1A3LL

Catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
DIVLTQAAFSNPVTLGASASISCRSSKSLLNSNGIIHMYWYLQKPGQSPQLLIYQMSKLASGAPDRFSGSGSGTDFTLRISRVEAEDVGVYYCAQNLELPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDTKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN FAB 13G5 (LIGHT CHAIN)
publication title An antibody exo Diels-Alderase inhibitor complex at 1.95 angstrom resolution.
pubmed doi rcsb
total genus 50
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3lL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3lL01
2JCCA 1DUZA 3MRNA 4X99B 3OAZK 4HS3A 4ODBD 3WO3B 4OB5L 2X41A 2NW3A 3TBVA 1F4WH 1QSFA 5FYJH 5K9KB 1CCZA 1BZ9A 3U4BL 1KCKA 3SBWA 3C9NA 1QLRB 5I1CH 3UTTA 5IOPB 3QFJE 4U6HA 5HHPA 5HGAB 3VWJC 2BHUA 4LLMA 4JFEE 3UBXI 3G5VA 2FX9L 3D1MC 3DVGA 4DWHA 2BVOB 2UZYB 1ZANL 2NY7L 5C0BA 1QFWM 4OLEA 1HSBB 4P2OD 4X4YA 1RSFA 2CRZA 4XNMA 5J1SC 5GJSH 1DZBA 1FQ9C 1YQVH 1HKLH 1L0QA 3TC9A 3SDXF 2BZDA 1AH1A 5F88B 4X7DC 1QEWA 3BUYB 4Y5XA 2IFFL 1EBAA 3MV9E 4PBWD 2OMBA 4S2SA 4Y4FA 5E99L 4D0DB 2H45A 4N0UA 1NCBL 1A7PH 4JRXD 1B0RB 3AREC 3LEXA 4LF3B 3VH8A 3NCMA 3IKCA 4XPBL 2ZUSA 3E2HB 3QSKB 1O0VA 4HQQH 5DJ0A 4XAKD 5EA0L 3MLTB 4PRIB 1FNEB 1I8KB 2HTLD 5EO0B 2IMNA 3SKUD 1DQDH 3MRMB 2B1AL 3QG6B 1IGTB 1AGCB 2OJEA 2D4FA 3LRHA 1YYLH 3WO4B 1XZ0A 2WANA 3KPTA 4C57C 2NY1D 1G9NC 5JIKA 1AY1L 3B9KD 2RR3A 4G80B 2EECA 4OLVL 3TIEA 4N9GA 1BFOA 5MEPB 4X6CA 2D0FA 3HE6D 2VIRA 4YDLB 4XWGH 1ZLVH 4KROC 3CPLA 3QUXD 1D5MB 5JW4M 3TPUB 3RWGA 4GO6B 3RWCB 4M7KH 1C5BH 2EC9T 2O5ZH 3FO2A 4QHKI 3G6JB 1F5WA 4FXGB 2OTPA 4E41A 4JY4B 1IVLA 2BERA 2F5BL 3EYUL 4X8JA 3WNOA 3F6IA 4LDLB 1OAYL 3DX7A 4RGNB 3WHXA 1P4LB 2PUQT 3SCMB 1CN4A 5E5MA 2UVEA 3MGTA 1YA5A 4P23D 4A6YH 1UXWA 5EU5B 5C0AA 4L8DB 2X1WL 3ES6B 2H8PB 2P5EB 1A9BB 4P46D 5ALBH 1EJ6A 3OV6A 3SGJC 5TE4H 4TSCL 3OJMB 1Z0NA 4NBYB 3DWTA 2VXTH 4U1IB 4UDTA 3DYOA 1X6LA 3QAZC 1KN4H 3PNWA 3EYSH 1S7SB 2WWMC 1V7ML 3NZ8A 1A6UH 2IANA 2K7QA 4XMPH 1J11A 3OKYA 1FAKT 1A6VL 4WW2A 4ODTL 2F53B 1FG9C 2Q86A 3U2SB 5IFAL 5L9DL 3QA3B 1KULA 4HDIA 2L7UA 5LGJA 5DVMA 2NW2A 4C4KT 3L3HB 1S9YA 4F7EB 5JORB 1YNKH 3RL2A 4HIXL 4WIQA 1Z5LB 1GGUA 4LARH 3BXNA 4O5LH 2DKMA 3MRCA 5DYOA 3TWCH 5MERA 4WTZG 1I3VA 1LD9A 4M61B 1H0DA 5CIPA 3WEXB 3MACH 3DETD 4Y1AB 1A14H 3HMWL 1TQBB 3GDBA 3ECBB 3U1SL 5HHXH 3P4MB 5CEZL 4RAVA 2R69H 1AD9A 3MLXH 2DQDL 5IM7A 2HFFB 4ETYA 4XP4H 3D39A 1P84J 3KJ4B 4FMKA 3MTRA 5FA3A 3OKLB 5J56B 1AXTH 5J12C 2DYPD 2XY1A 2P8LA 4LSVL 3PGCB 3EBAA 3H42L 4QGTA 3MCLL 1DVFD 3VGEA 2NX5A 5DC4B 2Y6SC 3H9SE 2AXGA 4DQOH 3TZVC 1ZOXA 1OW0A 3EOTH 3RNKB 2L7JA 1DCLA 3D2UA 4Y4HA 5TGBA 4JFQB 2OTWB 4R97C 1S5IL 1LK3L 4M93C 1A1NB 3MNVA 2XKUA 2WP3T 3DXAB 1ETZB 4U3HA 1FZKB 3VXTB 2CSPA 3A6BL 4OF5A 4YDKL 4WO4C 4L8BA 3IJSA 3CLEL 2CDEB 4NQUA 5GZNC 4Q6YA 5F7UA 3WL9A 1OTSC 3VGFA 2WUCH 4QRPE 3EYFB 2W1NA 3P3YA 5C1MB 1QR1B 5IEHB 3MGOA 2XG4A 5IBUG 3B8SA 4Y8AA 5ID0A 3HR5A 2ADFH 5C0GB 2IPUG 1NGQH 2NXZB 1BEYL 5E8OA 3S8WA 2AV7B 5BJTB 2IBGA 3FO1A 3TFKC 1B88A 3WXVH 4M00A 1YDPB 2FWOA 1U8MA 4FFVD 3C08L 3AMKA 4LKCA 3OGCB 2MHAA 5JUEL 5E6IC 2A6KA 2CQVA 5KSUB 4NQEB 3C8KB 2FB4L 5DLML 3V2AR 2EIDA 3KPSA 4GQPH 4BFGA 5IT2H 4JM4H 4RGOH 3ARFC 2GJ6E 4GRLA 2GT9B 3JV4B 3K0WA 2EYRA 5C0RH 4NQCA 4FQQA 1VERA 3KDMA 2X7LB 1TETH 3WDIA 3BP5B 4IS6B 5IV2B 3OAZH 1PFCA 1YNTA 4ODHL 4P3CH 4W4NA 3VMPA 4XVUC 2A6JB 1RZJC 4UILL 1CG9B 1P4BL 3ARZA 35C8H 4U31A 4C55A 4KTEL 4KGLA 1DBBL 3O3BB 2X89A 3G9AB 4XVSL 3S37H 2R0KH 4CVXA 4R7NB 4MSWA 3U36A 2PTUA 3LD8B 1E4WL 4KRPD 2DM3A 1U42A 2FHFA 5CLWA 3WNNA 5E6YA 4NKIL 4HUWA 5EUOE 1QBLL 1CBVL 1URLA 5IIEB 4WUKH 4WU5A 4PG2C 3MYJA 4NPYB 1H3PL 1N0XH 2HLAA 5EBMB 3RGHA 5DO2C 4JPVH 4OZFH 1GZQA 3UBXA 3HG1E 1BJ8A 3BH9A 1GCFA 4JQXC 5JTWA 4W6WB 4HLJA 4KXZH 3FCTA 4ONOA 4LCUB 1R3KB 3O8XA 2JB6B 2H26B 1XCQB 1FAIH 1JNNH 1A3QA 3MRFB 3QNXA 3UJIH 3SPVA 2Z0BA 4PJHB 4MA7H 5CSZA 3MXWH 4DKFL 2VLJD 4Y16A 2GAZB 3VJ6A 2XNAA 3PABA 5I1AA 5BRZD 1HSAA 5CWSA 3V4UH 3VD7A 3DVIA 2MOVA 4PJEA 4PJFB 5K33A 2SEBA 3VRLF 5I15L 5DQDH 4PP1D 2B0SL 3IAPA 1DN0B 3QH3A 5CD3B 3A67H 1UZ6F 3CLFL 1X5YA 4WI3A 2X05A 3E3QC 1B0GB 1J05B 3MRPB 2NNAB 4YHOH 5FM8A 4LPYA 2F19L 2PO6B 4XVTL 3GSWB 5A16A 3VWJA 2G9HB 3U0PB 2YEZB 4DGYL 5B22A 3C87A 1F58L 1EFQA 4MCYA 2XQBL 3S34H 1RFDL 1KBGH 1MJUH 2FIKB 4KPHL 5JW4N 8FABA 3H7LA 4ZG1A 3S5LA 3VDBA 1A5FH 5J9PA 5T3ZL 1P1ZB 4BSVB 4OLXL 4OGYH 3RGVA 1G9NL 3QUZD 5KTEH 3MZTA 1ZHKA 1F4HA 1A1MA 3I3EA 4CBPA 3JWDC 1TCMA 3G08B 3AREA 4B41A 4RCAA 3EHBD 4KZEL 1M6OB 3BGFC 2VDPL 2IG2L 4OFKA 1FFOA 1JPFA 3F12B 3ROOB 4NO3B 3UYRH 3K7UA 4TVSa 5KS9F 4XT1C 5CZXC 3RVWC 4P57A 3FTGA 1EHXA 2PR4L 4PRPD 1OGTA 4M8QA 2AAVA 4K8RD 5D6CA 5CP3A 2W38A 3W0WD 4QRSB 1TXKA 1YMMD 1NMBL 1J87A 1NDMA 1HEZB 2AJSL 1IQDA 4O2CA 4G43B 3IFOA 4R4BA 3E8UH 2VLMD 3BP7A 2PXYD 4LLQB 3WNMA 3DX8A 3QDGB 1EO8L 4JFZH 3REVB 4DEPC 3HUJF 4HZLB 1MHPL 4OGZA 1TJHL 4TNWF 4RFOH 4NHCH 1G9MC 2N7BA 3MNZA 4Q2ZB 1U8NA 3C60C 2BMKB 2CKBL 4LBEB 4N0YL 3TH2T 1U8JB 1Y0LA 2CLZA 5IR1B 3PP3K 4QRUB 3DVNA 4PY8I 3H3PL 1CT8A 4N0FA 5AEAA 3MOAL 5FO7B 2YBRB 4JRYD 3SDXB 4JN2A 2C5DC 4Z7UA 3HAEA 4ODUA 5B8CB 3WLWD 1ZTXL 4OLWL 1W0VB 3HI6H 4O58L 1WWBX 4F7TB 1TMCB 1N6QH 1PEWA 1S7QA 1W0WB 2QKIB 3UPCA 4LHUG 1ZHNB 5C0EA 3FO9B 1S8DA 4C59B 5JOFA 4NN7C 4J6RL 5EPMA 4PJDF 2CIKA 1IC4H 1C5CL 1J86A 1NGXA 1R3JB 3C6LB 2K7PA 2H1PL 3MRKB 2BY2A 4NSKA 1HXYA 3WD5H 4HFUL 5GZOD 5I17B 3PWPE 3MV8D 3UTSE 1VEOA 1W72L 2Y36H 4KH2A 4HCRL 2R4RH 5MP6H 2VH5L 1E6JH 2VDQH 3O6FA 3ZE2E 4MAYC 1MY7A 1QTYT 2H3NA 2OJZH 3C6LC 5JIPA 4QYOA 2R0WL 5E1AB 4G6AD 5I66A 2WIIA 3CXHJ 3T04D 3S88L 1IBGL 3BWAB 1HH6A 3VXUB 4BELD 4UAOB 4Y4FD 1CLCA 3QRGH 3FO0H 2OK0H 3QQNA 1QFUH 1UGNA 1E4XH 5IB2A 3BX7C 3RWEB 4O9HH 2FL5B 3Q5YA 2X4NB 4J3XA 1IAKB 3I75A 3N1MC 1KCRL 2RJMA 4C56D 3V5KA 4X7SL 1I7UA 1R5IB 1HILA 3TZVA 1ES0B 1ZT7A 1DDHA 1F4YH 1SJHA 5J4MA 5CJOH 3TO4C 1CD8A 4O02L 2WIMA 1MF2H 4V1DB 3IU4H 5D1ZC 5F1NB 2R4SL 1VKXB 5I19L 3GSNL 5FGSA 4XC1H 4UINL 3GSRA 5ANMA 4MHHI 1ORQB 1J1OH 1I8MA 4X5WB 4D9RE 2K3TA 3I02B 1UM5H 3I9GH 2NTFA 3U4EA 4DTGL 3KLHC 5HYSA 5E24E 5DD1H 3RA7L 1JMZA 1XGQB 4Q6IC 1G1YA 3VFMB 5IUSA 1X5GA 4YC2C 4P2QA 4U1HB 3EJYD 4XCNB 3RDTC 4LPXA 4G8IB 1I7RA 1MI5A 2GK0B 4OF3A 5I1DB 4Z78B 1RZJL 1TIUA 3TJHC 4D0BB 5FYJL 2E8ZA 3ZYZA 5E00B 3F62A 5HHNA 2DWEB 3MUY1 5FUOH 4X80H 2OCFD 5E5UB 1R5VA 4MB3A 3VFSA 1MJJB 4NKOB 5I18H 2DICA 4PGJA 3ARFA 3ZZ1A 3JXAA 3VFRA 1QBMH 4G8FB 5IJVA 1SYVA 5CCKL 4FXKB 4K23H 4H88H 5HJ3A 4JN1L 5MI0C 3BPNC 4OQTL 4OAWB 3FT4B 1JGEB 4OBSA 5FCUH 4HUXB 4YR6A 2HLFD 4NQXB 1FIGL 3OWEA 5FKAB 3D25B 3VFPB 4R4NC 3MRDA 1AIFA 2ED9A 3T65B 5GJSL 5L8JB 1U6AL 3OF6A 2X44D 4LGPB 4HZAA 5DJCA 3S4SA 5EZOL 3ESUF 4U3XA 1WAAE 4MJ4A 3UTPE 1LK2A 2AXJA 2EDOA 1ND0B 4M48L 2CKNA 5I1IH 2NLJB 1FYTB 1I1AB 3RI5K 3HE7A 4F33A 2R0LL 1I1FB 1D9KD 3O6LH 5FHBL 5ENWA 3IGAB 4NO2A 1PDKA 3RZWA 3U7WH 4L8CA 1TJGL 3DLQR 3HNTH 3MV7B 3V6ZA 4U6YA 4HWEH 4HQQL 3C2SA 3HHRB 1CDBA 3PGDB 3DARA 1I7ZA 2VXVH 4FFWD 4J3OC 3MPCA 5E9DD 4EXPX 1LNUA 3ILQC 3ZT6A 1CWVA 1DQDL 2EDYA 4JQXA 3VXME 5JOPD 3P0YH 4KJWD 1YYLL 2AKRA 5F1IA 3NABL 5KANI 1BOGB 4C83A 1GGTA 4FRWA 3M1BA 4AL8L 3MRRA 1RMFH 2NX5D 2VRAA 3LKPA 5HHVH 4M6MH 4G42B 1BZQK 1UM6L 1A7NH 2ESVB 2VLKB 3L9RB 5KSBF 5HHMB 5KSVB 1QKZH 2CLVB 3BPOC 1JV5A 4Y4HD 2R8SH 1RY7B 3RIAK 1IEHA 5FYKH 3S97C 3VE0B 4QO1A 4W6XB 3G5XA 5SWSA 1B9ZA 4UIMB 4OD2B 4YNYA 4K3EL 4BZ1L 4DVRL 2FCBA 4M7JL 2CLRB 1M7XA 5DMKA 1B6DA 4G9DA 3PWNA 5LXGH 3QXTA 1XIWB 3TGXA 3JV0A 2WQRA 1A4KB 5EZJB 4I48A 1FGNL 5ALBL 1TZGH 3SKOA 4X6BA 3QNYB 4GKOA 3JWDL 4HIHB 4WNQA 3C09C 1QFHA 1ZGLB 5JLZA 5CEYB 3DTXB 1FSKC 4G8GA 2R2EB 1KN4L 1NDGA 2UVFA 3JV5A 4NFCA 5EOCH 1TZHA 3RVXC 5HTSA 1KNOB 2IQAA 4PY7A 4P5MA 5T3ZE 4XMPL 4DKEH 25C8L 2ZUYA 3N0PB 1GHFH 5DQJB 3LIZL 4E0RB 4NFDA 4PRIE 5IG7B 3LRGA 4JPIA 2HN7B 1NEZA 4P4KA 2M8XA 3BZ4A 5IWLC 4YK4B 5ILTH 4WW1A 4Q97A 4PRHA 5I8KL 2XPGA 5C09A 2NY5C 1MLCA 2EDDA 2NY2B 2BNRA 2YXFA 2YMXH 3V6OC 1G7MA 5DRZA 1SYSA 1YEHL 4MX7A 3VXRB 5DHYB 5T3XL 1HXMB 5K9OA 2HT4D 4G6ML 3QI9C 1G9ML 4ZS6C 1RJZA 4Y2DC 3O3EA 5I71C 5F7KC 1HIMH 1OB1B 5KSAB 3WN5C 2R69L 4TUOA 3TBTA 4KKCD 1IFHH 3G6JE 4NM4H 4ODSH 1N2RA 4JDVB 1GC1H 2D7OA 1VGEH 2DWDA 2UWEA 3HE6B 1I7TA 4OFYA 3RNQB 5HPMB 5FO9B 3Q0HA 3PGFL 5D8JH 3Q1SL 3HC4L 4FTVB 4KJPC 1AXTL 1YMHA 4RGNE 4P9MH 4LSPH 5IHBA 3ZTJH 3U4AA 4I4WA 2P24A 3QCVH 4NQDB 4M5ZH 1I3UA 3U30C 3TCLB 1UB6B 2FR4A 2WBKA 4J12A 3O9WD 3QFDB 2QV2A 1MAJA 2FBOJ 3MA7B 4RAHA 3C60A 3NCFB 3EAKA 4HG4K 3EYOA 2MQ3A 1MFCL 3BVNB 4E42B 2XN9A 3MR9A 2D31B 3KHQA 3O8XD 1IZKA 3I6GA 4NNYB 4YX2L 2I07A 3PQYB 3ZDXF 3CVHB 3O4OB 5DVNA 3HPLB 3VFNB 5AWNL 3KWWA 1HYSD 4EI6B 5IVNA 3PWVB 2F53E 1YEGL 1FDLH 1P7QA 2IPTL 2WUCL 3DIFB 4ZFZB 3DJ9A 5FIEA 3IDIB 1KXTB 5JHLL 1BJ1J 3ILPB 1SJXA 4ZFFA 3CFJA 3WSQH 1PZ5A 4ERSL 2HVJB 2FRGP 1HHIA 2QSVA 4ZFOB 1WVZA 1U58A 3C5SB 3D18A 5ACZA 4NQVB 1NGQL 1FLTX 1CXFA 3WHE0 3ELAT 2IGFL 3ARBD 4NP4H 4TOYL 3SKMB 3BZFA 4PJGF 3P77A 1J1XL 4PTTB 4NKMB 2Y7QB 5GJTH 3HCVB 2EE3A 4Y4KD 3MRGA 2WW8A 4WHTB 1QSZA 3OR7B 5EZIL 4Y1AE 2OQJB 1NCTA 2WBWB 3VW3L 3QCUL 1RUQH 3INUL 4L3CB 1Q38A 3UXFA 1T66D 3OKEB 5IT2L 5KS9B 4JM4L 4AEIL 3VXQA 5AG9A 4QHMA 2MPAL 4ODWB 5DJAA 3V0WL 4WI7A 1MQKH 1Y6MR 4HS8L 2CH8A 1TETL 5JQHC 4MAYA 4DN3H 3W5MA 1EEZA 3LKNB 1PSKL 4CNIB 4LIQE 3FL7A 1IAOA 3F7VA 3HRPA 4NO0B 1RPQA 3VFUA 3L3DB 3UBXG 4P3CL 4M1CC 2I9LB 4HJJL 4D8PA 4D0CB 3GIZL 3RGVD 1AC0A 3HUJB 2Q20A 3WFCH 35C8L 4LEOA 3VG9C 5BZDB 3FOLA 2QQNL 4JO4H 4XPFL 5HYJA 1G7HB 5HDLA 4PGEA 2X1XR 5F9WC 4Z7QF 2ZNXA 5HPOA 3DXAE 1DVFB 3VD5A 1UVQB 5FO8B 5DJ8B 5FYLD 1RZFH 3KLAB 3H9SA 2V7HA 5F6HI 5T1KB 1UCBL 4TRPH 3W2DH 3P9MA 1CQKA 3WNPA 1PLGH 4EVNB 4PUBH 5I1JH 2XFXA 3TO4A 4JPVL 2A77H 3WUWB 1SY6L 2AJZB 5D1ZA 4HT1L 5FUZL 3SDDB 5HY9A 4GRWH 1INDL 1IM3B 2Q7YA 1AXSB 1OP5K 1SM3H 4NRXA 4HH9B 1N5YH 4J3VA 4OZHA 1IEAB 3GMNB 3CXDH 4PLKD 4KV5E 4PJDB 1IM9B 5C9JA 3JTTB 4CADA 2IAMD 4ALAH 5HHOE 4LIQH 2Y25A 2P5WB 2AXHA 1H5BA 4OT1L 1EFXA 4GG8A 3QHZH 3QDAA 4OZFA 4UQ2A 3MRQA 3DUHA 4JG0H 3S36X 4OZGF 5DQDL 4PJIB 4NC1C 1GPOH 2VLRB 3F58H 4MJ6B 2P8MA 4Z7OE 5KVEL 3GGWA 5SWQB 2VQ1B 1U95A 1C1EL 3FFCB 1T0MB 2BRRH 2GJ6A 1F6AB 1AKJB 1JNLH 3KYOA 1BBJB 1DBAL 1HE7A 2AJUH 2IADB 3LZFL 5L2JB 1J5OH 1DEDA 3OMZA 4WFED 4Y2OA 4NNXA 4UQ3A 2YD2A 4LCWD 1A3RH 3S34L 4JLRB 1ZV5A 2ATPB 2XKSA 1UCTA 5T5FH 1OOAA 2VJXA 4JFYB 4GS7C 4JG1H 2P43B 1KGCE 4FXLA 1OQOA 2XZQL 5DMGC 3WFBH 1A5FL 4L3ED 5FOBB 2FJGA 3IFLH 2B5IB 3FN0L 4G6KL 4GAYB 4OGYL 1BFVH 4KKLC 1IGFL 3AGVA 4HIIA 4NC0B 5C0IB 5KTEL 4NBZB 4GXVH 2H2PD 2ZG1A 3CDGB 3ULUD 1NKRA 1QLEH 2JJUA 5TDNA 2WBJC 4BFIA 5DA4A 1YYMH 3SE8H 5DJ6B 2D0HA 4RNRA 4CMMB 3X14A 5IQ9B 2HJKB 3BEVB 3CDFA 4JQIH 4HK0A 4PJHE 1M05B 2EDKA 2YC1A 1HHJB 4IOIB 5EC1B 1VCAA 1JUFA 3G5YB 3O3DA 3O45B 1FFNA 1DSFL 1T04A 5D1QB 2OLDA 4ZUVA 2DQTH 3TYFA 5I30L 3MRLB 3QEGH 3F65A 4PJFE 3QBTB 3TVMC 4KQ4L 1UFUA 1UG9A 4K9EH 5ETUB 4I3GA 4YXHH 1T0NA 3BN9D 2ORBL 5GIRB 4EOWL 3KYAA 1CS6A 5D1QC 5DK0B 5DRNA 5LBSH 4RFOL 3PIQA 5INDB 4NHCL 2WWKT 2A6DA 1Q0YL 2V9RA 4ZO9A 4YDJA 2OL3L 3FQXB 1YECL 4MQSB 2ADIB 3QUML 2AV1B 4IDLA 4NT6A 1GC1C 5T1LD 1FRGH 1G0YR 1EAPB 1OL0A 4MA8L 3WS3B 1KJ2H 1G7PA 5LQBH 1CXEA 3TO2B 5IGXH 2NY5L 2F58H 3MCG1 4PJ9A 2PCPA 4MA3B 1LEGB 5F89B 3MFFB 2EXWD 5TQ2H 3MBEC 5EOTA 3MOBH 4LLVB 3DURA 5D2NC 3CDCA 4OLZL 4P2QD 1FE8H 4XNQA 1LGVA 5IEKB 1CGYA 2VZSA 4DKDC 1MI5D 3IJHB 1N6QL 1JGLL 2H9GB 5H2BA 3MODH 1OT1A 4UOW1 2E7LA 1Q72H 1A6ZB 4OCSH 4OZ4B 3GEWB 5D1XA 5GRVK 3CH1B 4TNVF 1CGUA 4OLYL 5BV7C 1OGAD 4GBXC 5IWLA 3NIGF 2BY3A 4H1LG 1A9EA 4XWOD 3H9HA 3UZVB 3WD5L 5JPNA 4I5BA 1OTTC 1WBZB 2QHLA 2W9EH 4MDJB 4K3JL 5DTFA 4F15C 5T3XE 2R2BB 3CFBB 5F7WC 3V6OA 3VI3E 2Y36L 2XI9A 2E8YA 1DUYB 1GOHA 5B4MD 3PV6A 1MY5A 2OJZL 2GJJA 3QI9A 1MCCA 3NN8B 3OF6D 4NZTH 4WI2A 3CC5B 3T0ED 3ULVD 3STZB 3WN5A 3LDBC 4QRTA 4PGDA 4JFHD 2Q1EA 2P7TB 3B83A 3HE7D 4IMLB 5HGBA 1YJDL 4QLRA 5I6XC 2QSTA 4P3WA 2OK0L 4M62L 5HI5C 3BW9B 1A22B 2ICEB 4ZPVB 4O9HL 1A1OA 3SDAC 1T21A 5HYSG 3UP1A 1I4FB 3BJ91 2APXA 1A6TB 5C07B 4R4FH 1RIVH 2GITA 2F54E 1QO3A 3CVHL 2VAAA 4LDEB 3TA3D 4Y5VB 5JZ7C 5INCA 3SDXE 2CXKA 5KVGH 5H37H 1S7RA 1MF2L 3BQUC 5D96B 3IU4L 4P2RA 5DA0B 5FECA 3NFNB 4U1KA 4QT5B 3OSKA 4HWZA 1KB9K 4POZD 2A9NH 3N06B 4LVOC 3WJLC 4U1MB 5DJ2B 4JFDA 4ZFOL 3ZO0A 2J8UE 1IKFH 1KG0B 4TULH 5F9DC 5LCVH 3PG2A 2BRQA 4KK5C 3TNNA 1QRNB 2ICWI 3PHOA 5IHUL 1EMTH 5DQ9B 2ZPKH 1CFQB 3FB6B 1MFDH 3MREB 5CGMA 4TPRH 3AB0B 3AXLA 2H32B 3VFGL 3ZKND 4L4VB 4K94C 5K9JH 4KUCD 4LVHB 4ORGA 4GG6F 1VESA 1U3ZA 5A2IH 2QSCH 4YHIA 4XGZA 1OP5H 5JW3H 4X9BA 2V5RA 3QFJD 5FUOL 3C5JA 2ZCKH 5F7DB 1UH4A 4JFED 1MCFA 4YLQT 3AB0C 1IC1A 2QQLL 3P4OA 4RA3A 2EE9A 3BUTA 3MLSH 4ZTPH 5F7EL 4DZBB 5DZLA 3C6SB 4TSAH 2HRPH 2KBGA 3FT3A 2JJWA 3SJVB 3VFVB 1ACYH 5FCUL 3KYNB 2V17H 1JWMA 2HFEB 4X4ZA 2PYFA 4NNPL 3Q5OA 4MWFB 4D3CH 4RX4A 3JWOC 1C12A 4N0CC 4YAQA 5D2LA 4C54A 3MV9D 3DX6A 4FN0A 4EN3C 4APQB 3IRZA 1KTLB 5I1IL 1KTDA 1V7NH 3VRJB 1N0LA 1NCNA 4LLDB 2XXMB 3O6LL 2UY6A 3U7WL 4KI5C 3HNTL 3HNSL 3QIWC 5FDWB 4PJ7A 2P8PB 4U7SA 4HWEL 3CFDB 5IB3B 5ICYB 5BOZG 1MCWW 2N56A 3HZVA 1ZT4B 3GUTB 3NGBC 2R2CA 1VB9A 2Z31C 5I1EL 1U8IA 3DV4B 4NN5C 4YZFE 3UYPA 5TE6H 2NY3D 2WINA 3GSUB 2CPCA 1JHLH 4OFYD 3SQBA 3QRFM 1MJ7H 2QR0B 5DR5L 1SHMA 3QPXH 3QXWA 1UACL 4OBRA 4EI5D 1HCVA 3Q6FA 4JKMA 4RMQA 3VXSB 5C3TA 3LMJL 4FQPA 1XFPA 4OCNC 1HNFA 4PJGB 5E8NA 3OHXB 5LAXA 1AD0A 4HUVA 2W0LA 2YA1A 4IRZH 4ELKA 3TN0B 1QKZL 4PLOB 4Z77A 1LEIA 2R8SL 1CICD 3CIQA 3UTQA 4IDJH 1U8OA 1U2CA 4MJIA 1G7QA 4UU9A 4EDXB 4PRDB 5JO5A 1PY4A 1EGJL 1RULH 1NEZG 4ZSOB 4RIRA 4QHKJ 4P59L 3J7HA 1YUHA 5HHQA 2XWBA 2XA8L 2JJVA 1RJYB 3KNBB 3O0RL 1F13A 1MHHA 4P9HH 4L1HA 4N8VB 5A43C 3U6RA 3T77A 1AO7B 1FORH 1VFAA 5JA9A 1FYTE 4I0PC 1Y6KR 3RWHB 2GTWB 3LN4B 2H2SD 3KPOB 5J8OA 5EOCL 3EJZD 1INEL 1BX2A 3MV7E 2FEDC 1DLFH 5D71H 5IMOA 1JN6B 4DKEL 5IB4A 4HUUA 3EDFA 2ED7A 2HG5A 3MLWH 3ZTNL 4F7MA 4XXDA 2FNBA 4ZDHB 1ZLSH 1A2YA 3LN5A 4XHQA 1J0JA 3D69A 3MV01 1T7WA 2XZAH 3ZL4H 5C8JA 2WLZA 2WBJA 3RKDD 3RWIA 2VDLL 3MO1A 3NPSC 4MS8C 4H26A 4TNWK 4NKDA 3V5DA 1YY8B 2OSLB 3MRHB 2F8OA 3QXAB 2DM2A 3S35L 4ZPTA 5E8PA 1A6AA 3QIBD 1HOCB 1QRKA 4MDIA 1NC4D 2ESVE 2VLKE 3RWDB 1IILE 2CDGB 2HTKD 5HHME 1MAML 3VXMA 2BVUA 1T3FB 4LSTL 4NWUH 4F7CB 1K4DB 5IQ7H 3PWJA 1GC1L 1VGEL 2A6IA 2FATH 1P9MC 2HKFH 3TEUA 1JE6A 5MHSE 3OXRA 5JQ6H 4P9ML 2IPKB 3H9SD 5K9KA 2XT1B 3FOMA 2NZ9C 2C26A 3MMEB 4GW1B 4AEFA 1ZGLP 4OZGB 3QCVL 1J7VR 4FMFA 2VITB 1QLRA 4XXCC 3ZHDA 4U1GB 4WVRA 5DGRA 3GRWL 1CDCA 2YN5A 2QADC 4MJ5B 5BMFH 2W65B 5HGAA 3CSPA 2IBZX 2X4UB 4YXKL 1VPOL 1HSBA 3AMLA 1MCDA 4HLZH 5BV7L 4G6JL 3QQ4B 3ARDD 2P4AB 4NM8H 5ADOL 4QRPD 2GSIB 1GIGH 4KTDH 5HI3D 1KFAL 1XF3A 1T5XB 1JF1B 2XTJB 4LHUD 4GMTH 4MHHG 1RUPH 1RJLB 4UT6L 1DQJA 1T1XA 4YIQA 3MA9H 5D2NA 4YHYC 1TJIH 3WSQL 3BDYL 3L1OL 4D0DA 3C2AH 5GHWL 4G3YL 1ZA6B 1MFBL 3GHBH 1I3GH 1VADB 2BY1A 3KPLB 4NP4L 5F70A 1BM3H 1ZVSB 4PRIA 2WUBH 4WI4A 3VXRE 1S9XA 1I8KA 2XTJC 5EO0A 2GJ6D 3AAZA 3R1GH 2KUTA 3FN3A 4YEEA 1JTTA 2FSEA 1AGCA 4BYHA 2ARJB 3C8HA 2I26N 4I9WD 2E3VA 5EU7C 4YHKH 4OF7A 1CDHA 4G80A 4UZGA 2NY4C 1AR1C 2V2WA 3QT2A 3TPUA 3V0VB 1JPSL 2GUOA 4POYA 2VDRL 3MJ8B 3VRLE 1X4YA 3WXWL 1XR8B 3CCHB 4NQDE 5HDBE 1UZ8B 1UZ6E 3DMMB 4XCEB 4JY4A 5HDQL 2X4SA 1A6PA 3GSVB 4NUJB 1NCCL 5DDHA 1LEKB 2WM0A 4MQXC 2DLTA 5GS1B 2NMSA 2DQGL 5JXEA 3SCMA 1DP0A 3AROA 3W11C 4R6UA 3PQYE 4NFBA 4MZ3A 1BAFH 3FQNA 3ES6A 2YPLE 2P5EA 4JANA 3MBXH 4YBQD 1A9BA 5DZNA 1U3HC 4XX1E 4XP1H 1T89A 4YUEH 5AUMB 3BESR 3HG1D 5I1LB 1MVUB 4OZFG 3QXDB 1MREH 2KQMA 5I1JL 4A2LA 4XZUB 3G6DH 4K94L 3BQUA 1P4IH 5F96L 3KS0H 1HHHB 4JJ5A 4HGWB 4PRNA 1F3DH 2WAHA 5CJQH 1SM3L 5L88L 1Y6NR 1R24B 1LE9A 2AK4A 12E8H 1GAFH 3L5WA 1OCWL 2NY6C 5KANG 5JXAH 3CMOL 4O4YH 3DYPA 5EO1A 3QUKB 1HH9A 5J89A 3L3HA 1AP2B 5JORA 1KCVL 4PGZA 3ARBB 4PJ5E 1MPAH 1LVEA 1KIPA 1YEEH 2NY0C 1PBYA 1OP3K 1JPGA 1LO4H 3SGKA 1W8NA 3RY5A 4ZUTA 4LPUA 1WQVT 3JWOL 5BOPA 1GPOL 1QVOA 3CJJA 4PGCB 1LO0L 3F58L 2FO4B 3ECBA 4WU7B 1VA9A 1X4XA 4OCRH 5E56A 4CVZA 2IH1B 1OSPH 2AW2A 3CZFA 4PJ9D 5CBEA 5L7XH 1OAQL 4HKBB 4ZS7H 2OXGA 3CFCL 5FA4B 5GRWA 3HUJE 2AJUL 3AFLA 3ZKSD 1H8OA 1KT2A 4P5TD 2XWJB 3OKLA 2VL5A 4OM1L 1T2QH 5F3HB 2FEEI 4CKVX 2YWZA 3RTQB 3PGCA 3RVVD 3U9PH 1KSRA 5D1XD 4D94A 5T5FL 4J3SA 3R0MA 1ZGLM 4M1DH 3LEVH 2M2DA 1TTGA 4IRSD 3VXNB 4HC1L 5I8CA 1CFVH 2VDOH 3WFBL 2FIRT 5GGRB 4PJXE 3K8MA 2OTWA 2YSSA 4MNQB 3SDCB 2EDEA 1E4JA 1T1WA 3VXTA 1CYGA 5E2TH 1FZJA 4QXTB 3TIDB 1YY9C 4YBLC 15C8L 2F74B 5KOVC 1QA9A 3KPRA 3V52L 2W0FB 3R8QA 4MQ7B 1NCAH 4XI5C 1WUNT 3OJDB 1DLHB 4HWBH 1FGVL 4JM2C 4PB0H 4WI9A 2Z31A 3EYFA 1SMAA 4PJDE 2BC4B 6CGTA 4Z0BH 1R5WA 1ZHBB 2AEQH 4HC1A 4I77L 1Z9SA 2AV7A 2PW1B 2FHBA 4XHJD 4BH8A 5IESL 1KPVB 2P5WE 3QEGL 2A0LC 4OUUA 2BJMH 3NTCL 4PREB 3REWA 5I73C 2VC2H 2FECI 4G7VH 3BGMA 3DBXB 2L0DA 1NGZB 4NQEA 4YXHL 2VLRE 2CDFB 4NOFA 3C8KA 1KJ3H 3ME0A 2DMBA 2IAMB 3O4LB 4GSDH 4GG6B 4M6OH 2XXCB 3P40A 5ESQB 3O6KL 3FFCE 4EQ3A 5LBSL 3WFDH 2DQEH 5KZCD 3ARGC 4HKZA 4FABH 2UV3A 1B6UA 3TT3L 2X7LA 3M17A 5HGDB 3VFOB 1CD1A 4DVBB 3BP5A 4YDVA 5ITBH 5IV2A 1JTPA 1Q94B 2C4FU 1SBBA 2A6JA 5KG9B 1YQ2A 1KJ2L 3X3GH 5LQBL 3QJFA 1PG7W 4QTIH 1CG9A 5C0NC 1ZAGA 2Z93A 2F58L 1D5ZB 2VR9A 5DFVC 4M7ZB 5JIHA 4R7NA 4BKLA 2AQ3A 4NCC2 2DQFA 1IGCL 4PY8J 3PHSA 5GRZA 1MEXH 1M7IA 3GK8L 1KENL 3VWKB 1IC7H 1RIUL 3T09A 5D7LA 3BRDA 3MODL 4L3AA 4LRNL 2IWGA 5IIEA 5DRXB 3OB8A 3T0XA 4NPYA 4M1GH 1WWWX 1LE5B 5EBMA 5EBGA 3PWPD 3E0GA 1UEYA 5DD0H 3UTSD 1KJ2A 3IDNB 3DGGB 4L8SC 4WWKB 1NFDF 5I76A 4FG6D 3N1FC 3QIUC 2V7NB 2W9EL 3R06B 3P73B 1CFTB 2JB6A 3MLRH 1KIRB 1XCQA 1BZ7A 2CRMA 3NA9H 5KW9H 5IBTH 1QSEB 2D7NA 4R26L 2OX5A 3MRFA 1G0DA 4KJQD 3OB0K 4RFEA 3MUGB 4KK8C 4YXLH 4JHZA 1IAII 3BMVA 2O5XL 5A3ID 2NXYD 1U92B 5IW1B 2X1QA 4TQEH 2XQYG 2C4XA 1T20A 5EH1A 2ZSWB 1BGXH 4L9LB 1N6UA 1P9MA 1J0ZA 1IEBB 3U82B 1JYVA 2NR6D 1MJ8H 5DVOA 4GKNB 5I75C 1G7JB 5CUSH 2R29L 1B0GA 3L3JB 3RKPA 4Z76B 2PO6A 3JTSB 4L9LC 3TBWB 3TJEL 3CFEB 1QPXA 5DT1L 2G9HA 4HXBL 4P2OC 1AGDB 1KELH 1EO5A 1KB5B 2ZOKB 1UQSB 5LVEA 5C0CA 5CMAA 1S7UA 5EU3B 3QCTL 4D9RD 1H3TA 3NVQA 2BSSA 3U7YL 5IJKC 2W60B 4ZAKB 4FQHB 3PWUB 3QUYB 2A9NL 4JE4B 2P44B 1DANU 1FZOA 1JMXA 1AQDB 4JZOB 1P1ZA 1IKFL 4BSVA 3HN3A 5LCVL 3GHEH 2Y07L 2XKNA 1AGBA 4NO5B 1BFSA 3CFKA 3HLAA 5BO1H 2FO1A 1S5HA 2ZPKL 2XRAH 3BAEH 1BREA 1NCUA 1MWAH 1S7XB 4IRJD 1OHQA 2HTLC 4PJ8D 4KAQL 5IW6A 4XH2B 1NC2D 4LP4A 4I3SH 4NO3A 1XGRA 2QSCL 5HVFB 5FUCE 5F7YC 1R3LA 5JW3L 4P3DB 4ZNEA 4IIQC 1CQYA 2NY1C 4LOUD 3B9KC 1GGBH 3HA0A 3JV6A 2DQHL 5KSBE 4NJAL 5B21A 3IFNH 3RU8H 4Q0XH 1N7MH 4QRSA 1MQ8A 1WJ3A 3QUXC 3OXSB 1VEPA 4LLQA 4NZJA 2HFGH 4WRLA 3QDGA 1RVFL 1MH5B 4XPHH 4YO0A 2V17L 2DF3A 3REVA 1EPFA 3IFPB 3UTPD 3MRIA 5C07E 4WUUB 3AU1B 1CK0H 2FEEL 1PGRB 1TQCC 2BMKA 1DR9A 4LBEA 2MQ0A 1U9KA 3DV6A 1U8JA 3QDHA 3ZKXC 4L4TA 4JHWH 3QQ9D 4NBXB 3MJ9H 3CX5K 4P23C 2IF7A 1L4IA 3D87B 1NSNH 2E6QA 4QRUA 5GGTH 2Z92A 3WUWG 1UYWL 4JKWA 1J1PL 1XF2A 1UJ3A 4YFEA 3FQUA 3P9WB 3GMQA 5CBAA 1DBMH 5MEQB 1U3HA 2YXMA 3I6KA 4URTB 5KBNC 3HZYA 2YBRA 2PYEB 1TVHB 2VSCA 4ELMA 3VXMD 5B8CA 4LNRB 4TVPL 1E0OB 1RHHA 4R90H 5DHVB 2AGJH 1IC5H 3WLBB 2KDGA 4Q9RH 1TENA 1QRNE 4LQ1A 5I1KL 3H9ZA 2VZTA 3T0DA 1RK0B 4R9HA 4X9FA 3B6SB 1ZHNA 1NGPH 3S6CA 4ZD3L 2O61A 2A1WL 3QPXL 2IQ9H 1P5UA 3CSYB 5JHDB 4PRAB 3KYMB 3UO1H 1R3JA 3L7EB 1WCBA 3MRKA 5DMJB 4HUKB 2O93L 2M26A 1UADC 3V4VL 5I17A 1LDPH 3EYVB 4MA1B 5KN5A 2FECL 3ZDZF 5DWUH 3GI8H 4HBCL 4WW2F 5B3NA 3DETC 1JIBA 2FH6A 4WCYL 3QO1B 3MZGB 5CP7B 1OARL 3IETB 1RULL 3SJVE 3RY6C 1RAMA 4R8WH 5E1AA 1MCKA 1W2KT 4WEBH 4U2YA 4Y19E 1WEJH 3OJ2C 5TF1H 2EYSB 1UC6A 5ISZB 3VXUA 3U7AA 4LSRH 1N5AA 2GIYA 5KVDL 1LHZA 3RWEA 3MLPA 2OI9B 2FL5A 3C5ZB 1A21A 3U0TB 4QCIA 4PRID 5BS0B 1CZ8H 4JKPL 1ULVA 3CZJA 2FD6H 1P84K 3MV9B 5EWIH 1VFBA 2DBLH 5KVFL 3ZDXE 4OJFH 4FFZH 3BP4A 1N6VA 3V7AG 4R0LB 3RZCB 1UH3A 4JQVC 4NJ9L 1WFNA 3GBNH 1U8QB 2H32H 3W9DB 4V1DA 2COQA 5E2VH 4KVCL 5L2KB 1HWGB 3BKCL 1VKXA 4YE4H 4ZYKB 1BQLH 1QYGL 3IXAA 1R3IL 4XVJH 2R39A 5C6WH 2GCYB 3WKML 2XWTA 4JR9L 1OWWA 4X5WA 3BSZH 4U1SA 5I74C 3I02A 5DI8B 5IFJA 4JM2A 4PJGE 1OP9A 3Q2CA 4EEEA 2GJZB 1B4RA 1XGQA 1BIIB 4B53A 4HPOH 1FZMB 4XPAL 4FFVC 4RGND 3MJ6A 3B9AA 3RUGA 4XCNA 4RFNB 3WIIL 5JXED 3QDJE 3SCMD 1MRCL 2HKFL 2GK0A 2R56H 5I1DA 1IAIL 3U46B 4PLJD 1A7OL 4GKSA 4D0BA 5C7XH 2P5ED 4ZSOE 1EEYA 4GRMA 1S7WA 1MJJA 4HKJB 3D3VE 1B3JA 3ARGA 2J1KA 2ZKHH 1JZ5A 4KRMB 3V4PH 1MFAH 1H8SA 3MJ7B 1AO7E 9CGTA 3KYKH 3FT4A 1JNHB 4TNVK 4Z5RB 4QRQB 1XR9B 3VGGA 1P7KB 5FKAA 2HMID 2F53D 2AI0H 2EDXA 4Z7QE 1JP5A 2WK2A 4NM8L 5I1GH 1TTFA 3O3UN 1CE6A 1GIGL 3I50L 2J4WL 3F5WB 3VXOB 4KRPC 5MENB 3QULB 4GMTL 3MLZH 1A6WH 3UZQA 1FYTA 1I1AA 1WC7B 5HVHB 4KY1H 3MA9L 2W07A 4ONFL 1BLNA 4X5XA 4Y1AD 2ZUTA 2PW2B 4XP5H 3BWUC 5GGUB 1BM3L 1MCOH 1F2XK 1FC2D 2WUBL 3PGDA 4L4JA 1E4KC 2ZUQB 4JHAH 2W9DH 3R1GL 3FFDA 5FK9B 2BVPB 3HPJB 1Y18B 1IQWL 4DK6A 3IDMA 4JCMA 4BH7B 4HJGB 3CNKA 4O2EB 4FNLH 3IXTB 5DEGA 1INQA 4XBPB 5E4EB 5CEXA 4KHTL 4JPWH 4QOKA 3WYRA 3QIBB 1HNGA 4DN4L 1WWAX 1SJEB 3VG0L 4ONGH 4WO4D 2ESVA 2VLKA 2G2RB 3L9RA 2IEPA 4OCXH 2CLVA 1A8JH 1ACZA 5ICXB 1T5WB 2JELH 3L3KB 5F3BB 3Q6GL 4GKZB 3CDYA 3BZEA 4PP1C 4YHMH 1H9VA 5HD8D 3WFHA 2QQKL 1UWGH 4MJ2A 5J1AA 3DXAD 1F8TH 4RGMC 4BQ9A 1TCRB 3QEUA 3BRFA 4RBPK 5SX4H 1CLOH 3BD5A 2B2XH 1XIWA 2WSKA 4FQXB 1D5XA 2CIIB 1A4KA 2EH7H 5C70A 5EZJA 3WIHH 5T33H 5D7SH 4YUEL 2R1WB 3QNYA 1ZS8B 1Q9OB 1KIQA 4PJEF 4EIGB 4XP9L 1MREL 2XTJE 4P2OA 2NXZD 5CEYA 3DTXA 1V05A 3SE4C 2P48B 3G6DL 1BD2B 5F6HJ 1JF5A 3LKQB 1Z2KA 2FYYB 3LQZA 3O41A 2VXUH 3GJEA 5IK3B 3OKOB 3VMNA 3W9EA 5DQJA 1DTUA 1AQKH 5GRUH 3BYYA 5CZVH 2Y4SA 3QUZC 4XAWH 3OKMB 12E8L 1GAFL 5IMMB 2AJVH 3MRBA 4X4MA 4JRXA 4PR5A 3BO8B 1IL1A 1R3HB 2DQUH 3BPCB 4X98A 2I5YH 3EHBC 2B1HH 1WBXA 5T1MB 4GLRH 3P30H 1NFDB 2LU7A 3L5JA 2J88H 4NZRH 2E9BA 5DHYA 3HMXH 1HXMA 4QTHA 3MUJA 1HDMA 5D7JB 3TBYB 1G6RB 4MNHA 3EDEA 2YS4A 5DEFB 3MLYL 5DJDB 2RHEA 1MCHA 1DEEB 1I1YB 1OSPL 5KSAA 2FJHA 4X9IA 1MIEL 4YFDB 5L7XL 3RWJB 4K8RC 2Q87A 4IIQA 3RX8A 4ZS7L 2J5LB 3B9KA 5IVXA 4U1LB 3CSGA 2QHRL 5EOQH 3HE6A 5HPMA 2PXYC 3QUXA 1AGFA 1JYWA 1LO5B 4RAUB 4FTVA 3WIFA 1T2QL 1JGUL 3KPNA 5FHAL 1KGCD 5C08B 2GTZB 2J5LC 3I6LE 2FGWH 4JAMA 4ZOAA 1T1YB 1MLBB 3MA7A 3WJJC 1BF2A 2VDOL 4ZXBC 1DUZB 3MRNB 1C16A 1W8OA 1CTNA 4P23A 3D6GA 2DMCA 1QR4A 4P46A 3HPLA 3MROA 4OIIL 1QSFB 1GZPA 4JB9H 3U0WH 4ODVH 3IU3B 4TVPE 3BYTA 2DTML 1NCDL 3C9NB 1U91A 3WLWC 4LCCC 2NYYD 3LKRA 3IDIA 4EDWH 1YNLL 4U6HB 4U0RB 3ILPA 5HHPB 1NMCC 4MXWL 2Q8AL 1EJOH 2HVJA 1SEQL 1U8LA 2K9UA 3G5VB 3NIGE 3DVGB 4LKXB 3GBML 4UOW0 5C0BB 4PB9L 3THMH 4AG4H 4X4YB 4V2CB 3SBWC 4PTTA 4XNMB 4E5XB 3EO9H 4WHTA 5GISH 2V2TA 4OSUL 1RUAH 4Z7UF 2VZOA 5EU6E 4FQLL 5GZOC 2OQJA 3MNWB 4JZJC 1CR9L 2PO6D 3NMEA 2AERT 4L3CA 3UJJH 4Y5XB 2DQCH 1SBSL 5KS9A 1S3KH 3WFDL 4HWBA 4MXVF 1XGYH 2D4DA 2DI8A 2HT3D 4FQCH 4XTRD 4N0UB 3SKJH 2X09A 2F5AH 3MCKA 1EH9A 4G6AC 5D70H 3IB4A 3VGDA 3LKNA 4I18B 1BJMA 2QL1A 2AQ2A 4WDIA 3T1FB 4OV5A 1GGYA 1NJ9B 3L3DA 4AEHH 3X11A 2ID5A 3NCJH 2VDMH 4JO3H 3X3GL 4M02A 4Y4FC 4P5TB 2NTSP 2OJEB 5BZDA 2G5RA 1NGYB 1JF6A 1XGPA 2DYPA 1QUNA 1G7HA 1T6WA 4I2XE 3T1WA 4MNQE 3UCRA 3TIEB 4N9GB 1MCWM 5F1OB 1DVFA 2VIRB 4QHUA 5IMKB 5DJ8A 5EOCJ 1IC7L 4BZ2H 4JGJA 5T1KA 4GAGH 2V5MA 3GKZA 4UDUB 2AJ3B 4PJAF 1FCCA 4RMTA 3FO2B 4M1GL 5GGSY 5DXWA 1UWXH 4WGWB 1KTRL 4E41B 4EBQH 5T3XD 4X8JB 2D0GA 1X5ZA 5ITFB 1NAKH 1RU9L 2MCPL 5HGGS 1MCSA 3DX7B 4ACPA 5GRJH 1CL7H 3WHXB 5F72S 4XP6L 5E5MB 1AXSA 3MGTB 5GGVH 4KDTA 5KW9L 3QDGD 1KN2H 1DBKH 1UXWB 5C0AB 3GFUA 4CMHB 3VGAC 4DKAA 3FB5A 2AJYL 1IEAA 4YXLL 3BHBA 5E4IA 4H5SB 1AXIB 3EFDL 3MLVH 2CRIA 3O4LE 1JRHH 4GG6E 3X12A 4GOSA 3EJYC 3ZYIA 4AIXA 3IDXH 2P5WA 4FQ1L 4TQEL 5F9JA 2BCKA 5AG8A 2VISA 1BGXL 3IDYB 3NZ8B 3QDMB 2IANB 4PJIA 3B5HA 2VOTA 4LCIH 4WW2B 1NCWL 4N5ED 3D0LB 2Q86B 4MJ6A 1MJ8L 2APVA 2DRUA 2VQ1A 3FT2A 5ABDE 3L5HA 4HDIB 4UTBL 4Y0GA 4YPGB 1CE1L 1T0MA 5E08L 3L95A 1AKJA 2EXYD 5LGJB 2IPUK 1HI6B 5FYLH 3K8KA 1KIUA 1OY3B 2GI7A 2NW2B 4GFTB 1S9YB 2DM7A 2B20A 3IDYC 5L2JA 4XNYH 2DQJH 1WZKA 2HLFC 5EIVA 1FL3B 1KELL 4TYUA 5M95B 1JHKL 5DYOB 5MERB 1JGVH 1LD9B 1XT5A 2DQIH 1J0IA 3HFMH 1H0DB 4RQQB 4JLRA 1FNSH 1JI2A 2D9CA 1PKQB 3C6LD 4RBPH 4XPTH 1ZHLB 3KJ6H 1T83C 3G6AB 2D3VA 4HIEA 4U6XA 5FOBA 3O3AA 4GAYA 1D9KC 4NZDA 3D39B 3VCLA 3UTZB 4KV5F 4JGUA 1NGWA 3GMOA 5FA3B 2D7PA 2XRAL 3F7YA 5C86A 1MWAL 5DJ6A 3ARYA 2VZVA 4OZIE 4KTYA 1UXSB 3HRZB 4FFWC 1QSEE 5IQ9A 2HJKA 1OAKH 1FO0L 1P6AB 3FAXA 4I3SL 2V6HA 4CU6A 2ICWJ 3DUUB 1E4KA 4XMKL 1HHJA 1F90L 4KJWC 1Q8MA 5IROC 3D2UB 5TGBB 2KH2B 1OTUD 3PL6B 4NYLA 5EBLA 3S96B 4KVNH 3MRLA 1V3LA 3RU8L 2ICCA 3TH4T 2RBLA 2YD5A 3V8CA 5B38G 5GGQH 4QXGL 4L8BB 5ETUA 1I8LC 3IJSB 3D9AL 4JO2L 5CILL 1MWAA 1YEIH 3SGDH 2N7AA 3MXVL 4Y4HC 4XCFH 2OP4H 3KXFE 1DE4A 5INDA 5EBWA 5ALCL 3T0VA 2IFGA 3MGOB 1JHTA 2ADJB 4YQXL 3HR5B 1KLFA 1OM3H 1QSVA 5E8OB 2HVKB 2ADIA 1FIEA 5E2WH 3RQ3A 3FO1B 2VNCA 3MJ9L 4JFFE 4DK3A 3T2NH 3RDTD 5GGTL 4LKCB 2MHAB 3SKNA 1EAPA 3UC0H 2A6KB 3ULUH 3WMSA 1DBML 5M94B 2X4QB 1CXLA 3K81A 1N64L 3DHJA 3TO2A 4Z8FH 2MCG1 4UB0H 3KPSB 4GMSL 3MFFA 3LHPH 3JUZA 4GRLB 3PDGA 4LLVA 1FL5B 2EYRB 4NQCB 3WUZA 3TM6A 4FQQB 5DUML 3SE4A 1F3RB 3ZSSA 4Q9RL 3V8OA 3PDOB 1U8KA 4ZOBA 1I9RH 5GGSA 2H9GA 3EO0A 1X9QA 4Q9QL 5I8EA 1EX0A 1YNTB 2IQ9L 1NBYA 3MJ9A 4Y89A 5JOEA 3R0NA 1OPGH 1VACA 4K8RL 1GGCH 5J57B 5GGTA 3UO1L 1CIDA 4KQ3H 3TESA 1BECA 1QFWH 3EOBA 4CVXB 4MSWB 3U36B 4OTXH 2HT4C 2XV6B 2W0PA 4U6TA 3SOBL 1E27B 4WU5B 3NN8A 3FB8A 1IAIM 3IVKB 1ZVYA 4R2GB 3MYJB 3TCXA 3CC5A 4M3JA 3STZA 5E03A 1RZGB 3VGBA 2HLAB 4KKBD 2JB5H 4WUUE 4S1QH 5TF1L 1GZQB 5I9QC 1S7TA 3UBXB 3W0WA 1FYTD 1I1AD 3ILQD 1YMMA 4XPGH 3FCTB 4IMLA 4ZODA 4JO1H 2PXYA 2W92A 3MV7D 5FXCH 1H3UA 3FQWA 1F3JA 1MHCB 3QNXB 1JBJA 5C07A 3O9WC 4L9DA 5CSZB 4Y16B 5EWIL 3VJ6B 2XNAB 3ZE1F 5I1AB 4Y5VA 3O8XC 2PYEE 1HSAB 3FB7A 4NN6C 2LE9A 3QWRD 4UUJB 3DO7A 4PJEB 1KLUA 2SEBB 5E2VL 3NFNA 4OGAD 4G9FE 5EDXA 1EHLL 1HYSC 3QH3B 4XVJL 2DLFH 4QWWD 1U93A 3VD4A 1FFRA 2AABL 4JRYA 1U8PA 5DJ2A 3VI3F 2ESVD 2VLKD 4HIJA 5HHMD 2EC9U 1KG0A 4LCCA 1JGDB 2CJUL 2UZIL 4MNGA 2V2XB 5A16B 2YA2A 3VWJB 4Z95H 2HJLA 4B7LA 1CFQA 3QNZB 3FB6A 3ULVH 3MREA 5MHSD 1R0AH 5I1HH 4MCYB 4Y4KC 4EUPH 4L4VA 2XICA 5C2BH 1XIWD 5F7NC 1WITA 1BQHA 8FABB 5C7XL 3S5LB 1FJ1B 3ROLB 1T7XA 1T66C 1PZUB 4FQ2H 4PJCF 4X7EC 4JZJA 5J9PB 3MV8A 3TYGH 4NUGH 4RWYH 1FVEB 1ZHKB 5TH2B 5ISZE 2K1MA 1MFAL 3AREB 1A4JA 2NCMA 3PUCA 4U7KA 3VFVA 3ZT7A 1ITCA 3BKYH 3WFEH 3KYNA 4J8RB 1N3NA 1T6VN 3NFSH 3MUHL 1RZKH 4P2CG 3NZHH 5DD5H 3RGVC 3S98A 5BS0E 5DHVH 5I1GL 5JNYB 4P57B 1DL7H 2I60H 3AC0A 3STBA 4APQA 2J8UF 5DUPH 1KTLA 4M8QB 4N8CH 3MLZL 2NY2D 4LAQH 2KZWA 3VRJA 1LP9A 3FONB 1A0QH 3ARVA 5L2KE 1NDMB 4O2CB 1IQDB 2BDNH 4C56A 4R4BB 5D93C 4N0RA 3BP7B 5HGHA 1KEML 4XNXH 3VXRD 1AI1H 2P8PA 4KROB 4PIRF 4LSSH 4R7DA 4RWHA 3GB7A 3A6OA 5ICYA 1RURH 4UTAL 5IB3A 3PP4L 4HK3J 2G75B 1RUML 5KSAD 2YD6A 4M7LL 5DD3H 4PPTA 3MNZB 1UWEL 1U8NB 4WV1C 1JTOA 2Z4QB 2Q76B 3GSUA 4DGVL 4DW2H 3QISA 1IMHC 4OKDA 2CLZB 4F3FA 4DGIH 1MIMH 4FTVD 5DC9B 1AE6H 1X4ZA 3GKWL 2HT2D 3DVNB 3IYLW 5CGYD 3CX5J 1G1CA 1CT8B 4MD4A 4N0FB 3VXSA 1WFTA 4PLKC 3D0VB 5DZOA 4NQDD 4G7YH 3L6FA 3I3DA 2DDQL 4WY7L 2FBJH 3OHXA 3JBG7 4DFHA 1IGIH 5E5RB 4JN2B 1K3IA 2VWEC 2JELL 2BVTA 4J3TA 2EEBA 4M9OA 3GO1H 3HZKA 3QAZB 3SGEI 1OAUH 1NFIB 5D9SB 1UWGL 2CKBB 1S7QB 3PQYD 4LEXH 1DQLL 5C0EB 4OZHF 3MC0A 1KJMA 2KZ1B 5F44A 1S8DB 4ZSOA 5JOFB 2BP3A 3OPZH 4U6VL 2CIKB 4LMQI 4J4PD 1QHOA 1NGXB 4FZEH 2EH7L 2YD1A 5JR1H 5DFWH 3WIHL 1XGUA 4NSKB 3U9UA 4BA8A 4AK1A 4N8VA 4YWGL 5MENE 2CK0L 1IGMH 4YZFF 3QEQB 4X5LA 3KPOA 2E27H 1T03H 4QEGA 3RX7A 4MLIA 1LO3L 1CDJA 4HFWB 3QG7H 4QYOB 5ACMA 1ZLWK 2VE6B 5I66B 2WIIB 1EIBA 1FPTH 3DVFA 5GRUL 1T83A 1EK3A 4ZTOH 4PJ5D 2VLJE 2H2PC 2BHYA 3ULUC 1D9KA 3GJFH 3WE6A 4PJAB 1PW3A 1WSST 3NAAL 3O6FC 3WIHA 4H1LB 4P5KA 4W4OA 5IB2B 5J12B 3UMTA 2ZJSH 2E5EA 2Q6WB 3OGOE 2VDKH 3TP4A 1W72B 3KGRA 4ORZC 4NO0D 5E9DA 4XB7A 2PN5A 3T2OA 1MOEA 2EO9A 3MRHA 2HKHH 5E8DL 3K46A 5DMIH 3V5KB 1I7UB 1G7LB 1QZ1A 2J8HA 2ZCLH 1HILB 3TZVB 2BFVL 1ZT7B 2P42B 5IROA 1DDHB 5K9QI 1SJHB 3HNVH 4R97B 1L9NA 4HV8A 4M93B 1K4DA 3GI9H 2YRZA 4S1SH 4GXUN 1GGIL 3BN9C 4DCQA 4KMTL 4WO4B 1EZVX 3STLA 1I8LA 3PJSA 3ZE0F 3HC3H 5T1KD 4GW1A 3MMEA 1TPXC 4OZGA 4V2BA 5ADPH 2FHCA 1NAMH 3U4EB 2XYCA 5FDYA 5D72H 5EFIA 5HYSB 4MJ5A 1NLBH 5GRXG 2W65A 1MNUH 2HWZH 2X4UA 2YPKA 1B4JH 3SDDD 4M43L 3EDJA 4LCYA 1I7RB 1KACB 2AK1H 4RRPA 2CRYA 1FFPB 5F1SA 4N68A 1BD2E 2I24N 4OQ1A 4LQFL 1CXHA 5AZ2L 3FQTA 3QQ4A 4HGKC 3GSNB 2MMXA 1Q0XH 5E6IB 2GSIA 5BVJA 4H20H 2EXWC 2AEIT 1T5XA 4JY5H 1FH5L 4K07A 2DI9A 3VFTB 1IM9D 4XNZC 3DX9A 3ARFB 1UM4H 1V8HA 3VFRB 5IJVB 2BK8A 1SYVB 2XY2A 5HJ3B 4AT6A 2P5WD 2PNDA 1EJOL 5L0QC 4PRPE 5DK3A 1ZA6A 1NBZA 4K7PX 4YR6B 3T8XB 3KPLA 4AG4L 1NFDE 5D7IF 2DKUA 2VLRD 3MRDB 1AIFB 2B4CH 1N4XH 4G5ZH 1DJSA 1VSCA 1NANH 4KZDH 1CU4H 5HHOB 3O2DH 5J3HD 4XWOC 3CSBA 2A74A 3GNML 1RUAL 3N85L 3FFCD 3AY4A 1AKJD 4L5FH 4NHUA 3W81A 2VXSH 8CGTA 2G60L 4F58L 43C9A 2DQCL 2ARJA 2IH3A 3JZ7A 1ITBB 3B43A 5B4MC 1BFTA 4NO2B 4L8CB 1BBDH 3V6ZB 4X6DE 4CVWA 1I9IL 1HZHL 3CMGA 3T0EC 3ULVC 3DSFH 5C08E 3QEHA 1I7ZB 3CCHA 1WLHA 1BJ1H 1ERNA 3S36H 1LNUB 4FQIL 1DBJL 3HE7C 4WTXA 1KC5L 3HS0A 4BSWB 1FNAA 3UJTH 3UAJD 3GSVA 4NUJA 4A2MA 5GS1A 2XTLA 3MLUL 3OAUH 5E2UH 4OFDA 3I84A 3ZDYF 3M1BB 4ZUUB 1QSFE 3LKPB 3O9WA 4UT7H 3TA3C 1XMWA 1NBVL 4QRRB 3OKNA 1MVUA 1WBYA 3UTTE 1JV5B 4LRIC 3QXDA 1RZKC 5D1QD 4X83A 1Q9WB 1KCSH 3NCBB 3G5XB 5SWSB 4XZUA 3LKOA 5LWYH 4POZC 1LO2L 1XGTA 4MB4A 32C2A 1G6RH 3BDXA 4HGWA 5DMKB 2DJ4A 2G5BA 2ZUWA 4G9DB 5C0BE 4S1RH 1YEDA 3PWNB 3K2UH 1QPPA 4JKLA 4YHLH 1KN2L 2YKLL 5B3JF 3P0VH 1R24A 5EORH 4FQJH 1ZSDA 1FLRH 2X4TA 4S10A 4X6BB 1TFHA 5TE7L 3GMMA 1CLYH 3WNKA 1HQRB 3DRQB 3ARBA 1Q1JH 5JLZB 3SQOL 3ZKNC 4KKNA 4G8GB 4MD0B 5HDBF 3NH7H 4Y4KA 1A3LL 4N0UE 1OAXH 2IQAB 4P5MB 2A9ML 4QXUL 1IRAY 4Y5YC 1A47A 1TITA 2IH1A 6FABL 4JPIB 5D5MA 1NEZB 3BZ4B 1AJ7H 5CJ8A 4HKBA 4UMGA 1S7VB 4WW1B 2ZOLB 4PRHB 2XPGB 5C09B 1MLCB 2CR6A 2LAGB 1BP3B 4JREC 4XNYL 2DQJL 1JZ6A 2EH8H 2R1XA 3LSOA 2JIXB 3HI5H 1QQDA 1DQMH 3NFPA 3BGFB 4P4KC 4UV7L 3VU2A 4LU5H 2VL4A 4PJBF 4DZ8B 3R4DA 4OCWL 2EE6A 2DOCA 4P49A 1CF8L 4XPTL 4R96A 2ITCA 4LVNC 1B2WH 3TBTB 5J6GB 2EDRA 4IOFD 2DI7A 3X13A 1N2RB 1T7YA 4QXWA 4HAFA 4E41E 1I7TB 5FYKU 4YDIL 4QKXB 4OB5H 2AEPH 1YMHB 4D2NA 4WEUD 5TQ0H 1FBIH 3O2WH 3VFWA 1RIHH 5HI5D 3FRUA 3U4BH 4X7FC 4I4WB 4MQ7A 5D2LF 3L3GB 4DEPB 5C0AE 3RAJH 1OAKL 1C5DA 1DLHA 2FR4B 3MV11 4PYGA 2NY3C 2JK5B 5EZLA 2BXZA 4WV1A 3C60B 3EYOB 2BC4A 4CDGC 1ZHBA 5DJZB 1OAZH 5FF6A 1ZT1B 2PW1A 2XN9B 3MR9B 2NY7H 1XH3A 4EI5C 1BIHA 3I6GB 4FZ8L 1P5VA 2AQ1A 3QDME 1RZ7H 2IANE 1E6OH 3ZDZE 2MWCA 4DUXA 4AM0B 3DBXA 5C07D 1CDUA 2D03L 1MUJB 2CDFA 2M1KA 1YEIL 3DI3B 1P7QB 2IAMA 5CHNA 2Q7NA 2Y06L 4GG6A 1CICC 7FABL 4JHBA 2IFFH 2Z8WC 4FFYL 4ZFFB 3CFJB 4PJCB 2EZ0C 2VO5A 1PZ5B 5E99H 5FM5O 2ATKB 2J6EH 1U58B 3D18B 3GMLB 1OM3L 4PJXF 2AJXL 4PG9B 4XPBH 4IHOB 5CS7A 5DVLA 5DJXB 5E2WL 2F54B 4YGVA 1C7TA 1YEJH 5EA0H 1MCJA 4NN7B 1Q94A 3T2NL 4Z7VA 3K4DA 3UC0L 3ULUL 4NRZA 3B9DA 2B1AH 1PKQE 4J2XA 4Z8FL 4BK5A 4U0QB 2OYPA 1D5ZA 1QRND 4XBEH 4NGHH 2H2SC 1UEMA 4LCWA 3EJZC 4QHMB 4OLVH 3D39E 4RISL 2LTQC 5JDSA 5DJAB 2J8UB 3LS5L 4OD3H 3VWKA 4L4VD 5B39G 1I9RL 4MAYB 4F57L 4Z0XA 1IAOB 4DAGL 3F7VB 5SV4A 5D4QA 4L3EA 2GQHA 4YH6A 1OPGL 1P69B 1LE5A 1ORSA 3EYUH 2Z8VC 4LEOB 3IDJB 3DGGA 3RKDC 1OAYH 5HYJB 5CEZE 4IJ3C 4PGEB 1L7IH 5AYUL 4XBGA 2Y5TA 4OTXL 1CFTA 1IGYB 3SJVD 5KJRL 2NPLX 2H6PA 5TFSL 1TNNA 4Y19D 2C1PB 2EEDA 2Z8RA 1MCIA 2GSGA 2HTKC 2ZG2A 4TSCH 3P9MB 1YPZA 4NOBA 2FZ3A 2EDQA 1QACA 2DD8H 1IGJA 1JPTL 4APQD 5IW1A 3TO4B 4S1QL 5HSFA 4BQBA 5D1ZB 2XOTA 1MHEB 5HY9B 3OTTA 4JO1L 5FGBA 3SO3C 2GHWB 1NFKA 1RJCA 1JZ2A 1PQZB 2Q7YB 1ONQB 4ODTH 4NRXB 3BFOA 5IFAH 5T1DL 4GKNA 4WFFE 4MVBD 4OZHB 4UT9H 3O2VL 3L3JA 1D6EA 4M4RA 5GSVB 3ET9F 2LQRA 5C9JB 1FG2B 4Q6IB 3TBWA 4NWTL 1CGVA 3KPSE 2QSQA 3CFEA 4HIXH 1FNFA 3TT1L 1WTLA 4YC2B 1EFXB 3RDTB 5T1LA 4GG8B 4NQCE 4OZFB 1BQHG 3QJHA 4UQ2B 1J8HB 3ARDC 4N1CA 3K1DA 5EU3A 4L29A 3L5XL 3MQIA 5HI3C 3VXSD 2BVQB 3HMWH 4FQHA 3PWUA 3U1SH 1HINL 3H7BA 4XRCA 1AQDA 4YHNA 2DQDH 1H5BC 3TN0D 4F37F 1T7VA 3G5ZA 3LB6C 3BPLC 2YRLA 3QDJD 4NO5A 5MI0B 1VFMA 3BPNB 3LKSA 2VTFA 1F4WL 1S7XA 4NNXB 4UQ3B 5I1HL 2VLLA 3H42H 7CGTA 1OGAA 3MCLH 2KPNA 5I1CL 5AAMA 1AR2A 4LK4A 3VH8G 2FEDD 4KKAD 4P2YA 4WTZA 2EICA 2FJFB 4Z6AT 4NQSA 1S5IH 4NUGL 1LK3H 4HIIB 1AO7D 4RWYL 1EAJA 3A6BH 4BFIB 2C3WA 4ZOEA 1KJVB 1YQVL 4YDKH 1HKLL 3CLEH 3T0EA 2CGRH 3JVGC 4RNRB 3WFEL 1I9JH 4PV8B 3JSSA 3X14B 2XZCH 4EUPA 3CGTA 4HK0B 2YC1B 3IRPX 3AU1A 1JUFB 3ARWA 2X2YA 1T04B 4MQTB 1A7PL 5F93C 3B3IA 3QHTC 4ZUVB 1BEYH 4U33A 4LAQL 4KXZI 3B2UD 4GW5B 1F42A 4PJEE 3QZWA 4GAFB 3C08H 5AD0A 4YBQC 5E7FA 2P46B 4PP2A 5JUEH 4XNXL 4O2FA 1T0NB 5MEQA 5IF0A 3TA3A 5DLMH 1PG7X 4AIZA 1WK0A 5DRNB 3BPOB 1I9EA 5LGHH 3KAAA 4UBDD 4LRIA 2X5PA 1CGSH 4LNRA 5I16A 1FNHA 2A6DB 5E6ZA 5DHVA 5IMLB 5J13C 5CSGA 1FN4A 4YDJB 2VSDA 4QGYA 4XWGL 1RK0A 3ZLQC 1AE6L 5GS0D 4NT6B 4ODHH 4HEME 1BF8A 4M7KL 5BVPH 5JHDA 1C5BL 1Q9LB 2O5ZL 2WWKO 1G7PB 3OKDA 4UILH 5D7IB 5ERWA 1QLFA 3L7EA 3BN3B 4KTEH 1DBBH 1E28A 4XVSH 3C09B 5CJBA 5EOTB 4XCYB 1E4WH 2XACC 5DJYA 4ZUWB 2YZ1A 1FSKB 1MSPA 2DL2A 1RD6A 1PYWA 3ZMRA 4NKIH 4A6YL 1CBVH 2OL3B 3QO1A 4LEXL 5H2BB 5CP7A 1K4CB 3QFJA 3LN9A 4PJ9C 5TE4L 3QUMB 4Y5YA 3OPZL 1H3PH 4JFEA 1I1CA 1ZLUK 3RL1A 2VXTL 4MD5A 2VMFA 3BT2H 4FZEL 2XTJD 4MGXA 5DF0A 4X7CC 2Z9TA 4LMQE 5JPNB 1MFNA 5ISZA 5GQBA 3EYSL 3V5HB 1SMOA 3HTLX 1AHWC 1A6UL 1T4KA 2F8VA 3MRJA 2E7LC 2AXFA 3RVVC 4GRWF 1K9TA 5D1XC 3PP3H 4AH2B 2OMNA 2Q3ZA 3C5ZA 1CVRA 1YN7A 2E27L 1EXUA 1X5IA 4NZUH 4A6YA 2DLIA 4IRSC 3QI9B 3QG7L 1Z9LA 3MV9A 4Y2DB 5I71B 4LSUH 1K8IB 4HMDA 1FVCB 4X6EB 1CFBA 3WN5B 1YNKL 4R0LA 4QRTB 4LARL 1U8QA 3W9DA 4O5LL 3TWCL 5I2IB 3IF1A 2APTA 5I15H 4ZYKA 2B0SH 3MACL 3SY0B 2GCYA 1KUMA 1A14L 2VWEE 5LG1A 2BXYA 2ZJSL 3Q48A 2UYLA 1A1OB 5HHXL 1FVDB 2VDKL 4M4PA 2BVEA 4C58B 2GITB 3MLXL 3U30B 3UPAA 2F19H 1U3JA 4XVTH 4XP4L 2GJZA 2ZCLL 4JDZB 4LFHD 4HXAH 3DMMD 2V5YA 3K4AA 1HWHB 4XHJC 4QY8B 3G04A 4Z7UE 5EULV 4DGYH 3RVTD 4KI5F 3HNVL 1FZMA 1F58H 4EI5A 1K2DB 1JZ3A 4P2RB 3GJFA 5C0DB 5IW3A 4ETQA 1RFDH 1S9WA 4S1SL 3FKUS 1CXIA 1T22A 4KPHH 4MXVE 4AY0A 1NKOA 4DQOL 4JFDB 5H35B 4I3RH 3EOTL 3RVUD 5T3ZH 4OLXH 1CICA 4WFGE 1G9NH 1GVIA 3SE3C 5CP3H 1EEUA 3TNNB 3PHOB 3ZKQD 4K2UH 5JIIA 2YPLB 4ISVB 2HFTA 4OUOA 4BUHA 3N50A 1B4JL 4U1JA 3AXLB 1JNHA 4KZEH 1XR9A 2AK1L 3V6FB 2VDPH 3QEQE 2IG2H 4TVPD 4WWID 2R2HB 4ORGB 4YHIB 4XGZB 1UKQA 1HQ4A 3C5JB 2PR4H 2ADFL 4PJBB 5MENA 1UM4L 1NAMA 3P4OB 1MCNA 1X7QA 1Z9MA 4PJAE 3QYCA 3MJGX 3WXVL 3OR6B 1NMBH 2AJSH 5HYEA 3UTOA 1B90A 2EDFA 5A40E 1EO8H 1I8IB 1JWMB 2JE8A 4CVUA 5GGUA 4PJ5B 2X70B 1MHPH 4UNTA 4KZDL 1CU4L 1TJHH 4RGOL 3O2DL 2RQ8A 4H0HB 1C12B 1SEBB 4YAQB 5D2LB 1VGKB 4FG6C 5C0RL 2VQUA 2CKBH 3DX6B 4N0YH 3VG9B 2ARWA 2YN3A 5F9WB 3AS1A 2MSPA 2YD9A 3IXTA 3N1QC 1OF2B 2OR8A 4KJQC 3RBGA 1E4XI 3RTQD 4LLYB 5ANME 3QIBA 1NC4A 1CFNA 5A3IC 3BOVA 2NXYC 1SJEA 5D7KE 4HUMB 3S37L 2BOBB 2R0KL 5ICXA 3S36L 1JWUB 1ZTXH 3O2DA 4UV4H 2O26U 1PJ9A 4GKZA 4O58H 2WINB 3W39B 4MNQD 2NR6C 3SDCD 5EN2A 3D85B 2VZUA 4KK9D 4WUKL 4F2MA 1MI5E 3VXPA 4J6RH 4PJXB 3BE1H 1IAMA 1MRFH 1N0XL 4WFHD 2CIIA 2CMRH 3J8F7 5E8NB 4AENB 2DAVA 3UX9B 1F97A 5LAXB 1AD0B 4HUVB 4H1LH 4HFUH 4ELKB 4Z77B 4ZMAT 4F80A 2X9WA 3T0WA 3V7MA 1W72H 5F6IC 1FAIL 4HCRH 4MJIB 1JNNL 3ARDA 3VD3A 5JO5B 4QRPA 3UJIL 3LKQA 2BVYA 4MA7L 3MXWL 1YN6A 2R0WH 4CJ0A 4YGAB 5E95B 3OKOA 3T3PF 1MCQA 2GY7B 4YHLL 1YUHB 3K3QA 4LHUA 3P0VL 3O4LD 4PFEA 1S9VB 5EORL 5JW4Q 5IMMA 4HAGA 5EO9A 1FLRL 2ERJC 3V4UL 5FYJE 1A7QH 1RK1B 2HRLA 1VENA 3S5LG 5D6DA 4IRJC 2D7TH 3BPCA 1F2QA 3T77B 3L3IA 1VFAB 2BSRB 4BM7A 3HZMA 5T1MA 3P9LA 3A67L 4PJ8C 3H6JA 4PV9B 1EVUA 4K71C 1J8KA 4HHAA 5AZEH 1KCRH 5IMOB 4GS7B 4X7SH 4YHOL 1G6RA 4HUUB 5DJDA 4QNPF 4LOUC 1DEEA 5HVGB 5F7LB 1JI1A 5F71A 4XXDB 2Z35A 4O02H 4G8EA 2GFBA 3GMPB 3GSOB 3U83A 1ED3B 1A2YB 2R4SH 2Y72A 3LN5B 4MZ2A 2DIJA 3QO0A 2X1OA 3D69B 3KPMB 5EU4B 2RCSH 5I19H 1P53A 3GSNH 2WBJB 3D5OF 1KBGL 3FHQA 4UINH 1MJUL 4X9GA 3RWIB 3VWKD 4RAUA 3MO1B 3QIUD 4H26B 2BNQB 4X4XA 4OKVA 3JVGA 1YZZA 4EIZC 1XF5A 4DTGH 2BOCA 4ZPTB 5E8PB 1A6AB 1U41A 4MDIB 3RA7H 4OCYH 1T1YA 2LAAA 3EJJX 3QQ9C 4QRRE 1RZ8A 1UB5A 4WWKD 5EUOA 1HYRC 1OQXA 3PWJB 3NOIA 2A6IB 5SWSE 4PTUA 3KHOA 2BSED 1JZ8A 4QF1B 3TVMB 1C8PA 2IALA 1QSED 1RZJH 2AEPL 5SWZB 5J11C 3UYRL 3OXRB 3TBSB 5TQ0L 1FBIL 3O2WL 5IB5A 3FOMB 3HG1A 4WEMB 3IU3A 1RIHL 1TVDA 5TDPA 1CIUA 3RAJL 2BHZA 3E3QE 4J1UB 3EYQD 1NUGA 3W5NA 5CCKH 5GS3A 1V3JA 4JN1H 4ONHA 4PD4K 2MQCA 4OQTH 1OAZL 5KVMC 3E8UL 4LKXA 3ALWA 1CDYA 3HAEG 1S9KC 4G8GE 3EOAB 4JFZL 1FIGH 4HULB 4E5XA 5K9QG 5M7QA 1U6AH 5ESVB 4E9LA 1RZ7L 4Z7WF 1E6OL 3KXFD 4ELMF 3HI1B 1XF3B 5EZOH 1JJUA 3MNWA 2ZSVA 4M48H 3MGAA 4YHPA 4OV6F 4XCCH 2HJFB 3MBEB 1P2CA 5GS2D 1DQJB 1MCPH 4DOHB 4PRHE 1T1XB 2R0LH 4MMZC 4YIQB 5D2NB 5FHBH 4R3SA 5C09E 4JFFD 2J6EL 1TJGH 4UIKH 3EFFB 2B8OT 2BNRE 2R9HD 2EKSA 4I18A 3M07A 4ZAKD 3ULSA 4FA8A 3QUYD 1YEJL 3T1FA 1NJ9A 2Z8SA 1S9XB 5J6HA 5BV7B 4GBXB 5FCSH 1J88A 3AAZB 4GW4A 1OT2A 3HI6L 2DIBA 4P5TA 3VDAA 2FSEB 1O7VA 1NGYA 5E8EB 1AHWA 4H25A 4XBEL 3E2HC 4NGHL 4F15B 3NABH 3ZE1E 2ZCHH 1KV3A 4QHNA 1HHKB 1WWCA 2UWEE 2D9QB 4OD3L 1IC4L 1TZIA 2V2WB 2J6EA 3GM8A 5IMKA 4K3GA 4AL8H 2BSTA 1UH2A 2R0ZH 4IRSA 4NDMA 1UM6H 2QQQA 2GUOB 2VAJA 4UDUA 2AJ3A 3I85A 4G6FB 5JPMB 3WO4C 4ZUSA 1ADQH 3LDBB 2C7UA 3LOWA 2ICWB 3QP3A 2B7DT 2FLRT 2R4RL 2X4SB 4MCZB 5ITFA 5MP6L 1E6JL 2VDQL 5DDHB 4YDLC 4K3EH 4BZ1H 4DVRH 5I6XB 4M7JH 1L7IL 2XN9E 3VA6A 3L5IA 3SDAB 3FQNB 2VABA 4JANB 1FGNH 4AIOA 5KSBB 5IVOA 4WUUD 4LSDA 4H5SA 3JWDH 1XF4A 2Q3AA 3E6FA 1JK8A 1D5IH 2DD8L 1H3WM 3QRGL 3FO0L 4RGNC 2KKQA 1XCTA 1QFUL 5JXEC 1E4XL 3W82A 3SCMC 2FH8A 1ZA3B 4JVPA 4PJCE 3BQUB 1PY9A 4PLJC 4OF6A 4CAGA 3QDMA 4JJ5B 4PRNB 3JUYA 1T89C 25C8H 43CAA 3VI4F 4JM2F 4LVOB 1FNGA 3D0LA 3LIZH 3H0TA 1LE9B 2AK4B 4UT9L 1F4YL 1QBAA 4YPGA 3L5WB 5CJOL 2PYED 3KPQB 4CW1A 3SE3A 1HI6A 5I8KH 5EO1B 1EO7A 1HH9B 3RUGF 5EIIA 5C0FB 5ESAA 4XC1L 4JGMA 4KDWA 4G9FD 1KIPB 1CDIA 1FL3A 1J1OL 2HMIC 3MSPA 1JPGB 1YEHH 5T3XH 4RQQA 1I3RB 1T80A 1M7DB 1UM5L 3I9GL 4G6MH 4ZUTB 3VRIB 1G9MH 5JHDD 4GRWB 1QVOB 1OLLA 1PKQA 5DD1L 4CVZB 1ZHLA 1KF9B 3CZFB 5CBEB 3VGHA 3BIKA 1BMGA 3G6AA 3UDWA 3BMWA 1G6VK 4CJ1A 3SGKC 3UTZA 1KT2B 1BVLA 3S4SG 3PGFH 5IB1B 5HYJE 2VL5B 3Q1SH 3HC4H 5BW7A 1D5BB 2IBZY 4EUPG 1TQBC 2VN4A 3RPIA 1UXSA 4WJ5A 4X80L 2ITDA 3HRZA 5I18L 3PWPA 5HDOA 1KPUB 3UTSA 2PETA 2I9TA 1QBML 3DUUA 1ZE3C 4K23L 4H88L 4LLUA 3KJ4C 5I8CB 4K7FA 4EN3B 5ISZD 1MFCH 3QZWG 1L6ZA 4HJ0C 3PL6A 5DMYA 3IKKA 1CXKA 2YSSB 3S96A 4YX2H 4Y19B 1T1WB 1X5AA 5F8QC 2CUHA 1FZJB 3C5ZD 2LU3A 3QIWB 1H3GA 5AWNH 3BGAA 1D7FA 4ODXA 5BS0D 1QA9B 3KPRB 1A7BA 2MFNA 2CGRL 1YEGH 1I9JL 2IPTH 5F7HA 2XZCL 4WHDA 4OZHE 4HKXA 3NGBB 1UT9A 3RIFF 5JHLH 2Z31B 3RZCD 5HD8C 4NN5B 2ZNWA 4ERSH 2ADJA 1R5WB 1GL4B 4GH7B 5FM4A 4QHLB 5L2KD 4BH8B 2HVKA 5BXFA 3P4LA 2IGFH 4TOYH 4OUUB 3GIVA 1J1XH 4KUZH 3FZUD 2OBGA 4KJYA 3CK0H 4LNVA 4TTDC 1J8HE 5F1KC 3REWB 4X0KA 2VXVL 3BGMB 5EZIH 3BH8B 4WI5A 2X4QA 2X4RA 3VW3H 4O51B 3QCUH 2XQYK 3INUH 4OZIF 1WZ1H 2NXZC 3NCYS 3P0YL 5LGHL 4AEIH 4MYWB 1CGSL 3QXUA 1FL5A 1TLKA 4HKZB 5EUKA 2MPAH 3V0WH 4LGRB 3LPFA 3PDOA 3M17B 4HS8H 3PF2A 4I9WE 1CD1B 2W0KA 4YDVB 1PSKH 1RMFL 5HHVL 5DHXB 3LV3A 4M6ML 4POUB 1A7NL 1JCKA 4L1DA 5BVPL 3PV7A 4HJJH 5IKCA 3GIZH 3QJFB 5HXMA 2Z93B 5FYKL 1JZ4A 1CVSC 3QDJB 2QQNH 4XMLH 3AM8C 4XPFH 4IRJA 4BKLB 2OR7A 2DQFB 3BEWA 4J7RA 4I0PB 2ZZUT 1F11A 4PJ8A 3CUPA 5LXGL 1M7IB 5A2JH 1NC2A 4RZCA 5D7LB 3D3VB 2E9JA 4K9EC 1UCBH 1E27A 2EDTA 1TZGL 4JVWA 5KAQG 3IVKA 4X7TB 3LH2H 2EYTA 4JY6A 3ARQA 3RJQB 5E1HB 1RZGA 3ZE0E 2EIEA 3LD8C 3BT2L 3GSXA 5MEND 1KJ2B 1SY6H 4HT1H 5FUZH 1G0XA 5I76B 1HK6A 4Y8DC 1INDH 5TDOA 3KLSA 4MMXC 3EGSA 1BZ7B 3NPSB 5DRWA 1GHFL 3BP6A 1WAAA 3ARPA 3OX8B 1J0YA 1MHCA 4RFEB 4NZUL 2LV4A 1I75A 5ILTL 3OZ9H 3NACH 3LQAH 3GSQA 3ZKMD 5ID1A 4LSUL 5IVXF 3R8BB 2YRPA 4JFOA 2YMXL 3OKKA 4WI6A 1BOYA 4OT1H 1T20B 4UUJA 2X4OA 4N9OB 3DROB 3F7QA 1L0XA 4KRLB 1G7IB 4JVUA 4JFXB 3DOSA 5KVEH 1HIML 4NIKB 2NYYC 4BK4A 4EZMA 1C1EH 1M4KA 1IFHL 1JGDA 4NM4L 4ODSL 5D7IE 5DS8A 1DBAH 2QADB 2V2XA 4X99A 3LZFH 4HXAL 5BZWB 5D8JL 3CVIH 3QNZA 2J3SA 4LSPL 5C0CB 5CMAB 1S7UB 2BSSB 4RDQG 4M5ZL 5IOPA 4FQXD 2PO6C 2XZQH 1FZOB 3IJYB 1FNLA 1FJ1A 3ROLA 4I3RL 3VD9A 4S1DC 1S78D 4WI8A 4G6KH 3FN0H 2BVOA 2HT3C 1IGFH 4XTRC 1FVEA 2XKNB 1AGBB 4M6NH 4YHYB 4GJTB 5TH2A 3HLAB 3CFKB 2RFXB 1S5HB 4K2UL 1BD2D 4HPYH 3V6OE 1TVBB 3OBAA 4J8RA 5F88A 1FDLL 5IW6B 4YEFA 3BUYA 4ENED 1XGRB 5F8RC 2FX7H 1R3LB 3ZHLA 5JNYA 1DSFH 3ZDYE 1B0RA 4LF3A 5I30H 3JV6B 3L7FB 3WS6C 3NIDF 2GEEA 3FONA 5IVZB 5GJTL 2NY4B 3MLTA 4KQ4H 1FNEA 3E6HB 5DURB 5ICZB 2ORBH 3MRMA 4YO0B 4EOWH 5D7JD 4XC3H 3QG6A 1IGTA 1RUQL 2G75A 3MRIB 3H8NA 1Q0YH 2Y1VA 3BIBX 5DSCB 2YD7A 5B3JE 2Z4QA 2Q76A 3M45A 2V9TA 2OL3H 5MEPA 3DV6B 1MQKL 1YECH 5CD5C 4L4TB 1UKTA 5FV1L 4ZXBD 3T4YB 4DN3L 3QUMH 1D5MA 4P2RE 2MKLC 2Z92B 3RWCA 1T2JA 1XF2B 1UJ3B 2YWYA 3D0VA 3FQUB 5C08D