3VB8A

Crystal structure of engineered protein, northeast structural genomics consortium target or43
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
b'MSVVDYVVTSFNSTSQMSHELLFSVKKRWFVKPFEHSRRYGLLAYMLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEERTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFEKTAWVEESNYSIAEDDIQMVESIKRYLERKIAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered protein
publication title Computational design of a protein-based enzyme inhibitor.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 37
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vb8A00
3ILDA 3II2A 3VB8A 3II3A 3ILEA
chains in the Genus database with same CATH superfamily
5H4ZA 2JKLA 4FKHA 1ILSA 1BQSA 4Z5RB 5I66A 3ATEA 3S34H 3NK3A 3O45B 2ZWYA 5FM4A 3Q8EA 3HBPA 5CGBA 1T0NA 5AKRA 3FFCD 3I50H 1R47A 4U7MA 1IM3D 4JPWH 1R4XA 3UBXA 4BFKA 1ZHBB 5IMMA 4KO6A 4FQXC 2ADYA 5KSVB 2WO2B 5GZNA 3B2PA 4UOW1 1OAZH 2OYLA 1SJVA 5FYJL 3SPIA 1J05B 5I23A 1D5IL 1HZKA 4ODUA 4UMSA 3NJKA 3ZDZB 1NCDL 3IS1X 4QEGA 1FA4A 4JY4A 2CLRB 4M6NL 2I32A 4YDNA 4OUUA 2E7HA 4X4ZA 4UF7C 3DOSB 3ME0A 3FW6A 4JFFE 4P9HC 4AE1A 3H0TA 4ODSL 5DVLA 4ZRGA 5F3BB 3B2VH 1CLCA 1DZ0A 1ILUA 4FOMA 4YGVA 2EVFA 5IFJA 3V6ZB 1XV8A 4K7PX 4NKQB 5LBSA 4ZJ9A 4DGYH 3PJNA 2JCWA 1ZV2A 5DXWA 1V7ML 3ZKMD 1RPQA 2BJMH 3MXWL 1AE6L 3UZQB 2IPUG 2PO6B 5I2IA 3R0MA 3LZPA 1BXUA 4MX7B 1Q94A 4BH7A 1W2KT 3ABLB 1KC5H 2A0LD 1HEHC 4DAGL 2OMTB 2FIKB 3TJEH 5DS1A 4M7JL 1IL1B 5DK0B 2G3XA 2UV3A 5EDSA 4OLVH 4PG2A 5EZLA 1OE3A 1MRFH 1W72H 2H26A 4O2EA 4Z7UA 1XF5B 1TTGA 1AG0A 4NM8H 5D96C 4LCWB 1C5DB 3MJ6A 1Q9OB 3Q8FA 1PZUB 4I1PA 4OGQC 1OAKL 3IMWA 3SZKC 2DQFA 4HFWB 3S97C 1TJMA 2VDPL 4MHHG 3MRGB 3FO1A 4MYPA 5B3JE 1SHXA 4FLSA 1J8SA 1HCZA 4R97B 1FZJB 1RZJL 1K2DB 2LVEA 3GS7A 1U8HB 5E95B 2YKLL 2KC0A 3JT2A 1E4XH 3Q5OA 3Q3GB 4KO5A 4L9LA 3QEHA 1NCOA 3PABA 4GRWB 4U2ZA 4BSVA 5J1SC 1V3KA 3DO7A 5K9OB 3T1FA 1CDIA 3F7YB 2OMBA 3GJFH 3CZNA 4JANA 4YHYC 2XPZA 4JPKL 2EAEA 2G5BB 1CN4A 1E4KA 2JKTM 5CEZL 2VXVL 1IKFH 2ZP8A 1HT6A 3IRZA 2APFA 3FTXA 2ZUQC 3V9EA 3GB7A 5AVRB 5G4MA 5I15H 5AWNL 2QFRA 1SXZA 2F7RA 1EMTH 3FZUD 4IKKA 1OE1A 4NN7C 2AJSL 2CA3A 4YJZL 5DEJA 1CBVL 1IGJB 5KSUB 3FT2A 4TNWF 3V0VA 1YMME 4Z7QE 1GXEA 4EI6A 4J2XA 3GC3A 4ADGA 3K0WA 4NQDD 4Y1AB 3CZKA 4BDVB 1CG9B 2AJ3B 1ZSDA 2ZKHL 2W38A 2NY5C 3NH7L 2YAOA 4LGSB 3VFMA 2GPZA 5HPMA 4U1KB 4HV8A 1L9QA 4TULH 32C2A 4UQEA 2YZ8A 4WCYL 1BVOA 4WWOA 4PRNB 3LKPA 3WAKA 3MLUH 4F37F 2QKIB 4NRYA 2XJKA 2XWJB 1BZDA 1GTNA 1Z2KA 3V8OA 1GTFA 1YO4A 2QFPA 3ZL1A 4YDJA 5BCAA 4P4KD 3JTSA 3W9DB 1T1XA 2WMPB 4E42A 1T04B 3LZLA 5AL8A 2WHVA 5IG7A 4I0PB 3IDUA 2IPTH 4N8PA 2OL3A 4GXVH 3BWSA 1YEHH 2A9NL 1HXYB 1GC1C 3K6OA 4K3DL 4QRSB 3RURA 2FBJH 1AR1D 2CK0L 4P5KA 3TEYA 2NY6D 3HNVH 2WXHA 2ED6A 3BIKA 3ESVF 4GQRA 3L3GB 4OM0H 3TIDB 4JLRB 2HTLD 1WWWX 3OJDB 3VG0L 1WAPA 1FNSH 2VXTH 3OKNB 2DQIH 3ZT5A 2D7TH 3JUYA 4J2QA 1A66A 2O5YL 4R6UA 3TT1L 4Z7WB 2KH2B 4WI6A 3QH3B 1BQKA 3QJUB 4LSPH 1AZZC 4TXVB 2UXTA 5MENA 1QO3A 1T89C 4IKLA 4L4TD 1YEKH 4DKEH 2W07A 3MVSA 4KUCF 1NIFA 2BRRH 2VH5L 3V7AG 2Z7ZA 3FPYA 3ELQA 3LTVA 4XP1H 3Q2NA 1F6LL 2M83A 2YO3A 2IIJA 1BD2A 4RQQB 4M43L 4QI3A 1E4WH 2B14A 3QG6B 4LSTH 2NRDA 4RDBA 4PCSA 3EBIA 1BBJB 1CE6A 2C7FA 4DN3H 2CUIA 3QCUH 2XN9A 5KTEL 1VLXA 5DDHA 2P8PA 4FFZL 4DO5A 1KCKA 3QIUB 1OT4A 3Q44A 5DO2C 4JJHA 4Y2DA 2P3YA 3DMMA 4N90E 1EA9C 4QRRD 3BESR 2IBZY 2Y7LA 4AQ1A 4JRYB 3IKKA 1HE8A 2VN7A 5JW4M 4YBHA 4M5ZL 2EC9T 4TQ8A 5E00A 1B6UA 4OGAC 5EBWA 4HCGA 5F1SA 2P80D 2PYEB 2UZYB 4BZ2A 2NR6C 1IEBB 1LXMA 2WXLA 3JUZA 3KYAA 4PJXB 1D5XA 5CWSB 3SO3B 2CO2A 2X89D 1QPXA 5I0VA 1QSEB 1A2YA 2Q7AA 3ISRA 3O6LH 3QJRB 3QJSB 3EHBD 5C08B 3UZEA 2WN3A 4O2CA 4E9SA 1EO8L 3L17A 2H0PA 4KRPD 3RGBA 2OMXA 3QORA 4S1DD 4U6HB 5FKAB 2AEQH 2A5UA 1YNLL 4KJPC 4AUYA 1MY5A 3VXNA 5H2BB 1U8OA 5FYKU 3E2HB 3HJ0A 4JREB 5FUCC 2D3JA 3ARSA 1KZQA 1U8PB 3WNMA 1HQ4A 3DBXA 2EDJA 4LHJB 4AM0Q 4N2IA 2VLRE 4KXDA 2E4TA 2PF6A 1EFQA 3BZ5A 3AM8C 3UC2A 1W80A 4B3EA 1FVDA 4PUBH 1VCAA 2QEJA 4ODWA 2XTJD 5C0BB 3SE3C 4LVHC 5HJGA 1MW3A 3CVHH 3W2DL 1KG0A 3QWNA 5AUMB 3C2AH 5HI4D 4AKQA 5GGUA 4U1LA 3C60D 5DMGC 1FNHA 1KXTA 1MHPL 3CFCL 3O6ML 3FHAA 3V9CA 4WKZA 1UOKA 5ICXB 4L8SA 4XPBH 4HETA 1QLFA 3WL9B 1JWMA 5GRUH 1KJMA 4JJ5B 1DFBH 1OT1A 4G9FD 4G1EA 5CZVH 3THMH 2BSEA 4D0DA 4F8QA 4JFFA 5F3HA 4XN8A 1R46A 2AAVA 4JEGB 4B3VA 1YMHB 4XGZB 1AHWC 1K5NA 2FAUA 1E40A 1U8IB 4JM2F 4APXB 1YRKA 2I07A 1ASQA 1FJ1B 3E9TA 1OT2A 5A1AA 1TFPA 2VZVA 4IHOB 4OIBA 5L8JB 2A6DB 2P5PA 5F0MB 1N10A 4JO4L 4L1TA 4Z23A 3NABL 2VWEC 3MCKB 1GOGA 2X9ZA 1SFHA 4A66A 1SEBB 1PLGH 1R17A 4PY8J 4XMUA 5F6HI 2JCCF 3DV6A 3O9WA 1I9JL 1J1OL 5D6DA 3APNA 4OJDH 3MV9E 1KF9B 3BUPA 2CBTA 4LCYA 4DTGL 3DYOA 2GW5A 4UQ3B 2H0JA 1DVSA 3ILDA 3LEYL 2XY2A 4JFOB 1KXVC 3LXAA 4YSOA 5KYWA 5EBMA 4WHCA 2WXRA 1TPXC 5TE7L 2H3KA 4KPHH 3RDTA 4HUUB 3ULUH 5ID0B 2XI9A 3G08A 3RGVD 3LEVH 1ZY9A 3QZBA 2DICA 4LEBA 4FF9A 2NNAB 1FRGL 5JQIB 3EYOA 1BVNP 2IPKB 3QQ3A 4QTIH 5G2NA 4JKPL 4RGNE 2XFXB 5DA0B 5TDOA 3S35L 1QABA 3HUJB 1LJMA 1CC3A 2CWRA 3QI9D 4J3OC 4NQED 4I48A 3T3MB 2WBJD 4PJ8C 1J1PL 2HUEA 3JWNH 3U30B 1OGAB 3U4KA 2R8SH 2YAMA 4MWFB 5C0CD 4IU2B 2G4EA 3GBLA 1OPOA 1E6OH 3OZ9L 2OP4L 2C3GA 3TVMB 4Q9QL 1NCBH 1OLLA 1SN2A 1C08B 4JFXA 4PMEA 1NDMA 2VL4A 3RU8L 3CHRA 4K3EL 1IM9B 4XVUC 1OIOA 5KVFE 1PZBA 4C83A 5I5IA 3A22A 1VGKB 3U0WL 4AVIA 5TQ2L 1CXKA 1N68A 4IRJB 3WE6B 1D6VL 5AOIA 2AXFA 4YL9A 4UQ9A 3O6FA 1YMMA 4JRYE 5EEUA 4Y9GA 3OKOA 2ZAIA 2G5RA 4Z0XA 4UYPA 3S5LA 3O8XD 3ALPA 3BZEA 1A65A 4GKZA 2QGDA 4MXQD 3ZL2A 3DJRA 4NP9A 1MVUB 2CO7A 4ZODA 5I1HL 2V5SA 3V5KB 3RWDA 4E5XA 4FNLL 4Z7AA 1U6AH 4JY5L 4UV7H 1KTRL 1PD1A 1U58A 4K23L 5LUMA 3EZJB 5EUKA 4MB1A 4PJFB 4O9HH 4ZX5A 2VUYA 1R3LB 4BZYA 4OZIB 1ZANL 2J8UB 4TUJB 2BC4A 1F45A 4U6YA 3CIAA 5T1DL 5EU6E 1X9QA 3MODH 5LNGA 4HKJB 3LKSB 1CLYL 4EN3D 1AGFA 1LYQA 3O45A 3CNKA 4WJ5A 2B39A 3ATBA 3E1ZA 1O7DC 4B53A 1NGWA 1AY1H 2ZXGA 3ECWA 4XN2A 5HJ3A 4N2KA 2DMCA 4R26H 1LWHA 2Y23A 1HNYA 2PWFA 1MFCL 5HGBB 4F33A 3QVAA 1LMKA 3EJPA 3WFEL 4LNVA 2JKRM 1ZIAA 1XGRB 2FBOJ 1HZHH 1IAOB 1TZIB 1J05A 4JO3H 4GQQA 4JRLA 3STZA 3ZYJA 4RMQA 2K70A 2ATPB 4TNEA 3W39B 4B41A 3MN8A 3M17A 5FM5O 5TE6L 4JFED 1KJ3H 3GK8L 1E5BA 2ZPKL 3OLDA 4RLDA 1L5GB 2JKXA 4L37B 1OD9A 1S9XA 5D7IE 5DYFA 3L2MA 2BMKB 3MLVL 3CV5A 5C7XL 2COVD 3SDYL 1L7TL 1TQUA 3L4CA 3ZO0A 4QKXB 1S78D 3V6ZA 5AFAA 4TSAH 5AOKA 3FYIB 5DHYB 5CP3A 2F18A 2H2PC 2GJRA 3PDOB 4KK5D 4FQXB 5IMOB 2LU7A 2ENPA 3VDBA 3WFCH 3NZHL 2WOBA 3EO1B 4PSRA 5DT1L 3UZQA 1QFHA 4JHWH 1CGWA 2DTML 3QZOA 2PO6A 4L4VE 1HHJA 1IAIL 1RCYA 4KC3B 2F61A 2DMGA 3CVIL 3DI3B 4BQ8A 1HYRC 1WBYA 3VSTA 4POZD 4YIQA 3VM7A 1TZGH 2VR7A 1KTLB 2CIIA 2OMTA 2GHZA 3S3PA 1TNMA 4X9YA 2OFQA 2EE3A 3SQBA 4Z76B 1SOSA 4GUPB 1AO7E 3EBHA 2ETWA 2CO4A 1KV7A 1OAQH 4MSWA 2NSQA 1MHHA 1C8PA 3BVXA 4TUKL 3NJMA 1W8NA 4URTB 4WV1C 1S4IA 4UCFA 4F7PA 4JDEA 1DQIA 2ATKA 1KLGB 4JZJA 3L3HB 1AZVA 1FZJA 5MP6L 3ARFA 4NP4L 5I1IL 2WKGA 4PJHE 2ORBH 1SPDA 4OJYA 3MX0A 3T3ME 5KBLA 1NC4D 1UD2A 2HWZL 2NY3C 2CCWA 1ERNA 4J6IA 2XETA 2VLRA 2VLJD 3F7YA 4G7SB 3QFJB 4AT6B 4CJ1A 5DUMH 4I3SL 3PP4H 3D8MA 1YEEH 5D96B 1SDDB 3DPDA 3FU0A 4N8VB 5A16B 1K8IA 1RU9L 5DEGB 3ASWA 1CFTB 3NESA 4XBEL 5CO1A 3T5WA 1Y6KR 5CD3A 2YWZA 3SCMB 2UZPA 1WZ1H 2YN5A 2J56A 5E8OA 3DVFA 1P4IL 3I9IA 5IVXF 1B0GB 4CAGA 2PCYA 5IM7B 4ZMTA 5C0ND 1KWGA 4DP7X 3IRPX 1NGPH 1QA9B 1U93B 3MLYH 3DURB 4JDVB 1V7NH 2J1ZA 4YHYB 3AWGA 3JV5A 5JIQA 1MWAA 2WLLA 4AG4H 3CN2A 4ZMQA 4HKZB 1IEAB 1ZEAH 2VDLL 3CSYB 1JDDA 2ESVD 3MJ9L 4HALA 4ODXB 4DKTA 3CBRA 4ZW7A 4PRNA 4V33A 3CPLB 2JI3A 1T7ZA 4KX7A 4JHAL 3ZQWA 3R1GL 2XWJA 3GS0A 5I1JH 1ZVHA 4S2SB 1M3IA 5EEWA 4OZIE 4PG9A 2ZX6A 3HRPA 2EDWA 3KGTA 3IDGB 2IAMA 4JM2C 2OYKA 4WHDA 4YHIB 2WZPD 3X3GH 3MV9A 4XPTL 1KFGA 1S3RA 5HHNA 2VW4A 1SUJA 5D1XC 5LBSL 1Z5YD 3OR6B 3REWB 3L4UA 1V10A 1BWMA 2UUDK 3JWDL 4WWID 5LNDA 3NFSH 1AG6A 3OXSA 2R0ZH 3TIDA 4AZ8A 3AWFA 5KJRL 4N1HB 4Q0XL 4QR7A 4J1UB 4Y16D 5LAPA 1GAFL 3TBVB 4K4KA 5C2BH 4DIXA 3V4VA 5K39A 2FWUA 5B7EA 5IQ7L 5H35B 2A6KB 3QZWB 2C3HA 2R2BB 4LQFL 4FNQA 4X4XB 1L9SA 4Y4FB 5CEZD 2BVEA 2COQA 5H94B 2A9BA 3OKKB 4QXUH 3ELAT 1N67A 1OF0A 2DIBA 4X5WB 1ECZA 4QJ4B 2JJVA 3GYRA 3HR5B 3KWVA 4A2GA 4LKXA 2OXHA 1SEQL 4H0LC 3AU1A 5IBUG 4Z7OF 3D06A 5AB2A 1JJUA 2UXFA 5HYIA 3NQIA 1EHLH 3GSNA 2VZSA 1FN4B 4U1MB 3RFRA 2N1KA 1FVCA 2XG4A 3OX8A 5DA4A 3EADA 5EUOB 2VDRB 4YSPA 1DDHB 1PX4A 1ZT4A 2FT6A 5E94B 4PB9L 5DZ9A 4ZUTA 4N3TA 1OAUH 5F6IC 3QIUA 1JPTL 5C0IA 4IIQC 4L0PB 1AR2A 3BFOA 1XSJA 3UG3A 4JNXA 4JRYA 2C9AA 2OTWB 2H47C 3ARPA 3WI9A 5MEPB 1I8LA 2EUWA 4AEIH 4OD1L 3TNMB 4HJ0C 2VR3A 2QQNH 4GG6B 4FI7A 1IEBA 4PIRF 3ULVH 4R0LB 4OT1L 4Z3GA 5BMFL 5JW5B 2RCSH 3C8KA 5HI3D 5IT2H 1ZWIB 4GXUM 3RP1A 3B9DA 4KMTL 1GPOH 5KSAA 3VFUB 3RVXD 2IGTA 3QDMA 5GGTA 4ZS7L 3BKJH 4WO4D 2I60L 5JPMA 1U2HA 2DEYX 5A40E 5DFVD 4JUTA 3PQYB 1U8PA 2V5TA 5EU6A 1DBBH 3DX6A 1L0PA 3OGCB 4QOKE 4XRCA 4LF3B 1ZK5A 3JV0A 4NZTL 5IW1B 4F2ME 4EUPG 5DD6B 3P77A 1BFSA 1HHGB 4WFGE 5BXFB 5D2NE 4Z0BL 2G3NA 1G9MC 2CUAA 1T03L 1ZMYA 1E42A 1ONQB 4D8PA 1VFMA 1VPOH 2CKBH 2YMXH 2DQTL 1AQMA 5GGSA 3TJPA 4KH9A 5AUMA 3WTYA 2XC8A 1QTSA 2Z0BA 4H0HB 2X42A 4XI5C 3TBSA 2VABB 4KMQA 3HG0A 3OAUH 3FQ4A 2IGLA 4XNAA 1IBFA 1CT8B 1U2CA 2YC1B 5L2KB 3DTXA 2YGQA 2O6FA 3FKUS 3T0BA 3ZHDA 4BWUA 2EKJA 3HC4L 2VSMB 3NPZB 3TJHD 5E6YA 5GRWA 4PCYA 3C6SB 3FONB 3KPRB 5DHVB 1NDGA 5D7IA 2DKMA 3MBXL 1YMHA 4CNIB 4LVHB 5GGSY 3ZRSA 3VW3H 4A67A 2VDNL 2DBJA 4JFDB 3VFNB 1E9PB 1FJ1A 5I6KA 2VUOA 3WKPA 1N5AA 5C0FB 4B0MB 2BP8B 3PPEA 5CZRA 1DHKA 2QGEA 1TJGH 1FGVL 3W0WE 5GRVL 4ZAKC 1KUMA 3NSCA 2OTUB 2PR4L 1PLBA 5D1ZI 4ZTPL 1GGTA 4A38A 4L4VA 1CFSA 3HVDA 1SEBA 4ZFQA 1MCQA 3ZTJH 2IOIA 4FTVB 4ZO7A 3STLB 5IOPB 2YK1H 1UH2A 1BIIB 3C6LC 3WY3A 3W57A 3I75B 2WXNA 5JORA 4AI7A 2KUTA 1AO7A 4MJ5B 4W4OC 1Z3RA 1AHWB 3BLPX 4OLEA 1MCFA 4JG0H 4NM4L 4KITB 1AD9A 4HUVA 1ZE3H 2E9BA 1KYAA 3LMJH 2E86A 3DSFH 2DJMA 1YSOA 2J3SA 4HOZA 1XZ0A 1MAKA 3N06B 1GC1H 1IAII 2R29A 1TLKA 2QMKA 4KKCD 4UM8B 1LO2H 2YJLA 3U9PH 2EE2A 2LU5A 4PJHA 2DLGA 4EI0A 5FM5M 4AKOA 4P2AA 1MNNA 3KYKL 3G04B 3IXAB 3S37L 4I8DA 4MWFA 3C8DA 4NDMB 5F72S 1IQDB 2VDRH 2NXZC 4JHUA 3TVMA 3J7HA 4WTZA 4AQZA 2ROYA 3OGOE 1R3HB 4P59L 1C08A 5I8OL 1JNJA 1KCVL 4YLCA 4AV0A 5EUOE 1Y1UA 4N0FB 3FT3B 4BRJA 2OR9H 2YSTA 1RUQH 3P0GB 2NLJA 1JXKA 2AJZA 4DPBX 3RX9A 2P42B 3KLAB 5D4QA 1KCSH 3EH4B 5JDJA 4PJ8B 4ABVA 4J8QA 5L8LB 1EBAA 2AK4E 1GYCA 4ODHH 4Q89A 3VFPB 5IIEB 5ANMA 4UT7L 1H8SA 4KO9A 1JRHH 2N0MA 4CDHA 1SVCP 4IK6A 4GG6E 1LO4H 2VLKD 4DZ8B 4GAYB 1I8KB 1NFDF 4JDZB 5EU7C 3AQYA 1FVEB 1U3HC 1BMWA 3FS9A 3MMEA 5FFLA 2ZCKL 1UT2A 2C9XA 3BZ4A 3QEGL 5AG8A 1ODUA 4MJIE 4N2OA 2J25A 3RRQA 4QRPB 3CMOH 3H3KA 3QUMH 2D0FA 4OZIA 1Y6NR 3HI6H 2ZE0A 2VMCA 4JFZL 4UV4L 5DUBB 1HSAB 3Q05A 3PQYE 2A99A 5MHSE 2DYSB 3LXCA 1EJFA 4IRSA 3SKNB 1UZGA 4TQHA 3U7AA 4L1BA 3BH8B 1E8YA 4PRAA 2XXCB 1LO0L 2DWYA 1CJYA 2J72A 1T0OA 1MAJA 2WTRB 1AXTL 4L9DA 1XH3A 3WFDH 5I0WA 3QRFM 1F18A 3WGVB 4DK5A 1SHWA 2AQRA 4FZEL 3WFHA 5JW4N 5IFHL 3MTXA 3MA7B 1I7ZA 4HKBB 2NZ9C 1JGVH 4PJDF 3FHQA 4PW4A 1MFNA 1EX0A 1UYWL 2LTQC 3AG2B 2BNQD 1TJHH 3RPKA 2WP3O 4H1LG 4PWHA 5L2KE 3D51A 1ZA3A 4HUXA 1KY7A 1YVLA 3AUWB 2E74C 4DP5X 4P06A 1HCVA 4H8QA 2ZF8A 3IMSA 4R2GD 4OFYD 5FUOL 4L37A 4CC4A 3HR6A 3QK0A 2FATL 3HLAA 2EC9U 1BX2B 3ZHNA 2F53B 2G2RA 1JPFA 3RVVC 2RGSA 3S3BB 4H25A 4HC1L 4G3YL 4ATTA 4FQXA 3QR2A 4YNYB 1U8NB 2YOAA 4U31A 2D9CA 1PPIA 1RPKA 1I7RB 4HEME 5D1QC 3EJZC 4HHWA 3KJ6L 2ZOWA 3BKMH 4P07A 3QFGA 4OFIA 2QGCA 4Q8BA 4DO4A 5HPOA 4Y2OB 2C1OA 3U36A 2RALA 1R3JA 1S3KL 5L6YL 3Q2WA 3N91A 2ZG3A 3B1UA 2QZ5A 4HLEA 4AX3A 1MFDH 1RHHB 2O5XH 4U7SA 4F27A 5JNYB 3VWKC 5K9QI 5B21A 1XL6A 3HA0A 2YQ2A 4MDIB 1FDLH 1FG2A 3D25B 1Y7VA 4NWTL 3L3IB 4KHXH 5D70L 5GZOA 3OHXA 1Z3GH 4GG8A 5JHDE 5KYXA 4WFEE 2VWEE 3CVBA 3LKNB 4DQOL 3IKCA 2Q8AH 1HIMH 1QRKA 1JFHA 1N4XH 2HLAB 2W1NA 3GBDA 4I5BA 2V7HA 3V5HB 3QCVL 4GW1A 1UKTA 3ZE0F 4KGJA 4R4NC 4RNRA 3Q6GH 1AFVH 1AI1L 3ASNB 4QOKA 1MUJB 1AP2B 2WYTA 2XVGA 2NDFA 3RKDC 1AZCA 4F2MA 4HZAA 3S9DB 3QS2A 3S88L 4H1LA 4Z7NF 5D2NA 3WIFB 5J12C 1XMEB 2YD3A 3DJTA 3PY9A 4OQTH 3BRDA 1Z7JA 3HLKA 5AB1A 4WV1B 5D1ZD 2ARJQ 2VQTA 1JGUL 2F8XC 5ADPH 2QT6A 2YBRB 1KXHA 1MJ7H 3B43A 2R2CA 1G1KA 5DJZA 4TPRH 1OAYH 4MAUH 4X0NA 5IEKA 2WSDA 4YHLH 2WO4A 3DNKA 4IBSA 3UC0L 4ZK8A 3DDFA 3RTQB 1GY2A 5EU3A 2DBLL 3QUHA 1IKNC 2B4CL 2CIKA 1M7IA 2L3BA 3B9KB 3TT3H 4G6ML 1S9YA 3TL5A 4CSZA 2HT3C 1XBRA 1BEYL 1ZIBA 4MQXD 2D2CC 2DL9A 3QA3A 3E8VA 1KBGL 4HK3N 4KZCA 2KYIA 4GIAA 4K7PY 1V3JA 3ES6B 1OQOA 2QKSA 4LARH 1WK0A 2JKWA 1DQMH 4FQ1H 4RAHA 3BX7C 1I1AA 4XPHH 3W0WA 4S2SA 1ORQB 2F2HA 4IOIA 5DURB 5KVEL 3EYUL 4U1GB 3FCUB 1MCNA 1T20B 5C1MB 3UAJD 3M7OA 1NBVL 5DZAA 1JTOA 3BT2L 4NYLA 4RISL 4MKMA 4DVBA 4ODVL 1BJ1H 5GIRB 3ARBD 2CJSA 3SPGA 2V8LA 2FJHB 1JK8A 3QNYB 3D39E 2VRAA 4WUUB 3V8CA 5IOKA 3MTRA 1INEL 1R3KA 1A3LH 5I28A 5DQJA 4JRXB 5HP5A 3KD4A 5H35A 2A6KA 3QZWA 3QRGH 1NMAH 3V0GA 3F00A 2PNDA 1AS7A 3FF7A 2HAZA 1T22B 1IGYA 3K80A 2HT4D 3ECBA 4JM2B 3OKKA 4BFRA 4WSKA 3BVUA 3VH8B 2CHDA 4MNHB 3FSZA 3FT4B 5DGRA 3US0A 3O6KL 4MVBD 1COBA 4F8NA 2Z4QB 4U05A 3KL5A 4FG2A 1HTYA 2JCCB 3HS8A 1O7DE 1OSPL 3N6YA 3PUUA 1JPGB 1E8WA 1NCAH 3APCA 2FGWH 2F53E 5EUOA 1DDHA 1NBZB 2FJSA 2WP3T 1P5VB 4C8XA 3VXRB 3QQ9C 1YN6B 1AS8A 2IBBA 3UCQA 4KH2A 2BCKB 2LE9A 5I8CA 1MHEA 4Z8FL 1KPRB 4MAYA 2VDQB 2F5AL 2PETA 1IFHH 2I5YH 4A39A 2AK4A 5CJQL 2IOMA 3FMGL 3IEAA 3L5WA 4OJFL 2L7JA 1NKRA 5CLYA 2EIZB 5I1CH 3GIZH 1IFGA 3ZT7A 3QAZC 4JFVA 5A3IC 4GG6A 5DRZB 1XGQB 3LB6D 4EF3A 2VE6B 3LNIA 2CBMA 3W81A 1CMOA 3NBNA 1VFBA 2ZOKA 1TQVA 3NCEB 4AIZA 4FLQA 2MPAL 1DP0A 3BI9X 1EGJA 4LASL 5SWZE 2VERN 1OARH 3E80A 3ULSA 3E6HA 1ZD6A 3VTMA 3VU2A 5F6IB 4L29B 3CQFA 4MA7L 1DVFD 1I1RA 4MJIA 1MWAL 4PJ5B 1TQTA 4IIQB 5GGVH 3TH3T 1HCFX 3D85A 4GT7A 4FFWC 1FO0L 3BQUA 1ZLWK 1DBAH 3HAEG 1MY7A 3PQYA 2EECA 4JQXC 3KYNB 2NT0A 4GKNA 1YPZF 2FT8A 4OCXL 4EXPX 2NR6A 2NY4C 5C0AD 3QJVB 1UA6L 1BV8A 3U7WH 2RH0A 3Q48A 2O1AA 3LS4H 4L3EB 1KTDB 4U1IA 1PEWA 2A74C 1SXNA 4NQCD 4M8QB 5DR5H 3KMDA 4PGBB 3VAEA 1U0QA 1X7TA 3S3JA 4JL2A 3ZZ1A 4YSAA 1G87A 2XXGA 3BAEL 1BOYA 3ROLA 1H5BC 1KELH 4YOKA 1WFIA 2AJXH 3QIBD 3WD5L 4HWEH 1L9PA 2V6HA 1KTCA 1UJ3C 4J4PC 4D2NA 2V2WB 1UXLA 3KR3H 1U8QB 2BHZA 5C9KA 1OCZB 4ONHA 2HJLB 4OSUH 2PPFA 3V4VL 1VACB 5HYJD 3MRKB 2UX7A 5HHVH 3MRPA 2JVUA 3AM8A 3C6SA 5ALBH 3QDGE 1F86A 4HKXA 4L3FA 1E27B 2XXFA 2EDXA 3SE3A 4AH2B 2E9WA 4F8LA 5TDNB 1A7QL 2UYLB 5BVJA 3KPLA 4EBQH 5JDSB 3JV6B 3MRJA 1E9PA 4HGKC 5KUMA 4MMXA 1M57B 2NY2C 1WCBB 2E27L 4M7LH 1K5WA 4ZYKB 4HEMA 5I75B 3FUJA 5JW4Q 3RDJA 1F4XL 2Z8WC 3LKQB 3GSNL 5AZUA 3T0WA 2TRYA 3H53A 4HIXL 3VDAA 1SBBA 2ZTBA 1I9IL 1N3NA 1QSFB 4XPGL 5CHNB 4CVZA 1WEJH 2GVYA 4Z77B 4YHMH 1DZBA 5E08L 1NGZA 3I75A 3KLHC 3WJMB 1F4YL 3R8QA 1UD8A 1MCRA 1E90A 4XPAH 3UYRH 4C59B 3S8GB 2QQKH 3RGHA 1UJTA 4JPVL 4M5YH 2EDBA 4JMNA 1RLWA 4MD0A 4NO0A 3SOBL 4HIEB 1R75A 2Q86B 2OK0L 3HCVA 4L8BA 4KTGA 5F9JA 4S1SL 3U48A 2KL6A 5JHDA 3SKOA 3IJ7A 1OGSA 1UURA 3FTWA 5JOFA 5D5MF 5D55A 5BJTB 5CMAB 1MQ8A 4N2AA 2C3VA 5K59F 4QHLB 2FX8H 4FYSA 1QBML 1UHVA 2BP5M 3WJLC 1MIEL 2HB0A 1MLCA 3C6LB 3TZVB 1G6RB 4PGCA 5D1XE 3CTTA 4TMPA 4B7LA 2X0VA 4OCYH 1CUOA 3PGDA 4WI8A 5E7BA 1KXVA 5GGTL 4OCWH 3VXUB 5F89A 4PJAF 5FYKL 2WVVB 2A0LC 2DQEL 2QSCH 1CL7H 4GSXA 4KVNL 5EO1B 2O6PA 3NCCB 4A63A 2Y36L 4LDCA 3ROOA 5T1MA 4GAJH 2AMUA 2VDQH 1F3DJ 4ZMAT 5I76B 3RIFF 2VN5A 2X4RB 1XAKA 3N0AA 1MEXL 5IB3B 4XCYB 2X2YA 3KLAA 1WPCA 1JXGA 1B2WH 4QHMA 5F9WC 3MUY1 4Z7VF 5HHOD 5KANG 2BFVH 2DJUA 2YFOA 3MO1B 3D9AH 4M61B 5EZIH 3L4YA 1J0ZA 1TEYA 1GGIL 1MH5B 1WF5A 5TQ0H 4YHNA 1QNZH 1HVXA 4GRMA 5KEZA 4R90L 3QUGA 3BHBA 1I3RB 3VVVA 3RILA 1NAMA 3EYFA 2DLEA 1FG9C 1I9RL 2HG5A 3TYGL 2GJ6D 1RH8A 3OC8A 4A04A 4UBDD 4DK3A 1IVTA 4BFEA 3ZW3A 3MLWL 3FSOA 4YO0B 2QR0A 3MJGX 4FYTA 1YJDL 3O2DL 4FQHB 3IPEA 4JK0D 4D0BB 1UWGH 5EWIH 4BH8A 4IEFB 2OXGA 3ESUF 3IJYB 1UQSB 3TNNA 2B15A 5D7HA 4PRID 4GAFB 1ML0A 2Y7QA 3A21A 2GTQA 3U0TB 5IVXB 4KAQL 4XC1H 1AS6A 5LGHL 1YDPB 2G2PA 1XGUB 3L13A 2YS4A 5DD0L 3IPFA 4PN6A 2X70A 3NZ8A 5ESQA 3D39A 4QYAA 3T8XB 1U3HB 1F11A 5EULV 1SM3L 2KDYA 5A6LA 1SN0A 1TEGA 5IHHA 4MCNA 1RZFH 4ZQTA 1A5FH 2R69A 1JV2A 3BD3A 1AKJB 4NHUB 1LWRA 1S7TB 1KNOB 1UZ6E 3LAFA 2PPAA 1T5XB 4MJ6B 3WEBA 2V5RA 3F64A 1R9FA 1Q0YL 3TS8A 3IFPA 2BSSA 4P4KC 3ARGB 3N40F 4FHBD 1NANI 3QB7C 4V1DD 4XMLH 4ZOAA 3V0JA 2K8QA 2DQJL 1FI8C 4ZMVA 1RJZB 2DYPD 4M48H 3H2PA 4MXVF 4AL8C 2IMNA 2R29L 2L8AA 4X9GA 3FN0H 2YR3A 3V10A 3HE7C 4ORGB 4CU8A 1RJLB 5D7KD 1JFQH 2NY6C 2DWEA 2F53A 3UTOA 4N28A 3DXAD 1JHTB 5AW8B 3OJVC 2K9FB 1G7MB 2VJ8A 2H1PL 2PCFA 3EIFA 2LTQB 2ZX7A 2VIRB 4J3SA 3IJHB 3SDCA 1ZHKA 2VITB 4MQ7A 5I5JA 3PL6D 1N0XH 4UAOC 2XBZA 1YECH 5BNXD 3UO8B 4Y2OA 1CU4L 3RL2A 4QUOA 4ZT1A 2EACA 4KJYB 3MKKA 1JYXA 2AQQA 1NCNA 2A1WL 2YPKA 7CGTA 2YSSB 1JF1B 4UTBH 1A4KB 4JQIA 2WVUA 4W9IC 5FLVA 4J7RA 3G5WA 3IDMA 2VMJA 3HC3L 1NIAA 2ALAA 3DO3A 3LRHA 3UL4A 4BJLA 3JWOL 4C58B 1ORSB 5SWZA 4YAQB 2R1YB 3DJ9A 3FQWA 3NA4A 4HS8H 2F1BA 3MV7D 3SDXE 1NLBL 5FLUA 6FABL 1VESA 4Z7OB 2YD9A 5T1JA 3INOA 5D1QB 1KCBA 3EJCA 1G6RH 5JHLL 3PJSB 4X0KA 1MCDA 4XH2B 1XCWA 5DUJA 3BE1H 5F9OH 3QGVA 4BWTA 3T4AB 1CICD 5MI0B 3BAJA 2IF7A 5GGRB 1X9UA 3HBQA 5D4HA 3WTXA 5HHPA 3QPQD 1MRDL 2JXMA 1IB5A 4N5ED 1CLZL 4M6OL 5IJVA 4PS7A 3UFIA 3MA9H 2ILLA 3AY4C 3BKCH 1K3ZA 4WV1A 5EEZA 4FXKC 3HI5L 2FL5A 1BQLL 1Q9WB 2PWGA 3LNHA 3EHBC 4OIIH 4OLYH 3PWPB 1LO5A 4Y5VB 4ZUVB 4KRPC 4LVNC 3IVKB 4K3JL 3ZTNL 1BOGB 4K5OA 4S1DC 1T4KA 3PWUB 4PW3A 1GS7A 4EOWH 2YJQA 3HB3D 2HJFA 3SYCA 4XCCL 4QRAA 1U3JA 3L4TA 2OBGA 1KDIA 5FYLL 1U8JB 2CHNA 2CBPA 2DQUL 4PU2A 4F9LC 3QDGA 4HWNA 1INQB 5J12B 2AP2A 1EAJA 5AVVB 2E0PA 4J8RB 4PAZA 4X4YA 1CQYA 5E6ZA 1EFXD 4B0MM 3NZSA 4PRHA 1NAKL 3UIZA 4ALAH 3EG9A 1MAML 1E3ZA 1JOIA 5CLTA 2XTJC 3F5WB 4NZJA 1Y07A 4PV1C 3C08L 5C7ZA 4YDKH 3DJZA 3Q5YA 5DRNA 4WU5A 1GIGH 2RR3A 2YPLB 3GSOB 3OAYK 4MS8C 1TNNA 2VW6A 1SJEB 2YXVA 3LRSB 4PB0H 3UJIL 3P4OA 3C60C 3WXVL 1CZ8L 2LV4A 1GGBL 4AJYV 1XR8B 1JV5A 1S9WA 5D7LB 4U33A 3MRQA 3ATFA 3PFUA 3KPOA 1KBKA 3PJLA 1KN2H 4NAQA 4L3CB 3MRBA 5EU7E 4ZD3L 2OX5A 1GKEA 1JZJA 3RPIB 3WYRA 3ZMNA 2X6MA 3QJHB 1S7WB 4UNIA 2BOLA 3SSGA 3CCHB 2BVPA 4KI5E 3NK4A 3WHE1 1SHSA 1UFUA 1KV3A 3VNZA 1N64H 1KBVA 3UTTD 1OW0C 4B9ZA 3K1KC 1XF3B 2GY7B 1N59A 4HT1H 4B9KC 5KANI 3B7YA 1T22A 5GS2D 3T6QC 5T3XL 4HBCL 3G6JA 1ET7A 2OS7A 2VC2L 1DN2A 2F8IA 5D1XA 1LD9B 5AOZA 2VM4A 3RPBA 2VDOB 5I16B 2B8OT 4PCTA 2HRPH 4GAGH 2CD0A 3WNNA 2NNXA 4XB8A 3N43F 1A1OB 3T0EB 2Q6WB 4AJ0A 2ENQA 4IGBC 4P2QE 4BYHA 3OMNB 5E2UL 1GJIA 1JPGA 3QFDB 1UEYA 1NBZA 3BP5B 1SF3A 1P5VA 1VA9A 4CC0A 5L4FA 1L3WA 4ZUUB 1MCOH 1WAEA 3SHSA 1TVDA 2YGOA 1NC2D 1OSZB 2ZG1A 5AB0A 3RGVC 3ZDYE 3H9SB 2CDEA 4KTDL 3LZFL 1CXLA 4ISVB 2R23B 3FQNA 1LGVA 1WBXB 1N26A 2SEBA 2KQNA 4EEEA 4JN1L 2MJWA 4J39A 3MRIA 2HN7A 3EDDA 4FL4C 4WEUD 4LHUD 5CGMA 2WCPA 3J27A 1S7UA 3K72A 2VR6A 4GBXA 4GS7C 4C4BA 1K6QL 2WBJC 1FH5H 3MRFA 8FABB 4LSRL 4RFOL 4LO9A 2R15A 1J8HB 3ZZQA 2WJ5A 4AYDC 4KUZL 4C57C 1YUHB 4RMWA 4PQXA 2CO6A 3HZ3A 1N12A 4F8TA 2OZNA 5BW7C 4BXSV 4LAQL 2RAMA 5F1KC 1KTJA 1UD4A 3PXJA 3TEXA 5DI8A 1PX8A 4NSKA 3B3IB 4IIQA 3QWRD 4XNUL 2QSTA 5D7EA 3DIFB 3VB8A 1TTUA 3HE6D 1SJHA 5EU4B 5D7JD 5EF0A 4I1RA 1M05A 4YVUA 2XKNA 4F7MA 2H4EA 4OD3H 1CF1A 1YG9A 3KYNA 4G8EB 5K93A 4BZ1H 1LK3H 5DZJA 3BRGC 1KEMH 3QAZB 2R2EA 2VQUA 3F12B 1UCBL 4ZO9A 3JQOB 4OKVB 1G9NL 1FGNL 2IXQA 4IW4C 4NZRL 4W70A 3LEXA 5IB5B 3UGUA 1KTDA 4L5FL 4O51B 4OV5A 1YEDB 5CFAA 4MJHA 3VXME 2WXOA 2H2SC 2H9GB 1IJNA 4YBQD 1THCA 2K6WA 3GSRA 4M7LT 3FRPG 1FZMB 1J9SA 1IGML 3PWPE 2JK5A 1NFDB 4FKEA 4ETQB 5KBKA 3VMPA 3HG1B 1GKOA 4GMSH 3RWIB 1HXKA 2WUBH 4QF1B 4BD4A 3LQAL 3OQRA 2KPWA 1BZ8A 2NY4B 4TQPA 3N0PB 4J3WA 1DQTA 2ZSVB 2PTTA 4KZEL 5FAAA 1BVLB 2A74B 1GJWA 3QG7L 4WHYH 3RVTD 1BFVH 2P8MA 3JWNE 1K85A 4CADA 4HXAL 4FZ8H 4EN3C 1Y18B 4K8RD 1PZ2A 2DD8L 2BOCA 2D4DA 5I1GH 2P28B 1X7QA 3UADA 3SYPA 1BQUA 4GO9A 4NERA 4O02B 4P3CL 4ADJA 4RBPK 5I6PA 1PZ5A 5EO0B 3WIIH 3N44F 4X7SL 5DS8B 3RWCA 4JG5A 5TF1H 2YPLE 1P69B 3TTYA 1MCHA 4LLAA 4HCRH 2A83B 4X5PA 1B9KA 4PJDB 3KXFE 2P5ED 5AOJA 5D7LE 3FQXB 1EAQA 1FAIL 1KIQB 1SBSH 1XIWC 1MIMH 1ADQH 4NWUH 3FU3A 3KYMA 4R7DB 1JXFA 4S0TD 4N0UA 1RUAH 5DHEA 1BXVA 1GRWA 2VTFA 3L5XL 2DJ4A 2Q86A 2NY2B 3GHPA 4I0KA 4PYGA 2EE0A 3SDXA 4PBWD 3I02B 4F8PA 1S78C 2Y07L 2VLMD 4ZAKA 5T5FH 3C09C 4GSQA 4YLQT 1FNEA 2Q7NA 3F7QA 1JZEA 2EDDA 3IJEB 3CBJB 1ZHNA 2OSXA 2Z35B 1EGJL 2IC2A 3NT0A 3PHSA 3T77A 3VXQA 1CDGA 4QTHB 1S7RB 1BZOA 4XP6H 4KK9C 2BERA 5KS9F 3BN9D 2MNUA 2CDFB 3BAWA 2KZKA 4MA1C 3OKLA 3ZK0A 2DH2A 1FIGH 4POZC 2NUTB 1IILE 1SXAA 4N0RA 2EVHA 3FF8A 1WZMA 3SY6A 3QUZC 4LBEB 2BNRB 4U0QB 4X9HA 4FTDA 1OM3H 2QGBA 3QO1A 3AG1B 2A4ZA 1FV1B 2GIMA 3A4DA 3WDJA 2YRZA 1AQKL 5F7BA 2ZX5A 2GIXA 4XVSH 2Q5BA 1HKLL 3EH5B 4YSTA 3KL3A 4IKJA 3VFOB 1MH5A 3PFQA 4B9FA 4MCMA 4FQQB 3EGSB 2LT9A 1WITA 4PWKA 5AZEH 4QY8A 1FZOB 3ZE0B 1HHIB 1U8LB 4OIAA 1J9CT 3MOBL 4GIPD 4WI9A 3FO9A 5A7EA 1UOVA 4A6YB 1VIWA 4Q7DA 2B3RA 1LP9F 2I69A 4AGOA 3G6DH 3KPQB 3V4PA 3BDYH 5T33H 2NYZA 1XZWA 2XZAH 3BJ91 3P73B 1CFMA 2PXYD 2ATAA 1QSVA 2MWCA 1KB9K 3A6CL 1QEWA 1CD1B 5F9WB 1EWHA 5C0RL 4GLRH 3MKGA 1TVHA 5E8PB 1A9EA 5AVTB 1A6TB 5JO5B 1YLBB 4JHZA 2GJJA 4UU9B 4FFYA 3UTPE 4BEIA 2X4NA 1YDPA 2QQLL 1SXBA 3WMPA 3MXVH 1YYLL 3DVNB 4MJ2A 1E50A 3IDNB 2CR0A 1U3HA 2AJVL 1OPGL 1OHQA 4MD4A 5DD3L 3X14B 5HHXH 4AYBA 4BFBD 4F57L 1JWSB 3L4XA 2C5DC 1U92B 1G7QB 2LFGA 4Y7OC 4XAKD 4GSDH 5J57B 2XV0A 4KVCL 3HG1E 1ROWA 3HKZA 4YHOH 1R3IH 1HWHB 3AREA 3MV8D 5ENWB 5HHMB 5DJ2B 4O2FB 2ICWA 4B9YA 4V2CB 3ZX1A 3OKMA 3H42H 4FXGC 2XZZA 1RJZA 5GRVK 4YDLC 1WA0X 3IFNH 1I3UA 1QZNA 4AQEB 3K5RA 4Z3TA 5E4EB 3FO0L 4P2QA 4J3TA 1FIEA 5B39A 4TL5A 4MBOA 1RJLA 3SIKA 5E7FA 4GIOA 1DN0A 1B9ZA 1WGVA 3CDYA 2ZWNA 4Y19D 2WJ7A 4YR6A 3ET9F 3VM5A 2NNRA 1UD6A 4Y16C 4QT5A 3NCWA 3O3AB 1EVTC 3QRBA 3CVHA 3FYEB 1MFUA 1W0WA 5DVPA 5GJSL 3JWNG 3RX7A 4P4KB 5LCVH 2EUXA 4NUJB 3RY4A 5AVSB 1OY3B 1XT5A 2AGJL 3KPMB 3D0VA 2IQ9L 1RFDL 1JF1A 4KOBA 3DVGB 3T0DA 3UXFA 2H0EA 3SPHA 3U9UB 2G30A 5I18H 3HE7B 1OP5K 4N26A 3H7BA 3QIWB 3GHEH 1L6XA 4LVOC 1J0YA 3DUSA 4RWHA 5I6OA 4U3HA 4G6FD 2R1YA 3EF7A 3KJ4C 5HVFB 3LPOA 1A6VL 1JHLL 4XE0A 2R7EA 3MCLL 3AW5A 4PRPB 4Q56A 4UZSA 5T1KA 3PJSA 3U1SL 4XH2A 3K2IA 2BY0A 2X9WA 3QNZB 4RGMC 1Z1WA 3BGFC 4H8WH 1A4JB 5JUEL 5GS1C 4MZ3A 4P23D 1NAML 3BISA 4I77L 4ELMF 2UXVA 4EJ1C 2AK1H 4PWGA 3RQ3A 4LLVB 3SDAC 2EXTA 2WO3B 4ZUSB 3DROA 4NC0B 1OOAA 3P30H 3MNZB 4BA8A 4PVBA 3VWKA 4MTMA 3BSHA 4RESB 2GFBB 3ZKSD 5BRPA 5JXAL 5K9JH 3RIKA 3MOAL 4R4FH 1FZKA 1SY6A 3Q6FA 3VXMA 3NTCH 4XMWA 2AJYH 4YXLL 1Q1JH 2KMWA 3IJ8A 1AZRA 2NTFB 2BO0A 5HI3C 2Z92B 1LQBC 3PWPA 2WNGA 3GRWL 3CFKA 1QNIA 3EF4A 2WIMA 3GO1L 3ZSTA 1FYTD 1MF2H 3FU6A 3GJEA 4MMZC 3I6KB 4WO4C 5GGRY 4E9TA 4Q9RL 3BZFA 1P1ZB 1QYGH 1AH1A 2PP9A 1JD7A 5DFVC 2ZCHL 4HLZH 3VI3F 2R69L 2QV2A 4A6YH 4Z78B 2D31B 4TVPD 1M7UA 2R0LH 1FCGA 2WBXA 3OKDB 5C0EA 2W0FB 5IBTL 4PJ7F 4N8UA 2GBVA 1YPZB 3LD8C 3MRNA 5DJCB 5BPPA 4LKCA 3QT2A 4TOYL 3CDFA 4NLHA 3M6DA 3PWJA 3NAAL 4LVNB 3K71A 5LN8A 2YPLA 3SJVD 1V55B 3IB4A 1SJEA 2D8KA 3EJJX 1IKNA 1D6EA 5KYUA 4YHZL 3ZYOA 4YDVB 1Z0MA 1GW0A 2MCPH 2XX0A 3KXFA 1LEIA 4P2OB 5D7LA 4XC3H 3TO4C 4U4BA 4FG6C 2Y5TA 1GW6A 3TJHC 4G80B 2APWA 3DGGB 4DZBB 1K4DA 3O2VH 3CGTA 1MKFA 5J11B 1MJ8L 3WNJA 1OM9A 3GLEA 2DDQL 2ZJSH 1JI2A 2Q3XA 1XF4B 4E9XA 3M07A 4ANXA 3ALXA 3OTTA 4IBQA 4OVVA 1A3ZA 1S7SB 2ADIA 2X4UB 4JZNB 4LIQE 4LPVA 1LD9A 3RUGE 3I9GL 2MFNA 4I18C 4NQXB 4DP6X 5C0GB 4K7FB 4BGDA 1T4WA 3EJUA 4Z3IA 4ZW8A 4NQDE 1R24B 3BAKA 2EDLA 1A1OA 2BVOB 1QAWA 3X12B 5E6ID 5A43C 5AKTA 3TCLA 2PW1A 3WDHA 4R3SB 3VD5A 3GXTA 4N9GA 5L0QC 4NPJA 3A67L 2NOYA 3RY6C 1RZGA 3P4MB 2AI0L 1EJ6A 4JN2A 4NFDA 2YA2A 3CFEB 2IADA 2YQ3A 1F1DA 1W0VB 2ZICA 2AZUA 1I8AA 2B59B 4NO5B 2WIIA 2DZEA 3HFMH 4R8WL 1AGDA 1CGSL 4MRBA 2XKSA 5TDPB 3ALWA 4KKCC 5B8CA 4W6YB 5LBGA 1NGQH 4NKIH 4NC1E 1N6QL 1PYWB 1Z66A 4N6RB 1V54B 4IGBB 1KCWA 4EVNA 2CLZA 1FFNB 3II3A 4H26A 1WC7B 3CN4A 1MG2C 4LNRB 5IF0B 4A1RA 4ZDHB 2OYMA 2FYVA 3SGDH 3AAZA 1LEGA 3MNWB 4ZZKA 4LEOA 4PJAB 3WLWD 3U4EB 2W60A 3IE4A 2EKSB 2GHWB 3FUIA 4HXBL 4ONGH 3VXTA 4JW3A 5EU4A 1XHHA 5C09D 1SNRA 3MSPA 3T3PE 3L95A 5D7SH 5HDBF 4L4TE 4GS7B 1MCCA 1TYEB 2WBJB 1QRNB 2Z0UA 3VRLE 4DVRL 3WNLA 5IB4A 3L16A 1E28A 4G5ZH 5E6UB 3S35X 2X41A 4Z7VB 1SYVB 2EABA 5LGYA 3TBCA 4NNXB 2X53A 1D9KA 1TTFA 35C8H 3SKMA 3TV3H 5D9SA 3VX0A 3UEQA 1FZMA 4P04A 3NG5A 4EI5D 2DKUA 3AS1A 3CVDA 4X8JB 3HG1A 1DJWA 4JQXA 1F97A 3QUXD 1I3GL 3MRCB 4FNRA 4WEBL 3CDZB 2R0KL 4HZLA 3T2QA 2HFEA 2NX5D 2DRUA 4Z7UF 2Y7MA 1AJ7L 1FHNA 2C9UA 2FWOB 4W9HC 1KLFB 2JFCA 3CK0H 1CD8A 5E2WL 3T1WA 5ITFB 2QTVA 1J5HA 1CB4A 2A9DA 4AXWA 3WELA 1YYMH 3BVNB 3LRLA 4IJ3C 4G42B 2GCYB 3EOBA 3G7TA 3JV4B 1YPZE 4QO1A 4YSEA 5DK3A 3Q2CA 1TSRA 5GS2H 1RK0A 5IESL 1H5BA 3P2BA 4O02A 5BZWA 1IT9L 1NEZB 4GT0A 2MHAA 4HD9A 1FLRL 4HSCX 1UJ3A 4X42A 2VDMH 2F5BH 3CXDL 4OTXL 3TURA 3U6XS 4LPCA 4NOBA 3QZPA 3M1CA 2ZKYA 2Z4TA 3OLEA 1SF5A 1BCIA 4TTGA 3ARDD 1KTKE 3S34L 1RD6A 1KT2B 4HJGB 4LOUC 1DUYA 4FAAB 4O5LH 2EEXA 1IAKA 5CJ5A 1QFWH 4F1SA 4MBRA 1KIRA 3QEQD 4EN3B 4RDQG 2WLZA 1YZZA 2W5PA 3I50L 1F13A 2CLVA 2I26N 4GMTH 4JPWL 4R2GC 1NCHA 4HYTB 1M6UA 1S5HB 1QQDA 2XTJE 4IJTA 3V6FB 1ZHLB 3D1MC 3FFCA 3O4OC 4XP4H 1IM3A 1OAZL 2FSEB 5FECA 2A73A 1A1MA 1U21A 2V5MA 2VISB 5F7KC 3TA4D 3PV6A 1J5OH 2EUVA 4U1HA 3WS3A 1QMUA 3VA2C 1ZPLA 1ULVA 3GLAA 3I84A 4L0ZA 4N8CH 1S7RA 2Q2EB 3GSUB 4TYUA 1XIWB 3NJGA 4Z9KB 3N04A 1UENA 4HIQA 4QHUB 2HP4A 3B2VL 4UQ2A 1D5MA 1IC7H 4G9FE 3RWJA 5CLWA 3FU7A 2CO1A 4DGYL 5PAZA 4HHAB 2EDFA 4FHJA 1P0SE 1YEIH 2BJML 3EOTL 5AD0B 4W1TA 4PJGE 1Z9SA 1EEZA 3VFSA 3FO2B 4HOMA 1IGTA 1KC5L 3S8WA 3V0WL 3TJEL 1T2QH 3C5SB 2JWYA 4N8VG 5FCUH 1RAMA 5BV7B 4MA1B 4ZO6A 4OLVL 3O3DB 1MRFL 1W72L 1J8RA 1N0LA 2X88A 3IN0A 3VFOA 4BSJA 4F7TB 4NM8L 5SX4H 4MDJB 2C7UA 5K59E 2V2TA 1U8LA 2LLGA 3QUZB 2CO3A 3T2LA 3AZUA 2ZKXA 3NACH 3KBPA 3TFBA 1AQDB 1MHCB 2BY1A 2Q87A 4MMYA 1E4XL 1IC4L 1G9ML 5EU5B 2NY0D 3H2WA 2ITCB 5DD1L 3WAJA 2P45B 2IV9A 3FCTA 1DVTA 2GI0A 4RA0C 4X6DE 5C07D 4JL1A 4WI0A 4UU9A 4N22A 3MUZ1 4D8OA 2X4SA 1HHKB 4OD2A 2XPGB 4K9JA 1G7LB 1CWVA 1WHOA 4K8RH 5C0CE 1PZSA 4HMEA 4FQ2L 4QPEA 2DI8A 5DK2B 3IDNA 4P9MH 5JHBA 5I15L 3C5JA 5CBAB 4L05A 3X14A 1TQCC 5EOTB 3HS9A 3IJ9A 1KFAH 2WANA 1EMTL 2X2HA 2DN7A 3E3QE 3B56A 4D0CB 4CN1A 1DJGA 2JJWA 1KB3A 2SODB 3ZTJG 4BFIA 1QFPA 3B2MA 1NH6A 4YSRA 2IFFL 2AXJA 1AD0B 4P2RB 3CVCA 1E43A 1HJCA 4O2FA 3RUGA 4BCYA 1X9RA 4F3FB 1EHAA 4WI7A 4PWEA 4X8GA 2D7OA 4NQDA 5E2TH 2QADD 4S1RH 4TULL 1IVLA 4HCFA 3RWFB 3DSNA 3UAJC 3WN5A 5T1LD 3KWWA 2IH3B 3DX8B 3MLUL 2HH0H 2OPCA 3QXAA 1KN4H 4K5NA 1AZNA 4QRQB 5LDSA 1IBYA 3M8OH 3WENA 5E5MA 1KCUH 5F7DB 4I85A 4U6XA 1E9OB 1FNGB 2WQRA 5ECJE 2IPTL 3RWGB 1SXCA 4AYGA 2CKBA 1YEHL 2E3VA 3FOMB 3MGOA 3PWLA 1I8IB 3AXLA 4ZXBB 3D69B 2HFGH 3QUYD 3TN0D 3UO1H 4P4KA 2FBJL 3GMNB 4YE4L 1KJ2H 5F0LB 3US1A 4UT9H 1BVZA 1NPNA 3CFDB 3HNVL 1IBZA 4YDLB 4N1CA 4OM0L 3KGRA 5E99H 2OMVA 3NJNA 3GSWA 5F7EH 1HH9B 2YEZB 2VDPB 3PAVA 4M6AA 2VXTL 1FNSL 2XV3A 3AJ7A 1CTOA 2R4RH 1GCYA 2IALB 4NNYA 1N8ZA 2H5UA 4E41D 4UIKH 4Y16B 4XNZB 4U4IA 4JPIB 1UA3A 4KQ3H 4LSPL 5SWSD 3QULB 5E9DB 3LQZA 3G5VB 3IBOA 5H4YA 4DKEL 1YEKL 1VFAB 2XACC 3MYJB 3U2SB 3Q1SL 2D7NA 2BRRL 4DKAA 4XP1L 1A4JA 4KZDH 2VW7A 4J3VA 4KNTA 4U1SA 4L4TA 2IEPA 5GZNC 5FPIA 3HNTH 2BINA 5BRZD 1THAA 1E4WL 5CZKA 5HDOA 4LSTL 3TWCH 1V3LA 1LK2B 2D4FA 4XMKH 1H15A 4KKLD 4DN3L 4JFEE 4R7NA 4LVOB 2GFBA 3IFOB 2G9HB 43C9B 4A55A 5KBDA 2EXWD 2V7NA 1QWHA 3HRZB 3LB6C 1HOCB 4MFHA 3FFOA 3KJ4B 4PM1A 2W65B 5E2VH 4CC1A 2Z92A 4XBGB 5FK9A 3FN3A 2VNCA 2FZ3B 3PHQB 2DQHH 4RGMB 3BGFB 4FEMA 3LIZH 1DVFC 5BV7H 4APQD 4QRRA 3I6KA 4ANKA 3JWDC 1ZS8B 2XOTA 4HPOH 3SDAB 3BPNC 1MN4A 4I3RH 1CDUA 2IAAC 4WUKH 1YCSA 1X5LA 2VMEA 3BO8A 2D31A 4PJ9D 2RHEA 5J3HC 5F70A 3IDIB 2P80A 3O6LL 4OCSH 4TUOB 3UERA 2WGXA 2W0FA 1BJMA 2E47A 2FX7L 2H8PB 5B3JF 1ZT7B 1WO2A 3B9VA 1MXDA 4FXKA 4BFOA 2X89A 5EIIB 5I30H 2WOYA 5DJCA 1WD8A 3STZB 2AEQL 2HKFL 5IY5B 3FAXA 5IROD 1OZTG 4MMZB 1IUZA 3L54A 4HPYL 3QIBC 4YDVA 1A6PA 4UWQB 3KPNB 5I1DA 2YWYA 5HY9A 4L9LC 2OZ4A 1D5IH 3BVDB 4G8IB 1A9BB 3PHOB 3CPUA 1FC2D 4PUBL 2VLJE 3MLTB 3K6SA 3B34A 4WNSA 3CVHL 4X9FA 3LD8B 4HCIA 2FHBA 3F62A 3C2AL 5I17B 2YD0A 3K0YA 3NDZE 4ELKB 1ZTXH 2MPVA 2IGFH 2PMZA 2MQCA 4H5SB 2PTUA 4M4RA 4XPBL 3C60A 1KPUA 2WZAA 4BSWB 5EC1A 3DX3A 4OGXL 1MJUH 2J2ZB 3AABA 1RKRA 1DFBL 4F7EA 4WGKA 4KFZC 2VDKL 5CZVL 3TO4B 1RSYA 5GSRA 5FW7A 1JS4A 5C0GA 1DE4A 4K7FA 3N44B 5DJXB 2ZSWB 3QE5A 2AV1A 2APSA 4JO2H 4NBYB 1QEXA 2BVOA 2YAPA 4G9FA 4DFHA 2XVKA 1P7QD 3LNFA 3P3SA 3VGFA 3H3PL 1IAMA 2E8ZA 2MSPA 3FJTA 5A2IH 4ZPTA 2ESVE 2BY2A 1OW0A 3P9MB 4XNDA 4PJGA 2TSBA 1YY9D 3K2KA 4BUHA 4JFWA 4GH7B 1INDH 3CZGA 1IX2A 1AIFA 1PLGL 3B8SA 1MI5B 4NO5A 4MYWB 2XWCA 3R06A 4A7GA 5TDPA 4I18B 2VDPH 1A14H 4Y7MA 1UWXK 3LSOA 3CDCA 4XVTH 3S2AA 4IBWA 3I3EA 1IFRA 3TBYB 3FCSB 1IIIA 1I4FA 1RZJH 1F2XK 2DMBA 2FWLB 2NXYD 4PLJD 2YKLH 4HWZA 5ALCH 4KPHL 5L0QB 1Q9KB 1SOKA 2AAAA 3LEVL 4LNRA 2EIEA 2ITDB 5J6SA 4ZDHA 1A8ZA 5KS9B 4PWFA 4HUWA 3MNWA 4QTIL 5HVHB 3O3UN 2XN2A 3RGVA 4EDXB 3V5DB 5CN2A 1ZLWH 3MJ7A 3C5ZB 3SYOA 2ZIDA 3CFJB 3GUTB 5J6GB 2YA0A 1JHKH 5HGHB 2R8SL 2MIZA 2X1WL 2RB8A 5AWNH 5CEZE 3JXAA 4TVPH 1O9ZA 2DQ6A 3GUFA 1E6OL 3QI9A 4NQEA 4X6DA 4XNQB 2WBJA 4PS4H 3S7GA 2F54B 4X99B 4XMXA 2AJSH 2FH6A 5I1AB 3G5XA 3IS0X 4OR1A 1A47A 2EZ0C 1NCBL 1J0IA 4Y4HB 5C0CA 3K6IA 4AUJA 5ACZA 1ZA6B 5FKPA 1LEKA 1JN6A 1QI3A 4NQSA 5JQHC 5BW7A 4KWUA 3NGBC 4KKBD 3IGFA 1NKGA 1LNUB 3S37X 3NH7H 3GLZA 5EEYA 1RZ8B 4KOCA 1NBCA 2AV7A 4DGVH 2I7OA 3VRJB 4HS6A 2ODIA 1DQJB 4UBDC 4YZFE 3P9WB 4U3SB 2DM3A 5KOVC 1YAIA 2KHAA 4NS0A 3ZPDA 2X0WA 4HH9B 4POYA 3MZGB 1LP9B 2VZ1A 4G8FA 1TJIH 3X17A 2VLLA 2ZG2A 3S8FB 2FO4A 3FTGA 3I6LD 4I2XE 5J13C 5AVZB 1RUKH 2FWOA 4AY0A 2N01B 3WIAA 3O8XA 1DR9A 4LCCC 3OBAA 4JFQA 2Y1ZA 1U6AL 2RTTA 1T21B 4K3DH 4B5ZA 3JV4A 4UV7L 1RUMH 1H3XA 3FCBA 7PCYA 4O9HL 4YSSA 1NEZA 4LSVH 2GKIA 4AYEC 4XHJD 2BHUA 2HKAA 5FGBA 1J0HA 1UA7A 4WW2F 2X4PB 2DM2A 3MODL 1OF2B 3UACA 5JW3H 2R83A 3LKRA 4K71B 2O5YH 3D0LB 4LDLB 3TT1H 3G5YB 5KYYB 3SE9H 1D5ZA 2N7SA 4XVJH 1SXSA 1KT2A 1N6UA 4G1MB 1ODAA 4UILH 2R1XA 1KSRA 4P3WA 5J6HB 4OZFB 5AVYB 2XWZA 1PJWA 4EN3A 4PJEE 4IJ3B 4HAFA 3KVQA 5BS0B 4R26L 1KYFA 5IHZB 1NEPA 1OEZW 3IN2A 1N8OE 4ZX6A 4PBXA 3VD0A 3BMWA 5KN5A 3F84A 5IGXH 2HRHA 2FSEA 5HVWA 4JO3L 3RVUD 3VYPA 2R27A 2C26A 2X38A 4RZKA 5I8EB 1JUFB 2X4OA 4EIZC 5J9PA 3BQVA 4ZX3A 4U0RB 3O0LA 2PW2B 2DEXX 4JFHD 1DQQB 1Z32X 5GS3A 2BX5A 3AFLA 2G4GA 2JNZA 3NSDA 3U4BH 1XFPA 2V17L 4QYOB 3UEZA 2RACA 3AU0A 4X6EB 2VL5B 3W9EA 2FX9H 3QNXA 4EKJA 1GHFH 4JFEA 3HZMA 1EUTA 4R2GB 4XNMB 3L4WA 1JYVA 2V9TA 4HHAA 1HINH 1PJ9A 3O4OB 2WLKA 5KVDH 2UY7B 1TVBA 4ZTOH 3WFCL 1NLDH 4JHWL 4Y4KD 1QLRB 3EH3B 2LFEA 3C8HA 3KEDA 4H13C 1Q90A 1UEMA 3UTQB 3VXPB 3TPUA 3CDGB 1VERA 1B4TA 4M62L 4MZ2A 1XD0A 3FO2A 3WEXB 4X5RA 4E9VA 1XB3A 3C5SA 2MCAA 3ESOA 3S36L 3ETBJ 3L4VA 4MNQD 3D2UD 2PN5A 1JNHB 1OAQL 2XYBA 3HHRB 4FFVD 4KRNA 4F7TA 3L5HA 1VHPA 3VVWA 4ELMB 1Q4NX 2ALWA 3QPQC 2FR4B 3BEWB 4OLWL 5ISZD 2EYRA 5GJTH 1XAUA 2OM5A 3E6FA 4PI0A 3HNSH 2QVTA 2PR9A 5F3FA 5KS9E 3FULA 3IWVA 5HYSB 3RDTC 1HYSD 4YFDB 3SY0A 3BAIA 1J8KA 3P40A 2X2IA 3VWJD 5IQ9B 2ORBL 3W2DH 4KU1A 2Q1EA 2FGZA 3WKNA 4X2UA 2GBTA 4A7QA 3D52A 4XO5A 4P3DA 3ARXA 5DUML 1NC4A 2F54E 3PP4L 2NQ3A 5I0DA 2XPGA 4WW1B 1IEHA 3CFCH 1YEEL 2XRAH 3HZVA 4ZFGL 2VLJA 4ICXA 3K6NA 4YL4A 1FSKB 4R7XA 3WHXA 4I4WB 3IXTA 3R0NA 1QFWM 1WZ1L 3CSFA 4XN4A 3VI3B 4DCQB 4HULB 4X6FA 3EJSA 4HIJB 3HPLA 3QDJB 4RRPM 4QKTA 2ZZUT 1M9WA 4L2YA 4PJ7B 3MLYL 3F7VB 1UKSA 3KLLA 3WTSA 1V7NL 1J5CA 2O6DA 2CXKA 3KPPB 4NJ9H 4XHQA 4AG4L 4F3FA 5CILL 1EHXA 2OMUB 2YAEA 1ZEAL 3LY6A 2H1XA 1WBZA 2YD7A 1J1OH 3DPBA 3KBHE 4A2FA 3N40P 2VLKE 3ILPA 2R1WB 3GI9H 5CLZA 4AENB 4NPKA 5HYEA 5D8JH 2ESVA 4QRQA 4URKA 1HWGB 4GI8A 2OQJA 2GSGB 3VH8G 4R96A 1KLUA 4PMFA 4XX1E 1FNGA 3O3BA 3SD2A 3ZMEA 3FH7A 2ZNWA 4AGMA 1CFQA 3X3GL 1RQ5A 1GH7A 2Z31D 5DRXB 3OXRA 5EZPA 2D0GA 1U4FA 1VSCA 4FXGA 2K3HA 4L1LA 3REVB 3T65B 3EJRA 3CFDA 2WZPA 3NFSL 2JB6A 3S48A 2BIPA 2R0ZL 1A9VA 2OMWB 2BWIA 4M00A 3HKFA 4OZGB 5B38G 4NXKA 1Z0NA 12E8H 4ZNEE 5DJ6A 4M7KH 2WV3A 3TXAA 3WDIA 5C2BL 3GXFA 5JLZA 4FNTA 3H7LA 1DVUA 3DARA 1FORH 1QFUH 4Y16A 1PQZA 4KY1H 2I7SA 3EJYD 3WSQH 4Y1SA 1WTLA 2Z91A 2B4CC 3A6OA 3G5VA 3L3DB 3NIDB 3MYJA 4QXUL 3CN3A 1RY7B 1UB6A 2BNQE 5D72H 3VQ2C 5EZJB 3UZVB 5D7IF 1H6TA 3LZQA 2NDGA 3BVVA 4JPQA 2HX8A 2EDTA 3NJIA 1JDCA 1JG9A 4Z3JA 4GRLD 4WWPA 1EHLL 1HDMB 4IBTA 1F3DH 3PDGA 1GGCH 1NMCB 3LNGA 1X5HA 2G9HA 1RIUH 1USZA 3APDA 3QXDA 3UGXA 5C0DA 5BOJA 3FXIC 1MLBA 1OAUL 4P5RA 5A2BA 2P1YA 3L08A 2X6BA 3QJZA 4UM9D 1T0NB 2OSLA 4XBGA 3JVGA 4HIPA 2Y1AA 1OAJA 3L3KA 5LHDA 2NYYD 5IMMB 5GRJH 5GS1A 5FEBA 3WMSA 4AEIL 1ZS8A 1KIUA 2VDLB 4D9RD 2XWTB 2P24A 2QQNL 4K23H 4ODUB 3HE6C 3AQXA 5D7JC 4I2XA 4NUQA 1ZANH 1BAGA 3Q1EA 4JY4B 4AYFB 4ANVA 4OUUB 4TKWA 5IT2L 4QRBA 3ME0B 4ELME 5HDBB 2H8PA 1GPOL 1J87A 2VQ4A 4OLXH 1CLYH 2PWHA 3Q5TA 4YGVB 5JHMA 5B38A 3BKJL 4PJHF 3OAYH 3GMOA 3Q8AA 4P48A 3ZGHA 3QC6X 1ITCA 4MMZA 4YBQC 2MCG1 1KIPA 3SQOH 2KQMA 1N9PA 4WO4A 1DBBL 2XBDA 3NSFA 1XEDA 3BPNB 4X9BA 4JM4H 1NQBA 3KPNA 3GS4A 4OZHE 5I2IB 3SE8L 4H40A 3ARFC 1ZOXA 1Q94B 1WE5A 4RFNC 4L8CA 2DMKA 4PJEA 1DUZB 4WW2C 4EXKA 1JXDA 2VM9A 4HJEA 1VPOL 2CKBL 2YMXL 3N50A 1GL4B 1I7UA 4O2EB 2H26B 5EZLB 4JGNA 4FEIA 3KLSA 1BEXA 4AK2A 2ZPKH 5DC2A 1MW2A 1I7TA 2X1QA 1OKEA 1X6NA 3MBED 4GEJA 4BXVA 1JYWA 3HG5A 4Y9BA 3OAUL 1JZHA 3VQ1C 4MZRA 1KB5H 2RJMA 4KKRA 3L7FA 2DQFB 2W80C 3EBAA 4PJ7E 1JPSH 1LO3H 2B1HL 2J2ZA 5EMYA 5EBLA 3ETTA 1KGYE 3JTTA 4L9LB 4N0CC 7PAZA 3QEHB 2YPVH 3PABB 4BSVB 2VKWA 2IVFC 5DJ8B 2ZSWA 1DBJH 1T1WA 2DLTA 3T1FB 3X1FA 3BP6B 3ZE2E 5J4MA 4UDTA 3VE0B 4JANB 4H8PA 2UWEE 5AALA 4N2MA 2DQDL 2WBKA 3WEAA 1IJ9A 4OZIF 5DMIH 1RIHH 3GDBA 4LCWD 2JTYA 4LL9A 3VJ6A 3GB7B 4J6RL 5ETUA 5FM8A 3NCMA 2EICA 3BGAA 3PYCA 2YK1L 3VQLA 1E5UI 1ET5A 1F2QA 4I18A 3TYFA 3V0VB 1JZFA 1TZAA 3TBYA 4EI6B 4WO0A 5MP6H 4OZGE 4JG0L 3IGLA 3AC0A 1ZSDB 4QAWA 1F58H 2FB4H 4IKIA 2ADJA 3D6GA 4K55A 3LMJL 2QVIA 3BN9C 2HWZH 3RY6A 3DSFL 3WV0A 4BK8A 5HPMB 3Q9PA 2MQ0A 3CFMA 3EO0A 5ESVB 3S4SG 2DLFH 3F7LA 4XMPH 3BP4A 4B50A 3VCLA 4N6QA 2Y06H 1WFJA 2GABA 4HJJL 3LKPB 4WNQB 4KFMA 1LO2L 3DRQA 3NIDE 5F9DC 3U9PL 3MJWA 3B6SB 3OMIB 3X1NA 4NRYB 4B9IA 4Q9CA 1NJ9A 1FL6A 2MEJB 4XP9H 3GUTA 1E4HA 3FQ1A 3HZKA 2FWSA 4YDJB 4RGNC 3JTSB 5KBMA 1ES0A 1T1XB 4PTUA 3V6OC 4DGUA 4K15A 3UDWC 5IG7B 4K5LA 2OL3B 4Y1AD 7FABH 1E5AA 2OR8A 3F6IA 4TNWK 5JPNC 2PPCA 4P5KB 1JD9A 2B2XH 3BIKB 1IARB 3MROA 2EXYD 2NNCA 5ICYA 4JPSA 4EO5A 5I8KH 1RSFA 1MOEA 3QAQA 3U1PA 1KCSL 1Z9PA 2VDLH 1BQHA 3CHXA 4U3SA 3ZQXA 4JG1H 4ODHL 3WLBA 5I1KH 4OZ4A 4N24A 1JRHL 4KK6C 2PXYC 1RXLA 1QO3B 2QBWA 3HG3A 4JHAH 3T9WA 4F37K 5MENB 4XN5A 4I0PD 1LO4L 1P84J 1LMIA 1C16A 2VDNB 5IW3A 1WH0A 4IU3A 5J8OA 3D08A 2E76C 2BM3A 3FU9A 1XB6A 4JRWA 4Q6IC 5IQLA 1BD2B 3K8MA 3NGBB 4I9WD 2VLKA 2BNUB 2CHWA 2WB7A 3PIQB 5LBSH 2KKQA 5M94B 4PWIA 1CLOH 4RBPH 3CMOL 2XN9B 3QJQB 2Q3AA 2QHLA 3QUML 3VRIB 4CMMB 1B3JA 4HS3B 5DDHB 3HI6L 3NCYP 1OO2A 2P8PB 4G7QB 1QLEH 4H44C 5KJRH 1M7XA 3DX1A 3ULUD 4Y2DB 4QHNA 5C3TA 3UPRA 3DMMB 2QLVB 5EH1A 3S4SA 3L6FB 5JPMC 1G4RA 1N7MH 4AQ1B 3KCWA 5KYYA 3ZE1F 1BFOA 2ED9A 4GOSA 4FN0A 3P54A 3QO0B 5EBWB 3U25A 3WFDL 2EH8H 1JNLH 4XMVA 5C0AE 5DFAA 3VI4E 3QSKB 1UXWA 2WWKT 5C86A 4YVNA 1GZQA 3HIZA 3LNDA 4U6VH 1DLFH 3ISWA 1JGVL 1PZDA 1D5XB 1PNCA 4NQCE 1A2YB 1I85C 4YC2B 2XWXA 3UBFA 2AXWA 5LGJB 4PPTA 5DJDB 3TASA 5IMKA 4HMCA 1TJHL 4O2CB 2OMXB 3QORB 1UB5A 1RVFH 1L9OA 1O6SA 3A6BH 3KL0A 4Y2LA 2BNQA 4PP2A 1ZVNA 3IDJA 3FAWA 1NCWL 3VXNB 1U8OB 1XCQB 4AK1A 1DQQA 4G59C 1IGCH 3L2NA 2H45A 2WQXA 3DBXB 3OHMB 2HT2D 4KXZI 4WFHD 3NCXA 3NJHA 2PYED 3F01A 1NL0H 2Y1VA 2DYPB 2VMDA 1PSKH 1WQVT 4OFYA 4YBLC 4F5CE 5IJBC 1YJDC 1QSED 3RFZC 1FVDB 4ONFH 1FFOA 3Q2VA 4ODWB 4W6WB 5C08D 4AM0B 3MCG1 2Z7UA 3DXAB 1KG0B 4OT1H 5BMFH 1I1YA 1QLRA 3BKML 3CUPB 1WGOA 4U1LB 3K7UA 5HGDA 3UTQA 3CDGA 4FE9A 4P5TD 4LSQL 1A7NL 1XR9A 3CSTA 4WKZB 3P69A 2O5XL 4L8SB 4P23C 1WZKA 2B1AH 1QLFB 3IDXH 3VD7A 2P5WD 4OM1H 3AS3A 1FDLL 4D0DB 4JFFB 5F3HB 1JZGA 4KHXL 4L8DA 4ILDA 3KLKA 2EJ1A 5C0BD 3WO3B 2GSIA 4G83A 4YFLF 4IMLA 2FEDD 1OTUD 4IDJH 4HLJA 3X3FH 2I07B 1N4XL 1K8DB 1A6AA 5DQ9A 4GW4A 5H37H 2OL3H 3Q6GL 1AFVL 3DI2B 2FBRA 4HUMB 4IIZA 4KKNA 5GRXG 5I5MA 2NY7H 1L9MA 5LDUA 2H32A 3O4LD 4OZHA 1ZSHA 1WLHA 2WVTA 3DV6B 3O9WB 4MJJA 3SD5A 1OB1B 4RSVA 4WW1A 3PAUA 3UJTH 4LCYB 5EUOF 4EQ3A 1JZDC 4OQTL 2X4TA 4WHYG 1MW0A 3NCFB 1KOAA 1GSMA 1PVHA 3W1ZA 3I9PA 5KYWB 5ADPL 5EBMB 3ZO9A 1MJ7L 2F0CA 2WB1A 2M1KA 5CD5D 4TNGA 3RDTB 1CDHA 5D1ZA 4TPRL 1OAYL 3MBXH 2QVFB 2QHRH 3CQQA 1MFMA 3G08B 4MAUL 4A2EA 4YHLL 4M02A 4XOCA 4CKQA 1QBLH 4FLHA 4KV5E 2D3VA 2JE8A 2WYZA 4OBSA 1P84K 2AQSA 2BSDA 4K94H 4PJ7A 4WRLA 3WY1A 3QQ3B 5AYTA 2WQVA 2VOTA 3FT9A 3GXMA 3TT3L 4FMFA 5TDOB 3IETA 4CGUB 4UOZA 4JGUA 4HWUA 1UM4H 3BD4A 5B7FA 4I48B 5HHOE 3JWOC 3HS0C 4GKSA 3V0IA 3CBKB 1EDQA 3GBNH 1DQLH 2DLIA 2ZOUA 4YGAB 3OV6A 2UWEA 2R1WA 2ZUVA 1PCXA 4LARL 3UJJL 3P4NA 5TH2A 1S9KC 4HEPG 1JGDB 4FQ1L 1R5WA 3RLSA 4XPHL 1OCWH 2QSQA 1NDMB 5HDQH 2GJ6E 2GSGA 4YDMA 2CSPA 2F08A 4C83B 2MQ3A 3HC2A 4P57A 2UZXA 5CLXA 4YHPA 2AXFB 4JVPA 3O6FB 4MB3A 4BZ2H 4ES9A 1OGAD 1G7PA 3UAJA 1M1XA 4L1SA 1J12A 4PRIE 2OMWA 4OZGA 5D6CB 3SGJC 1OP5H 4Z0XB 3DOIA 2ZCLH 3FB6A 3KGUA 3S5LB 2VR9A 3AADB 2WXQA 1T0MA 3ARBA 3BZEB 4UT6H 4XMTA 4GKZB 3DUUB 4LU5H 3BP7A 5E6IC 3RB7A 3RHWF 3QRGL 2CO7B 1VENA 5GS0H 1NMAL 1IM9D 2ZAHA 3PP3K 5HBBA 3RWDB 4E5XB 1G84A 3L3DA 3ZQ9A 3TO2B 1Y0LA 5JQ6L 1GCFA 2X09A 3GMQA 1U58B 3GNML 4PVNA 1PD0A 1OGTA 2K4WA 3H9HB 3BW9A 3BH9A 4IRJD 3EFDH 5EUKB 1YC7A 5EZJA 1CQKA 3BUYA 4K9EH 2O61A 1Q38A 4U6YB 1RLBA 1VEOA 5CP7B 4MA3A 4U3XA 1HCYA 4PREB 2HTKC 5E8NA 5IEHA 3NEEA 3L5JA 1NCAL 1N5YL 1AGFB 3FSAA 3VXSD 3QXTA 1H0DA 4WJ5B 4CC4C 2BIHA 4LLMB 3V7AE 3RI5K 5D7KE 4NZDA 5BOPA 1NGWB 5HJ3B 1MVFA 3DXAE 1AAJA 2YD5A 5IHBA 1R5IA 1IFHL 1WS7A 4AKPA 4F33B 5K9QG 2I5YL 3RX5A 5BZDB 4HEPA 5G4OA 3WLWC 5DGQA 4EIUA 4RMSA 2X05A 4HZ1A 5I1CL 1MCWW 3GIZL 3ZKQD 2XWTA 1PKQB 3ABGA 4JO5A 2BOBA 3VYNA 3MJ9A 2BVUA 3ILQD 1OTTC 2Y6SC 5T5FA 5TFSH 2HVKA 1MSPA 1U3YA 2J4WH 4OLUH 4AZUA 3WTWA 4CW1A 5TGBA 4LLWB 4AYFA 3M17B 2ICWJ 1UGKA 4M29A 5I74C 3RAJH 4BK5C 2I27N 3ZHFA 5E03A 1S9XB 1MQKL 1LO0H 3MREB 1WA1X 2WINB 3QWOA 2A9CA 2R4SH 5GGVL 2XG5A 2ZUUA 2V9QA 3QARA 1JRHI 3MV7E 1ADWA 1DVFA 1NMBH 1RZ7H 1GMIA 4LDOB 4TVSa 9PCYA 5GZOC 3OHXC 1JPST 3W56A 4PRDA 2BVQA 2CQVA 5IB2B 3HE6B 1HHJB 1UACH 3QUXC 4NRXA 3U7WL 5KSBE 2BSRA 1PLAA 4JO1H 3LS4L 5L9DH 4WU7B 1OCRB 2L7UA 4WGWB 1M7DA 3N55A 1WBYB 3QZNA 1RERA 4YIQB 5C0AA 3VI4A 1NGYA 2CIIB 5DR5L 1DUZA 2CM5A 2ERJC 3GSQA 4MRCA 3SQBB 4JCMA 1J1XH 1DFXA 4F8OA 5LXVA 4V2BA 4NQCA 2Q2LA 5D2NC 4MSWB 1SVZA 4J3OF 1MHHB 2AJXL 4YDIH 3BGMA 5FUOH 4HWEL 2G3MA 3SBPA 4EZJA 1IGIH 3QJXA 4HJTA 3R7RA 1X5GA 2FATH 2JJUA 4F7PB 4H4NA 5KW9H 3KR3L 2WK2A 3NIFE 4JDEB 3QIBA 2ATKB 4W68A 3E7JA 2EC8A 4JZJB 3TEZA 1O6VA 4PGJA 1F6AA 4HK0A 5HHVL 1FL3B 3ARFB 3DGDA 4C4UA 3MX0B 4KKAC 5CEYA 5DJ8A 2I9LA 4KTEL 1PIGA 1XH1A 5HYJA 3BP6A 2VO8A 2XQBH 4OI7A 1A8JH 2VLRB 4WW2B 3ARDC 3VE0A 2PYFB 1L0YA 4P0DA 4EBQL 2XZCH 4F5CA 5EB9A 2FJFA 4M7LL 1K8IB 1S7XA 1QUPA 3ULVD 5LO7A 2X9YA 2XT1B 4M56A 5CD3B 2IDUA 5I82A 1I8MA 5ILTH 5E8OB 4X4ME 1IZJA 1WEJL 1I1AC 1BYNA 4YHML 2DQGL 2XU9A 3MLRL 1G9NC 1RI8A 1C12A 1YEGH 4MXWH 1NUNB 2A6IB 3CSGA 3OKEA 3AITA 4XPAL 3UYRL 3BCDA 2J57A 2QQKL 3QFJD 2EDMA 3BEVA 4M5YL 4HJUA 1T2XA 1MWAB 2VRKA 2WLLB 4WFGD 4QNPF 4Y2NA 3W11C 4ABQA 3VFGH 5ANHA 3TBWB 1FO0B 3LKOB 5ESVA 5AZ2H 1VCBC 2MKLC 1FE8L 1Z5LA 4CBPA 2W0LA 3CLWA 4NEHB 5TE4H 1P6FA 3DX7A 4WNQA 3LQAC 5DEZA 1F4WH 1NCJA 2YGPA 3SCMD 3B6SA 2FX8L 2H0FA 3UTTE 2JV6A 1C5CL 3ZKNC 1GZPB 3BVTA 1JGUH 4E9YA 4PG9B 1M6OB 4OCYL 4U1NA 4B95C 4WDIA 3QISA 2IAMB 4HLZG 4OCWL 1EXUA 4CGTA 3MV9B 1GYAA 5HHNB 3BPCA 4ENZA 1CL7L 1YN7B 4GO8A 1TU2A 2E4FA 3DUHA 5LCVA 3QBTB 2VDQL 3OXSB 1HNFA 2AJUH 4ZMWA 5JXED 4AZ8B 1G9EA 5K33A 3MRHA 2C4XA 3MNDA 3V4VB 3E8UH 1B2WL 5K39B 3DX9B 4NZFA 5LN4A 1P53A 4PHXA 3RL1A 2BFVL 4RGNB 2NMSA 2W8CA 2Y7NA 4HAKA 3D9AL 1PKQE 4MAYC 2Y3NA 3JTBA 5EZIL 3CFBA 4NAMA 3SODB 5HHOA 1VADA 1QNZL 2J1XA 1TSHA 2MCMA 1HKFA 4LKXB 4EQ2A 5JPNB 2VQ1A 2NT1A 2OXHB 2BNUA 3AU1B 4G11A 5CP3H 1IAIM 3PIQA 5KVEE 3GSNB 3BT2H 3IFLH 5KJ4A 4ODVH 3TV8A 1FVCB 2BSTA 2XG4B 3NFNA 3OX8B 2GJ6A 4CMMA 3VRIA 4FX5A 1ZT4B 2F1EA 4HS3A 3F8UB 1UWGL 3BPOC 5EWIL 4ZBJA 4ZUTB 4ENEC 3MOQA 2GSMB 4KJQD 2DYRB 5HHQA 1TETH 1VGEH 4JY6A 2GEEA 2Q76A 3OAWA 4Y4FD 5DLMH 1FWXA 2PXYB 3I6GA 2VR4A 5C0IB 4C4KO 3L6FA 3ABMB 4PV8B 3NRQA 4AW4A 3BQUC 3C6EA 3K4DA 4MJ4A 2Y24A 2YD4A 4PRIA 1A7BA 5JA9A 3QO0A 1SUHA 1MPAH 4HUCA 1A7PH 1DCLA 2D7PA 2W0KA 4LCCA 4QIRA 4YUEH 2M2DA 1F3JB 1DJXA 2QADC 2YUZA 3MFFA 4NN5B 5GHWL 5I6XC 4DKFH 1PU0A 1A5FL 2Z7WA 1JGLH 3C8KB 3G9AB 5LGJA 2AVGA 4XNXH 5DJDA 2V3EA 3C87A 5DJ0A 3WEOA 2X4QA 1OSPH 2V0AA 1HEZA 5KSAB 2WXMA 3V0EA 4GRWH 3QDMB 2XVBA 4OF3A 3PXLA 5EOCJ 4OI9A 4WF7A 5JPMB 5I1EH 4XMLL 1XCQA 4W9GC 4DQAA 1NA8A 4B96A 2XICA 4K07A 3PE9A 4M48L 4JR9H 1H9VA 2UZIH 5EU6B 3DX6B 3FN0L 3A47A 5CN1A