3UMTA

Scfv12, anti-bcla antibody single chain variable fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
242
structure length
227
Chain Sequence
QVQLQQSGLELVKPGASVKISCKTSGYTFTEYTMHWVKQSHGKSLEWIGGINPNNGGTSYNQKFKGKAILTVDKSSSTAYLELRSLTSEDSAVYYCARDDRYPAWFAYWGQGTTVTVSSTDIQLTQSPSSLSASLGERVSITCRASQDIGSNLNWLQQKPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYASSPPTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Systematic stability engineering of single-chain antibodies
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords scFv heavy chain and light chain
total genus 59
structure length 227
sequence length 242
ec nomenclature
pdb deposition date 2011-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3umtA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3umtA02
4YQXH 3TWCH 3BRGC 3DETD 3GMOB 2VIRB 1HHKA 3QEHA 2I9TA 3QIWD 2WUCL 4PGEA 1J10A 1NGZB 3Q5YA 4NSKB 2NY5H 4WI8A 4K8RH 4HIEB 4HUUA 4JM2D 3C5ZB 4C54A 2FSEA 3HNVH 3FQUA 4NWTH 5KJRH 4FG6D 3CIQA 2BVEA 1NDGB 1NUGA 1ZA6A 5MP6L 3GGWA 4LDEB 5HBBA 3L7FB 3DXAB 3U7WL 4JQIH 3MRKA 1J0YA 5IMLA 4Y4HB 5DTFB 1FFOA 1L0QA 1PKQB 1IKFL 2BNQE 3MRPA 4JFED 1AGCA 4I4WB 3I6LD 3RVTC 3NIGF 3KPNB 4F9PC 1UT9A 3QUXD 1HQRB 3FTGA 3C60C 4YDIH 4LF3B 4LNVA 5HI4C 3UTPE 3X11A 4UILL 4L4VE 4HUNB 1AIFB 3TNNB 2F58H 5CJBA 5DGRA 2IPKB 3HR6A 2C5DC 3NACL 2DQTL 1MY5A 1FVDA 2R1XA 3RWHA 1OL0A 4FTVE 1HYSD 3PDDA 3FCTA 2PYFA 1A6UH 2VZ3A 1IBGL 1FO0A 4PY8I 5IVXB 3T2NL 1RK1B 1NGPL 2EDDA 2W9EH 1JYXA 5FYKH 1A2YB 3MV7E 1WIUA 1IGIH 5D6CA 3RA7H 5ACMA 3GHBL 3NFSH 1NMCB 2AQ1A 1JIBA 3MLUH 3S6CA 4CADA 3EKCA 3B3IB 4RSVA 3C5ZA 2X44D 43CAB 2VNCA 1M7XA 5C09B 1MIMH 4NZUH 4CL7A 3BEVA 3RU8H 1CGSL 4QEGA 4MD5B 2WIIB 1KPVB 1IC5L 4JFHD 1G7HA 5E8EA 3WNOA 4BFBD 1YNTB 3PHOB 4BSJA 4FXKA 4M7ZB 2DD8H 1A6AA 3V52L 4QHNA 3IRZA 1QYGL 5ENWA 3HS0A 5C0JA 1AGCB 3VGHA 3NCYP 4GKZB 1A7BA 4EOWH 3QA3B 5MENE 3CPLA 2PR4L 5C8JA 3WJJC 3OKEA 1HEZA 2ICWB 2UWEB 3CU1A 5HGBB 3QDJA 1RZ8B 4GLRH 2BNUA 5FK9A 4MJIE 1X5ZA 2OCFD 2AXGB 4N0UB 4JDTL 1IT9L 2YEZB 4WFEE 5DC0A 3G08A 3H9HB 1P7HL 3NH7L 2L7UA 4MHHG 4OZ4B 3RNQA 3MBEB 1ODAA 4OLUL 2GTWB 3HB3C 1KSRA 2CQVA 2UZIL 3MLRL 5DJCB 3QG7L 1MREH 1OHQA 1QP1A 1XEDA 4OCYH 3WS6A 1T3FA 2QJDA 2XG4A 4ORGB 5EB9A 1B88A 3DRTB 2D0GA 5BRZD 5D7LE 2EECA 4PY7B 4PP2B 3SDDA 5ID1A 1KULA 3U46B 3NFSL 1NQBA 1G7MB 3H6JA 1MFDL 2Q1EA 2BRRL 3RRQA 1NDGA 1NSNH 3RUGF 3GMLA 4ZDHB 1D7FA 2CRZA 3JVGC 3P40A 1P7QD 3ARVA 1IBGH 1XT5A 4MNGB 1WC7A 1YC8A 3QPXL 1CL7H 2DM7A 4G7YL 5GZNC 2QEJA 2KKQA 1ZT1B 1ZS8B 5EO9A 1MF2H 5IEKB 3U7AA 1ES0B 1YN7A 3CFEB 1UENA 1X6NA 2NW2A 2GHWB 2F58L 2J8UE 3T04D 4RQQB 2V2WA 1RJCA 1WWBX 1T21A 4YDIL 2EC9U 1P4LB 1N64H 2HH0L 4XVUD 4G6ML 4PRAA 1U3HC 4YDLB 4HDIA 1AQKH 1NMAH 1F02I 4X5WB 2K3TA 2CLZB 1BHGA 5AUMA 4WTZG 4KVCH 4RRPA 4R97B 3V6FB 1Q0XH 3L3IB 3QH3A 3PJSB 2E3VA 4OF0A 4U7KA 2NY4B 4I3SH 2AJZB 4XP6H 3MA7A 1SJHB 4LHJB 2ID5A 1QRKA 4OF3A 2AK4E 2JIXA 5D7LB 2V5TA 3G5YB 2X4SB 2HLFC 4Y16C 3O45A 4Y5VA 5I76A 3TWCL 4YQXL 1Q9WA 2PETA 2XN9B 3NZHL 1KIRA 2Z35B 3DGGB 3MJ9A 5GGSB 4PJFA 5HYSA 4NYLA 5EZLB 4NPYA 2DWEA 4XXCC 4PYHA 1H3VA 3H9SA 2DYPD 3JV6A 1RVFL 1ADQH 1IQWH 2GK2A 1MCPL 4JVUA 4NRXB 3VXUA 2WLZA 4DGIL 2EZ0C 2XKNA 2EH7H 1J1PH 1PQZA 2BVQA 2X4RB 2NZIA 4LSRH 4KPHH 4Y5YB 4NP4H 2X1PA 3LKPB 1FVEB 5JO5A 1VGEH 3SO3C 2NY5C 3E0GA 5CGTA 1IC7L 1YN7B 3VD7A 2Z4QA 3DYMA 5D96B 1QTYT 1X5AA 2ADJA 4UNUA 2H32H 1CTNA 4JHAL 5DQDL 5KVDH 1H3GA 4K55A 1UH4A 1XF3A 1S9YB 3HPLA 4L4TA 3K8KA 3ULSB 4ELMF 2VDNH 1KXTB 3FAWA 4HHAA 5D72L 4KUCD 1MI5A 4OD2B 5JIHA 4RGOL 4IHOA 5GGQH 4LRIA 4DAGL 3O6KH 2Z8VC 2EXWC 1GGBL 2Y5TB 3HAEA 1N2RA 3QHZH 4JJHA 3TYGH 4HFWA 3RVXC 2NZ9D 2FATH 2VC2L 3RTQB 1QRNA 2DLFL 4J6RH 4GFTB 4FFZH 3MV8A 4BZYA 3OAYK 3JWOL 1KB5A 2J4WH 3LQAC 5I1DB 3QUYC 1GGCL 4RGNB 3BZFA 4QTIH 3S8WA 2IJ0C 4F7TB 2QHLA 4P5TD 2ORBH 3MNZB 3LHPH 1NUFA 3TNMA 4M4RA 2J8HA 4EVNA 5IVOA 1QA9A 1XR9A 3QCTH 3S5LB 5CKAA 3VJ6A 5E9DB 3HI5L 5K59E 2KQNA 3BH8B 1NMCC 1UQSA 1YEDB 4JFPA 1I3RB 1U93A 1A21A 1FL5B 4P23D 4AEHH 5F9OH 2X70B 1NCNA 3RL2B 3HNSH 1PG7L 2E9WA 3QQ9C 1XF2B 5FGSA 5FUOL 4JFDB 3PHOA 1F4YL 2HVJA 1NBYB 1H0DA 1OB1A 4BQBA 1KELH 2J8UF 5H35A 1CDHA 2O5ZH 5D7SL 2IQ9H 4ZAKA 1N6QH 1HKLL 1BBDL 2IPTL 5KZCD 3U4AA 4JO2H 1OM3H 4GJTB 4HIIB 1QBBA 1Z0NA 3NABL 3GSNL 2AXFB 2BVOB 4PJAF 2DQGH 5F7EL 3LEYL 3X12A 3HFML 4MNQE 2H6PA 4J4PA 1JBJA 4Y1AE 5ICYA 4F9LA 3ARFD 3CZFA 3EYOA 3PV6A 4QRQB 1EUTA 5SX4H 2YN5A 4HUKB 5CZKA 4F8TA 3SPVA 5E5RB 1DQJB 4PGDA 3LEXB 1BBJA 4CKVX 2HFGL 2YK1H 3DUSA 3QO0B 5DS8A 3RFZC 5ADPL 2ZCHH 4JY4A 2VR9A 2BFVL 4QHLA 4OB5L 1NBZB 1GPOL 1RFDL 2ADGA 1A7RH 1IGFL 3IXTB 3V0VA 2R2HB 3PDGA 4L3ED 4FQHA 3Q5OA 4MAUH 4ODWB 1RZJL 4XNYH 5T3ZD 2NMSA 5T1DL 4UBDC 3BX7C 3RTQC 4U1LB 4IRZH 1FZJB 1EEYB 3L5WA 4N9OB 4KZEH 5EU6B 2VXTH 2PF6A 4KAQH 4P9MH 1ZSDB 4PBWD 1JFQL 2E8YA 1FVEA 5JO5B 3IAGC 4Q9QL 3BISA 3HZVA 3VFPA 1NEUA 1QD0A 1MQ8A 2VDKL 1E4XI 1VFAB 4S1QL 1A8JH 1W72A 2F5BH 4RAUA 2H9GB 2AXFA 1BMGA 4FA8A 4YHNA 3QUZB 3HPLB 4L4TB 3ULSA 3IDGA 3RKDD 5E99H 2B1HH 4NN6B 3V95A 3O2DH 5HVHB 2G2RA 4ZUVA 4OBRA 5I2IA 2X4PA 3VD3A 4YR6A 1SYVA 3M07A 4U1SA 4F57L 1GOGA 1RJLA 4LPUA 5D7IA 1S9KC 2NXZC 5CP3A 5JW4Q 4OZFA 3SPVB 2OJZH 4Y16D 4OZIE 1LEKA 5E24E 1F4XL 1DDHB 3QRGL 2CRYA 2ZPKL 3IDYB 4GKOA 4QRPB 4TSCH 1RZKL 4JCMA 3T0ED 4HGWA 5I18L 1EEZB 4XB8A 3TA3A 1I3RA 1QO3A 4HKZA 4ODXA 3RIAF 4ZFGL 5IW1A 4NKQB 4R4BB 1R5VB 5HI3D 4JRYD 4S11A 4ISVB 2C26A 5FGRA 5JA9A 2HN7A 4YK4B 4DW2H 4YXHH 3BFOA 4DTGH 4KKBD 3ULVC 2OTWA 2X9WA 3EDJA 4XI5C 3ES6A 3MLVH 3HPJA 1TJIH 4X4YB 4HS6B 1KPUB 4HH9B 1NLBH 3KR3L 3C6SA 1DLFH 4FRWA 4P2OC 3SDXE 4X7DC 4CJ1A 3DXAA 4YGVA 5L7XL 1Q9LB 3SDCC 5JW5B 5CIPB 4LHUG 2C3GA 3H42H 4Y5YA 1A7NL 2IAMC 4Y2DD 1FGVH 2ICEA 1I7RA 3AXLB 4P3CL 5ID0A 2IWGA 4PRID 4Z7VB 4PJDA 1RV6X 4TUOB 2PYEE 4XP9H 2PTUA 3T09A 5F1IA 3O9WC 4J8RA 1NAKL 1NDMA 1S5IL 1FG9C 3G5VA 5HJ3A 1NKRA 3BP7A 4RMWA 1T03H 3EJYC 5F1SA 1FYTE 3MREB 1IL1A 5DRZB 2BNQD 2XWBB 1Z9SA 3CU7A 5CJQH 4PRIE 1INDL 2VXSL 5MEQA 3U2SA 4NGHL 3MOBH 1TIUA 5ISZD 2DLEA 3MJ8B 1TXKA 4R4BA 3JTTB 3NTCH 4YHYB 4Y4HD 5DS8B 4DKFH 3GSWB 2VLKB 1OARL 4WGWB 3LRSB 5FV1L 1NAML 4TVPD 4Q7DA 1WTLA 4Y4KB 3VXUD 2LU3A 4UV4H 4PRPD 5ITFA 4L8SC 1DVFD 2A9ML 3A0OA 3DX9A 3VRLE 2VXVL 3OKLB 3BZEB 3QZWA 2R69H 2Y25A 3MMEA 1INEL 5CEXA 3BWUC 3I50H 4K9EH 3KPPB 5D1ZB 4MQ7A 2Q8AL 4G7VL 4L4TE 1BFOA 4I0CC 4JRYE 3B3IA 3ESVF 1GXEA 4XPGL 5FHBL 3F12A 3QFJE 1G9NC 4XPTL 1QSFB 5ETUA 2ADFH 3IFOB 4JLRB 4ZD3H 3M17A 1A6PA 2YSSB 1ZV5A 4HAFA 1EBPA 3U83A 5I16B 3M1BB 3ZKNC 2HWZL 2P8MB 1AGEA 4FXKB 3ULUL 4WRLA 5BRZB 2GSIA 1U95A 4GAGH 5TQ0H 1TQCB 1FVDB 3OKEB 1LP9F 4R26L 3V4UL 1HXYB 4PRHD 2VLRE 3DETC 1WFTA 6FABH 1X7QB 1KC5L 3LSOA 5IBTH 4K7FB 1P1ZB 5E2WL 4MA1C 4PJIB 4MJ4A 3QDGB 5ID1B 3ZKXB 4YHIA 3B9EA 4GG8B 3LRSA 4K3JL 4X4YA 1XGQA 3KLDA 1HWHB 4M3KB 1I1FA 3ARYA 4K3JH 1VGKA 1T83A 3GRWA 3RDTC 1UM6H 2IC2A 4IMLB 3U2SB 1FP5A 1SEQL 1HNFA 1U92B 1BFVL 1JV5B 2VLJD 4G9DA 2Q3AA 3WJJA 3V4UH 3ILQC 4HS6A 4JFZL 1AD9B 5DMGC 4OCSL 2FZ3A 3SDXA 1MH5B 1AXTL 4OUUB 3FRUB 3G6JF 4HX1B 1CFSA 5GHWL 4P5MA 1DR9A 2HWZH 2R2EA 2DI9A 4DOHB 4KQ4L 2FR4A 4Y4KC 1ZT7A 5E56A 4XPGH 3OXRA 4XMKH 4IIQC 5FHBH 5FECA 1YEKL 1DQLL 5DHYB 3FN0H 4A6YB 3EJZD 3MPCA 1NCCL 1XF1A 4PJ9C 1DEEB 5I19H 4MLSA 2R4SH 5JR1L 5E8PA 1E6OH 1I7ZB 4WW2F 1KCVL 4LPTA 4N8CL 1JGVH 1JK8A 1M7DA 1AH1A 2VDOL 4NQCE 2M1KA 1T7ZA 1S9WB 4J3WA 4M1GH 4MB3A 3BT2H 5EA0L 5TE6L 1PYWB 4QT5A 5HYSB 2BNRD 3W82A 1NCBL 5SV3A 4OKVB 1WWCA 4JHZA 1I9RL 2EDLA 4ONGL 2XY1A 1H3TA 4QHKI 5EC1A 3KPSA 2AW2A 4R90L 4WEMB 5BS0E 3KYAA 1KNOB 1FC1A 1IGJB 1AGFA 3MRLA 1P2CB 1UXSA 2A6KA 2OTWB 1T1WB 1BF8A 3L3IA 3FO9A 3S35L 1MNUL 4YEFA 5ICZB 4M00A 2DQJH 3HC3L 1MLCA 5D1QA 3JBG7 5B39B 2HJLB 4IS6B 4LAJH 4LAQL 3H42L 4X5WA 2NXYC 4PREA 1KIPB 4Z7VF 1I85C 1QFPA 4KTYA 4Q9RH 1C8PA 5SX5H 2J8OA 3O8XA 1QQDA 1CGXA 1PQZB 1ZLUK 1NCAL 4Y16A 3CSBA 4Y5VC 5B8CA 1IAII 2W59A 4LIQL 3GZKA 4GBXC 2JB6B 3TO4C 4WHCA 3MLVL 4HULB 1A4JB 3ZKXC 4LQ1A 4XWOD 1MCBA 5B4MD 4PJDF 4A6YA 4TUJA 43C9B 4AT6B 4LSVH 1CFQB 4URTB 4O2EB 1ND0B 5H8DA 4O5LH 2Y7QA 2BMKB 4POYA 5FOBB 3ZHLA 3NFNA 1RZKH 1CQYA 4N8CH 3OKYA 4PB9L 4J1UA 1FH5H 2OJZL 4PJBF 3WFDL 2LV4A 3DX9B 1GRWA 5KANG 1M6OA 4N0YH 5I6XB 5C86A 1RZIA 4OUUA 4OLZL 1OWWA 2JK5B 1UM5L 4FQJL 4HZLA 1ROWA 4XGZA 4EVNB 3E6FA 5DHXB 2HJLA 4IS6A 2FJGA 4KDTA 2YPLE 2EDXA 4HHAB 2QTEA 3FTGB 2BZDA 1JGLH 1ZANL 1CG9B 4KI5D 4YPGA 2PUQT 3DGCR 3EYVA 3CH1B 4KQ3H 3R8BB 4K9EC 3U30B 3HS0B 4PJ9B 5C0JB 4NJ9H 1JFQH 2EIEA 3RZCA 1CDIA 2AK4D 4G8FA 3VFWA 3WJLC 3K2MC 3CUPA 4WU7A 2BJMH 1BFVH 4NQCD 3H3PL 4HK0B 4NQDE 1KLFA 1MELA 3HAEB 1QQDB 4F2MB 4EEEA 3GMPA 4L3AA 3M45A 5IB3B 4ORZC 1F3DH 4OCRL 2PTTB 4QRPD 5EOQL 4BH8A 3AU1A 1JN6A 4NO0A 3KAAA 3QDAA 4V1DD 3OJDB 5F1NB 1VKXA 4LKCB 4TNVF 4MQSB 5E2WH 3ABZA 3SDYH 1H8NA 4JR9L 5TQ2H 6FABL 3NAAL 4LPWA 3I3EA 1MSPA 5DRNA 3PWPD 5CD3B 2EEDA 1KXVC 5HHNA 3QUZC 4KGJA 3DXAD 2BCKA 5C6PB 5B39A 1W0VA 4YEEA 4GAGL 1N6VA 1S7TB 3G6JA 1BX2B 4G3YL 3FQWB 1M71B 2EIDA 1MWAA 1F4WH 4FHBD 3U9UB 1HZHL 4Y88A 3LEYH 1A6VH 4JY4B 1NANI 1M05A 4LCYB 3MCKA 5IFHH 4BFIB 5TF0A 2NW3A 3TT3L 1FE8H 4ZD3L 2GUOA 2VXQL 2VN4A 1ED3A 1QSZA 2ZCLH 2UWEA 4DEPB 5HGBA 4X6EA 1JYVA 1QBAA 1DQQB 4U0RB 3MRPB 1MWAH 5HGGS 3WL9A 1BJ8A 5L9DL 3ELAT 4MYWB 2YRPA 3DVNA 4XPBL 2IH1A 4LCCB 5E95B 2RR3A 1IC4L 5E2JA 3B83A 3GMNA 2R69L 5A16B 1Y0LA 1I8MB 3SEPA 3P73A 2C3WA 1KF9B 2YA2A 2D7TL 5GS2H 3EJJX 4X9HA 3SGJA 5EIIA 3PABB 1CDUA 1EX0A 4OZFB 1JJUA 3PWPB 1MAKA 3O3EB 3VFWB 2VKWA 4R8WL 4OCWL 4LLVA 4XPHH 1NJ9A 5IMMB 3LHPL 1G7MA 3MA9H 4QHMA 1UA6H 2NY3B 2ZUSA 3NA4A 1DL7L 3O3BA 3QJFB 5F71A 3MV7A 2EDJA 2WWMD 1IAOA 3IJYB 5T33L 4U6VL 2VXSH 2H26A 1U8LA 1YY9C 3JWOH 4J3OC 2D31B 4Y5VB 5I76B 4BH7B 3QHFH 2NY6B 1FHGA 2Z35A 3DGGA 1HDMA 2D7MA 3KPRB 4RMRA 3QZWG 5IVXE 5HGAA 3ORJA 35C8H 3FO2A 1YJDC 2ENSA 3BUYB 2QV2A 5I1AB 4UQ3B 1JHKL 4P5TC 2DWEB 5EBWA 3EFFA 1F97A 2A1WH 4JM2A 4LSTH 4OF7A 4Z7UB 4U1NB 3S4SB 4PJHF 4HXBH 5BZDA 2R0KH 3BESR 2P7TA 3H3KA 4QHNB 1DN0B 3SDAC 2EICA 4PRPE 1JGUL 5DYOB 1DANT 1T4KB 4XCNB 3V6FA 3WYRA 1VGEL 4X9IA 1VDGA 1MCCA 5F6HJ 3X3GL 4YBLB 2QL1A 3QDJB 4M9PA 4OIIL 2Z0BA 4JDZA 4BZ1H 1RUKH 1FFRA 2FWOA 2OJEB 5E6IB 3UAJC 4BQ9A 1MIEH 5GQBA 5H37G 2YRZA 1AR2A 1YPZB 4WJ5A 2AV1B 4M6OL 2R23A 3H7LA 2D03L 2A83B 4TUOA 3BP6B 3G04A 2AXGA 1Z9MA 2WSKA 5I18H 5DD5L 5EIIB 3DMMA 5HGDB 1V7NH 1I75A 2HAZA 2ZPKH 3VGGA 4Z7NE 3TZVD 3QBTB 4NKOB 3WIHL 3LPGA 1Z3GL 3HG1A 4IMKC 4GG6F 2HRPL 1U91B 1MHCA 3IFPA 4LMQI 3ARBC 5EUKB 1NBVL 1T3FB 4OSUH 3QIWC 3OKLA 2ICWJ 2CKBA 1JVKA 5HDQH 1INQB 3Q3GA 2UV3A 4LVOB 5I66B 3ES6B 4FP8L 4L3EE 4KXZI 4XP6L 3H9ZA 3OPZL 3VXOA 4OGYH 4RBPH 1ULVA 3BQUC 4PP1D 4FG6C 1AO7A 1OF2A 3EYFB 4N0RA 3GSRA 4GMTH 5T3XH 3GJEA 5TDPA 3RNKB 3RP1A 4JDVA 2PO6A 5JW5A 4MJ5A 4BSVB 3PXHA 1YZZA 1ZHBB 3B4NA 1VADB 2F53E 5F6IB 5BZDB 3PGCA 1YECL 3QULB 4IHOB 2R29L 3QDJD 1BZ7B 2YD5A 3TCLA 1L0XA 4OF6A 1CL7L 1GPOH 4OV5B 1YC7A 3QPXH 1X7QA 1F8TL 1A7QH 3OG4B 2BFVH 4N5EC 2ZUUA 1T1XB 1HDMB 1GHFH 1CIUA 2NY7L 2D3VA 1ZHNA 2P49B 1SQ2N 1BAFH 4XHJC 5L0QB 4X6CF 3H2WA 1TTGA 3CFDA 3MNZA 2R23B 5EO0A 3OBAA 2VIRA 5GISH 5GSVA 4OI8A 4Z7UA 2YPKB 3QWRA 2GJZA 5DO2C 5DUPL 5BW7A 5L8JB 3QNXA 1QSFA 3DO7B 1U93B 4U3CA 4W4OC 1IM3B 3LD8C 3FQUB 3GSNH 3MLRH 5KG9B 2IQAA 1LO2L 3CVHH 3NABH 4YE4H 4YDLC 5LWYL 3I3BA 4MQ7B 1HKLH 3TF7C 5D7SH 4H0IA 1KELL 3MRMB 3IU4L 4G9FD 3WS3A 3TN0A 1T4KA 3OKMA 3KPNA 2AK1H 4MGXA 1N3NA 1B9ZA 1CDBA 3C09C 3SDXB 4HUWB 4M7LT 3WFBL 3NPSC 5F9OL 4KXZH 5D5ME 5H94B 5H37H 1NBQA 2H1PL 1P1ZA 1R0AH 5FF6A 3QPQC 2RIKA 5CJ8A 5DQ9B 3V6OC 4NO0D 4WU5A 5ESQB 1A5FL 4YHNB 1CK0H 2VLLB 4HLJA 4W81A 3LKRA 3WXWH 1RZFH 3KYNB 1G1CA 3UO1H 5IHUH 5A43C 4Z7QE 5I9QC 1RJLB 2P5WE 3ILPB 4GRWB 3O4OC 1J0ZA 3EJYD 4YUEH 5EO0B 3P4OA 4UBDD 3P9MB 1KCSH 2ARWA 1M7DB 5J1SC 2GW5A 2VC2H 3MRBA 2JTDA 1J86A 1NGPH 3VDAA 4UT7H 3T2NH 5JXAL 2K1MA 4Y4HC 5M7QA 4LP5A 4X7SL 4RGOH 5L2KD 3NFPA 2VDNL 2YPLA 1XGRA 4PGCB 3D25A 3HUJA 5J9PA 2RBLA 3KS0H 5T5FL 4CADB 2J88H 2DM4A 2BSSA 3FHAA 5HDBE 4TULL 1B0GA 1OP3K 4WCYH 2R4RH 1IC7H 3T1FB 4GAJH 4MLIA 5KSBE 4PJEA 5FCUH 1YDPB 3U0TB 2EH7L 4UT9L 3VXPB 2X4TA 2CKBH 4MAYB 4NWUL 4UV7H 5FIEA 4HC1L 5DJ0A 5KJRL 3FAXA 1S9YA 4HLZH 5GGUA 4ERSL 1X4XA 3LIZH 5EZJB 2DIJA 4TN9A 3O0RL 2VRAA 3QDHA 4P23B 1BQSA 3ZLQC 5DMJB 5EU6E 4GBXD 3TO4D 3LRHA 3QHTC 3NCCB 3P9MA 1WIOA 1QRND 4X6DB 3TZVC 3ZKQD 5C3LD 3L3DB 3PL6B 3KDMA 5EULV 4MCYB 1R5WA 4OZFH 5DD0H 5EOCL 1SY6L 4HUVB 4X6FB 1A14H 5D2LB 1BVLA 2VDQL 5EZIL 4UIKH 4OUOA 1F90H 3A6CL 4LFHD 5E00B 1GCFA 4FFVD 4RNRB 43CAA 4JPIA 5I1CH 1I8LC 1KPUA 4HH9A 1YNLL 5IEKA 1JCKA 2B2XH 3QIBC 4P2YA 2DQIL 5F88A 2A9NL 3W39A 1KCRH 3OAUL 2BNRB 3NCBB 2MSPA 4KVCL 4ZODA 3MUJA 4U1LA 4R0LA 1OAZH 3SGKC 2FLRT 5E8NB 2FJGB 4QHUA 3TIDB 1B0RA 4PPTA 4YPGB 1R3JA 1FL6A 4NHUA 1I8IB 5KBNC 5D7LD 4NNPL 2AVGA 2IANA 3MUY1 4HKXA 1A9EB 1WBXB 3GKWH 4HXAL 3OGCB 2UVFA 3LPFA 3KLAB 3M17B 3TESA 3C5SB 2CXGA 2OL3H 2GTZA 3O3AA 4ZAKD 15C8H 4KK6D 4X7SH 1CLCA 5B3JE 4Z7WF 1FN4B 1T66D 3ZL4L 5JXAH 1KCUH 5J56B 3PQYD 2EXWD 2OI9C 4LCUB 3NFNB 4GG6A 2BRRH 2CR6A 1FVCA 3ZTNH 4PV9B 3MCG1 5CLTA 5FYLE 4OZIF 3MV9B 3C2AH 4FOMA 3DVGA 3NZ8B 3HUJB 5J9PB 1N5YH 4HS3A 4LCWB 3G5YA 1FZOB 2BSED 5IHUL 2NY1C 1RJZA 5INDA 1BREA 5EBMA 3JV5A 1CFTA 4MXVF 4YXLL 1I1AA 2Q76A 2UZIH 3BYYA 1U2CA 1UADC 3QXAB 4GS7C 5GS0H 3FT4A 2VL5A 2DDQH 2WWKO 2XZQH 3KYKL 1E4KC 2H2SD 1T5XB 5FYJL 2YUWA 2ADIA 2IFFH 1ITBB 1RZKC 1OT2A 5E8NA 3WFBH 4ZPTB 3LQAH 3ZDYF 3WJLA 4BFIA 3EIFA 4HZLB 3G5XA 3K80A 3SCMD 4X0KB 1DBJH 1JTTA 4TTGA 1JGEB 1P4LA 3T0EC 1EPFA 4EI5C 2JCCB 5KOMC 1K9TA 4LP4A 2X89D 3FQWA 2XT1B 1IGCH 5IQ9B 4TVPE 2P5ED 4PV8B 1AGEB 2JIXB 4MNHA 3T65A 1ZK9A 1QNZH 1OAYL 1IC5H 4FXLA 4KGLA 1UZ6F 2HT2C 4UTBH 3RU8L 4Y2DA 5DJ0B 2NY3C 5F70A 4X6CA 3STLB 4RGNC 5HDOA 1LO3H 3RBSA 4J12A 1CS6A 1ZWIA 2KBGA 1U36A 3IGAB 3UROR 3O2VL 4D9QE 4MJ2A 3IDMA 3QSKB 5ANMB 4H26A 2VERN 1EFXA 3QI9A 5KS9B 1DDHA 5J6HB 2W9EL 3G5VB 1YQVL 2NY7H 2UVEA 4HCRH 3CJJA 3VXQA 4JAMB 1IE5A 5F89B 4HUXA 4NNYA 3LDBB 4P0DA 1GOHA 1Y6KR 1ZLSH 4GSDH 3WHXA 1QKZL 4F8QA 1RIHL 2X70A 3MYJB 2G9HA 4POUB 2NLJA 3HRZB 2F9BT 2IH1B 4LCCA 3O6MH 2BP3A 4Z0XB 2BSSB 4CGTA 1P6FA 3EOTH 4C56E 3QI9D 3FB8B 1Z5LA 1FN4A 2GAZB 4PJFF 1MPAL 2ZUYA 5T3XL 3KPTA 3IKKA 1JHLL 3MRHB 2DM2A 5EOTB 3EZJB 2H41A 5E1AA 1C5CH 4FP8H 3QUMB 3GBNH 1LNUA 5SWSD 3VFTB 5HDLA 3C6LD 3P9LA 1E4WH 5C07A 4G43A 1ZWIB 5HDQL 2P4AB 3SKJH 4PRIA 4G8GE 2NY5L 2F15A 2Y5TA 4MAYA 5GRUL 3LMJL 2V2XB 3RTQA 3WLBB 1IMHC 4TTDC 3NMEA 5HI4D 5J1AA 5J11B 1XF5A 5GRXG 3GM8A 4NZTL 4OZHE 5T3ZL 5HPMA 3V5HA 4Z7OE 2RJMA 4XH2B 2K7PA 3VXSE 4JGUA 4M03A 4L4VA 4XMPL 4YFDB 1UWXK 3LN4A 4IBLT 5I1AA 2D7OA 2X09A 5CSBA 2AGJL 1NBZA 3JTTA 5E7BA 5ISZA 5IGXL 1UB5B 4JFYB 1MHCB 2VXUH 1QSED 1DBAH 4HJ0C 3MV9D 3FKUS 1MIEL 2EEAA 3SDAA 2I07B 5AD0A 3QQ4B 3BDXA 3O9WA 4WY7L 2GEEA 3BH8A 2R2BA 5SWQB 4HWBA 5H35B 1EK3A 1KPRA 4NRYB 2AJVL 4BZ1L 4YH6A 3W2DH 3SBWA 1X5FA 3ARFB 3BHBB 2VZVA 4UMGA 3QUZD 3UTTE 1OQOA 3X3GH 5TE4L 1S7VB 4APQA 3S9DB 3H7BA 4RDQG 1DQDH 1GGIH 1MHHA 1TTFA 3NIFE 3EUUA 3RWIB 5K9JH 1TETH 2WLYA 4EN3C 1BEYH 1NMBH 2ATKA 5C08E 2ERJB 5C0ND 3E3QE 1MHPH 1MUJA 1OAQL 4ODBD 4Z0BL 4BSVA 4C57C 3TA3C 4U1HB 4Y8DC 1RK0A 4X99A 1CCZA 2Y9RT 1OGTA 4Y19B 1FL6B 2FGZA 3EYFA 4JQXA 1I1YB 4G43B 2BSTB 3JSSA 1Z0MA 2R8SL 1G7LA 3MFGB 4OT1L 4QRUB 5LGHH 4WY7H 2I60L 2QQQA 4JO3H 3JV4A 2WWMC 3GJFB 3U4BL 3TCLB 4PBXA 4BUGA 4TOYH 3EOYG 4HQQH 4ONHA 4MD4A 1ZLWK 5F96H 1MCLA 4HF5L 2X4PB 4U6VH 5GJSL 2DQEH 4HGKC 4UAOC 1XF4A 3VRIB 3W9DA 4XMPH 5FOBA 3I6GA 4ZTPH 4MA8H 2W60A 3HE7C 2E9BA 3NA9H 4N5ED 2NLJB 5IW3A 3PWPE 1U9KA 2ZOKA 4RAVA 4E41A 4ODVH 2W9LA 4LKXA 2ZP0T 4K8RC 1AO7B 1OF2B 1JNLL 1MAMH 3HPJB 2UYLA 5JOFB 4QY8A 2J7LA 4O4YH 3GBNL 1IC4H 1T22A 2VITA 1WZKA 5IV2A 1KPVA 2QR0B 3SCMC 5GS3A 4ZFOA 5TGBA 5BMFL 1MWAL 3QEUB 5AD0B 2XXMB 1EUUA 4JB9L 3SKNB 4NQDD 4G8EB 1ZXQA 3CH1A 3TV3H 1FLRH 5IB1A 1NGYA 3EOTL 1ETZB 1FIGH 2EE3A 4Q2ZB 3BI9X 3WMSA 1BFTA 5IP4A 5CHNB 2HTLC 1A6VL 1HZHH 3ARTA 1IJ9A 3GMMA 4XH2A 3THML 1LD9B 1FSKC 4WUUE 5GGSY 5IVZB 3RUGE 3VXRE 4B53A 3WUZA 3JWNC 4QWWD 4XC1H 1FG2B 1G7JA 5J12B 1T89C 1A4KB 3BZ4A 4KKNA 2P46B 3MRGB 5TQ2L 2PYFB 4JR9H 5DRXA 4P46B 2B39A 1W72L 4M3JA 4ONOA 3TM6A 1IM3A 3OKDA 4I8DA 3VA2C 3CVIH 3D3VD 1WAAA 5KVFH 4GRLC 2OTPA 3ZZ1A 5SWZD 3KJ4C 5I1HL 2OK0H 2Y07H 2OMNA 1IAIM 1OGAD 2BDNH 2C3XA 3WS6C 2HVKA 2DBLL 4CVUA 1G7PB 4PRPB 3H3PH 12E8L 3OQ3B 3U0WL 3UTZB 3U9UA 4O58L 2WAHA 2CIKA 3D39D 5C0CE 1CR9L 2UZYB 2UUDK 3ARFA 1ND0A 5DMGD 5KSAC 2RCSL 4UTBL 1N4XH 2JB5L 4HS8L 3HI1B 3D39B 2PXYB 1QNZL 3WHXB 1WUNT 4ZOEA 2V2WB 1NGQL 4Q9CA 3OV6A 4M43L 4KJYA 5JORB 2ATKB 4AENA 1R3HA 4WW2B 1CD0A 1SJVA 2NY4D 4XVTH 3EFFB 3WIFA 2DQFA 4WHDA 5K9KB 1JZ4A 5DFTA 2B20A 4H25A 1DBJL 4E41E 3DVNB 4GO6B 4TSAH 2P8MA 1T1ZB 1TVHB 4ZNCD 3AVEA 4FQJH 2IFFL 2ZJSH 3KYMA 1AXSB 5DQJA 3RZCB 1A6TB 3P73B 5IB1B 3MCLL 4N0YL 3O8XB 4N9GA 3WFHA 2DDQL 4OZGB 3IT8D 2Z31D 4OTXL 3RZCD 3GSWA 3GUTA 1YNKL 5DQ9A 3VGAB 1FLTX 2D7PA 4RAVB 4P2RB 4ODHH 1FYTB 4DVRH 5DZOA 4P46A 5E2UH 1UACL 1KFAH 2IF7A 4M8QA 2WWKT 2DLHA 3DSNA 2FECI 2D0FA 1SY6A 4ORGA 1XF4B 1XZ0A 4KTEL 3VRIA 2E5EA 4LBEB 3BZEA 5GRYA 1UH3A 1A4KA 2AV1A 2Y6SC 4UB0L 3WEXA 1LK3H 2CMRH 2VLKA 5DRWA 4PLOB 5GGUB 4M8VA 4BQ6A 4B0MM 4NO0B 2AXJA 2APBA 5H2BB 1IEBA 3WDJA 4Y4KA 4XCYA 4NYLB 3L95B 3O8XC 1YYLL 5HTSA 2VUOA 4XPAH 4RNRA 3RVWC 15C8L 5D7KE 1JZ6A 4PJGA 1O5DT 4NSKA 1ES0A 3KPMA 5F9AC 4NO2B 4Q9RL 1CQKA 1BFSA 1FNLA 2DQFB 1D9KB 2PCPA 5K9KA 5CWSA 5ICXB 3VW3H 3H9SB 2X9XA 3MOQA 2F5AL 2YSSA 3GBMH 4S1SL 5C70A 2PXYA 3CH8A 3QO1A 2HT3C 1TLKA 2OR7A 3DTXB 2OJEA 4P5MB 3BKYL 3QCUL 2DIAA 3LEVL 4MJ5B 4H1LH 3C08L 4P2OD 3C9NB 3RHWK 1I7UB 4JY5L 4KZDL 1K4CA 5L88H 4R90H 5CBAA 5E6ZA 1U41A 3A6CH 2DQHL 1MVFA 4WU7B 1CE6B 4UIKL 2X4NB 5EZIH 1IKNA 5EZJA 1JRHL 4LLWB 1OSZA 4KKAD 4ONHB 1J7VR 3C5SA 5DVMA 3ZYZA 3S36L 1IM9D 3FCTB 3B9KB 1V3LA 3OKDB 1F6AB 5I74C 1AFVL 3O9WD 4BA8A 3QUKB 1KIRB 1NCWL 3HI1A 4M7KH 2R56H 3IU3A 1TQBB 1DE4B 4JY6A 1VFBB 1HOCB 1QEWA 1JGVL 4R4NC 3LIZL 1CIDA 3LKNB 5FUZL 2V9QA 5JA8B 5I19L 1RULH 1H3WM 5HHNB 1RZGA 2NQCA 3N50A 5FYLD 3GJFH 3O3BB 1T1ZA 3QJFA 1TVHA 3RY4A 3QUYA 5EBWB 3GSUB 3MRKB 4XNZB 3WIFB 3EW3B 3MCKB 5J8OA 1KLUB 2EH8H 4XXCA 1KTRL 1IM9A 3QEUA 4LOUC 5JMRA 5EU4A 4YC2B 1SJEA 4WHTA 1T6WA 4JZNA 1I3GL 3BKCH 3RI5K 1AXTH 1AXSA 3FO9B 5ICZA 4M93B 4UQ2B 3N1QC 5DHVB 1DBBH 5D1QB 2JB6A 4PJ8D 5GPRA 4BM7A 5DRWB 5KSBB 2Q8BH 1WSST 5E8PB 4LVHB 5BVPH 2E7LA 3HLAA 1P4IL 3VG0H 5C7XH 4LLWA 1K2DA 1FZOA 1TVBB 3ALPA 3ECBA 5JQ6H 4FQ2L 5IK3A 4KRMB 5GGVL 3MV9A 1VEMA 2AXHA 3LKRB 4M6AA 4HPOL 4QT5B 1A4JA 3C5JB 1BBJB 1QFHA 5IOPA 5FM4A 4LVEA 4LDOB 1RIVH 1FYHB 4PY7A 1WBYB 3MV7D 1YPZE 2Y5EA 3DO7A 3B2VL 5IM7B 4D8PB 4DKDC 2WQRA 4OF5A 1MCIA 2DTML 1AGFB 1T80A 3HCVA 1X5LA 4CU8A 3FO2B 3FFDA 1R0AL 2H1PH 3O6FB 3BN9C 1KIQA 1G9EA 2WNGA 4X9FA 1XGRB 2NY4C 2V5YA 1LEGA 3DO3A 4JG1L 4YFEA 1XIWA 1UXWB 2LVEA 4L9LA 1T66C 1TJGH 5GSRA 2VZUA 3DTXA 3VGEA 3MRHA 5IKCB 1DQML 4TSBL 2NY1B 5DYOA 1T0MB 3VWJC 4G8FB 1JTPA 1CD8A 2O61A 5LWYH 1OWRM 2IAMB 4LNRA 1D3CA 3QI9C 1K4CB 4K9EL 4N1HB 3MRQA 3PHSA 5AUMB 1SJEB 3WXVH 4JDZB 3EYVB 4Z8FL 4JREC 3UTSE 2KL6A 1D5XB 5KS9A 1DBMH 2VXVH 5E6IA 4HD9A 5LGKA 2V2XA 4RA0C 1PEZA 2A9MH 2QSTA 4KROB 4L8DA 4OV5A 4PTTB 4UV4L 4DGYL 3RBGA 1FYTA 4YHKH 3P9LB 3TH2T 4CJ0A 1EHNA 1A3RH 3BSZL 1EEZA 4P23A 2XWTA 4G42A 2FYYA 3U1SH 1A7QL 1XF5B 4ISVA 4Z76B 1T03L 4O2CB 3SDAB 4R3SA 1AE6H 1P84J 5EUKA 4QCIB 4WDIA 4Q0XH 4Z95L 2YPVL 2P5WD 4IEFB 1D6EB 3AREC 3GHEH 1LO0H 1LO5B 4M7LH 5AWNH 4HZAA 3OTTA 5K9QI 5JW4N 1RUPH 4JEGB 1BJMA 4JGJA 3MV8E 4PJEF 1DVFC 1BP3B 4XBPB 1K3ZA 2FO4A 4CUCA 1SHMA 5F88B 3MRMA 5F7YC 3O2WL 1J8HE 4PB0H 3VFPB 3IJSB 4GMTL 5C0DB 4KV5E 4PJAB 3QUXA 4QXGH 4WGVB 4OGYL 2DOCA 3DJ9A 2IBBA 1L7TL 1V3JA 5D7JD 3AMLA 5GSRB 1II4E 4G9FE 4HK0A 3TBSB 4YXHL 4DW2L 3MV01 2VLKD 5DSCA 4Y5YC 2HRPH 5C09E 2IAMA 1RJYB 4X6DA 4DVBB 2E27H 4OLWH 4NM8L 5SWSB 5HPMB 3MRDA 5JW4M 5F3HB 3V5HB 1V7NL 5T3ZE 4OD1L 4ZXBA 3UC0H 5DJXB 1VEOA 4YHLH 5I73C 3RNQB 3ARSA 2FX7L 2E27L 4NC1C 1R5VA 4M6OH 4LKXB 4DZ8B 1D5MA 4YGAB 1UB5A 2F53D 4HLZG 3RIFF 3SO3B 4OFPA 1W0VB 5A2IH 3G6AA 4NQXB 3T3ME 5HHMD 1M71A 5J3HC 5I8OL 3O2DL 4PLNC 1T7YA 2DMCA 5GS1C 4NNXA 1RUKL 4I5BA 4Z18A 2IQAB 4XBPA 1H15A 4U1NA 3S4SA 3VFVA 2X4QA 4MS8C 1T2QH 2HLAB 4N8VG 2VDKH 1ED3B 1MFCH 1J8KA 1JGUH 3UTSB 3A6OA 3MUGA 1UXWA 4L9LB 3VG9C 1EHLL 3IJHB 2BVTA 4ZOAA 4DKAA 1YEHH 5EZOH 1SBBA 3D0VB 2N7AA 4X99B 1MJUL 2ICEB 3VD5A 4P46D 5TGBB 3K2UL 4PR5B 4WHTB 3NCMA 3GMNB 4C56B 3LQZA 1KGCE 2PN5A 5A3ID 4JN2B 5E08L 5ACZA 3I6GB 3AY4A 2CO7B 5HJ3B 3AROA 4P2QD 3ULUD 4KI5C 5GXBB 2ZG2A 5I16A 2EDRA 2WUBH 3A6BL 5TPWL 3IVKB 3QHFL 2DRUA 1XGPB 2XOTA 1NJ9B 3U1SL 4K7PL 1QPPA 2O93L 3NZ8A 1T0NA 3V5KB 4WUUA 3BP4A 2ZG1A 1MFEL 4HIHB 2W60B 3VU2A 1S5HA 1BD2E 1UA6L 4XCCH 1AC0A 5CCKH 4GKSB 4KROD 1F11A 2L0DA 1HHHA 1IRAY 3H9YA 5IJKA 2CRMA 3L6FB 2G75B 4MSWB 4O9HL 5A2KH 1QOKA 5TFSL 2D7TH 2SEBB 4H88H 5DO2D 4NNXB 5CJXA 3IJSA 5F7EH 4JGMA 5KVGL 3RWFB 1XGQB 1GIGL 4LASH 5D7IE 3P11L 5C0AA 3VXOB 4DN4L 2Q87A 3MJ7B 1OM3L 4LLMA 2R2HA 4XPBH 1G9NH 5L9DH 5T1KB 5CHNA 3QJHA 2JCCA 4OI9A 2CKBB 4P3WA 3MYJA 1TJGL 3VI3F 3OKNA 4NZRH 5E00A 1CF8H 4OLYL 1F4YH 5CSZB 4QGYA 1WCBA 1FE8L 3TT3H 3W11D 1PY4A 3F5WB 3BZ4B 3HNSL 4Y2DB 3P11H 1GIGH 4LASL 5D2NA 5KVGH 5JXEA 4H8WC 1Z5LB 1SYSB 2YD6A 4LLDA 4Y4HA 4G3YH 3MLWL 3TVMA 4DFHA 3BGFB 3QCTL 5C92A 5HHQB 2Q20A 5JPNB 4WJ5B 1G6RH 3KNBB 3B2VH 3BYTA 3HG1B 4ZUTB 1K8IA 1S7RB 3NAAH 1JZ3A 3RX7A 4RMSA 4X6DE 5FECB 4Z9KB 2Z31C 4F7CB 1OTSC 3SE3A 3HN3A 4X4ZA 2VDPL 5F44A 5EU7E 5LXGH 4JAMA 1DFBL 4XNQA 5GGVH 1VGKB 1KJ2A 5IJVA 1MFAH 5L6YH 4PGEB 5DUMH 4KK5D 1KEGH 4XNMA 2DQDH 4H1LG 3DV4A 4P2CG 4D0CB 3U0PA 2AEPH 3T3PE 2Q8BL 5AAMA 3RKPA 2EIZA 1UC6A 4JFYA 1PD6A 2QSQA 1EEQA 4PJCB 4D0BA 5DK0A 1RU9H 1FNGA 2FBJH 3Q1SH 1YY9D 4GW5A 5DQDH 1ZA6B 1I3GH 2ADIB 4MQXD 1A02N 4JDVB 5EIVA 1D5IH 1BZ7A 3N1MC 3NN8B 1GZPB 3AS2A 4D3CH 5C8JB 3O81A 5IF0A 1HYRC 5EOTA 4LLMB 3IDJB 4LF3A 3X11B 1ZLUH 5I8OH 1ZTXH 3GNML 1A9EA 3RL2A 3UYOD 3D5OF 5E1HB 1ADQL 1IQWL 3WFZA 1BJ1J 4AQ1B 3G5XB 4BKLA 3CFDB 1RULL 1HEZB 3WFDH 3CVHB 1S7RA 2EDHA 3ARDB 4EIZC 2BVYA 2FEDC 5CGYD 2WIMA 5E9DE 5ADOH 1I85A 3PDOB 2WBJD 1OD9A 4LCUA 4O5LL 3RUGB 3VXRB 1KTLB 4R9HA 4FQPA 4NM8H 5HHQA 4OKDA 1IVLA 5D6CB 1Q38A 4R2GC 4U1GC 3K8MA 5DD3H 1HXMA 4PJGB 4N0FA 4JRXA 3DRTA 3NGBB 3B8YA 3ZE2F 1MRDL 3IGAA 4AEIH 1D9KC 1HE7A 1RJZB 3AAZB 5INDB 5J3HD 4PJCA 2XXCB 1D5MB 5I0DA 1U8OB 4QXGL 4ONFL 3V4VL 3G6AB 1KACB 4GRLD 2GFBB 4P59L 4WUKL 3TGXA 4DQOL 1Q0XL 1H8OA 3C08H 4FXGA 1UXSB 3QJHB 1SYSA 1D5ZB 4JFFE 1NEZG 4NO2A 4XBGB 5CEXB 5LQBL 4TNVK 4G6JL 3U4EA 1TMCB 4G6MH 2HH0H 3CFIC 3D69B 4ZFOL 2F5AH 2X4QB 1JHTA 2FIKB 3TZVA 3BPOC 5I71C 4I2XA 1RUPL 5HHVH 2DJUA 3GHEL 4M7LL 3TYFB 1G9MC 1NC4D 1C7TA 2VDMH 4NIKB 3IDNB 4N0UA 5KTEH 2IEPA 2YEZA 5DK2A 5TDNA 1AE6L 3GIZL 1KV3A 3MC0A 2LU7A 5FB8B 3QUMA 4NFCA 1PLGH 1FCGA 1SJHA 2E9JA 4OCLC 4ZUTA 1KJ2B 3O4LD 4F2MA 4ONGH 4N5UA 3I3DA 2VISB 2AEWA 3W5MA 4ACPA 4UQ2A 3F58L 2ITDB 3U7YL 4P3DB 1U8IA 4FZEH 1CFNB 3S34L 1HCVA 4YHKL 3AU1B 3CFKA 1BZQK 5EA0H 3QXWA 1N0XL 1BOYA 3VXNB 1WQVT 3RAJL 4Z7UF 2VDOH 2LABA 1MREL 1VFBA 3S88H 1NC4A 1OGAE 1KCVH 4ODHL 3C6LC 3PHQA 2PYED 5HD8D 4EUPH 2NX5A 2OP4L 3KPPA 5I8EA 3K0WA 3BIBX 3IDJA 4WHYG 1TVDA 3MCLH 3BPCB 4YBQC 3RWFA 4PGBB 3W0WD 2CD0A 2VSCA 3NN8A 4KQ4H 2CUHA 2APWA 4BFEA 3QXTA 1AD9A 1VCAA 4NHUB 3ZT6A 3FMGH 4HDIB 5IIEA 4JREB 3LKSB 4NBYB 5CINL 3WL9B 1RSFA 5L2KE 3UTPD 4F58L 3QRFM 3TIDA 5I1JH 2NY3D 1MI5B 4OD2A 1V8HA 3BPOB 5I71B 4NCC1 4O58H 2LAAA 5FOJA 1MI5D 3UYRL 1R24B 1QR1B 3PABA 5IMOA 1YA5A 3GSQA 1FSKB 3FOLB 4TRPH 2C4XA 3GHBH 4P2RA 2PTTA 2D7NA 3G6DL 3IFLH 4HS3B 3L3DA 5JQ6L 2Z9TA 4M48L 1S9WA 1NDMB 2CK2A 5DDHB 3T8XA 4NUGL 2Q76B 1ZVSA 4R26H 1IEBB 2BVUA 4L9LC 5TQ0L 3NACH 3L9RB 1EGJH 1NH6A 4JPVH 2PYEB 1MH5A 2I07A 3FRUA 4G42B 1WFOA 1P4BL 4XCEA 5B3JF 5LJYH 3Q6GH 2BVQB 5AYUL 1VSCA 2XNAB 4HMCA 4NHCL 3SO5A 1LEGB 5D4QA 1IKFH 4WEUD 2ADFL 3SE9L 4QYOB 3BUTA 2UYLB 1X4ZA 4JQIL 3TYFA 4RISH 2YZ8A 4QNPF 5FM5M 2DF3A 1ORSB 1A6TA 4NT6B 4ZG1A 1PKQE 3O3UN 2AKRA 4X80H 4QRTB 4FABH 3PIQB 4JFDA 2GTZB 3O3AB 4O4YL 2AAVA 3L3OA 3STZA 3GMMB 1HQ4B 4WUUD 1I1YA 3AGVA 3FFCD 1AP2B 5EU5A 3E6HB 5E4EC 2DL9A 4YHML 1NC4B 3W9EA 4QXWA 4PTTA 2F19H 3QAZC 2ZUWA 1OARH 4MQTB 4Y19D 3X3FH 3S36H 3NA9L 4IRSB 3AB0B 3VXNA 4EN3A 2GITB 1TTUA 5IMOB 3MOBL 4NGHH 4D94A 2KUTA 4EUPB 1YPZA 1INDH 5AZ2H 3GI8L 5F89A 4MVBD 2HTLD 3O2DA 4JFOB 3MLZL 3ARPA 4GH7B 4ZQKB 1MJ8H 4KZDH 1K5NB 1C08B 5FA3A 3KJ6H 4MNQB 3GO1L 1NAKH 5IVNA 4ZS7H 4QRRA 4JY6B 5E9DA 4QCIA 5HGDA 3MRIB 3BKYH 3LKSA 3QCUH 4NO5A 1F4HA 3PWVA 3N1FC 4RX4A 4PJXE 4K3DH 2ADGB 1JTOA 2FO4B 4UTAH 4AL8L 3KPLB 2GT9B 1INQA 3Q3GB 3QIWA 2FEEL 2OS7A 4EN3D 2C7UB 3U4EB 3ZE1E 1CVRA 4NCC2 1EEYA 1DQDL 2VZ1A 4X5LA 5C9JA 3QIBD 1QUNA 5F8QC 4E5XB 5EWIL 3KR3H 1H9VA 3P0GB 1NLBL 1E28B 1Q72H 3BQUA 1TJIL 4FTVB 2BVOA 3RNKA 4PJIF 2MQCA 4J3TA 1AD0A 3L5XL 2H6PB 4OJFL 3PWNB 2VH5L 1W72B 4PRHA 2X5PA 4KK9D 3F65A 1OSZB 1X44A 3WKML 1RPQA 1BPVA 1A1NB 1OAUL 1GGTA 1AR1D 4JCLA 1MCEA 5HHPB 4PJCF 1JGDA 3ZO0A 3KG5A 5CEZL 4NN5C 1MQKH 5JW4R 2I24N 4EXKA 4DVRL 4HEPG 1I7ZA 4DOHE 4IRSA 4WI5A 4MXQC 4X7TB 3SGDI 2A0LD 4FQHB 3Q2CA 5EIQA 4NQTA 3SJVA 5HSFA 2CGRH 3T1WA 4XP5H 4F37F 4KROC 2ZJSL 2IH3B 2DM3A 3ALXA 5ISZB 4F9PA 3PWUB 1FZJA 1QBLL 1AI1L 1VACA 3SQBA 4LHQB 4KJWC 5JIPA 1ACYL 2A6IB 2W92A 4S1QH 3JTSA 1KPRB 2MMXA 4LSUH 3R06B 3AM8A 5EC1B 5ABDE 2FHFA 3WLBA 1L7IH 1N4XL 3RVVC 4X7CC 2VXTL 4QF1A 1MFBL 4EDXA 5JHDE 5HVGB 4IRZL 4AY0A 5EN2B 3U0WH 1RIHH 2XPGB 2W65A 5D6DC 4GRMB 4UT6H 2Y07L 4I0PD 5I1HH 2D9QB 1CICC 4MAUL 2UY6A 1L6XA 5C9JB 4OFYD 3TN0C 1SEBA 1X5IA 3ARFC 4GW1A 2YD2A 3LVEA 1YMMD 4PJ7B 1OY3B 2P1YA 2MPAH 1JPGB 3UYPA 4TVPH 2YK1L 3MJ8A 2HFGH 1WVZA 1LE9B 3Q0HA 2GY7B 2R2BB 3HMXL 5SWQA 3P30H 3GSOB 3B9KA 3MREA 4PG2A 4KKLC 4JFOA 5DEGA 3MRBB 5KS9F 4X6CE 32C2B 1JP5A 2XTLA 2VZOA 1EMTH 3D2UA 2J2ZA 1H5BB 1U8LB 3SGEH 2VABA 3DVFA 2A6DB 3QWOA 4NCDA 1VACB 2HKFH 2BY2A 5IHZB 4D9LL 5F7DB 3WFCL 4YHPA 5DMKB 1FIGL 2NW3B 1OP3H 3V7AG 2Y7QB 4P46C 1DE4A 1GC1L 1AGBA 3LKNA 4MA7L 3TBVB 5DFWH 1AXIB 5BMFH 4YFLI 3C8KA 3NOIA 3F62A 4IRJD 2VSDA 3C5ZD 1N5AB 4GAYB 3TT1L 1M6OB 4PGJA 4MD4B 4AEHL 4HWBL 1O0VA 5CZXD 3QCVL 1C7SA 1ORSA 5HHPA 1ZA3B 1MAML 2PXYD 3QISA 4LLDB 2DS4A 1JNLH 8FABA 3VH8G 3HC0A 1HHJA 1A6ZB 4CMHC 4BZ2L 3V2AR 3HUJE 3QWRD 2ORBL 2B0SH 4MA8L 3T0DA 4ALAL 2OX5A 3D85D 3IFNH 3RPKA 1N5YL 4PGZA 4PJXF 4P4KB 2NNAB 4GG6E 2D31A 1QZ1A 4HQQL 2R39A 4HKJB 4IMLA 3DSFH 1I3UA 3ZTNL 4ZFOB 4UU9B 4LSPL 5DJXA 2YHGA 2FATL 1NPUA 3QR2A 1G7PA 2I60H 4PRPA 2DLTA 3BUYA 3WDIA 5LGHL 3EO1B 1KTLA 2MWCA 4KVNH 4F33A 3AMKA 1TPXC 1CU4L 5CP3H 3ARUA 4YHOL 2YPLB 1JN6B 2OL3L 3LB6D 3MJ6A 3SOBL 4XXDA 1X5JA 3MRIA 3GKWL 3QQ3A 4R0LB 3A67L 3F7YB 2BC4B 5BQ7B 1JV5A 5D7JC 4AL8H 5FA4A 2YA0A 2J8UA 3VE0A 3RJDA 1H15B 4GW1B 4K3DL 4U1KB 3O41B 4NRZA 5CKGA 3H9SD 2AJVH 3OF6A 1XIWD 3OGCA 3SQOH 2A9NH 4LCYA 1LD9A 2DQIH 1MCPH 3GO1H 4Y4FC 3MLYH 1ZHBA 3KJ6L 1VADA 5DJDB 1FV1B 4U4BA 3F7VB 4QNPE 4K7PX 1MRFH 3MRGA 1F90L 2L4OA 2VDQH 3S3JA 1DQQA 3WSQL 2EKSB 4JRXB 3ULVF 1VFMA 5I1KL 4PJIA 4NZTH 5T3ZH 1DANU 4JZJC 5J57B 1JK8B 3K46A 2GFBA 3LMJH 3D1MC 5GRJH 2UZXB 3NIDE 3SKJL 1IEAA 4PJ9D 3PWPA 1E4WL 1TQBC 1EFQA 2V5SA 1XCQA 5ESAB 2CIKB 4X80L 4FABL 4QRSA 4XXDB 2GJJA 5FYJD 4ZSOE 3V4PH 2F74A 1AGDB 1T2JA 2B8OT 2E7LC 2HG5A 2OSLA 3RGVC 3RHWF 3QNXB 2H26B 1J9CT 2CXKA 1U42A 2PW2A 3UTSA 3B9AA 5EC2B 1WWWX 2P5WA 4XBEL 4AENB 1FJ1B 1AQKL 4Z76A 1NFDF 1K85A 2X10A 4KK8C 4LVHC 3AREB 3J7HA 1NGWA 4U2YA 4YAQA 3OZ9H 3T4YA 1YNTA 3C8HA 1KXQE 2NY0D 3MNWB 1P4BH 4UDTA 1MRCL 4I9WD 2NY2C 1FL5A 1LDSA 4PJHB 1E4KA 3VFSA 5CSZA 3O4OB 1WBXA 4YHZL 1MF2L 5F9WB 1YY8B 2FEEI 3BP5A 4G7YH 3HE6C 2GSGA 3STBA 5D7IF 4DZBA 3SHSA 1ONQA 1JPTH 1D5XA 4UT7L 1KGCD 1NSNL 4M48H 4ELKB 3IF1B 3MSPA 1A7PL 5L2JB 1D9KD 4LBEA 3IFLL 4DVBA 2AS5M 2XYCA 4YUEL 4B5EA 2AJYL 4U33A 2X4NA 1U3JA 2BY1A 2EDNA 3EYQC 1UM4H 3PGDA 4N8VA 3RKDC 2YC1A 3UO1L 1NFIA 1EDQA 1DUYB 3QG7H 2HLFD 2YRLA 4NNYB 1JYWA 2RHEA 4QRSB 1A5FH 4OLUH 1FFNA 1DQJA 4FNLL 4YWGL 5D1XB 1FNAA 3VCLA 4W6YB 3NH7H 4HIJB 4JANB 2BNRE 3QUYB 2F54B 3D2UB 1G7HB 5E8EB 3FB6A 5CINH 2VLME 4KRLB 3ALWA 3F7YA 1IGYB 3EOAB 3QG6A 3V0AC 4Z0XA 4H8WH 3JUYA 2AK1L 3LZFH 1GJIA 1FAIH 3DWTA 4EOWL 3D0LA 3LQAL 1PDKA 1QYGH 3IU4H 4PRNA 1BECA 3BKJH 2A6JB 2GYSA 2EKSA 4MJ6A 4UIMB 5TDOA 2VAAA 2ZSWB 4Y5XA 3ULVD 2BHUA 4YE4L 1YDPA 3MUHL 2FX8L 5A2FA 4ETQA 1MIML 3TH4T 1H3UA 1EEUA 3HUJF 3P0YL 4PJ8B 1CE6A 3IF1A 5DJYA 3RAJH 4PLJC 3B9VA 3MLUL 4LLAA 4WIQA 3TIEB 4E42A 1A3QA 5J6GB 3BP5B 2RGSA 3MXWH 3LN9A 2IPUG 3CXDL 2D2OA 3RA7L 3C5JA 3D2UD 2FJFA 2IAMD 4Y2DC 1PVHA 3MFFA 3F58H 2EDFA 4NDMA 2X4UA 3CDFA 3JWDL 1I3VA 1IEHA 1J8HD 4MAYC 2V2TA 1F00I 1S5HB 4XNMB 1GHFL 1BQLH 3QUXC 4MDIA 4U7SA 5DRNB 1U3ZA 3KLSA 5J1AB 3IVKA 1F8TH 3DPBA 1PLGL 1E4JA 3GFUA 3ZE2E 4QKXB 4HUXB 4Y7MA 2IGFL 1S8DB 4ZTOH 4EN3B 1FDLH 5EUOA 4GW5B 3UTOA 1KENL 3PWVB 4P5KA 1JI1A 2H2PC 2PW2B 1YECH 5FV2A 5D1XC 3T4YB 1OAZL 1HQ4A 5LQBH 2LE9A 1WFUA 5GRWA 2VL4A 3FB8A 4Z7VE 2CUMA 1KCRL 3MZGB 4LGSB 2EC8A 3IJHA 4WUKH 4P59H 3UTTA 5IG7B 3V4VH 5C0IA 1S7VA 1BIIA 3OPZH 3D9AL 3HNVL 4NWTL 4OFVA 1QLEH 3LS5L 4KDWA 1M7IA 5I1CL 4KJPC 4L8CA 5MEND 2ZCKL 1LP9A 2J3SA 4AEIL 1Q9KA 3QEGL 1MRDH 1P7QA 2WMPA 2VAJA 3QFDA 3TEUA 5IOPB 2EXYC 4KY1L 1ADQA 2WUCH 5DD0L 5EOCH 2VZSA 3CGTA 5JPNA 4PJ7F 3QFJD 4RFNB 3W9EB 5ISZE 3OR6B 1Z3GH 2B5IB 5IK3B 1B2WL 4PG9B 2BXZA 3UJTH 3DHMA 4JANA 4GOSA 1GL4B 3DX7A 3CMOH 4GG6B 4L4VB 4WUUB 3O0RH 2WINA 3DX8B 2ITCA 3W11C 3HKFA 4QTHB 3MJ9H 4ZFZB 1V3MA 1RQ5A 4Y8AA 4ERSH 1DUYA 4P2OA 1OTTD 1XGYL 2YN3A 3E2HB 5AYQA 1F11B 1OD7A 4XP4H 1WWAX 5KOVC 4TQEL 4KHXL 5MEQB 4HC1H 1BGXL 1DLHB 2X4UB 4NWUH 4UV7L 3D18B 2CLZA 4XAKE 1DSFH 1BX2A 4K71B 2HMIC 2Y1VA 1UWGH 5FYLH 5HYJA 3R1GH 4ELMA 4LGRB 3VFNB 4UT9H 5F7FA 3FN9A 4X7FC 4D0BB 4OIIH 4G6KH 2YKLH 3NCFB 4AM0B 1ZKAA 4D3CL 3RWIA 4L29B 2A73A 1WZ1L 4WCYL 1A1OA 2OZ4A 3FQRA 4GUPB 3MV8D 3PWLB 3QUXB 1FJ1A 1MY7A 3VWKB 3CX5K 4HXBL 5C0GA 4R7NB 3X14B 3L5JA 5FHAH 5KSAD 3V9FA 4UIMA 5TDOB 4OIAA 4R4FL 2ED9A 2A1WL 4H1LA 3F5WA 4NN7B 4K07A 1B4RA 3SKNA 1Z2KA 1IZJA 3ILQD 1GGUA 5GGSA 2DQDL 1B0WA 3DI2B 4GXVL 5A3IC 4OLEA 35C8L 2QSVA 4PJ5E 4M6NH 5L8LB 5HYJD 1A6WH 4QF1B 3BP6A 5IBLD 4LLVB 5C0BE 4L8BA 5LXGL 3VXPA 4O2CA 2BY3A 2XFXA 1MJJB 4LCWA 3AS3A 4L9DA 3GRWH 4RMVA 4I48A 3ZE1F 3CZFB 4JPWH 1RZFL 2W1NA 3VRJA 2B4CC 3ETBF 3OWEA 1G6RL 1SVCP 4OCWH 1CK0L 1T89A 4NN7C 2QQLL 3IFPB 3OJVC 4R8WH 4DEPC 4E0RB 5DVNA 1BQHG 2BVPB 3HG1D 5T3XE 2ERJC 4ODSH 5T1LB 3UTSD 1OLZA 2VMFA 1YUHB 3JTSB 4EIGB 2AQ2A 5BV7H 2R2CA 4I5BB 2G5BA 3HMWL 25C8L 5FO8B 3KDMB 1BVKB 1S7QA 4WO4C 3RWDB 4JM2B 1OTUD 4L29A 4FXGB 5D6DA 2Z8RA 3FB6B 5GGTL 5JORA 4MX7B 1N8ZA 3TBSA 3K1KC 4EQ3A 3HZMB 3HRZA 3AS1A 3QP3A 1MCWW 2DMBA 4TUKL 4R96B 2CK0H 2ICES 3RIAK 1CLOH 3D0LB 3PV7A 3CVHL 1FZKB 3MRDB 3PWLA 5DUPH 3HC0B 3JWOC 4YDJA 3QDMA 1F58H 2B7DT 5JIIA 1P53A 5GISL 3QIUD 1A22B 4M61B 4OFIA 5SWZA 5CCKL 3HZYB 4FFWC 4RGNE 3SDYL 4P99A 3FOMA 5LCVL 2EZ0D 3REWB 1QR4A 2W38A 3TCXA 1VFOA 1XZ0B 2WQ8A 2B4CL 1J0KA 4GKNA 5DK2B 5TDNB 1BOGA 1UQSB 2NNAA 4MXWL 1NCTA 2R1XB 2Z8SA 3B5TA 5CJOH 5FYKD 1DTUA 1T20B 5EOQH 3RJQB 2WUBL 3A6BH 5LKNA 4C83B 3MFFB 1V7MH 3C87A 5D2NC 4BK4A 1NEZB 4DUXA 3ARDD 3UZQA 1HXMB 4HGWB 3CFCH 5E08H 4UUJB 3BEWA 2BY0A 4AG4H 1J1OH 2VABB 4G6AC 1MCQA 2XA8L 3ZKMC 2YD9A 1MJUH 2HKHH 1CE1H 1UKTA 1X5KA 1U8OA 2RB8A 4MD0B 3QQ4A 1GGYA 4FQXC 4Z5RB 4C56A 1BF2A 4YBHA 1EHLH 4GRLA 3GKZA 4HG4J 1QRNE 1OGAB 1JGLL 3B5HA 4JKMA 1HHJB 5DJ6B 2XICA 1MHHB 3JV0A 3ZT7A 2JELH 1ORQA 2ZKHH 2PTVA 1D9KA 2PCPB 1AP2A 3VXMD 4LEOB 1A1MA 4NKMB 5DT1L 3UBXG 5C0IB 3L3JB 4X98A 4JPKL 5ID0B 3W5NA 4GXUM 3WN5A 2FGWL 1KIPA 3EO9L 2AJXL 4PB9H 4YBQD 1NCDL 4EDWH 3RGVB 1FORH 1T1XA 1XAUA 2YD8A 3N0PB 2VUYA 5IB4B 3G08B 3TO2A 3UP1A 1MHEB 5GIRA 5JDSA 1F2XK 1QO3B 4ODXB 5DJDA 3LH2H 4KMTL 5FGBC 3QUKA 1OTTC 5H2BA 5IT2L 1BJ1H 2W0FA 4DCQA 2OMBA 4UU9A 3O4LB 2QADC 4PRBB 5EU6D 2RAMA 3VFRB 4M62H 3M8OL 4NJAH 5ANMA 2WBJB 3T0WA 5KAQG 5F7KC 4C83A 1YJDL 2F74B 2I9LB 2APXA 3D39E 2UWEE 4X4ME 5C0CD 4LRIC 4OCXH 3IDGB 4JM4H 2Z91B 2MCG1 4HT1L 4Y4FA 1E6JL 3IETB 1X3DA 3VGAC 4NO3A 2YBRA 2H3NB 4LAQH 4U1HA 5HHOE 3LCYA 5D7IB 1IM9B 5MENA 2QR0A 1T7WA 4LARL 4RFOL 1MCSA 2DQJL 3HC3H 4WEBH 2Q86B 4CMMA 4F7MB 5IMKB 1MNUH 1G84A 1W2KT 4H0GA 2HYMA 4QXUL 5D2NB 5EFIA 1DUZB 1JHKH 2YPVH 3CSGA 4JQVA 4LEOA 4Z95H 1O7VA 1EO7A 3MXVH 1YYML 4XVJH 5D7KD 4B7IA 3CVHA 3IDXH 5DFVC 3PP3H 1GAFH 2VDRH 5IHLB 3T0EB 3DIFB 5ALBL 5EBLA 3KNBA 5D9SB 2E8ZA 5EU5B 1A9BB 4HWEH 3CFJB 5BRZA 5T33H 3INUL 4K2UL 4MXQD 4XHJD 1P5UA 1NCBH 2YXMA 3W9DB 1JZ2A 5KZCB 5E1AB 1L9MA 2N56A 1UWXH 5TE6H 5BCAA 1OAXH 5AG8A 1KUMA 4E41B 4XHQA 4M1GL 1EO8H 5C2BH 3MRRA 4FQIL 1DBML 1SM3H 5HYFA 3WXVL 1S3KH 4KDTC 5D71L 3NCYS 3GK8H 2R4SL 1KJ3L 3KXFA 5JNYB 1FNGB 2X2YA 1YEKH 4XBGA 3UBXA 4PJHA 1H3PL 3LN5B 4ZNEA 5CJ5A 1N7ML 2R0WL 3VFOA 5J12C 3WNNA 3K8LA 3UPCA 1EXUB 1U3YA 5IB2A 5IFHL 1EZVY 2XTJC 4NO5B 2NXYB 4KJQC 4ZUSB 5E2VL 2O5YL 2W0LA 4ZPVA 4Y89A 2XKNB 3LV3B 4NO3B 1EO5A 4OCSH 1U95B 4JFZH 2ZSVB 4I3GA 5MHSD 1FZKA 5HYEA 1PSKH 1KN4H 5C0AD 4YZFE 3QDJE 2VO5A 4M9OA 1RIVL 1J8HB 4FFWD 1KB5L 5TF1L 5KAQF 1SEQH 2ARJB 8FABB 4NKIH 4OD3H 1NGXA 1UM6L 4RIRB 4HIXL 4HPOH 2VKXA 4P4RB 5DJZB 3ARQA 3EYUH 2MNUA 3LAFA 3DI3B 1OAKH 4OGXL 2CIIA 4TNWK 4XAKD 5EBGA 1P4IH 2BHYA 3MLXL 3R8QA 1FL3B 3REVB 3W81A 1U92A 1FVCB 4WW2C 3HMXA 3MRNB 3OGOE 3FONA 4KK6C 2OQJA 3VXRD 1PSKL 1KJVB 2DWDB 2IADB 2FX9H 1TZHB 4KI5F 4AEFA 3L1OL 1DP0A 2DQUH 4NJ9L 1T5XA 1T7VA 3BKCL 2XWTB 4KK9C 3VMPA 4KUZL 3LN5A 4OZIB 1D5ZA 4W6WB 1ZANH 4PJ7E 3P9WB 5CMAB 4ELME 4I18C 2YBRB 1JGEA 1RI8A 3WBDA 3KPRA 5T1MB 4H25B 5IIEB 1FFPB 3U9PL 4WDIB 1N7MH 4FS0A 5D9SA 1UM5H 4XPTH 2AI0H 1XGTA 2BC4A 3LV3A 4CVWA 1S7UA 2F54D 4YHYC 1T04A 2DJ4A 1V05A 4M1CD 2Q8AH 1A3LL 4OZGA 2BNQB 3S98A 1CFNA 4X6CB 4U1KA 2Y4SA 4D0DA 3K4AA 1I1FB 1H0DB 1OB1B 5I8CA 4ZO9A 1SM3L 5DK3A 4LU5H 2R56L 5FKAA 4G5ZH 4AZ8A 1ETZA 4Y16B 2VISA 4I0PA 4EI5D 1A0QH 4L8DB 2Y36H 4H26B 3EBAA 1NAMH 1R3LB 1EFXB 3C8DA 3WE6A 1RZ7L 4LSVL 2FWOB 4HWZA 3GB7A 4DKFL 3X17A 1RUQL 4NQDB 3ZYJA 4JO1L 4XCYB 1AY1L 1JRHH 4P5TA 1YMHA 2ZUQB 3OR7A 4WTXA 2WZPD 3WD5L 4OZHF 4PGBA 1ZVSB 3L3HB 1JPFB 3I2CL 3VI3E 2A83A 3VFOB 4P4KC 3IDXL 4JY5H 1IGJA 4KMLB 5I8EB 4RMTA 2E7HA 1S5IH 3WUWA 3SE8H 5DJ8A 1NC2B 4OCMC 2ITCB 3KPOA 3HI6L 3SJVD 4WEBL 4RFOH 5T1MA 4X0KA 5D70L 2HMID 1FGVL 3VW3L 1A7NH 1QSEB 3P0VH 4XC3H 2R1WB 1XMWA 4F3FA 1U8JA 2EYSA 3GI9H 4OZIA 2JK5A 4XCEB 4HT1H 1J1XH 5L7XH 4L4JA 3QFDB 3QXDB 3UCRA 2A6DA 3UJIH 4DWHA 3EO0A 3RZWA 1U2HA 2AKRB 2CH8A 1CXKA 3VG9B 1FYTD 2DICA 3AREA 4KU1A 1DLFL 5F7DA 3NPSB 2Q86A 4CMMB 1UWEH 4F7MA 4IRSC 2AJUH 3TLRA 4CNIA 1BWMA 2OZ4H 5ACZB 1DBKL 1I9RH 3UTQA 5FYJU 5LBSL 43C9A 4AT6A 2ARJQ 5F3BB 1XGPA 4HWZB 1R5IA 4U6TA 5I1EL 1AHWC 1JPGA 1WT5A 4PUBH 5DQJB 2HRLA 1DLHA 5IB5A 2P5EE 1IAKB 2EC9T 4WFFD 1KFAL 4EUPA 4WI3A 5E2UL 2WINB 3DX8A 1F4XH 1ZHKA 2AJXH 1J0HA 3S35X 1E6OL 2FGWH 5JR1H 1YNKH 5A2JH 4OTXH 3ZKSD 2CLRA 3EJZC 3OB0H 3MQIA 4F57H 1EZVX 3TA3B 3KYOA 1I8KA 2IPUK 2NY0C 5E8DH 4MB4A 1BQUA 1PBYA 2J5LB 5KW9L 3Q48A 5A40E 1HHHB 4OZHB 5JHDA 2YS4A 5HI5D 4KJWD 1B90A 3NVQA 4H1LB 4IDJH 4NQSA 4ZS6D 4KK5C 2ATPA 5DJ8B 3QIWB 3QEQD 4NOBA 4WVRA 2Z8WC 5BV7B 4HKBA 2YR3A 3O6LH 1VERA 1OTUC 5DHVA 1QSFD 5DJ2A 1JYNA 2DKMA 1CR9H 2EDQA 2GSGB 1UVQB 5JPMA 3MOAL 3QQ3B 12E8H 3IYLW 4AG4L 3DYPA 2X4OB 5T1DH 2V7HB 4MJ6B 4JN2A 4MA3B 4R96A 1NFDE 1OGTB 1WGOA 2C1OA 4V2CB 5KVFL 5FDWA 4LNRB 4I0PB 1J12A 3FZUC 4OB5H 3PP4L 4FTVA 2ZCHL 4OGZA 3TA3D 2YUVA 2XFXB 4OGAC 4TPRL 4XX1G 5JXEC 4LVOC 5JMOC 1VKXB 3TVMB 3QEQA 5MEPB 2E6PA 4N1CA 3UJJL 4KV5F 5LCVH 3PUCA 5FM5O 3O3EA 4JFEB 4R2GB 2ZOKB 4HBCH 5F9WC 3KGRA 1QBMH 3P4NB 3FN3A 4TVSa 2FEDD 4KKLD 4XC1L 3K4DA 3EHBD 4Y4FD 3T4AB 1VESA 5T1LA 5E5UB 1QSEA 2EYTA 1IEAB 3HCVB 1ZGLM 3ULUH 4LHUD 1CICA 2AK4A 4PJBA 4PJ9A 5DK0B 4UOW0 2FECL 2X1XR 5ACLA 3WHE1 1LWRA 2R9HC 2ESVE 4U1MA 3ARBD 5IJVB 2ATPB 1BBDH 9CGTA 3CAFA 3K3QA 3GMQB 3TV3L 5F9JA 4DKEH 4JB9H 4ZUWA 1PGRB 1U8JB 3JVGA 3T0BA 4G6FD 4OI7A 3FT3B 3LD8B 1P9MA 5FUOH 3C5ZC 4PRHB 3NIGE 4KI5E 4IRJC 4FQXD 3EDKA 1T83C 4E5XA 2XQBL 3I50L 4UDTB 1C1EL 4M1DH 3SE4C 4G8EA 4Y1AD 3FOMB 3REWA 1Q94A 2X6MA 3R06A 3HI5H 1FO0L 1MCJA 3L3JA 4X98B 5EOCJ 3S37L 5IWLA 4HWUA 4OLXH 3O6FC 4LHUA 1KLUA 1OPGH 2CO6B 4JFDE 5GJTL 3BIKA 1JWMA 1E0OB 3NTCL 4HSQA 3GRWL 1T5WA 4FQQA 5GJSH 5IB5B 3WV0A 3BEWB 4HF5H 1RURL 1CVSC 5CJQL 5D1QC 1R3IL 2HFFA 5IEHA 1CGVA 1X5YA 5FO9A 3VD4A 4NC0B 4YZFF 4P4KD 1OSPH 4FQXA 3BVNB 3U4BH 5DD1H 1LE9A 2HT4D 2HVKB 1H5BA 1U8HA 3IDYC 4Z5RA 5L2JA 1GGBH 4HKBB 5IESH 3O6KL 2ADJB 3RWCA 2ICWI 5I17A 3SE3C 4ZO6A 5BS0A 2DTSA 4OZHA 3QXUA 4JN1L 1OAQH 1IFHL 4NQSB 1MHPL 4Z0BH 3CXHK 2XPGA 4ELMB 1YPZF 1CICB 3MBXL 4PJBB 5HYIA 3FT3A 4IOSD 2VE6A 1S78C 4L1DA 4HCRA 4JZJA 5DC4B 5C0AE 1TJHH 3BD4A 2A77L 4W4NA 3IDUA 4KPHL 4YDKL 2GCYB 4GS7B 4DGIH 2X9YA 1RD6A 5SX4I 4ZO7A 1LILA 4DTGL 2VAAB 2ZSWA 3QEQB 4Y5XB 1TENA 5FGBA 1JPSL 1XGYH 2Y06H 4JRXD 3OR6A 5BS0D 1ONQB 4ZFGH 3H8NA 5DI8B 4M8QB 5F6HI 4ENED 5BO1H 4HUMB 4N9GB 2XN9D 3CMOL 4XMLL 1C16A 2YUXA 5BOZG 4WI9A 4YPJA 3GUTB 1MCHA 3CFKB 2QQNH 5JUEH 1J0JA 3BH9B 4LGPB 5IHZA 1K8DB 4P2RE 2ESVB 1JF6A 3KHOA 3K74B 4N8PA 3L95A 1NGZA 4IJ3B 4XP1H 5KS9E 1PX4A 2HFEA 1JF1B 2VWEC 3VXME 2B1HL 3HE6A 1QLEL 3DVGB 3D9AH 4GBXA 3TO4A 2C1PB 1E4XH 2XZAH 3VFGL 4X7EC 4NDMB 4BYHA 1LK2A 2CSPA 1RUML 2DBJA 4KRPB 1JWUA 5D5MF 4GXUN 3I9GL 5C0AB 3EOBA 1NMAL 1A6ZA 4P9ML 4KAQL 1Q1JL 2G60H 4YIQB 2JCCF 2FJHB 3BAEH 3OMZA 2J1KA 4I2XB 3MODH 1VEPA 2NYYD 3ZTJH 4PR5A 1QKZH 3N1PC 1ZLSL 2OL3A 1RZJH 5FA4B 3WS3B 4LVNB 4X4XB 3QQNA 5BV7C 3T2QA 5CBAB 2D4DA 1RFDH 3CSYB 5FM8A 1I9EA 5HYQA 5DURD 1QSVA 1P7KB 5I1GH 4NFBA 1U3HD 3OHXA 1T5WB 2CDGB 5E03A 4P4RA 5DJZA 3K7UA 2ITDA 2E7CA 1MFDH 1TQCC 3FO1B 4OCNC 2EDTA 3MXWL 3L5WB 5J1TC 3SY0A 4G9FA 3BDYL 1ZSDA 2FD6H 1I7TB 4W6XB 3ZYIA 3HFMH 4MA1B 5BVJA 4RZCA 2DQGL 4MXVE 3I02A 2FX8H 1UCBL 5C08D 5TE7L 1YEFL 4JO2L 1VB9A 3QAZB 4WFED 4ZXBB 1I9IL 3FRPA 4J3VA 3BRFA 1OAYH 3L5HA 4Z6AT 2IQ9L 1N6QL 1JF1A 3F7QA 4X6BB 2O5ZL 3ULUE 1A6AB 2GKIA 2P8LB 4KKCD 3U0PB 4D0CA 3VXQB 4ZFZA 1K6QL 1IGCL 4DJMA 1FBIH 5DLML 3ZMRA 4U1MB 1KJVA 4I2XE 4JRWA 2EO1A 1FRGL 3P77A 3O41A 2HG5B 1JE6A 5HYJB 1GC1C 1QFWH 1G1YA 1GZPA 1AQDB 2XNAA 1F3JB 1CGSH 4FNLH 4YWGH 1AO7E 1FV1A 1UCBH 5TE7H 4YXLH 1M7IB 3EZ8A 2HJFB 3MUGB 2OL3B 4ELKA 2GJZB 2FD6L 3U6RA 2AJYH 4ZAKC 5FGCB 2F8OA 4G8GD 3X13B 3U36B 4L8BB 1JWMB 2VQUA 3C2AL 4DZBB 4NQED 4FFZL 3HC4H 1EAJA 5C0BD 2ESVA 1AGDA 4FFYH 5TJWK 5FYKL 3NCJH 1EGJA 5ERWB 5I1GL 3CXHJ 2YC1B 2FB4H 3QHZL 3TYGL 5IB3A 2OR9H 1JPTL 4LSQH 5JHDD 5D72H 3BRDA 2P8PB 1K5NA 1CGTA 3V8OA 4J3UA 3MZTA 3WNPA 1A7OL 2DMKA 1NGWB 1J18A 3VXSA 1U8NB 4HC1A 2DQTH 1HCFX 4N0FB 2XTJD 4Z7VA 4HXAH 4XNXH 2R1YA 3MUZ1 1FPTL 4MD0A 1JNHB 3FO0L 2J6EL 4O2FB 2X41A 1MRCH 4NNPH 1WBYA 4L4VD 3GSUA 5FO8A 3QUYD 5K9QG 2QLVB 2AABL 2FH6A 3OZ9L 5DJ6A 1HYSC 4WU5B 3T0EE 1J1PL 1FFPA 4XBEH 1OW0C 4IOIB 4M5YL 5EUOE 3QIUB 3ARGD 4XTRC 5MP6H 3WFEL 4YBLC 2P5EB 1F3JA 1RVFH 1F3RB 4ZFFB 3MJ7A 3CLEH 4Z78B 1S7SA 2P43B 1E28A 1EVUA 2GUOB 4QRTA 1Q0YL 5DZLA 3SCMB 3K4ZA 5KSBA 4K8RL 3BXNB 1KCLA 3HLAB 2NY0B 5L2KA 1XF3B 3KLAA 4M61A 3UBXI 3ET9F 1JF5A 2BSTA 3LQMA 5JUEL 1UKQA 5D1XA 5DGQA 2GIYA 3D25B 3MBEC 3VCLB 3GB7B 2BRQA 1A9BA 5I1KH 5HVHC 2ZWLT 4GKNB 2X05A 4XMLH 2W0KA 4GRWF 2V17L 2C9AA 1IGYA 2ILLA 4RQQA 5JDJA 4LCWD 5CILL 5SWZB 5F6IC 2DI7A 3CLEL 2IAND 5SV4A 1N26A 2O5XL 3VFMA 3WFEH 4UUJA 3PWJA 2FNBA 3MRCA 1M1SA 2YUZA 5E0QA 3NIDF 2H3NA 5FCUL 1YEIH 2P42B 2MQ3A 4O02H 1N64L 1TJHL 3LKPA 3EOAA 3QG6B 1QFWM 4X7TA 1IGML 5F21B 5EUOB 4U31A 4LOUD 4CVZA 3T77A 4KUCF 5JOFA 3FO0H 3A67H 4MX7A 4PJAA 2B1AH 4M6MH 1G0DA 4XNXL 2C7UA 1JMXA 4GRWH 2J88L 1Y18B 1CXHA 3EO0B 5FGCE 4YHOH 1Y6NR 3RGVD 4IMKA 1CU4H 2A2QT 3T2PA 3C60A 5KN5A 2V7HA 1NUNB 2FB4L 1QRNB 2IG2H 5J89A 4UZGA 5DD1L 2EEBA 3RIFK 4LSPH 4YJZL 4FFYL 5J11C 5C09D 1T6VN 1BVLB 5T5NF 3MV8B 4PV9A 3TIEA 3AM8C 3GSXA 5DJ2B 4E42B 4MB5A 1N0LA 1ZGLB 3TBYA 2NTSP 5JIKA 5IROC 1P5VA 1Q9KB 3HZYA 2P24B 2ED8A 5IVZA 1A1MB 4NKMA 3S36X 4ALAH 1YEGL 3W39B 4JFEA 4RIRA 1IAKA 4RMUA 2DL2A 1RJYA 3WXWL 4XVSL 4Z7UE 3S3PA 2NX5B 3NIFF 32C2A 3DYOA 5FDYA 1I4FA 1UZ8B 2N1KA 4IM8A 4QLRA 3BDBA 5C9KA 3VXSB 3PDOA 4PYGA 1FO0H 1YEDA 3S37H 4LEXH 1QFWL 1IT9H 3T8XB 3C60D 3DARA 1MHEA 4PJGF 5JDSB 4RZCB 4NKOA 4QOKD 2V9RA 3CMGA 2VTFA 4HPYH 4UNVA 2PR4H 4WO4D 2HVJB 2NY6C 5IB2B 5DLMH 5KVMC 3FQRB 1S9XB 2DD8L 3V52H 4DKEL 5FKPB 1FQ9C 4FQLH 1YEJH 4HJGB 3AS0A 1U8MA 5CMAA 5C0DA 1I9IH 1CBVL 3VWJD 3VFVB 4C58B 3CC5A 4RFEB 5INCB 5IFJB 1LO2H 1S7SB 3D39A 4X4MA 4NZUL 4Z7OF 1B6UA 3LQZB 2C3HA 1UVQA 4L5FH 3TBVA 4KRNA 1I1AD 3BDYH 4F7TA 3SDCD 2J5LC 4Z7WA 4PJXB 3UDWA 2XKSA 3QDGD 4PGDB 1T0NB 1WZMA 4V1DE 2OYPA 1IGIL 2GY5A 5I6XC 4WI4A 3OKKA 1F6LL 4NN6C 4K3EH 3TO2B 4GKSA 1A6UL 5MHSE 4U6YA 2ZUTA 4WWKA 2G75A 1DJSA 4X8JB 3FQTA 3BO8B 4NUJB 1RMFL 2R29H 4UT6L 4U0RC 4N90E 2CPCA 2E6QA 3DVIA 5DFVD 1X5HA 1P9MC 3WEXB 3VWKA 4UILH 3QWOB 1MFBH 4ZQKA 3BAEL 1U8NA 5C07D 2G60L 2YPKA 1I4FB 4YHPB 5DMKA 3V0WH 2JIXD 4M5ZL 1I1RA 3FHQA 5CUSH 3W0WE 4LSUL 1OQXA 1G6RA 1QHOA 3U7WH 1RUMH 1QG3A 1PG7X 1IAMA 3E8UH 4LHUB 2XZAL 3VFGH 1HN1A 3GSXB 3S96A 3IDMB 4ZS6C 5I74B 4WWKD 5CBEA 4J2XA 1J05B 3D85A 5DVLA 3L3OB 4HMDA 3STZB 1U3HA 5CIPA 2CGRL 3U82B 4EZMA 1J0IA 4PRIB 4Q74A 3HZMA 4QGTA 4KWUA 4XP1L 4NQCA 1NBVH 1ZLWH 2XWJA 3SN6N