3VB8A

Crystal structure of engineered protein, northeast structural genomics consortium target or43
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
MSVVDYVVTSFNSTSQMSHELLFSVKKRWFVKPFEHSRRYGLLAYMLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEERTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFEKTAWVEESNYSIAEDDIQMVESIKRYLERKIAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered protein
publication title Computational design of a protein-based enzyme inhibitor.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 37
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vb8A00
3ILEA 3ILDA 3VB8A 3II2A 3II3A
chains in the Genus database with same CATH superfamily
3HG2A 1AG6A 3AQDA 3DX9B 3P30L 4YSPA 2KUTA 1PG7L 3VW3L 1JGIA 3NTCL 1PCSA 3OJVC 4PHZA 5KZCB 5DVLA 4FGMA 4U31A 2K4WA 4GKNB 3RA7H 4X6FA 5SX4H 2P24B 2ED8A 5CN3A 3WN5C 2GABA 1MCPL 3G08B 2BSBA 4JHBA 1IC4L 5L0QB 4GO9A 4HJ1A 4TSBL 4XMLL 3CPLA 4Q4IA 4OCYL 4YS4A 1S9WB 1FIEA 2FGZA 3FZUC 3NJIA 1S7TB 3V10A 4LDCA 4ORGB 1EERB 3TIDA 4HIQA 2APSA 1IBBA 4G43B 1DANT 3LY6A 4KMQA 1ZV9A 4NKDB 3RL2B 3WUWG 2LFGA 5J57B 5JORA 1LEKB 1HILB 3MRKA 3AVEA 1MJ8L 3V2AR 3TBVA 2DDQL 2WB7A 5L4IA 1JK8A 5IJDC 2FSDA 3VWJA 3TESA 3FT2B 2FX8H 3GIVA 1NZRA 1CXKA 3DXAB 5LGHH 4N4YB 3N0AA 1KDIA 1D5ZB 2MFNA 2WZ0A 4PP1D 3JTSA 4A38A 5IFHH 4H1LA 2WWMC 3P9WB 4RDBA 4X7DC 1E9OB 5BS0B 1JFQH 4Z6AT 4GQ9H 5BRZE 2ED9A 3O4LB 4R4NC 4P0DA 3HE6D 4XB7A 4S0HA 3LKPA 2IAAC 2OXHB 4Y2DC 3SY0A 1OGAA 4DZBB 2AXWA 1W6LA 2O6CA 5KAQG 3GS7A 4PJDB 2ZAGA 3N04A 5F6HJ 3UTTD 5I71B 4QO1B 4CMHC 3S4SG 1FG2B 1JAEA 4FDWA 4JANB 1T1ZB 2ZG3A 2MCPL 3ARBC 2OR9H 3PGCB 4X5LA 1SJHA 1E6OH 1FL6B 3QH3B 4IU3B 3F65A 2VLKB 3CZNA 1UZ8B 2O6DA 4OZHB 1EH9A 3ZUCA 4PJXF 4PJHF 1KJ3L 5DK0A 4MNQE 3Q8BA 1WJ3A 2VUOA 5JZ7C 3M6DA 1W16A 3T3PF 1C16A 2C9AA 2DICA 3JUZA 4KPHL 1C08A 3KPLB 1V3JA 3PJSB 2KH2B 1TNMA 1ZPLA 2ALWA 3QXVA 1ZGLA 2KS0A 3SCMC 2OZ4L 5AL0A 2VH5H 1T1YA 4F7MB 2XSKA 3FQWB 4O4YH 1VDGA 2VAAB 2G4GA 4Z77B 5CIPB 4Y19D 3OSVA 1WBYB 5KBKA 3ROLB 3DX2A 4P99A 4EPSA 4UQ3A 35C8H 2GHZA 4JRYB 1IMHC 3CFMA 2VQUA 3H9SB 3LX9A 3GSWB 2AXJA 3CDFA 1DBJL 1YC7A 4AL8L 3ILEA 1Z0NA 3OQRA 4R4FH 5FGCE 4FG2A 1INEL 1EMTL 1RK0B 1OF2B 5F3HA 1DQTA 2TRYA 2VR3A 1XR9B 3FU5A 4YDJB 3AMLA 5FDWB 3HIZA 4B9JA 1XH3B 4LXFA 1GS6X 4H25A 2PXYA 4J6IA 5A6LA 4UV4H 1OAZL 4UI2A 3UZQA 1J5CA 3U7WL 5D9SB 2LW3A 1N5YH 2CHXA 4ODHL 3SOTA 2V7HA 4Q97A 3GTNA 3HJ0A 2X10A 2HFFA 3LV3B 4H1LH 5I8KH 2EH8H 2B7DT 4U6YB 4TL4A 3QIUA 1AXIB 1BOYA 4NQCE 1XEUA 5JR1H 2RD0A 5HHNA 4X83A 1AR1C 1H6FA 1TYEB 3VM5A 4HIJA 3BP5A 1EJOL 5GIRB 4EDWH 3TPKA 1B0WA 4MNGA 2X1PA 4QXTB 1KJMB 3D2TA 1YVLA 1OV8A 4XBEL 3ARDD 4LPCA 3NVQA 1JMZA 1JZGA 2P8PB 3P54A 1FYTD 2NYYD 1G1CA 2WLJA 4JFVA 3JT0A 3C8HA 1WPCA 4B41A 1WZKA 2R39A 3LDBB 2AHIA 4C4BA 3KPOB 4MQXD 1SYSB 4P06A 4CJ1A 5I19H 2A74C 5TE7L 4L1TA 3KR3H 1JV5A 1MI5D 1CTMA 4KXAA 4HCRA 2FATH 1RZGA 2IH3B 3FQ2A 3KAAA 2Z8RA 5JHBA 2APVA 4DP2X 4KZ0A 5DZNA 1NA8A 3BXNB 2F7RA 3UCQA 5GZOA 4AIOA 4WU7B 1JZJA 3HBQA 1E5UI 4WFHE 2N56A 4BZYA 2Z8SA 1P53A 2HJLA 1NFIB 3HUJF 1R3LB 3OKNA 2EP6A 1YUKB 2Q3ZA 4QXWA 5D7KD 3A22A 1U8LB 3KCPA 4RGNB 3I2CL 3WXVL 1RZJC 4PGBA 3RDJA 4L3EE 4M9PA 5F88A 3WAJA 1SFHA 3FJTA 1UM6H 2QSCL 4M62L 4WSKA 1WLHA 4LLDB 2GTQA 4QYAA 5EA0H 3SGEI 2R7EB 4N8VA 1V7NL 4FI7A 5E2WH 5KSVB 1AXSA 3CUPA 2EKSA 5AVVB 2K6ZA 1LO4L 3UEZA 5DQ9A 4PTTB 2NYKA 2EDNA 4XHQA 4PRHA 5E6UB 5CWSA 1T6WA 2D03H 1UA7A 2J21A 2YUWA 4KI5D 4FFYL 4M8QB 2JI2A 1NGXA 1P2CB 5LNDA 3CVCA 3CLFL 3HC3L 3PQYE 4ZUSA 1HXYA 4NQVA 2VLJD 4U3CA 1PX3A 2OMZA 4N20A 4AM0B 1ZVSB 2ZJSH 3GFUA 4PFEA 3CZUB 1IQDA 1Y6MR 2W1NA 1U6AH 3QZNA 5JHAA 3RDTB 1N5AB 2X9XA 3HTLX 4M00A 3WFDH 1JK9B 3II2A 2ADIA 3ZE2B 1BMZA 2JIXB 4JG9A 4K2UL 4MLIA 4QRTA 1NIDA 1HWGB 5FUCE 4C59B 5KVEE 5D7IE 5EPMB 4R0LA 2NTFA 1WUNT 1JI2A 4TUUA 5KVFE 5JPNC 2HJFA 4OFQA 4X42A 3CFDB 4L37A 2Y0SA 5H35B 4P59H 3NN8A 3R8QA 4ICWA 5J06A 3MBXL 3U79A 3DMMB 2KL6A 4Z8FH 4UIMA 2DI8A 3IK2A 3UYRL 4TNWF 1NCGA 3EFFB 5I0ZA 1A14H 3BHBA 1WBXB 4UM8A 1RPUA 2CMRL 4PRAA 2F58L 4LSVH 1H0DA 4OF0A 3ARFC 1KIRB 3UP1A 3MV8E 1HU8A 3QGVA 3VGGA 4B9KC 2K6YA 3KXFA 3L4YA 4Q58C 3SHSA 2YMXH 4CW1A 2CO1A 5AVZB 5J9PB 3CBKB 5I1AA 3L9RB 1E4WL 1EFXB 3K6SB 1RHHB 3BD5A 1HE8A 3CDCA 2Z92B 1J1PH 1YEDB 2DLFL 3EG9A 5DHEA 5CUSL 5ABZA 5IWLC 2JB5H 2B9AA 3FUHA 4FXGC 2OJZH 1ACYH 1X5LA 4GXVH 4LNVA 5B1AB 3STLA 1MCDA 1LO0L 1I9JH 2LABA 3KBEA 3QCTH 3S37H 2IANE 3GS4A 1XF4B 2JCCE 2O1AA 1IBZA 3HCVB 4MJID 2GITB 3T4AB 3NBNA 5IT2L 2F8XC 1QYGL 2C9VA 4U6VH 2CBPA 4Y4HC 1HH9A 1CGVA 4F8PA 5A6MA 1GGBL 5CCKH 3F5WB 3MYZA 3OC5A 5KN5B 5C97A 2YGNA 4R83A 2FIKA 3NPSC 4I88A 5CEXB 4HUMB 4L9DA 5IHHA 1DBBH 3TBTB 4DWHA 4ZSOE 1EDHA 2OTPA 3HNSH 3B9AA 1DJZA 3Q7JA 4JKWA 5EOCL 3TZVD 4UM9B 5F7DB 3U0WH 4PJ8B 1U93B 3Q01A 5FFOA 2E7MA 4YHOL 2XYCA 5E23A 1CLZH 4LCCA 4MKMA 1AGFB 2QKIB 4JGUA 1W91A 1H8LA 4A39A 1XF3B 1X5HA 1ZLVK 5C0IA 3TBBA 2DLEA 1BAFH 1PKQE 4AQ8C 2XOTA 4HOMA 1U3HA 1KIQB 5HJ3B 1MLCB 1CC3A 2NY7H 1ZRUA 3NJVA 4PRNB 5EO1A 2XWCA 2YAEA 4BWTA 4KRMB 2HRLA 1O7DE 1H3XA 2Q7YA 3ZE1E 2KQNA 5FF6A 3REWB 3FCGA 4XPAH 2YBRA 3RIKA 5DYOB 5HGBB 3TEYA 1M71B 4MVBD 4OT1H 3BRGC 2XWRA 4UANA 3NSCA 4ZFZB 1WFJA 5GHWL 2VITB 2BVPA 4OCNC 4XMWA 4F93B 4WFFE 1PTZA 1SY6A 2F53A 4RSVA 4HUVA 4N68A 4LZKA 3O2VL 3KBHE 4AGPA 1FA4A 2R4RH 2CPUA 3ZZLA 4JB9L 4L4VB 5DEFB 2HLFD 4YXHL 3BAEH 3I9PA 4KNQA 1A6WH 3VU1A 1JPEA 2WBJD 2BFVL 2OMWA 3NT0A 2DQFB 3KNBA 3B8YA 4J2QA 4U1JA 1PGRB 5DJCA 3ZDZE 2AV1B 1OAUL 2JK5B 3ZHNA 2AW2A 3HE7A 4A2HA 5HYJD 2NY0C 1OTSD 3FB8B 4NI6A 3SOBH 1I7UB 4ONFL 4UINL 3AM8A 4AYDC 2JKJA 3ZHFA 5I1GH 2R1XB 5DZJA 5GS0L 4Z23A 1XIWB 3VWKC 2GI7A 1EPFA 4OUOA 3QG7L 2OYKA 5IHZB 3S35H 3IS0X 5T5FL 4I0PD 5LKNA 3L7EB 5C0EA 3OD3A 5G4OA 2X42A 1NL0H 2CXGA 4TKWA 1NDMA 2OX5B 4KZDH 5CEZL 4ZOEA 4JG0L 3TJEL 5JOPD 1UWYA 1E4XL 1KPVA 1DVUA 3O8XA 1LHZA 1DQQB 4ABUA 1YPZE 2AJUL 2QADC 1BAWA 3WEMA 1GZHC 1UZ6E 4NQDD 1HHIB 5EU3B 3CBRA 3VSVA 3ARGA 5D8JL 2IAMD 4E9SA 4FAAB 1MJUH 2JKLA 4ZI8A 4RFEA 4TULL 1A4CA 1BV8A 3MFFB 4JLRB 4AH2A 3B34A 1SGKA 4PLJD 2NZIA 1INQB 4RAVB 2LQRA 3V6FA 1DJHA 4APQC 3VI4E 4APXA 4OTXH 5F2FA 1YY9C 4Y9FA 1GC1C 3S4SA 3UYPB 1P6FA 3WNJA 3FO2A 5D2NB 3PHQB 2DQCL 2XY1A 2D7PA 2MMXA 1FORL 3UH8A 5EBLB 5SV3A 1C5BL 3RUGE 5HSFA 1VFOA 4W4OC 1KTCA 4L2LA 2R9HD 5AEAA 1RIHL 2X88A 3QUYB 1EJFA 5D7JB 2X6UA 3CFCL 4CL7A 5AAWA 2ADJB 1FNGB 4EN3D 2XIBA 2LLLA 1AKJB 3HZYA 3WKPA 1ZTXH 4Y5XC 3ZDWA 2YGPA 2NY1B 1DUZB 1KBWA 5G4MA 3RHWF 3RVWD 4OJCA 2NX5A 3RWEB 1FAKT 2R56H 2IALB 3CZSA 1UXMA 2ZE0A 2BJML 1KLGA 3DRQA 1O0VA 1Q94A 2KLRA 4L8SA 3KZ8A 2RH0A 4DGUA 2EDFA 1PEWA 4P2QD 3FBKA 4N9GA 5B7MA 2XXGA 4YGVB 4QJ3B 2FO4A 3WIAA 4K94C 2PTVA 4NJAH 1G0DA 1XXFC 1EAOA 2C3VB 4LPTA 4YHNB 2VR8A 3WD5L 4XP6H 5T3XH 1AOHA 3P0VL 2L8AA 2BOCB 3CFUA 4FCAA 4N0FB 5EOQH 1BJ1J 3DOSB 1IBFA 1A7QL 1P4IL 1SMOA 3GI8H 4WY7L 1A25A 2L7UA 2Z35B 4MKTA 4MXVE 4ZPVA 3IBOA 5FA3A 2CIKA 3H2PA 1ZLUH 3H9YA 5DK3A 3PU7A 5BJTB 5ERWA 4JQXA 5JIQA 1S46A 1J9TA 4LIQH 3L3OC 4A2LA 4IBYA 1T0PB 1XR8B 4PN6A 4M8VA 3FU6A 1CFTB 4U05A 1OPGL 1TTCA 1OE1A 3BT2L 3D05A 3FL7A 1BIHA 2X41A 3HFFA 4XVOA 4PRPB 1CD1A 1I4FB 2APWA 2DQEH 2E7DA 3OJDA 4LVEA 4KNTA 4L9LC 2DQIH 4HWUA 2MTAA 1EXUA 4IBTA 1U8IA 2AQ1A 4LDOB 2ZX6A 4U1NB 5HDBB 3QORB 1FFPB 3HG1E 4XPHH 4DVBA 1Q9KA 5FLUA 4LLAA 1H3VA 1RY7B 4UU9A 3FT4B 3NZHH 5K9JH 3MRFA 2LT9A 3VM7A 2ATKA 1TTRA 2HRPH 3A24A 4LAQH 5GRVK 1XGTB 5EUOF 1TU2A 1NC4B 1UCBH 2Z6FA 2IADA 2RFXB 3NEOA 3CVHA 1OL0A 3HE6C 5DJDA 5LXGH 4XC3L 3X3FL 2BW5A 4YDIH 1H8SA 3OF6D 5ECJE 4DQOL 1GXEA 2Q0ZX 1TJXA 4K3JL 1EK3A 5FUOH 4C56D 5IJCC 4YXLH 5MHSD 4R7LA 3L4TA 3PXJA 4ZXBD 2V0AA 4N3UA 4RMQA 2ZD0A 1CXEA 3ULAB 1NICA 3SDXA 4Z3IA 5J4MA 3LN4B 4WSGA 4UQ2A 1L3WA 3OPZH 3PGFL 1SEQH 3RY5A 1JNHA 1YJDH 2WTPA 1S7XA 4LP5A 2ZCHH 4Y5YC 3HOGA 1U91A 5LWYH 2FJUB 5K9KA 5C71A 3VSQA 2BSDA 3AG3B 4QRUB 4N6QA 5LO7A 4GKSB 1LWRA 1P4LB 5E9DA 4OCWL 4JPIB 4L8CA 1J0IA 3KH4A 1KYFA 1MFCL 1KGUA 3TV8A 1TZ8A 2H3XC 4OCXL 2YQ3A 4N90E 1WHPA 4RISH 5ACZA 4KRPB 4L1HA 1TQUA 2OJEB 2ZYRA 4A2MA 2YEZA 5I18H 4P2OD 4Q89A 4HYTB 4DZ8B 5B39A 1XGZA 1JVLA 3MYJA 4X6DE 1ZLSH 5E51A 4AQ1C 3GSXB 5C7XL 1NGQL 3G9AB 1JJUA 3MGOB 4OM0L 4N0YL 3MO1A 1H6TA 3H4HA 5C6TH 4W9IC 3L1GA 2R51A 1JSYA 1ZS2A 1RUPL 3UG4A 1KN2H 3HJEA 5HGDA 3PJNA 4MXQC 2DQTH 3EYUL 3MNWB 3L3KA 1FRGH 1YEFH 1E67A 3B9KA 2BP8B 2XN9E 3L48A 1CPUA 4FZEH 4H8VA 3T0WA 3L54A 5CAYB 1LE5A 4KOCA 4S1RH 2JE8A 3NESA 1D6EB 5A6IA 2IH1B 2BDNL 5AKVA 1X5AA 3BDYL 1QFOA 5KG9A 4N2HA 3PFUA 2NY2D 3I9GH 2KLTA 5IQ9A 4N6RA 2R0WL 2TSBA 3F7KA 5DHDA 3D7PA 4NPKA 2MQCA 2HN7A 1I1YB 3CVHH 3T0EB 4GG6F 1UWGH 3G6JA 1UT2A 5JYLA 1Y0LB 3QDJD 1T4KA 4PTUB 3V5HB 4KK9D 3V55A 4XMUA 2CO6A 1QBMH 3WIFB 2P5ED 3U1SL 2ROXA 4FYRA 4Y16A 3TPUA 5IEKB 3UGXA 5FB8A 5DEGA 3WTVA 3CHSA 2F15A 2XPZA 5ID1B 1P4UA 5DRWB 1XZWA 2CDFB 1NSNL 3E6HB 4BFEA 4MQXC 4OUUA 1E43A 1RUAH 2QVKA 5I1KH 1KZQA 4LKXA 3JV5A 3CN3A 2V17L 2KZ1B 3ESPA 3NEEA 2OFQA 3APMA 1MCIA 1BOGA 3ISRA 4V2CB 2MCG1 3VFRA 5F9OH 4IRSA 3P77B 5C8JB 2CDEA 3OB8A 1W0VA 1J0KA 3VA6A 2AEPL 4ZO9A 1T6BX 2VC2B 1S9KC 1NGZA 5L2KB 1KYAA 3MREA 3PY9A 4UBDD 5EU6D 4F7EA 4MJ6B 1M57B 3TA3B 1MIMH 2EDDA 5I2IA 4M3HA 2ZP9A 4RVBA 1IJNA 1I53A 3O9WD 3SYCA 3SYQA 4UWQB 1UXWA 4J39A 4WW2C 3MV9B 2WQSA 1NCBH 1LK3L 4FLQA 3ORJA 3UDWA 2VWEC 2NY3B 3GKWL 2QPEB 3CH1B 2YD5A 4W70A 5BS0E 1LO5A 1EHNA 3FW6A 3LN9A 3SKNB 1JRHI 5CJ8A 1BQHG 3O4LE 4P4KB 4V33A 4WV1C 1LEGB 3CK0H 4J6RL 3L9YA 4HUUB 3ZJAA 4RMSA 3KPNA 4JHAH 3UTPE 1N6QL 3KYMB 2DWTA 1OM3H 2ITEA 2DI9A 1F41A 5F1IB 4PJDE 4LKCB 5D7SL 3O3EB 4KI5C 4FNQA 5FYKU 2ENQA 2AEQH 1DQLH 1OAYL 1A5FL 2C7FA 3SBPA 2KLSA 2UWEB 2WLLA 2JNZA 1QD0A 5I1DA 1MLBA 3O6LL 2O5XL 5JIIA 3RTQD 4XN1A 1FLTX 1MW2A 5J1SC 3QZWA 4JFEA 3WBDA 3KWVA 3HPLB 2P5WD 3KPSB 1IGIL 3L5XL 3BVXA 1J8RA 2MNJB 4M1DH 4Q0XL 4KJYB 3SPCA 4Y19B 4ONHB 1SXSA 2CJTA 5IFAH 2PUQT 2D7OA 4LLMB 5BZXA 5DFAA 3QHZH 4M1GL 4I89A 1CG9B 1I9IH 1A3RH 2P49B 1XSJA 2QZQA 1JHKH 5DD1H 5L9DH 2ROYA 4KHXL 3DBXA 4FHBD 5AW3B 4XNZB 5J12B 1YMMB 3FTGB 3I6GB 4F37F 4I3RH 5KVDE 4PGCA 1AH1A 1IAKA 1SNRA 2TRHA 4WUKL 5F7YC 5ADOL 2Q7AA 3N42F 4WJ5A 5DEZA 1I1FA 4JRYE 1GPOH 3WNNA 1MFVA 3GSNB 4KQ3L 2XZZA 3LSOA 3D25B 2EINB 2FDBP 4E42A 4HJTA 4HALA 1EEUA 5E2JA 1JPGB 2AKRA 3WGUB 4IEFA 1U2HA 2ZOLB 4S1QH 5F96H 2EKJA 3MZGB 2DL2A 4HS3B 3VFTA 1T83C 3A4EA 1I7TA 3M1BA 4NS0A 2EVFA 3DGCR 4KQ4H 1MQKL 4ILDA 4QDGA 3GNMH 4YJZL 2BMKB 3OKOA 2X4TA 3HS0B 1KLFB 5SWZB 2WJ7A 1CFQB 3E0GA 3UBXI 2R0KH 1OVZA 4E5XA 3MDJA 1EBAA 4HZAA 3VU2A 3WNKA 4MBOA 4M8UA 1XF2A 1AIFB 1LNUB 5FHAL 3K71B 4NZUH 2J6EA 1X5KA 1NAMH 1E6JH 4U1IA 3T4YB 1HHHA 3EGSA 4KROB 4L8DA 2IDTA 4B9YA 2CRMA 4TNVF 2AQTA 4JFHD 3PWPB 3LNFA 1JXKA 3MLPA 1GR7A 5F0MB 2VC2L 2OMVB 4KUCF 5C0DA 3PIQA 4MMYB 2E7LA 5E99H 5AW1B 1YUHA 4CVXA 4L05A 3TZVC 3VWJD 2FBOJ 4E41A 2ICCA 3NP3A 1AI1L 3MVSA 3WY1A 5GJTH 1O6VA 3QWRA 4LU5L 4AG4H 2Y9RT 3IDMB 1PYWA 3L3HB 3I3DA 1IE5A 3PHAA 4MDRA 1AHWA 1MG3C 5FWQA 3N1GC 3K3QA 4Z7WA 2PWGA 3Q9QA 4RGOH 3SDAB 2WGNB 3NJHA 5IREA 1T03H 5IW6B 1M1XA 5IV2B 2KI6A 3EO0A 4J23A 1HINL 1FAIL 5DVNA 4NM8H 3WKYA 3BQUD 1YMHA 2QQLH 4OH2A 3V6BR 5CD3B 4NWUH 1BZOA 2FX7L 4FQHA 4B60A 1QUNA 4WNSA 5D1ZI 3BEVA 3GJFB 3OV6A 4A2DA 4UNUA 2NRDA 4MVBC 5KVGL 2G2RA 3BMVA 1DQDL 3HN5A 4MMXB 3QR2A 5E2TL 4A7VA 4NQTA 5E6YA 4WWID 5DI8A 2ERJB 3PREA 2Z4QB 3M07A 2VIRA 4YNYB 5JIPA 1C9SA 4AV4A 4PU2A 1IM9B 4W9HC 4KTDH 5IB3B 2JF1A 3G04B 3EJUA 4JZJB 2X6CA 4HS8L 3RPIB 4XRCB 1MW3A 3D39E 2X70A 4H88L 5DJYA 4LAJH 4YHIB 3CXDH 2E9JA 5C92A 1A8JH 4ZW5A 1BYNA 2F8VA 4HX1A 5INCB 1OTSC 3UJIL 5ESQB 5IBLD 3DSFH 4PP2B 1D7CA 4JL2A 2J6EH 2WIMA 2ZKMX 4ODWB 4PJCB 4Q9BA 4X0NA 3NSFA 4XNQB 4D9LL 2FLRT 1R5VA 2K9UA 2CA4A 4I0PC 5JIKA 1LQBC 5T1LA 3PHSA 3TVMB 3MRNB 3OLGA 2YQBA 3TCTA 2V2XA 5KYYB 5EIIG 5ISZE 1MFMA 1V05A 3GSNL 4HAKA 3VXSB 5FYJH 4I18C 2W88A 2P7TA 1UT1A 1D5BA 1DZBA 1D5IL 3NABL 3OZ9L 2XA3A 3QBTB 4TQEL 3LEVH 3X12B 2EYTB 3V4VB 3BAKA 3UZVA 5IROD 1CICB 2XXCB 2YLHA 4XPTL 3ULUD 4GSDL 2IAMC 3NA9H 2ESVE 4MD5A 5AYUH 5EFIB 2Z93B 4OFYA 1BM7A 3N9GH 3MROA 2XWTA 3IFLL 5GXBB 4PLJC 1LXMA 2UY7A 5IMOB 1U8JA 2DW5A 3U46A 2DM2A 3GSUA 3CVIL 2Y2YA 2W0FA 1RLBA 2X7LA 5C09B 5BW7C 3D9AL 1A9VA 4NUMA 4JAMB 3D30A 3VFNB 1U58A 2IBZY 3M86A 1ZT4A 5D71L 3EZJB 3QIUD 4LSRL 3EAKA 5CEZE 4PJ5B 4K5OA 4BE6A 4IOSA 4PR5A 4QRRA 1CFSB 2VDLB 3IDIB 4R2GD 3R8BB 1J8KA 4GAJL 2I9LA 1FFOB 1RFDH 3KYKH 3K6IA 4AC4A 4UOW1 3PAUA 3ARSA 1JNNL 1E3XA 3S96B 2VISB 4NZRH 2IPUK 3EJZD 3ML9A 1MFEL 4MJIB 4WUUB 5DMIL 5FYLL 4DW2H 5E8EA 1QHOA 5E03A 2N3JA 4EN3C 4QJ4B 4RFNC 3OKMA 4JDVB 2C1OB 4K7PL 3I84A 5K9QG 4QMEA 5HY9B 4PG9B 5T3ZL 2LR4A 1CXHA 3RVWC 4OD1L 3EHBD 5I0DA 2VYRE 3THMH 3RVTD 1URLA 3U9UA 1CF1A 4XP4H 4DT2A 3ATAA 3TYFB 2DWEB 2I25N 1CFNA 3GHEL 4P48A 3UTSD 4NEHB 2CLVB 3KBFA 1MHCA 4U4BA 4WO4B 1QWNA 2W60A 2ZQKA 4WEUD 4ZODA 4B5EA 4DUVA 5AFAA 2FRGP 2FNWA 3QIWB 5AB9A 1ZSDB 3E1F1 4HUXB 1JHTB 3O3AB 1WGVA 1JOIA 5C08B 5CZKA 3OXRA 4NRXA 3UBXB 3SKJL 4AENA 2IIJA 3FCTA 5IFHL 3LKSB 1EHLH 5I1EH 2X9YA 2Y06L 3S97C 4RWYL 2XPGB 5B8CB 4ZT1A 2MQ3A 5IM7A 2CUIA 1IT9L 3JYBA 1CB4A 8FABB 3ZMRA 5KSAA 3QDMA 2WLNA 1G6RB 1KT2A 3UAEA 4J5VA 4W1TA 1I9RH 1P7QB 4WGKA 5EO9A 1QFWI 4P9HH 4ZNCD 5JQHC 4X4XA 9PCYA 3X1BA 5PCYA 3J7HA 3V9CA 4XR8C 1I1AC 5L4JA 1TITA 1UQSB 4PRHD 4RIRA 5ANMB 3NMEA 4S0SD 1U8NB 2LU4A 4U1MB 2CHNA 2ZCKH 4GAAA 4JM4H 2YRBA 4PI0A 4P9ML 3UZEC 4GP4B 5ADPL 5L2JB 4BWWA 3F12A 4NSKB 3AXHA 3L08A 5CGMA 1H8OA 5E8DL 1G9NL 3FN0L 2VR5A 3G3LA 4OIAA 3U4EA 2GFBA 1JUFB 1NBVL 4LL1A 3S3BB 5CLZA 4KK5D 4L4VE 4I0CC 1JRHL 3BQVA 1IEHA 1DDHB 5DJZA 3V4VL 3BP4A 1NANI 4B95C 2XACC 1XT5A 4Y5VB 1FZJA 3LKQB 2GT9B 3GMLA 4JQVC 5KS9B 4ZXBC 1T1XA 4NUPA 5ICUA 1TEYA 1X44A 2ZXGA 4I2XA 3LHPL 3AZUA 3SGKC 3AW5A 4CC4C 1JWMA 4OU3A 3IETB 4NT6A 3B2UD 1EHXA 1JXDA 3O3BB 4LQ1A 1G9EA 3CZKA 3E2HC 3MN8A 4KVCH 3BO8B 5EO0A 4PJEF 2H6PA 1R9FA 2XWXA 3K6FA 4OZIB 2VDLL 1ZANL 3H9HA 1ZLWK 1NWOA 1TKWA 2ZSVB 3OGOE 3MRBB 1RMFL 2VLLB 4G8GA 5C0AB 3O6ML 1HOCB 2WMPA 2I5YL 3PHOB 3HC0A 5T1DL 3VRIB 2ZIDA 5LDUA 2FVNA 3VI3F 4GUQA 1Z9SB 4PREB 1A7NH 3TH4T 1OE2A 4MQ7A 4P2OC 4QTHA 1H15A 4JFFE 2BP0B 4DOHE 1MVUB 3C8KA 2IVFC 4FZ8L 5AZEH 3EYFA 2IMNA 3QA3A 1EO8L 4XBMA 4JFDA 3PWNA 5D2NE 3WTSA 2BSED 4YK4B 3OHMB 2OQJA 1FL3B 1F45A 5MEQA 5GISL 1EZUA 2IJ0C 2VN5A 4G2AA 1N19A 2FYYA 2QPUA 4XVSH 2DMCA 1J8SA 1JHLL 3MXVH 1DANU 5FOBA 4QWWD 2WGXA 4JG5A 4ZAKC 1JE6A 3EH4B 3H85A 4F91B 3SBWC 3ROOB 1REIA 4O58H 4JG1H 1KB9J 4QTIL 5C0BA 2Y07L 2OK0H 4R4BB 2PW2B 5D7EA 2QELA 4GMTH 1JYVA 1PNDA 4P2QB 4L4TE 3RAJL 3HUJA 4I3SH 1N8ZB 1N3NA 1F02I 2DKUA 2YSSB 5HGHA 1DJGA 3U6RA 3SDYL 2FQDA 5IVZB 4WK0B 5SX4I 4GAGH 1C12A 2Q6WA 3L3JA 1CZ8L 2MNWA 5F9JB 1WAAA 1JWSB 4JDEA 4YHPA 1G6RL 1U36A 4OLZH 3BVNB 1LEIB 3C09B 4KK9C 4PGEA 2K0RA 5D2LA 1IJ9A 1U3HD 2B2XH 1HOEA 3WHXA 4KUZH 2ILLA 2XQ0A 4NIYE 4DK6A 1N9PA 5FWRA 2WYZA 3QARA 1NEPA 1CLCA 4OAWB 4R26H 4LOFA 2EEAA 5DT1H 2A9AA 4HT1L 5D4HA 5E4AA 2GJZA 4R3SA 4AYSA 2J1XA 2K7QA 4GRWE 2Z8VC 5JQIB 2O93L 2GG1A 4NRYA 3HS8A 4FFZA 4OZFG 4H8PA 4D0CB 1PMYA 1U8QB 1HSAA 1QO3B 3RI5K 1RURL 4KXZI 5KANG 4N5UA 4RBPH 4D9RD 3EDJA 1IEBA 2F53D 4MXWH 3RVXD 5KSUA 4JFZL 2CSPA 2VLRA 1N4XL 1RJZA 4F9LA 2DEWX 5HYEA 4UBDC 4ANKA 1PZ5A 4X6CA 1YG9A 2HFGH 3S88L 3VG9C 4BH7B 5L4MA 5F1SA 3VD2A 2H3KA 2EZ0D 1SLUA 3O9WC 4H26B 1BFTA 4RESB 4WDIB 1VCBC 4IK7A 3RFZA 1FVDB 4L8BB 5GS1A 1BGXH 4GW5B 5T3XD 5D7LE 4ETQB 4IS6B 4K8RH 5DD5H 5FKAB 4YDNA 4K5PA 1V8HA 5DQDL 1CDHA 3D2UD 2BOBA 1CDBA 2AQQA 4AW4A 1QLEB 3GMPA 1NLDH 1SLWA 2VW4A 5AVYB 4PJBB 2WVTA 3BZ5A 4QD2E 1D5RA 2RGSA 3CDZB 1MXDA 4JM2F 3MC0A 2D8KA 4CU8A 3SE3C 1ETZB 2BNQB 2VQTA 3BAYA 3D3VB 4XMKH 3JWDC 1KLUA 1RULH 2BIHA 3PV6A 3R18A 2R8SH 1VEOA 2I9TB 3BE1H 1FNFA 1HI6A 4XZUB 3RTQC 5T8IA 1G1KA 3R0NA 3F7RA 5D1XB 2FE0A 5DK2A 5GJSH 3HFMH 5B1CA 2VZUA 3UACA 3U9PH 1D5XA 4W9KC 1JGVH 4Y1AB 3F84A 4ZPTA 3FUNA 2YAQA 2VN6A 2OMYB 1HYRC 1TMQA 1AC6A 1G84A 4LK4A 1TETL 3S8FB 2ED7A 1Y18B 3NSYA 4NHCH 3MLXH 2AJVL 1DQKA 2BCKB 1CXLA 3F58L 4XN9A 3DO4A 1R3KA 4PJFB 4GQQA 3QYCA 1S78D 1D9KB 2DQHL 4TLKA 3SPIA 1W8OA 4EJ1C 1BQUA 1BQRA 2CJUH 4FFZH 3S3JA 1WIPA 1AE6H 3LQMA 4QHPA 2VUKA 4RZCB 3ZKND 5K59E 2EO9A 3TCXA 4HK3N 4C47A 3QEQB 1MREL 2V9QA 1XGPB 4P5KB 2VSKB 1XDTT 1NCUA 3II1A 4WZ9A 2VRKA 3QAZB 4A7SA 3IFNL 1X9UA 1KPUA 3O81A 3P0GB 1GGIH 3KPQB 1PNCA 1UD4A 3NAAL 4W9FC 3RNQA 5FUZH 2R15A 1KBGH 1W15A 3D52A 4ZFQA 2NY2B 3ABZA 5EBMB 3FUFA 3GBDA 4LL9A 1I7ZA 3QEGH 1AKPA 1S7VA 3VX1A 3U6XS 3OMAB 3O6KH 1VFMA 3Q6FB 1QW9A 2AJ3A 4BQ6A 2QMKA 2FJGB 2P5EB 4UQEA 1N26A 1QFUH 3MLWL 5DTFB 3VXRA 4P57A 1PAZA 2PCPB 4ZUUB 4U4IA 1GAFH 3ASWA 2JXMB 4LLVB 5IQ7H 3KLAA 1MWOA 1QI3A 3QUXB 4HMEA 5E2UL 1DBAL 3QXDA 5ICZA 2LGNA 1GGUA 5B21A 3TTSA 5MI0B 3US1A 3OAYK 3TIEA 1WK0A 4KY1H 4FI6A 2CA3A 1IQWH 4U1SA 2VW7A 1QVOA 3F04A 3HMXL 3GBLA 3IXTA 1FN4B 4KUCD 3D48R 1U33A 2V9UA 3MTRA 3VWJC 1BIIA 1HHKB 3MKKA 4GFTB 3SO3B 3TX4A 4B6ZA 4QHLA 4ZS6D 1AP2A 4D0DB 1FGVH 3HC4H 3GZOA 1KGWA 4WWKD 5EIVA 1L9PA 3SJVB 5EOTB 3II3A 4RCAA 3IDJA 3LD8C 5EU6B 2GB2A 4YHKH 1CBVL 1W8NA 2QVMA 5HD8C 3WLBB 5GRYA 4B9FA 1G5AA 1PQZA 3BWAB 4M48H 1AFVH 1AQDA 2FSEB 3O41B 4XPGL 1B0RB 4AEIH 1QLEL 1LYQA 2EACA 3Q3GB 2YFOA 3WS3B 5TDOA 4M3JA 3BQUC 3SDDA 5DD6A 2XQBL 4J3XA 1U8KB 1X7QB 2WUCH 1ZEAL 4OGYH 2ITCA 4K7FB 3WIHA 4OIIH 3TO4A 3QO0A 2R23A 3Q6GL 3MV7A 1DE4B 4NQEB 3Q5YA 3WKML 1A65A 4NCC1 3IAPA 2ZKHL 1RZQA 2K1MA 2DJMA 4J2XA 5IR1B 3M45A 1ADQH 1YEGL 1MHPL 1TYJA 3MOAH 3UTTE 2XZAL 1FLRL 4FRWA 5KBPA 1Y07A 3QIBB 3D6GA 2IG2L 4XWGL 3VYOA 1DEEB 4EQ2A 4HC1L 5AW0B 2IGLA 4P04A 2EEFA 2P5WB 5BVPL 4HWZA 1FZMA 4QKXB 5DFVD 5HHPB 1Z9LA 4OFIA 5IVOA 4B9CA 3HZMB 2BHFA 4ELKB 4OCRH 3T09A 4N2AA 5BXFA 2G2NA 5IKCA 4P5RA 3VRLE 3AC0A 1UD5A 3ARYA 1AO7B 3FB6B 1TQWA 1FL5A 3NJJA 4NB7A 3DTDA 1AJ7H 1IAII 3OR6A 2Y1VA 2ZWNA 3NQKA 1S7WB 4JK0D 5DWPA 4Y19E 3L3GA 1A6VH 4BRVA 1CL7I 2A83A 1BZ9A 3IU4L 3K8KA 2AZAA 2ICES 5IROC 1MZYA 3UTZB 1S7SA 1XV8A 2VW6A 1NWPA 5F0PB 2WXKA 5J89A 3ULUC 3CC1A 4BV1A 2X28A 3QPQD 3WS6C 3GF8A 2N1TE 3V5KA 1KGCD 2HWZL 3QFDA 3O4OC 4LSTH 1MPAL 1CYGA 4QAMB 5T5NF 2CCVA 3GLAA 1ACZA 1KIUA 1P9MA 2L04A 2V7NB 3ATEA 3LS4H 4X6FB 1OSPL 1M2VA 1IGCL 3DTUB 3GJEA 4FX5A 4NKOA 4YR6A 3FMGH 3CPLB 1BDYA 3FSWA 4KTYA 4D8PA 2E76C 3GSOA 4CMMA 4U6XA 3WIHH 2NY6D 3SY6A 4ZQTA 3MAWA 3GXUB 1E5ZA 3EJZC 4Y16D 2DMGA 3T3MB 1H8NA 1OTUC 1GZPB 1JV2A 4YE4H 3IFOA 2XG5A 3HAEG 3FQ4A 1RP8A 3ZR5A 3IDNB 1CLYH 5JORB 4EDXA 2R4SH 1JNLH 3EHBC 3MRKB 4GOSA 2G5UA 3IDXL 4PI2A 3RVTC 3TBVB 4IW4C 2ZCLH 1FYTE 3RA7L 4FTDA 1UTDA 1JK8B 4S11A 1L9NA 1OZTG 1HNYA 3GIVB 2HKFL 3VE0A 4XX5A 1M1SA 2IV9A 4IRSD 5A2KH 1UVQA 5EUOA 4K9EH 2E27L 1MI5E 1NM9A 3AG1B 2CK2A 3IAQA 3JTSB 4FXTA 1BD2D 3BYYA 3NFSL 1QNZH 3TWYA 1V55B 1FZOA 3AGWA 1AS7A 2YJLA 4O02A 4TSCH 1N67A 5I74B 4YO0A 4TTGA 3AB0C 3LKPB 1J8HB 5GRWA 5AD0A 2H5UA 1OGAB 3AAZB 3G6AA 4ODXB 5HYFA 1PPIA 4NN5B 2VXSH 1UATA 2WXHA 2WQWA 5DVPA 4ZYKA 3AS1A 3DRTB 4FFTA 3KPPA 4AJ0A 3IDYB 2BY1A 5D7KE 3VXMA 2FX8L 2WLZA 3APDA 5B38G 5IUSA 3HA0A 2VWEE 5LGHL 1TFPA 3W5MA 2XTJD 3L16A 4OFKA 1D6VL 4XNXH 1YEEH 4P3CH 3D09A 5DUBA 1J5OH 4MD4A 4GS7B 3AMKA 5FHBH 2NZ1A 1C16B 1L0XA 3GD1C 1C08B 5L88H 2X89A 1F58H 3Q9PA 5CFAA 5J11B 1BVOA 2Z1PA 1F4YH 4GQ9L 3BAXA 1ZGLB 1P84J 2DRUA 5FOJA 1T1YB 4KI5E 3AREB 4JFED 1UENA 1ILSA 4NNXB 2CBMA 3AABA 3I75A 4OZFA 3VD3A 2GBTA 3ARUA 2YQ2A 5DA4A 5JPMA 1UOWA 5DUMH 4MAYA 1THAA 2VLJE 4Y2OA 3O45A 5IVXB 4H8WH 2A74B 2OR9L 4TVSa 4UQ3B 5LG1A 5EDXA 1AQ8A 4HZLA 4I3GA 1XD0A 2WO3B 4M7KH 4O9HL 4MNHA 1HT6A 2HTKD 4XP5H 5FYKD 2A4EA 3HPJA 4PJCE 3ZDXB 2GUYA 2ATPB 1AGEB 3MRRB 3B2UC 5F3HB 3X2QB 3W0WB 2WKLA 2PXYB 5D7IF 4F7PA 3UZQB 3GJFK 2VH5L 1MOEA 4O4YL 1NLBH 1WC7B 4GRLA 2P8LA 3PWLA 4JL1A 4HJIA 4TVPH 1H3PL 3W81A 2HFFB 3GHBL 4QHMA 1E2WA 2GK2A 5AWNL 1ES0A 3QDAA 4UQ9A 1KTLA 5HPMA 1V10A 3ABGA 1OSZA 5DU7A 3QIUB 4ZDHA 3ZR6A 3QWQB 2ZSWA 1M4KA 4O02H 1T04A 4R2GB 3DETD 5HHNB 4PJAA 4XNAA 2K7PA 1S8DB 3ZL4H 3BP5B 1JPTH 1Z9OA 4R4FL 4QRQB 4MNGB 2HT4D 3HG5A 2AJYH 4KKNA 3BI9X 1YYLH 1IC0A 2EIDA 1NFDB 5I5JA 4UV4L 2PMZA 3ES6A 5K9OB 1EGJL 4UT6L 4ES8A 5F72S 1PX8A 2XCMC 1HNFA 1SFDA 2W65A 4GG8A 1ZD6A 3KYAA 4PUBH 4QWWC 1NQBA 3EGXA 4Y1SA 2DYPA 3UG5A 4YHYB 4OCSL 1JV5B 1ET7A 5I8KL 2XNAA 5L8KB 1KY6A 3MBEC 5MENA 3D18A 4ZW6A 1RZGB 1WITA 5GZNA 1PG7H 1PF3A 3NTCH 4E41D 5JR1L 4UB0L 3MRQA 1JZ5A 2UUDK 2J1KA 1G87A 2FBJH 4HUWA 4NZJA 1GOGA 4QHKJ 1L0QA 4QHUB 4EDWL 1VPOH 4OZFH 4Y4FA 1IC4H 2BSSA 2FWLB 2RHEA 2OZ4A 4XMLH 2QFPA 3WJJA 4ODVH 2HJLB 1ZWIA 1QBLH 4LOVA 3RGVA 3OKNB 2X1XR 1QSFB 4WNQA 1ECYA 2PO6A 3IJEA 2J44A 1RZKC 4Z1PA 1BW8A 1EBPA 4ZO8A 4PGBB 2F54D 5FK9A 3KR3L 1TTGA 3MJ8A 3ZXAC 5FKPA 3FN3A 2FATL 4BKLA 3LZQA 2W94A 1U21A 1AXSB 3CUPB 1YNLH 1SVBA 2EKSB 4HAGA 4P23B 3S36L 4M7JH 1LTXA 2K4AA 3OTTA 4IIQB 3MLSH 5TE4L 4BRJA 4JFQA 3ZE1F 5JYMA 1WQVT 3D0VA 2NXYD 1NGXB 2E4FA 2XETA 1E5YA 2MH4A 3PP3K 3TGXA 1ZMYA 3U1QA 2I24N 1O7SA 4HS6A 4ZUSB 1HXYB 4NQVB 1S7TA 2OMZB 2BHZA 3BJ91 4M6NH 5F0LB 4XOAA 1IQDB 2R83A 1B88A 3AM8C 4G43A 1Z5LA 4EBQH 4TVUA 4N2CA 4FQJL 4LHJB 4X6BB 3WJLA 5HDWA 3GO1H 2FJHA 2ZNXA 1TF4A 1NCJA 2ADIB 4FFVD 3S5LG 5CJQH 5B1JA 5T1LD 5E2WL 4QRTB 4X8JB 5HYJE 4A63A 3MR9A 1DTUA 1NCOA 4R0LB 3FF8A 2HJFB 1QWUA 3K2UH 4PJIE 4L37B 4EKJA 2R2HA 3NN8B 3IMBA 2BH0A 1W0YT 5EF2A 3I6KB 4JVPA 1BECA 2FT6A 4UIMB 1JGUH 2N0MA 5KS9E 4UM8B 1KV3A 5JOPE 7PAZA 3IGUA 2YMTA 4PRAB 3CQQA 2MPAH 3ML8A 2ZJSL 4ZMWA 4KPHH 4IBLT 1O75A 2B20A 1U6AL 4NQDE 3KXFB 1YPZF 3MLZH 3LPOA 2ED6A 3CHOA 4CW1B 4OJAA 4KQ0A 1UZ6F 2OZ4H 5I1JL 4Q74A 2B0SL 3KLQA 2DH3A 4DZBA 2GQHA 4FL4B 2E74C 2FT8A 2E0PA 1BVKA 3EG9B 4Z7VE 3WEAA 4QRRD 4CJ0A 1CL7L 5DRZA 4PG2A 5ALCL 5IMKB 4L5FE 4URKA 4JFSA 2BS9A 1JZ3A 3C6LD 3PGCA 4P59L 4WW1A 5IBTL 4IBQA 5AW9B 3U0TA 1Z3GL 2G3NA 2H0JA 2VLKA 2B59A 3VI4F 4OZHA 3SE8H 3STLB 4PRIA 1F4HA 2NXZD 3BVDB 4R7XA 3BKJL 4XE5B 4HCRL 1S78C 2X9WA 1KMGA 1IKFH 2D73A 4Q56A 4N1CA 1HH9B 3C60A 2FNBA 4J28A 4LSVL 5GSVA 1EMTH 3OX8B 3ZKNC 2XN1A 3KPLA 5LGYA 1U3ZA 3N91A 3X13A 3RUGF 1U41A 2YMXL 3CZJA 1OAZH 3C5XA 4BD4A 3B5TA 3U7WH 1X7SA 2A1WH 1EEYA 3QEUA 3FQWA 4F7MA 1YJDC 1NKGA 2UYLA 4QJ5B 1QFHA 2OW6A 4KHTH 4ZG1A 3LKOB 1J1PL 2AAVA 1H6UA 4Z77A 5D1QA 1OHZA 1E2ZA 2MNUA 3MZTA 3B2MA 4EVNA 2JB5L 4Y9GA 3VXTA 4PSPA 2OJZL 3UPCA 1ACYL 5AOLA 1OAXH 4LCCB 4QRPD 2D31B 2IFFL 1JG9A 9CGTA 4J7RA 1LMKA 1RD6A 4JO2H 4P46D 1OSEA 3S37L 1I9JL 2Z7YA 3H9SA 3GSWA 3QCTL 5AVUB 2J7LA 3MLRH 3CFQA 3S8GB 1RI8A 1DLHB 4JJHA 4P2QE 2FQEA 4BFGA 1EJOH 3MJGX 4U6VL 1U3HB 2BS8A 5CEYA 3OLDA 1YLBB 1SJEA 3LXAA 4PLOB 5EO1B 3ULVH 5E6IA 4YDJA 4ENZA 2PYEE 3BKCH 1USZA 1I3GH 2EAEA 2MEJB 5FDWA 4MSWB 5FF6B 3QYNA 3N41F 3FSOA 1F3RB 4JO1L 4RWHA 1DBBL 4BK5C 2YBRB 5AQ0A 3QDMD 3Q1SL 3DIFB 3HNSL 2PWFA 4MA7H 3QNXA 3U0WL 1Y7VA 4APQB 4FXKA 1LD9A 2BVPB 2EADA 3C12A 4BCXA 2CLZA 5CP3A 5F1OB 1SHSA 2F53B 4HUVB 4ZS6C 4HBQA 3BAJA 4Z7NB 4WKZB 4L3FA 4OSUL 4WWKC 1E42A 5ENWA 2A5UA 4KNUA 1BAFL 2C3HA 2OSLA 5B1BB 4AEEA 2OMWB 3HAEA 1CTNA 5K69A 2AABL 3KNBB 4U1JB 5DJCB 5I6XC 5DO2C 1HTYA 2BINA 3WUWB 3E38A 5D4JA 3HE7B 2QQQA 1WWWX 2BVYA 4I9WD 2P8PA 2AXFB 4OLYH 3VACA 3L7FA 4UOZA 3T1WA 3Q8EA 4OT1L 1U30A 2BXYA 4NKIL 4RAUA 3WXVH 4NX0A 5C0EB 1N2RA 2ADFL 1OAKL 4G3YL 4G9FD 1A3ZA 5E6ZA 1FI8C 3L95A 1DCEA 1Z32X 3AQZA 4YSOA 2CJ3A 1KPVB 1UD6A 3O8XB 4JMXA 1HZHL 1V7NH 4BA8A 3C8DA 3HVNA 3K4AA 1NDGA 3KS0J 1LO4H 2W0KA 5E8NA 3EH2A 2R4RL 3VNYA 3F6IA 4C56E 4DVRH 5MHSE 2R2CA 2O26U 1DQJB 1A6WL 3ETBF 3ARGB 1UM4H 1SMAA 3QULA 4TLUA 2ZKWA 4WU7A 3BP6B 4RFEB 3ZE0B 4M03A 4AH2B 2VXTL 2W9DH 3S5YA 2EVJA 4HISA 1KPRA 1DVFA 1N0XL 3GMMA 2BY3A 5CHNA 5T1KD 4IBZA 1NFIA 2F74B 1R47A 3SOBL 3SQOH 4JKMA 1R3LA 3CLFH 3HC3H 5I1GL 3V6FB 4G8GD 4PJBE 2X6VA 3S4SB 1RL1A 1VF5C 4PJXE 3S35L 2FH8A 5ACLA 5B38A 1PD1A 4HUKB 4Z7QE 1DBKH 2KBGA 3F62A 4X5XA 4KZDL 1Z7JA 2Q5BA 4AGNA 3RX8A 1CDUA 1TQBB 2R7EA 3L3OB 3CFNA 3ESUF 3K1KC 3NJMA 4GYBA 4HIHA 2FGWH 4JFDD 4K3GA 4PTTA 3M46A 4ZX4A 5CXPA 1XO8A 3A4AA 2Z8WC 3GUFA 4R5TA 1T7VA 2A6JB 4RRPM 1JCVA 3HMWH 3MBXH 2J8UE 5CMAA 2HJKA 1P0SE 4LP4A 3F7PC 4NM4L 4QY8B 3QPQC 5CP3H 1KJVB 3UYRH 4J3WA 4X6DF 1WWAX 4NBXB 1A64A 2CMRH 3H42H 2NX5B 4HCIA 4QAWA 4Z5RA 1H19A 4AM0A 1ZVSA 3DIDA 3MPCA 1U8CB 2FLBT 2X38A 3VXQA 1KLGB 1G7QA 3HAEH 1Q94B 5C0BD 3DLQR 3SPVA 1N5AA 1GHFH 3LQAC 4L8SB 4W9LC 3RWJA 4HKBA 5JNYA 4JGJA 4N9GB 1E4WH 2FWSA 5CJXA 1Q1JL 2FO4B 2EE2A 4PJ7E 2GSGA 3BVTA 5EPMA 3V6ZB 4V1DA 3FT0A 4LMQI 5B3JE 1OD9A 2Q8BL 5I8OH 1LE9A 5H35A 1I8AA 2ZYIA 4ANWA 2NY6C 3MMEA 4W9JC 3AY4C 2XPYA 4OV6F 1OP5K 1LO0H 4LOEA 1ZTXL 2YZ8A 1T7YA 1SY6L 4NGHL 2B1OA 3EFFA 1FIGH 1ZXKA 4ZPVB 2R56L 2O72A 3JUYA 3QDJE 3IMUA 5FA3B 1GGBH 1QQDA 1KIRA 2CIKB 2Q76A 4J4PC 4JQIL 3I3BA 1F1DA 5DFTA 5J5EA 1E4HA 2P5EE 2WN2A 3RZWA 2YD1A 1NBQA 3A21A 4YSEA 3N6YA 4L1LA 2EIJB 2BVQA 3SYPA 5J9PA 1UWXK 1J1OL 5INDA 3K6SA 1P1VA 1RHHA 2C9PA 1WH0A 5EOCH 3DJTA 1CD1B 1M7IA 3LZPA 3OJDB 3D07A 4Z18A 4IRSC 4HKXB 1SXNA 4L0PB 1U8IB 2Z4TA 1AZCA 4XP6L 2CLRA 3TXAA 3RJOA 1NUDA 4YHOH 2KT6A 5TK4A 1PD6A 1IM3B 4FKEA 4DVBB 1Q9KB 3PFQA 5AKSA 4BSJA 4UU9B 1RXLA 3EO9L 3T4AA 5DWUL 3VGAC 5T5NG 5I1IL 2RACA 4OFPA 1TU2B 4CSPA 2IADB 5FO8A 3CVHB 1LDPL 1AHMA 5DJDB 3QQ4A 4RQQA 2NY5H 1VRSA 2O5ZH 4JZOA 1VEPA 1SXZA 4K94L 2GBAA 2OTWA 3CVBA 5EHFA 4NPJA 3OXSB 3QQ3A 1KCLA 3TBTA 4KITB 4QCIA 1T6VN 1F11A 4UM9A 1UYWL 4YSRA 3SDXB 4EI5A 3BVVA 4PJ8A 4UQ2B 2DQIL 2XTJC 4KI1A 1AMXA 2H8PB 2W07A 1JNHB 1S7XB 5LG6A 2PR4L 5A7EA 1U91B 1FPTL 2QKIA 5HHMD 4XPHL 3APFA 5K9JL 1XF3A 1J9RA 3BH4A 3V4UH 4LAQL 3W56A 4YXHH 3FK3A 5E9DB 4YIQA 4L8CB 1UCBL 3R06A 1LP9E 3DX8B 3OAWA 5DZVA 1MLCA 5I73C 5LXGL 2O6EA 5IHUH 3W9DA 4YDIL 1ONQB 4PJDF 1FH5L 4IRJC 3RWCA 4PJ9A 4NYLB 1H5BC 3NJGA 4FQQA 5GS0H 2ZUSA 4W6YB 3REWA 3UPRA 5J6GA 3P69A 2ZONA 4I1RA 1BX2B 4YSDA 5B39B 5E0FA 1XXDC 3TN0B 5I75C 5J0BA 2P5WE 5FW8A 4JHVA 2X2IA 3OPZL 4JREC 4M7LL 3TJEH 5L8LB 2HTKC 2MWCA 2ZCHL 3GEWB 5JOEA 1NKRA 4OZ4B 4OQ1A 4X50A 1KB3A 1L5GA 3TH2T 4D7PA 4A7TA 3HLKA 3I6LD 5DEFA 4J3OF 3WIIH 1Q72L 5B7EA 4LRIA 3L3KB 15C8L 1IFRA 1UADC 4K3HA 2X05A 3B9KB 2AV1A 1R5IA 2C4FT 1JD7A 5BNXD 3UP6A 3D5OF 4RISL 5AG9A 4Y8DC 3KE0A 1FNSH 1LE5B 3ZL1A 3NACH 4WW2B 4N0UA 3AQXA 5KG9B 4GUPA 1WIOA 4JO4L 4PYGA 5IQ9B 1ZLSL 4N6RB 3V9FA 5TDNA 2NT1A 4HOZA 3PGDA 3O2WH 4G7VL 4JHWH 4R6UA 1T4KB 3QUZA 1DQQA 4G71B 5AG8A 2CO6B 3A4DA 3LNEA 5AL8A 3KPMA 2Q7NA 2HT4C 4Y16B 3TPUB 4ZZKA 5FB8B 5DEGB 3IN2A 1HHIA 2E7HA 3OKLA 2DQTL 4BIKA 4OF3A 1FRGL 4XHJC 1YEFL 2IO5A 3QDGA 3MFGB 3ZIMA 1J5DA 1WBZA 4FZEL 5HVFB 4HCGA 2TSAA 1AZVA 1TR7A 2AP2A 4S1RL 3U0PA 2WZPD 3QQDA 5EEVA 2XN0A 4LKXB 4WI0A 4IJ3C 4JFHE 1NGWB 1BOGB 3I9GL 4EF3A 3MJ9L 1NEZG 4J27A 1NMCC 2IDSA 3CVHL 4DFIA 1W0VB 1UWGL 5DURB 3T2QA 3K46A 1G0XA 3MREB 3QSKB 5FV2A 4EZMA 1AHWC 4F7EB 2YD3A 3QUYA 5I2IB 2ENYA 5F3FA 4L23A 1BFOB 3CCHA 1FNGA 4HZ1A 5ITFA 1GGCH 1UXWB 1AKJA 5F6IC 43CAA 4A7GF 1IV8A 4A04A 4IMLB 1P4IH 1RUAL 3KJ4C 3T04D 3CSBA 2Q3AA 1DUZA 3REVA 2CGRL 1LO5B 4ANVA 4WI7A 1SZNA 1JERA 4G6MH 4YH6A 2BIOA 3D4ZA 1NH6A 2IPTH 5AOJA 5F9OL 1FYHB 3CPUA 3BT2H 4YGVA 1Z1WA 3BESR 3BZFB 2NXYC 4FQ1H 2G75B 2C3VA 3D85A 5ES4B 1WT5C 5PAZA 1KTDB 2BSRA 4TQIA 3HBGA 2WLLB 4ORZC 4GXUN 5I1DB 1MLBB 4FE9A 2PW1A 4KDTA 4TLSA 3MNZA 1JF6A 1NCBL 2JLPA 4FQPA 4JFEB 3COOA 5F7LB 3H54A 2QGEA 3BN3B 5AZUA 1FHGA 2Z35A 4ZMOA 4N0RA 2GC4C 2XTSA 5EULV 3B2PA 1FP5A 5BJTA 5I5RA 4DQOH 1NOLA 1AS8A 1ZGLM 4K3JH 1ZT1B 3FFCD 3KM2A 3FU3A 4NP4L 1KWKA 3DBXB 3FAXA 4HPOH 4WWPA 2X87A 3P3TA 5MERA 1OM3L 2XI9A 2QTEA 3SGJA 3CSYA 2HPTA 4FG6C 1IAKB 3DK2A 4PRPA 3GPEA 1JZHA 4A2FA 2HG0A 1XMEB 3PGFH 2AEQL 3B37A 5C07A 3ZDYB 2VUYA 1FC1A 4G6FD 4U1NA 4DEPC 1WP6A 1I1FB 3OG6B 3DC0A 4P9HC 1MSPA 5I26A 1FV1A 3FCSA 2R1WB 4E42B 1QEWA 3PS6A 4QRFA 4FCHA 1QNIA 4M1DL 3DIVA 3QZLA 4OCWH 3ULUE 3ELAT 2AK4A 4IEFB 4TRPH 5IFAL 3ARRA 2PNDA 4XMZA 4XX1G 5E4IA 4OCXH 5EORL 5F7MC 3MV01 3VFTB 1UUSA 5K5YA 5E24E 1I9IL 2N7SA 5DD1L 5L9DL 1BBDH 3QC5X 4ZX3A 2XXFA 3OKOB 2A7BA 1KB9K 1DO6A 2X4TB 4JO3H 4RLDA 4I3RL 4E5XB 3C6LC 2YXMA 4FTVB 5HDLA 2NXZC 4FNRA 4PMEA 4N0YH 4U1IB 5IIEB 1HHHB 2PP9A 3OG4B 3MNVA 4FLRA 4BUHA 3EGSB 1GPOL 2CCLA 4L8DB 3UYOD 3U4KA 1SDAB 1DJYA 3D50A 3I50L 5DMGD 2CALA 2V8LA 3HRZA 3AUWB 3EYUH 3ARPA 4MNGE 2ZYSA 5C0DB 4JPIA 1UEMA 4KRNA 5F96L 1KBKA 5FX3A 5BOJA 1YUHB 2Z7WA 5LXVA 3NG5A 4CVXB 1A1MA 4DGIL 4N2FA 4KQ4L 2OJEA 4E41B 2J73A 2BVEA 5EZIH 4O00A 5A2IH 3BDYH 2WP3O 3HG3A 3UAAA 3WUZA 1RV6X 1U8OB 2R0KL 5MP6H 1PYWB 4TVPD 4Q14A 4LPYA 4P46C 4IMKC 4KOBA 4Z7WB 1D5MA 3UTSE 1E6JL 2DV6A 4UT7L 5D96C 4ELMA 5CM1A 1M1XB 3EO0B 3C5JA 1JMXA 3CSTA 1YMHB 4UNTA 4F9PA 4NLHA 5BRZA 4CA4A 4I9XA 4H4NA 1AQMA 4N2IA 1QUNB 1Y1DA 2Y6SD 3BCDA 3BEVB 4M4RA 1NUNB 1NOFA 3HBZA 4LNRB 5GGSB 3VXMD 3OMIB 2AVFA 3K4DA 4OCLC 5DI8B 5CGBA 1CGYA 2JI1A 1T3FB 4AG4L 4E2OA 2VIRB 4PY8I 1TPXC 1I8UA 1MRCL 2WNGA 3NIFE 2NNXA 1ILUA 5DYFA 4RGOL 2AEPH 3UIYA 2D7QA 4MNQA 3POCA 25C8H 2ICWJ 4BCYA 4PTUA 2X70B 5DJYB 3V5HA 3B1TA 4PRHE 1OAJA 3CHXA 4HX1B 5IEKA 4NENB 1B90A 5BUAA 1FFQA 3MJ7A 3TFBA 3BZEA 2QQLL 1YDPB 3QPXL 2X1OA 5ID1A 3LHAA 4IRZA 5DRWA 4NWUL 2V33A 2CDFA 5FA4A 1UJTA 4MAYD 4CC1A 2YWZA 1C8QA 3S3PA 2ADYA 2V2XB 2X2HA 5DRNB 2AZUA 1KCUL 1DVXA 4WHCA 3CQPA 4Y1TA 2YK1H 2P7TB 4UQCA 4ZTEA 4NBYB 5LUMA 4J6RH 2WLHA 4HQQH 5C8JA 1OIOA 1A6PA 3EZ8A 3EJYD 2YHGA 4AM0Q 1KBPA 4MD5B 5FFGA 2VMCA 3RX9A 2IBGA 5D7SH 5L2KA 4MA1B 3RJDA 3CXDL 3MROB 2CG9X 1YQVH 4MRCA 1A5FH 2UY7B 1VB9A 5BV7H 3U46B 3GSUB 3IE9A 4TQHA 2GTZA 2W0FB 2X7LB 3NRFA 2IOMA 4YQXL 1IRAY 2YRZA 4K71C 5TFSL 2J6EL 3LVTA 2PWDA 2VZVA 1U58B 1IGIH 1K8IA 3KPRB 5FC9A 1CLOH 5EZJB 2EE0A 4PR5B 4AQOA 3C5SA 5ICYA 5FYJL 2HLEB 3VQLA 4NQCA 4BK8A 3AT0A 4P2RB 1M56B 4QKTA 4Z7OE 3E1ZA 4YBQD 4WGVB 2ENSA 4HUUA 3O6FA 4LVNB 2H7WA 4NUGH 2PR9A 3KYMA 4A2EA 1ZHNA 5F1IA 3ZKXB 1I1AB 3NA9L 3MHZA 5E8EB 5AYUL 4CSSA 3O3EA 3L6FB 3WTUA 3OKMB 1QA9A 1S4IA 1G9MC 3QE5A 3L4UA 3FRPG 1A22B 1YN7B 4BFNA 2P80A 3W9EA 1GMEA 5CFHA 4KQ3H 1AGDA 1F90H 1LLAA 3U9UB 1EUUA 3BAIA 3E6FA 1KFAH 1LDSA 1L9OA 2XVBA 5FCUH 1CFNB 1N10A 5GZND 4ONHA 4LLMA 2F1EA 4J8RA 2OMXA 4NPYB 4XNMB 3KYNA 3OAUH 2OR8A 4FEIA 1GJUA 2W60B 1SXCA 1N64L 3VG0H 1B9KA 1RFDL 4IRZH 5BVJB 2DYSB 1YMMA 4Y4FD 3WHE0 3Q13A 5EG6C 1CO1A 3UTQA 5IG7B 4DW2L 3DHJA 1HHGA 3FNKA 1XL6A 3RGVD 3OXRB 4NRXB 4IGBA 3FCTB 1OHQA 5FHAH 1NGYB 3GUTA 2WINA 3KYOB 1T20B 1TT6A 3QS2A 1Q0YH 1PY9A 4XNBA 2AJXL 1T2XA 2W0LA 3BUPA 1Y1UA 2RMNA 3N1FC 4S1SL 1F0LA 5IM7B 4F7TA 5EBWB 4U1KB 3THML 4GG6E 1BF5A 2YMOA 5KSAB 3QDMB 4PJHB 5CU5A 4XP4L 1KT2B 3T3PB 4B5ZA 4X4XB 1CURA 3LPPA 2X53A 4QEGA 5KZCD 3GIZL 4M7LT 4NN7B 2XBZA 3FHQA 5AZ2L 5IBUG 2EC9T 4RIRB 5KBDA 1YC8A 1COBA 3T2LA 5LGKA 1S5IH 1OP9A 2DY2A 4NO2B 1KLFA 2FL5A 4GW1B 4LU5H 3RWHA 3RRQA 5EU7C 5E94A 1FHNA 1UGNA 1XGUA 2QSTA 3BSZA 3F12B 4LDEB 4M93C 5BO1L 5EZLB 4D9RE 1AIFA 1LNUA 4ADGA 2FK9A 2CE6A 1PFOA 3PQYA 1A4KA 3RNKB 2GFBB 4QGYA 1VJSA 1WGOA 2NR6A 2VO5A 4TLTA 1OCCB 1H3TA 1JN6B 1TFHA 3R0MA 2XIDA 5DJZB 3W3BA 4G6JL 3ILDA 3GSVA 3ESNA 3T77A 1HE7A 3DVIA 1I9RL 5GGVL 1J86A 1B4JH 2AITA 2FX7H 1FZJB 3HR5A 4MMYA 3GMLB 3NK4A 1T1XB 3KW7A 3QJFA 4LGSB 3ULVD 5E2TH 3ZPDA 1DQDH 4WK4B 1UC6A 4I2XB 4FNLH 1WSST 5T3XE 3RJQB 2ZCKL 1JWMB 4NT6B 4BQCA 5D5ME 5SV4A 3DXAD 1F6LL 3HS9A 5EO0B 2H6PB 2FJFA 3L3HA 5DHYA 4PHXA 4P5MA 3H9HB 4MJ2A 4HS8H 3SDAA 3CXFA 1SHWA 2FH6A 4DQAA 1B4RA 1KYOJ 5IV2A 4AKQA 5LN8A 3TO2A 4XN5A 4AIXA 2WMPB 4LIQE 2B77A 2QV2A 2EYRA 2QGCA 4QLRA 1A2YA 2CKNA 2K8QA 1MRFL 3T0AA 3ARQA 5F9AC 3I02B 4CRPA 4WWOA 2BOLA 1OO2A 3C87A 4MQ7B 3D0LA 3NP4A 4QTHB 3W38A 4N8CH 1H15B 4MMXA 1GJIA 1R1CA 3C8KB 4WO0A 1K5WA 3EYFB 5C0FA 4JFDB 2VLKD 2DJUA 1TVHA 3MRLB 2A9DA 2OQJB 3EGDB 1D5IH 4PD4K 5E7FA 5AVWB 5MEQB 5IB3A 5E4EC 2JCCA 2FYYB 3ATDA 3C60D 3ZYIA 4WGWB 5FOBB 3VCLB 4LT7A 2Z64C 2AMUA 3BPOC 2NMSA 3DV4B 4YHIA 3PNWA 5DO8A 4MCYA 1I8LA 2X4PB 4ZQKA 5ESQA 3KM1A 5C0BB 1P5VA 3B43A 3BSZH 3NIGB 1WFMA 1OB1B 4ZSOA 5C0JA 2YS4A 5LN4A 1ZLUK 4BA0A 3HUJB 2A38A 2JJSA 5HGHB 5K9QI 1CF8H 5EU5A 3G9VA 3QNYA 5D71H 3EXLA 2ZXEB 5EU4A 5AZEL 3TVMA 3U6RB 3QUHA 3VFWB 5KYYA 2X4RB 4PV8A 3EJCA 3CU7A 3FN9A 3L3JB 4OLUL 3H9SD 3ZMNA 4YHPB 4GAJH 3MGTB 3LNDA 4NZTL 4PGEB 3V0VA 2EDOA 3X12A 4XVSL 3DV6A 2X40A 5CZRA 3WHXB 3CG8A 5DMIH 5KVEH 1MFEH 3DYOA 1UOLA 4ZD3H 3ARTA 3X11A 1N70A 3T0XA 5KVFH 1G1OA 4K7PH 2GJZB 4R3SB 3BH8A 4ZNEA 3EYVA 5T3ZH 1ET8A 4O58L 4U7SA 2YGOA 4OD1H 2J72A 2OK0L 4CILA 3UAJD 4GMTL 1GS8A 4N24A 1HSAB 4I3SL 3NEXA 4M7ZC 3VFNA 1PW3A 2DQMA 1F3DH 4PY7B 1I3UA 1IEBB 2B5IB 4N0CD 1A9EB 1SEBA 1Y6KR 2IEPA 3GXIA 2AQNA 2NQ3A 1HQRA 4GAGL 4PJ5A 5AVSB 1RH8A 2VLRB 3TJHC 3MXWH 1S7UA 2FQFA 1RJZB 4J3OG 5AW2B 3SBRA 5D72H 1D7BA 4Z76A 4OLZL 1MWAA 5SWSB 1KCKA 1PZ5B 2B2XL 4X6CB 3RWDA 4HK0B 2DOCA 4KUZL 1ZY9A 1IGMH 4WUUA 1CD9B 1ESOA 4AJVA 2HLAA 4OLVH 1K4CA 2Z31C 4HH9A 1JD9A 4MMZB 4R26L 1XCTA 2ZX9A 4I85A 1XB3A 4JDVA 5DUPH 3SKJH 1AY1H 2C1OA 1BHGA 4HSCX 3TFKD 4GBXA 4HF5L 1M9WA 3RFZB 1A6TA 5GS1B 1P84K 5E70A 3CFJA 2HUHA 2EXSA 2F68X 3K72A 1KY7A 3FAWA 3JTBA 2BOBB 2BC4A 1O7VA 3GMPB 1NCIA 3SE4A 3AWFA 5KW9L 2WIIB 4AVKA 4L18A 5HHMB 4WCYH 1TO5A 1ZSDA 4HUXA 1O7DC 3O3AA 3SDXE 4ENED 1KLUB 5EF1A 4P9MH 1OT2A 2ID5A 3PV6B 4M1CC 5CBEA 3D12B 4KO7A 4M02A 1GGTA 1HI6B 3UBXA 3ZKMD 4JKKA 5DJ8A 4RGND 1BGXL 2XV3A 5JHMA 4NI3A 4P2AA 4UAOB 1D5XB 4ZPTB 1NBVH 4ZUWA 4K8RL 5HJBA 1JRHH 8FABA 5DD5L 3FQUA 4XNUL 1JPSH 1G6RA 1P7KA 2O5NA 3NGBC 2CXKA 5CS7A 1P7QA 3CSGA 1NLDL 5DUJA 1MUJB 2VXVH 1UH3A 4U3SA 1R3KB 3IDGA 1UQSA 5ANMA 1FWXA 1XWVA 2UWEF 1OD7A 1IGYA 1ZE3C 5TDPA 1IGTB 1RULL 1N8OE 3VRLF 2R8SL 3BE1L 4G59C 2Q9OA 1P6WA 1IGFH 1QTYT 4V2BA 3I6SA 3CZGA 2UV3A 3N85H 1SXAA 3HFML 3U9PL 1KCBA 1RMFH 4LFHD 1MWAH 1P4BH 3O6MH 2JELH 1DDHA 1P9MC 4BSVB 1KGCE 1E4JA 4AYMC 4QUOA 1RUKH 4E9XA 4EO5A 5FIEA 1T5XA 1YYCA 3WG7B 4V1DD 3PP3H 2VDQH 1IFGA 2Y7QA 1SHMA 4HETA 5D1ZA 4JRLA 4FZ8H 5C3IA 4Q6IB 2FEDD 2CJUL 4FFZL 4MA8H 4Y9BA 4LGRB 4OGAD 3BC9A 4FQXA 4RMTA 3OMNB 5GS0D 3DMMD 3VXRB 5C2UB 3I85A 4DFHA 5I1LA 3BO8A 3SPJA 5GISH 1HXMA 2ZWZA 3G6JE 3KLAB 2FR4A 4OZIA 5DMGC 3V0WH 3QFJB 3VAEA 1EQWA 5I28A 3TIEB 3ZN6A 1A3LL 3MRBA 4X4MA 4L1BA 3DX3A 3DOIA 4U1SB 1GGIL 1HOCA 5AOZA 5C0AA 1QVOB 3IXTB 2PCXA 1RZIB 1QX1A 5DS2A 1KBGL 5IOPB 2NNAA 2Y07H 4QHLB 1AP2B 4PREA 1MF2L 2BZDA 4B9PA 3QEGL 1KEGL 3UCRA 4JO8A 1DQIA 1HHJA 2UZIH 3O6KL 4YZWA 2IPUG 1T80A 4QT5A 3CC5B 2PCFB 1MVUA 4JE0A 5HDRA 4NO0A 1DVTA 2IDCA 3IDJB 1R34A 5CCGE 1CZ8H 1QFUL 3FRPA 4YHLH 1PQZB 1G6RH 3MA7A 1FL3A 1GAFL 4GJTB 3DUUA 5KANI 1A7BA 2EICA 2HPOA 2XA8H 5IQ7L 3IWVA 3RB7A 2B8OT 1BD2E 3SDDB 5DD6B 5DQJA 4AYEC 3NCJH 4B3VA 2O61B 5B7FA 4BHUI 4KY1L 1M7XA 1IQWL 3TO4B 1BZQK 3IF1A 3QO0B 2R23B 1J0YA 2J1WA 3A23A 3MV7B 1BVLA 4WLCA 2ENJA 2GTWB 2HXAA 3IWUA 4IKKA 3GXNA 4UM9D 3BEWA 3T08A 2CR6A 4DTGH 1FGVL 3HC4L 4PJ8D 1RURH 4EZKA 2QQNH 5DEJA 1B2YA 1UD3A 4PVMA 4JFZH 1KGIA 4YHKL 4JR9L 4BEIA 1N4XH 3GTTA 2DLGA 5K93A 4M48L 1R0AH 3BPLC 3L1EA 2XTJE 5K33A 3H3BC 1J18A 3T2OA 4R97C 2GHWB 4RMVA 5D93B 3PL6C 4F1ZA 3S88H 2WUCL 2WO2B 4HWZB 1FZMB 4OAWA 4FABL 4OIIL 1QRNB 5FECA 1J0JA 4HGWA 5I1HL 3I74A 1KYUA 5JPMC 2G2PA 2AEWA 2H9GA 4QTFA 3B83A 3IBEA 4F8QA 5BXFB 5IKCB 4MAYC 5A43C 4XXWA 3TOPA 4JFEE 1FL5B 1D2OA 1G1YA 3C5ZA 3L3IA 4MLSA 5GS3A 1G9HA 4D0CA 1U8QA 3WNPA 2ZT9C 3HBPA 3L3GB 4HJSA 5DQDH 3MOAL 4GLRI 2A83B 2GIXA 1CFVH 2LLGA 3EJYC 1XX9C 3ASNB 1S7SB 3RWIB 4LHUG 3FYIB 4EIUA 3ZTDC 3BGAA 2OSWA 3EYOA 1M6UA 3V5KB 5FYKE 3QFDB 5M95B 1P7HL 2YRPA 2ZXWB 3ETSA 1N6VA 4PWGA 1RZ7H 4EQ3A 4PJCF 1ZK5A 3K5RA 3ZDYE 5JQ6H 5HHQB 1KIUB 2F08A 1Z3RA 3HZ3A 1XIWD 3PUUA 1SHXA 1CIUA 4OCRL 4Y9EA 3ZKSD 1CI3M 4GW5A 4ETQA 1JZEA 4IS6A 4PJEE 3A6BL 4LCYA 4FQCL 4NKOB 5FKAA 5AB2A 5F7EH 1Q38A 4NO5A 1NMAL 1TETH 1WYJA 1A6VL 2HX7A 3NIDB 3GSOB 4YBQC 3BD4A 4U6XB 4CMMB 1K2DB 4EI6B 1X7TA 1N6UA 5CZXC 3P02A 2VR4A 3N1MC 3TV3H 2NNRA 3EUUA 2DQHH 2IDQA 5CR8A 1JV2B 4XVTH 2PP7A 2H1PH 3BPCB 3IRCA 4JM0A 3D3VA 2XDHA 1DYZA 1X5YA 3CDYA 1OZUA 4EDXB 3UO8B 2Q10A 1YNKH 1IBYA 1QOKA 3VFVA 2BSTA 4DF9A 4PEEA 4JY4A 3IFNH 1SJXA 4GEIA 4IKLA 2MHAA 3LS4L 2LU7A 4AUUA 3VE0B 5GZNC 4CVZA 4M8RA 2Z65C 5DDHA 4M9OA 3FMGL 5EOCJ 4BGDA 5EUOB 4RRPA 4H2CA 4HC1A 2VDKH 3X14A 4KKQA 4ZTOL 1LK2A 4Y4FC 3OHXC 4GKLA 4AIZA 1SOKA 2DD8H 4PJFA 4E41E 1YY8A 1FZOB 3QUYD 1WE5A 5D7JD 5C1MB 1YEWA 4O02B 4YO0B 5KYUB 1AKJD 1CLYL 3MLWH 4HLEA 3AITA 2A6DA 2JTYA 3N2JA 4KK6D 4WFGD 4HG4K 3JVGA 5AD0B 3HZKA 1F13A 2R4SL 2P5PA 3QB7C 1I85A 2NY1D 2VOTA 4ZYKB 4ZMQA 4P5KA 5JIDA 1L6ZA 2XQYG 2ZCLL 1G5GA 3KPPB 4AL8C 3OVUB 2BSCA 3U7YH 5CSZB 1ED3B 1XB6A 4OF8A 1C5CH 4W4NA 3M7FB 2F54E 4K9EL 4JPQA 2EDKA 4AQAA 5DUBB 2UZYA 4UILL 5IB2A 5DS8A 1QNZL 5L0QC 3LH9A 4P5TA 5I16A 1MN4A 3CAFA 3OAZH 4EUPG 5FO7A 1QW8A 4X5WA 1MRDL 2FJGA 5SX5K 1PEZA 4WAFA 5DTFA 3QR0A 2CM5A 4ZUUA 1Q8MA 3M1OA 3UOAB 3IB4A 3ZVVA 1OEZW 4CN4A 3PNRB 1QLEH 2VXSL 3G6DH 3I75B 4OZFB 5CU9A 2Y7MA 2XQBH 1VSCA 1E8YA 1QFWH 4U1LA 4X9YA 3WJLC 5A3ID 1QACA 4Y2OB 1DSYA 1ZEAH 3MODH 3O45B 4KKAD 1PZSA 5J13B 3D87B 3IMTA 2F7PA 3V7AG 5J1AB 4HZLB 3EDDA 4Z7UE 1JVOA 4GEJA 2YD7A 4XNXL 4MNHB 1YEEL 1D3CA 2E9IA 4L4JA 4D0DA 1J5OL 1B4TA 4PRPD 2FHFA 2RALA 1UWEH 5FHBL 3ZZQA 5C07D 3NDZE 4ABWA 5L88L 1F58L 2KPNA 1P7BA 2C26A 1FLRH 2D9CA 4BH8A 1F4YL 1RVFL 4F7PB 3NFPA 1INDH 2IG2H 3WLBA 4RGMB 3AADB 4XWGH 4PJIF 3BWAA 2FUTA 4HC1H 2FSEA 2EDMA 5HGGS 4GRLB 2P8LB 5L7XL 3Q3GA 4QHMB 3RG1C 1NANH 5C86A 1ES0B 4AITA 5HPMB 1OLZA 6FABL 4ZDHB 5KS9F 4TF4A 4H8WL 2ZSWB 2I07B 1QLFB 4AT6A 1T04B 4NQEA 1DE4A 1WZ1H 3B7TA 5I71C 1BG9A 2M1KA 4S1DD 2ATAA 4XP5L 3CLEH 2WO4A 1AVAA 2QHRH 5AVQB 3T2PA 3QZMA 5BZDB 1A1OB 3VFSA 3DUSB 1TCRB 4QRRE 3RL1A 1M53A 2V6HA 1OAQL 4V11A 3FPYA 3WN5A 4ERSL 4FYQA 3QIBA 3ES6B 1PDKA 1BPLB 3OM3B 4GG8B 1DEEA 4KXBA 2W9LA 3BFWA 1NLBL 3EGXB 3ZZ1A 3N40F 2DYPB 4TVPL 3W2DH 1F00I 2XNAB 2X5PA 5MENB 3NJLA 3D18B 2CHDA 1SUHA 1YEJH 2J1YA 3MKGA 4YWGH 4PBVC 1PLGH 4O02L 1UJ3B 1SN0A 3MRQB 5JMRA 4F2MB 2WTRB 3WYRA 1S3KH 1SVZA 4AX3A 3ZL4L 3FB6A 1JPTL 1GCYA 4JDTL 2QV4A 2BSSB 3HNVH 1S7WA 4XVJH 1JIBA 1GW0A 2YGVA 3RGVB 4XWOD 1YYLL 3M88A 3NJNA 1MNNA 4QRPE 4WNQB 1ZHKA 2PO6B 3IJEB 4OF6A 4PUBL 4NZFA 3IJHA 3T6VA 1ZIBA 5FK9B 2ORBH 3MJ8B 1MCCA 4YL4A 4F3FB 5C3LD 3QXAB 4PPTA 1OCWH 1P5UB 4BKLB 2E46A 3LZNA 3UAJC 3IDXH 1FFTB 3CFTA 1MJ7H 5ETUB 2V7NA 2FBJL 4Y2DA 4N0CC 2YPKA 2HKFH 3QDME 4JFQB 1OM9A 1VPOL 2N0KA 3D0VB 3T0ED 2FBRA 4ODVL 2E27H 2XN2A 1DJWA 1QBLL 2HVKA 3DSNA 1W72A 4HS6B 3ARBA 2HX8A 1VACB 3KGTA 3NFSH 2WXMA 3CXHK 3DO3A 2WQRA 1GZPA 1XEDA 2K8MA 4S2SB 1Z5LB 1UFGA 2YPVA 3B7UX 1IILE 3IDNA 4FJYA 3KBPA 1MFAL 4FNUA 3LDBC 4YFLF 1E8ZA 2AF2A 2FJHB 4LLYB 2VABA 4AXWB 2GJ6B 1YNLL 1GYVA 3MR9B 4RZKA 3N42B 4WI3A 4F2FA 5A1AA 4KXZH 4I9WE 4NAMA 4M7JL 3SCMA 1LWJA 3MLSL 2X2JA 4H0GA 5BUGA 2R2HB 4FMKA 3SKUD 1EGJA 3B2VH 4UT6A 4L3CA 4G9FE 2LV4A 2DKSA 4KK8D 1D6VH 5JHDA 4E68A 5L2KD 3JV6A 3FH7A 4MDJB 3RY4A 1ZA6A 4I2XE 1G7JA 2E5EA 4NDMB 3VVVA 4KGJA 4ENEC 3EFDH 2XRAH 3TA3D 4M6NL 1ACCA 3M1CA 4EBQL 3LRKA 2MKLC 3ZKMC 4OLEA 2VDNB 3L1OH 1ZJBA 3MV9D 4HFWA 4RGNC 4Z7AA 3H53A 1J8HA 3GO1L 3DX7A 5DJ2A 2GY7B 3AAZA 4ODXA 5CJQL 2NY3D 3EJTA 4HBCH 3DRTA 1BVKB 4HXBH 5DRZB 1WCQA 4G8GE 4RA3A 2FO1A 4O2CB 4NC2B 3CHRA 3K2UL 3BSGA 5DMJB 4P4KD 4PJBF 4WW1B 3U0TB 2B59B 3O6FD 4Y2NA 4PRIB 1RZFL 5I82A 1JGUL 3DX6A 4O9HH 2V8MA 3MCKB 4Z7QF 1S3RA 2EQDA 1F97A 4PJ6A 2A6KB 3C60B 5GSVB 5I17B 1A9BA 2MPAL 4WF7A 2Y1YA 3Q0HA 1TQCC 3LXCA 1U8HB 1DFXA 2NW3A 4BFRA 4PIRF 4JFDE 3DO7A 5TK2A 3X13B 5C6WH 3MUGB 2F7IA 3EJPA 3MLZL 4XPBL 4A1RA 2ZUTA 2WK2A 1EEYB 3AREA 3QEUB 4NQUA 1NTDA 2UYLB 2WOBA 1ZV5A 3KPSD 4NNXA 3SPGA 1W72H 5IMMA 1H3PH 3RDTC 3H1ZA 3GHBH 3KL3A 3H2QA 4GW4A 3QNFA 4M5TA 5D1QB 5AWNH 2J8UF 4EVNB 3ZHKA 1EEQA 1K3IA 3VXTB 3QNZA 3WNMA 1AD0B 3CNKA 4NQQA 2NY4B 5EUKB 5IVXA 2WD0A 2A74A 4IYKA 3R1GL 2V5TA 3EFOB 3UXFA 2YPVH 3SE8L 1YMMD 3CN1A 1SDYA 4UZGA 2EXYD 4LQFL 1TJIL 4RBPK 3SB3A 1IKFL 1X6NA 5AKTA 2FEDC 2FZ3B 4KTEL 1WUZA 3KL0A 2ATPA 5GS0C 1AGEA 3MRRA 5CEYB 3DMMC 1SJEB 2EC8A 5E6IB 2BS71 3W0WA 3PE9A 4PJ7F 1B0GA 1WAAE 2EDYA 4A67A 4KKRA 5B3JF 1EGJH 4UT6H 3RGHA 2A1WL 3T5WA 4U3HA 5D2LE 2CZNA 3APNA 1T5KA 1WC7A 3IN0A 5LVEA 4TV3A 1UFUA 3QNXB 1GYUA 4KHTL 5IFJA 4OCSH 3WMSA 2VXQA 4FXKB 1LD9B 2V5RA 2V9RA 1OQOA 4ZW3A 2CLZB 3MCG1 3QJHA 5E95B 1OAXL 1EVTC 1RK7A 3DKHA 4UB0H 4M4PA 4JO2L 4E9TA 1CD8A 2DWSA 1RJLB 5ENWB 5SWZD 3MLRL 3IGFA 2OSLB 3VMPA 1S8DA 3X1EA 2ODIA 3HAEB 1F4WH 3HG0A 1FDLH 4K07A 3BUBA 2BP5M 4QRQA 4Q9RL 4IOIA 5I6NA 3ULVL 3U25A 3RPKA 3T4AC 1IIKA 4GO6B 3BKCL 4X7CC 1I3GL 1PX4A 3QHFH 4KROD 3NCXA 2NR6D 4ZTPH 4TL5A 1NFDA 1TVBA 3B3IA 3L7FB 5EU7E 2PPCA 5K9OA 4IDLA 2P3YA 3PWPD 4GSUA 4RAUB 4MA7L 3WDIA 1JYNA 4YHMH 1N2RB 3FO0H 1JGEB 3L95B 2HT2C 2HRGA 3GZPA 3IM1A 4LSQL 5FYLD 5D6CB 3S36H 1NDGB 4HK3J 5KBLA 5E8NB 2CO4A 2VDNL 3FYEB 5T3ZD 5TQ2H 5TE4H 3KJ6L 3QULB 4QHUA 2QKIC 4LPVA 5E1AA 2CJSA 2N59A 1A6AA 2ICEC 2YD9A 4AE0A 5JPNA 1KPRB 1DVFB 3GMMB 5CHNB 3SDAD 2NUTA 2VZSA 4OLWL 4CDHA 1II4E 1YNTA 1VADB 4BJLA 1G7PA 3A5VA 4OLYL 2XQYA 5HHME 1QSFA 1IVLA 4RA0C 4LSSH 5B38B 1TMCB 1XH2A 3CWGA 4IOFD 4Y4KC 3TEZA 1PU0A 4BFBD 4FQJH 4G83A 3ARFA 4X5XB 2AK1H 5DZ9A 1UM5H 3LB6D 1X3DA 3PDDA 2H6OA 4NBZB 1UXSA 2YEQA 4KJQC 2NUPB 3ZT7A 1K72A 4P23A 5HYSG 1LP9F 2IH8A 4HIHB 4JFFA 3MLUH 2KMWA 3M8OL 4DVRL 1I7RA 1AZNA 3CHQA 4IIQA 1UOKA 4W6XB 5HI4D 3ECBA 3UGUA 1UM4L 1KYDA 3OZKA 1OP3H 1L9MA 1IM9D 4RMUA 2E8ZA 5ILTH 2CH8A 1VGEL 2VXQH 2FEJA 2FLMA 2W9DL 3KLKA 5CMAB 2HJKB 3IGAB 5JUEH 5IWL