3VB8A

Crystal structure of engineered protein, northeast structural genomics consortium target or43
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
MSVVDYVVTSFNSTSQMSHELLFSVKKRWFVKPFEHSRRYGLLAYMLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEERTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFEKTAWVEESNYSIAEDDIQMVESIKRYLERKIAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Engineered protein
publication title Computational design of a protein-based enzyme inhibitor.
pubmed doi rcsb
source organism Artificial gene
total genus 37
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vb8A00
3II2A 3VB8A 3ILDA 3ILEA 3II3A
chains in the Genus database with same CATH superfamily
1KXTB 2VDLB 1SY6A 2K45A 3SDAA 3SDXA 4X6CA 3VGAB 2H1XA 4QRPD 3FJTA 4W9GC 2APSA 5FV2A 5K39A 3ELQA 4P49A 3VYPA 1JHKL 3H3KA 3CBKB 3VXUE 3ZT7A 5FGBC 3RGVD 1XGQB 2J2ZA 1Z5YD 3MRMB 4L3ED 1T1WB 2AV7B 2NNRA 3O45B 4V2CB 3RILA 1LQSR 1JNLH 4BKSC 5KWYC 1SJXA 5DD3H 4C8XA 1IEBA 4FE9A 3HI5H 4H88L 4YX2L 4CMHC 1TLKA 4PJHB 3UDWC 5FB8B 1YY8A 1TTUA 1TSHA 1DO5A 4AYFA 1AO7B 1M9SA 1Y18A 2VDOL 5EB9A 5A2AA 1I8IB 4IGBB 5ANMA 3MO1A 3CIAA 3BUBA 1XBRA 3THMH 1YEKH 1DVSA 1P7BA 4U2YA 3SCMB 4MAYA 4L1BA 4ONGH 4M5YL 2ZSVB 1E4WL 4GT7A 3BSHA 5JHMA 3V0DA 2P26A 4Y1AB 3KH4A 1S9VB 1WEJL 5MENE 1XH0A 3B8YA 4OCSH 3X3GH 4Y2LA 2F08A 5EDSA 1EXUB 5AD0A 4WW1A 1UJ3A 3PU7A 2X4UA 1R5IA 1CICB 4NNXB 4WW2F 3SPCA 5EO0B 4BSWB 1VACA 3N9GH 2Q3ZA 2AJZA 2CR6A 3QH3A 5DQ9A 2NW3A 2BRRL 4PJAF 3HOGA 1CF8H 4HIIA 4NRXA 3ES6A 5IVXB 3N1FC 3TEYA 2X2HA 3ARFB 3F6LA 4CNIB 1MQ8A 4U1NB 5B1JC 2BJMH 1SGKA 4AX3A 4LDEB 5J4MA 3AXLA 4OV6F 4P8QA 4UILH 4LSVH 4JFYA 4WCYL 1C1EL 3PRZA 5L88L 4GI9A 2QGEA 3RWJA 3ZZQA 4K7FA 5T5FL 3O8XC 5LWYL 2X3BA 4LIQH 3T2QA 3KVDD 3TIEB 1HWWA 4U0RB 3CQQA 3X1BA 2UY6B 1N67A 1V3LA 4NZUH 3ZU8A 4F9PC 1E6OL 2NY6D 1ZHBA 2B77A 4RWYL 5IJKC 4P3DA 4Z7WF 3T3MB 1TVHB 4YFEA 4BIKA 1NIEA 3OBAA 5FK9B 1CFNA 3RFRA 4I87A 1MLCB 3QYNA 1KB9K 2Z35A 4BKLB 1VPOL 3LS4L 1EFQA 1A6PA 3NCXA 5FYJH 1T3FB 4X9IA 4A7QA 4C59B 1OARL 3BVUA 3WFHA 1YC8A 1IGIL 1CG9B 2W88A 5A16B 5LGJB 1JUFA 1NCTA 3BAXA 2JXMA 4OIFA 2IXQB 3BPCB 2VDML 2DWDA 2AQ2A 1JPTL 4YFLF 1WIOA 3BDYH 2VZ1A 4YDVB 3MV7A 4GG6A 4PY7A 5FGRA 4Z7OE 4K7PY 3MHZA 5H4ZA 3GIVB 2BFGA 4XN5A 4JFQB 5E2VL 1FGVH 4TNWK 1W8NA 1UZ8A 1J5DA 5E24E 2XJKA 1VJSA 5HDOA 1SHWA 1RJYB 1SYSB 2E7BA 4PRHB 1V7NH 4DW2L 2VAAA 1IL1B 4MA1B 3NSYA 3L3DA 4WFGD 5F3HB 3QWOB 4F8PA 2G75A 3RFZB 4IIZA 1O6SA 3H4FA 5AAPA 1CFTA 3G6JE 4M9OA 2YXVA 5F1OB 1AHWA 3L2MA 4WHYG 3LKNA 2FNWA 4KJWC 1PAMA 1KGIA 4TULL 3OJ2C 3NZHL 1F3RB 3FUKA 5D4HA 5DMKB 4H8HA 5GS1A 2MEJB 3KYAA 3UJJH 2DWYA 1K5NB 4GQQA 5HGAA 2K3HA 5I9QB 4Z7IA 5CILL 2NR6C 1FVDB 1H3UA 1KPRA 2YD7A 4BDVA 2JJSC 4D0BA 4MLSA 4ZX5A 3F00A 5K59F 2ZUTA 3QG7L 3KYOA 4FCAA 4NZFA 5ETUB 2BCMA 4K94H 1CR9H 3GNMH 5A2LH 3GUFA 1A6TA 3ULUD 3ZZ1A 4Z7QE 4LBEB 4UM8B 4HIEA 4ONHB 4K7PH 1IBGH 2VDNH 5GRUL 1JGEB 4PWJA 1ACYH 3IETB 4FQXB 1KJ2A 1XGZA 1Z9LA 5K69A 1II4E 1FDLL 2O93L 2RTTA 3Q5OA 2ATKB 4LPXA 2OYPA 3D69A 3TZVA 4DQAA 5MEOA 2ED9A 3T04D 2JQAA 3QZLA 3G5YB 1HFUA 1LEKB 2J1YA 3VRLF 4EZJA 1M7IB 1MG2C 4YHML 1W0VA 1UCBL 3RBGA 3X1FA 3V4VB 3V79C 4LHUA 3AQXA 2IMNA 1JHLL 4LSQL 3VXMB 1A9EA 1U2HA 3T4AB 4AE0A 1FAIL 3SODB 3PP4L 1JZFA 1NCOA 4JRYD 1NGWB 3QUKA 3PJNA 4NP4H 2W9DL 5CP7A 1OAYH 1R24A 3PNWA 3JWNG 3HCVB 1L9RA 2OYLA 4LKCA 2FL5A 5C0AB 5K93A 2BK8A 2KBGA 1Z9PA 2J55A 4RNRB 1G6RB 3BH9B 1JPFA 1Q0EA 4KFZC 3EJSA 3MGTB 1NCAH 2KI6A 3DYMA 3HNSL 2KDGA 2MFNA 3WUWA 5DK3A 3I2CL 5C0ND 2ITDA 4WJ5B 2AXWA 1WTGT 2JIXA 4QOKD 2AQQA 1DCEA 3JUZA 4RFOH 4W9FC 3ZYZA 5AB9A 1VADA 1VZIA 3WTWA 4HWUA 5IFJA 2A5UA 3V7AE 5SV4A 3S35H 2J4WL 2Y25A 1G94A 3ISRA 5I1LB 1S9YA 2KZKA 5DHVH 1NCJA 1OAQL 3V6ZB 4GUPB 4JDVB 1ZMYA 4X5XA 1CLOL 2GAZA 1IUZA 4LPUA 5CJOL 1O6TA 1HU8A 1NGQH 1VKXB 2R4SL 3WIAA 3G5XB 5HHQA 2YPLE 2XTJE 2I9LA 2X4QA 3M8OH 3EFDH 4ZFOL 1NUDA 2UY7A 2DQTH 2VXSH 3FRPG 5E23A 4JPVL 4MHHG 4J8RB 3KVPA 2C1PA 1OGSA 2ZJSL 2EVGA 2Z3FA 4OAWB 3BD5A 3WGUB 2GSGA 4ZUWB 5CAYB 1BVKA 3IJSA 2C4FU 3V5KB 4PJ8D 3WO4B 1N7ML 1PJWA 3MGAA 3B7YA 3TFKC 2VXQH 3ZL1A 4BZ1H 5I0VA 2VH5H 1USZA 1AY1L 1DSFL 2P44B 3VA6A 1KN4H 2YC1A 3TXAA 4ACTA 1UD2A 3S0PA 4WWID 5I6OA 2PCFA 3M1OA 2QPDB 4I5BA 4FFWC 4UMSA 4N8VB 4OU3A 1H15A 4PREB 5CD5C 1JRHH 1JWSA 3N91A 3ZKQD 4PGCB 3NJXA 4E0RB 2L7JA 4POYA 2A9CA 1JPGA 1JGIA 2OZNA 5JZ7C 2WN3A 4DEPC 4UOW1 1TJIH 3I50L 4E36A 1AE6H 3VFSB 1DQQB 5DMJB 3U4EA 1HXKA 4NOBA 3V95A 2DQCL 3AS3A 2HCZX 2J57A 4U3XA 4ZFGH 2GY7B 3BO8A 3UBGA 1FZOB 2W9EL 5I75B 3FQ2A 3LJ3A 5IEHA 3TO4B 4G7RB 4N2AA 5K33A 4KKCD 4PV8A 1KJ3H 3NSFA 1JV5A 1F3JB 1RZQA 2BC4A 4L8SB 4QRQA 4Y4KC 3A22A 3QNZA 5E00A 1HYSD 3GSXB 2A9ML 5ID1B 1NCWL 1G84A 4QD2E 1MW2A 4PWEA 3BEVB 3QEHB 1J9SA 4O5LH 5JNYB 2G5RA 3R8BB 3ILQC 3X17A 4BWWA 2AK4E 1AHKA 4QRTA 3WENA 2IOIA 1DQDL 3WFZA 5IHUL 1BD2A 4HH9B 5E2WH 4IEFA 4Z76B 3E6HA 3O2VL 3O2DH 2PXYC 3LQAC 4UQEA 1BZ8A 4KMQA 1AFVL 2FQEA 5DZ9A 3A4AA 2DLIA 3ESVF 3N43F 4FQLH 4ODTL 4I48B 5E9DA 3C60A 2R2EA 3ILEA 2LVEA 2CGRL 5HHOA 2VL5A 2GI0A 2KZWA 5FUOH 4BQ6A 3H7LA 3POHA 5C6WH 3MV8D 3V0VB 2FR4B 4KJWD 3EGSB 4IU3A 4M5TA 5IKCA 1NCGA 1T22B 2QQLH 4ZS7H 5FLVA 1G9NC 1KBVA 1UB5A 1PLAA 1NDGA 3BZ5A 2J5WA 3S88L 5DRXA 3ULSA 1UFUA 2AVFA 2Z1KA 2HVJB 1KZQA 4GRWB 3UEQA 4WFFE 4GKNB 4LPCA 5H37H 4XNZB 1IT9L 3SBWA 3VFWA 5EUKB 3RZWA 1VFBB 2LHAA 3CJJA 1S7QA 1JHKH 2CKBA 3GZQA 4JFED 2A74A 1LTXA 4FNSA 3QZNA 2R0WL 1IGJA 3O3DB 3UBXG 2HLFC 4RMBA 1AQ8A 5EO9A 3O0RL 4MMXA 5E8EB 5FCSH 2MNUA 3BKYL 4N2BA 2NY0B 3U2JA 1FRGL 3BPLB 1J0JA 4H25B 4H88H 4YX2H 4PRAB 1RV6X 1ZGLP 1TJXA 3FFCA 4MMZB 2ICWJ 4CN1A 4OIIL 4U6TA 2VDOH 5IHBA 1UKQA 3EJZC 1I3RB 5IP4A 1OQXA 4OD2A 3O3EB 3QO1B 3ZYJA 3BVVA 4YSUA 2K6YA 4L8DB 4X7DC 4M5YH 2EE9A 5HYQB 2E0PA 1E4WH 1HVXA 2P42B 5LAXB 1SZNA 2GT9B 1UM5L 1WA2X 4MJ5B 1ETZA 2ED8A 4X6CF 2NSXA 3SDXF 3L9YA 1WEJH 1G7JA 1TIUA 2ID5A 2PTUA 4AQAB 1YPZE 2YGVA 1IIIA 5K1VA 2X0VA 3B9KA 1E4XI 4HZLA 2XV3A 1F45A 1PGRB 2YBGA 3I6KA 1W6WA 1VCBC 2Z8VC 1B0WA 3LDBB 1M6UA 2HA1A 3BGFC 5I5JA 3L3OB 4A2EA 4DKFL 2BRRH 1J1PL 1LP9A 3B2UC 5AZ2L 3PWNB 4Z18A 1DFBL 5EOCJ 2Q0ZX 3L2NA 2Y1YA 1PFCA 4GEJA 3U2SA 3EBIA 3NFPB 4DUVA 3MFFA 2VSKB 3CZGA 1BFVL 2E7MA 2Z7UA 1P9MA 5C0BA 2VDKB 3N06B 4OCYL 1C1EH 4WCYH 1WK0A 3GINA 5L88H 2PWEA 3IWVA 2LTQB 5T5FH 5LWYH 2EH7L 1A6VL 4OFVA 4PG9B 1NCDL 2P8MB 4K0OA 3PL6A 4XO9A 3IT8D 3QI9D 3KLQA 4QAMB 3MRFA 4ELMB 1T04A 5EIIA 3FTVA 3CSPA 1WIUA 2Q6WB 1E6OH 2WVUA 4OF8A 2UYLA 3QUHA 4RWYH 5E0QA 4JFFB 4FP8L 3P1VA 3O6LL 1P2CB 3F12B 5L7XL 4M1CD 2A3TA 1QKZL 4LVHB 5F7HA 4M6OL 4JZNA 2FE0A 2J1WA 3WHXB 4A6YL 1VPOH 3LS4H 3QFJE 2W9LA 3NH7L 4HMCA 3TN0B 2YOCA 1OARH 1I3VA 2ZQKA 4UINL 1IGIH 4XRCB 4L4VD 5ABDE 1MFUA 3JYCA 1MCCA 1NQBA 4S1QL 1WP6A 3I74A 5IEKA 4ZNCD 2GKIA 2X1QA 2VDMH 4P4RA 1JPTH 1CE1L 2COQA 3L1EA 3NPZB 2Q20A 3ATBA 4N87A 2VAJA 1RP8A 4DUXA 4KQ0A 2Y07H 1IARB 1RHHB 1WITA 1T20A 2VDLL 1E5ZA 2X12A 1QUPA 2WJ7A 1LO0L 3RB5A 2CWRA 4DW2H 1EZVY 5FFGA 1FI8C 5HJ3B 3VWJB 2CR3A 2QADC 3MYJA 3N85L 5I76A 4NP9A 2XWDA 2BZDA 2NMSA 5ES4B 1IAKA 4JANA 5KOMC 2HT2D 3RLSA 4X8JA 4H8VA 2Y6SD 2G9KA 3BT2L 3LEVL 5FYJD 4CSSA 3KGTA 4TULH 4TQEL 3NZHH 3ZUNC 5AAWA 2DYPB 3T4YA 1DEEB 3F5WB 5EBMB 5F7MC 2XWXA 4GG6F 3MSPA 2GIYA 5CILH 4PJ6A 4RRPG 1QSEE 1AVAA 3X11A 4ZX3A 4NGHL 1MCDA 3KPLA 2X6MA 4LLMA 4Y4KD 3QG7H 5DEZA 2MQ3A 5FAAA 3PGCB 3VGDA 1UFGA 3ARGC 1GTNA 4Q4IA 3VXUD 2B1OA 1TUPA 5FYKU 1JTPA 4OF5A 4GSRA 1T7ZA 1HDMB 5ESAA 2D9QB 3KJ6L 4ZSOA 4I4WA 1R75A 3II2A 1N6UA 4JBSA 4FL4C 3ZDYE 3IJ8A 2YJQA 4FFZL 4NEHB 5I28A 1XB6A 2CLRA 4XXDB 5CS7A 5GRUH 1DLHB 1VENA 3FT3A 1CU4L 1EEZA 3PHOA 4Z78B 5JO5A 4L8CA 3H9HB 1XZ0B 4XNXL 3SDCB 4NQCA 3CH1A 3GSOA 1UYWH 5D6CA 2CCWA 3DOSA 3TBTA 1QSFE 1HAWA 4BUHA 2P5EA 1F97A 5MEND 2KC0A 3HE6D 4YHMH 1A4KA 2D4DA 3SY0B 3VX1A 3VQLA 4X6DE 2ZX9A 4KROB 4AQZA 1T89C 4U1HB 1JHLH 2O6EA 2QQQA 4LSQH 4JGNA 1G5GA 3LH2L 1XT5A 1GC1L 1A4JA 3D8MA 1FAIH 2EZ0D 1KYOK 3MREB 4NZRL 4UM9A 2XFXA 4LKXB 4X4YB 3U0PB 3CV5A 3PP4H 1X7TA 1JJUA 5EDXA 2W9DH 2EDEA 4XCCL 4X4XA 1S7VB 4YDJA 3VW3L 2P45B 2BXYA 1SFDA 3K6SA 3CPLA 3HG4A 2WK2A 3T8VA 4NAQA 2YQGA 5LBSL 3RX7A 5EEYA 5JIDA 3FHQA 5ALCL 1CDCA 1R33A 3UTZB 1YC7A 1HWHB 4HIJA 5IV2B 5BRQA 3VXSB 1NIFA 2Z4TA 4JRXB 3D4ZA 3G5WA 4QO1A 4G8IA 5DRWA 4OJCA 3W3BA 3CPUA 3QDGB 1BSIA 3IFPB 3A23A 4Q0XL 5F9JA 4ZO6A 1DBAL 2JCCB 1GZQB 3VI4E 3ZSTA 3WIHL 5M94B 2ZOWA 4Y0GA 4UBDD 4ZO7A 1VHPA 3RHWF 2YPVL 5CEZL 4M1DL 5E8DL 4ZG1A 2C7UB 5DC0A 4ELDA 2J4WH 3WEMA 4AYMC 4BFBD 4DPBX 2DZEA 5LNGA 1Q0XL 3DXAA 3VFPB 4XP1L 2V2TA 1CLOH 1CT8A 1IQDA 3DX9B 4D9QE 4MKTA 4OUUB 1SDDA 1QFHA 5CJOH 2NY1D 5TDNB 2VJ0A 1KMGA 1OB1A 2R1XB 2R4SH 4WWKA 1L3WA 1J10A 5DJ2A 3TH3T 4NQSB 3D9AH 1INQA 2DICA 3QZOA 1J1OH 4JPVH 1SVCP 4DZBB 5BV7C 3C8KA 1IJ9A 2P24A 1FFTB 2IQ9L 4GRLB 1MHHA 5CGMA 3FF7A 2C5DC 2WSDA 2VDPB 3WNJA 5KVGE 3ZHKA 3QORA 3HMWL 3BXNA 2QPUA 1KV3A 3TIDB 3FAWA 4FTVE 4WI6A 1N7MH 5ID0A 3AU1B 5JW4Q 2KL6A 3EFOA 2CUMA 1G5AA 3B9AA 5FHAL 1AY1H 1DSFH 1QLEL 3OMIB 4Q14A 5C2UB 1S7WA 4M43L 4WI5A 1UG9A 2WXGA 4OD3L 4B9PA 4WO4A 2N0KA 2YXFA 3QIBB 1QG3A 2WP3T 2KERA 2Z9TA 3HLKA 4Q6IA 2JJVA 2QJDA 2W65A 4NC1E 3ZKNC 1YZZA 3C5ZB 5IMLA 3TF4A 3ZTCC 3LRHA 1R0AL 1YUHA 4WVRA 3I50H 3A47A 4I77L 5I0YA 3RUGA 2DQCH 1K5WA 4PBVC 3HFFA 3X13B 3SO3C 2W9EH 1HSBB 4QMEA 3GMLB 5SX4I 4MLIA 1GHFH 1KLGB 2C9UA 5DWUH 4EN2A 3FRUB 4YDIL 1NCWH 3MAWA 2IV8A 3V4VL 2HKHL 2WQVA 1KBPA 2QSCL 2CO6B 4ZUUB 2ADGB 2LABA 2WBJD 2ZWZA 3DIFB 4PJAE 3VWKA 2WLIB 3U25A 2DWSA 3KWWB 3ZX1A 2YQ3A 4PW3A 3QJSB 1NGYA 5IHUH 3BGAA 2RCSL 3DK0A 4Y4HD 4PI0A 3ZIMA 5B3NA 2VB5A 3O2WL 3O2VH 3B6SA 1AFVH 1OGAB 1L9OA 1NFKA 1QFWI 1AGBA 1PSKL 2QADD 4ODTH 5DK0A 5L8KB 1NAMA 2BY1A 1UM6L 3KLAB 4ZW5A 3KLKA 3TC9A 3CFEB 4QWWD 5FDYA 4OZIF 3HG0A 2IANB 2WCGA 5A3IC 1DEDA 3MLTB 2YPKB 3L1GA 3R19A 3H8NA 4G6FD 3US0A 1ETA1 2RJMA 3S88H 5C6PB 3L4CA 4Z7WE 2XXFA 4YZFF 1OCZB 3LOWA 2ZXEB 4PBDA 3WN5A 5DUML 3V0EA 2Z31A 4OKVB 4XNUL 3LPPA 1IT9H 1FNAA 2H2PC 4OJEH 1JV2B 4N1CA 1JXFA 2VR8A 2XN2A 2QHLA 3PDGA 2DEYX 2PYEA 3LX9A 3L17A 4XP5H 4K73A 5F1KC 1X7QB 5LBVA 2JNZA 2R0WH 2CLVA 2WIMA 2XWTB 3K6IA 3H3PL 2SEBB 1TZHA 4R7DA 3MRDB 3ZE0F 5A2IH 1MOEA 3O0RH 4JW3A 1M2OA 5KVGH 2UVEA 1FRGH 2XWJB 5KEZA 4IRZL 3LYRA 1WCQA 4WV1A 4CVXB 3UPAA 4QXUL 3QNXB 1HAUA 4TUOA 4OIIH 4Y19A 1EJOL 3VFGL 3F85A 3U9WA 5DRZB 3OHMB 1U8LB 1MFEH 3RVXC 3TA3D 4M1GL 4ZPVA 1BVLA 3BPOB 4NQXA 1XH3B 2PMZA 2J1XA 1SMDA 3RX9A 4X6FB 3K4ZA 3Q9PA 1YYLL 2WWNA 2WCPA 4PIRF 3UERA 4RAUB 1MAKA 2J20A 1EUTA 2ZOLA 3RY5A 2YPLD 1LM8V 2XTJD 3DIVA 2XKNB 3K6NA 4TSCL 4YWGL 2XZAL 2Y1ZA 1QSZA 2C3HA 4WGVB 2TRHA 4N2OA 2W94A 4N2NA 4Y1AE 4DKFH 1MJJB 5I2IA 1J1PH 3CHQA 3I9IA 3N1PC 1LO2H 1U8OB 1DBML 1AQMA 4N0YL 4RMWA 5AZ2H 5C0JA 1D7DA 5T1LD 1JF5A 1K8DA 2WTOA 1ZJAA 4D0DA 4ETQA 2AQSA 1E4XL 1RIVL 4WWOA 2WZ6A 4HEPA 7PAZA 1FZJB 1BFVH 3DYPA 4LP8A 1PZ3A 3RJDA 3DVNB 4R7VA 4OCYH 1BFSA 1ZLEA 4Y2NA 4ZS6D 5F97E 4BQ8A 2IH3A 4WI0A 5K9KA 4JO4L 3G9VA 3DX7B 1A6VH 4LL1A 4PPTA 1AZVA 1NCDH 1BM3L 1MCBA 4AEFA 2ZP8A 4YAQB 3TCLB 2EDTA 3DSNB 3RIAF 2XG5B 1I4FA 5FXCH 3MCYA 2X0UA 1L6PA 1X9RA 3INOA 1ZT4B 4FP8H 4MNGB 3TNMA 2WQXA 4NKIL 5L7XH 5BW7A 2CKNA 4M6OH 1FSKB 4N0CC 4FNPA 3W0WB 3P4OA 3K72A 4R7LA 2AJVL 3MV9B 3NH7H 2GQHA 4AI7A 4F80A 1FH2A 2FWUA 3F84A 4X99A 3GHBL 5EIQA 4UDTB 5CJQL 3I6GB 4QYOA 2Q7NA 2YSTA 4S1QH 1SRDA 4G8EA 3KM1A 1ULVA 3OKLB 3O3AB 4JMXA 5HGDA 4H13C 3K8KA 4PVNA 4LCCC 2AK4D 2F68X 1YEEL 3NZUA 3OWRA 1TVBB 1RIHL 4E9RA 5ACZA 4HUVA 4ECNA 2DV6A 1RK7A 3JQOB 1LO0H 3ABKB 1DJYA 1WHPA 4GMSL 3I3EA 5C2BL 2GHZA 5SWSE 3U9PL 3CZFB 1X5AA 3W39B 3KCPA 3V0JA 5AVXB 5C0FB 3H55A 3N85H 1OL0A 2G60L 2YD2A 3KM2A 4K4KA 3RDTA 3FRPA 4EN3D 5D1ZA 4XN2A 2ZE0A 2AKRB 3FQ1A 4BUGA 2J8HA 3LV3A 5HY9A 4PRHE 3LEVH 2FO4B 1M2VB 1A64A 1OGTA 1NPUA 1TQVA 4TQEH 4UT9A 1U8IB 3HTLX 4PGDA 4WNQB 1Q8MA 3NIDB 3FKUS 1KYOJ 3GMNA 3HUJF 3OKMA 5HYJD 4U1LB 3EOAB 2GB2A 3ELAT 4PGEB 4MVBC 4WFFD 2CHXA 1KCSH 2PPFA 3SKMA 4AQ1C 3KMDA 3R4DA 2UX6A 3OLIA 1RJZB 4ZW7A 3UP1A 3HG1E 4NGHH 1JZIA 5CGYC 4YXLL 1MXDA 3DO7A 2OMWB 4KK6D 2WKOF 3E6FB 1TOXA 2YBRA 5MHSE 2VDRB 2EEFA 4HWZA 4AM0A 4CAGA 4APQD 4MSWA 1HZHL 1SHXA 4QHPA 4PJCE 1IE4A 3HRZC 5AVUB 4FFZH 3OKDA 2J6WA 2NY2C 3AAZA 4DGUA 1KBGL 1W15A 1LXMA 4EDXB 1DSYA 3DX2A 2ZT9C 3H42H 4LQFL 2XX1A 3GSWB 3VXNA 5KSAB 1CU4H 4HLZG 4L0YA 4CBPA 3HHSB 1MZZA 4XNXH 4Z3FA 5JOPE 2O5NA 3BVXA 2D3JA 3HKFA 4LB8A 2CJTA 4UQDA 5E8OA 4DKAA 2DN7A 1N8OE 4G5ZL 4LL4A 1CC3A 2F8VA 3HMXL 2VDKL 3S8GB 1P4LA 1U58A 4QCIA 2JLLA 3B3BA 3ETSA 2VXTL 2R2HA 1I1CA 3KYNB 1D5MB 1E8YA 5A3ID 4Y4FA 1OOWA 3LH2H 3W9EB 1GC1H 4N9GA 1GXEA 1NBZA 4JQXA 4NZRH 4MQTB 3LCYA 1NGXA 2X9XA 4BQBA 1MG3C 2X4SB 1LE5B 1XD1A 3M07A 3W9DA 2N01B 1O9WA 4TS6A 4UQIM 4N2MA 4XCCH 5AW2B 1YCSA 3IJHB 4M6NL 4AKQA 3VW3H 5EZLA 2V2WA 3CSFA 5EF1A 3GJFB 4I2XA 4O51B 5LBSH 4B9ZA 3T3PF 1FC1A 2LW3A 1PMYA 1TTAA 5ALCH 4KK9D 3KWUA 1SUJA 7FABL 1MFVA 3T8MA 2HKFH 1OGPA 2Q2LA 4WHTA 1CFQB 1HH9A 3L5XL 3N50A 1SQ2N 3W57A 2F7QA 2OMZB 2ZF9A 3WLBA 1DBAH 4D8PA 2PW1A 2ICCA 2Y7QA 5J06A 5LGHL 1XIWB 1TFPA 1D5XB 4IS6B 1KCUH 3WIHH 2CCLA 3K2KA 4Y5XC 4EXKA 1A6ZA 1WYJA 2YPVH 4M1DH 4MAUL 5E8DH 1UACL 1D9KA 5IQ9A 3QAZB 3VXPA 2HT4C 2E7CA 1AMYA 2F53B 3LXBA 3QPKA 4JPQA 3VYNA 1KEGL 3NACH 1P7HL 1F3DH 1Q0XH 3QFJD 4XP1H 2BVPA 3UBXA 2FT7A 5T5NG 3Q7JA 4CSZA 4ZAKB 4DH2A 1A2YA 1IGFL 1URIA 2ICWB 4AXWA 3TVMC 1RZPA 3TT3L 5AW6B 2YK1L 3QQ3A 1E50A 4WO0A 4OZFB 5D70L 4FN0A 4I13B 1ECZA 1EBPA 1T5WB 4XN4A 3MCLH 2IVFC 3BGMA 3OSVA 4U1JA 3KR3L 2GSIB 4ORGB 2C3VB 4OUOA 4WUUA 3IDGB 1T1YA 2IQ9H 4JKLA 4XNYL 4AITA 2R0LL 5EOTB 1O75A 3HMWH 5GSRB 1ZRUA 4JVPA 4AT6B 2ITCB 2Q2EB 4PJ5B 1FPTL 4U3HA 4AH2B 3E9TA 2ZP0T 3IPEA 4XMZA 5FHAH 2DLTA 1QLEH 2WYZA 5KYYB 1I3GL 1M53A 3AM8C 1CXFA 2H5UA 1KTBA 2DEXX 2RD0A 1XWVA 4OD3H 5E4AA 2EILB 3HAEG 5EZIL 2ZUVA 4YK4C 1ICTA 3L5WB 3VG0H 3ZKMC 4HPHA 3QPQC 2FLRT 3F8UB 4LPTA 4NRZA 5FOBA 5L9DL 1CD8A 4NC0B 2NY7L 2GTWB 2YHGA 2FYVA 5KYWA 1R0AH 1ROCA 2ZKHL 3EHBB 4I77H 5D1XE 1QHPA 5F7DA 1IC5L 3FO1B 3PHQA 1LEIB 2CBTA 1UUNA 3NCYS 2EDXA 1QSED 4I0PD 1S7TA 5D72L 1F6AA 5AOMA 5C3LD 3B9DA 1MI5E 1QFOA 3L6FB 1P1ZB 3IVKA 4UQ2A 5HI4C 1BHGA 4YDIH 2E76C 4E9YA 5T1KA 4LSUL 1OALA 4AGMA 2OMVB 3V4VH 2HTKC 2EE2A 1HQRB 2GITB 2HKHH 4HA1A 2B0SL 1OF2B 2ZX7A 5D4JA 3VGAC 2CQVA 4F7PA 2Z6FA 3WU1A 4NHUB 2J21A 3FL7A 1KLFB 2BSSB 3FS9A 3C75A 3MMEA 1OP4A 4ZPTB 4PJGB 3KPRE 4J3WA 2KYIA 1QPKA 5MERB 4EIBA 4XNMA 2RCSH 1OW0C 1U8JB 1JHTB 2XA3A 2ZOKA 4G70B 4QEGA 3O2WH 5G5DA 2EC8A 5DLML 5BO1L 2AAAA 3RUGF 1QSFD 1F2QA 4P2QA 1PSKH 5FYJU 3PHSA 1UM6H 4JO2L 4NKDB 3D39E 1MVFA 3C6SA 4IGBC 3O6FA 3HPLA 3IU3A 1ZWIA 1N70A 2X6CA 3FO2B 3SCMC 1E5CA 4G42B 2Y6TE 3UG4A 4N0FA 1KXVC 1AKJB 4EI6B 2FSEB 4IMLA 2J8OA 2ZYIA 2ICWI 4J3OH 1NC4A 4NZ8A 5I23A 1H3XA 1JK8A 4EKJA 4PGBB 1QFWL 1CDHA 1M1XB 1LMIA 3J7HA 4OI8A 2F8XC 2IWEA 3KBEA 5DUMH 2GJZB 3MJ7A 4XNUH 1MWAL 4HHAA 5DHYB 5F3BA 4CADA 3C6LD 1U33A 5I0ZA 1CICC 4NPKA 5AVWB 5I1CL 3BP7B 3UC2A 1MY7A 1U42A 3UOAB 2G9HB 1PQZB 5F9OL 4F24A 1CTOA 3O9WA 4NCC2 4GRWE 5C09B 3ARFC 5AVYB 1HHIB 3H3PH 3QUYA 1JZDC 4NPYA 3WMSA 4NLHA 4N26A 3D85D 3WKNA 2H3KA 2NY2D 2WCSA 1CGUA 3MBEA 5I16A 3GWJA 3VFOA 2BVOB 2Y2WA 4C55A 4F8OA 4IRZH 3V4PB 4FG6D 1LWRA 3RWFB 5DSCA 2XIBA 4NKOB 4Y2DB 1A25A 1EJOH 2K4WA 4GQZA 3HS0B 4NBZB 1U21A 1ZV2A 3IDIB 3VFGH 4LGSB 3AGVA 1U3HB 4JUSA 3TBSB 2VDPL 1MCRA 2VLMD 4FADA 3CFIC 3BH8B 2ADJB 4M1GH 4TNWF 2VE6A 4LCWB 4KZEL 2Z92A 4U0RC 2WTRB 4M7LL 4D9QD 2ODIA 1UD8A 1QZ1A 2E47A 2QZQA 4L8BA 1YYLH 2PWFA 1C8QA 3VI3A 4QTFA 1G0YR 3RG1C 1OTTC 3DURB 2HRGA 4R9HA 3FU7B 2E56A 1SDAB 2VERA 4X7TA 4YWGH 1PG7X 2VR3A 4HDIB 2XZAH 1YEJL 4QT5B 3SQBB 5J9PA 3B5HA 1ZVYA 1C08A 2GJPA 4OV5B 2XYBA 32C2A 2B9AA 4N0YH 5ICYA 2GABA 2X6AA 4JVUA 1NBYA 2V7HB 2VSMB 4ZBJA 5KSBA 5E5LA 1G43A 3VXTA 5B38B 4KK5D 1E4XH 1RIVH 2V9QA 2WW8A 3KGUA 4FTVD 1LK2B 2YEZA 3FB6A 3HC2A 5CCJA 1ONQA 2CDGB 3CDCA 1WO2A 5J6HB 2WY3B 3KBFA 2G5UA 4P4KD 1OTUC 1WGVA 3EH2A 4GKOA 3R0NA 4JO4H 2QGDA 4DP4X 4EJ1C 2DI8A 1BM3H 4JS7A 5JQIB 1K4DB 3G9AB 2CJSA 4I1PA 2DMKA 1Z5LA 4MA1C 5IG7B 1C5BL 1X5JA 2BM3A 2FT8A 3ZMRA 3RFZC 3NFSL 5DEFA 2UVFA 1NGZB 3TBBA 3ZRSA 3D3VB 3D08A 4FGMA 3CSGA 3S8FB 4BHUI 4Z7UA 2AJVH 5CEYB 4DK6A 2A77L 3GHBH 2Q86B 1NDTA 2FECI 4XCNB 5CJQH 4F7CA 3GYRA 3PV6B 1N3NB 5I9QC 1WLHA 1PEWA 3CK0L 5FO2A 1XSKA 1YEEH 3AW5A 2RGSA 5HJBA 3K71B 3DA0A 3IJ7A 2BHUA 4HIHB 1X4ZA 1RIHH 1KGCE 1UT2A 1H5BB 2H8PA 1UOVA 3MC0A 4K23L 2R0ZL 4GRWH 5CJXC 1MFCL 2AQTA 3KBPA 4JDZA 3GTTA 3IRCA 1FJ1B 3H3BC 2JJUA 2YUZA 2KLSA 4GMSH 5C2BH 5IESL 2YR3A 3U9PH 4H1LB 2BSTB 4PGJA 1EHKB 4GBXB 2OQJA 2R1WA 4IIQB 1CLCA 3MLSL 3WLWD 3K0YA 5CKAA 4P5TA 4PRBA 3QPQD 3WFCL 2DQIL 4QJ4B 4P23B 1SOKA 4MQ7B 3FOLA 4PV9B 1XEUA 3EBAA 5I0DA 1KIPA 1NCUA 3DGGB 1KPUA 2EKSB 4R0LB 1YMMB 3N5AA 5BRZA 5D1QE 3EYSL 5C7XL 1WH0A 3TA4D 4PRIE 3FDWA 4JN2B 4IKJA 4U4IA 4URKA 3UGUA 4QRRA 3BJ91 3IE9A 3T09A 3VB8A 2ED6A 4JZJA 4YXLH 4MCYA 3T4AC 3OJDA 1LDPL 5E03A 2QKIA 1WA1X 5E51A 2Q76B 2WXJA 2OLDA 3EUUA 1HZHH 2VQUA 3S4SB 1AANA 1GS8A 4L23A 1JERA 1T83A 4UZUA 1BIIB 4C54A 1D5RA 1DN0B 2D3VA 4I3SL 1TJHL 4LQFH 5B22A 1YVLA 4DPCX 1AGFB 3OG4B 4YFLI 3GKWL 3RVWC 5LO7A 3ARDA 1U36A 3UYRL 2G30A 3KPQB 1F1AA 3V10A 2OMXA 4G5ZH 2VRAA 3HMXH 5GGSB 2NLJA 4AY0A 1VERA 1MFNA 1ACXA 2VXTH 3PXJA 1CQKA 1U8NA 4UDUA 5SX5H 3IXTB 4HPOL 1NCIA 3DRQB 4LDCA 4MCNA 3DTUB 4ICXA 4Y1AD 3KPSA 1E4JA 3T1FA 1G7MA 1UZ6F 3FT4A 1X3DA 2UXGA 4M6NH 4G9DA 1T0NA 4L29B 2J72A 3X1NA 5D96B 5B3JF 3ZYOA 1UWGL 4UTBL 5FA3B 1WRFA 3OKNA 5G55A 2E6PA 3NIGB 3ARBB 7FABH 1AIZA 2V9RA 3OKEA 4U1MA 4CKVX 2GYSA 3ARFD 3SE3A 5D2NE 1E2ZA 3SPJA 1Y6NR 1OVZA 4Y5VA 4FEIA 4AUJA 1NOAA 3EO0B 3L5XH 5A2JH 2C1OA 2X4PA 3QXDA 3TYFA 2GBTA 1T0OA 2CHDA 3LNFA 4UYQA 1PEZA 3WO4C 3QDJA 2NPLX 1OAJA 1V3KA 3OV6A 1CN4A 5LGHH 1GYAA 4IHOB 3LRSA 3N1GC 1KT2B 1GYWA 1AG6A 2CG9X 4JRXE 3MOAL 4MAUH 5F88B 2OYKA 5JXEA 6PAZA 4O2FB 3MLPA 3QDGE 4E9QA 1IM9D 2R23B 1NPJA 1KEGH 2EINB 3II3A 4KY2A 2AF2A 1IGFH 3HR5B 4IQHA 3TT3H 1QEXA 4LASL 4LLUB 1YEDB 2YA2A 4N2FA 4OZIE 1A1MA 4JPKL 2BOCA 2FEDC 5I75C 3BEWB 3C9NB 1F58L 3KR3H 3TO4C 4FHKA 4TNEA 4HV8B 4L8SC 3BWUF 2D7MA 3IK2A 4YZFE 3RNKA 2AJSL 2DIEA 3CZLA 5JQ6H 4XNYH 1K8IA 2R0LH 2RH0A 4JM2A 4ALAC 4U2ZA 4LP5A 4AJYV 2EE3A 3SKUD 2Z7WA 1ACCA 1GH7A 1LO3L 1WWAX 3GSUB 1WZAA 4O02B 2EXYC 3GS7A 1FPTH 1JZ8A 2R7EB 5TJWK 5F7YC 5T1JA 2AV1B 4Z3JA 3K80A 3HFML 5DJAB 2VDRL 3W82A 2Z1PA 2WNGA 3ZE0E 3EG9B 1FFOA 3O3UN 4L3FA 5EZIH 5IF0B 3STBA 5JIHA 1JZ2A 4PRHD 1HQ4A 5CLTA 4ZYKB 1EJ6A 4JQIA 3PQYB 2VMEA 2JWYA 1KIRB 4F1ZA 1G1OA 2K4AA 1OSZB 3M1CA 5L9DH 2NY7H 1FWXA 1UQSB 1FV1A 2ATPB 3MGOA 4HJIA 2ZKHH 3IS1X 3WNPA 5BS0A 1K72A 4PB9L 3BAIA 4AYID 1IC5H 4RLDA 3HE7B 3Q3GA 4AZ8A 3WNIA 1EH9A 4GIOA 3OXRA 2O4EA 1BIHA 1JVOA 3FYIB 1KGJA 4WU7A 5DVLA 2O5ZL 5MHSD 4YSQA 5J56B 2J3SA 3TM6A 2DH2A 4QRPA 1HXYA 3WTTA 3RVUC 5DZNA 4PRPE 5MEQB 3RWCA 4NFCA 2B0SH 1XAUA 4UT7L 3U7WL 4CRPA 4ACPA 1EO8L 4P2RB 3BZ4A 3IDYB 1MDTA 3VSQA 4NN7B 3RGVA 1F86A 4N2GA 4L3EA 3N40P 2KPWA 4B0MB 4HS3A 3L3HB 3CBJB 1JZHA 1WS7A 1CD9B 2N1TE 3BVDB 2QQNL 5JOPD 4RZKA 3P3TA 5I8CB 3F7YB 2BH0A 5DLMH 2NY0C 3BPLC 5BO1H 4W6WB 4HYTB 5DT1H 3RZCB 5ITFA 3QJTB 5JW4R 4MMZC 4UUJA 1OSEA 4M8QB 1T5KA 4FQXD 4BINA 3P2BA 2N59A 2BIIA 4JO2H 4PTTB 3NJIA 3WFBH 5I0WA 3UPRA 2NY3B 3UZEA 5DJ6B 5DD6A 1Z3GL 2ODHA 3F7PC 4DGIL 3GRWA 2V7NA 3WFDL 1ZK9A 4W9JC 3HC0B 3REWB 3VYOA 4GAYA 4RMTA 3FU0A 1JVLA 3Q1SH 5IZ7A 1QFWH 1RSFA 3MNWA 1OOAA 4FAAB 1JPEA 2QDWA 3VD2A 3ZY7A 3VXMD 1MWAH 4M3HA 1BQUA 2DL9A 4F7EA 2VKXA 2B39A 3SDAB 5I1CH 4X6CB 3LDBC 4HXAL 2ZXQA 3L3OC 3EYUL 5F9OH 1NPNA 3IDNA 2PR9A 1CGXA 1Z32X 4OIAA 1G7LB 2GJJA 5F6HI 1OCRB 5E4EB 3TH2T 4B9YA 2Q7AA 1KIQA 4K9EL 2H26B 4HJ0C 4M02A 2BY0A 1P4BL 1KIUB 4KTDL 5AEAA 2XFGB 3NEXA 1QFUL 1YY8B 1HX0A 2DIAA 4P07A 1W91A 4C47A 5GGTL 4AYFB 4H40A 2LTQC 2VDPH 5GZND 3LNDA 5ANMB 1HL4A 3A5VA 5CP3A 4C4KO 4KZEH 1W72B 4J3OD 2YWZA 4B3EA 4Q9BA 4M7LH 1FL6A 5EIVA 3TTYA 1YDPB 2VABB 2I27N 3B56A 2VDQB 1FL3A 5J6SA 1N26A 1OHQA 3DC0A 2Y3NA 5E8NA 3IGKA 2EVJA 5FGSA 1ZLUH 4BSJA 1T66D 1T0PB 4LVHC 4WW1B 4M61A 1UJ3B 2X4UB 5B1BB 1I8UA 1YEJH 3T65A 5DA4A 3AY4C 1HK6A 5IW3A 2AXHA 1VACB 3HUJE 3H6JA 2AJZB 3QH3B 5DQ9B 2NW3B 4KKLC 4HIIB 4L5FL 5CBEB 4H0LC 1A7BA 4W6YB 2FQFA 4JG9A 4AUYA 3TX4A 2XX0A 3QIWB 1JP5A 2IV9A 3CH8A 4LLDA 3AG1B 5ICZA 1A7PL 3L2LA 4L37B 4ZO8A 4JFYB 3K8MA 1BVNP 3IXAB 4EUPA 2J44A 5E9NA 3L3IB 1XEDA 4U6XB 1L9TA 3ET9F 4F15B 1QW9A 3RWJB 3CHPA 4WEUD 3QG6A 4K7FB 4XXWC 4BE6A 3EDJA 3VI3F 4D0CA 3BFQG 2EXWC 2ZAHA 3MXVL 1WSST 4QR7A 3EGDB 3VWJC 5D1XD 2BX5A 2F74B 3NFSH 3CVCA 1ZHBB 4RGNE 1FVEA 4HJJL 3E38A 3D6GA 4Q56A 1EIBA 3OL2A 1MI5D 4HKBA 1WCBB 3T08A 4PS8A 5KSBF 4J39A 4WWPA 1CPUA 2A77H 4D7BA 1KPVA 5I1KL 5AOJA 1OM3L 5JW4N 3KPNA 3WFHB 4KJPC 2YD9A 3MOBL 3EH5B 5KYXA 3ML8A 2XI9A 3CK0H 3N42B 3W0WE 3RVVC 2DWDB 3HZVA 2B20A 3KPRD 2VUKA 4UU9A 2WO3B 3DVGB 1ZK5A 5BQ7A 3DWTA 4K23H 2R0ZH 1SJMA 4LRIC 1MFCH 2AVGA 5F7KC 1BJMA 1DE4A 1H3TA 1T80A 5H37G 1QTPA 1BYOA 2EXYD 3K91A 3C2AL 2DLHA 4F2ME 1N0LB 4LRNL 2V5RA 2OCFD 4F8QA 1G7HA 3BWZA 5IFAL 4B50A 2VAAB 2FWOA 4ATTA 3L3DB 1EAPA 1WT5A 3MLSH 3NJNA 4Z7UF 3D05A 5T33L 2LLNA 3D2TA 1ITCA 3M88A 3SDCC 3WFCH 3CVHA 2M2DA 3HA0A 1BZ9A 3WV0A 1AHWB 1AGCB 1BZEA 4XVOA 1U8HB 2F5BL 4ZOAA 3V4PL 4HK3J 2AQ3A 1IILE 3C5JA 4Z0XB 3EYSH 1N2RA 5GS1B 5C7XH 4KROC 3FTGB 1TZOA 1MQKL 2HX8A 3V5HA 1NLDL 3BQVA 5HGAB 5I6KA 4Y16B 4KDTA 1ZDQA 4JRYA 1LDPH 1KPRB 3QXAA 4PJEA 2FB4L 5EU7E 4G7YL 5C9KA 1PD6A 3KYOB 3S9DB 1HN1A 3RVUD 3L81A 1OCCB 4BQ9A 2J88L 4FQQA 5ICXA 4ZZFA 1A6TB 5FGBA 2B5IB 3ZHNA 4W9EC 1KC5L 4AVKA 5J6GA 1JFQL 4RAVA 4HIEB 1QEWA 3GXFA 4EQ2A 3U0TB 1I7TA 3GKWH 1K9TA 1KJ2B 3UXFA 1I9JL 3UYRH 4QOKA 4ANWA 4FYTA 4JRFA 1RXLA 4PLKD 3D69B 3MNVA 4L4TB 3TZVB 3IRZA 1RZ8A 4NCC1 4V2BA 3ZHFA 1JMZA 2OMUA 1HOCA 3L3JA 2BHZA 4NKMA 3CZKA 3IF1A 1W0VB 3FT0A 4TUJA 5FM8A 4LSDA 4LHUB 1NL0L 3FU5A 4ZUTB 1OZTG 1A9EB 2IAAC 4YBQC 3AS1A 3OD3A 3SGJC 3WTVA 2X1WL 2Q7YB 4JHAL 3TESA 3QUKB 2ZWLT 5CP7B 2HKAA 2VM9A 1ZLWH 4PLJC 4YHIA 3FH7A 1UWGH 4UTBH 3ILPB 5A40E 4LKCB 4QGTA 4NBYB 5GZOA 4PJBA 5C3IA 1B0GA 4G6JL 4Q6YA 3FCTA 1E27A 3SGEI 4BK5A 4XI5D 4PJ8A 3SJVE 4NWUL 3NAAL 4LU5L 3QS3A 2XQBL 2WLKA 4ZDHA 4MJIE 3N3EA 4CSTA 2MKWA 4HJ0D 1KB5A 2FTAA 3O0LA 3I6SA 4HKJA 1J05B 2DBLL 3IBOA 3L5IA 4QKTA 3DPBB 1VADB 1P7KA 4RIRA 3T0EE 1TMQA 3RWGB 1RCYA 4PJ7B 4F9PA 3RUGE 1ILUA 1S9YB 3MX0A 1XCQB 4NWTL 4I1RA 3QJHB 4J6RL 1S4IA 2H32A 4JFFD 2GAZB 4XMXA 1ADQL 4LASH 4U4BA 3CQPA 4YLQT 4CN4A 4JPKH 4XNAA 2AK1L 1DJIA 1F58H 6FABL 2HMID 2BVUA 3TN0D 1PBYA 2X4QB 4CU7A 5DJDB 1BWWA 2AEQL 1U3NA 2AJSH 4JY6B 4QXTA 3UROR 3MUUA 1KGCD 4RMQA 5GIRB 3ZXAC 4GIAA 3PFQA 5AB0A 4L2YA 4J28A 3MTRA 2XC8A 5J57B 3S6CA 1LO3H 1MCOL 3O4LE 4U6VL 3QQDB 1BVKB 3AXIA 4G6MH 5D4IA 3WG7B 4FNLL 4FMFA 2BW5A 4ELKB 2IBGA 5IR1A 3HFMH 1EHLL 2VDRH 2OXGA 3BQUA 5D7LB 5C70A 5AENA 4WRLA 3V8OA 3BUDA 4XTRD 3LXUX 3HZKB 5EUOB 1JWSB 3K8LA 3ZUCA 3P0YL 3QXWA 5D1QD 4PB9H 3MV8A 3RJQB 4Y5YB 4PB0H 4Y8AA 4PRID 2BPBA 1HOEA 1SJEA 3U4EB 2GBUA 3S5LG 3BO8B 4JM2F 5HGBA 1UASA 2VR5A 2YAFA 2B9BA 3MRLA 5IEHB 1BEXA 4ZMPA 3GGWA 3NPSB 2O5ZH 3ZDXB 3CFJA 2BC4B 2XIIA 3CFCL 2ARJA 3PUCA 3AG2B 3S5YA 4YE0A 4NB7A 3Q8EA 1XF1A 4X50A 2IOMA 4UT7H 3U7WH 3IAPA 2B59A 4JFEA 4ZFFA 2QV4A 3EOTH 1EGJL 1I7ZA 1S7RA 5E4IA 5A7BA 1SHSA 5B1KA 4NZDA 4AYEC 4ZTOL 1KWKA 2HJKB 4QRTB 2QQNH 4BZ2A 1BD2B 2ENPA 1AGEA 3E6HB 3GJFH 1LE9B 1IQWL 4XB8A 3BMVA 3SDDB 5JHAA 5HGGS 3ECBA 4PJGE 2CMRL 4YSTA 4AC4A 3AS0A 2QPFA 2EH8H 2QTVA 1A4CA 4GJTB 4JREB 5E9DB 3C60B 2R2EB 1Y6MR 3GM0A 4X5LA 3SDCD 2VL5B 2BNRE 2B8OT 4LLVB 1MJUL 3UYPA 1Z3GH 4IMKA 2XDHA 5KSUA 4DGIH 3WFDH 1MCLA 1A6UL 4FLOA 3E8VA 3BPOC 5IKCB 1WQVT 2EDOA 5L6YL 3OR7A 1UB5B 2JH2A 1M7XA 2DQFB 4KROD 5DRXB 3ULSB 4A37A 43CAA 2ROYA 1D5BA 3DTXA 2KHAA 4KRPB 3VFWB 5DTFA 5E95B 3TTSA 5AKTA 4F27A 1I1AD 4HXAH 3PIQA 3WSQL 3TEWA 3FQNA 3EYUH 3GDBA 4FA7B 1TR7A 5DD1L 3BZDA 1ZV5A 1S7QB 4OF0A 1ZLVH 3H2WA 2NTFA 5FV1L 3RURA 4OZFH 1EUUA 4M5ZL 4TQ8A 3SYOA 5CN3A 1IGJB 1IBYA 3FH8A 2PP7A 4K9EH 4MMXB 4QKXB 3US9A 1GSKA 3KLDA 4KTDH 3U4BL 2X10A 3VXSD 1QFUH 1UVQA 4RDBA 3FQYA 1VIWA 3Q0HA 4JRXD 4NT6A 5F9AC 5B4MD 3Q06A 1ZT7B 5I6XB 3QI9A 1TYRA 3QDGD 4CBZA 4LMQI 3D52A 4PHZA 3FT1A 1D5ZB 1SEBA 1QW8A 1INDL 3PF2A 2G3ZA 2IFFL 1WFUA 1ETZB 5E6YA 2QPSA 4YL9A 4KRLB 1RJLB 4HPYL 1BMWA 1UOWA 4B97A 4FD0A 1YEIL 4KZ0A 1FSKC 5D7HA 3I6KB 4L4VA 3T6ZA 4G9FE 3D2UB 1CJYA 4FULA 2L7QA 5IMKB 4RESB 1QD0A 4M56A 4XZ4A 1M42A 3BHBA 1NZRA 2CGZA 1LP9B 1KACB 2BSRB 1J8RA 3FNKA 1E0OB 5EU3B 1AXTL 3EADA 4K5MA 3U2SB 1J9RA 4GRLD 4ESKA 1SBSL 1UH3A 1XTLA 1QPXA 4N3TA 2AP2A 1G1KA 1FYTB 3A6CH 3QW9A 3TBVB 1GGUA 1W6LA 1GZPA 2OS7A 3VFVA 3PL6B 3P2DA 1INEL 1KJMA 1E7VA 4NJ9L 3MRFB 3MXVH 5F2FA 5JA9A 1T04B 2EIJB 3BDXA 4QRSB 4NPJA 1C8PA 1WFOA 1S8DB 1AQKL 3EFFB 2UYLB 3MNZA 3FT2A 4HJJH 2K78A 3UZVA 3QIBD 5B39G 2LLLA 4FI6A 2NT0A 3C5ZD 4I9WD 4JZNB 4GNKB 4MDIA 1EA9C 2ZOTA 2BP0A 4WI3A 5I1KH 4PP1D 4R7NA 1OM3H 1A1OB 2C9RA 4PRPD 5E1QA 1KTLA 3D3VE 4P3CL 4ZT1A 1TYEB 4AMKL 4Y4KA 3MOBH 3LVTA 2AS5M 2XKSA 2MOGA 5IEKB 3VXUA 3OC8A 3PLYA 1CB4A 1FN4A 3GMOA 3Q01A 3NJJA 4P4RB 3ZL2A 1IGYA 5HI5C 4XHJD 2CGYA 3MROA 1MREL 3MRCA 2TSAA 5EBWA 4X0KA 2JB6A 5KBNC 2GUOA 4XMTA 1U30A 4R4BA 4K7PX 3QGVA 4LRNH 1NEZB 1U4FA 4LVNB 3LHPH 4JFDB 1N9PA 3MJ8B 4YHLL 5IFAH 4E41E 3BLBA 5E6ZA 2DY2A 2W91A 5KSAC 3FQXB 1XF4A 4JFOA 5T33H 2LE9A 3QFDB 1N59A 5I76B 1QYGH 2GTQA 3ARUA 2Q3AA 3VD4A 1OGAD 1IAKB 1MDAA 3MN8A 4UQBA 5MENA 4X8JB 3UABA 3HE6A 1N18A 4IBUA 3MV11 4P05A 4CMMA 1MW3A 1PG7L 2F5BH 3EYVA 5GQBA 2XZQL 5KUMA 1T7YA 1QWHA 1MQKH 1YMHA 3QHFL 1NLDH 5D5MF 4MMYA 3WS3A 3ULUF 4W70A 3RKDD 3TJPA 1QFPA 1W72L 3IS0X 2X1PA 5IT2L 3X11B 1TYJA 2FB4H 4LLMB 4G7YH 4G80A 5F3FA 1AACA 1RK1A 5HI3D 5F7FA 4AW4A 1FFPA 4R26L 2VDQL 4F5CE 5DZVA 4HUUA 3O8XB 2J88H 4N0UE 5FEBA 1E40A 1KELH 5ESAB 1SYVA 4MXQD 5DZPA 1UOLA 2BIHA 1JFQH 4OR1A 4XT1C 3BN3B 4JJ5A 3FT3B 4LPVA 1ZS2A 1FYHB 5JO5B 3PHOB 4L8CB 3MLYL 1I9JH 3T3PB 1BAWA 1JWMA 2LAGB 2EDQA 1LEGA 2CH8A 5I66A 3L3KA 4L1HA 5E2UH 3MRNA 1XIWC 2EVHA 2VIRA 4DPRA 2XWBA 2P5EB 5BO0D 4YHYC 3E7JA 3FZUC 3QAZC 1TO4A 2HN7B 2O6PA 1REIA 1Q9KA 4X42A 1GYUA 1HEZA 2HVBA 3KXFE 3OF6D 4ZQKA 3QK0A 5DS8A 1YQVL 1NL0H 4GH7B 3ESOA 4RX4D 1UXWB 4OF3A 4Q9CA 3FTZA 5DFVD 1A4JB 4PJXB 4LK4A 2VGLM 2Y9RT 4MA7L 3H0TB 1GY1A 1E67A 3FN9A 4GO8A 4JHAH 4RMSA 5EZJA 4CA4A 5MI0C 3BKCH 3Q8BA 3LZLA 1XGPB 4DPAX 4X4XB 1NJ9A 4YDJB 3UTTE 3K6SB 4OZ4B 4YSAA 4U3SA 3RBSA 2YFNA 1S6NA 3FTWA 4GAAA 2CO3A 4UMGA 4G6JH 3DV6A 5HJDA 1NGPL 4HIJB 4NWUH 4XPHL 3JUYA 3N41B 3PJSA 5AOZA 3NAAH 3VFMB 2XQBH 1HC1A 2HPTA 2APVA 5F9JB 2UZYB 2ZXGA 5EBLB 3G6JA 5DHVA 5E7BA 3MBXH 1IKFL 1DQJA 4Z7NE 2DBLH 4MASA 1EO5A 3UL4A 2R2CA 4HOMA 1J8SA 4NN5C 1M71B 5F8RC 1ZCRA 3BKJL 3FUMA 3LB6D 1CGYA 1DJHA 1TMCB 5DJZA 3WAKA 5K9QI 5JQHC 4JFVA 4JHWL 4NWTH 5D71L 3DXAB 4J6RH 3EHBC 2V2TB 1IQDB 1CT8B 1VFOA 2NXZD 1ADQH 1CDGA 4PV1C 5F0LB 3A67L 1WFNA 3D7PA 1IGCL 2FJFA 1B2YA 4ISVA 3RTQB 3W0WD 1TFHA 1CLZL 5DJ2B 6FABH 1ZDSA 4NNYA 4DK5A 5IJVA 1INQB 4LOVA 4KKPA 3PABB 1D3CA 5GGQL 4ILDA 5CMAA 3SKOA 1J9TA 5HPOA 4F93B 2VXQA 4BZ1A 5EU5A 2IQAA 2WBJA 3BSZL 2GSMB 1MCOH 3ZE2F 3CSYA 3QORB 1WWWX 2ADFL 3KAAA 3SPIA 3H6AA 4FNLH 5HYEA 2ZOUA 4Y4HA 2EYRA 3EFOB 3UGXA 5ESVA 1EHLH 4CGTA 1BBDL 4MWFB 4LSPL 1S7WB 4OVVA 1EFXD 4UI2A 1G0DA 5FDWA 1R46A 3KWVA 4Q6IB 1XF5A 2D73A 2W65B 3PWPB 3P0YH 2JJTA 1D6EA 5HPMB 3VFUB 1ASPA 3CDGA 2N7AA 3MRIA 1PX4A 4U6YA 3D0LA 2WP3O 3NABL 4PLOB 4JB9L 2YUWA 4M5SA 5KOVC 1NC2B 3OR6A 1NEUA 2DIBA 5J11B 2ALWA 2OKMA 1MCPL 4YSOA 3NJKA 1AOHA 4WKXA 1I31A 2VITA 1MCWW 3F01A 3GMMA 3Q2CA 3FFDA 3C09B 3ISYA 4XODA 3ZO9A 5HI5D 5IB1A 3V2AR 4ZTPL 2YN5A 5ABAA 3O2DA 3MUJA 1EGJH 4KXBA 4DVBA 1JF6A 1NLBL 1PY9A 4ZTOH 4XMWA 3GPEA 3VWKB 1MLBA 2QLVB 1J8HB 4PRDA 2VUOA 4PQXA 2KUTA 1NGYB 2KQNA 1TCRA 1T6BX 1E4HA 2GJ6B 4HT1L 1IQWH 4Q7DA 1SXSA 4WI8A 1S5HA 5L2KE 3K0WA 4QUOA 5LB1A 2CMRH 2HWZL 4KK8C 4Y2DC 5DK0B 2FZ3A 3HS0C 2JKLA 1AD0B 3RY6C 3TA3A 3QSKB 1NAMB 1U3HC 2WOYA 4XVUC 1BV8A 2I60L 2WWMC 1B4LA 1MJUH 2IDTA 1OPGL 3VB9A 1L5GA 2EC9T 3V0IA 3VI3E 1A6UH 3CD4A 3R7QA 3BLKA 1AD9A 5L6YH 2ESVE 5H37A 4OJAA 5HDBB 1KTJA 1WBXA 2YPLA 3QE5A 4N5EC 4MKMA 3QJQB 2VXUL 4E42A 3VFRA 1OB0A 2VW4A 5TDPB 4FFYL 4ZUVA 3RVTD 3WN5B 3ABLB 4X4ME 5D7JD 2ICEA 3Q5TA 2BSCA 4OM0L 4P2AA 5JW5A 5T1LA 4UTAH 5DD1H 4N28A 5IVOA 2NDGA 2PYEB 1B2WL 5LGYA 3SJVD 3GMQB 4M5ZH 2Q9OA 2Y7OA 3T0XA 2CLVB 1URLA 5AW4B 1AS6A 4MJID 5HD8D 1KJVA 1TZHB 4R7DB 4ODBD 1SFHA 4KO6A 3VSUA 2YA0A 2YMOA 1SBBA 1E90A 4KPHL 3U4BH 4DEPB 2OP4L 4Z23A 4ZNEE 2IGLA 2F54E 4Y19B 3AC0A 2ZKXA 4YO0B 2NYYC 1OZUA 2X5PA 3T0ED 2TSBA 4GLRI 2CUAA 4MAZA 3BPNB 5I0XA 1XIWD 2FIKA 3WEBA 3CZNA 4QHLB 5BUGA 4NQXB 3NESA 1G9MC 3DJZA 2MOQA 3APMA 3L5HA 5FOJA 1RERA 1T5XA 4JZOB 1UCTA 2F53D 4HPYH 2A73A 4XCFL 4YPJA 1E3XA 4OLYL 1GGBL 1SOSA 1YEIH 2ZOLB 1PDKB 3HR6A 4IOSD 4QHUB 4ZAKD 4BE5A 3QCUL 1YN6B 4XPTL 2M8XA 5T3ZL 5I2IB 2DMCA 3CTTA 2J6EL 4TVUA 1D7FA 2AK4A 4YEFA 1K8DB 4TKWA 3O4LD 4P06A 2P49B 4D0DB 2E3VA 4JPSA 3TFBA 4OFPA 3FO9B 5T5FA 4Z5RA 2LV4A 4PWHA 1THCA 2FLBT 3RWIB 5ITBL 5I6MA 1L9PA 1SBSH 1H5BC 1UB6B 4ZFZA 5IROD 4G8GB 4JKKA 4OIBA 1YHPA 3ZGHA 2MNJB 3T0WA 3STZB 4EN3A 4HOWA 2XY1A 2DAVA 4GBXC 2R29L 4IIQC 4XWGL 3WJJC 5EZOL 4Q58C 2DJ4A 3OLDA 1AQKH 1I4FB 3L1FA 2FJHB 4CILA 2OMTB 3OSKA 1L9SA 1UT9A 2P48B 4BFNA 3TNMB 4P23C 5HYJA 2UZIL 3JTTA 3EHBD 1KY6A 3P4OB 3K72B 4X4ZA 2VR6A 4I0CC 4R0LC 5CM1A 4B9CA 4U0QB 4X99B 2PTTB 1CGSL 5KJ7E 4P3CH 4AMKH 3MLVL 4QYOB 2EQDA 1MNUL 1AS7A 2MNWA 4KKQA 4APQA 3U30B 4J5VA 4O2CA 1W80A 5T1MA 1MREH 5AW3B 3MOQA 2ZCLL 2OMBA 3V6FA 4HUVB 3UZQA 3DO3A 1QWUA 4ODHL 1GCFA 3CFDB 2J43A 4HKZB 1KXHA 1NFDE 2QLYA 4YHLH 5J1SC 3P9MA 1W8EA 2Z34A 4AQ8C 4KO7A 2BNRD 4ZXBD 3RDTB 5GISL 1EZVX 3FRPB 2JF1A 2XNAB 4OI7A 1YPZA 2HJFA 3ISWA 5HY9B 1PFOA 4JFTA 1PG7H 1HNYA 3ARWA 3BSGA 2EABA 1OGTB 4A7VA 1FIGL 3CCHA 2NYKA 3HC4L 3OX8A 2XZQH 3W37A 4B9GA 2BMKB 4PGDB 3ENEA 3OPUA 4EF3A 3OKMB 5DURD 5IVZA 1JSYA 2H0PA 3SKMB 4XN7A 1W72H 3OMNB 5IT2H 3D25B 1ORQA 1DN2A 2BIOA 4ZJ9A 2HZHA 3DO7B 4P5KA 3GT6A 2UZPA 4IOFD 4R26H 2VDQH 3ECQA 2YBRB 3I85A 4JLRA 4HWZB 3VRIB 4AM0B 3QJUB 4DTGL 5KYNA 4MSWB 3HRPA 3C2SA 4WHCA 3R0MA 2G3NA 5D96C 5HDLA 2YN3A 5FX3A 3OKDB 3AAZB 1DUZB 4KHTL 3S5LA 2NW2A 1J5CA 3CLEL 3PGDB 1CMOA 4FXKC 2XHNA 4KNSA 4N2KA 3D5OF 4FI7A 4AZUA 4DEUA 4YBHA 3V8CA 4KI5E 1QVOA 3DX8A 1ZT1A 4WTXA 5E8OB 1GOHA 2UXTA 2P3YA 2DS4A 3VNZA 2YGNA 4W4OA 2YAOA 1NMCB 2X4NB 4Y2DD 1JOIA 3QUXD 5IJDC 1MVYA 3GBML 4JFPA 4XVUD 1TZAA 4KX7A 2HYMA 2VXVL 2WWMD 1CI3M 3QFJA 1U58B 2R1YB 2KMWA 3UFIA 4YHOL 1EEUA 2HFFB 4LCWD 3GB7A 5C07E 2F2HA 2XN0A 3E3QC 4L4TE 5AALA 1BZOA 1GKEA 1XTMA 2C34A 2NDFA 4G9FD 3CDYA 4Y4FB 5H2BA 2X42A 5KTEL 2MPAL 3WXWL 1NGXB 4HK0A 4MA7H 4NNPH 1EVUA 2K9FB 3W9DB 4KRMB 1C16A 1H3GA 1WV7T 4W81A 3L08A 2OJZH 5ENWB 3BUTA 2V2WB 4PJDF 2IG2L 4JKPL 4KQ4L 5FECB 4YE4L 1R4XA 3QA3A 4I2XB 4DKEL 3VD0A 5I6NA 4Q2ZA 5EEWA 2VLRB 1NGPH 1IC7L 4MRBA 2WLJA 1XFPA 5TFSL 4XPHH 2C9SA 3GK8L 1BPVA 4WHTB 4F20A 1N8ZA 5HHME 4M7JH 2R39A 3WTXA 4D8PB 3WLBB 2E9IA 3LAFA 2Y7QB 4A2GA 3POCA 1IKFH 5CWSB 3OAYK 3TURA 1BF8A 4ZD3L 3R06A 1AC6A 2NZ1A 1JMXA 1LO4L 1PNCA 5DVPA 2QDVA 4EBQL 3BKJH 1WBZB 2WKGA 3C87A 3VXPB 4AYSA 2VLJE 4DQOL 4XVTL 5HHVH 4JHWH 4XB7A 5D71H 3O41A 4N2HA 2BVPB 3UBXB 4Z7OF 4DEWA 2A6KB 1QSEA 3KPOA 3KLSA 4I0PA 4NIKB 4ZFOA 3A67H 5IHHA 3HE7C 3D3VD 2VM3A 4NFDA 12E8L 1IGCH 2ZCKL 1W16A 3QQ3B 4GO6B 4PJ7E 4GQRA 1K2DA 4QRPE 1ZEAL 1CLZH 5BZDA 3KLHD 3VNYA 3BGMB 1J8KA 4U1JB 3FONA 4JY5L 5GGQH 5F7WC 5I6PA 4WUUB 4FX5A 2AC0A 1QZNA 2YZ8A 4G7VL 1R3HA 2X3CA 4LCCA 1T1YB 3VMOA 1TKWA 4X5WB 4XBPA 3FPYA 3G6JF 1AXSA 1BXUA 3BSZH 4P2OB 3SGDI 3M17A 3COOA 4JDTL 4MD4B 5DUPL 4PWIA 5IBUG 3L4UA 2ADFH 1BCIA 3IDYC 4PHXA 3LZRA 4NN7C 4DN3L 5E1AA 4E41D 3G6DL 2OTUB 3PAUA 1I8KA 3GQFA 1SF3A 3QUZD 1BBDH 4UIKL 1QSFA 4LSPH 5AVSB 1OD7A 4KJQC 1NOFA 1F4WL 1GZHC 5KG9A 2E6JA 4MX7B 4X6DA 3RZCC 1AI1L 2OXHA 4HU8A 1JD9A 4GBXD 3WEAA 4NRZB 1NTDA 3CLWA 1MELA 1EANA 3FK3A 1QACA 2W0FA 4ODVL 5D7LE 5KYWB 4OVUA 1QTYT 2NY3C 3HHMA 2HLAB 3PHQB 4P23D 1XHHA 3GBEA 3FYEB 1Z66A 3NABH 5EUOE 1R3KA 4UWQB 3O11B 1S7TB 4HMEA 2X1XR 2ERJB 4JB9H 4Z7QF 1F6AB 1ID5I 3VE0A 4DKDC 2DQMA 2R2BB 4HS6A 3I6LE 4Y9CA 1YMMD 4ZODA 5SX5K 5T3ZE 2WIIA 4C83A 2A6IA 2O5XL 2X9YA 4UQ2B 3QP3A 3Q6FA 3SBQA 3C6LA 3IVKB 1MCPH 3ARZA 4RSVA 3S36X 3S3CB 3T5WA 4UQ3A 2CJ3A 5L2JA 1XCTB 3RL1B 3L45A 3SDAC 1K4CB 1U2YA 2K70A 4ZTPH 4U7MA 3ZDXE 1HHHA 5IIEA 3TJHC 5B39A 3HRZA 3QJRB 3WY3A 1NKRA 2L3BA 3MMEB 1NLBH 5LUMA 1WC7B 3IDJB 3DJRA 1KNOA 3GLZA 3VI4A 2HTLC 5E4EC 2N1KA 5ESQA 3UMNA 3LZFL 4M48L 4HT1H 4JFXA 1YNKL 4BFIB 3DUUA 2HWZH 1UGNA 3P0VH 4NO2A 4GRMB 2AMGA 4G1MA 4O58L 1CK0L 3UYOD 4S2SA 4YHNA 2I60H 2CA3A 3C6SB 4E5XG 1OPGH 3KXFD 1QR1A 2ZAGA 3DUSA 4HSAC 5I8EA 2F18A 3UBXI 2DM4A 4N0FB 2CK0L 1DANU 4H26A 3EOBA 4IMLB 5EG6C 5CCKL 3FB8A 4BFEA 2MCAA 1GJUA 3V6OE 1JK8B 1I1YA 2VXUH 5EC2A 3FH5A 4H20L 5D2LE 1KG0A 4FFYH 4HKXB 3TPKA 3UTTD 2V3FA 1UJ3C 1TQSA 3QEUB 4HHAB 4CADB 4OM0H 5DEGA 2JELL 1RUQL 4M3JA 1UEMA 1ZKAA 1IVLA 4FYRA 3BIKA 4ZUSA 1J48A 5CLWA 4ZMAT 2W38A 3PREA 3MRRB 1B2WH 4FTVA 3ATAA 3O9WB 4NO5A 2VJ8A 3OHXA 4GW1A 4MB5A 3QUYB 4NPYB 5DR5L 3C8DA 1XGRA 2Z7YA 4ZMVA 5I16B 2A0LC 1FAKT 3EGXA 3ARBD 3QIWC 4KPHH 3NCBB 2VN5A 4P4KA 3VFOB 3L7EA 2AAVA 2OP4H 3OJVC 4RMUA 3IEAA 1DVFD 5AW8B 2FJGB 2MHAA 2OYMA 4FCHA 3HIZA 3STLA 4MD5B 3I3BA 1UWEL 1YAZA 5EULV 3Q6GL 4M62L 1PPIA 3WUWG 1QI5A 4WAFA 5HSFA 1WVZA 1ZJBA 4LOEA 4OZGA 4GIPD 1Q90A 2Y5EA 4XCFH 2VQ1A 1XF3A 2MQCA 1G7IB 1AZCA 2YAEA 1GGBH 5DHEA 3RPBA 3MR9A 4NO0D 1I7RB 2E8YA 3IMVA 3X2QB 3LY6A 1BXVA 4APXA 4JN1L 4JO5A 1Z9MA 1I8LA 4X7TB 3REVA 3QCUH 2CO1A 5AG8A 1H9VA 1FA4A 3GSRB 3T2LA 4XPTH 1C08B 2VLLA 4WW2A 4FQJH 5T3ZH 5LN8A 3LH9A 5EEVA 2J6EH 4HUNB 5D5ME 5ICYB 5MP6L 2EIDA 2A38A 1SLXA 4PJAA 2B14A 1LILA 2WN2A 4JGJA 2B16A 2CO7A 2WBWB 2YEZB 3FB6B 3KWXA 2ZUYA 5GGVL 2EDBA 3T2NH 1ONQB 5ITBH 3PWJA 1GKOA 5DO2D 2XWRA 2HFEA 3LNGA 1TNNA 4JM0A 5E8PA 2WBKA 1HHJA 2VISB 2VQ4A 1GW0A 3FSOA 4LGRB 1UD5A 2RACA 4M7LT 5JHDB 1CFSB 3MLZL 4QTHA 3PGFL 1X6NA 5FIEA 4XOBA 2W07B 2R29H 3DUHA 4QHMA 1Z5LB 4XWGH 4NLAA 3V52H 5EZOH 3VRJA 3RAJL 5D7IB 3RPKA 4M8UA 3VXRB 5FA4A 4M93B 3PQYD 3VMNA 4GP4B 3W2DL 4Z7WA 2WMPA 1AHWC 2UZIH 2XBZA 4JCMA 2XJLA 2K9UA 4JRYE 1E5AA 4ZQTA 4PY8I 3WJLA 5GS1C 2EAEA 1CGSH 2OSLA 1XR8A 4N86A 1FLRL 3MLVH 2DMBA 5BVPL 1MNUH 1CD1A 5JYMA 1SXZA 4KOBA 2VMFA 2ZNWA 4JJOA 1X5MA 4LGPB 5F72S 4KKNA 3GTNA 4XP6L 1SDYA 3QHZL 2B1HL 4G1EB 4K3JL 2ZCLH 4AGQA 2ZCZA 5AUMA 1SMAA 4ODHH 1NFIB 2XVGA 4JDZB 4P2RD 2B5IC 1J1XL 2WGXA 3IE4A 1KBWA 4RGOH 3CFBB 3U79A 3IMBA 1XGQA 3A3YB 4Y89A 5L2KD 3X1GA 1X5KA 2DQUL 4UTCA 4LSSL 2GCYB 4W68A 5DLLA 2OQJB 2GBAA 2R1WB 4PWGA 5EU4B 4KJQD 5GISH 2GIXA 3DGCR 2XXGA 1QI3A 4P5TB 4PRBB 1OP3H 1I8IA 1DBBL 4JFDE 1TCMA 2ESVD 3TZVC 1CIDA 3C6EA 3FOLB 4CU6A 1FIGH 3HC4H 1T03L 3MTXA 3QRLA 4R2GB 2CE6A 1KXVA 4NERA 2ZSVA 2Z8SA 3FU8A 5BRZB 3H9SE 2ETWA 4EIGB 4RSYA 4Y1AA 5FW7A 3KPTA 1DANT 4FNRA 4NUQA 2TAAA 4QRRB 5C08B 3OKYA 4LEXL 1WZKA 4MCYB 1ORSB 3OJDB 4YSCA 4JVWA 1ZLUK 4FFZA 5J3HD 4XP9L 4QY8A 5B7MA 5T3XL 5TQ0H 4BSWA 3T0BA 4DTGH 5KN5B 4JFWA 5E0FA 3UAAA 1X5ZA 1PY4A 1E9OB 3DX6B 3M86A 4WLCA 5ADPL 3ARFA 4FRWA 5DVKA 3TJHD 5F0JB 4KHTH 4CNIA 1JZ5A 2K3TA 5IGXL 1OF0A 1YYML 2F54D 3CLEH 4Y9FA 1RZKL 4BRVA 1YPZF 3EDKA 3HJ0A 1P84J 3QXVA 2ZG2A 3MRQB 4M29A 4LOFA 5F7NC 4D9LH 1JZ4A 1HHGB 3LQAL 3ARDB 3LZQA 5F8QC 3SYAA 1MCIA 2AGJL 1QBMH 3H1ZA 3M46A 5KVEL 2R27A 1JYVA 1UEYA 3N2JA 2OMXB 1M1SA 1KGUA 2GK0B 5DDHB 3GBMH 5F44A 1IM9A 3AY2A 3K4AA 3TIEA 2V5YA 2VXVH 2NLJB 4NYLA 3T71A 1OSPL 2UY6A 1Q1JL 5A6LA 4ZW3A 1X5FA 3B2VH 3HLAA 1IC4L 1G9NL 3MLXL 4KHXH 2BNQB 3Q1EA 5KTEH 5A2FA 2V8MA 3WXWH 4V1DB 4UV7L 5FK9A 4L1DA 5KVDL 5LBSA 2F9BT 4NDMA 3KPSB 5JW4M 1MLCA 4FQCL 3T1FB 4BFFA 1G7MB 4BKLA 2BCKA 4ZFQA 3ZTDC 2C7FA 3OQRA 2CIIA 3FT4B 4MJ2A 4F3FB 4M9PA 3RIAK 3BN9C 4G9DB 4IBYA 2IG2H 4FXGA 4JKPH 4KQ4H 4YE4H 3UEZA 3U48A 4DKEH 1ES0A 3IFOB 2IXQA 1OT1A 4U1MB 3OKEB 1IC7H 4D9RE 5TFSH 3WIHA 2I25N 3NJFA 2V37A 1ZA3A 1ODAA 2X1OA 3GIVA 5I74B 2P7TA 2YPVA 4H0GA 4JFQA 3NCWA 2X4PB 3QIWD 3QXDB 3TYFB 5FKAA 4HUMB 1FZMB 4M7ZB 2NUPB 4MS8C 3QDJB 4NQEB 4DO6A 3AREB 3LIZL 5IW6A 1O9VA 3ML9A 1DVUA 3RDJA 1JZ3A 1ADWA 2G2RA 1SYSA 4PRHA 3SKNA 4L3AA 3BWSA 4N85A 4ZD3H 3EO9L 1LO4H 3LRSB 4WU5B 1V27A 4TLKA 3WIFB 4EBQH 1M7UA 3MV8E 1RUPH 1IBZA 4GYBA 4HIQA 2D8KA 5LCVL 4DQOH 4XVTH 3FCSA 3ETBF 4CN6A 4PJIE 3NOIA 5BVJA 3K2MC 3B2MA 1IE5A 4Y5YC 3UAEA 2BFVL 3GSVA 12E8H 5EIIG 3EH3B 2YIHA 1DQML 4UNUA 1ZEAH 2BOCB 4S1RL 2VLKB 2GJRA 4JY5H 2CRIA 2EDJA 3BVNA 3NPSC 4PJCA 1Q9WA 4XNDA 4EXPX 4G7VH 1MUJB 4AKOA 1CXHA 1G87A 3QZBA 1LWHA 4N25A 1AJ7L 5ETUA 5HDWA 3P4LA 3FQTB 3MKKA 2XOTA 4JDTH 5DUPH 3ESNA 3LPWA 5T1DL 5IBLD 5CJXA 5AZUA 4DN3H 3G6DH 4A68A 3VCLB 4KMLB 3IKCB 4DESA 1L9NA 3V4UL 1GGIL 1TQTA 1YJDL 3MQIA 1U9KA 3DKHA 3F83A 4ONHA 1IFRA 3MJ9L 4H5SB 1JGEA 4UIKH 2AEIT 1WG3A 1F4WH 3IETA 2NX5B 3QO0A 4FQXA 1L4IA 5I82A 4FKKA 2Y7SA 2YLHA 1OT4A 3SDDC 5D4QA 1AI1H 3ECUA 3D0AA 4YVNA 2ATKA 4YPGA 1RL1A 3FF8A 4ODVH 5JW3H 4JREC 5BS0B 3C60C 3BT0A 4YGVB 1DBJH 1F90L 3U6XA 3Q3GB 4AZ8B 4B0MM 1LEKA 4Z8FL 1J18A 3OXRB 3ZDYF 4OI9A 4LLWB 5HHXH 3V4VA 1FO0L 4F8NA 3PWPE 4FNTA 4WU7B 4NQQA 2O5XH 4W9CC 3FUDA 2CR0A 2PO6D 1HXYB 1LJMA 4Y16D 4KJYA 4P5SA 4N2IA 1QBLL 2H0FA 3SBWC 1GW6A 1P1VA 4KRPC 1MW1A 5C0EA 1JWUB 3AJ7A 3BZ4B 3HCVA 1ZLWK 5J1AA 4BCZA 1VEMA 4L3EB 3WL9B 4HS3B 4X6DF 2W80C 3NT0A 2VTFA 3E1ZA 3FCBA 1BQSA 4R84A 4KI5D 3BH9A 3LZFH 4M48H 4NM8L 4MMXC 3GLAA 1CTMA 3VXQA 3VGBA 1MCJA 5GZNA 5ITFB 3JTSB 3JZ7A 3LMJH 2X70A 4WI9A 4O58H 1JGVL 1KTDB 4N1HB 1FE8L 5I6XC 4HZAA 1GGCH 3NN8B 2XIDA 3VGHA 4EDWL 4IW4C 2GJ6E 5C07D 4L4TD 5DD6B 1QR4A 5DQJB 4K3DL 2V7NB 4P46D 4P2YA 3TS8A 2CK0H 5C0GB 5FGCB 4XMKL 5IQNA 2X41A 2P5WB 4A1RA 2XETA 4IM8A 3B34A 2QVMA 3QQ9C 4IRSA 1HKLL 4GUPA 4JDVA 4G6AC 4H20H 3V6ZA 3MNWB 3JV0A 4JL2A 2NSQA 2R8SL 4D94A 2JK5B 1GYCA 1VESA 4F7EB 2JELH 3EJRA 4GXUN 4N9OB 3G5XA 1FH5L 1T21A 5JDSA 1B9KA 3FHAA 2XVLA 4IRZA 1QUNA 3AITA 3SGKC 1U8KB 5A2BA 2RR3A 5HHMD 3F05A 5DR5H 2P52A 1QHQA 4GOSA 4S1DD 2MCMA 4KITB 4OAWA 5TGBA 5C0IA 4GKZA 3DARA 4WQOA 3K6DA 5D7SL 1X6LA 5AAMA 3V5KA 2YD0A 2G5BB 5EU6E 3CXFA 3C5SB 3KDMA 1BREA 5E6SB 4FJ6A 2VLJD 4HXBL 1SJHA 4YDLC 2OW6A 4PIBA 1UWEH 1WZ1L 2VRKA 5D1XA 4A38A 2FT6A 3PL6C 3ZTNL 2DM7A 4I8DA 4XC1L 1E42A 2CBOA 3Q6GH 4M62H 3EAKA 4PREA 4FZ8L 4UZGA 1FL3B 1MI5A 1ZXKA 5E8NB 4AEHH 1DQQA 5CZVL 4GLRH 4NO3A 2NYZA 3ESPA 4M61B 1DZBA 3ZR6A 3ZDZE 4GSQA 1T2JA 4K9JA 3S2CA 3T65B 1TQWA 3ZE1B 5T3XE 2EIZB 3NJLA 2H1PL 1BFTA 4HCRL 5FM4A 3TNNA 2YEQA 2V6HA 5HDRA 1F3JA 1RI8A 4L8SA 5MP6H 1DZ0A 2CDFA 3BN9D 3GSXA 2EYSB 3KPRA 2V17L 5JLZA 2V2XB 5ALBL 5HHNB 3BEVA 5GGVH 5E70A 4TUKL 2XBDA 4MZ3A 4M6ML 5JNYA 4V11A 4LLDB 1RZGB 2BY3A 2F5AL 1HSAB 1HH6B 4JHVA 1LO5B 2EIKB 4XPFL 2EDYA 1DO6A 2ENYA 4Q4EA 3HVNA 3QS2A 3GMPA 1A3LL 3VM5A 1JZGA 4OZGF 3B1TA 3D39A 3MLZH 3QG6B 4LVNC 4R90L 3GSNL 3PGFH 1RIUL 4HH9A 4D0CB 1T1ZA 1HHKB 3SY6A 5D7LD 4EZMA 4TTDD 4G8GE 3GJFK 4DERA 1EZLA 3RAJH 2IH1B 2DQDL 1NUFA 3AABA 4KXDA 1FVEB 4YNYB 2Y36L 3FUIA 4Y7MA 3W2DH 4CW1A 3LSOA 1H8NA 3N04A 4W9HC 1I8MB 2X0WA 3I6LD 5T3ZD 5KS9F 5KVDE 3UO8B 4HKBB 3DI2B 3V0VA 1WJ3A 2A2QT 2GUYA 2X89D 3EGSA 4WTWA 5AAWC 4YHPA 2QVFB 3WDJA 1FLRH 4UQAA 1BLNB 1NM9A 3QNYA 3HNTH 5BVPH 4IYKA 2HVJA 5KYXB 1SPDA 4DGYL 2O6CA 1DVQA 1B9ZA 1UXMA 5BV7L 3D33A 1D5IL 4XP6H 4LEOA 5FUCC 3QHZH 2B1HH 5EUKA 4K3JH 1XSOA 4L9LA 2NOYA 3F64A 3IJYA 4POUB 4UU9B 5IUSA 3KPPA 5BQ7B 3B1UA 5H4YA 4PJDE 1ZLVK 1DE4B 1VRSA 1J1XH 4S0SD 1VFMA 3R4RA 4RWHA 3D06A 3P11L 1E7UA 2E4FA 2DQUH 1G7HB 3FQUA 5E8EA 1F0LA 2C3XA 4LSSH 4H25A 2I26N 4WHYH 2F1EA 3MCKB 1T4KB 5AOKA 1XF2B 1H8OA 3SDDD 5BMFL 3QJOA 1DBBH 4Y2OB 1YN7A 1BZ9B 1KEMH 3O3EA 3QO1A 1T03H 5E9DD 4JDEB 4L8DA 5HYQA 1WE5A 5LHDA 3N44F 3C5JB 3I9PA 2ITFA 1N2RB 2GT9A 4AIXA 3I9GL 1PKQB 4AQAA 1SVZA 3V5HB 4LEXH 2WTPA 5F7UA 4Z7VB 2B2XL 5FKPA 5IJBC 3HS9A 4HGWB 2V9TA 4PJEB 1ZGLA 3HAEB 3FSVA 4XP9H 4ODXB 1TJGL 5T3XH 5I71B 4LZKA 5L8LB 3P4NA 1IM3B 3B5TA 3WEXA 1IZJA 2N7SA 4ZMNA 5ADPH 4FQQB 5DYOB 5E56A 5CBAB 3PWNA 4PJHF 1P7QB 3KWTA 5IGXH 3QIUB 5J6GB 2EUXA 2DM2A 3NFPA 1QEWB 3HMXA 2VZOA 5BXFB 1I7TB 3G5ZA 1MCKA 1RAMA 3O4OB 4BGLA 1RZFL 2X6VA 4IBVA 3LQAH 3G7TA 3KG5A 2N7BA 4QOKB 2AGJH 3CHOA 1GAFL 3MNVB 4PD4J 3UP6A 4RDQG 4JHZA 1FFNA 5AZEL 3WTYA 2APXA 3UTPE 4AYBA 2OMUB 1OSPH 4N8UA 4H2CA 4NKMB 1Q1JH 3IF1B 5D9SB 1PZDA 4V33A 5C86A 3FAXA 1HL8A 2IH9A 1KSRA 4FYQA 1CCZA 3EKCA 3OTTA 4JFFA 1IC4H 1G9NH 2W5PA 3MLXH 1B4RA 1IEAB 1PYWA 3F12A 5J12B 1PU0A 4ATWA 1KN2H 1S9KC 3QQ9D 5KVDH 3NEEA 1OWRM 1CURA 4FQCH 2IDUA 1FNEB 5ANHA 3PCYA 3ZN6A 3RU8L 1CFMA 2EIMB 2H41A 2YFOA 3TN0A 3NBNA 3RTQC 4J2QA 4WWKC 1PIGA 3QEQE 2O61B 4X80L 3D2UD 3HB3B 2PPCA 2W60B 5L4IA 1OAXL 4E5XA 1QBAA 1DBKL 4PJBB 2Y5QA 5GS0C 1WBYB 2VOTA 5FC9A 3ASOB 4PLNC 4RAHA 4GXFA 3B7SA 4PJ8B 2EDNA 3APNA 1J88A 3QORC 5LGKA 1JCVA 1GR7A 1AR2A 3ZRFC 3V7MA 3OAWA 3SPHA 1KF9B 3LIZH 3TBYA 1I7UA 5EFIA 1AZRA 1FYTD 4HKJB 4HEPG 3T3MF 3EJPA 3EO9H 1UM4L 1EK3A 3LNEA 5DRNB 1IB5A 4PCSA 4R8WL 5HJ3A 5AL0A 4DP6X 1SXNA 1B6DA 4RIRB 5GJSL 5LCVH 1SLWA 5E5UB 3VFNB 5D1QA 5I8KL 4DUWA 2XQYK 4PRIA 3MX0B 4Q6IC 5FHBL 4XO3A 3NJHA 2HB0A 2BFVH 2XZCL 4XBGA 3OKKB 1PD1A 2WANA 2OTWA 3U1PA 4PP2B 5DFWH 1DQMH 1DEEA