3UMTA

Scfv12, anti-bcla antibody single chain variable fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
242
structure length
227
Chain Sequence
QVQLQQSGLELVKPGASVKISCKTSGYTFTEYTMHWVKQSHGKSLEWIGGINPNNGGTSYNQKFKGKAILTVDKSSSTAYLELRSLTSEDSAVYYCARDDRYPAWFAYWGQGTTVTVSSTDIQLTQSPSSLSASLGERVSITCRASQDIGSNLNWLQQKPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYASSPPTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords scFv heavy chain and light chain
publication title Systematic stability engineering of single-chain antibodies
rcsb
source organism Mus musculus
total genus 59
structure length 227
sequence length 242
ec nomenclature
pdb deposition date 2011-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3umtA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3umtA02
2Y07H 5FA4A 1U8LB 3HS0B 3X14B 1A6VH 1J12A 3QRGH 5C0IA 3MRFB 4TNWF 3BEVB 5I8EA 3E2HB 3QA3B 2YK1H 1DSFL 1UKTA 5D1XD 3EO1B 1FFNA 2OP4H 4X6BB 2VAAB 4QRPE 4JM2A 4U05A 4J3TA 3FQXB 1UWGH 5FECA 2J8UF 4D8PB 4RIRA 5J1AB 3WFEH 4XH2B 1INEL 3VWJA 3PQYD 5EIVA 1QBBA 5DMIH 1DFBH 1T4KB 1JZ2A 2C1PB 4CNIB 3D3VD 1ORQB 5IKCB 4PJIF 4JREC 3KGRA 4PJ7F 3MBEA 1INDL 1ZLSH 1C5BL 4MXWL 1FO0H 4WI9A 5I1LB 1BFTA 4GT7A 4YXLH 1IQWL 1PJ9A 2JTDA 3B9AA 2X4PA 1CFSB 4GRLC 3WIIH 4WU5B 1QNZL 4ODSH 2BY1A 5K33A 1CICA 1ZA3B 2ICEB 3UTZB 4ZXBB 3QPXH 3VXSA 4PJDB 5E08H 4JQVC 3VXOA 4RMSA 4YHYC 2RCSL 1B6UA 4S1RH 5AD0B 1D5ZA 2NTFA 4NZUL 4PBXA 1NC4D 4X5XB 3CVHL 1NJ9A 2EECA 2VLKB 2YRZA 1QHPA 2OK0L 2VN7A 1NAMB 2CR3A 3VJ6B 2Q3ZA 1UZ8A 2YN5A 3Q2CA 4NQVB 5D2LE 5E00A 3KS0J 4Y5XA 2VDRL 5F7YC 3UP1A 2VDKH 1TDQA 3QXAA 4PJ8A 2GSIB 5E6IC 2HH0H 4QRQB 4JFXA 4KZDL 4LCIH 3ETBF 2G75B 3JWOL 1FBIL 4GG6A 3W39B 3LN5A 1OWRM 5BVPH 4EQ2A 1XGRB 3SDXE 2NW2B 4LRIC 5TFSH 1VCAA 5DLML 5IW6A 4JFPA 4OV5A 3DGGA 3SDDB 2NNAB 3JV0A 1P1ZB 5HHQA 3RL2B 3QUZD 2VDPH 1N6QH 5D7IE 5TE7H 3ARVA 3Q48A 4EN3A 4LLUB 4R3SB 1U8PA 3HB3D 1T5XA 4L3EE 3M1BA 3BQUC 4Z7VA 4RGNB 4GS7B 5BV7L 1UH4A 3T3PF 1QO3A 3QIBC 5HI5D 3RUGE 2ATPA 2AV7B 4PJAB 1P4IH 2FO4A 4OFPA 3T3MF 1F6AB 2GK0A 4DOHE 3EKCA 4FNLH 5FB8A 1HI6B 3I3DA 1FL5A 2H9GB 3CSYA 3AAZB 3G6JF 1J87A 5F6IB 1ZGLB 4L5FH 3T4YA 2FX8L 3HAEH 3HZMA 4Y88A 2E6JA 2H8PA 4F7TA 3O2DL 1UYWL 4MXQC 3GB7A 4WI5A 5CEZH 1K6QL 4U1NB 3LEXA 4YAQA 4MNGE 2IPTH 4H1LB 3QT2A 1BWMA 2VISB 2VC2H 2BRRL 3SDAD 5HGAB 2B39A 3HA0A 2DBLH 3VXPA 4G80B 1NC2D 2CRIA 5LWYH 4JHWL 2X7LA 2ZP0T 2DQFA 5EFIA 5IT2L 1MAML 3DOSA 1CIUA 3S36X 1NCWL 2BOCB 2BMKA 4OI8A 4F58L 5K9QI 1OW0A 4PJCE 3V8OA 5IFJB 3KXFA 2IFFL 5EBWB 2O93L 4ZODA 3J8F7 2BSTA 2ICES 3MOAL 4JPWH 5GS1B 1S9YA 1ZWIA 5LGHL 3TBYB 4N8CH 4XGZB 4OFDA 2R4RH 4KFZC 4PFEA 3L5XL 3KPLA 1UXWB 3EOAB 3X3FH 2OMNA 4K55A 5MHSD 5HI4C 3SGKC 2I07A 4DZBB 4P5TD 4LCYA 4F57H 2XXCB 2J8UA 3AGVA 5IJVA 2LVCA 4NKIL 1GAFH 3MFGB 3LKQA 4YHZL 3O2WL 4OD3H 2JJSC 5I18H 2A2QT 3QFJE 4N0RA 4PJIA 1MCRA 1HKLH 3TBTB 4PJ7A 1RZKH 3MRNB 4LPVA 3TFKD 2C1OA 4Y4KB 4X0KB 4EOWH 4MNQD 1ED3A 2XZAH 3GSQB 1HNFA 3SDXB 4PY8I 3HI1A 4ZTOH 5IGXH 1MCWM 4JO4H 3JTSB 4WUKL 5DFVC 4L1HA 1XGPA 2AVGA 4Q0XL 3STZB 3BUYA 3GSNB 4YR6B 2G60L 4FQIL 1OQXA 4C83B 5I8CA 2R2EA 4XP6H 1V3MA 4KK9D 3H9HB 3BFOA 1I3GL 4QRRD 5EBMB 1A14L 3OXSA 3RUGB 2PTTA 1IRAY 4UNTA 5F70A 3WDJA 4OZHE 3DVGB 5D7JC 3KLDA 4GLRI 4JB9H 1KLUB 1NGZA 3LPGA 1PBYA 1EFXA 1Z9SA 3RY6C 4MCYA 1LO4H 4NKDB 5H94B 5TH2A 2SEBB 1NGXB 2M2DA 2FGZA 4RRPG 1I1AD 3KYOA 3NN8A 4IRJA 4K3EH 4U1MB 1DQMH 3BWAA 3PIQB 1K5NA 3V52H 2BX5A 1X5ZA 4DAGH 1JFQL 3QCTH 1N7ML 1BOYA 1U8QA 2AK1H 3MRJB 5DC4B 4NZRH 4R4BA 3WCYA 4JO3H 4YDKH 5E56A 4XBGA 4OGAD 4LHUB 3UEZA 3O4LB 4RFOL 3X3GL 3V0WH 1IM3B 2YZ1A 3MXVH 1WBYA 1F8TL 1F5WA 3DROA 1T21B 3IJHB 3O2VL 3DUUA 4XZUB 2R39A 1VKXA 1YNLL 2NR6D 1GPOL 4PJCB 4LDLB 2P8LA 3CJJA 4DVBB 3IF1B 1K3IA 4LEXH 2Z31A 2R29H 2KH2B 2VH5H 5IB5A 5DQ9B 2NZIA 1EGJA 1CQKA 3HHRB 4BFIA 1OAXH 1RJYA 2GYSA 3G6JA 3FO9A 1IAII 5EA0L 2PO6B 1HOCA 2ZKHL 3H3PH 5DD0H 1P2CB 2ID5A 1NKOA 4O58L 4HMCA 4L3CA 1M71A 2BVOA 3UDWC 5IG7A 3MUGA 1CFNB 3OGCB 5AAMA 2C7UA 3CVIH 2OR7A 1SM3H 5ITFA 2XA8H 1Y0LA 3ZT5A 3ZDYF 1IM9D 4ZXBC 3QFJB 4NN6C 1KFAL 1XGUB 4NZTH 3MV7A 4BZ2H 4WUUD 4JN1L 3VW3H 2Z0BA 5F8RC 4MMZC 4XVJL 5FYJD 5BZWA 1C08A 4JN2B 4NKQB 1OVZA 1KN4L 4LQ1A 3THMH 3FT2A 5D7LD 3OF6D 3RVVD 3IFLH 2OR9H 1X5YA 2FBJH 1BVKA 5D1QB 1MH5B 2EZ0D 5BZDA 2DM3A 5DT1L 3MUZ1 2VXTL 1JN6B 2EXYC 4PJAF 4X7SH 2BNRE 4ZUWB 3UAJC 5MI0B 4FXLA 3LS5L 4S11A 4ZYKA 4YO0B 1FPTH 5I16B 4NBZB 2DLFH 1GSMA 2ATKA 3AREA 3CK0H 1VEPA 3VXMB 4C4KT 3IGAB 2PW1B 2Y1VA 3IDNA 4OZHB 2A74B 5EB9A 2WUCH 3JTTA 2W0PA 4YQXL 3FQUB 5ADPH 1MCFA 1JGVH 4HFUL 3LQZA 2OYPA 1TJGH 3U7YH 3WIHL 5C09A 5INDB 2IF7A 3HE7D 3MRGA 1IAOB 1B2WH 5E2VH 1CDHA 2DKMA 5T3XD 1JHKL 1FGVH 5GGVH 2YBRB 3STBA 4LVOB 1I8KA 3QH3B 3LN9A 1BD2E 4NFBA 1W0WA 2JB6B 2WIIA 3C87A 1RY7B 5F7EL 5DRNB 4PV9B 3MMEA 2AKRB 1CN4A 1VA9A 3SQOL 4J7RA 1HCVA 1T0MA 4HJ0D 3ZKND 3P9LB 5FCUL 1HSAA 4X4ME 1JYNA 5B39B 1NCDH 3FRPA 35C8H 4OZGE 2AJ3A 1EJOL 1HHGB 4JAMA 4K9EL 5HHXH 3MJ9A 3WS3A 1UM6H 4KJWD 2Q8BL 4YX2L 3QEQE 3QCVH 4CGTA 2W1NA 1A1MB 3Q6GL 2X4RB 3RNKA 5FHAL 2IFGA 3HR5B 1SBSL 2WINA 4D9QD 5L9DH 5D70L 3K4ZA 1FFQA 2QSVA 4JJ5B 2BNUA 1NEUA 3TZVB 4M48L 4YXKH 2FATL 1PEWA 3CFJA 3FT3A 1HILA 5L7XL 4LLDB 3NVQA 1QRND 5EN2A 3DXAA 1VADA 1RHHB 4XAKD 2V5YA 3GMMB 4CMHC 3WFBH 1BBDL 1A1OA 4NP4L 5SWSE 1R3KA 3HC4L 1WFTA 5FYKU 4N1EA 5B38A 1A6PA 4U6VH 1BQHB 5BS0A 1A9BB 4AM0A 5EU5B 1U8JA 5DJXA 1AD9B 3RNQB 5DF0A 2JIXA 1UACH 4R2GB 3LDBB 1WFOA 2DMCA 4L8SC 5E8NA 3H9SA 3LQAL 4UILH 3PP4L 5KANG 3ARYA 3ZKSD 5KAQG 3MR9B 1AGDB 3VI3E 2ED9A 4MQTB 4HK3J 3X13B 1NAMH 2DTMH 4Y4KC 5I75B 1QYGH 3UO1H 4YBLC 1ZVYA 3PNWB 3Q6FA 4UDUB 3QDHA 2AJUH 3BD5A 4I8DA 4XCCH 4JVUA 3S3SA 5DEFA 5DRZB 5AYUH 1KTLB 1D5IL 1R3LA 1TETH 5T1MB 3R8BB 2HRPH 5DUMH 4HS6A 4GRMB 4HIJB 5DI8B 4WGWB 4YUEL 1E27A 2AABH 2VJXA 4HDIB 5J11C 4HKZB 5J56B 1TNMA 3DNKA 3H7LA 3HG1E 5HVHB 4ZDHB 3DHMA 2IPUK 2ZPKH 3NZHL 5JW3L 1HHIA 3U30B 4EVNA 4R8WH 5B4MD 1WLHA 2ZWLT 4PRPB 1TQBC 5L8LB 4YHPA 2GCYB 1D9KA 2DYPB 1A6ZB 1N26A 2WBJA 3WLBA 5JOFA 4FS0A 4R7DB 4Y2OA 2NLJB 4ZUVB 4JFYA 4NT6A 4AL8L 2GUOB 3DTXA 4I1NB 4YPGA 3LQMA 3CAFA 2Q76A 2Q8AH 1KEGH 4KK5C 4XI5C 4KPHH 3WO4B 5E2TH 5CLWA 1MFAL 1AJ7H 4OV6F 2BNQA 4GSDH 1IT9H 5ESQB 1LK3L 1R24A 2F54D 4OCYH 4LLMA 3ILQD 2JJWA 4M93B 3BRDA 4M4PA 3UTTE 2CKNA 3QEQB 4I5BB 5DTFB 4NQDE 3ARWA 5HYSA 4H1LH 1L7TL 4LKCA 4G7YH 4CU6A 2ZCHL 4HUUA 2IG2H 4XNYH 1ONQB 3U4BH 2A6KA 4ODBD 3ZYOA 4RX4A 3HI5H 4KRPB 3RGVB 1F90H 3H6JA 1I3UA 1OL0A 1AE6H 3BGMA 3PWLB 3OPZH 4UZGA 3G6AB 1SJEB 4KROC 2VQ1A 5AWNL 1E4WH 2CMRL 2IAND 3BE1L 3C60D 4U6YB 1G7IA 3TO4A 3V6FA 4JFQB 4Z77B 1ZHBA 5FYLD 1DN0B 1HHHA 3U6RB 1JCKA 4LSUH 4ERSH 5CZVH 5CHNA 5SWSB 3TP4A 4X83A 5CWSA 3VGGA 1GGTA 2KKQA 1A02N 3NOIA 2E9WA 2JK5B 4FQJH 3D2UD 2F74B 1AP2B 1YNTB 4N0YL 3JWOC 1U3HD 2IADB 5C0RL 3L7FA 4PRIA 1VFAA 3SN6N 1NBYB 3Q1SH 2JJTC 3MLRH 3NBNA 2PYEB 4K8RL 5D93B 2NX5E 5HHOD 1DR9A 4WW2B 3D39D 1J1OL 2PF6A 1QKZL 4BSWB 3L3KB 3MRRA 4ORGB 4QF1B 3GO1L 1BIHA 2XN9D 5EU4B 1G7QA 3I9GH 2L7UA 4XNZB 2R1YA 3K8KA 2EE2A 1TVDA 4PTTA 4M61B 4NQEA 5BV7C 1CFTB 4CW1B 2P5WD 5EUKB 4ODWA 1F58H 4JFOB 1ETZA 3MREB 4KI5D 4YGVB 3A6CH 2APTA 3GFUA 3RVTC 4WNQA 2LTQB 1HH6B 1QACA 2EEAA 3BO8B 5GHWL 1MIML 3BP5A 3HG1B 3LRHA 4M5ZH 4P23A 1AHWB 4NIKB 5GRYA 3S5LA 2F5BL 2BDNL 3NIFE 5DVOA 3S4SB 5KSBB 4R7NB 2AGJH 3GSNH 1HXMB 2YRPA 2OI9B 4Z7OF 4POUB 1P7KA 4XPTL 1HCFX 2CR6A 1QFWH 1RZGA 2FGWH 4OZIB 1C8PA 4O4YL 5FIEA 1IGFL 3SKNA 5DJYA 3TIEA 2AXFA 2VLRE 3GMOA 5IFHH 3BAEL 5F6HJ 2BJML 1ZHKB 1FN4B 3RVUD 5C0EA 3QNZA 2NQCA 1QBAA 2VR9A 3RWDB 1DBMH 4PLOB 2BY0A 4HCRA 1YEIH 1NKRA 4G6KH 5F89B 3W11C 2W0FA 3ILPB 5EH1A 4I18C 1Q72L 5E8EB 2P24B 3QIUC 2FIKA 1WJ3A 5EUOF 2IEPA 3VD3A 3NFSH 3W0WB 1IGMH 1A7QL 1QG3A 1UKQA 3U36A 1UEMA 4XP5H 5DFWH 3CX5K 5SWZE 4G6MH 5IBTL 5GIRA 4E41D 5J12B 1VFMA 5CGYC 5CEYA 1E4XI 3ESUF 4I77H 2EDNA 5A2FA 3O8XD 4LLYA 4HIHA 5FO9A 4HLZG 4HJGB 4NM8L 4MJ2A 5C0AB 1FVDB 5D9SA 1EEYA 1MSPA 4YNYA 2A83B 3HE6A 3T2NH 4N5ED 1TLKA 1OGTB 3QHZL 4C54A 1FNSH 2BZDA 2PXYA 5ETUA 2R0WH 1V5JA 5F21B 4HFWA 3UTQA 4W6YB 3GSRB 4IRZL 1LEGB 5IW1A 2RQ8A 2G5BB 1WWCA 2NX5B 2DL2A 3CU7A 5DMKB 3V5KB 3QULB 5KTEH 3L3HB 3TVMB 2D03L 1KT2B 1SJVA 2D3VA 1II4E 2D4FA 5MENE 3CFBA 1MCDA 4HH9B 4Y4HD 1KXVC 2GY5A 1NGQL 4Y4FA 3T1FB 4WHYH 1T5WB 2N7AA 3MJ8A 2IPKB 3QI9A 3TN0C 1ZMYA 3AXLB 1UWEL 5IEKA 4MYWB 3EYQD 4HQQL 3GSWA 3B2UC 1RFDL 4R26L 4KRMB 3ARUA 2HKHH 3IDYB 2APBA 4P4KD 4HEME 3WNLA 3PGFL 1MQKH 3RDTC 5GRJH 4MAYB 1BFVL 3P0GB 4URTB 3WD5H 4UTBH 5HGDB 4P2QB 3MRHA 5BV7H 4C56A 4XNMB 4LCWA 5ISZA 5FUOL 1HYRC 4OD1L 4TUOA 1MHHA 3ALWA 1F3DH 2IGFL 3TH4T 1KIRB 4Y16B 2KQNA 3BSZL 1Q9LB 3FONB 2VLRB 1WAAF 1N59B 3CPLB 4RWYH 1HZHH 1UYWH 1JHLL 2QEJA 3HNVH 1OAUL 1ZHLB 2R1WA 3A6BH 4KC3B 3G5ZA 3B8YA 4JPVH 2ADJB 4ENED 3O81A 4OCNC 1KCRL 3OKOB 4HXBL 4OFIA 2J4WL 4M43L 4R97B 4ODXA 4ZOCA 1JNHB 3L3IB 1RJLB 1OCWL 3L5JA 4KXZI 4DUWA 1MJ7L 1MJ8H 3A67L 3JUYA 2XIDA 5DDHA 4PRHE 5DSCA 1U8KA 1QEWA 1IJ9A 3GMRA 3QXDA 4POZC 2DQUL 2RAMA 5F9DC 4DUVA 3ROOB 2VSCA 5GZND 5E9DB 3CDYA 4K71C 4QXTA 3L5XH 4X5LA 3OR7B 4OLZL 2YR3A 2KDGA 3BI9X 1NCCL 2DIBA 5GGVY 3WL9B 4KH2A 3BX7C 5CBAB 2IAMB 1G7PB 5KVDL 4YFDB 2X70A 1ZVSA 1PW3A 4QHMB 5FOJA 1J5OL 1DJSA 2CDEB 4MS8C 3SJVE 3T0ED 4PJ9D 1LO3L 3AM8A 2DJ4A 5LG1A 5C0BB 5F7DA 2W9EL 1KPRB 5MENB 3O4OB 4WIQA 3D87B 4OLWL 3C2SA 5IM7B 3RRQA 4PJFA 2ZG1A 3HCVA 5JO5B 5D1ZD 3DIFB 2XQBH 1GGCL 1FYTE 1OTUD 4GAYB 4CMMA 5IP4A 2FSEA 1W72L 2FEDC 5F97E 3DYPA 3PJSA 4P46A 3V5DA 4WW2C 2DD8H 3BEWB 1NFIA 4Z7UF 4OZIF 5T3ZL 1KPUB 4XNUL 3FO0H 2GSGB 4XBEH 4K3GA 1KB5A 3HC3H 1KCSH 1K2DA 2E6QA 3EYOB 3BIKA 4NJ9H 1J8HA 4ZD3H 5BRZE 1I8MB 3IDJB 1KJ2L 1KCUL 5DJ8B 3WNOA 4JFEE 2B5IC 3CMOL 1IFHH 3VXRB 2OI9C 4L4JA 3ARBD 2VXQL 4X9GA 1FE8H 1JF1B 1U92A 1WBXA 4GKOA 1FNEA 1I9JH 3MV11 5E5MA 2EDJA 3GSOB 5SWQA 4EI5A 5EOCH 5CCKH 3ARFC 3U0PA 4K9EC 3OJVC 3DWTA 1FV1A 3KLAA 2CDFA 1BJ1H 1YEJL 4KKLC 5A16A 3KPSB 3RZCA 2HJFA 1D6EB 3O6LH 5KW9L 3IETA 4H20H 1NBVL 3RWHB 1UH3A 1DBKL 1F2QA 4H26A 5DEGB 4RZCA 4KK8C 3FTGB 3C5SA 4FABL 5TPWH 1WAAA 2KL6A 1OT1A 1PD6A 4PY7B 3O9WA 4BSVB 2P45B 3KHQA 1NEZB 1SHMA 3S36H 3ZDZF 4EI6A 3UPRA 4U1GC 3H2WA 3SE9H 1LO0H 3B9KA 2BRQA 3X11B 3IXAB 2P5EE 1HQ4B 1IAIL 1PAMA 5LGJB 1MHCB 1AY1L 5ECJE 1A7OL 3KDMA 4JM4L 5CZKA 3QUXD 1JL8A 4PLJD 4R90H 2VLLA 2AI0L 1HQRA 4XVJH 4JM2D 4XMPH 1HINH 3U4EB 4L29A 4LSPL 1MWAH 3UJTH 3BYYA 4X6CF 3P9MA 3O6FD 5F1IB 4DCQA 2AJZA 4QHUB 2FX9L 3ZTNH 3VWJD 4HD9A 5IB4B 3SBWA 3LB6C 3T2OA 2ADGB 5F3BB 4IRSD 2OZ4H 5GGSB 4TUKH 5T1LB 4HK3N 5IF0A 4X8XA 4Z76B 3BOVA 1DUYA 4AEIH 5C86A 4U6HA 1RIVL 5DRXB 4NFCA 5IOPB 2VOTA 4U7KA 3OX8A 3MCKA 4OSUH 2FZ3B 3E6HA 4BUHA 4RAUB 4OIIH 1AIFB 1CL7H 2R9HD 2VXSL 3QNXB 1PZ5B 2XFXB 2YPKA 1NDMA 5BRZB 2OJEB 2VXUH 4M5YL 1NFDE 4Z7NE 1WC7A 2EXWC 1I7ZB 3OKLA 4P49A 1CZ8H 5JXED 3OKMB 4LCCA 4OCRL 4MJIA 2DN7A 1V3LA 4JFFA 3C6LA 1IC4H 5HDOA 1AR1C 3MRKB 1XGYL 1FNGA 5IR1B 5HYJB 3QUYD 2ARWA 3KLSA 4NBYB 3VFGL 5F7MC 2VIRB 3WUWB 1BF2A 1QA9B 4DKFH 1DVFA 5KVEH 1KGCD 4UT9L 3O6ML 4F80A 1I9RH 1CGUA 3UJJL 4FQ1L 4H0HB 12E8H 1ZA6B 2QTEA 3BKYH 2OX5A 5B3JE 3EYUH 1F4XL 2GEEA 2QADB 1MEXL 3NAAL 2QKIB 2GT9A 3EOTL 5CINL 3BUTA 1TXKA 1A6TA 3T8XB 4S0SD 5LAXA 3FN3A 5CILL 2CIIA 2R2HA 3MGTB 3VD4A 3VE0A 4PP1C 1G7LB 2GITB 4MSWB 4Z18A 5C2BL 5JR1H 4YX2H 1E4KC 3GBNH 1W8OA 3C8KA 1UM4H 4EUPB 1T0NA 3L5HA 4NQCA 1YPZB 5ACZB 3WSQL 1G6RB 4NQSB 4P2OD 3GUTA 4PJXB 4WTXA 3SCMB 1QVOA 2ZG3A 4PUBH 4NNPH 3HTLX 4JKPL 4N68A 3ZKXB 1FO0A 3ROLA 4NOFA 5HYFA 1WISA 4DTGH 2DQDL 3F6IA 4X6DE 3RPKA 1R0AL 3FFCD 4XB7A 3BGAA 5EU7C 3HNSL 2FHFA 1A0QH 4ZAKC 1MCBA 1AQDA 3BIAX 4FOMA 1CBVH 2HLFC 2Q86A 3DETD 4G8FA 3QIWA 2IAMC 1DUZB 5FCSH 5BO1L 1OT2A 3DUHA 5T33H 2PR4L 4JZOB 3C2AH 4UB0L 5D2NE 1BECA 2NZ9D 1GL4B 1RK0B 5C08D 4G7VL 3MLXH 3PP4H 1OF2B 1FORH 3N1QC 4PV8B 4FN0A 4UOW1 3SPVA 3CZFB 1RZFH 3LEVH 5KVMC 4QXGH 3ZHLA 1MCNA 4HX1B 2V9RA 2HTKC 2CDGA 1JK8B 5HHNA 2DJSA 1S7XB 2VE6A 3EOYG 1IAKA 3TJHD 2B20A 4HEPG 2XKUA 2OTWA 3G9VA 43CAB 1NFDB 3LH2H 4ISVB 4ZFOL 1S78D 3BDYH 5I15H 3BMWA 3L95A 4P3DB 1I8LC 1QSED 3G5XA 1S7SB 1EO8H 2M1KA 4P3CH 3GHBL 1PQZB 1UB6B 5GSRA 3LY6A 4N0FA 1CFQB 4X6CA 5DS8A 3UTSE 4F3FB 4UUJA 5H37G 4OJFH 1H8SA 2HTLD 1T1ZB 5I1EH 3QXUA 2G5RA 3IS1X 3MV01 5CJ8A 1NMBL 2DDQL 1XZ0B 1IGCL 5LVEA 3I02A 5HYQB 1XFPA 3UBXG 4PR5B 1OAYH 3VFRB 5DQJB 3HAEA 2UUDK 4GAJL 2UZIL 4LPTA 5EZLB 5IQ9B 2YKLL 3TBWB 2DL9A 4X80L 5I9QC 2HT3C 4WEUD 2ZUTA 4KUZL 3N85L 4FTVA 1EBAA 1FSKB 1DL7H 5GZOC 2W65B 1M7IB 2IBZY 2A1WL 5I17B 2E7MA 3PQYE 1EXUA 1P4LA 5E2WL 3MRQB 3FQRB 1HWGB 3IXTA 1QRKA 1ZT4B 4U0RB 2V9TA 4QGYA 3D3VE 3IJYB 4LSRH 4M3KB 4QEGA 2B0SL 4X6DB 25C8L 2ZSWA 1T66C 4UT7L 4NO2A 4YBQD 4DQOL 1F45A 3GI9L 3NCBB 5ALBH 4J6RH 4RQQB 1S8DB 9CGTA 2AXGA 2J12B 1M6OB 3BKML 1DBAH 3RA7H 2LU3A 4U1KB 4J3SA 3MROB 3LHPH 3PL6C 4GRLA 2NY1C 3RX7A 1Q9OB 3G5VB 1HYSC 4ESKA 2CLRA 4LLAA 5HYEA 1XEDA 3N1FC 5JUEL 2L0DA 3LKPB 3D48R 3MV8A 4F15B 2YC1B 4JQVA 2H6PB 4RGOL 1TQCC 2NY3B 3BH8A 1LE9A 1T6WA 2YPLA 1IBGL 1X3DA 4LBEA 5EO1A 3LMJL 1NGYB 1RZJC 4NJAH 3D1MC 4HWBH 1BM3L 4I9WD 3ARDB 5TGBB 1PSKL 4F2MB 1CFBA 2J5LC 3K46A 1B0GB 4FA8A 5E6IA 3VG0H 5I2IA 4M1GL 4OGZA 2F5BH 1VENA 1F42A 4LVHB 4YHKH 5F1KC 1T2QH 1Z0MA 3C6SB 4LRIA 1KNOA 4NM4L 5CJXC 3E0GA 1YMMD 1DBJL 4O4YH 3KPMA 3IFOA 1MCCA 1MVUA 2O5ZL 3AU1A 4PREB 5MERA 5H35B 1MY5A 2HWZL 5FUZH 4APQC 1GH7A 3QIBA 4G8EB 1FL3B 5AYQA 2O5XL 5I19L 1Q72H 1IEBA 2IH3B 3U82B 4KK6D 1PLGH 3EDKA 4QRSB 2HVKB 1HH9A 3NACL 3BPOC 2YD1A 1Z9MA 2ICWA 3QQ3B 4UINH 3BP6A 4HGMA 2F5AH 3D3VB 4L4TD 4RAVB 3G6DH 2X4NA 5IBTH 1F3JB 2JCCF 3F7VB 3WKML 3EFFB 3BRGC 4MA3B 1PX4A 2KZWA 3T0DA 4Q6IC 4QO1A 1D6VH 2I9LA 4MDIB 1MI5B 3ALPA 4MLIA 2AJSH 1P9MC 4JKMA 5B22A 2FJHB 1GGUA 5DZNA 1S5HB 2O26U 4WFED 3RWCA 2YPVL 4NO3B 4MA7H 3L3GA 3ELAT 5E70A 5B8CB 2X1WL 4XP9L 4NO5B 1E4XL 5MHSE 3HUJB 4JDVA 5JHDB 1NC4B 4L4VA 4JCLA 1WCQA 3BXNA 3T65A 4OLVH 1AO7B 1F13A 4N8VA 1FAKT 1MRCL 2J88L 3DRQA 1PYWA 5EU6A 3SGKA 1JPFB 1YN6A 3ZKQD 5SV3A 1D7FA 3P3YA 3QUMA 4M7JH 4TRPH 3C8HA 1D5BB 3GK8H 1I3VA 3OJMB 3LEYL 1SVZA 4U1IB 5J7CC 4MNQE 2JJSA 4LP5A 1AR2A 3GM0A 4X98A 3QWRD 3PGFH 1NMAH 4NUGH 4HUNB 2L7JA 4JANB 5FYJL 4HGWB 4U4BA 3N9GH 1RZJH 3QUZB 1MHPL 2IGFH 4OCWL 1E6OL 3ISWA 5JMOC 3GJFA 5C0JA 5CZXC 1RZ8A 3VH8G 3QQNA 4TVPD 2AJXL 2F53A 3BZFB 2R56L 4O9HH 4QRRE 1I7RA 3QEHA 1TZHA 3RL1A 1JHLH 5CEXB 3WLWC 4LLVA 1T03L 3QNYB 3WXWH 5KOVC 4CKVX 3MNWB 4U6TA 1DTUA 4I3SL 5J6GB 5L2KD 1IILE 4X7FC 1KENL 2UUDH 4M43H 1ZS8A 5D7JA 1JPGB 2QQNH 5GISL 2YD3A 4FXGB 4M8QB 3NABL 2PW2A 2VLKD 5DC0A 4NHUA 3T0WA 1G9NL 3QDJA 5GRXG 3HMXL 5FO7B 3RY6A 1XR9B 5E8PA 4G8IA 4PGDA 4GAFB 5FXCH 4JFDA 4OCSH 4M4RA 4MVBC 4ZUSB 2QSTA 5CP7A 1LWRA 3MV9A 3H8NA 2FWOA 1C12A 2ADIB 3LKRA 1N4XL 2WM0A 4PB0H 3PV6B 5KVFL 3ZZ1A 4LLQA 3DGCR 1KSRA 1MFCH 4ZG1A 5MEQB 1NCCH 5DWUL 2BK8A 4F8TA 3SDDD 1IGIL 3FMGH 1Q0XH 5DUBB 4D8PA 4BH7A 3W5MA 2NY6C 5SX5K 4AZ8A 1J5OH 3P11L 4BQBA 5I1JH 4NRXB 4P5TB 5JW4N 5EZOH 4GUPB 5D2LF 1F6FB 1G6RH 4RGND 4QNPF 1U3YA 2A0LC 3H7BA 3VXNA 3KPRD 1BZ7B 5DJDA 4TSBH 3AUVA 1TZGH 3ULUF 1MCHA 3AS2A 1RZ7H 1N5YH 4Y19A 1G9MC 1BZ9B 5D2NC 3UDWA 2VZSA 5EULV 2GI7A 3CSGA 3PWPB 4ZFGH 4X4YA 2AJYL 3NA4A 2VLJB 3TV3H 2JCCA 1W72H 2BNQD 4S1QL 1S7QB 1ZA3A 2E8ZA 1MIEL 3GJEB 3R1GL 3RU8L 1YYLH 5FYJE 1FZKB 2WAHA 3HPJB 5D7IF 5DA4A 1MPAL 5EBLB 4FFYH 3RBGA 5D7LE 4TPRH 5F71A 1BIIA 2NY3C 4HT1L 1OTTD 4RX4D 3SGEH 4MA8H 1U91A 3LKNA 3PGDA 2DQEL 1FGNL 3P77B 4C58B 4OBRA 3OG6B 3B9DA 4NC1E 3GIVA 2DI8A 3ARDC 3DSNA 4XCFH 4BKLB 3V6OC 2WUBL 3S3PA 1UCBH 2M8XA 1U8MB 1KIQB 3UJIL 2Z8VC 3U83A 5DYOA 1CXFA 5HVGB 2G75A 4MXVF 4K7FB 1I1RA 5IIEA 3IVKA 5DHXB 5I8KH 4ETQB 3KPQA 1XF4A 1XGRA 4XC1H 2DI9A 4JR9L 3OKNB 4LVNB 2P8PB 4DGVL 4E0RB 1CDJA 2H2PD 4TOYL 1JF5A 5T3XE 1PKQA 2AAVA 1EJ6A 1UGNA 1EUTA 3K81A 1MRDL 3NZ8B 3Q3GA 3EDJA 2YD2A 4E42B 5D1XC 3RHWF 3ZE1E 1S7VB 3G5YB 4AEFA 5KW9H 3IFNH 4HF5H 1CVRA 4YWGH 4NSKA 3DURA 1S5IL 1OP9A 3AAZA 5DJ0A 4XMLH 5I73B 4G9DA 1V7MH 3U0TA 2Y23A 4XVUC 1U95B 4QRPA 3IDIA 1V7NH 2H32B 3MQIA 5BVJA 1MCJA 4MNHB 4MCZB 4HXAH 3BZEA 1LK2B 1AC6A 1YQVH 1JNNL 3BJ91 1AY1H 1FJ1A 5JIKA 4YPJA 5JQHC 1WWAX 3RTQD 2I9TA 1JWMA 1RZIB 1YNKL 3D9AH 2HLAB 1IM9B 3DO7B 3MJ7B 1UQSA 2VITA 3CFDB 4XCEA 4FZ8H 4KKCD 2H3NB 1QRNE 2DIAA 4M1DL 2N56A 5IB2B 2ITCB 3SO3C 4XAKE 2F8XC 2AW2A 3IDMA 4R6UA 1P4BL 1FQ9C 1GZQB 3GI8H 1IEAA 2XA3A 4NCDA 4HIEB 3TEUA 4IM8A 1AKJB 3QDAA 4GXUM 4KKNA 4JEGB 5D7LB 5FYLL 1G9MH 2ICWI 2NY5L 3OKEA 1OAKL 2R69H 1A6AB 3VA2C 3UPAA 4Y2DB 1JV5B 4KUCF 4QWWD 4LHUD 1E6JH 3O4LD 1EHLH 1CLZH 3D85A 2VXSH 4F7CB 4LNRA 4JZJC 3QG6B 1Z3GL 5D2LA 2DWDA 4L8SA 4YBHA 1RUKH 5F1NA 1CGSL 3TBTA 3KPNA 5GGUB 4P9HH 2V5RA 2YUWA 3BHBB 4Y4KA 2Y06L 2K3TA 1XGTB 2PO6D 3K8MA 3NIGE 3HB3C 4X9HA 1MJUH 4I0KA 3MACL 1YY8A 3CFKA 1JRHH 3RWJB 2R4SH 5D72L 5FM4A 5I76B 5HI5C 4UT9H 2DI7A 3BD3A 3GSNA 3PGCB 4YHNA 2HFTA 5D7IA 1A7PH 1YEEH 3QP3A 5F7NC 1OWWA 4HGKC 4L3EA 4OZ4A 4WO4B 4H8WH 2OTPA 1JPSH 4P2CG 1OM3H 1FFPB 1KCLA 4NN5C 4YDJA 4KKBC 1Z9LA 1HXYA 2D31B 4G6AC 1J1PH 4HIIA 3MXWL 3DVGA 3NFPA 1BVZA 5IB1B 2RGSA 3SDAC 5EORL 4NKDA 3RWGA 1PG7H 4MNGA 3WSQH 5D1QD 2F54E 4X7EC 3NFNA 1GGBL 3AFLA 3ZDXF 5IB3B 3RZWA 5IK3A 3QCUL 3CLEL 4K2UL 4LCWD 4U6XA 3UTOA 1K8IB 5IQ7L 4P9ML 2ZCLL 5DJCB 1DQQB 5IV2A 1MCPH 2DQTL 5SX5H 1VEOA 3VXMD 1CXIA 3MRLA 4NNXB 5FGCE 3TWCL 5J13C 1OD9A 4H25A 4LF3B 4JLRB 4MZ2A 2IANE 1QRNB 5JA9A 3J7HA 1NLBL 2AEWA 5FYLE 3IDGA 4PGEB 4H1LG 4P5TC 5DQ9A 4KRLB 3KYAA 3VFTB 2CLVB 3CVHA 3F5WB 3BPCB 3JVGC 1NGWA 3L3OB 4JFHD 2PKDA 4FQXB 2BCKA 5FDWA 3TCLA 1DLFL 1A1NA 1WFUA 5JZ7D 1U58A 1LE5A 4AK1A 3DX7A 2WBKA 1CGWA 1X4ZA 4OZFA 5FYJU 5HHOE 1WTGT 1ZVHA 1U8IA 5BW7C 1KYOJ 3D39E 4TNVF 4KDVA 1P7QD 4QCIB 2OSLB 3FFDB 3V0AC 1JWUB 2JJTA 2YOCA 3OZ9L 5GGRB 1QPXA 4O2FB 2UWEE 3SQBA 3I6KA 4NRZB 5AUMB 2XN9E 3TA3B 3RPIA 4OKVA 3IFPB 5E7BA 2F19H 5GGQH 4XAWH 2BSRB 2GFBA 4JO2L 3SE4C 2P5WE 3V7AE 1JGEA 5AG8A 2PYFB 5C07A 4KI5E 2UVEA 3L7EB 2QSCH 1CTOA 2QV2A 1XIWA 4KK9C 2VO5A 4Z95H 1ZT7B 5C8JA 2HFGL 4RFEA 3QDMB 1IL1B 2Q7NA 4XMKL 3DUSB 4EIZC 5HPMA 2RFXB 1EZVX 3CFEA 1KB9J 1NH6A 1Q9KA 4XXDA 4QHNB 1I85C 4HUWA 1XCQB 1ZLWK 4S2SB 4NQTA 5I16A 4EDXA 3C5ZB 2WANA 1N8ZA 2V2XA 4KQ3H 4WV1B 5DK3A 3O2DA 1YZZA 4LVNC 3K2UL 2PW1A 4OZGF 2J6EH 1I1AC 4OZHA 3TJEH 5CIPB 3U9UB 4G8GE 1KV3A 3LN4A 3TM6A 4AMKL 1FLRH 4ORZC 1PZUB 2E9JA 4CUCA 2D7TH 5FUCE 1ZV5A 3W81A 5FO8B 2CKBL 3DX8B 1RAMA 4OGAC 2F54B 4ZTPL 5FKPB 2VTFA 4R2GD 3CFCL 1FZJA 3V4UL 4XCNB 5GGSY 2H26A 3HNTL 4HHAB 4UQ3A 3FO1B 2G9HB 3MLTB 4Y5VC 3WYRA 3ZT7A 2YBRA 3IU3B 1T04B 2NR6C 3GMPB 3QH3A 5DD3L 1TVHA 2EE6A 2EYTA 4AJ0A 2AQ1A 4I18A 4OUUA 1DDHA 5HJ3A 5DRNA 4WDIB 1V3JA 3GI9H 3QIUA 1KB5L 1T1XB 4LQFL 3KWWB 4JRWA 3SOBH 4KMTL 2IANB 4XPFL 1C16B 4E41E 3LD8B 2MFNA 4OUOA 1ZANL 4DJMA 4O5LL 3OHXB 5C92A 4FQCL 5GS0D 1JGLH 1LEIA 2XZQH 3D2UB 4N90D 4H0IA 4ZSOB 4UIMA 3VI3F 4TSAL 4LHUG 2VABA 3L6FA 5JUEH 3WN5C 1YN7B 4PRPD 2P8MB 5JTWA 2DYPD 4RGOH 4U7MA 5DURB 4OAWB 5HYIA 3RJDA 4OGXL 3D39B 3MPCA 2VZ1A 1SY6H 2UWEB 1I1YB 2XN9B 2XWBA 3M8OL 5CD3B 4EIGB 5DGQA 2B2XH 3OTTA 1S3KH 1CXKA 5F72S 1KN2L 4Y1AA 3RVVC 5DXWA 4TULH 1P7HL 4NRYA 2EZ0C 4UU9A 3V9FA 5CGMA 3RVWD 5J6HA 4M6NL 1UA6H 3RWIA 2XTJD 2XICA 1MREL 3BT2L 3O3EA 4XPAL 2JB5L 3IDXL 4WU7B 3REVA 2BFVL 3QEQD 3MCLH 3TN0A 2EC8A 4P57B 5MEPA 5CP3H 1AD9A 3CDFA 4YDIL 5INCA 5L0QB 3O11A 4RMVA 3EIFA 7FABL 4KRPD 4WHYG 1J05A 1JVKA 1UEYA 1AGBB 2BNRA 3MR9A 4MQXD 3ULSB 4A6YB 4GJTB 4MB5A 3QWOB 1TPXC 3RDTA 5KSVB 1G9NC 4NKOB 5IMLB 5CJ5A 1N0XL 1J0YA 1O5DT 2WK2A 3HE7C 3OJDB 3P4NB 4NCC1 2YA2A 4Z0XA 4RDQG 3T77B 1JYXA 5E4EC 5L8JB 5DD1L 3EGSB 3HZVB 4AEHL 3OB0K 5SWSD 4G8GB 4ODVL 5I19H 1WEJL 1MFDH 2HG5A 3SY0B 3CD4A 2VQUA 5T1MA 2VAJA 3IKCB 4KY1L 4GRMA 3VXTA 5GSVB 1XR8A 2FYYA 1KELH 3QBTB 3CX2A 2PYED 1G7MB 4Z78A 4LMQE 2D0HA 4MD0A 5GRVK 2H1PL 3QQ4B 1G7JA 5CSZB 1BD2A 3MNZB 2ESVB 4HJ0C 3ZKNC 4LSVL 4JZNB 4JPKL 3L5IA 2R0KH 4ZFFB 1SVCP 4ZUVA 4QGTA 1TJIL 5T5NF 4J2XA 1MOEA 2DWEB 3TT1L 1LGVA 3HRZB 1DE4B 1I3RA 1KLGA 4KTDH 4E41B 1XF5B 4KJWC 2NY7L 2Y7QA 2C26A 4QXWA 4U1JA 4D9LL 2YPVH 5JNYA 3GBMH 2ICWJ 4U2ZA 1WWWX 2HKFH 2GAZB 5CFHA 4XNQB 3HZKB 4YZFE 3E3QE 1B88A 4OZGA 3QDGD 4GAGH 4L9LB 3V4VL 3HG1D 5C0GA 4PJBE 1NAKH 1QFWI 3PDOB 4UV4L 4MJ5A 1AXSB 2NPLX 3GRWH 1YEDA 1RJZA 4LEOB 1ONQA 5GGTL 5C0FB 3T0EE 5DHVB 3K4AA 3VRLF 4YDLB 4LNVA 5C6WH 2K1MA 3B2VH 1QFUH 1KJVB 3FN0L 1SJEA 5B39G 4HG4J 5IMKB 5JDSA 2Z92B 1MWAA 3M07A 3QRGL 5F93C 2LVEA 4YC2B 2EDHA 4BZ1H 2YK1L 3T2PA 3R06A 3U6RA 3W9EA 4RA3A 4JPIB 2OP4L 2E7HA 5D96B 3QXWA 3NIFF 4K94C 4NQCD 1UWGL 1LP9B 2FDBP 5F44A 2OZ4A 1NL0H 3GGWB 4ZUUB 1GRWA 3VGBA 1JHTB 4IIQC 3WFEL 4W4NA 1A7NH 5CBEB 1DFBL 5HDQH 3W0WD 8FABB 3QB7C 3T4AA 3IT8D 1ZLSL 1OB1B 4HAFA 1FHGA 3TESA 2EYRB 4YXLL 3WIHA 1F4HA 4U3HA 4PJ5A 3B3IB 3UC0H 4I3SH 5C0AD 1ZLWH 3WIIL 1BQHG 4ODSL 4BELD 1NDGA 1UB5B 3MRMB 5F88B 4WI7A 4KJQD 3KS0H 5B4MC 1HH6A 3NABH 4LLWA 4I48A 1CLYL 1G9NH 2X05A 5E08L 2B7DT 4NQXA 1KCKA 1AD0B 1UXSA 4S1RL 4HBQA 3VMOA 5T3XH 3CC5B 1CU4L 1IGYA 4UBDD 3TVMD 3BKJH 4KQ4L 5DFTA 1I1CA 1C5CH 3HKFA 4B7IA 3O3BB 5KJRH 1T1YB 1BOGA 4B7LA 2QBWA 2EIZB 2VDKL 3DMMB 1KXQE 1QZ1A 4FMKA 3ARFA 2HH0L 4OQTH 3QFDB 3C8DA 2HFFA 3ILQC 4LCIL 4ZOBA 4RA0C 1MCOH 3EO0A 4NBXB 3HI6H 5AG9A 3I6GA 1FCCA 2P43B 5BJTB 1VGEH 1IGJB 5BVPL 2E7CA 5TFSL 4C57C 1ZHNB 4L8CB 4PJBB 2HAZA 3FB5B 1HEZB 4MAYD 3SKOB 3UTTA 5KN5B 4QT5A 2ARJB 4P2QD 4YHML 4NQDA 4PP2A 5CGTA 2VDPL 4PS4L 1N6QL 1TENA 2YWZA 5TE7L 3F58H 2VRAA 2Y5TB 3C60C 2VZVA 3LD8C 4PJ9B 5C1MB 5FA3B 5ICZA 4KHXH 2OL3H 4N0CD 4Y16D 4QOKA 1OGAB 2NY5C 2VQTA 4X7CC 2AJYH 5I74B 4OI9A 4P5KB 1P4IL 2YSSA 4ZPTB 4FNLL 3SKMB 2APWA 1X7QA 4IEFB 3V6ZB 4CL7A 2A77L 1U3HC 4ZO8A 4L5FL 5D1ZB 4FMFA 1I1FB 4K23H 2G2RA 2X40A 2XWTA 4R4FH 4NC2B 1A64A 4OLUH 5DJZB 2MHAB 3WDHA 4HLZH 2IPTL 4NNYB 4HC1H 2VC2L 2FO1A 1JYWA 4P2RB 3LRGA 2E7LC 2ERJB 4KGJA 2DBLL 4ZUTA 1LNUA 3S8WA 5CKAA 5ESVB 2UYLB 1D5XB 1I4FB 1NCUA 3PWNB 3V5KA 3F12A 5LWYL 1QP1A 5FOBA 1F4WH 4K94H 1ZSDA 1UM5H 2BVEA 4KI5C 4HH9A 2Z35B 5IROC 3RWFB 5E9DD 4WTZA 1NUDA 1WV7T 1JIBA 5HHPA 4FFWD 5L0QC 3LCYA 4O2CA 1EVUA 4K07A 1GJIA 4N8CL 3EJYD 3QO1B 4WENB 2ILLA 2R4RL 3WE6B 3AMKA 4PGBA 3TO2B 1ND0B 5J9PB 5D7SH 3X3FL 1ZAGA 1WT5A 4OLXH 4P5MA 5D5ME 4F57L 4XNMA 1KGCE 4GW4A 2FR4B 5C0BD 1BX2A 3HR6A 3U79A 1UFUA 2DM2A 3U46A 4PJHE 4QTHB 1GAFL 4W6XB 5MEND 3RVUC 1N2RB 4HPYL 4M3JA 4NPYA 3RFZC 1H5BC 4KVNL 4OD3L 1EV2E 3M17A 4LAJH 4AT6A 2X4OA 3QJHA 5ACLA 5HHMB 3CPLA 1CLOL 1HKLL 3UBXB 3VRJA 1RZKL 2CXKA 4EQ3A 1REIA 3B9VA 1LD9B 1TIUA 2B4CC 3D69B 3VWKA 3BP4B 5BXFA 5CKGA 2VZTA 5CIPH 3G9AB 4HZLA 3WHXA 4EOWL 1WIOA 5HD8C 3U0WH 5EC2A 3S4SG 4DVRH 4ZTOL 5IGXL 1F4AA 4JO4L 3MODH 2FJFA 3C5JB 4G9FA 3TYFB 4CDHA 3MA7B 3VU2A 2X9WA 1N64H 4IS6B 2Y36L 1E4KA 1MAKA 1GXEA 4D0DA 1BZQK 4XP6L 5FA4B 3O8XC 4HIXH 4HSQA 3FFCE 5C0IB 5I8EB 5ICXA 2A6IA 5SWZA 3RIAF 1P4BH 3KR3H 4JM2B 4XBPB 1T2XA 4KWUA 4JB9L 5FECB 3IRZA 3VXRD 5C0CA 4F8QA 4U1LA 4CADA 5LJYH 4JG0H 4RIRB 2W60A 4ZAKA 1OAKH 1KTDA 3VWJB 1U8HA 1DANU 3OBAA 4K3EL 2BVTA 1DQML 3V52L 4DAGL 2IAMA 1G7PA 3QCTL 2AK1L 4Y4HC 3MBEB 4NZRL 5TE6H 2AXJA 4JO3L 4YC2C 3MLPA 4YDKL 3KPSD 5IVXF 3V0WL 5DO2D 4YHOH 3MXVL 3N1PC 1J88A 3GSUA 4HWBA 3WFCH 1CICB 2NY0B 3EYFB 4P4KC 4HWZA 2FD6L 3VXSB 2NY4C 3QO0A 4LEXL 2R29L 5IHLB 1QSEE 5MP6H 3VXOB 5D72H 4YFLF 5ANME 5T5FH 1OAXL 2BVUA 4JHAH 3RQ3A 1D5ZB 2NTFB 4LASH 4M1CD 2A9NH 5FM5O 1A3QA 2AK4A 1XF3A 1NJ9B 1N6UA 3H3PL 3SKUD 5I30H 1I8LA 1RURH 5DMGD 1UZ8B 4Z7WF 2EDKA 2MMXA 4W6WB 1VFBB 1KPUA 4Y8AA 5E00B 4XP1L 4GKNA 2BSSA 4PJ8B 3CVIL 4XHQA 2WP3O 3EHBC 3GMNB 5E6ZA 4PJIE 4JFXB 3V79C 2MOVA 1SM3L 2XA8L 3BPLC 4KVCH 1C5DA 5HDLA 4NZTL 4Q6YA 3LN5B 4ENEC 4BZ2L 1MCKA 3V95A 1TTGA 1SEBA 3VW3L 5FHBL 1RUMH 4OM0H 5IW6B 1E28A 4OV5B 3DGGB 1W0YT 1CD8A 2ZSVA 3THML 1PVHA 5T1LD 4EN3B 3IFLL 2OR9L 4P9MH 1U8PB 1CL7I 2FBJL 1T5XB 3BH9A 4P2OB 3VD9A 1F4YH 3GSOA 3M1BB 4Z7VB 4UV7H 1AGCA 2F53D 2B4CH 2YD4A 4Y5YC 5KS9E 4X7SL 2ATPB 4X6EA 1B4JH 5GZNC 2FO4B 4ONFH 2GK0B 4UAOB 1FPTL 3FFCB 4NN7C 5BRZD 3GBLA 1FL5B 3CSYB 4PRHA 3E3QC 3C9NA 3CK0L 3T4YB 2X44D 3HZMB 4J4PD 3RWHA 2H8PB 3RX8A 4F7TB 3GB7B 2WUCL 1EPFA 1MY7A 4WW1A 3LEXB 2D9CA 1JGVL 4LRNH 4BQ6A 5JHLH 1TJGL 3U7YL 5HYJD 3T0EC 3OMZA 1B0RA 1B2WL 5E2VL 1S9VA 3MLVH 3VXPB 3BN3B 2GQHA 1GC1C 1TVBA 1FGVL 5GGVL 1HE7A 2X7LB 1JUFA 5EFIB 4JO1H 3S88H 1PGRB 3GSXA 3SJVA 2BMKB 3H9YA 5CJQH 1A7RH 3PL6A 3JWDH 2QADD 3CH8A 4D9RD 5DHVH 5IMMA 3T3PE 2BSTB 5E95B 1S9YB 1ZWIB 4I9WE 3G6JE 2HJLA 4Z8FH 5EO9A 1FYTA 1CYGA 3KPLB 4GXVH 1NCDL 1H3PH 1BQLH 4JDZA 3V6BR 35C8L 3TPUB 1RUPL 4GG8A 2I07B 4UNUA 1Z2KA 4LCYB 4ELMF 3MLYL 4CU8A 4XMKH 5HHXL 4P99A 3SCMD 2J8UB 5F3BA 1UM6L 4BYHA 2DICA 3QR2A 5IJVB 3QCVL 2BC4A 4Z76A 5B3JF 3LKQB 5IHUH 4GKZA 4Q9CA 2VWEE 5L9DL 2FZ3A 4RAUA 4B0MM 4PJIB 1KOAA 4FQHA 1NLDH 4PJ7B 4IJ3B 3VH8B 5FEBA 4YXKL 1BGXH 1QSFA 2C1OB 2VZUA 3BGFC 1X5LA 5CJXA 3ARBC 1TCRA 5IVXA 2OJZH 1ED3B 3HRPA 3S37X 3NCJH 3WFBL 2P47B 3HI1B 4JFEA 1WWBX 3CLFH 4LSDA 3DSFH 4OTXH 1XGPB 3BUYB 2MQCA 4U6VL 4APQA 5KSAA 5I8CB 2HMIC 3UYRH 1TJHH 2GJ6A 2R2EB 1UACL 3CUPA 4F9LC 1EHXA 5GRZA 2WZPD 4UILL 5D7KD 4TUJA 4L4TE 4Z9KB 2UY6A 3OXSB 3M45A 2PTTB 4U49A 1NAML 4Z7WA 1CIDA 3STLA 3UAJD 2EXYD 1QYGL 3UO1L 1BVLA 3VGAC 1ZANH 3O3AA 1CTNA 1CS6A 3FOLA 2JF1A 4NUJA 2AJUL 1NGZB 1EFXB 4XCCL 4MB3A 4MCYB 5C09E 3SDCD 4NO0D 5AYUL 1TETL 3KYOB 3NN8B 4IRJB 1X5JA 4WFEE 5T1KA 2HRPL 1QBMH 6FABH 4MA1C 4Q6IA 2AABL 3VFUA 1AGEA 4JJHA 2D0GA 1U8QB 4R4BB 1P9MA 3VFSA 3EYVA 3FB8A 4XBGB 2ZPKL 3QUXC 5IVZA 1UH2A 4WI3A 2F8OA 4PLJC 4R8WL 3DROB 3UZQA 2P5EA 3DUUB 4TTDC 4JM2C 1VKXB 3F62A 3TH2T 4HKBB 2P8LB 3O6FC 3EOBA 3FB6A 4PJGF 1W72A 2EEDA 3LZFH 1GC1H 4DUXA 1GZPA 5IB5B 4BFIB 4IRSC 5F7HA 1RJYB 3G6JB 2Q8AL 4XPAH 3FO9B 3NMEA 1KEGL 4BJLA 1NEZG 1J7VR 4KPHL 3ZL4H 4OCXH 2QHRH 4O00A 1KPVA 5E2TL 3VFNA 3HPLA 1AJ7L 4GSDL 1IT9L 1A47A 2X09A 2JJVA 4OCYL 4HBCH 4L3CB 2CIKA 1T1WA 1M71B 2BVOB 4Q2ZA 2R9HC 4OFYA 3DX6A 3MUGB 5IG7B 4WI4A 1IGTA 5DVMA 2C7UB 4W4OA 4G7YL 3CDGB 3TBSA 2IG2L 4XNYL 5ITFB 4QXUL 3BPNB 1Y0LB 5TDPA 3U4BL 1RIHL 1KJ2A 3HI5L 4TVPE 3ULVH 4GG6F 1F90L 5JXEC 3MV7B 4I0PC 1JK8A 5K9KA 4CVWA 3O45A 3OPZL 4AEHH 3VG9B 4TNWK 4GW5A 5FV2A 4L9DA 3WKNA 4KHTH 1E4WL 1QLEH 43CAA 5BZWB 4ISVA 3QHFH 1C08B 3KPOA 2FEEI 1NCNA 5EG6C 1XH3A 3QUYC 4P3DA 4X9BA 4Q7DA 4LSUL 4PJDE 3FT2B 1ADQH 1EAJA 4JRYA 4ERSL 2O61A 3NCEB 5L2KE 1BVKB 2EE3A 4FQJL 1PQZA 1OSZA 4Z7QF 5BZDB 3VI4E 3H9SE 2VLKE 4IHOA 3Q1SL 3R0MA 3MLRL 1MNUL 4ZYKB 2D7MA 1MHEA 4ELMA 4L4TB 5M7QA 3TT1H 3IDNB 5GGRY 1L9NA 4OF8A 1YEHH 3JTTB 3ULUD 1H9VA 4PJEF 3MZTA 5EOCJ 3K2MC 3FO2A 3LQZB 5EZLA 5C09B 3L9RA 4P2OC 3MRGB 2D9QB 1F58L 5DJAA 3WUWG 3PWUA 3A6CL 5AZ2L 1GGIH 1M7IA 1I8KB 4E5XA 5DHYA 4M5ZL 1UJ3C 5C9KA 3GNMH 5K9OA 1W0WB 3H42H 1LDPH 3H0TA 3CX5J 1D5MA 4RGNE 5D6DC 3IU4L 2AGJL 3DETC 2PUQT 3GSNL 4KZEH 4ZS6C 1NBZA 5FK9A 1EBPA 3MMEB 3KPRE 4X6DA 3ZE0E 4PJAE 5I6XB 1QFWL 2X6MA 5E4IA 5F3HA 2PN5A 2FGWL 4XP4H 1D3CA 4A2MA 1T0MB 2P7TA 2NZ9C 3WEXA 5IFHL 4B53A 1T0PB 4XNXH 1C1EH 3F7YA 1MLCA 2AJ3B 2BNQE 4JAMB 4EUPG 1FZOA 4QLRA 4D94A 2RBLA 1T7WA 2WLYA 1DBML 3WS3B 5D2NA 1YC8A 1GOHA 1PY4A 3TCXA 1A3RH 1YEIL 1ZKAA 4G6KL 3RNKB 1XF2A 4P4RA 1OW0C 3G5VA 3OAUH 3WIFA 1X44A 2WINB 4M8VA 2NW3A 3LIZH 1BLNA 3TJHC 1B4RA 5D8JH 5HDBE 2BNUB 4TSCH 2ZZUT 5IBUB 3FT3B 5EWIH 2V7HA 1HILB 1T3FA 4Q9QH 3OAZK 3NFSL 1EHAA 1IGML 5EN2B 1VADB 4XP5L 5DK0A 1F97A 1MI5D 1YJDC 3A6OA 4LOUD 1JWSA 5JIIA 4G6ML 1A1OB 3O41A 1R3KB 5JPNA 5EOQH 3I75A 5B38B 3QAZB 4YIQA 1ZLVK 4CBPA 5FKAA 4I77L 1Y18A 3V6OA 4PJGA 1CLYH 1WQVT 3VFMA 4AM0B 5L2KB 4KDWA 2HTLC 3T2NL 1U8JB 5DJXB 1RMFH 1FNSL 5EZJA 5JHDD 5LKNA 1B3JA 1RZKC 5E8NB 1CU4H 3H9SB 3UTSA 2R0WL 4WVRA 5FYKD 4XRCA 4KQ4H 1AO7D 1A9EA 4LL9A 2EDYA 5DVNA 3BKCH 4YE4H 5KTEL 3Q6FB 4LGSB 1A4JA 5ILTH 5C6PB 3S98A 5IVOA 2GTZA 5DEFB 2WNGA 4D2NA 4NQEE 1UZ6F 4OIAA 2DQHH 1DQJA 4GRWF 1R3LB 5J0BA 5C07D 4HS6B 5D1XA 3R0NA 4HUVA 1E27B 1VEMA 1XIWD 3ARXA 4YHMH 2DTSA 4OD2A 2YD6A 1HHIB 1CF8L 4PS4H 4EVNB 4MWFB 2HVKA 3MCG1 2HKHL 5DD6A 1MQKL 3PQYA 4LDEB 4X9IA 4YHPB 5GRJL 2VDQH 1D9KB 3QQ3A 4U1HA 4YBQC 3WD5L 2WBJB 4UTBL 3S96A 3WLBB 3VDCA 4KUCD 2FHCA 5ICYA 5JOFB 1WITA 2IQ9H 3KPRB 4JHZA 4JFYB 4NT6B 3DTXB 4IBLT 4YPGB 1NMCB 2HYMA 5M95B 3S6CA 3K4DA 1J18A 1SYSA 2A77H 2Q76B 4JKKA 1UKSA 4RWYL 1HZHL 1R3JA 1FVCA 1FLTX 1M7DA 1OQOA 3GSVA 2BNQB 3HNVL 4U1SA 1R24B 2EKSA 4LLMB 1FNFA 1W0VA 4PJEA 4AIOA 4QRTA 3A6BL 4NGHH 1BAFH 4YFLI 1DQLH 2HT2D 4JPVL 5HYSB 2HN7A 4NO5A 2Q6WA 4HUUB 4HWNA 1LEKA 1NC4A 2A6KB 5KAQF 1QFHA 2AERT 3O4LE 4WHTA 5EOTA 3BGMB 1CWVA 2HJKA 2XOTA 4UMGA 1EO7A 4G43A 2YD5A 4ZFOA 3P4MA 2VQ1B 3V6FB 1G7IB 3TO4B 1MJ8L 2A73A 1ZHBB 3S3JA 1HHHB 5DQDH 1CD9B 5CHNB 3OWEA 1CE6A 4JZJA 4FFVD 5CWSB 3KPPA 3QJFA 1JGDA 2V2WA 2ZCKH 4NDMA 5CGYD 1DN2A 4OQ1A 5E24E 3L7FB 4PRIB 1VFAB 3BPNC 4F33A 1BREA 5ACMA 1YJDH 2XWJA 4R9HA 4FQLL 3LRSA 4DWHA 4HPYH 3KYMA 5F9WB 4U31A 3MRRB 4KVNH 3P0VL 3JSSA 3DVNA 4J8RA 1G7QB 4MJ6A 2J6EA 3MC0A 1CLOH 3PWPD 4CVXA 3NGBB 4Y1AD 2VR4A 4R0LC 3JV4A 4PTTB 2VLJD 4NQEB 3W2DH 4KK6C 4S1DD 3MA9H 4ODWB 1GCFA 2BSED 2ORBH 3ES6A 4KMLB 4WNQB 1MFEH 1OAQH 4AG4H 1Q9WA 2XQBL 4F9PC 3SGEI 6CGTA 1JYVA 3TN0D 3BP5B 2Y72A 4BH8B 2Y6SD 3S5LB 1X5AA 4P2YA 1AXTH 5I1HH 1SYVA 3SDAA 4DKDC 2DD8L 2Y36H 4EKXA 4LCWE 4KTYA 1KF9B 1P7KB 1WSST 2ZUQB 1RZGB 1NC2A 1YEFH 4IOIA 3FO0L 3SKNB 4XBEL 5DJYB 2AXFB 3GMOB 2CO6B 5EPMA 3HC3L 1KCSL 3VXME 3RTQB 4N9OB 3R4DA 3MUHL 4NJ9L 3D0VA 5C0EB 1VDGA 2CJUH 1QLRA 4ZD3L 5L8KB 1J86A 4BZYA 4WI6A 5F7UA 5FM5M 1XAUA 1JGUL 1OPGL 1BHGA 3Q0HA 2D7OA 5GJTH 3PG2A 3U7WH 1EO5A 3C09C 2W0FB 2DQJH 5EO0A 3B5HA 1ZEAH 4JFHE 4J3VA 1IFHL 3U1SH 1KG0A 2XYCA 1I7TA 5GS0L 2FIKB 3LAFA 4RFNB 1FE8L 1L6XA 4P59H 1EAPA 4GUPA 3OKKA 4C55A 1I9JL 3E2HC 2EKJA 3CH1A 3JVGA 4LPWA 5EOCL 5CCKL 1HDMA 3U36B 5IVNA 1SY6A 1ERNA 2XNAA 3LS4H 2DBJA 2AS5M 4KV5E 5CEYB 5E1AA 4LLYB 4HIHB 3S9DB 2FD6H 1SQ2N 3O6LL 5FO9B 4NHCH 4H20L 5D9SB 1EEYB 1JI1A 3MYZA 4BFGA 4YNYB 3HE6B 5BW7A 3MRPA 3OAZH 2YD7A 3GJEA 3JV5A 3PWVA 4MNQA 1EGJH 5TPWL 2FNBA 3K1DA 4HFWB 3DI3B 3UTQB 1ZLVH 5IW1B 3P4OA 3S36L 3SE4A 1MF2H 1UCTA 1NQBA 4XP1H 5TE4H 3SE9L 1LO0L 3ZE1F 1MFNA 1JZ8A 3CFBB 3F7QA 1W8NA 1GYAA 4BKLA 5EUOE 4WTWA 3WS6C 4Y4FB 3V4PH 1HHJB 4QRRA 3MJ8B 3QI9B 2IWGA 1WCBA 5K59F 5KZCB 4M9PA 5IEKB 5FHBH 5JPMA 3GKWH 4BSJA 4R90L 3RIFF 3S34H 3NPSB 1I85A 1KEMH 3GSWB 4XMPL 1HINL 1J0ZA 1MWAL 4F37F 3UJTL 1AKJD 2QSQA 1VB9A 3OKNA 1T7YA 3ZTNL 1I1AA 4Y2DD 1CGVA 3MRHB 4C56B 4ODTH 2OZ4L 3RKDD 4TUKL 2BVQA 4LCWB 4B5EA 4TUOB 1MHHB 3NZ8A 4AEIL 1YEKH 3REWA 3OR6A 1AXIB 2BHZA 1UADC 4CVZA 1V05A 1YA5A 3GHEH 4OSUL 3FJTA 4OIIL 2FBOJ 4Y5VA 1CL7L 3PDGA 5LBSH 3SDDC 5JW5A 3SDYH 2VXUL 1EZVY 1JRHI 2HA1A 2R1WB 2FB4H 1CZ8L 1U95A 1IC7L 4GQ9H 4RGNC 4GS7C 3HLAA 1OAZH 3I84A 4D0BB 1R5VA 4WWKD 4OM1H 1IC4L 4N90E 1F11A 32C2A 15C8H 4ODXB 3GRWA 4MCZA 2V5TA 1PY9A 4PRPE 1EX0A 4WO4D 5F6IC 4DKFL 4HJJH 2EDWA 5KVEL 1O0VA 1ACZA 2NY2B 1LVEA 5DDHB 5DSCB 1U8KB 4LCUA 1QEWB 1I9RL 3I50H 3GMRB 1P7QB 12E8L 1P69B 3BKYL 3VDBA 3WN5A 5DR5H 2XTLA 3EYUL 3MJ7A 2NXZB 3VFWA 5ABDE 4GFTB 2W9DH 4QXTB 3KG5A 4WUUA 5FDYA 4MDJA 3I6LD 2X4SA 1WAAE 1G0YR 1N5AA 3O6KH 1OTTC 4WHDA 4K3JH 1RUPH 2R8SH 1GZQA 2LAAA 4WJ5A 4HIEA 3MLYH 2BY3A 2XTJE 2Q87A 5JR1L 3BW9A 5JA8B 3GBNL 5D7LA 1X4XA 3OF6A 3W82A 1ZVSB 2X70B 1UM4L 3E6FA 3TH3T 1QQDA 4BFBD 5CS7A 5FF6B 4QHLA 2J2ZA 1T7VA 1XCTA 2GK2A 4PUBL 5GS1C 2X1QA 4NNPL 5F7DB 3MFFA 5JW4R 1AC0A 1FL6A 2A6JA 1IE5A 4DTGL 5EUOB 5CSBA 5CLTA 4LARH 4TVPH 4V1DA 4DN3L 3IAGC 5I1GH 1KC5H 1HSBA 1A0QL 1X5HA 1CBVL 1AQKH 3KLHD 4P46B 4QY8A 2IC2A 3V5DB 2EDQA 4FQXD 4WFHD 5T33L 3HMXA 1H3WM 3HE7A 4RBPK 3C2AL 1HN1A 2R2CA 1KJMB 3MLUH 4BQ9A 1NFIB 2PYEE 5E03A 2KZ1B 5DJ2A 4OLEA 3MLXL 2WW8A 4GKSA 1FORL 1CFVH 1KB5B 2P44B 3S7GA 1A4KA 1K2DB 2W38A 3JV6A 1RZFL 3BIKB 3LEVL 4QXGL 1J8KA 1J8HB 5E7FA 3TA3D 2EYSA 2BP3A 3ZO0A 4UNVA 1A6UH 3DX9B 4PD4J 3DBXA 3L3DA 1A8JH 1S7TA 2APXA 4LSQH 4JE4B 3LH2L 3BDYL 5I15L 5E8DH 1ITCA 5TQ2H 1Q94A 3TGXA 2ICCA 2NCMA 2Z4QA 2NXYB 3QDGE 1EO8L 1U92B 1WBXB 4P3CL 1FNEB 3QDMD 3PWJA 1OY3B 4EI5B 3N1MC 5C0DA 3RTQC 2AQ2A 5KSBE 3VXUA 3FL7A 3U0PB 4AH2A 2YUZA 3ZE2E 1FFOA 1FV1B 2OL3A 3KLAB 4KKCC 1FZMA 2C3VA 4OJFL 5GJSH 5BCAA 4OF6A 5DK2A 5D6CA 3C5ZD 4Z7UE 5I1EL 4OZIE 3EZJB 3RZCB 2HJFB 1H3GA 3FB7A 1MLBA 4ONOA 2JELH 2XRAH 4H26B 4RZCB 3D0LA 1OAYL 4KI5F 3VWKD 5DC9B 3C5SB 1CG9A 5BQ7A 3O9WB 4QWWC 4LU5H 3VFTA 3TNMA 2XTJB 3UPRB 4EI6B 4NQCE 4AEEA 2XY2A 3B9KB 4HWUA 1DL7L 3GIZH 4RISH 3RVXC 3I3BA 3NTCH 5JIHA 4HV8A 4QXUH 1EH9A 1RIHH 4XXCC 3W0WE 4XVSH 4K7PH 3KDMB 4LSRL 1KIPA 4PBWD 1WZKA 3FAWA 4IIQA 5I8OL 2VLLB 1HQRB 4O2FA 4PY8J 2PO6C 4NRZA 1BEYH 4L29B 4J3WA 4X99A 4KAQH 5ALBL 4DCQB 4J6RL 5C0AE 2AJZB 3WFDH 4K8RD 1YEGH 3AY4A 2PYFA 3ZYIA 4HK0A 1UENA 1TMCB 2ZOKA 4F7EA 1DBAL 3RA7L 1PFCA 5IF0B 5CAYB 2V2TB 3LHPL 1DUYB 1MNUH 2FEEL 3NIDF 4PRBA 1NUNB 4OFKA 4U6HB 3E8UL 5CUSH 3ZDZE 3LKOA 3OX8B 3MCKB 5ALCH 5DURD 4XPBH 1LO5A 3E6HB 2VDMH 3V0VA 3S37H 4FQQA 4ZO9A 2YPKB 5BOPA 43C9A 1NDMB 3AS0A 4HULB 1X6LA 5DMJB 4D3CH 1FIEA 3NA9L 3B8SA 2HTKD 5D1QC 4LCCB 4MJIB 1JJUA 4NJAL 4J23A 4HWBL 5EU3A 4JFFB 1HHKA 5AZ2H 3C6LB 5HGHA 4Z6AT 1I7UA 2AK4D 4PRAA 5D4QA 5MI0C 1FNGB 4X6CE 3QDGB 2W92A 3DX8A 2H2SD 3OB8A 4X4XA 3FT4A 3PHQA 3VG0L 4GO6B 4HMDA 4XPGL 4HKXA 5EIIA 1DVFB 4HUMB 4P2QE 4N9GA 4YHKL 3IU4H 1EA9C 2IBGA 4MJ4A 1T2QL 5KANI 2ZUUA 1OARH 4LGRB 4Z7UB 1MJJA 1GGYA 1MFBH 3KJ4B 2GT9B 4Y8DC 5DRWA 1A6TB 5ENWA 4JKWA 1P5VA 3LKSA 4G8GD 2IANA 3KVQA 1C16A 3C60A 5LAXB 2EDOA 2CIIB 3GMQA 2R2HB 3VE0B 5FUZL 4LVOC 4D0CA 2H41A 1AH1A 5DJ6A 5JZ7C 3OHXA 4FTVE 5C71A 2P48B 1U8OB 3C8KB 4HKJA 4AIZA 1R5IA 4HCRH 4MD4A 1T0NB 4NQCB 2BHUA 2ADFH 3GUTB 3OKDA 1QVOB 1OOAA 2HT3D 1RU9H 1U3HA 1PLGL 5HHVH 1FO0B 4FXKA 3P0YH 2ESVD 1IQDA 2YD8A 5I0ZA 1G9EA 4PJFF 4UINL 2DKUA 3ARTA 5HHOA 1CDIA 2F5AL 3G6DL 3ZLQC 3ARPA 2Q86B 4LP4A 3KYKH 2E7LA 4G8FB 1I1YA 3QIWB 3DO3A 5E9DE 2YUVA 2EDTA 3RY5A 4X7DC 1D6VL 3K0WA 4X7TB 4ZQKA 2AJSL 2P5WA 4LFHD 2ZUYA 5I1DA 5IROA 3TZVC 4MA7L 1U2HA 1X5XA 3OG4B 2KPNA 3MOBH 5J3HD 3SPVB 1NUFA 3BZ4A 3MV8E 3FQNA 4RBPH 2CDGB 1H8NA 1U8NA 5C0BE 1MCLA 3S35H 4KI1A 4WTZG 5HHNB 5ID1A 4OLVL 2VE6B 1IAKB 5F9OL 1M05A 2OTWB 3BVNA 1PEZA 3L95B 1SEQH 5HY9A 3UYPA 4FFZH 4R2GC 3LDBC 4M7JL 4TRPL 4U3XA 1P6FA 3G5XB 3GK8L 1AGFA 1H5BA 3NH7H 2CLZA 4NFDA 5GSRB 1CXLA 5GSVA 4N0UE 1CF8H 4N0FB 4X6CB 2CK0H 2XZCL 5DS8B 5ELIA 2FIRT 3QEGH 5I75C 4PRDA 3DI2B 2UV3A 3NCMA 4UUJB 1DQDL 4E9LA 1NMAL 4YEFA 4NUGL 3IAQA 1GHFH 2R23A 3N9GL 5H2BA 1RZJL 2OLDA 1OP3K 3IJSA 3PHOA 1QSFD 3BP7A 4JZNA 2LQRA 4DZ8A 3KNBA 3HAEB 3LSOA 4LSSL 5GS0C 2CGRH 4O9HL 4MB4A 1SJXA 1DE4A 3L1OH 5HVHC 3QXTA 1NANH 5B21A 3WXWL 3U30C 3V2AR 3O8XA 1N6VA 2E6PA 4FTVB 3VXRE 4PYHA 5KSAD 2DIJA 2GJ6D 5DD5H 2FLBT 1EXUB 1P4LB 2QQNL 3IXTB 1EERB 4IMLA 4HWEH 2BOBA 1P53A 2VMFA 4N5UA 1HNGA 4JRXD 4AENA 2QQKH 4XWGL 5F7LB 4NO2B 3KPSE 3WO4C 4OCSL 4YLQT 3DMMD 4M00A 2IH1A 3P30H 4Y4HA 4O02H 5TJWK 4M93C 1N3NA 3ORJA 2AXGB 2EDRA 2WWKO 1YUHA 4PB0L 3SE8H 2CPCA 1MFCL 2ZJSH 1L0QA 5L6YH 1EEZA 4KRPC 4GRLB 3RGVC 5HGBA 4FQLH 3FMGL 4MQXC 3ZSSA 5J06A 1Q0XL 1FH5L 2PCPA 1JHTA 4P4KA 3DV4A 2VDOH 1CDYA 3MV8B 5I1JL 5EZOL 5HGGS 3P0VH 1INQA 2Z93A 5JLZA 4YHYB 5CBEA 1G6RL 1OGAD 2OMBA 2R0LL 3BH8B 1LE9B 5E94A 2YPLB 4LBEB 5IHZA 4TSBL 1TZGL 1KYOK 3PE9A 3SBWC 1RZ7L 1N5YL 3V7AG 4QYOA 2IBBA 2X4UA 4ZFGL 4LPCA 2CKBA 2EDXA 1WF5A 3TV3L 5CJOH 2Q7YA 5E6IB 5D93C 5T3ZD 5I2IB 1X9QA 1YYLL 4N0UB 4I4WA 4FFYL 4JY6A 3ARGA 4P2RD 2GTWA 3NCFB 1KNOB 4TPRL 1AD0A 5JOEA 3ULVD 3W9DA 3TC9A 1NCAH 2V9QA 3KPMB 3IFOB 3VCLA 4XNZC 1MVUB 2F53E 4MA8L 3AU1B 1G7HA 1KB9K 5BMFH 2MSPA 2GJZA 1A5FH 1TFHA 4ELKA 4XCFL 2LTQC 3OL2A 1UCBL 1Q1JH 1JGUH 1OPGH 5HI3D 4Y5YA 4KTEH 3FQTA 2NYYD 3QIBB 1AHWC 1KCVH 3EYSH 4JRYD 1BQUA 4HPOH 1YY9D 3P73A 5I8KL 1IEBB 2F9BT 3ABZA 4XC1L 5TDNA 5EZIH 3CCHA 4LKXA 2FL5A 1HH9B 5GS0H 5HYJE 4L8CA 4YHLH 3FB5A 3QDJE 2ICWB 3D18A 4JHBA 4JY4B 5ADOH 3OGOE 3BP6B 3CZJA 3MGAA 1CD1A 5C6TH 1OSPH 5C0ND 4MHHG 5HSFA 3SHSA 3T0EA 1F3RB 1ES0A 3MRIA 4D9RE 5HHMD 2I9LB 3IFNL 4HF5L 4GBXD 2ITDA 4YWGL 3CIQA 4PB9L 3U2SA 3HC0A 1TITA 4YH6A 2OTUB 1SJHA 4LFHG 3RWCB 1A2YB 4XMLL 5EC1A 1V7ML 1FDLH 3L3GB 1KBGH 2CQVA 4LIQL 4QRUA 5D5MF 1V7NL 3G04A 1A7BA 2AEQH 4JDVB 1YPZE 5A40E 4L4VB 3O0RH 4POYA 4PJXE 4EDWH 4PJHF 4Y89A 3BXNB 5KG9A 5JXAH 1J0KA 5J12C 4HXAL 3T65B 1S7UA 3WHE1 2ENYA 5L2JB 2YD9A 1YQVL 3DRQB 5EU6B 3BRFA 4Y19E 4J3XA 1ORSB 2HVJA 2A0LD 3QUMB 5ID0B 4HMEA 3D9AL 1QLFA 3D25A 4WY7L 4JDTL 4CJ0A 4FZ8L 4LPUA 1JZ6A 1R3HA 1VACB 4X98B 5E5RB 3VGDA 1U93A 4ZFZA 3GI8L 4UBDC 3TPKA 3TVMC 4Z5RA 4ODHL 5I0DA 1AI1H 1VGKA 3ARBA 2V7NA 4PGJA 1G9ML 3MBED 3GJFB 5C0JB 2R69L 1T89C 1VERA 2MCPH 3GDBA 1BPVA 1RZ8B 4K7PY 3EDEA 4FQ2H 3KPTA 5E99L 2F53B 1E6JL 1EHLL 5D7KE 5L88H 1CLZL 3MBXH 4NZJA 4JQXC 3RI5F 1N2RA 3QEHB 3RL1B 4PRNA 1U6AL 4LLVB 3G08A 1CICD 2NY0D 4F9LA 2VNCA 3IDYC 4O2EA 1RUKL 1DBBH 3MLZH 1OP3H 3VXSD 2W07A 4MQ7B 4WWID 4MAYC 3O3DB 1IC7H 3MOQA 4P9HL 4X5WA 4NZDA 1ZXQA 3MRBA 4NYLA 3IAPA 1ZS8B 5D7JB 5F9JA 4OF0A 3TYGH 1S9XA 3VGFA 2PW2B 2DQIH 2FJGA 3QEUA 4XC3L 2ZUVA 4NHUB 5GGTA 1MJUL 4N0CC 2DQGL 4Y16C 2KQMA 3INUH 3QDJB 2P4AB 1JRHL 3C08H 2R4SL 5E8PB 3BESR 4ZNEA 1YMHB 4RNRA 5CSGA 4JFDB 3MA7A 3HMWH 4PJ8D 1A7PL 1YEEL 5CP7B 5FGSA 3O3UN 1IC5H 1BJMA 5K9QG 3CU1A 4H8WL 1OM3L 1JPSL 2FWOB 1C12B 1I9IH 2K7PA 4RGMB 3LKRB 5KSUA 3CXHK 4R96A 1S9WB 2V17L 3QUXA 2X4TB 4LLQB 1YYMH 1J1PL 4LIQE 4B50A 4S10A 4XBPA 1FC2D 1WZ1H 3WJJC 2IALA 3PABA 4R97C 1XF1A 3QHTC 3O6FA 4BH7B 1UG9A 3QG7H 1LO2L 1A22B 4DGYH 4EN3D 1PG7L 2X1XR 4G42A 4XVUD 2Y9RT 4G5ZH 4IRSA 5IESH 3H7BB 3VXNB 3LV3A 1Y6MR 5DJDB 1H0DA 2AEIT 4L1DA 4MHHI 4Y19B 1MCPL 4DN3H 2ED7A 2QR0A 4FFWC 3DVFA 2I24N 4HS3A 4X4YB 1FVEB 4OBSA 3EJYC 4XPHH 1CD0A 2JCCB 1H3VA 1BBJA 4HG4K 1EK3A 3EYFA 4OCLC 2FECL 4NN6B 1K4CA 4DN4H 2IQAA 5JXEA 4I0PA 4CAGA 2FH6A 1FAIL 5E2JA 1OTSD 2R1XA 4IOFD 1BIIB 4V2BA 4M9OA 4MX7A 4UTAH 5KS9F 1U91B 3LKNB 3PGDB 3QUYA 3O4OC 2O5YH 3TNNB 3L3JA 3DRTB 5D5MA 1VFBA 3GIVB 1EDQA 3KXFD 4PJHA 2BXZA 3ZKMD 4QNPE 3GMNA 3B6SA 5DYOB 5FYKL 1VPOH 3VD7A 2VL5B 2JJUA 5IIEB 3IVKB 3ULUE 2DJUA 4LK4A 4RAHA 4W81A 4BQ8A 4IDJL 3KPQB 1XGQA 1XF4B 1UC6A 4M6OH 2F19L 5GGQL 4XAWL 1GIGH 3SDCB 4NO0B 3AMLA 2MWCA 4JFZH 1PKQB 3GJFK 1K8DA 1IAMA 5I1IH 1S7WA 2QSCL 3EBAA 2OQJA 2R0ZH 3CXDL 4MGXA 3FKUS 4Z95L 3GMLA 4P2OA 3UX9B 3Q3GB 3E1F1 1IKNC 2VERN 4J1UA 4NKMA 4S0TD 2GHWB 2VYRE 2AV1A 3MLWH 3TIDA 3ET9F 4NSKB 3DURB 3QZWG 5ERWA 3FFCA 3VFOA 1UJ3A 4JY5H 4KQ3L 5DJ0B 4G9DB 4XCYA 5GS2H 5D6DA 3U0TB 2J6EL 3TJEL 4QRPB 4KKBD 3RKPA 3IDIB 2X5PA 1ZOXA 4G6AD 5A2LH 4I2XA 4MXVE 1MAJA 1FLRL 1S7RA 1T7XA 1G1CA 4NWTH 5E2UH 5BVJB 3TBVA 2D7TL 2ZOLA 4LMQI 3ZHKA 5E8OA 4S1SH 3BZEB 3MYJA 5C08A 5DO2C 1DLHB 2QQQA 1CE1H 1L7IH 1FJ1B 4Z0BH 3OAYK 4LAQL 5I1KL 1JPST 3QYCA 2I9TB 1JWMB 1W2KT 5I8OH 3FQWA 1UQSB 2VITB 4XCEB 4H88L 1IAIM 3VRIA 2YS4A 1EFXD 1MI5E 1CDCA 2PTVA 3IDMB 4M1CC 3SOBL 5F1OB 2WP3T 1IEAB 1MCWW 4IRJD 4L3AA 2J3SA 5DMGC 1QSEA 3T1WA 3FRUA 1JGLL 3OKEB 5ANMA 4CMHB 3TPUA 4M7KH 2XZQL 3EDFA 5LGKA 3E8UH 5EDXA 3HUJE 5JHDE 5EBGA 2W91A 3D85B 5ITBH 4LNRB 2ZNXA 2D0FA 5FYKE 2I60H 1H8OA 3MNVA 5D2LB 1AO7E 4OLYH 1EVTC 2B1AL 5TF0A 2DWDB 3MRCA 3NA9H 4L8SB 5F1NB 3RWEA 3VH8A 2Z31D 3KPNB 1SY6L 1CDGA 1Z9OA 2CRZA 1ZE3C 4YBLB 2B2XL 5C07E 1S3KL 4GW1A 4TULL 1FNLA 3ECBA 1YY8B 1WBZA 3CFKB 3PP3K 3V5HA 1JTOA 4XPGH 3VFPA 3SGJC 1UA6L 3EO9L 4UT6L 1CCZA 3MCLL 4YHNB 5D7IB 2EIEA 1L6ZA 1MUJA 4UDTA 1PG7W 5J11B 4L3EB 4OZ4B 5IUSA 4G6FB 5D71L 5KS9A 4J4PC 3DV6A 3MV7D 4YDJB 1HXYB 4DOHB 4XX1G 4HIIB 4OGYL 1VFUA 2HFEA 3NFPB 1TQBB 1U3JA 5AZEL 1DEEA 4L8BA 4DKEH 4YDVA 1PX3A 3BQUA 5C9JA 1J1XL 1K3ZA 4GH7B 3VXQA 4MAUH 2R2BB 3VD5A 4KKAD 1I8IA 3RWGB 1MFDL 4MNGB 4KJPD 2XKNA 3NFNB 5I1AA 4EJ1C 3P9WB 5IK3B 1KELL 3MGOA 4U6XB 3MO1A 3UROR 4RGMC 4YXHH 2QADC 5IV2B 1VHPA 3UTPD 3ARED 2X4QB 3JUZA 5I66A 4ZNCD 4DGIL 3MRLB 2CH8A 5C70A 4H25B 3MSPA 1QR1A 4HKBA 4YHIA 2DF3A 3UBXI 3WXVH 2R0KL 2LU4A 2Z91A 4N1HB 4PJDF 3IDGB 4F7MA 5C09D 1RK1A 4KTDL 4UIKH 4EXKA 5IWLC 3SCMC 2VKWA 3CVHB 4KROB 3VI4F 5F6HI 1NGWB 3GBML 3OXRB 3ZKXC 2HKFL 2BCKB 2F58H 4ONGH 4ZS7H 5FDWB 3TCLB 2A6DA 3RY4A 1A1NB 4F7PA 4WCYL 2A9MH 4GAGL 2E5EA 1U58B 1LE5B 1KULA 1L9MA 3QUKA 4ODUA 3DX7B 4TN9A 2WIMA 4I13B 1FIGH 1M1SA 1NAKL 1IKFH 2NTSP 4CDGC 4OZFB 3ZDXE 2EDLA 1U8IB 3CDGA 5SV4A 4YGAB 3GRWL 5F9OH 1YMMA 1Z6JT 2BVPA 3U4AA 3I6KB 1XMWA 5CD5D 5MEOA 3P2TA 3RPIB 4OKVB 3MRDA 1MELA 3PWPE 3B2VL 4HUXA 1X5KA 4Y1AE 1QFUL 1UVQA 2VLJE 2GFBB 3QUMH 1JGEB 3HZYA 5C07B 4BZ1L 2XZCH 4L8DA 2W59A 4PTUB 1XIWB 3B9EA 1ZT1A 5IBLD 1DQDH 3AC0A 3MUY1 4R0LA 5BV7B 2XPGA 1Q0YH 4OB5H 5C8JB 5CMAA 1N0LA 4RFEB 1NBQA 1YDPA 1U36A 1NL0L 5JORA 5HPMB 3CFEB 3ZE0F 1Q9KB 3WDIA 4XXDB 3X12A 4F9PA 1RIUH 4HUWB 3GJFH 1A7NL 4EDXB 2VDLH 2YEZA 4L4TA 4LSSH 3R8QA 1N8ZB 5HDQL 2V2XB 4V1DD 3DXAD 5TDOB 3SDCC 4J12A 1JI2A 4PLKD 5IJKC 5C7XH 1OP5K 3LN4B 4TVSa 3FZUD 1H3XA 3NCYP 3UC0L 4QHKI 4JG1H 5BS0D 1BFOA 5JDJA 4WEBL 4UQ2B 2JIXD 2FX7H 1H15A 4PG9A 1FZJB 1JTPA 3EFDL 2H26B 3H9SD 4UQ3B 3WFHA 5IW3A 5HDBF 1CGXA 3FOMA 3DVIA 3RAJH 1TVHB 2YMXH 1NGPH 3MLSH 2EYTB 5K9JH 4XWGH 5T3XL 1K4DA 4I18B 4OT1H 4OUUB 1DDHB 5HJ3B 4PGCA 5F96H 3QIUB 3BKJL 1U8LA 3HS0A 4P3WA 3X14A 2I5YH 1C5CL 5SX4H 5KJRL 3MRFA 1FSKC 5GS3A 3BEVA 3OAYH 1XT5A 3QA3A 1A3LH 3EO1A 3F8UB 1JZ7A 5DUPH 4OQTL 3HFMH 4X6BA 2VAAA 4P48A 1LEIB 1MCOL 4U0RC 3HI6L 3FQXA 1MRFH 1QBLH 1VGEL 1ITBB 4I3RL 1FH5H 3QQ9D 1GOFA 4UIMB 1G0XA 3QWRA 5J1AA 2VABB 3VXUD 3L6FB