1A3LL

Catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
DIVLTQAAFSNPVTLGASASISCRSSKSLLNSNGIIHMYWYLQKPGQSPQLLIYQMSKLASGAPDRFSGSGSGTDFTLRISRVEAEDVGVYYCAQNLELPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDTKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN FAB 13G5 (LIGHT CHAIN)
publication title An antibody exo Diels-Alderase inhibitor complex at 1.95 angstrom resolution.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 50
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3lL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3lL01
1QFHA 3F7VB 3W39B 4HPOL 1FL6B 3FAXA 3QIBC 3MRIB 3TA3D 2PF6A 5IEKB 2K9UA 4PJGA 4Z7VB 5ETUB 5FO8A 3ZDYF 1MHHA 3L3KA 4LSSL 2W07A 5GHWH 3L5HA 1VGEL 2MCPH 2J8UA 1MRFH 1MCWM 1I7ZA 4O5LH 1MHCA 1HYSD 4BQCA 1FNAA 3O8XC 4F33A 1SYSA 4UIMA 2VTFA 4XPTL 1MCCA 5IIEB 4KPHH 3P9MA 5IBUG 1UEMA 3EHBC 4WI5A 2NQCA 3HRZB 3K74B 3O6LL 5I19L 2APFA 3UJIL 3VFGH 1ZGLM 3VH8B 2W0KA 1L6XA 5FYJL 3TP4A 4ZSOA 4XNMB 1ZHLA 2VZOA 3PWUB 3MNVA 5FXCH 3L3IB 1DQML 3ULVC 1FVDA 1H3PH 5DWUL 1JVKA 3BKMH 5EU5B 3UO1L 1GHFH 5I76B 4GAYB 1HKLL 4IOSD 3LKRB 1NGPH 1BOYA 3L3OB 4C83A 1Y0LA 4ONFH 1TNNA 2CIKA 4FTVD 1BIHA 4U6YA 4NKDB 5HYJB 1OPGH 4PJDA 1HZHH 4XT1C 3ULVF 4JFYA 4PLNC 5FECB 1JYWA 1HH9B 4DK6A 1ZE3C 5T1KB 3G5XB 3ROLB 5FYLL 1T89A 5FOJA 4XC3H 1YJDH 2APBA 2M1KA 4K7PH 5TPWH 3NABL 5C0CA 5GRYA 2IBZY 3SQOL 4PTUA 4JJ5A 5EC1A 1U8JA 4Z77A 5F9WB 5I71B 3QUKB 2P46B 1CGSH 5I6XB 2DRUA 1P6AB 1AO7E 1QSEE 1T4KB 1ZLVK 3MOQA 1MI5B 4GMSL 2GCYB 1IGYA 5SWZE 1R3LB 5BS0E 4NKIH 3WE6A 3IDGA 3RWCA 4L3CA 4WY7L 4EI6A 3QQ9C 1RUKH 5E8PB 1AGBA 3T0ED 4U1HA 2DM3A 2ZZUT 5IQ7H 4OZHA 4M9OA 1DE4A 4X99B 3C6LD 3DTXB 5DTFB 2IADA 4QGYA 1KENL 3FZUD 4HDIA 5J89A 3QUMA 5CGYD 3OX8B 5BOPA 2R9HC 2DLGA 3JTTB 3P2TA 4M7JH 5IP4A 5DJAB 4HWUA 2YN3A 3ZYIA 1BD2A 2EH8L 2UZXB 1MIEL 4PJHB 5I8KH 1YNTB 3KPRB 3RVUC 2QLVB 2FYYB 4HG4K 1U42A 5EO0A 2AJZB 3MRLA 2C3VB 4X8JA 1M6OA 3V95A 4OZ4A 1NMAH 4TPRH 5C1MB 3CU7A 3CVHL 5JLZB 4U2YA 3DSFL 3V2AR 1E4XI 2G2RA 1LO2L 3HC4H 4F7EB 2CUHA 5FK9A 3PWVA 1A3QA 3UTQB 4BK4A 5D8JL 4KTYA 4EOWL 2WZPD 2YUXA 4PLJD 1MNUL 4MA3B 4ZFFB 2NY5C 3EGSA 4WEMB 2NLJB 4LDOB 4KKLD 1O7VA 4HZLB 4M8QA 5DSCA 1TCRA 1WWCA 4G9DB 2HVKA 4NNXB 2R1XA 5IK3B 3BKCH 5BCAA 5DA4A 1S9XB 3TO4A 5E7BA 4YK4B 1Q72H 4HK0B 4NZRL 4YBQC 4JFQA 1ZA6B 4CN4A 4Y5XB 2ICES 5D6DC 1W0WA 3DV4B 1MFAL 2BVPA 2ZNXA 1W8OA 1WT5A 3PGDA 5DD3L 1V3JA 3GJFB 4O2EB 5K9OB 5CZVH 4ZUSA 3DVFA 4P2RB 2X4OA 3RGHA 2Y36L 1J5OH 1DUYA 1FBIH 1AGDB 3WLWD 1JV5B 5JR1H 2J6EH 4PRIB 4XNZB 5J8OA 2PKDA 4LSRH 4P9HC 3QULA 1U3HB 4PJ7B 4HIJB 4UTAH 3BO8B 1JP5A 4ESKA 4R4NC 1BIIA 1FNEB 5GZOC 2CQVA 1WTLA 5C0DA 1KIRA 2A6IA 1XF5B 4WO4B 1GGBH 4PJBE 1ZANL 2R4RL 4ONHA 1A4KA 3WJJA 3NCEB 4AG4H 1QBLL 3O9WC 1R5IA 4JRXE 5H2BB 3P9LA 2WQRA 3H42L 4U1GB 3VG9C 4DN4L 1R3IH 5BW7C 5HVWA 5IESH 4MCZB 4NO0B 4JCMA 5MEQB 2I25N 1EHXA 4XBPA 3TCLA 2Z92A 2HN7B 1CF8L 3UZVB 4U7SA 1S7SB 2XTJC 4OLWL 5D2LA 4OM0L 2NMSA 1JPTH 2ZCLH 5K9JH 4PGZA 2Q8BH 5K9KB 1CIDA 2UZYB 2NY4D 5IHLB 5DR5L 2HWZH 4FZEH 4GQPH 5HDQL 4TVPE 3BQUB 4L4VD 5D1ZB 1MFBH 3SDAC 1D9KB 1A9EB 4YFLI 5ALBH 4DQOL 4Z78A 2K3TA 3HKFA 2QKIA 3U83A 3BSZL 1Z9LA 2Q20A 2D7QA 4P5TC 4Y2OA 4WI2A 2D31B 2NY2D 2QADB 5C09D 3CVHA 4YHOH 4ZDHB 5IHZA 2HLAB 3EYSH 2YD3A 1YEFH 2VERN 1I1YB 2WIIA 1V3LA 5FGRA 4OGXH 4FQLH 4V2CB 4K2UH 2F53A 1S7TA 1J7VR 5I2IA 4OCYH 5FYKD 4XBGA 4H20H 2YBRB 5DFTA 2XACC 2X40A 5FUOH 1F4YH 5IHUL 1JMZA 4ENEC 2JLLA 5T3ZD 3OXSA 3VWJC 2BNQE 4XXDA 4LLDB 3NFPA 3NCYP 4ZUWB 1G7QA 1FIGL 3OSKA 2YHGA 3BPLC 4ZS6D 4L4JA 1NDGA 3S96B 2EIZB 4X6CF 4Y4KD 5K9QG 3P73A 1LP9A 2VXVL 5JDSB 1U6AL 3UTZB 1OAUH 1XGYL 2BNUB 4PP1C 3BKYL 1IAIH 2NX5A 4M1CD 5JXEA 1P5VA 2A6KA 2PTTB 3ESUF 2AK1H 4OZIF 2F5AH 2DOCA 4ZD3L 1KCKA 4Y89A 2MSPA 4JZOB 2IANB 3MA9L 3M1BA 2Y1VA 2D0HA 3BEWB 4QGTA 1K4DB 3MFGB 1HE7A 4TSCL 1MRCL 43C9A 4I3GA 2FGWH 5HGAA 4DGIL 3DO7B 3AS1A 3ZDYE 1Q94A 4XHJC 4HK3N 3EYOB 1VADA 4LDLB 5D6CA 2HRLA 2VLJA 1HOCA 3STZA 4AJ0A 3SE3A 4Z7OF 3HCVA 4S0SD 2ZUYA 5IMMA 1WQVT 4K3DL 1IM9B 3GUTA 1MJJB 4L3ED 1H5BA 4N1EA 3A67L 3PQYB 2QJDA 4D9LH 2MPAL 3LD8B 4PJFE 4PY7A 1SEQL 2ZP0T 4JFFE 3PWPA 5E6IC 4NOBA 4PRAA 3BZFA 3KPPA 3EOAB 4ZFGH 5L2KE 3ARZA 2NW3B 1QLEL 4WI6A 5EOQH 1EAPA 3MGOA 2AKRA 4PJEA 4X98B 1QVOA 3MV8B 4PJAA 5B38B 1Q0XL 1U92B 4TULH 4PGJA 1RULH 2OSLB 3BP4B 3IDIB 1KCUL 2XYCA 4LDEB 5DJXA 4G7VL 3WXWL 2XZCH 3DGCR 1A6WH 4NCDA 1B90A 2CLRB 1KN2L 3ULVE 1WEJH 4LSPH 1IGTB 1J0YA 3INUL 3MRJA 2OL3L 4OZGA 2ZWLT 1N5AA 3W11C 5KTEH 4ZQKB 2CLVA 5B3JF 5ESQA 3ZYZA 3K0WA 3BPCB 4MWFB 2X1WL 2WBKA 4LOUD 2ESVB 2HKFL 3RZCC 3M07A 3JWDC 2NNAA 1EEUA 4D2NA 5MENB 3KYNB 3CZFA 2R2HB 1JHKL 5JUEL 4GRWF 5C3LD 2V17L 1NCWL 3NPZB 2YUVA 4E5XA 4POUB 4M7ZC 4YDJA 1E4KA 4JFPB 4X5WB 4NC2B 2YKLH 3IRZA 4N0UA 1IAMA 3B5HA 5EBMA 3U7YL 2X2YA 1T66C 4XHQA 2DQHH 3FB8B 2FRGP 4JFEA 3DVIA 4XP6H 2X5PA 1H3TA 2VQTA 3NCCB 3QISA 1NBYB 1YYMH 3BGAA 4M43L 1DQQA 1X9QA 2H6PA 4LFHG 3HZMB 4FQ2L 4M6NL 1AXTH 1PY4A 1D5ZA 1QO3B 5E00A 4Q7DA 3CMOL 3B6SB 2JF1A 3CFDB 3U46B 4KUZH 3VXSD 3RKPA 2ZCHH 2EYSB 2ZSWB 4PJ9D 2HT4C 2ZCKL 2VC2L 3EO0B 3OB0H 1AGEA 4D9QE 3KYOB 5D7JC 2C26A 2IC2A 5EWIH 4MNQA 2VZ1A 4HKXB 3MZTA 5CP3H 1NL0L 3MV9D 2H8PA 3QXAA 1L0YA 4XVTH 4X6DB 2BDNL 4F80A 1U8PA 1P69B 2J88L 4P2QA 4DKFL 5E8OB 4YIQA 5H94B 4Q74A 4RWYL 5B4MD 1MWAH 1JRHI 2VDRH 3MV7D 5I8OH 3X3FH 3O3AB 4PGBA 4ZG1A 1MHPL 4AQOA 1NCUA 3RWGB 2Z35A 2UUDK 3FRPG 4J7RA 3MACH 2P48B 3ARBA 5SWSE 1BX2A 2OL3A 2X41A 5IF0A 3G5YB 4NT6A 5JOPE 2MHAB 2Y72A 3EOYG 1OD9A 4OD2B 1PW3A 4RMWA 3VWKC 5EUOE 2ZKHH 4MJIA 5C0BE 1M7XA 1UXWA 5CD3A 1G0XA 1JRHH 2QEJA 3P30L 4KTEL 3AM8C 5ADPH 1DEEA 3DXAB 3MCLL 5F3BA 1IFHH 4WTZA 4QYOB 4AIZB 2KQMA 1MFEH 4WEBH 4U6VH 2FECI 2P5WE 2VDPH 2L7UA 5E9DD 3H9SE 4LSTL 4HIIA 2R23A 4PJIB 3VCLB 4KQ4H 4NO2B 3KLDA 1CN4A 2GUOB 4FXGB 3ZTNL 1OD7A 5JHDB 4I0CC 1T21B 1G6VK 3HC3H 2B0SH 2VO5A 1MCBA 2ED7A 4PG2A 4LAQH 1YQVH 4P57A 3QIWA 3MYZA 4TSBH 1V3KA 3X3GL 1K6QL 2FO4A 2JCCB 4GKNB 2XTJE 3ZHDA 3QO0A 1T04B 4TNVF 4PR5B 3DV6A 4YUEL 2ADFH 4ZOBA 4G8EA 4LSSH 3SOBL 1VGEH 3V0WH 4PJCB 5A3IC 1PEZA 1QSVA 4NO5B 4X6BA 3IYLW 2AK4E 3HLAA 1UJTA 4K3GA 2WNGA 4F9LA 2VXTH 2BVOB 5K9QI 4A2LA 2IGFL 3O11A 4URTB 3T4AA 1CXLA 3C60B 4DVBB 5EU6D 4P46C 5F3HB 4TUKL 2EICA 4GKOA 5JW3H 4KK9D 5DQJB 3CXHJ 4GSDL 4G8GD 2IG2L 4QXTB 5DJ8A 2WQ8A 1PY9A 4HH9A 4Y19E 4U1KB 1MELA 3SKOB 1YNLH 3D2UD 5DWUH 4QRRD 3UO1H 4X6CE 1KTDB 2XPGA 1UM4H 3MRQA 2QV2A 4FABL 4ZYKA 2BY2A 1HEZA 1QFOA 3TN0D 3KPMB 3GDBA 5C0AE 1G9NH 2IQ9H 1NMBH 2GT9A 4OZIE 4YHPA 1DBML 4LCWE 3U6RB 3MGAA 1CD0A 1CFNA 2AJ3A 1AY1H 5IQ9A 3CX5J 2WLZA 1LK2B 4ONOA 5KVEH 1HHHA 5FYLH 3OR7B 4CVWA 1TJIL 2Z31A 1P84J 3FQNB 4L4TA 4DCQB 2R1WA 4HC1H 4YHYB 2EDHA 3GSXB 4GBXD 3IJHA 3C8HA 3KWWA 5F7EL 1NFIA 3F6LA 1BZ7A 5IVXA 5JORA 3FONB 1FFQA 2UWEF 3WIIH 4Z7OE 3U4AA 5EBWB 4UU9A 5DJYB 3V52H 3T3MF 5DK2A 5CEZH 4GW5A 4UV4H 3PXHA 2BXYA 5E1HB 2FLBT 5E2UL 4HBCL 4JQXA 1NFDF 5ESVB 1HSAA 1X5ZA 4DKDC 4JM2F 3MRFA 5FGSA 4GXUM 4MMZC 1FP5A 2PYED 2HJFB 5BXFA 5IBTH 4NZDA 1KJ3L 4AQ1B 1S9VB 4Z7UB 2HTLC 1MRDL 2NY7H 3V7AG 5IJKA 4CADB 3L9RB 1B3JA 4D0CB 1YEEH 5DMGC 1H3XA 3AXLB 4WHTA 5J1SC 3GHBL 2E6JA 4HGWA 4F37F 3GSRA 4P4KA 2GI7A 3ZZ1A 3CVHH 1V7NL 2R39A 4D8PA 4H1LA 5GISL 1GOGA 3Q6GL 4OUOA 1CGUA 1FYTB 3A6BL 3MXVL 2P8MB 5B3JE 5IBLC 1VDGA 1QRNE 3HG1A 5HPOA 1MNUH 3MRBA 5J6GB 1LNUA 5DUPL 3SE8L 1UXSB 2VDLL 1NBQA 3IDMB 2PETA 5AZ2H 3A6OA 1PZUB 4NZRH 5GS1C 4WCYL 4OGYH 2H3NA 4PJGB 4I48B 5L9DL 1OGAD 5J13B 5FO8B 1MHHB 3ARTA 3BDYH 3L3KB 3VG0L 1XAUA 1XGPA 3MR9A 1F4WL 3GRWH 2J8UB 5DD3H 4K94C 4GO6B 1I7ZB 3AUVA 1MHCB 3GKZA 2GIYA 3M8OL 5T3XE 4F33B 1SYSB 4UIMB 2Y36H 5GIRA 4NQSB 1JNLL 4YFDB 3P9MB 3N1PC 3UDWA 1Q1JL 1UVQA 2CUIA 5EU7C 1HINL 5HHOA 4ZSOB 3U30C 3HN3A 1HHGA 5LGHL 4G43A 5ALCL 2XI9A 4LSQL 2ZPKH 1IQDA 1OCWH 3U0PA 3C5ZC 3LHPL 2NZ9C 4I3RL 5L8KB 4ODTL 1Y18B 3O4LA 3VDBA 5JPNA 1N5YH 3MBEA 3CSYA 4OI9A 4NQDD 4C83B 1Y0LB 5C9KA 4XMLL 3MRCA 2D0GA 4U6YB 2B4CC 1QBLH 4IRSD 4PJDB 3T4YA 3RQ3A 4JFYB 3WFBH 4DN4H 5EIQA 5JA8B 4KKBC 4WUKH 5E2WH 1CZ8H 4LVHB 3SDXA 1QKZL 1UM6L 2FCBA 2A74A 4KJQC 4NJAL 3RVXC 5C0CB 5BRZE 3DMMA 5FM4A 2FBJL 4JJ5B 1NMCC 5EC1B 2O93L 1U8JB 2DM4A 3ECBA 1L9NA 4U49A 4Z77B 3VXSB 4OM0H 4OIAA 1UYWH 5HHMB 5I15L 2YZ8A 4PJ9B 4RMTA 1IGYB 5E4EC 4U31A 5IW6A 4EDWL 3WE6B 5DR5H 2X1PA 3IDGB 3ETBF 3RWCB 4L3CB 4JREB 4Y2DD 1N6UA 1F4XL 5AZEL 3WHE1 4EI6B 5L0QC 5C07A 4XWOD 1WBXB 4U1HB 4OZHB 3H6JA 1UM5L 4O4YH 1DE4B 3S5LA 3RVTC 2IADB 2V2WA 4YXHH 4HDIB 3WD5L 1QSFD 2A6DB 3QUMB 1EV2E 3FN0L 4WW1A 1TETL 3FT2A 3L7EA 1MFNA 3P0VL 5FHAL 5D1XA 3CFCL 1MIML 3SGJA 4KDTA 4UB0H 1NCBH 3GBLA 3TEUA 1BD2B 3B9AA 3N50A 1T03L 5EO0B 2NXZD 3MRLB 1J0HA 5IHUH 4TUOB 5LCVH 4X8JB 1M6OB 4XVUC 4OZ4B 4U1NA 2NXYB 1K3IA 3BGFC 4OCRL 2EE9A 2G2RB 4LRNL 1XGQB 4XWGL 5FK9B 1GOFA 1JI1A 3PWVB 3WNMA 5C0FA 4OCNC 3I50L 2NY0D 1YECH 2GW5A 2VXVH 4HUXA 5D1QD 4M8QB 5DSCB 2FEEL 1TCRB 2HVKB 1SM3L 5DURB 1NKRA 2F74A 5KOMC 3WFEH 3TO4B 3VFMA 1TCMA 1KEGL 3RIFK 4JFQB 4ZD3H 4CKVX 4I0PC 3V6BR 2AI0H 1RV6X 1B4JL 4X4XA 1BAFH 1W0WB 2EC9T 3MA9H 4PJ8A 2BVPB 3PGDB 4W68A 1QFWL 2QQLL 5D72H 3VFPA 4RGMC 3X14B 4ZUSB 1NPUA 2X4OB 4TSCH 1MRCH 3OR6A 5EC2A 1DUYB 3L95A 3FTGA 4DGIH 5IR1A 4WUUE 4LU5H 4RNRA 3R06A 1ZVSA 4EN3A 4DN3L 1CG9A 4OF5A 1HCVA 3QULB 4MQXD 3F62A 4GQ9H 4KHTH 3QWRA 1AO7A 4XCEA 1HQ4A 1QSEA 3U36B 3A67H 1MH5A 1SEQH 2D7NA 1BIIB 5BS0A 3B8SA 5HJ3A 4I9WD 4Y1AD 4MHHG 1DEDA 1S9KC 2CKNA 4ZXBD 5GRUL 1KIRB 4WI7A 2I60L 3QUZC 1SBSL 1FLRL 4ONHB 1A1NA 1A4KB 4RGNC 5ESAA 1LO4H 2X1OA 5TF1H 5GS0D 4R7NA 4KQ3L 1R5IB 2P5EE 4OI8A 4LCIH 3P9LB 4JHWL 1R6VA 1F6AA 4KFZC 1KCSL 5AG8A 4KMLB 2ICWA 3EO9L 1MY5A 1WFTA 2EIBA 4XBPB 1YZZA 4TVPL 3TCLB 2Z92B 3D9AH 5HY9A 5KZCB 2AQ3A 5D2LB 3INUH 1ORSA 4J3XA 4EBQL 4FFZL 2R69H 3KJ6L 5D2NC 5TJWK 1DN2A 3RWEA 4AEIH 3TZVD 4M02A 3BIBX 1HWGB 5TF0A 3CC5A 1DQJA 5HSFA 5B39A 4Z78B 1T2JA 2QKIB 3C2AL 5D7LD 2UWEE 3SJVE 1ZLVH 3WCYA 3FL7A 1ZK9A 2X7LA 4Z18A 3QDGD 2YPLD 3CVHB 5DEZA 5I74B 5IHZB 2XWJB 4KZDL 2AW2A 1DBAL 1JHKH 3H7BB 4EIGB 1GH7A 5DRWA 1NFDE 2WIIB 5LXGH 2V17H 4WFFE 2EXYC 2FX8L 3T8XB 3NCBB 2F53B 1S7TB 4RWHA 5I2IB 4DFHA 3GM0A 2EDKA 5DFVD 4JFOA 3O0RH 4KHXH 4XBGB 1I8KA 3IS0X 4G8FA 3HC0A 4L8SA 3U7YH 4EJ1C 5KANI 1T3FA 2F54E 3OXSB 1N7ML 5KS9A 4KY1L 1TTUA 4XXDB 4PJ5D 4GLRI 3NAAL 3N06B 3NFPB 4X7SH 1CQYA 1G7QB 4M93B 4WI8A 1NC2A 1YEIL 1FNLA 4M43H 4G3YH 3DETD 4FQ2H 1NDGB 2DMKA 3AC0A 2R0ZL 1LP9B 5DT1H 5F89A 5EFIA 3CMOH 3RGVC 2Z91A 2G9HA 1Q8MA 2BZDA 1YA5A 2A6KB 4NBXB 2ZCKH 5I1JL 4IMKA 4NZJA 2YMXL 3SPVA 3U9PL 4TNWF 1XIWC 1YEGH 1IAOA 3DUHA 3M1BB 1FDLH 3T0XA 3FJTA 3EIFA 1AI1L 4GLRH 3MODL 4JRXA 1AP2A 3TV3L 4YHKH 43C9B 1KBGH 4KRPD 4HJ0C 3P0YH 2IBGA 3T0AA 1Q94B 1JJUA 4UINL 3UAJD 1MCLA 1IEAA 1A9BA 3JV0A 1VADB 3RJQB 1J88A 1IAIM 4J1UA 5D6CB 2VLJB 1HOCB 3STZB 2FJGA 2LE9A 3ORJA 4HUMB 5KVDL 3U1SH 3HCVB 1NLBH 5IMMB 2WUBH 3GUTB 4YX2H 1H5BB 3IFOA 2DIBA 3GI8L 4V1DD 3PWPB 3IXTA 5D1ZC 1PSKL 5FDWA 4PRAB 4MJ4A 3BZFB 4OLYL 2WWKO 2YUWA 5CSZA 4FZ8L 4FQCL 5FM8A 1HHKA 1OGAB 3HA0A 1EAPB 3MGOB 3EUUA 5INDB 2AKRB 4PJEB 4HGMA 4N0CD 1QVOB 4PJAB 4JGUA 1NEZA 3WL9A 1J1OL 1RK1A 3W2DL 4HEME 3PL6A 4S0TD 3ULVL 4WFEE 4XPBL 4Y4HA 2EZ0D 1C5CL 1ZOXA 4RX4D 3D3VD 3I2CH 5DJXB 1OT1A 2Z8SA 1KV3A 2QSTA 2VMFA 4KTEH 1KN4L 1DLFH 2GK0A 1J12A 2VISA 3MRJB 4WFHD 1ITCA 3CFKA 4Z8FL 4OZGB 5EN2A 1NGQL 4G9FE 2BNQA 1N5AB 5I1CL 3VFUA 4BQ8A 4HCRL 3S37X 1OAXL 3QAZB 4FQXC 3OQ3B 3GSVA 5DD6A 2R15A 4YBLC 4S10A 4CVUA 5F44A 3L3DA 2NNAB 2PR4L 4BFBD 1NC4A 4LLAA 3ZTNH 1IAKA 3CZFB 5HGGS 4JM4L 3ELAT 2VDKL 2ADIA 5E7FA 3SBWC 1QFWM 3OJDA 3WKML 1BREA 3X3GH 1M4KA 2R0WL 4E5XB 4YDJB 4GRMA 4NPYA 5JW5A 4NIKB 3ZL4H 4LGSB 1KNOA 2BJML 2KQNA 4H1LH 4DZ8A 2FWOA 4N0UB 2OJZL 4PRPD 3SOBH 3GSNL 2LV4A 1W2KT 4ERSL 4JFEB 1EEYA 2VB5A 4MDIA 5CJ8A 3AB0C 4KRLB 3NA4A 4OZFG 3VXMD 4K3EH 4K8RC 3ZTJG 1DQQB 2H6PB 3FQXA 3IFNL 4CBPA 4CW1A 4RMUA 3EYUL 1JUFB 1D5ZB 3CDCA 1IGIL 1XFPA 5E00B 1U8KA 3QIBA 4PJFA 1NUFA 1QSFB 3W5MA 2C3HA 5GS2H 3RX7A 3GMNA 3TA3C 4I8DA 3ZE1F 2DICA 5C08D 3TNMA 3V4UH 5L2KA 1AGEB 5L6YL 4Q9RL 3HMXL 1VFBB 1NCAH 3UTTE 1HYSC 4FABH 3O8XA 5I66A 2NY5L 3E0GA 2EXWD 2EE6A 1AHWB 4R8WH 5FM5M 3JV6A 5HHVH 5F88A 2H8PB 3QXAB 4DTGL 4KRMB 4DW2H 4MGXA 1F13A 1U8PB 2DM2A 2PW1A 4C56D 2L0DA 2MNUA 4P2QB 3JUYA 1P84K 4YIQB 4PY8J 3IDNB 1WAAF 3L7FA 2NY0B 1FHGA 2NR6D 1A7PL 1AFVL 2ARJA 4L3AA 4NWUL 4QNPF 1BWWA 3V0VA 2HFGL 4RA3A 1HYRC 5F7WC 1XGTA 2IWGA 3FFCE 2Z35B 4YR6A 2DM7A 3WXVL 2NZIA 5JOFA 1BJMA 3ARBB 3AU1A 1BX2B 2OL3B 3RWIA 4P9HL 2Q6WA 4HBCH 1WSST 3WSQL 5F1OB 5IF0B 3DJ9A 2Q8AH 1F6LL 1CWVA 4NT6B 2K7QA 4HCRA 3IDUA 3SY0A 1QFUL 2FEDD 4MJIB 4UIKL 5F6HJ 4Q6YA 5CD3B 3TBVA 2J8OA 3W81A 5CS7A 2YD9A 1EO7A 4S1QL 3IFLH 1DEEB 2RBLA 3Q48A 3FOMA 4JRYD 1P4BL 4F8TA 1D5XB 5TQ0L 4NQEE 2A73B 1DVFD 3RX8A 4JHAH 3GHBH 3GMOA 5GGTL 4WJ5A 5I75C 5DJ0A 1DL7L 4PRHE 1TZHA 1D5BA 4N90D 4WENB 1AD0A 4NGHL 4N5UA 1OM3L 2HJKA 3J7HA 2R23B 4J23A 3C6LC 4RGNE 3GSNA 3REVB 5I18H 2DD8L 3FZUC 3MXVH 3PNWA 3VRLF 4XI5D 5CGYC 4NN6C 5A2FA 3QPXH 1PLGH 2QHRL 5SWZD 4P57B 3QIWB 4OF7A 4WV1C 4R97B 1XH3A 4TN9A 2FO4B 1AJ7L 5DZNA 4WCYH 1Z5LB 1ULVA 2EDXA 2FJFA 3QO0B 3QIUD 5L9DH 5D2NE 5E99L 3DV6B 3TESA 4G8EB 3TIEA 2XKUA 3BOVA 2VOTA 3OHXA 4AMKL 2XN9E 1L9MA 3IGAA 5C2BL 1OWWA 4X6BB 3HLAB 5FA4A 3HMXA 2EDQA 2DLIA 3GFUA 5C0RL 1JYNA 3O11B 4ZTOH 1UKSA 3RPKA 4PLJC 4HUNB 1L7TH 1Q1JH 3GI9L 2P24A 1H8OA 1WTGT 4KKLC 1YUHA 2XIDA 5CJXC 4FHBD 5TE7H 1ZTXL 1VERA 2YOCA 3L1OH 1HINH 3VXOA 5DK0A 2DBLH 2WV3A 1F2XK 4IRZH 2P44B 4X9IA 2FB4L 5DJ8B 5LGHH 4QRPE 4HH9B 5ALCH 3RY6C 5ICYA 3D0LB 3CH1A 3S4SG 1T7XA 5ILTL 5HYSA 5D6DA 3F12A 1WV7T 2FIKA 2XPGB 4LL9A 3MUZ1 3MRQB 5SWSA 2DQTH 3FAWA 1FC2D 5ERWA 5C6PB 1ACYH 4E41D 4M5YL 1HEZB 5FGCE 2I9LB 1ODAA 3CSBA 2GT9B 2DBJA 3ALWA 5GSVA 5A43C 3PGFH 4YC2B 4YHPB 5EUOA 3TGXA 1IZKA 3CDFA 3CLFL 1CFNB 2BVUA 5C0BA 2MQCA 1FZKA 1EZVX 1HHHB 3MZGB 4LHJB 2YPKA 2IPTL 2Z31B 4XPGH 1QTYT 1A21A 4L4TB 2R1WB 3A6CH 1B0GA 3IJHB 4YXLL 1QEWA 2FBJH 4KVCH 1NFIB 4GRLA 1BZ7B 5IVXB 5JORB 25C8H 1H0DA 3QRFM 2P5WA 3F58L 1YEHL 4UU9B 2IFFH 4KH2A 3H9SA 4BSJA 5DK2B 4GW5B 3O9WA 3Q1SH 3W0WE 3WO3B 1FAIH 4UNVA 2J5LB 5GGTA 4MAYD 5TGBB 1OP5H 5BW7A 1HSAB 2UUDH 2C7UA 3WD5H 2AQ1A 3C09B 3VD4A 5E08H 3W5NA 4YDLC 4XP1L 2HLFD 5ANME 15C8H 2CRYA 4OT1L 2FEEI 1V05A 3KPSD 3GSUA 3T1FA 5HHXH 3NCJH 2X4SA 3CFJA 4WHTB 1I9IL 3TJHD 1T03H 4HGWB 3GSRB 1QHOA 2AK4A 3ARED 1EXUA 4LPTA 4JO1L 1IZJA 3SDAA 4F15B 1P53A 5I1DA 4P5TA 4WDIA 4D8PB 3BZ4A 5M95B 2NY2C 2A9NH 3MJ9L 4LRNH 1TNMA 4P3CL 1JE6A 4MXVF 3V4VH 4CJ1A 3HG1B 3I50H 2UVFA 3MRBB 3ZDZF 1LNUB 2DQIL 3GK8L 4Y19A 2AQ2A 1LK3H 1EPFA 1SM3H 4XAWH 1D3CA 5T3XL 1BQHG 5E2VH 2F15A 2P49B 3N1QC 2H3NB 2DJSA 1RFDL 5C0AA 3VWJA 2GY7B 1DTUA 35C8L 4OZIA 1XGPB 3MR9B 3SHSA 4LCWA 3GMMA 4JVPA 4NNPH 1NLDH 4K3JH 1TZIA 3I75B 5GIRB 3FQRA 4ZS6C 3MOBL 4K71B 4Y4KC 2VR4A 3KXFD 1D7FA 4JFDD 1UVQB 3GKWH 1EFXD 4NCC1 1JNNL 4HX1A 4MJ6A 5DUML 4DN3H 5HHOB 1T2QH 4M1CC 1X5FA 1HHGB 1M05B 4G43B 1G84A 1IQDB 3U0PB 1KB5L 3DX9A 1TLKA 1EEQA 1U93A 3VXRD 5EOCJ 2H1PL 2FJHA 3P4NA 2H2SD 4C58B 5CILH 3RTQD 3O4LB 5FUZL 3ZE1E 5JPNB 3AMLA 3MBEB 3CSYB 1ZAGA 4CUCA 1FFOA 1FLRH 3MRCB 5CHNA 2R0LL 3WHXB 2VDMH 2XZQL 3T4YB 2H32A 3WUWA 4RAVA 4LNRB 3SDXB 2A1WH 4HS8H 1CDJA 2A74B 5F8QC 4Z7WF 1A7RH 3DMMB 4TVPH 4R26H 5E6IA 3UJJL 3ECBB 3VXQA 4EBQH 3MJ8A 4ZS7L 1WLHA 4Y8AA 5I1KH 1WICA 3LEVH 4EIZC 5IW6B 1WAAE 1K85A 3KPQA 5I8EB 5C07B 1S9YA 4JB9L 4QNPE 3QZWA 5KW9H 1UKTA 1EFQA 2JB5L 2XZAL 3C2AH 5F7FA 1QRNA 2E9JA 1WCBA 1F97A 2G5RA 3S5LB 3NA9H 2V2WB 1DBAH 3OKLA 2UVEA 3DYMA 3T0BA 1PGRB 3E8UL 4YAQA 1FSKC 4JFFD 4QCIA 3MJ9A 2DQEL 1BVZA 4WW1B 1TVBA 3FT2B 3L7EB 1V7ML 4HUUA 5FOBA 2FX8H 3X11A 2F8OA 2JJWA 4IMLA 5D1XB 2XNAB 4PD4K 1P4IL 1U2CA 3HNSL 1AKJA 5ENWA 3DYPA 4FTVE 4U1NB 4LOUC 2CKBL 1Z9OA 4W81A 3RZCA 1E4WL 1T5WA 4G5ZL 4NC0B 4FQPA 5IMLA 2OR9L 3HI6L 5C0FB 4JGMA 4H0HB 4IHOA 1I7RB 1PBYA 4PJXF 1OARL 5E5UB 5K59E 1GXEA 1IGJA 4HUXB 1DN0A 4ETQA 1GC1H 4QHKJ 4IRJD 2BVQA 3FCTA 3LDBB 4KI5D 3VRLE 4IDJH 2F74B 1L7IH 1LDPL 3MUHL 3U82B 2Q3ZA 1DUZB 5C0JA 1PKQE 1PJ9A 4X4XB 5IEHA 4PJ8B 1KB5A 2IAMA 3T0EE 1MHEA 4FMKA 4MXQD 4NUGL 3LCYA 3TV3H 5IB5A 5EC2B 3OR6B 3L95B 3FTGB 1KJ2H 3V6ZA 4JZNA 3L3JA 4RNRB 5DHVA 4UINH 3R06B 4Q9QL 1RUML 1ZS8A 1ZVSB 5BRZA 4EN3B 1IE5A 1CG9B 4Y7MA 1AIFB 2EECA 3Q3GA 4PV9A 4PJ9C 4NN7C 5T1LA 3MLTA 2HT2D 1AO7B 4XCEB 1QSEB 1UB5A 5D7JA 2DN7A 3O41A 1MH5B 4JREC 2Y4SA 3GI8H 1QBAA 5BS0B 3HZKA 5HJ3B 4OLYH 2ZOKA 1BMGA 4FZ8H 4X80H 4FQCH 3TYFA 4HMEA 3UROR 4BZ2L 1F5WA 1NANI 4M5ZL 1SVZA 5EZLA 1CTNA 4WW2C 2UV3A 3GM8A 5ESAB 3W2DH 4R7NB 4NHCL 1DBJL 4IS6A 4XPBH 5CEZD 3NTCL 4P59L 1OF2A 1F6AB 4JN1H 4M6AA 4HMCA 2A77H 1V5JA 2ICWB 1TPXC 1L0XA 1XF3A 4Z95L 1RD6A 3CX2A 5HY9B 1ORSB 3NFSL 3OBAA 4J6RL 3BP7A 4HFUL 3D1MC 4KROD 2EDTA 5AWNL 3RWEB 3HZYA 4FOMA 3H2WA 4HCRH 3CC5B 1DQJB 2BHZA 1ZT1A 1OAYL 2Y7QA 4X4ME 2UY7A 3OJMB 5GJTL 3VWKA 3FHQA 3SGDI 1LO0L 3BI9X 2APVA 2BCKA 3NCYS 3FN9A 2CKBA 2PR4H 4AT6A 3NFNA 4CN6A 3HFML 2K1MA 2HFFA 2GJ6D 3AM8A 4YH6A 1A6AA 5DRWB 4BFIA 5DEGA 5DMIL 5KBNC 1OLLA 1PD6A 3CSGA 4JFOB 3E6HA 4S1SH 3U7AA 1I8KB 1G9MH 5ACLA 5LJYH 4G8FB 5JOPD 3HC0B 4L8SB 3GJFK 2OJZH 5DVLA 1T3FB 5EO9A 4FG6D 4TVSa 1RJLA 4ERSH 4WUUA 1F4AA 4QTHA 4TSAH 3SGDH 3IS1X 2EDWA 2GEEA 1HWHB 1NC2B 5IFHL 1MCEA 4MAYB 2EDDA 4XNYL 1S7UA 1WBYA 3JWOC 1ZT4A 1JTTA 1Y6KR 5EFIB 5F89B 2NY6D 3OGOE 5DMKA 3VRJA 2Z91B 3IU4L 2G9HB 4R2GB 1DANT 4MXVE 2NY3D 1CE1L 2BP3A 1AQDA 5L6YH 3ZDZE 3SPVB 2V7HA 1IAOB 1KPRA 4XP4L 3RNKA 4PJBB 1FE8L 4JY4A 1AGCA 2DQGH 2P5EA 4JRXB 1AP2B 3RPIA 3QRGL 4HW6A 4P46A 5BO1L 5C09E 4W4NA 2ATKB 1JBJA 3D87B 4KK9C 1S3KH 1IEAB 1DQLL 4DGVL 4XVJL 1PDKA 4J1UB 1BBDH 2GY5A 1P1ZA 4LHUD 1CGTA 3MLZL 4HXAH 4K94L 1FJ1A 5E8DL 1A7PH 4P5KA 3IFOB 3WO4B 4LBEA 5FYKE 4JFXA 1RIUL 2JB6A 1DBKH 3IXTB 2YA2A 4P2OD 2HFGH 4WI9A 2AP2A 5FDWB 5A2KH 3FO1A 1I1RA 1WFUA 5CSZB 5HDOA 5T3ZE 3TN0C 5FO9A 1YEKL 1HHKB 3GB7A 4LPWA 4J3SA 3O45A 5I74C 2UWEA 3SJVA 1BJ1H 2PUQT 3DUSA 5JIKA 1CXKA 1NEZB 1RK1B 5T5NF 3WL9B 3PL6B 5JPMA 5T1MA 4Y4HB 4UDUA 3RI5K 1MLCB 3ARGD 4JR9H 1NFDA 4N9GA 4UIKH 1NBZA 4FN0A 1T0MB 4OLEA 2SEBA 4RIRA 3QEQD 3G6JA 1NAML 1IKFH 2W1NA 2XQBL 2VLKD 1RY7B 2GK0B 4M4RA 5KSBF 2B4CL 2VISB 3CFKB 5EN2B 4PBVC 2AEQH 2XRAH 2BNQB 4Z7WE 3RP1A 3VFUB 5IT2H 4M93C 4NYLA 1RZ7L 3JVGC 4AEFA 2CXGA 4ONGH 5DD6B 3PG2A 3I84A 2DD8H 3NPSB 1KIQA 4F57H 1CLZL 3L3DB 3P4OA 5FEBA 1NC4B 2UYLA 1IAKB 3GHEH 2NY1B 3WNLA 1MCPH 1IKNC 2QHRH 4NM4H 2NW2A 5E1AA 3OJDB 1T7VA 4GRMB 4NPYB 5JW5B 4MA8L 5TQ2L 4W70A 4QF1B 1XGRB 1FH5H 1KNOB 2Z0BA 4FNLL 4YDKL 4DZ8B 2BOCA 2FWOB 3TM6A 4OV6F 1LMKA 5J12C 3VMNA 4C4KT 2HT3D 5T5FL 2DLHA 1EEYB 1S7WA 3B3IB 4X8XA 4MDIB 4NCC2 5ELIA 2VNCA 2E6QA 3EDJA 3GI9H 3FQXB 4H8WC 4CW1B 4HBQA 3D39E 4H5SA 1CR9L 2NTSP 2Y6SC 4K23L 4QHLA 1ZLUK 1U8KB 2X4PA 3QIBB 1I1CA 2FB4H 4PJFB 4JFFB 5GS1A 1BVLA 3GMNB 1JHLL 4R9HA 3K4ZA 3TNMB 5GZND 1M7DA 3LEYH 4RMQA 5L2KB 4PJXE 5L7XL 1EO8H 2MQ3A 1A3LL 4DEPB 1HXYA 3CCHB 4HAGA 4YHML 4Q0XL 3O8XB 5I66B 5I30L 5EDXA 3JV6B 1U8IA 5F88B 3WLBA 4WGWB 2E3VA 1J1XL 2WINA 4UAOC 1CI5A 2LAAA 2OTPA 4XCCH 2CO6B 3D18A 5I8CA 2Q7NA 3H9ZA 3WS6C 2PW1B 4Z7VF 3X13A 3GZKA 5LQBH 1T1XB 2DI9A 2IPTH 4HT1L 3L7FB 3QHTC 3SDYL 2VSCA 1QR1A 3C5ZA 2ARJB 3L6FA 4IOFD 2XA3A 2HH0L 4G9FA 3V0VB 4QXWA 1NAMA 4YR6B 2OZ4H 1YEHH 3AU1B 2AEIT 2JJVA 1KJMA 3RWIB 4IRSC 1KELL 2OMNA 3HNTL 1NCDL 3SY0B 5J6HB 1FO0L 4R96A 4YHZL 1FN4B 4PBWD 3EFFA 4FRWA 3DRTA 2D7OA 2X1QA 4MS8C 1G0DA 1FNHA 4HWZA 4MX7A 3SGKC 3TBVB 5BJTA 1WC7A 4KDWA 2VLLA 3VI4E 2X05A 2ITDA 4OB5L 2JELL 3FOMB 3PHOB 2CGRL 1INDL 1X4YA 1P9MC 4AL8L 3GMOB 1GGUA 4LRIC 4WJ5B 4Y2DC 5DJ0B 5M7QA 1FL5A 4JO1H 4WU7A 4XWOC 5EBGA 1OAQH 1TZHB 1D5BB 3TBWA 3EJZD 4ZTPL 3QSKB 3MV9E 2JE8A 4BZ1L 3GSOA 2FD6H 4YHLL 3MJ9H 2CMRH 3GSNB 4XCFL 2Q3AA 5T5NG 3MGTA 2IALB 4MLIA 5ETUA 2DQIH 3GK8H 1JFQH 3MO1A 3MV7E 2MKWA 3ET9F 3MJ7A 4FQIH 1XH3B 5F7NC 4Y0GA 2NXZC 3UTTA 1AHWC 3EDDA 4U05A 3JWDH 4QHUA 1N4XH 3MRDB 3OHXB 1K5NB 3IGAB 4P23D 2MFNA 1HILA 1O5DT 1IEBB 5FA4B 3O2DL 1HCFX 5I17A 4HIXH 4XNMA 3PWUA 3PP4H 1QD0A 3CMGA 3BIKB 2NY0C 2P24B 4PJHF 1YUHB 5D1QC 1QP1A 2BFVH 3OKOA 3VXOB 3DURA 2E27L 3ISWA 1OVZA 2FLRT 3THML 1FRGL 1JPSH 3LZFH 5ICYB 3CH1B 4I0PA 5HYSB 3F12B 4M8VA 2FIKB 3RHWF 5SWSB 5ERWB 5E9DE 3BXNA 5FUZH 5DHVH 1LEGA 4ISVA 5GSVB 2G60L 2R0LH 5EUOB 3TVMD 2V5YA 4M7LT 1H8NA 1RZJC 5C0BB 1I9JL 1FZKB 1ZHKB 3MROA 4NQVA 3TT1H 1ZEAL 3C2SA 1KEMH 5BMFL 2VXQL 1Z3GH 2VLRE 2YPKB 1FO0A 3RA7L 3ZMRA 1JN6A 3PDGA 1B0GB 2JIXA 5GRJH 1QEWB 4NQEA 1GAFL 3AS3A 3UJJH 4PTTA 5HYIA 4PRHA 4GRLB 5ISZD 4YDIL 1H0DB 2NY3B 4ZXBC 2P5WB 3I3DA 2OTWA 3QUZA 5JIHA 4KTDH 3H9SB 3L3GA 4G6FD 5D7SH 3OX8A 3O9WB 5GS0C 2V9QA 4XBEH 4R4FL 3VGBA 2ZUXA 5EU6E 2I07A 3VG9B 5MHSD 4GAFB 4KK8D 1PX4A 2BHYA 3UBXA 3MRMA 2C7UB 2DQUH 5DJAA 4B41A 3QIWC 4L9LC 5FFLA 4QWWD 3MUJA 4QY8B 4G8GE 4ZNEE 1MCOL 3G9VA 5CKAA 2H45A 5J1AA 2XTJB 2O61B 4QRRE 1LEKA 5D2NA 1T80A 3V6OC 4W4OC 2H26A 3D85A 1X5LA 1MCFA 2X4SB 3CFJB 4KXZH 3TZVC 3CXDL 1XR9A 2AK4B 3HNSH 3WFHA 1EXUB 2RJMA 5FUCE 3QDAA 3SDAB 4YEFA 2CKBH 2E6PA 1AXSA 2F19L 2FL5B 4NC1E 4P5TB 3BZ4B 4WDIB 3SKJH 4G9DA 5KSBE 1G7JA 1OQOA 3DVNA 1VPOH 3HI6H 5HTSA 3MLXL 4YLQT 3O2DA 1OARH 2YA0A 4QRPA 4Y19B 3ARGB 3DV4A 3S97C 1W72L 3UYPA 2WLYA 5DFVC 3JSSA 1MJ7L 4HLZG 3LEXA 5E8EA 5JQ6L 5C0AB 3VWJB 1AGDA 2EC8A 4OZIB 2YK1L 3AMKA 3DBXA 4I13B 4LCWB 2DQCL 3GMMB 1LVEA 1TZIB 4NUGH 4UTBH 5IGXL 4U1JA 3BPLB 3DETC 2EH7H 2PYEE 1E0OB 3S34H 4WFFD 4JM2D 3L5XH 4O58H 1KJVA 4HS6A 1J8HD 4JO3L 4HX1B 3RGVA 1RUMH 5HHNA 4Q9QH 4MJ6B 3RUGF 3DI2B 4YHIB 5B8CB 3MUGB 1KG0A 2F54D 2NYYD 3MLYL 1XIWA 1KPVA 1INEL 3N1MC 3DX9B 5E5RB 2R8SH 1A64A 3HRPA 1U93B 5H2BA 2FJHB 4K8RL 3P4NB 3W0WA 3JV5A 1YC8A 4M3JA 3QFDA 2J4WH 1ETZB 4KRPC 3B5GA 3K2UL 3RAJL 1FFOB 1A7OL 4BZYA 3BAEL 5CHNB 3REWA 3UAJC 1DBJH 2DDQL 5JXAH 3A0OA 2H32B 3WUWB 2D4FA 1QA9A 3U2SA 4I2XE 1P7KA 4MNGE 4RAVB 5ANMA 5CLWA 3T2NL 1UH3A 1IEHA 1CFQA 3K8LA 3ZHKA 3W82A 5ID0B 5D1ZA 4LARL 5E6IB 1CLOH 1YJDC 3OF6D 3VXQB 4MCYB 5TFSL 2X10A 4J6RH 5JHLL 3MJ8B 4HFUH 4I0KA 5CCKL 3P77A 5AWNH 1VACA 4H88L 3QXVA 1J8KA 3KPQB 1MPAL 5SX5K 1I9RL 4N0CC 2O5XH 1MCKA 1BP3B 1S9YB 3WNNA 3VFSA 3QZWB 5GJTH 2EZ0C 1QRNB 3BWUC 3TBTB 1XMWA 1WCBB 1JGDB 1RVFL 3OKLB 1UWGH 2R4SH 3HFMH 4YAQB 3TH2T 5IWLC 5FDYA 4QCIB 1IGCH 5F1NA 4ZODA 3U7WL 1T1ZA 1TVBB 2APWA 4HUUB 5FOBB 4MA1C 3X11B 3MV11 2HTKD 3BMWA 4IMLB 1GRWA 3CFBA 4LLDA 3FRUA 4IM8A 5LBSL 1W72A 4OIIL 4HJJH 3S4SA 3MA7A 1N3NB 2R2CA 2OI9C 4UNTA 4FQXA 4NZUL 4K71C 1NH6A 5TE4L 3RZCB 4XMKH 2R56L 5CAYB 1T5WB 1D5MB 1BQLL 3IAPA 5ITBH 3CSPA 2IJ0C 5IFHH 3SCMD 3GMRA 5IMLB 1CCZA 4XNYH 3DRQA 3CK0L 1AXIB 1CE6A 1IARB 2YZ1A 1MCWW 1KPUA 3SBWA 1IGJB 1DN0B 1F58H 4M7ZB 4ETQB 1U95A 4A6YL 5DA0B 2FHCA 2BVQB 3FCTB 1FIEA 3BHBA 4XNUL 5FHBH 3MNZB 3DHMA 4UUJA 4YBHA 5ICXA 1MFCL 5IEHB 3IF1B 1KB5B 3S35L 1K8IA 2IAMB 1B0RA 2DYPD 3I9GL 5IB5B 1CICD 4OTXL 1IM9A 2W92A 4M1GL 1MJJA 4ODXA 3V6ZB 4JZNB 3L3JB 3JZ7A 1YQ2A 5I1AB 4DGVH 2J7LA 2R2BA 1ZS8B 5BRZB 2BK8A 3TA3A 2W38A 3MLZH 3Q3GB 4PV9B 5T1LB 3MLTB 5HHPA 4DWHA 3VGHA 4Y5VC 1UB5B 5D7JB 3ZT6A 3O41B 5C8JA 4X7FC 3MXWH 1WAAA 4ZFZA 4TUJA 1DQDL 4WFGD 3HZKB 4LNVA 2ZOKB 2EXWC 1PG7W 1C1EL 3TYFB 4Y88A 1Z0MA 5KAQF 4NFCA 3U4BH 5I1HL 3O81A 5IFAL 4HHAA 1LO5B 3DNKA 5EOCL 4LPUA 4X7TA 4ODVL 2XWBA 2IBZX 1OF2B 2EEAA 2P8PA 1B6DA 4OCXL 2ED8A 1G6RH 3KPTA 4JANB 2NR6C 2VH5L 1XF3B 1NAMH 4LLYA 2AJYL 3QCTL 1CXEA 1WCQA 1BOGA 3HNVL 4LPYA 4D0DA 1KCLA 1EJOH 4HMDA 4WRLA 4FTVA 2XWTB 2DJ4A 2ZUTA 2BRQA 2DAVA 3HZYB 4GG8A 3S6CA 1CGXA 3PWJA 1ZT1B 2X09A 1X7QA 2Y7QB 3CLEH 2W9DH 3VWKB 3B9KD 1TJGL 2BCKB 2FEDC 4AEEA 4X5WA 2CKBB 4G6AD 4AT6B 2HG5A 3NFNB 3O6ML 2HFFB 4BJLA 2AJUL 2E7LC 1A6AB 5HYEA 1N2RA 1IGFH 4BFIB 4J3WA 3FFCD 4ZFOL 5DEGB 2GJJA 3ARDD 4XC1L 1PKQA 1DVFC 5TQ2H 1JGVL 4C55A 4I9WE 4A6YA 4FNLH 3T0EA 3N1GC 43CAB 2BRRL 3RNQA 5EO9B 3N9GH 3C6LA 1RJLB 4JEGB 5T5FH 1CDGA 4WUUB 1OWRM 2HP4A 3B6SA 4QTHB 1E6OH 1G0YR 1P4LA 1U2HA 2XT1B 3EO0A 3MOAL 4ACPA 1S7UB 3ZKND 1I8IA 4K23H 4OD3L 1ZT4B 2FX7L 4WV1A 4XTRD 4P9MH 3VRJB 5DMKB 4RFEA 1T83C 1SQ2N 3EDEA 1CQKA 3QIUC 3DSNA 1AQDB 3V6OE 5L7XH 3DARA 4G6KL 1A3LH 4OCLC 5B38G 2V7HB 1J0IA 1KPRB 3RNKB 4YFLF 4YHMH 3MSPA 4Q0XH 4JY4B 4OLUL 3RDTD 5DHXB 1AGCB 2BNRD 5E8OA 5ADOL 5D7LE 2P5EB 4P46B 1J1XH 2XG4A 3QDGE 4MNHA 2YPLE 5FYKL 3O6KL 3S3PA 6FABL 5DEFA 4JY5L 1WVZA 4KK5D 5T3ZL 1P1ZB 2YN5A 3RY6A 1I1AD 1FGNL 3SDYH 1QPXA 1FJ1B 5AYUH 4P5KB 2D0FA 2XFXA 4NKOA 4LBEB 1KCVL 4JFXB 2XN9D 3LPGA 1JZ5A 5TDNB 3TBSA 4M7KL 3QG7H 2JB6B 3O3BA 3CD4A 3RUGE 1YY8B 3FO1B 4I77L 4MXWH 2PO6D 1OL0A 5ICZA 5FO9B 4X4MA 4PJ5E 3GB7B 1CT8A 3O45B 5MI0C 2UWEB 3SJVB 3UBXI 1KELH 3HAEA 1NCDH 3DUSB 1A6UL 1C8PA 4DVRH 5JPMB 4YHZH 5F70A 5T1MB 4ZMAT 1F2QA 4UDUB 4AIZA 2YA1A 1NFDB 2WK2A 4N9GB 1NBZB 3DPBA 4JM2B 1PG7L 4YPGA 2SEBB 4RIRB 5EG6C 2EKJA 3ME0A 3G6JB 4L8SC 4BQ6A 1NSNL 1F3DH 2C4XA 2JELH 1JZ2A 3IT8D 1UWXK 1BHGA 1INDH 4DKEH 5C2UB 1JZ4A 3VCLA 1WBZB 2F54B 4ZFOA 3QDJD 1BZQK 3MLSH 3K4AA 1A6ZA 4NYLB 2D4DA 3BZDA 4HD9A 4MAYC 3KPLA 4XCNA 3NIGF 3WFCL 4EXKA 4GS7C 3HI1A 1KIQB 3UPRA 3SDDD 3LIZH 3NH7L 3LQMA 1ORQA 2UYLB 2I5YH 2V5TA 4HH8A 1HDMA 1NUGA 1FVEA 2HLFC 2V9RA 4WU5A 4YGVA 4PGDA 2DLEA 2NW2B 4UT6H 4POZD 5E1AB 1HI6A 4V1DE 1KCRL 3K7UA 5GJSL 4XP5H 3TJHC 3VDCA 1T7WA 5GGQL 4L4VA 3AREC 1MUJA 2BOCB 2KH2B 1A5FL 3P4LA 2QQKL 3FQWA 2P7TA 4M7LL 5C09A 5DVNA 4B50A 3FOLA 1CK0L 1S7WB 2XKNA 2CH8A 4CMMB 1IBGH 4FQ1H 3QNYB 3GJFH 4J2XA 5I1EL 4TQEH 4HZAA 3WO4C 4H5SB 3KLAB 5FCSH 1RIVH 4QHLB 5HGDB 3GIZL 5HPMA 2X4PB 3EJJX 3TJEH 3VJ6A 5F1IA 1BVLB 1ZGLA 3CUPA 2J8HA 1UADC 4U3HA 4WFHE 1M7DB 2DWEA 1HXYB 2X4UA 2WUCL 4Z5RA 5HI5C 1CBVH 4PY8I 1C5BH 1X5IA 1U8IB 4E0RA 3WLBB 4Y4KA 4UZGA 1UC6A 2WINB 1ZVYA 2B2XH 3C8KA 4Z0BL 3VFWA 2BOBA 3D18B 3KDMA 4ZUTA 5I8CB 3BEVA 1ZEAH 3U30B 1NGWA 2B1HH 2A9ML 5BVPL 4MJ5A 2P42B 2XKSA 3B2UD 5L8JB 2J8UF 1RK0A 1QR1B 5D7IF 2A83A 3S3SA 1GAFH 2EDBA 2ITCA 4G9FB 2EYTA 3NIDF 4Z7WA 2H2SC 4P49A 4YDIH 5T33L 1SYVA 5DLML 1RJCA 1NAMB 4PRPE 3RTQC 4OF0A 5F6HI 5HXMA 5BZWA 4QXUH 1Q0YH 3SO3C 1KJMB 2ZJSL 1I8MB 3HR5A 1NCCH 3VXME 4N0FA 3TT3H 3LS4H 3HS0A 4CADA 2AABL 4R96B 4MVBD 3CGTA 5MEOA 3BUTA 4DOHE 1IRAY 4GW4B 3EFFB 4JDTL 4L3EA 3DRTB 1MCOH 1DCLA 3V0AC 1JYXA 1NMCB 1A6PA 5BJTB 1GSMA 1LO3L 4MA7L 5BV7B 2VLLB 5C08E 2YSSA 4KAQL 3HB3D 2ITDB 4BUHA 3LRGA 1EVTC 3WKNA 4TOYH 3B2VH 5E4EB 1MY7A 3WDHA 4Y16D 5I9QC 2HKHH 1FV1A 5B3NA 5L0QB 1FL5B 3L5IA 5DI8A 5IUSA 3C5JB 4WU7B 3TBWB 5J6GA 2D9QB 1QOKA 2GTWB 1UXSA 5ID1A 3PJSA 3GSOB 3JBG7 3LN9A 4OBSA 4LIQH 4HKZA 4C56E 3T0DA 4QTIL 3MGTB 5KG9A 5CZKA 3MLXH 2CRIA 3P9WB 1K4CA 4I48A 1IC5L 5DRZA 3KHOA 3MO1B 4DEPC 3VFNA 3NACL 3MJ7B 5E56A 4NQSA 3UTTB 3BKJH 5D71H 2UZIH 5JQ6H 5M94B 5LWYH 3BD4A 3BGFB 4QHUB 4ODHL 3QJFA 4ALAL 4N8PA 2DQCH 5JO5A 4G80A 4EI5D 1HILB 5I17B 5MP6L 4BYHA 5CP7B 3RIAF 2VIRA 2LQRA 3O3UN 3OPZH 4GKZA 5DVOA 3UXFA 2E8ZA 4JLRB 3U79A 3OKDB 4IRJC 3OKOB 2RAMA 4KI5C 3DURB 1Y18A 3DXAE 4QHMA 5IB1A 1F3RB 5FF6A 4JRYE 1WUNT 5LAXA 2OYPA 4F7CA 3HI5L 4I0PB 3FFCB 4HQQH 3K8MA 1TDQA 5DC4B 1X5AA 1I85C 4RGMB 3BE1L 4N90E 1ZLUH 5C0NC 4MXQC 3BXNB 1LEGB 2C3XA 5EORL 3JWOL 4ISVB 4XPHL 5D93B 5EZOH 3RWHA 1A7OH 1SY6H 2I26N 4AENA 1Y6MR 4KI5F 4UT9L 1G9NC 4UQ3A 2DDQH 3NZHL 1TQBC 2XQYK 3MROB 3VXSA 3TFKD 1U8QA 4NQVB 4M1DL 1N59A 4PJ9A 3LMJH 3QXWA 5CLTA 4APQD 2HT2C 4RZCA 3CNKA 1FO0B 3C08H 3T2NH 2KZWA 1JN6B 1P7QD 1NDMB 2JIXB 3EZ8A 3Q5OA 4NQEB 4OCSL 1H15A 2GQHA 1WBXA 1JWMA 4PTTB 4PRHB 5GRWA 5TE6H 4Y5YC 1OSPH 1YY9D 3MV9A 2OTWB 3EFDL 3QUZB 1X6LA 4H88H 1MPAH 4WW2A 3L3GB 1I9RH 1RU9L 2A6DA 2MMXA 1YNKH 4RGNB 1EUUA 4LPVA 5IHBA 3U48A 7CGTA 3MRRA 2I07B 4B7IA 1AC6A 3MBXL 5IKCA 3UBXB 3MRMB 3VDAA 1RAMA 1RVFH 3CVIH 4OZFB 3MV7A 1EIBA 1KB9K 3LVEA 5CJQL 4TUOA 1RUPL 3U7WH 1MREH 4GAJL 3FO9B 1I3VA 5J1AB 4GAGL 1LEKB 3UC0H 5HYFA 1OP9A 5D2NB 2Q7YA 4KROC 2H26B 3D85B 1OAZL 1HIMH 4OLXH 2W0LA 1XGQA 2XN9B 4G6ML 4E41E 3O6FD 1XR9B 4XZUA 3WFHB 4HEPG 2E8YA 1MJUH 1O0VA 1OGTA 5TE4H 1AXSB 3OXRA 1G7JB 1M7IB 3DVNB 4JO2H 1R5VA 2H41A 3LH2L 2AV7B 4HWEH 4QOKD 4OM1L 3CK0H 3G04A 5HVFB 1CDYA 2VQ1A 4QRPB 1WZKA 3PE9A 1N0XL 4M61B 1RZFH 1E4XH 5D7KD 3X14A 5JDJA 3AAZA 3BRDA 3LEXB 5L8LB 5F72S 5E9DA 5E8EB 3QG6A 4ENED 4FG6C 3RU8H 3VI3F 2DQJH 1MAML 4B53A 2YD2A 3DBXB 1KSRA 4OCWL 5A1AA 1N64H 3QUXD 3I9GH 1A4JA 3RWJA 4U1JB 3ILQD 3U36A 3MNWA 1DLHA 3BVNB 4IDLA 5GGVH 4XP9L 3TF7C 2V6HA 3GSQA 1KJVB 4HS6B 3RGVB 2NY6C 5HHNB 1WFNA 4GRLC 1WK0A 3CPLA 2NY3C 5I1LA 3EYVA 3FO0H 1KG0B 3KPSE 4F7PA 4RGOH 1XIWB 1KPVB 1U9KA 5HYQA 3VGGA 2N7AA 4X83A 4LCCC 5C6TL 1MQ8A 5F9OL 1AD9B 4JKPL 4HPYL 3W0WB 4PGEA 4H8WL 3T1WA 5GPRA 2X42A 4L5FH 1ED3B 5EU6A 3QFDB 4O2CA 1KLGA 4XAKD 1RURH 5EOCH 1UJ3B 3REWB 1AQKL 4G8GA 4ZNEA 1FGVL 3VD9A 4JPVL 4YZFF 4NQTA 4K7PY 1QA9B 4NQCD 2L4OA 1XEDA 3U2SB 1P7KB 4RFOH 3D2UA 4BQ9A 5ANMB 4Y8DC 4QRRA 1AH1A 3QCUH 1CFQB 2V2TA 1FORH 1A7NL 3SE9H 3WNPA 3QCTH 3GBNL 4D3CL 4P2OC 3TN0A 2R0KL 2ERJC 5F21B 3HAEH 3P77B 1VACB 2XWJA 5KSBA 5D7IE 1HQRA 1RHFA 1JMXA 4PG9A 3H7BA 3VFSB 2M2DA 3BT2L 2FX9L 3KXFE 5MERB 3T8XA 4JFDE 3ARGC 4LCYA 3DOSA 1TJGH 1AR2A 4JPKL 1BFVH 3VGAB 3RVWD 2GTZA 4GBXA 3WFDL 4PUBH 5CJOH 3O6MH 2AJUH 1ADQH 4K3HA 5F1NB 1S78D 4R3SA 1T1ZB 3UYRL 1EERB 1GPOL 3E2HB 1KULA 3CFBB 3QEGL 2E7BA 1IC1A 3VXRE 2GSIA 3FRUB 3ES6A 3O2WL 3T65A 1VEMA 1W72B 3IDXL 2VR5A 3S4SB 3LB6D 5GGSY 3MA7B 1EMTL 5EA0L 3EJYD 4LVNC 4FQXB 1Q9WA 3JVGA 4QHKI 4YBLB 4YXKH 2PYEA 4N5ED 3ARYA 3HMWL 4KZEH 3IDJA 4YJZL 5FV1L 3WEXA 4S2SA 5B8CC 4YHNA 3DROA 3GMRB 2FGZA 1IKNA 5DQDL 1KACB 4LSUL 3UCRA 5AD0A 3DRQB 4PLKD 1CE6B 2Y5EA 3DVGA 1DSFH 1E6JL 4OD3H 1KPUB 1FVCA 4R7DA 1U95B 4YWGL 3GBML 3BHBB 4J3OC 4HK3J 5FYJU 1N6QL 4UT7L 4JGJA 2YEZB 5FM5O 4M6OL 1P5UA 4UUJB 1D5IL 4WNQA 5ICXB 4KVNL 4CU7A 3H3PH 4F3FA 2HT3C 3MLRL 1G7HA 1K8IB 3KPOA 3AB0B 1B0RB 2ADGB 3QUYD 2B5IC 5ADOH 4NN5C 4OF6A 1CDCA 4RISL 1JTPA 1HN1A 4MNGA 4ODXB 1EK3A 3QNZA 5E2TH 3CH8A 1CU4H 5J0BA 4DAGL 2R2BB 5T3ZH 5DZOA 4U1SA 3TA3B 3V8CA 1GJIA 1SEBA 5HHPB 5GZNC 1OGAA 1C12A 2DQDH 5KSAD 5INDA 3C5SA 2Q87A 5C8JB 2OR8A 4M7KH 4ZFZB 2WAHA 4TUJB 3VD5A 4R4BA 1TQCC 4I77H 3QI9D 4NNYA 3PIQA 2VDNL 3VXUD 1BVKA 5I16B 3VE0A 3D39D 4HXBH 4HHAB 1AC0A 4ORZC 4PGCA 4J3TA 4K55A 3UTSD 2AXFA 2X4TA 4NWTH 4X7TB 1OAKL 3WS6A 3CFIC 4QRQA 4JHBA 2XWBB 4JQIH 5FCUH 2P8PB 1OB1A 1PG7H 1UH2A 1J86A 5E94A 1E27A 4IOFC 4KI5E 4N1HB 3QFJD 4LLYB 1S7XA 3LKQA 4X7CC 4BUGA 2OK0H 4M6MH 1YMMD 3T2OA 1BOGB 3MYJA 4XNXL 4D0DB 3BISA 5DC0A 4NQDA 1RZJL 2Y07L 4FTVB 4X9FA 1RMFL 1IT9H 4IRSA 4GG8B 4QRSA 2X9XA 3ARFD 4PFEA 3PWJB 2RIKA 3S98A 1X7QB 1BF8A 5B22A 2VZSA 3CDGA 1II4E 3VXTA 4M62L 3SGKA 2HG5B 2J1KA 1OQXA 2APTA 5SX5H 3VGEA 4ZOEA 1QSZA 1N2RB 2I24N 3HE6D 1J1PH 4F7MA 4I18C 5FYLE 5GS0L 1KCRH 1P9MA 2IQAA 5GJSH 1PKQB 4POYA 4F7TA 2IAMC 4LRIA 4Y2DA 5DRXA 4QO1A 5I75B 1AE6L 4A6YB 2GITB 4UV7H 1A3RH 4C57C 3T0EB 5IVNA 3EJZC 1BQSA 1A5FH 4AYFA 3RNQB 3V8OA 2OS7A 1QNZL 4M7LH 2R29H 1JUFA 3C6LB 4CMHC 4LHUG 3QEHA 5I1GL 1QSFA 5CEZE 1P4LB 2KKQA 1WZMA 4NN6B 4GT7A 1EBPA 1GOHA 4Z7QF 3H0TA 3RRQA 2VXUL 2XA8L 1I8IB 1VFBA 3UTPD 4NJ9H 4WV1B 1UWEH 3U0WL 1NAKL 1OTUD 4AIXA 3BESR 4RFEB 5T1DL 4U7KA 1AHWA 3BWAA 3LS5L 3MREA 3GIVA 3DI3B 3QCVH 5A3ID 1MFDH 4PS4L 4BELD 4OJFH 4MSWA 3IDNA 1A6VL 5CINH 4MNHB 3IDYB 5D1QA 3VI3E 2K7PA 4Z0BH 1ZSDB 5IMKB 2GJ6E 1OP5K 2F58H 5DEFB 5C92A 1BEYH 4G6JH 4K9EC 4UI2A 4XMPL 1DQTA 2QQQA 2XFXB 4NKOB 3SDCD 1FNSH 5GHWL 1ZMYA 4NUJA 1NBVL 3TBSB 2FNBA 1DDHB 4UOW1 3O3BB 3CIQA 2WM0A 4JO4H 1YEDA 2YRZA 5ICZB 4IOIA 1CT8B 5I1IH 4KPHL 3WHE0 4KMTL 3TVMC 5HDLA 1IC7H 2IFGA 3TC9A 3HAEB 3VFGL 8CGTA 3Q5YA 3LKOA 3KNBB 1D5XA 3BW9A 3BPNC 2A73A 2E9WA 1X4XA 3MLUH 1H3PL 2WBJD 4YPGB 3BKML 4DUWA 3QXDB 1GHFL 2NX5E 5A2JH 2FSEB 2M8XA 3GO1H 2Q86A 4LSDA 4Y1AA 2GK2A 4YZFE 3I6KA 3KYAA 3ULUH 4ZXBA 3QDMD 1NGPL 3QUMH 1FPTH 3REVA 4ZFOB 1S7VA 4ONFL 5IMOB 4AY0A 4MZ2A 1A6ZB 4NRZA 1JWUA 1HZHL 5MEPA 3KPLB 4XCNB 3PV6A 3F65A 4KK8C 2YR3A 4L9LA 2VLRD 3HI1B 4O2FA 4HPOH 4QWWC 3UPRB 3VW3L 1YJDL 4HAFA 4K7PL 5CEXA 5TPWL 1Z5LA 3H7LA 1ORQB 3HHRB 5IVXF 4YDLB 4P4RA 4LMQE 1HDMB 1L6ZA 1FVEB 1IC5H 4WU5B 1CDUA 4YGVB 4PGDB 1T1YA 2PXYD 3V6OA 4W4OA 3NACH 5SV4A 1HI6B 2NY4B 4OFPA 3TZVA 4LCUB 3PWPE 1JF6A 3MMEA 2LAGB 4XPTH 4L4VB 1RUKL 3MLVL 5GSRA 1MUJB 5F7LB 3QP3A 5IQ7L 3EDFA 3O6LH 5D7LA 5I19H 3FQWB 4ODHH 3UJIH 2P7TB 3QDGA 5C09B 2NY2B 2YPLA 1I75A 5FYJH 3FOLB 2XKNB 1CGYA 1DQMH 5IW1A 3H9YA 3D0LA 5HGHA 4MB3A 3B4NA 1A8JH 5EPMA 3QEQE 2WWMD 1HKLH 4G7YL 5HPMB 1W0VA 2VLKE 2WW8A 3VJ6B 3P40A 5F1IB 2I9LA 1ZGLB 3CUPB 1RZKC 3RUGA 4HG4J 4X6EA 1SHMA 3IKCA 2DWEB 1F3JA 1NMAL 4TPRL 2YUZA 4YPJA 4PJ5A 4J4PD 2X4UB 4Z5RB 1I3RA 1A47A 4GFTB 3HC4L 5CBEB 4XPHH 2PNDA 4E0RB 3PGCA 2YPVL 4Y4KB 3NABH 1BECA 1J18A 1RHHA 4JM2C 5INCB 3SQOH 3C8KB 2ZUSA 3ARPA 3VFWB 2BOBB 4L1HA 3KDMB 4ZUTB 4M1DH 3BEVB 3EDKA 4H0IA 3VFRA 3BKCL 4WTZG 5FIEA 1NGWB 4GMSH 3P3YA 4FS0A 1G7IA 2CIIA 1U41A 5C0GA 2DTML 1Q72L 4MJ5B 3JTSA 4CU8A 4WY7H 1RK0B 3GMLB 1VFAB 2XY2A 2A83B 3C5ZD 1WZ1L 2JJTC 5C9JB 2ITCB 4ZAKD 4YFEA 2EYTB 5TGBA 4Z7WB 1SYVB 4LLWA 5CZVL 3EFDH 1KENH 5BZWB 1IVLA 1FBIL 4NZTL 3HR5B 2E9IA 2J6EL 2BSRA 1J0JA 4BQBA 4N0FB 3IU3A 3HS0B 4FMFA 1K2DA 3DUUA 4WWKD 5MEOB 4Y4FD 2EH8H 1MIEH 3BX7C 2YS4A 3IJSB 4L3EB 4UTAL 4KJQD 3I6LD 4U1IA 1VESA 3EKCA 4V1DA 4NQUA 4OGAD 2KZ1B 2C4FU 2YSSB 3DSFH 1RIHL 1LO2H 1MCIA 1OAZH 5KANG 1U3YA 4MNQE 4G6MH 2OMBA 1FV1B 1NFKA 4AEHL 4AG4L 5D8JH 5DI8B 4K07A 4EOWH 5FKAA 5ID1B 4RX4A 3D3VA 3PJSB 4MD0A 1R3IL 5IESL 1UWXH 4KKAD 5F97E 2VL4A 4PRDA 4HKZB 1FSKB 4NDMA 5IWLA 2VSDA 4DK3A 5KG9B 3QA3A 4GRWE 1K4CB 5DRZB 2HTKC 1N0XH 5JNYA 1MFAH 4MZ3A 5K9JL 3VFNB 1NEUA 4PJXB 1C16B 2Q8BL 1GCFA 3I75A 2HWZL 2HAZA 5LGJA 4ODSL 3VD3A 2LFGA 1MFBL 5HGBA 1MAMH 3QJFB 1X44A 5JO5B 4G80B 2F9BT 5GGSA 1Q9LA 5CSGA 3SCMC 3EYSL 1UCBL 1M05A 1YEFL 3ARFB 3EAKA 2VIRB 4XP9H 3EYFA 4GKZB 3JXAA 4OGXL 2EDEA 4FQLL 3ARQA 4K2UL 5E4IA 4CDHA 4PREB 2X89D 4OCYL 4QHMB 5IB1B 4H20L 5FF6B 4RAHA 5LAXB 3QQNA 5FUOL 4PRPA 4F7CB 1F4YL 1ZANH 3HE6B 4Z7QE 1T1WA 2R4RH 4L8CB 4NKQB 4GKSA 5HYJD 3WHXA 3UPAA 1RZ8A 2BSSB 5F9OH 4JKPH 5KN5A 3H42H 1VSCA 4GG6F 3VXMA 4LNRA 3PABA 1CICC 5T1KD 3L5JA 2FBOJ 1UGNA 3RWHB 1CL7L 4AENB 1CF8H 4UQ3B 1FGVH 5BV7C 4OLWH 1U8QB 1OAUL 2OLDA 1UCTA 1N59B 1IAIL 4W6WB 2J6EA 3WBDA 4NN7B 1MI5D 1Y6NR 3V7AE 2CXKA 3Q6FA 4Y5VA 4RZCB 5CWSA 3SN6N 2AK1L 2F5AL 1AGFA 1FL3A 5I8EA 1A7NH 5HDQH 4EUPA 4X5XA 1H15B 1JWMB 1CLYL 3BP5A 4DQOH 1A2YB 5ITFA 4H1LG 5KOVC 3HE7D 3BSZH 3K4DA 3VMOA 3MV9B 4JN2A 5FO7B 4X7EC 3B8YA 4WW2B 4GH7B 1CTOA 3N85L 2QHLA 4C56A 1B2WL 3MRRB 4GUPA 2FH6A 4KJWD 5IKCB 3V7MA 1EBAA 3OKEA 2XNAA 3WFDH 3MV7B 1TPXB 3KPRD 1MSPA 2CSPA 3UX9B 3BH9A 2ID5A 1LQSR 4XX1G 3UYRH 4QT5A 5DRNA 3PHSA 1GPOH 1UT9A 5IB2A 4ZFGL 1EJ6A 1OW0C 2Q7YB 2VUYA 3O2WH 5EOQL 5KVMC 3IDXH 5JZ7D 5IV2A 1FIGH 5EA0H 3ZSSA 4XZUB 1I7RA 1KLFA 4TULL 3VFOA 1RULL 1OGTB 3B9KC 3ABZA 4GJTB 4BSWA 1U6AH 1M71A 3HMWH 1XGYH 2C3GA 3FT3A 3BKYH 3OXRB 1CDBA 1GGIL 4G6AC 1R5VB 4N8VA 5BVJA 2E7LA 4OBRA 1H3VA 2QBWA 4S11A 4BKLB 4MLSA 3AROA 3G04B 2OBGA 1DUZA 1QRKA 1ZKAA 1WEJL 1E6JH 2VQ1B 3IB4A 5D5MF 2Y9RT 3ARDC 4JRYA 5GRVL 1CIUA 4XH2A 5FGBC 1DVFA 3GBMH 3VGFA 1FFNA 5J06A 3AAZB 3WDIA 5ISZE 4P2RD 2P8LA 1GZQA 1LE9A 5KTEL 4M6OH 3LRHA 5E9DB 5D93C 3QG6B 2VDOL 2YD5A 3MCKA 4PRID 4X5LA 1Z9MA 1H3WM 1MCJA 4X7DC 1IM3A 1AIFA 5MHSE 1A4JB 2IPKA 3RWJB 4K3DH 1U3HD 4KK6D 3MNWB 1DLHB 5DK3A 2MPAH 5SWZA 3ZKNC 2YWZA 1FZMA 1NCNA 2YD1A 3GSQB 4MD5A 4XTRC 1T83A 2VN4A 1TIUA 4RSVA 1QLEH 3CPLB 5I1LB 2PW2A 3QIUA 4U0RC 3EYVB 5KS9F 4ELMF 2G5BA 3O4OC 4F7PB 2YKLL 4WO4D 2JJUA 1X5GA 5HYQB 1Q0XH 3V6FA 4XP6L 5DD1L 4PGEB 4WHCA 3RDTC 2VDNH 1PQZB 1RQ5A 3QO1A 1YYML 4M00A 3S5LG 1KCUH 4NO0D 5EU6B 4O2CB 1KLGB 3SQBA 4G7VH 5FB8A 3WXWH 4XPFL 2ZUQC 1KN2H 1OAKH 4G8GB 4PB0L 1FZJA 1YYLL 4KK5C 4KUZL 2OL3H 3HZVB 5EOTA 1WWBX 3D5OF 3D2UB 1I1AC 4QRRB 3T3PF 4LLVB 4OFYD 2V2TB 4X0KA 4HUWA 2WP3O 4LEXL 1CD8A 4WEUD 3BQUD 1DR9A 1I7TA 3QEUB 4H26A 4E41A 3TN0B 1D9KD 5JW4Q 4KKCD 2HKFH 3P0GB 2PO6C 2VKXA 4CN1A 1GZPA 2QADD 3T3ME 5KSBB 4NFBA 1HQRB 4XVTL 4PG9B 5JUEH 5J3HD 4EVNA 4JKMA 1NCWH 2ED9A 2I9TA 4LCYB 4JCLA 1J8HE 4CNIA 4M62H 2GTZB 3QXUA 4GBXB 4KDVA 1F00I 1MWAL 4XXCC 2WIMA 3X3FL 4X6FA 4R3SB 2JK5A 4ORGA 3F7QA 3L5WA 3MACL 2GSIB 3ES6B 2DWDA 3T65B 1AE6H 4RRPG 2X6MA 1S9WA 1I4FA 3NGBC 4MAYA 4JQVC 2V7NA 1Q9WB 2XXCB 4M6NH 4ELKA 2AGJL 2PYEB 1WFOA 3FN3A 4JFHD 1TVDA 3SDDC 3IDJB 5F7YC 3WEXB 4S2SB 5F7UA 4YHNB 3DROB 4YO0A 2VC2H 3G5VA 4OGZA 5AD0B 2VXUH 5EU4A 5ADPL 3DVGB 1QQDA 3KPSA 1YEJL 1FVCB 4POZC 4R7DB 1NAKH 4PJBA 1MJ8L 1GGCL 2IAND 1VB9A 3MRNA 5T1DH 1MFEL 4WEBL 4U6VL 3AREA 1HHIA 1GC1C 1NL0H 3LKNA 3SKNA 4WNQB 5J12B 2ATKA 1IL1A 2BDNH 4F3FB 1G7HB 1UJ3C 4BSVA 4KQ4L 2J88H 2OXHA 3KPOB 5DJCA 4DKFH 2OX5A 3LSOA 4RWYH 2WP3T 4I2XB 1IM9D 3ZKSD 4MNGB 1KFAL 3QNZB 2B0SL 3PQYD 2CO7B 4LAQL 1A1MA 1YQVL 2CK0L 2VZVA 3S88L 2BX5A 1MHPH 2YWYA 4TSBL 1T6VN 4U1SB 3NIFF 1JZ6A 4XMPH 1SEBB 1J87A 1VGKA 4KU1A 1C12B 2ADFL 2FECL 3SGEI 1NKOA 3C5SB 1NBVH 3V0WL 3MV8D 5B39G 4R4BB 3WS3A 32C2A 4NBZB 2EDYA 5D7IA 4HIHB 3LAFA 1CXHA 4NNYB 3PIQB 1MLCA 2VXTL 3BD3A 1BVKB 5IOPA 3KR3L 2KL6A 4UAOB 3VE0B 3VGAC 3LOWA 3KXFA 1UZ6F 4JFDA 3OTTA 1T0MA 1VFMA 4IJ3B 4KMTH 1EFXA 4PJFF 5CP3A 3P30H 4NBYB 4PGCB 5JW3L 3CU1A 2AXFB 2X4TB 4QRQB 3ZLQC 3MCLH 5LGKA 4GG6E 2RB8A 3E2HC 3I3BA 3B2UC 3CDYA 1OB1B 1YNLL 5I0ZA 5E94B 1B0WA 1OTTD 1E27B 4DGYL 3VXRA 5GGRY 3SGEH 1S7XB 1NGXA 1X3DA 3LKQB 1UM4L 1MWAA 2WMPA 5DMYA 3KYMA 3RTQA 4LSTH 3MYJB 3PXJA 1OP3K 2ESVD 1G9NL 2IQ9L 4JAMA 4NQDB 1NMBL 5I0DA 4OSUL 2BVEA 5EB9A 4PB9L 4IRSB 3O3EA 5MEND 4QRSB 2EDFA 1AY1L 4LQFL 4MVBC 2Y06L 5KVEL 3CDGB 2CJUL 1K6QH 3VW3H 1TXKA 1T0PB 3VXTB 2PN5A 3H3BC 4L29A 4HC1L 4QF1A 2Z9TA 1XGRA 2XY1A 2QR0A 3R8QA 4YUEH 3OKYA 4FXKA 4NKMA 5HD8D 3HB3C 3G08A 3BRFA 3MQIA 4KJYA 2MKLC 4F7MB 3C6SA 2XZZA 3WIIL 1IILE 2IQAB 4Y16C 2HRPL 3B3IA 4WFGE 4F7TB 4HWNA 3V52L 4Y2DB 5DRXB 5CEZL 2IGFH 4UV4L 1OLZA 3TIDA 3MLVH 3HE7B 4TUKH 3CXHK 1G9MC 4GSDH 2IG2H 5IBTL 1RZGA 3QEHB 3U9UA 4JFFA 5E03A 4YDVA 2NY7L 3H0TB 5BZDA 3CCHA 3K46A 5EIVA 4WTWA 1YEEL 4G7YH 3VA6A 5I73C 4UQ2B 2NXZB 1JWSA 3DX6B 3BWAB 1N8ZB 3MREB 4JPIB 1DBMH 5IROC 1A7QL 5D5ME 3U0TA 3GIVB 2COQA 1NEZG 1WJ3A 3CX5K 1FZOB 1DP0A 3LQAC 4EI5C 2AXGA 1T1XA 1TJIH 4MSWB 2YPVH 1XF1A 3T08A 4D9RD 5D1QB 1SVCP 4IRJA 5F7EH 5SX4I 1WF5A 5AZ2L 1G9EA 2DTMH 4LKXA 4OGYL 3DO3A 3F6IA 3M17A 1WZ1H 5E2UH 3BDYL 1I85A 4NUJB 2ZG1A 3GRWL 5E2JA 3PWNA 5J6HA 1M1SA 2V5SA 1FN4A 1YEDB 1XCQA 5KS9E 4ELME 2FIRT 4WI3A 4IOIB 1QACA 1KJ3H 3RIFF 2Z93A 4NZTH 1JGEA 1MRDH 5JMRA 3H3KA 3TFKC 1HSBA 3EOBA 1U8HA 3DXAD 5SX4H 3PHOA 3LKOB 5GXBB 1EVUA 5DUBA 2OQJA 4APQC 4EUPH 3BW9B 3QDHA 2ZPKL 1OCWL 1U8MA 4BFGA 3MRKA 2Q86B 2CDEA 2B1AL 3LKPA 4U6XA 4Y1AB 4HC1A 5GS3A 3T0EC 1V7NH 3I6KB 1RIHH 1U58A 4ZXBB 4Y5YA 1VENA 5GISH 1QYGL 5EUOF 1P6FA 1YY9C 2OJEA 2CD0A 3Q6GH 1N5YL 1S7VB 3A6BH 1C08A 3T3PE 4XB8A 5C6WH 4AEHH 2GJZA 2IALA 3BN3B 3QWOB 1A0QL 2BNRE 2FH8A 3B43A 2QSQA 4TNVK 4NRZB 1O7SA 5JHDD 5DUPH 3SE8H 1JWUB 1FYHB 5MEPB 3PV6B 2VDLH 3WFBL 1ZHBA 4WUKL 3QBTB 5E2WL 4L9LB 1CZ8L 5CD5D 4O2FB 4QXGL 2UY6A 1MAJA 3WIFA 1JZ3A 2LVCA 5CEXB 4OFKA 3V5DA 1H3UA 4P4RB 5TDOA 3HUJF 3VMPA 3VG0H 1UYWL 1F4WH 1I9EA 3MRDA 1T1YB 1K5NA 3BJ91 3FB5A 1IEBA 3M8OH 3TZVB 4ODUA 3MMEB 3LN4A 5DF0A 1YC7A 2HMID 3O6FC 1F6FB 4ODSH 1UACL 1JNLH 2DI7A 3C60D 3BIKA 4HFWA 5GSRB 4O51A 4Q6IC 3IDYC 5D7LB 4AM0A 4O4YL 2Z8RA 3QDGB 1OOAA 1ES0A 2YPLB 1ZVHA 4NSKA 3K3QA 4YXHL 2GJ6A 2F8XC 1UCBH 4H0GA 5IW1B 4LSQH 1CL7I 5HGHB 4RFNC 5EPMB 1NGZA 3LHPH 4HKBA 5TDPA 4I3RH 1IAII 2N56A 4UB0L 1NCBL 4ODTH 3MTRA 5IM7A 5ACMA 1W0VB 3QQ4A 1F11B 3ARUA 3VXPB 3RUGB 1TMCB 5LCVL 4X6EB 3QDJE 4XMLH 1X4ZA 1U8NA 3IKCB 1F3JB 3ILPA 5DGRA 3WLWC 2VN7A 3NMEA 4OIBA 2WBWB 4PJ5B 1XF4A 1ZHKA 3T09A 1I3RB 2ICWI 1FCGA 5IVZA 4CVXA 1S5IL 2MTPA 3QUXC 5H37H 3GRWA 1QKZH 1UM6H 1DBBL 3ILQC 4N1CA 2CK2A 3PGCB 4NJAH 1CL7H 1IGML 1RHHB 1YECL 3UYOD 3K1KC 5I15H 4LLMA 3VFRB 3Q0HA 2DIAA 3WFEL 1G7IB 2CIIB 5C0GB 4EDWH 3JTSB 5AZEH 1F4XH 2AI0L 3KS0H 4BFEA 1PAMA 4LCCA 1BAFL 4OFIA 1CLYH 4OLVL 2I27N 3HPLB 1UM5H 5D72L 2DF3A 4LLWB 3NIFE 3SEPA 4KRPB 2VLMD 4QY8A 4F37K 4FQQA 4LU5L 4TYUA 4ZOCA 3S8WA 5CIPA 3N85H 3FN0H 1QR4A 3QQ3B 1TETH 5L88L 2O61A 1B2WH 2BSRB 4LEOA 3P0VH 4IBLT 3IU3B 5FHAH 3CFCH 1MIMH 2O26U 4LHUA 4ZO8A 5IB3A 1K2DB 3DUUB 4CJ0A 4KHTL 1MCRA 4GQ9L 1JTOA 2NY4C 1UZ6E 4U3XA 5F7DA 4U1IB 1BJ1J 4V1DB 4P2OA 3ZKMD 3BDBA 3M45A 1QFWI 2FL5A 4OCRH 1KIPB 4UBDD 3F7YA 2D3VA 4XWGH 1FYTD 4OQTL 3QNXB 4M4PA 3WN5C 1LO4L 5TF1L 2VXSL 4LCIL 5FKAB 2YD8A 3ARGA 3KJ4C 1BFOA 3D3VB 4MD0B 2A38A 3SE4C 4X6CA 2OCFD 3RVWC 1GGIH 4PRDB 3QEQA 5JW4N 4NDMB 2HVJA 1KEGH 2H2PD 5HYSG 3FKUS 1S78C 3D9AL 3QA3B 2VLKA 4NRXA 4MA1B 5J11C 1B4JH 5JNYB 3FRPA 1QFWH 2QQLH 2R69L 2HYMA 3GMQA 3LB6C 4AEIL 1RZIA 2OI9B 3EJYC 4KJPD 5LGJB 2CDFA 4HIEA 2VDOH 5CMAA 5HGBB 4N5EC 4GOSA 1RJYA 5SV3A 4YHIA 1VFUA 3DHJA 3MUGA 5GGSB 3BN9D 5B8CA 4XCYA 1BQUA 1Q9LB 2E7CA 5D4QA 1ZT7B 1UA6L 3BPOC 4PLKC 3WIHL 5LXGL 3EYFB 4EQ3A 2X70A 1G7PA 2W59A 1A02N 5GRUH 3D48R 2X9YA 2I60H 3O0RL 4KHXL 5F9DC 2N7BA 1ETZA 3E3QC 1SBSH 4PRPB 1T1WB 4GKSB 1Q9OA 4KQ3H 4PV8A 1RZ8B 5DD1H 4JHWH 5KN5B 5EU3A 3QUYC 4X7SL 3VXMB 1KCSH 3PABB 1TJHL