4O2FB 1Z3GH 32C2B 3WUWG 3LZFH 3TIDB 4RNRB 5L8KB 4EN3A 3AXLA 2C3HA 4TTGA 1IEBB 2MHAA 5E08H 2APFA 4I48B 3LH2H 4O4YH 3K0WA 4H20L 3B9AA 3OKOB 5LWYL 1JFQH 4HDIA 5EU7C 1IJ9A 2IPTH 4HKBB 4J3XA 5CJOH 1N6VA 2FCBA 2Y36L 1IMHC 3QIUD 3VXME 2R0KH 3VFVA 5DJ6A 3LMJH 1LE5A 1IGMH 5E24E 1TTUA 1F3RB 4NRZB 5JMOC 3HZKB 3VH8G 1UJ3C 3NGBB 2KQNA 1JYXA 1HYSD 1H3GA 5ENWB 1CICD 1S7QB 4MQ7B 4YEFA 5DD0L 4YXHL 2APVA 4WHTA 1BPVA 1FNSL 3BT2H 3HC4L 3EJYD 3MGTB 4U1IA 1ZKAA 2ESVE 4BSWA 1CU4H 4JFOB 5IF0B 4M7LH 2LAGB 5EIQA 5DJXB 5JA8B 3A6OA 3O4OB 4PRDB 1FVDA 3RX5A 4OB5L 3ECBB 1MQKH 3N9GL 3LD8B 1M7XA 3G5VB 3TBVA 2VRAA 3P9MB 3B3IA 4IMKC 1XAUA 3F7YB 4YFEA 3GSUA 5D5MA 4Z7UE 2FEEI 1E28A 2QADC 1ERNA 4QY8B 2DQJH 4M7ZB 4U0RB 2WP3O 5C0JB 4XB7A 1DANU 1F4YL 4RAUA 1RURL 5EOQL 3MV9A 2Y72A 4K3EH 3IF1B 1FV1A 3DRTB 2IANB 5BO1H 1A6ZA 2ATKA 1ED3B 3FO2A 2P5EA 3K8KA 5D7LA 4G9FB 1KCUL 3GHEH 3KDMA 3RA7H 3Q5OA 4OF0A 5HVHC 5C0ND 4TSBH 1CIUA 3PP3H 1CE6B 5FKAB 5C09A 4BZ1H 3UJJL 5E0QA 2FYYB 1PKQB 4LLUA 2PXYC 4MSWA 4RFEA 3MRIA 4PJ8D 4EDXA 2DB8A 4QRSA 3UO1L 3MBEC 3LVEA 4MB4A 1YA5A 2OXHA 3RIFK 5C09D 4PGCA 5TQ2H 3AM8A 3CDFA 2I60H 4PJDB 4U1HB 3EO0B 4R26L 1S9WA 4JZJC 4M1CC 1U9KA 1D5IH 2QQNL 3O6LL 1Z0NA 4WEMB 3HC3H 4HUVB 1UZ6E 5I75C 2WLYA 3P4OB 4GUPA 1CGTA 4I0PA 1GOHA 3AAZB 1BFSA 3BRGC 3NZ8A 4OFIA 4ENED 4RMSA 3NCYS 2VZ3A 3EDEA 3M8OL 3OL2A 4RMVA 1Q0YL 2E27H 2JF1A 3PWPE 4H1LG 4Z6AT 4I2XB 5L9DH 1J1OH 3E1F1 1NKOA 3LKPA 2ZCKH 4XP9L 2DQIH 5DUPL 5KTEH 5MHSE 1ZHKA 4ODSL 3QPXL 1U2CA 3ARWA 4WTZG 3LCYA 1HE7A 1OD7A 4R7DA 1MCFA 2EDNA 1GC1L 4OFDA 1AD0A 4GSDH 1YC7A 1JPTL 1YDPB 4H88L 2EC8A 3O2WH 3RZWA 4RMTA 1KN4H 4OZFA 3ZHDA 3AU1B 3RWJB 5FV2A 3QHZL 3TBSA 1IAKB 2BXYA 5L2JA 4MD5A 3LMJL 1YECH 2VDLL 3ALPA 3AMKA 4PJAE 4OFKA 3BXNA 2B2XL 1QFWM 2YPLB 5GIRB 3PWUA 1K9TA 5DMGC 5C0AB 3MRGB 4JKMA 5F7MC 1DQLL 2A0LD 4KK8C 4XPAH 2A77H 2DMKA 4NUGL 2AEPL 3NCBB 4WI9A 3VE0B 4HD9A 2NZIA 2J8UF 2HJKB 1OSPH 4GRLC 1VGKB 1FDLH 5EO0B 1TPXC 1RUPH 1NGXA 1FVEA 4DGVL 4F57H 5IB2B 1C5BH 1T5WB 2CIKB 3PG2A 3HN3A 3U46B 1X4ZA 3CSBA 3L5XH 5D70H 5CIPA 4PYGA 3S98A 2VLMD 3LS4H 5DUML 1XF5A 2AW2A 3CZFB 3QO0B 3OPZH 1HH6A 5DMIL 3H3KA 4G43A 1S7VA 2BVEA 4R4FL 5JXEA 3SQOL 1NCWL 2VC2H 5LCVL 1I9RH 4WFED 4X6CF 1T2QH 5JDSB 4TUOB 4WU7B 3LB6C 4KDVA 1LDPL 1U8NB 4HIJA 3VXUA 3WHXB 1N6QH 4KAQH 1J87A 2IBGA 1C1EH 5LAXB 1MCBA 4OD1L 1KN2L 1KXTB 2JCCE 2Q86A 1WGOA 4LCIL 3L5HA 4U6XB 3HNVL 4B0MM 4MLSA 1IFHL 2P42B 2AERT 3ZE0E 4KKCD 3VRLF 3QIWD 4UIMA 4GS7B 4UILH 5CEZL 1IM9D 4PUBH 2WIIA 3QEUB 4HCRL 1K2DA 1DTUA 3GMQB 1RZGA 3H9HB 4E0RA 2XNAA 4JB9H 1KG0A 3OJDA 4QRRB 1D5IL 3H3PH 3E2HC 1A7QH 2OZ4H 2DF3A 1X5YA 3LN4B 3KYOA 1X5JA 3RX7A 2HLFD 4HLJA 3FN0H 5GGSB 3MLTA 3PWNB 1NJ9B 4JQIH 3BPCB 3KLAA 4GXVH 5E6ID 5EU3B 1OAKH 5F88A 1L0QA 3ZKND 5D70L 4O2EB 1HINL 4Z77B 3QIUC 1WT5C 3DGGA 1ZEAH 1FC1A 1SEQL 5ESVB 2CH8A 5C6TH 1FDLL 2J5LC 3HS0B 5EUOB 4EZMA 2NW3A 1P5VA 1HYSC 3K8LA 5IUSA 2BY3A 2P8MB 4P46C 4NDMA 4ZFFB 5F7LB 3NA9L 1MRCL 1I9IL 1PVHA 4J1UA 2DLEA 4U6HA 4XCCH 2L0DA 2P8PA 4JDVB 1YMMB 3QJHA 3C5ZA 1F4WL 4YHIA 3DUUB 3FO0H 5B39A 4Y5VA 4G8GA 4LHUB 4OFYA 3A67L 1JE6A 4JQXA 4POYA 1YPZF 1AO7D 1K6QH 3CZJA 1CZ8H 3QNZA 1FFPA 1RFDL 3BD5A 5JHDD 1JGVL 3G9AB 3AM8C 4HQQL 4GG6F 2E7CA 4DKEH 3QQ3B 3MC0A 4Y4HA 3L7EB 4NQSA 1A6AB 1PKQE 5AD0A 3NPSC 4WW2A 2BSTA 3L3JA 1FAIH 1F3DJ 2VL5A 5JNYA 1OAZL 3DX7A 3GSVB 2EYTA 4L8BB 5H94B 3IGAA 1LGVA 5DJ0B 4AJ0A 3CFDA 4OZGB 5I30H 3BX7C 3T1FB 4P2OA 5D5ME 2WUBH 2A38A 5K9QI 2Q8BH 4LPUA 3O45A 2HAZA 1U8MA 4LCWE 2I60L 4PJ8C 3RVWD 5C7XH 4XP5L 1LP9F 3ZE2F 1VDGA 2IAND 3NABH 4XMPL 1CCZA 2CLRB 2QHRL 5C70A 2ZUUA 5CJOL 5E1AB 5ID1A 4NKQB 1O5DT 4M6NH 4MNQA 3TESA 4TVPH 2CQVA 2O93L 1T04A 2GT9B 3HI6L 4KDWA 4ONFH 3KPPB 4YK4C 4U1SB 1Q9KB 3QEQE 4HX1B 3U0PA 1TJGL 4G80A 1JTPA 4CVXB 5F1NB 1ZLWK 1NEZG 3WIFB 1FZOA 2A2QT 4PRPE 4L8SA 4TPRH 3PHOB 3V95A 1KJVB 1UXSB 1EEUA 2X40A 3IDGB 3KYNB 4GXVL 3CCHB 3DMMD 5CSZA 4JM2A 1MPAH 1QSFB 1OB1A 2J4WH 4PJAB 2W9DL 5B8CC 2A6JA 3MX0A 1BEYH 2BP3A 5AZEH 5TF1L 1BQSA 5FM5O 5L6YL 1NFIA 5J1AA 4PTTB 4YHIB 4Z7VA 2GTWA 4XNUH 3H9SB 2VSCA 3BWAA 5DJ8A 3AY4A 4RIRB 2XN9A 4NFBA 5TDOA 3NTCL 1QSFD 1DN2A 2ZNWA 4N0YH 1R3KB 4LVOB 5FGCE 4UQ2A 2GK0A 4HH9B 3WKML 1FGVL 4ZFOA 2IFGA 1CD8A 5DC0A 2QHLA 1EVUA 5EPMB 3ZE2E 2A0LC 3KYOB 1KB5A 4KK8D 4WJ5A 1I9RL 2PTTA 5C07A 2IAMB 3GMNA 5DSCA 2J88L 5IMMB 1II4E 3MGOB 4ZQKA 3BJ91 3V5HA 2W9DH 3GMQA 1P1ZA 3GRWA 2J4WL 4LLYB 2G9HB 3OPZL 4R0LB 2B0SH 4W4OC 4Z76B 2JTDA 3EBAA 4DN3H 1T2JA 3LN4A 1N6UA 4AG4H 3D0LA 4NQVB 5T3XE 4POZD 3SE9L 3P3YA 4E0RB 1K4DB 1AGCB 4PJDE 4JPIA 4AENA 3VXUB 1S7RB 3O3EB 4X8JB 3RDTA 2YR3A 4AEHL 2Z31B 4NC1E 5IV2B 1Z3GL 5SWSD 5L0QC 4TSCH 2XA8H 3SE3C 3P2TA 4KROD 4P2QB 4PP1C 1A6TA 1K3IA 1DBAH 1XMWA 1NCAL 3S37H 1EUUA 1YNKH 3HPJA 2H6PA 4DQOH 3QQ9C 4LRNH 3ULVD 4MD0A 5D6CB 5F97E 4DW2L 2AEQH 2DBLH 4BZ2H 4X5WB 3KJ4C 1MUJA 3RU8H 1QEWB 3AROA 2Q8AH 2WUBL 4JM2C 1G0YR 3WS6A 1A4KA 3U36B 1BLNB 3OXRA 2YPVL 3QO0A 4MA3A 3ZDYE 1F3JA 4TVPE 4XVSH 4YE4L 1QVOA 3FN9A 4HF5L 2ATPA 1GRWA 4NN6C 4X98A 5JPNB 4IMLB 4YK4B 1KB5B 2ZCLH 1T5WA 5CMAA 4YFLI 1CFVL 1WLHA 1A6WL 4NQEE 3CU7A 4U1MA 1EERB 5HI5D 1GGBH 3JTTB 3WFDL 4JM4H 5DEFB 5DZNA 1QYGH 4LLVA 2APTA 4MLIA 2PYFA 3QEHB 3ZL4H 1YPZA 2WM0A 2W0LA 3RKDC 2F54B 1JGVH 3BWAB 3QI9A 4NQDA 1GGIL 4L3EB 5GS0L 1TITA 2APBA 3N1QC 4Q9RH 1CD0A 4NQEB 4F2MB 1IAOB 4P46D 1KENL 5E9DA 5BS0D 4U2YA 1R5WB 3V6FA 3LRSA 1Z9OA 5HI3D 1KIQA 5KSAD 5JOEA 5EU6A 2MMXA 4J3UA 3CMOL 4F3FA 3BIKB 5DVNA 3TCXA 5E6IB 1N64L 1U8QA 5DD6A 5CZVH 3CDGB 4ELMB 1E4XH 1BFVL 1DBKL 5J13C 4HXAL 1KPUA 3I85A 2NYYD 4QRRD 3P0GB 2FEDD 4HX1A 1JV5A 5E4IA 3UPAA 3NCEB 4TUKH 5DRNA 2WWKO 3BMWA 4MVBC 2W9LA 2YD9A 5KVDL 1JN6A 1IGYA 1G7QB 5E56A 1FBIH 1KUMA 4NBXB 3CVIL 3GSNA 1DVFB 5CGMA 2DQTH 1G7PA 3KXFA 4HUVA 2VZ1A 1CG9B 4MNQD 1TENA 1OW0A 1RURH 1OLLA 4OI7A 4F7EA 4QLRA 4ZNEE 1BBDL 3N0PB 2DQHL 3HNSL 1EFXB 2FJFA 1A14H 3F7VA 3MOBH 5DS8A 3VFTB 1CQYA 1B0GB 1K8IA 5FM5M 5HVHB 4HIIA 4KPHL 4F7TB 4X0KA 2F8OA 3SDAB 3HRPA 4YUEH 3VXPB 3HB3C 1FHGA 1F3DH 1FJ1B 1J18A 3SBWC 4F8TA 1AR1C 4O58H 3RVWC 4X6FA 4JVPA 1DSFL 2J5LB 4G8IA 3FFCB 3D69B 1WWWX 2P5EB 1J5OH 1YNLH 4GLRH 2FX7H 1ZTXH 2HKFH 1UADC 5BVPH 3CAFA 4YZFF 3TIEA 1CF8L 1PY4A 2VWEC 2UY7A 3EYVB 4H1LA 5HGDA 3QIUA 3L1OH 4D0DB 3NZHL 4AIZB 1D5XA 2Q8AL 3FTGB 5E8EA 5EO9B 1L0YA 3VRJA 4JFEE 5DHXB 1K6QL 3T4YB 1SJVA 3FB5A 1CLYL 2EDHA 1MCLA 4K2UL 4JO3L 4WFFD 5D2LA 4BFGA 5CGTA 3VXMA 3GI8L 2UWEB 1JHLL 5AG8A 1ZE3C 4ONOA 3ARFB 4ETQA 5FB8A 5ALCH 4Q9QL 3BIAX 1V7MH 3NFNA 1RZJH 2CRMA 3HZYA 4TSAH 2J7LA 3D48R 2F53A 5CHNB 3D3VA 4XXDB 4MS8C 4LGSB 5D6DA 4ISVB 1QBAA 4CMHB 2A77L 2YZ8A 2X89A 5CZXC 3BQUA 3GMLB 1L7TL 4QXUL 4PJEE 3MV7D 3HS0A 5EUOA 4UDTA 4U1MB 4XBPA 1KLFA 4HCRA 3VD7A 1G7HB 4G6JH 4MXVE 1OCWH 4HC1L 1VFOA 3QUYA 4TNWK 1SYVA 1R5IA 4XVUD 4RRPA 2XY1A 1YYML 1NC4A 3MRLA 1NAML 4DCQA 3OQ3B 4CN4A 5JUEL 2OMBA 2DICA 3PP4H 3UBXG 2MTPA 3CIQA 5F6HJ 3TO4C 1NCUA 3U36A 2DQIL 1IC1A 4OFVA 3TJEH 5J1SC 4LVNB 3QNXA 2ESVB 1INQA 4YJZL 4LEOB 3FOLA 3OAUL 4LCWB 2EKSA 1RV6X 4NWUL 5FCUL 2C4FT 4EUPH 2ZUQB 3WJLC 5IHZA 5K9KB 1F11A 1WWBX 2MOVA 1X3DA 2AK1H 4YO0A 2HYMA 1BREA 3QHTC 2JJVA 5CAYB 2WSKA 3VWKB 4YO0B 2YKLL 3GJFH 1TVHA 5LCVH 4JCMA 3TVMA 3WIHL 2G60L 4MB5A 3T0AA 3B2VL 3REVA 2DQUL 4X8JA 3QH3A 4NKMA 2CLVA 4PLJD 3HI1B 4OD3L 1TLKA 4JKPH 5DDHA 5BXFB 1J0KA 4NPYA 3HR6A 3DXAB 4PGEB 3G5YA 3KPLB 2MCPH 4G9FD 2ORBL 3CVHH 5J89A 4I3SL 3QAZC 3Q5TA 2YN5A 3H7BB 4PV8A 4WENB 1HWGB 1N2RB 5DJ2B 4XPBL 4LIQH 5C0BB 8FABA 1T1WB 3RI5K 2ZUYA 4ZPTA 1ZMYA 2D7PA 5I8EA 1TNMA 4JCLA 3O6MH 3VH8A 4YDLC 1JTOA 2BHZA 4AMKL 5H37H 5BO1L 2ENSA 2AV7A 5CS7A 2XN9B 5D5MF 5TDOB 5B8CB 3TCLB 2HVKA 4K7FB 5HI5C 5LGJB 1B4RA 2EXWC 3LIZH 2IFFH 4JFFE 5B39G 4PG9A 4ORZC 3HFMH 1NQBA 3S96B 4OD2A 3GKWH 5JOFA 4Z78B 3RKDD 4N8VB 4ETQB 3QUMH 3L5JA 1ADQA 1MFAH 4FQCL 3QO1B 1QRNA 3D3VB 4XXDA 3OX8A 2Z8VC 4FP8H 4BQCA 3IFLL 3FT3A 4PJAA 1C7TA 5I15H 2PCPA 4F7CA 1Z2KA 1ORQA 5DGRA 4Q6IA 5F9DC 1KB9J 5FB8B 1H8OA 4FQ2H 4MA1C 1D5XB 2JB5H 3ZE1E 2N56A 1KJVA 3V5KA 4Z7NE 4QYOB 2DLHA 3U9PL 4XC3L 1JWUB 2NTFB 5ITBH 2IH1B 4HQQH 2ZNXA 3G6AA 3C5ZD 3FQRA 3O6LH 3MNWB 3IJYB 1M7IA 4FOMA 1E4JA 1XIWC 5DHVA 3LN9A 4HWZA 2P49B 4RX4A 1XGRB 5TE4H 4HLZG 5I71B 3SDAD 5TQ2L 4QTIL 4JRYD 3GSOA 3D25A 3FFCE 3FB7A 1PG7L 1XEDA 2XKUA 4Q0XH 2W0FB 5ANMA 5EB9A 5KVDH 3EFDH 1IZKA 4U6YA 3GSQA 5MERB 2HKHL 1PGRB 1N0XH 1HDMA 2VNCA 4JZNA 1NL0H 1HOCA 1LEKB 3X11B 3ETBF 2FSEA 3CMGA 1HHKA 3GMOA 1CLOL 1DVFD 3F12A 3RUGF 5IVXB 3I6LD 1HH9A 4LAQH 4I3SH 1UA6L 4NQCA 2OJEA 4LLUB 1JNHB 3WYRA 3HZMB 4UU9B 2QTEA 4M93C 4JO4H 3HB3D 2BJMH 4F37F 3UC0H 5IVOA 1R3LA 3GEWB 3QDJE 5GGTA 3VD3A 1FZKB 3FN0L 1XT5A 4H26B 1MFCH 1N0LA 4LNRA 3HMWL 5E99L 1F4YH 4HJ0D 2X4TB 3MLSH 2E8ZA 4WV1C 4JO1L 3VXRA 5FYJE 1ZA6B 3TZVA 4XAWH 4E5XA 5E5MA 5KSAB 3MXWL 5GRVL 2NY4C 2G5RA 5EC2A 2PCPB 4F7CB 2CDEA 1IAOA 1MH5B 1A6UH 4L3ED 1C8PA 3HRZB 3G5VA 4K3JH 5IK3A 4LL9A 3TBVB 2AJYL 1CXLA 3UTTD 4PJAF 5EU6B 2VR5A 2LTQC 4PRBA 4BH8A 1OOAA 4DKDC 1L7IL 4L1HA 4FZ8H 3UZVB 3INUH 4YC2B 1AFVL 2B1HH 4Y16B 2IH3A 5LGJA 4MS8D 4XP6H 2QSCH 5DC4B 4ZTOL 4FFYL 5GS1B 4WHTB 2DI7A 5GRZA 4Y0GA 4X9HA 1UKSA 1I8KB 4GKNB 1NC2D 3P77B 3MLZH 4JJ5A 3VD5A 8FABB 4DGVH 1RULL 3MV7A 5DYOB 4QRPB 1RJYB 1QHPA 1XGYL 2ED7A 3SDXF 2DD8L 1FGNL 2UUDK 3U0TB 4MA7H 5IJKC 2I07B 4N0UB 4MMZC 3KHQA 4XBGB 1VACB 4ODXB 5D7SH 2H6PB 2FGWL 3PQYB 3QCVH 2JJWA 4AG4L 5CP3H 2HRPL 3MOAH 4P2QD 5I17B 2VDLH 4JKWA 5SWSB 5SWQA 4OGYL 1ZHLA 1IT9L 4IOIB 1TFHA 3QG6B 4UI2A 4Z7VF 4D0BB 1A4JB 1U8NA 4TOYL 3BPLC 1UYWL 4G7VH 2KL6A 4L1DA 3T04D 3L1OL 1PX3A 5JIPA 3LN5A 4ZOCA 3I02B 5DD5H 5L88H 5KOVC 4HPOL 4F8QA 4XX1G 4NO0A 3QEQD 1YJDL 3HMXL 3K3QA 4YPGB 1J1PL 4PLKC 3U4EA 1CICA 4EIGB 4WHYH 2IAMD 5F93C 2BVUA 4NQVA 3BRFA 4NN6B 1RI8A 1NBYB 3MLRL 1RU9H 2VZVA 5IB2A 2ADIB 4Z7VE 5F9JB 1NGXB 1MY7A 1T80A 5IJVB 3HZVA 2UVFA 4P4KA 3IJSA 2DTML 3MLSL 3T65B 5I1GH 2JK5A 5DUBB 2BVPB 2R0WH 5IEKA 1VSCA 2BNRD 4RFNC 4L4TA 1A1NA 4NBYB 4Y16A 5C86A 4UOW1 4JREC 4LAQL 4KVNH 2P44B 3MRMB 4OF7A 3FQTA 5EORL 4M93B 1U3ZA 4ZD3H 2F53B 5CHNA 2V5MA 5CP7A 1CD1B 5CD3A 5HHQA 3HRZA 4BQ9A 4UBDD 2QL1A 4LKCA 4E41E 5BRZB 5LBSL 3PHOA 1A9EB 3BUYA 5DFWH 4BK5A 5DWUH 4Y19D 2EDLA 4JFHE 3LEVH 1RZFL 5IFHL 3E6HA 4XP5H 1QNZL 3LS5L 2CRIA 5M95B 1YY8B 1KELH 5T33H 1IGIH 5GJSH 4ZXBA 5DF0A 5JORB 5F1IB 3UTSB 3V4VL 3MREA 5HYSA 2IADA 2X4UB 4HFUL 5BS0A 5C0GB 4L5FH 4OZIA 2DQJL 1BFTA 5D7IA 3UPRB 3F5WB 3HUJF 2BSED 4M5ZL 3D87B 1S7TB 4JEGB 3C5ZC 1KCRH 3BZFB 3LRHA 4JFPA 3MLYH 4XPHL 3JTSA 4PJHA 3GSNL 2CDGB 4O2CB 3MRHB 4A6YA 2IGFH 1FC2D 1RZIB 1IKNA 5IM7A 5GRUL 1DL7H 4HZAA 1QKZL 1XR8A 5DJ0A 4F33B 1U8MB 5GGTL 4OQ1A 4G6FB 2VR9A 1DP0A 3MRPA 2YWYA 1WICA 1INDH 1BP3B 1DVFC 5E5UB 5CEXB 1KTLB 4R97B 3M1BA 3WLBA 1DBML 3CNKA 3LEYL 3O8XA 4GKOA 1IGYB 1M7IB 1AJ7L 3W9DA 3UTPD 1YEDB 1BECA 4ZFZA 4YAQA 5CD5D 5HGGS 4U1NB 1R24B 3QB7C 1CLZH 2YD8A 1T3FA 3JXAA 5K9OB 4WW2B 3THMH 1J8HD 12E8L 4HJ0C 5AD0B 4JFFB 4PRIA 1CE1L 5IBUB 1GZQA 5MI0B 5I6XC 2ZJSH 3RWFB 1IGJA 4R4BA 5SWZA 1KCVH 5CIPH 1PZUB 3FAWA 2NW2B 3VG9C 2GITB 1WZKA 4HS8H 1F5WA 2W38A 1M6OB 4JDVA 1FCCA 3WNOA 4OZHE 3QO1A 2KQMA 3RIAF 4Y5YB 1VCAA 1JWSB 4XNQA 4LHUA 5DR5L 5BZDB 4YNYB 6FABH 2P8MA 3SKUD 4L4TD 3DI3B 4ZTOH 1CDYA 1CYGA 1X5LA 1A7PL 4JFZH 1NFDE 3R1GH 4EDWH 1OAUH 1QFWH 1H3WM 5D2NB 3S34H