4UDTB

T cell receptor (trav22,trbv7-9) structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLGGYEQYFGPGTRLTVTEDLKNVFPPEVAVFVPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C R
publication title Structure of Staphylococcal Enterotoxin E in Complex with Tcr Defines the Role of Tcr Loop Positioning in Superantigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4udtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4udtB02
1CGSL 3VCLB 5DJDB 2FX9H 3QIBA 3C2SA 3DSNA 5E2WH 5E1HB 5CD3B 3SKOA 1TVBA 3FONB 1XGTB 5KSBA 2EDTA 2G2RA 1KFAH 1MJ7L 4XMLH 2V2XA 4NQCE 1CD1B 2A73A 1R3HA 2OMNA 1I9JL 4I3GA 4NQDB 5E9DB 1G84A 3HE6B 1A1NA 1WC7B 4NWTH 2EIDA 1RUKH 4WTZG 5EOCL 4MSWB 1FDLL 1J8HE 3PP4L 4BFBD 2DLFL 3NCCB 1GOGA 4XGZA 2NY5C 1OTUD 5EZJA 1EAPA 2NW2B 3T0EC 1AR2A 4YHOL 5I74B 5IW6B 3PJSB 4OLVL 4KTEL 5FDYA 1FAIL 4Y1AE 3VMNA 1YJDL 4CRPA 2GFBB 2C3XA 5DJXB 2F58H 4JFQA 2VZUA 1SEBA 2DKUA 3QAZB 2ADIA 2BERA 3QHZL 4PJBB 2XKSA 5D1XB 4YDKH 2DQUL 3MV01 2CDEA 4LASL 3WLBA 4HT1H 5TE6H 4WW2A 1YY9D 4ZPVA 4MXQD 4DVBB 1XF1A 5TF1H 1HOCB 4HMDA 1UQSB 4PYHA 2AXGA 4YHPB 2F5BH 2WWKO 4N8VA 2GJ6B 1RMFH 2HT2C 3AY4C 3ZKQD 3MFFA 4LF3A 4CJ1A 3IXTA 5FO8A 1BREA 1U2CA 1S7TB 2F5AL 1OM3H 1KYOJ 3OWEA 4QRUB 1N6QH 2CJUH 4KI5C 1P7QD 2D7MA 3RZWA 5T3ZD 4KFZC 3LRGA 3C2AL 5ICYA 1A7RL 2YZ8A 4UV7H 3V6FB 4UOW1 5L8LB 5KBNC 1HHKB 4WTXA 2V7HA 4X9BA 3QDMA 4JFEA 3QHFH 1HI6B 5IVOA 3TCXA 4Z7VE 4ISVB 1HH6B 1IEHA 3S36X 1T4KB 1YEFL 5AZEL 4L5FH 3TIDA 5J6GB 2OQJA 1XIWA 4LRIA 1SM3H 2OP4H 3T0VA 2D7TL 2HFFB 5D2NB 3KLDA 5KS9F 1IQDB 2J4WL 3LQAL 4H8WC 2C26A 3WO4C 1RSFA 4X4XB 1DL7H 2B1AH 5DMJB 2CK2A 1YEHH 3INUH 2LQRA 4G6ML 3SQBA 4U1HB 5IHUH 1RZKL 2AEPL 5HVHC 3B5HA 3T0EE 5HY9A 1S78C 1NJ9B 4JKPH 5BMFL 3HKFA 1JHKL 3D2UA 2BSTB 1LO0H 4FRWA 5MERA 3FT2A 1FLTX 3B9KA 3DMMC 3HUJE 2QHLA 1WISA 3CGTA 2NTFA 4PJ8C 3IFLL 3ROOB 4NRYB 4UAOC 4OLEA 3HPLA 1MQ8A 1L9NA 2CLRA 4NKDA 5ITBL 1FYHB 5IVXE 4O2EA 5TQ2H 4IMLA 1N0LA 2VSDA 3L1OH 4U1KA 35C8L 2MQ0A 4OCWH 3C6SB 3KYOA 2PUQT 5TDPA 4FMKA 4E0RB 1DE4A 2HVJA 4N68A 1D5XB 4GRWB 4LLAA 3UZQA 4ZAKA 1I1AA 3X3GH 1U42A 1FL6A 4G8EA 3GMMB 4OFDA 4KI5E 4EVNB 5IW1A 2DI7A 1OSZA 4PRBA 1MEXL 5ESVB 2JJVA 3OXRA 5GS2H 3G5XB 1RU9L 4XVSL 5F1IB 3LZFL 3HFMH 3F6LA 4H0IA 4JJHA 4JM2F 5F3HB 4L3CA 5GGVY 3SGEH 5F70A 1TPXB 5L9DL 5F9OH 1CCZA 1R3KB 3REVB 3U0PB 4M4RA 3VJ6B 4Y5VC 5GS1A 3FMGH 4UT9H 3GHEH 3TO4A 1A0QH 2Q6WB 4C58B 1G6RA 1KIQB 1MLCB 1NCAH 1EK3A 4AH2B 2IANB 4JGMA 1NDMA 3PUCA 4S2SB 3O45B 4PRHE 3RPKA 4EI5A 5J12B 4YPGA 5DUPL 4O4YH 3RDTD 2IEPA 3IETB 3QDMD 5DDHA 1ADQL 4NQSB 4I2XA 4JFED 1EGJH 1ZTXH 3CVIH 3VXMB 4GG6A 5IVZA 4LEXH 3MLVH 4LKCB 3RAJH 3VMPA 3AXLA 3O6FB 5IHLB 1XIWD 4LGSB 3F7VA 1A4JB 2FDBP 3U30B 3VWJD 4G42A 2ZG1A 4R90H 3B8YA 4ZTOH 4JRXB 4XWOC 5D71H 3QR2A 4YX2H 2R29H 4R0LB 1B4RA 2W1NA 3V2AR 4OAWB 5IFJB 1YUHA 2OJEB 2VC2H 3JWDH 5EC1B 5E0QA 3GSQA 3VXRA 1I75A 3KPTA 4JO4H 2VZ3A 3HMWL 1I7ZB 4G43B 1U6AL 3W0WA 4QRPA 4XHJC 2V5RA 3QQ9C 3D2UD 3MLXH 1DQDH 2RIKA 4TSBL 3FQWB 3B9KD 1FNGA 1A6ZB 1KTLA 4F2MA 1A6TA 2ERJC 4BM7A 1Z0MA 3HLAB 5HI3C 1U8NA 2H6PB 4WUUE 3QIWB 1JNNL 4UINL 2JJSC 3DVFA 1HE7A 5I18H 5GGQL 2IBZY 3LEXA 3UYOD 4DCQB 4PTUB 5IHZB 1QEWB 3VDAA 5EBMB 3CAFA 5EG6C 3UTPE 3W2DH 3M8OH 2NR6D 1XGYH 1I1YA 1ACYH 2BRQA 2LU3A 3SDAA 1CICC 1Q0XH 3LS4L 4LSVH 4ZAKD 2H2SC 4LARH 3S37L 1X7QB 3T2OA 2IH3B 1U3HC 5ESQA 1NAML 1CGSH 3DYMA 3AB0B 3LH2L 3CU1A 4X8XA 1R3JA 3S98A 1C16B 4PRNB 3QFJE 2GITB 4HIIB 1MJ7H 3L3OA 2R1WA 2ICEA 3BIBX 3SDYL 1EV2E 5C0DA 4S10A 5DYOB 2DQJL 1I9JH 3MXVL 3MJ8A 1T1ZB 4N90E 4QOKB 5F88A 3UTSE 1IAOA 5EOCH 3IDNB 3TO4D 1FDLH 2JELL 1FJ1A 2HRLA 2DLFH 3PP4H 5JOFB 1VESA 4YR6B 1C12B 3BXNA 3BMWA 5INDA 3V5HB 4EI5D 2P5EB 2HP4A 2VJXA 1KENL 4YHOH 3LD8C 3VGAC 2FWOA 4OLVH 4KTEH 5CZXD 2YA2A 1FAIH 2GT9A 4WEBL 1YJDH 3ZO0A 1YPZA 4FP8L 2AQ2A 1J1XL 1RULL 4JY4B 4HBCL 5C0AB 1T6VN 1I3VA 5E03A 5EOCJ 5GHWL 5I73B 1U95B 2BNQE 3QHZH 2VDKL 5B38G 2DQUH 1JWUA 4GH7B 3CDFA 4LASH 5B8CC 3LN5A 5JNYA 2FGWL 1R3LA 3DRTA 1RZFL 4JRYB 4LVHB 4M7JL 1G7MA 4KV5E 2ZCKL 2VLMD 1QPPA 3IF1B 2IALB 4D94A 3QXUA 1HQ4A 3VXRD 3WIHA 4K7FA 5DMGD 3OKYA 1X5IA 3ZDYE 4KQ3L 3NIDE 1ZLSL 3W0WD 4QRPD 4MCZB 5F7LB 3FJTA 2F5AH 3RZCB 5HYQB 5GJTL 3EYFA 4GBXA 4P2OC 3K4AA 2X4RB 3U82B 1A3LL 1F5WA 3C2AH 1A7RH 2YN5A 4GXVL 4I8DA 1U36A 2EXWC 3HC0B 1VCAA 2J1KA 1IL1B 3QA3A 4GW1B 1Y6NR 1P6AB 3HZMA 3ARGA 1JNHB 4LLYB 1G9MC 4W4OC 2OTPA 4Z7WF 5IWLC 1MRFH 5EZLB 4LGRB 1YEFH 5AZEH 4AJ0A 2GHWB 2A6DA 4ZXBA 2H26B 3NCYP 2JB5L 2ZSVB 4ZO9A 4M7ZC 2D7TH 4O51B 3QUXB 1UENA 4LVNB 2CH8A 3PE9A 2HFEB 1AH1A 2KUTA 4MLSA 5C0EB 1EFXB 5FO9B 1Q8MA 2J4WH 4ZNCD 4YJZL 1RZ7L 3MRBA 3LQAH 2AV1A 2VUOA 5KSUA 1QSFA 4HEPG 1QFOA 3DOSA 3BZFB 3P4LA 3WFCL 4G6MH 3OTTA 4M6OL 1YC7A 3C08L 5F1SA 1RZKH 2AEPH 3TESA 5AD0A 3G08A 4QRRA 1NH6A 5JXEA 4GRWH 5BMFH 5I1IL 1JF5A 1JHKH 4LIQE 3H2WA 1F2QA 2QJDA 1KULA 1K5NA 4WHDA 1BVZA 1U92A 3IFLH 1M7XA 2R2EB 3RUGE 4ELME 1MJUL 4P46B 3BPCB 2QR0B 5ITBH 1BD2E 1VACB 3SDXE 4HK3N 4JY6B 4Z6AT 5JW4N 1BMGA 35C8H 4Y16B 4WENB 4HZAA 2NXYD 5DRZA 2BOCA 4HK0A 4PJBF 4JO2L 4P4KB 1S7UB 2A83B 4NHUA 1E28B 3FRUA 1VFAA 3OR7B 1UEMA 2YPLA 3FQRB 5DXWA 1LO2L 1MI5E 3RQ3A 5CGYD 5DS8B 1YECL 5B4MC 3W81A 1BOGB 5DA0B 2BSSA 1IT9L 5D7KD 5FM4A 4OI9A 3LQZB 1MEXH 1NGXB 3CFDA 1PG7X 2YD8A 4RMRA 1G0DA 4JCLA 4XVSH 1RU9H 3IFPB 3LZFH 1ND0A 5DC4B 3ARFB 3OKEB 2LAAA 1WFOA 2P44B 4Y4FA 3T8XA 1TZIA 3L3JB 5L9DH 3FFCE 5D1ZC 2AJYL 4H25B 1U3ZA 4GBXD 1QFUL 3VXQB 4P4RA 3Q5TA 3QZWG 4G43A 2A6IB 2YR3A 2Z8SA 1NFDB 4EUPG 1TCMA 1MFNA 4CMMB 5FV1L 5FYJU 3S9DB 5DUPH 3I6GB 3O9WB 3ARGD 5E6IC 1ADQH 1UC6A 5ID0A 5C07A 2BC4B 3OG4B 1XH3B 5F96L 4ORGA 5GS0L 4UUJA 3DVGA 5I2IB 3VFNA 5A3ID 1JN6B 3P73B 1TIUA 4G80B 4S0SD 3MRHB 1T0MB 4XP5L 1WAAE 3U48A 2EEAA 2X4SA 43C9B 3BGAA 4MDIB 4P3DB 2WUBH 5SV4A 1JPFA 1QSFD 3U36A 2YD4A 1JF6A 2NNAB 1KC5L 3HC3L 3HMWH 3I02B 4QRRD 1U6AH 1C5DB 5I8EB 3L5XL 1T1XA 5IMKB 1WV7T 5CAYB 5FA4A 4S1SL 4TSBH 3U6RA 2Y5TA 4I5BB 4LHUB 3C8KA 4RRPG 3WFEL 1QFWL 5D2LB 4X5XA 4QEGA 5I1LA 3HN3A 5EO0B 2EDWA 3WNKA 1JNNH 1TQBC 4UINH 4OLXL 3UYRL 2ICWI 2BNRA 5GGQH 4BKLA 1NCUA 4ZUUA 2Z91A 1BQHG 2J8OA 2ZNXA 3Q6FB 5HGDA 4A6YL 4P2RE 3P9WB 1A6AA 3C09B 4GRMB 5CJ5A 1KB5B 5BVPL 4GRWF 4OT1L 5DJ2A 4IRSA 2MOVA 4FMFA 1N3NA 4KKCC 2YPLD 3AUVA 2UUDH 2IF7A 5C6TL 3S37H 4M93B 4FABL 4QY8A 1MY7A 5JW4Q 4NJ9L 3QXVA 3BP7B 3LH2H 1UJ3C 2AJXL 4C57C 5JHDE 2CRYA 1MIML 1U8HA 2DD8L 1R5IA 4MB5A 1PQZA 5AUMA 1E0OB 3ECBB 4TN9A 1SMOA 4J3UA 4C54A 1QR1B 1AO7A 3SDYH 3VW3L 4Y4FD 1RZIB 2B4CC 2DQJH 3MXVH 4WY7L 3QWOB 5HGAB 5HDBF 4OCLC 1OP3H 1D9KC 5DRNA 5ID1A 2VE6A 1FNLA 5IMOA 2MNUA 1UCBL 2J8UE 2P48B 2JELH 2PXYB 3T1FA 2QV2A 5ETUB 4YEFA 3VRLE 4KK9C 3ZE1E 4MA3A 2OTWB 1KENH 3KPPB 1PEZA 1X6LA 2XWBA 2ZP0T 4WEBH 3AU1A 4XXCA 3W9EA 4FP8H 1J1XH 1DQQB 4BH7A 1RULH 5EIQA 3VXNA 4QRQA 4HBCH 1MCIA 1LE9B 5K9OB 3MCLL 2FJGA 5GHWH 2P8PB 3A6BL 3QXTA 2VDKH 4M6AA 2MQCA 2XQBL 2F54A 3L3DA 4EOWL 4E42B 4FFWD 4JPKL 2FGWH 3QHTC 1RZFH 1HEZB 4E41B 1IM9B 1LNUB 2DQCL 1VEPA 2ZCKH 3L5JA 1KELL 1NANH 3EJJX 5IOPA 2P5WB 1M7IA 4KQ3H 3DV4A 1ZLSH 1W72A 2ZKHL 1Q9LA 2ARWA 1KPRA 1RUPL 5GJTH 4RFEB 3QEHA 4ZD3L 1FIEA 3RX8A 1A3LH 1HHHA 4GXVH 4ZOBA 3KPRB 4OLYL 5MEPB 2NX5E 3QNYA 3LOWA 3BKJL 1KNOB 4HZLA 4LQFL 3NIGF 4C56B 2ENSA 3TA3C 2BNRD 2OZ4A 3BZDA 4UTBL 3V4PL 4Z77A 1B0GA 4TNVF 1P6FA 2HN7A 5EOQL 4F37K 5M7QA 4PJ9A 5BOPA 1J05A 3HRZB 4PJDB 4XPHL 4IRSD 1IGJB 2JB5H 1ZT1A 2WP3O 4P2QA 3O2VL 4PJHE 5GRVK 5I76B 3V4UL 3MX0A 5IB3B 5E99L 1JTPA 2D0GA 1RZ7H 1JZ2A 1KT2B 1AP2B 4IDLA 1VENA 3TBWA 4UQ2B 3KPSB 3WFCH 2XKNA 3EYVB 3MACL 4K8RL 2HTLC 4PY8I 5HVWA 4M6OH 3C08H 1BOGA 1QQDB 1AO7D 1WLHA 3NCEB 5D7LB 5TFSL 3TT3L 3BE1L 3BWAB 5I1IH 4LLWA 5C0BA 2Y4SA 3RKDD 1AGCA 1Y6MR 3RRQA 1BFVL 2CIIA 1OVZA 1GOHA 5GRXG 3TJHC 3GMOA 3NPZB 2XN9A 4UI2A 3WIIL 5D7JA 3VFWA 3GSNA 5HYSB 1QUNA 4YLQT 1MJUH 4NN6C 4QHLB 1T2XA 4HS3A 5HGHA 1QLRA 1NMBL 4D9LL 3UEZA 2WINA 4M02A 5FYKD 1S9XB 1IVLA 3LAFA 3UBXA 4LCWA 4JO2H 4MCYB 4XH2A 5D96C 4FQQB 1UGNA 2BOBB 4CVZA 3VI4F 1LO2H 2W07A 4NZDA 5A2IH 4X6DE 1HSAA 1Y0LA 2D7PA 2F54D 3UTTE 1YECH 3VRIB 2IADA 4NDMA 4F9PA 3SPVB 4MA7L 5BJTA 3P40A 3SGJC 3OXSA 1IT9H 3PGFL 4S1RL 1MH5B 4EI6A 5I1HL 1ZHNA 3AM8A 4HAGA 3VD9A 2F8VA 2NY0D 3IAQA 4YDVB 4XVTL 3ULUL 3H3BC 1LEGB 4LSSL 4PJIB 4AEHL 4JFHE 5DT1H 1P4BL 2AJYH 4U1SA 1BBJB 1JWSB 2O5YL 1QFUH 2DQEL 4OCNC 3F7YA 2FJFB 5CGTA 2Y7QA 2E3VA 5D7IB 2D9CA 4WO4C 2JIXB 1K8DB 1WCQA 3MGAA 2KBGA 3MV7B 3RWFA 1BVKA 4MNGA 4PJ7A 2EDQA 4X99B 1SY6H 4OCRL 4ZMAT 4YE4L 1G9ML 4YEEA 3RJQB 3WN5B 3ULVC 5M94B 4U6YA 5F96H 5E08L 3VXPA 1M7DA 5GS0H 4FG6C 4P46D 4PJ9D 3FZUC 3IJHA 4I0PB 1VADA 4P2QD 2QKIA 4XP5H 5E8EA 5GJSL 1F90L 1LDPL 2EH8H 1WZ1L 3MBEB 3KVQA 3IJSB 3ZYOA 4U1LA 1F2XK 1IC5L 2G9HB 3NFPA 3CD4A 2NY4B 4XCNA 3WHXA 4FQHA 1S9KC 4Z7UA 2H9GA 1KC5H 4LLUA 2VLRB 3HC3H 4X6EB 4M1DH 3IKKA 3VFSA 15C8L 3R06B 3L5XH 2RJMA 3C5SB 3HNTL 3SOBL 1OARL 4L8BB 4PR5B 4S1SH 5C0BD 8FABA 2V9TA 4YXLL 3HB3C 3TWCL 2IPUG 3IJYA 4LPXA 3WFEH 1QFWH 2X4UA 5EU3B 3FB8A 5D7JD 3VXUA 4YDJA 2QHRL 3RTQB 3E0GA 4AEEA 4OLXH 4MZ2A 1PKQB 4F7PB 4KROB 2QQNL 3O3DA 5KVDL 4FFVD 3UYRH 5TDNB 3CPLA 4M1GL 3V4VL 5KSAB 5IBUB 3EGSB 4B7IA 1LP9A 4A6YH 3DROA 5IB5B 3O6ML 3QUZB 2AV7B 4DUVA 5BVPH 5F6IC 5FGBA 4LCWD 1D7FA 4OT1H 2VDLL 3MNVA 4HUKB 2YRZA 5EU5A 5C6TH 4NM8L 5H37G 2D9QB 1XR8B 4FABH 1LE9A 1INQB 4XPTL 1L6XA 4NJ9H 2WBJC 4DZ8B 2AJXH 1KCVL 4PRAB 1MIMH 5TDOA 4OKDA 1FYTB 3O41A 3SDCB 1S7RB 4DUXA 2ZG3A 3T08A 4NZRL 2BMKB 2Z4QA 1TJHL 3SDDB 3N0PB 3VW3H 3GUTA 3EYOA 3K0WA 4WY7H 4F3FA 4Y2DA 5IM7B 4PJAE 2VRAA 2LFGA 1UCBH 1TNMA 3D3VA 1N59B 3D0LB 1JGDB 3T77B 4XB7A 4XNQA 3DURB 1HDMB 2XRAL 1S9YA 5GZND 2GQHA 3MODL 3NCFB 5MEQB 4HGWB 1VGKA 3BMVA 2E7CA 1XF4A 2EEBA 2ZPKH 5DO2C 5B3JE 3CLEL 4QGTA 5DK0B 3WS3A 1IGML 4NOBA 4JZOA 4JPIB 1CT8B 3P4OA 3MCLH 1MF2L 1OGAB 3A6BH 4PRPA 2PW1A 3KJ6L 4NM4L 2L4OA 4OD1L 2XQBH 3S5LB 5MENA 3DGGA 4EOWH 3MROA 4JPKH 2WZPD 2YBRB 3KLAB 2DQCH 1KELH 2H2PC 4DGVL 2F74B 2YUWA 3HMXL 5GQBA 2MQ3A 3O3UN 1UZ8B 4RGND 4HS8L 4YDIL 2ZKHH 5KS9A 1AI1L 5KSBE 3TPUA 1RUPH 1JF1B 2KKQA 2B5IC 3MRRA 3D39B 4ZD3H 5C3TA 2FR4A 4NN7B 2C4FT 2PETA 5EU6B 3TYFA 4C55A 5IB2A 5GGRB 4QTHA 3GJFB 3EUUA 4OLYH 4K7PY 3VXUD 2DQFA 3BKJH 4XCEB 4LQFH 3ARSA 5GZOC 4D2NA 4LKXB 4PD4J 3LKSB 2VDPL 4LLQA 4W4NA 2R2BA 1M71B 4UTBH 3V4PH 5E4EB 1U8LA 1ONQB 4PP2A 5CIPH 1QP1A 2EXYC 1MVUA 5EOQH 4XPHH 5D9SB 3PHOB 1K2DB 3K1KC 1FCGA 3O2VH 4QTIL 3GIVB 4G9DB 4PJXA 3V4UH 1I7TA 2DBJA 1T5XB 5IROA 5E99H 5GGTL 4ETYA 1YY8A 5EUKA 3RGVA 4EN3B 4KDVA 1G7HA 1GZQA 3MGOA 3MACH 5C0FA 4K8RH 5EUOB 2EYRB 1S7SA 1T03L 4M6NL 4Z7QE 4LK4A 5KOMC 1IM9D 2WAHA 3I9GL 1YC8A 1J0YA 4HX1B 3TT3H 2FX8L 3BE1H 5JPMB 3IXAB 4Y2DD 4JQXA 1A9BA 3RBSA 1CL7I 1BFVH 3ULSB 5SX4I 2EIZA 2HLFD 3D3VD 1WCBB 2W0FA 4I9WD 3V0AC 5IESL 3SBWC 4WI9A 3WIIH 2C4FU 1BX2A 2X4QB 2Y6SC 4JM2A 1RZ8B 2DLTA 4LMQE 2HLAB 4OBRA 3CK0L 1J0IA 1T5WB 1NMBH 4CU8A 3FKUS 4D9LH 3RWJB 4RFNB 3CDYA 3CXHJ 2AXFA 4B50A 2YA0A 1TCRB 5EORH 4EQ2A 2O5XL 3BISA 3FAXA 1T0PB 4BUGA 1T1YB 4PRPD 4QHUA 2HG5B 3QUYA 4PY7A 4FOMA 3BH8A 4R2GD 3C5ZB 2VOTA 2WUCL 5MEND 2NXZD 2UWEA 4IOIB 1GL4B 1ZANL 4KK5D 4MA7H 4R7DB 3C60C 3PGFH 3TVMC 4S1RH 4P2CG 5I1HH 3SGDI 5T1KA 1L9MA 4G3YL 2X4OA 3O11A 1U8PB 5IJVA 5MEOB 1EFQA 2PF6A 4KH2A 4XVTH 4WWKC 1AGDB 4MNHB 4RZCB 3ULUH 3MRPA 3WNOA 4U1IA 4LSSH 4AM0A 4AEHH 3KPSD 4G6FB 1P4BH 3S4SB 4F33A 1RQ5A 5I9QB 2BY0A 2O5YH 1WZMA 1OF2B 2DQEH 2YZ1A 4HWEL 5DEGA 5I66B 1H3XA 1N5AA 4XVUD 1FFPA 2WIIB 3ZE2E 4XP9L 3OJVC 4NGHL 4X7SH 5MHSD 4OCRH 4YE4H 5MI0C 1G9MH 1FV1B 5DD1L 5DI8A 1GGTA 2ARJA 3RY6C 3V79C 1TVHA 3U7AA 3BIAX 4X6CB 4PJDF 5C0JA 5E08H 4H0HB 1EUUA 1QYGL 3G6JF 3BKYL 5L7XL 2J5LC 1QG3A 1NCBL 4BQ9A 4YHYC 3QQ4A 1UFUA 5BZDB 4X6FB 1NGYB 5CEYB 4AL8L 1J5OL 5GJSH 3WJJC 1F90H 1LDPH 1D6EB 4OZGB 1JYNA 1GGYA 1WZ1H 1O7SA 5KOVC 2IPKB 1OQXA 4L1DA 4X7TB 3RGVD 5D93B 1IC5H 3B3IB 4AIZA 5HHMB 3OJMB 1FNEB 1N2RB 1HHJB 4OZHE 1CK0L 1NGWB 2BJML 4NO3B 1X5FA 2YN3A 5T33L 3K4DA 2GW5A 1J1OL 3OL2A 4NNXA 2VMFA 15C8H 2WWKT 5BVJA 1MCKA 3HNTH 4K71B 3LKQA 3SOBH 1OARH 3GSWA 4U0QB 1ES0A 3LHPL 4YXLH 3W82A 3WIFB 3TWCH 1O7VA 4CJ0A 4JFFB 1T2QL 3EO9L 3JV5A 4PRIB 3IFOA 2QHRH 5HHOE 1RVFL 1V05A 1XF5A 1UZ6E 1JZ7A 1E6JL 2QQNH 4IBLT 5KVDH 2R4RL 3V4VH 4M1GH 3U9PL 5LXGL 1F00I 2XTJB 4AZ8A 2JJTC 3UCRA 2HTKC 3O6MH 4Y7MA 1WWAX 4LNRB 1KLUB 1WWBX 2VDLH 4I2XE 5IFHL 1NEZA 1NMCC 3BN3B 3QUYD 3T1WA 3D1MC 2FO4B 1WIOA 5DTFB 4N8CL 4NM8H 4O5LL 2NY2B 3EDFA 4XPTH 4RAVA 5C0IB 3CNKA 4J4PD 4GLRH 1KCVH 1A8JH 1MCEA 3JSSA 3L3GB 4DZBB 1A2YB 4X5WB 3RL2B 1A1OB 2XXCB 4JDZB 4XTRD 4NZRH 3WL9B 1TJHH 2J6EA 2VLME 4RWYL 2HJLA 1BEYL 2FECL 4LPWA 3CSYA 2B0SL 5D7IF 4V1DA 3EAKA 3W9DA 3W0WE 4QRPE 5C70A 3AMLA 3VRJA 4UMGA 5I1DB 1EGJA 1MCDA 1BVLB 5FV2A 1IGIL 2R2CA 3ULVL 1QSZA 3IVKB 2XRAH 1L6ZA 1G0YR 3MODH 4KJQD 5GGRA 3RFZC 1OTTD 3BPNB 4MD5A 5HHQB 3ULUF 2EKSA 3CLEH 4KK6C 3DHJA 1IGMH 3TZVC 2NW3A 1MF2H 2P42B 4KROD 5DC9B 4JEGB 5TQ0L 1DN0B 3OKOA 1ZWIA 3PWNA 4TQEL 4NM4H 4OD1H 1MFBL 2Z31A 1A1MB 3DBXB 3QUZD 4ODXB 4YK4B 5DK3A 1MPAL 4U7KA 2PW2B 5FGSA 3GMPB 3DUHA 4BZ1L 4DGVH 1E4XL 2Y25A 4IHOA 1ZLUH 3HMXH 1ETZB 3CDGB 3HE7C 3BRFA 4OUOA 3Q3GA 4HS8H 3MLPA 4U1NB 3NGBC 4YDIH 2IH1B 5I1JL 1N8ZB 5ECJE 1NUGA 1AI1H 1CE6B 3CXDL 3EO0B 2H8PA 3UAJC 2BNUA 3JVGA 1XEDA 4NJAL 5DVOA 3TNMB 3D87B 1CIUA 3LY6A 5EWIL 4TVPL 4M7KL 1OD7A 1K9TA 2V7NA 4BZ2L 4DOHB 3ARTA 4HUVB 2VDPH 5DK2A 2GAZA 1ZS8B 6FABL 4OFVA 4FXGB 2OSLB 5D72L 5DRWA 4GKSB 4K55A 2FHCA 4XRCB 4MNQE 2L0DA 1PVHA 2LVCA 4Y89A 5FOBB 1YPZE 5KAQG 4QTIH 32C2A 4PYGA 2QADD 5ACZB 2UYLB 5GGTH 3OB8A 4JO1H 3EZ8A 3P9LA 4DVRL 3BP4B 1HH9B 3O4LB 5FHBL 1OTSC 4MD4A 1YMMB 2F53E 3CZJA 5INCA 3BEWA 3ZZ1A 1T03H 1FE8L 4L8DA 4M6NH 1CD9B 5ESAB 4CBPA 3I9GH 3JV4B 4FS0A 5FGRA 4U2YA 2FX8H 2X7LA 5SWZB 1ZLVK 4AEIL 4ZSOE 4DEPB 3B2UD 4J1UA 4V1DD 4DKEL 1B6UA 2QL1A 3CU7A 4JQIL 3MLYL 4MJ6B 5IESH 5CD5C 3K81A 5DJZA 4G8IA 3W5MA 3MV9A 3CFKB 2QSQA 5A16A 3H6JA 3GJEB 2FEEI 3CK0H 3CVHL 4PJ5A 3CMOL 3V6BR 2B20A 4Y4HB 4XP4L 1E4KC 4M9OA 3PWLB 3R8QA 4HXBL 4U1JA 3OSKA 4G5ZL 4I3SL 1ZT4B 3BIKB 2LTQC 5T1DL 3TNNA 2HT4C 2O5XH 4TYUA 1QPXA 2FIKA 2VZ1A 5BZWA 4X80L 1W0WA 2VL5B 2WUCH 2Z31D 3PGCA 1HHGA 1JPGB 1JPTL 2PTUA 3FO2B 5AAWA 1ZANH 2LE9A 3RVUD 3GJFK 1AXSB 3QEQA 4NQCB 2CXGA 1DZBA 2LVEA 4G3YH 4LOUD 3E6HB 5KG9B 2Z35A 3PV6B 3TCLB 3WFHB 5CLTA 1J8KA 4M5ZL 1YYML 1ZLUK 4M61A 6CGTA 4YQXL 3FQTA 4P23B 3L95A 4RCAA 3LDBB 5F9JA 3JTSA 3PQYA 4HWEH 2DQDL 4ZDHB 2NLJA 4I18B 4HS6B 1VKXB 4XP9H 1DLHB 3IKCB 4NGHH 4TUOA 4Y1AB 5FA3A 1YDPA 5DD1H 4Y5YC 3GBLA 5KN5B 4TPRL 2EECA 1JJUA 5DUBB 2V2TB 5CMAA 3L6FA 4PJGE 2WBWB 4WV1B 1QYGH 3BGFC 3BKYH 5L7XH 1NCBH 4K3GA 1U93B 4IIQB 1P9MC 1I3RB 2P45B 3FQNA 3RU8L 1EXUA 4AL8H 1J5OH 3SE3A 3ARPA 3MRGA 4QT5A 3O0RL 3VWKA 2FLRT 4HJGA 3KXFA 1XF2A 4OZIA 5EUOF 3V9FA 2DWEB 1CK0H 4LVOB 3OJDA 2BJMH 4HDIB 1JI2A 1ZVSA 5T33H 2YPKA 1UXWB 3MRNA 1WK0A 4XHQA 4Y5XA 1L4IA 1J1OH 5IR1B 4R3SB 3T65B 4KRPD 4XBGA 2NYYC 4TSAL 1U58B 3LHPH 3BQUC 5C09A 1IE5A 3ETBF 1U8OA 3AS2A 3TBSB 1CGVA 1T2QH 3OV6A 3EO9H 4MVBC 5DJCA 1BZ7A 2LU7A 3KYNA 3MV9D 1RHFA 4KQ4L 1RVFH 3BOVA 3QQ3A 2F8OA 4PJ5D 1E6JH 4Z7VB 2R4RH 2A0LD 5HGBA 1AGEA 4KKAC 4LP4A 4L9LC 3U9PH 5LXGH 5DHYA 2RB8A 1MY5A 1KIRB 3B83A 3WUWA 4RMQA 3I75B 1FFNA 5IHBA 5DJAB 3BUYB 5IFHH 4OFKA 4QXGL 1NPUA 2XT1B 3B43A 4MDJA 3O3EA 5C07E 4ONHB 3ARDC 3FB6A 4N8CH 1SQ2N 3FHQA 2AXHA 3ESVF 4O5LH 2KH2B 2VKWA 2JKXA 1MAML 2ICWA 1B4JL 4HV8B 1URLA 3QEQD 2X09A 2B39A 2R23B 3DTXA 1DVFA 4MQ7B 1ZMYA 5LQBL 3QIUB 4CMHB 2BVQB 3GMRA 4PBWD 4NO5B 1OGTB 4JM4L 1U8IB 1BJMA 3QUKA 2ESVB 4HG4K 3B6SA 1B0RA 1S7WB 4FNLL 4RWYH 2WV3A 1BEYH 4PGEA 1JBJA 2NY3C 2B0SH 4KVNL 2CLZB 4KKBD 4RDQG 1NEUA 3PQYD 5C0NC 3U0TB 2X1QA 4YGVB 4Q6IA 1CE6A 4GG8A 1RIHH 5IVXB 3F6IA 5EBWA 1IGIH 2W0KA 3ULVH 1I3GL 4WU5B 3DLQR 4X6CF 4JFFD 1K3IA 5IW3A 3CH1A 5C0CA 4FQIL 4HWBL 4HH9B 3UZEA 2BNRE 2VQ1B 3EIFA 4L4VB 2WWMD 5TQ0H 4OZGF 3B5GA 3PABB 4TQEH 4YDLB 5DGRA 2XTJD 3WFBL 4ODUA 1MFBH 4ZQKA 2NY1B 2W92A 5LBSL 3VWKD 1MPAH 2JF1A 5FOBA 2ADJB 3KXFD 4BZ1H 2X2YA 1E4XH 5EBLA 3U4AA 4UBDD 5FUCC 2YMXL 3TO2B 2Y5EA 4PGBB 5I1JH 1J12A 4LHQB 1M05A 3CXDH 4G6AD 5I8CA 5E8NA 1G7LA 4W6WB 3T4YA 4NJAH 5C09D 1AO7E 4CU7A 3A6CL 2VISB 2Y23A 4U6TA 5EWIH 4TVPH 4CW1A 1TTFA 5ACMA 3QJFA 2W65B 3AMKA 4M7KH 4N0RA 3DO7A 1A7QL 1KTDA 1ZGLM 4BZ2H 3AC0A 4GKNB 4MAYB 1CIDA 3QCVL 4KJWD 3UTQB 5D8JL 1D5ZB 2P4AB 6FABH 4M7LT 1J18A 5D72H 3MRQB 5I16A 1I3UA 3NABL 1UB5B 1NAMA 1FFOB 5CEXA 3MR9B 1YEIH 2NCMA 3ZTNL 2YWZA 4D3CL 1WGOA 3QJHB 1IKNA 4U1MA 4DVRH 2J12B 3P77B 3AAZB 5FHBH 4ZYKA 4JJ5A 2F54E 1DVFD 3CC5B 1AHWB 2ATKA 1FE8H 3LMJL 1MUJB 1TZHA 2G5BA 4GRLC 4YHZL 3L9RB 2PCPB 1T7YA 2DKSA 4AEIH 5J11B 1WBXA 4IEFB 1YN6B 3OPZL 5J4MA 4IRJC 4DKEH 1BFOB 1CXEA 1U8QA 2KZ1B 4JQIH 3MLYH 5L2JB 2GTZA 4LCCA 4KHXL 4MJ5A 3L3KB 3AREC 5DQ9A 2MSPA 3RWHA 3UDWC 5H2BA 1J8HA 1I1FB 2CXKA 3LKOB 1X5HA 2W0LA 2NMSA 2IMNA 3CVHH 5E1AB 3CMOH 1ORSB 5IBLC 4XP4H 3OKKA 3ILPB 5GPRA 1CXFA 2FATL 5C0CD 5HHVL 1H15B 4HXBH 3Q6GL 5ANMA 1SJXA 4I3SH 4WFED 5T1DH 1FP5A 1JV5A 3MSPA 3T2QA 3VG9C 2Y9RT 4M3JA 4D8PB 3EOTL 4X80H 5KSVA 1GZPA 5F9WC 1JPTH 2DF3A 1IGYA 4F80A 1D5MA 1WZLA 5JXAL 3QDAA 1RZGA 3QFJB 5DZOA 2DQGL 4P2QE 4PTTA 1NKOA 5HJ3A 3ULVF 2FEDD 4FFZL 5IG7B 3VFMB 1LO5B 2CIKB 3EFFA 1A3RH 4LPYA 1N5YL 1ZLWH 2CDGA 2IAMA 2VR5A 1YEDA 4YO0B 3GB7B 4M5ZH 3GI8L 4YQXH 4KMQA 1U41A 1SYSB 4DFIA 1KG0B 4JZNA 1JI1A 5FYLL 2AERT 1BJ1J 3FT3A 3EDDA 1BQHB 2PO6B 4POZD 2DQDH 2BVTA 3E3QE 4W68A 5L6YL 1AIFB 4O2CB 5SWZD 2X5PA 4ZPTB 1I4FB 4IJ3C 4KUCF 2XN9E 3TN0A 4RNRB 3VA6A 4TPRH 4QKXB 2LU4A 2BNQB 1B9ZA 1NGZA 5SX5K 3KLHD 4L29B 3D69A 1PDKA 5FYKU 3VXSA 1YA5A 3U4EB 4M3KB 4M48L 1J9CT 4Y4HD 1RHHB 3RU8H 2NY6C 5FYJL 1X44A 4P5KB 4NNYB 4MGXA 3O0RH 1HYSD 3KYAA 1OQOA 4LCYA 4APQB 2BSRA 4Z8FL 4QHNB 1P4LA 1YEEL 2YSSA 4YPJA 2V9RA 2DI9A 2ZUSA 4JFDA 3ZT5A 1DDHB 5IB4B 4LMQI 3T0EA 4BFGA 3LEVL 3HR5B 3NFNB 4TSAH 2X1PA 5K9KB 1KF9B 4YBLC 2B2XL 3PWVB 5EC2A 4BSVA 3RWEA 4ENED 4MS8C 1F3JA 1FG2B 1A7NL 4R4ND 4YC2C 1TTUA 3HUJA 4LDLB 1P5UA 3MRCA 4FQXB 1BQSA 1J8HD 4PJEE 5EO9A 3ZE0E 1SBSL 4C83B 4KQ4H 4WDIA 3S3PA 4O2FB 4MNGE 4NO0B 4PJ7E 4U6HB 5IFAL 5IMMB 5T5FL 5EPMA 4P5MB 1QSEB 1ZHKA 3I6LE 3RWCA 3QUMB 3NA4A 4QXGH 9CGTA 3MNZB 3UP1A 4X8JA 3PDOB 7FABL 1FZMA 2A6JA 2RHEA 3AY4A 4Y4KB 4KZDL 5I1AA 2JLLA 2WP3T 1MAMH 3JV6A 1B4JH 5TE7L 4HFWB 4GQPH 1OTUC 4OKVA 3RI5F 1DBAL 3VH8A 5LQBH 4X98A 5GGRY 3KNBB 2AK4A 2IAMD 3QO1B 4K94C 2IMMA 1MFEL 4FNLH 3TBVB 4KVNH 4Z7UE 3U1SL 1NFIA 1I9RL 3RUGB 4W81A 4ZO7A 3CJJA 1BD2B 3SDXB 5DMKA 4WNQB 2W9EL 1PW3A 5JZ7D 1YY9C 2N7AA 2Z92A 4HKZA 1I3GH 1MSPA 3L7EA 4PRHA 1Y18A 3TN0D 4LLMB 3KAAA 3FQXA 1CFNA 3TP4A 4FQIH 4HWBH 5K59F 1MI5B 5FKAB 2PYEE 3WFBH 3RHWF 4WW1A 4P2OB 3GBNL 3U4BL 4L3EA 5ERWB 2BVEA 1P84J 3PGDA 5LBSH 1GSMA 3G5VB 2A77L 5KW9L 5GIRA 5M95B 1IAMA 2OI9C 4IS6A 3VFPB 3BRGC 3DMMA 5IK3B 4DFHA 2YMXH 4TSCL 5DD6A 4PV8B 4QGYA 3FFCB 4PJ8A 2A74B 4TTGA 3QYCA 4J3TA 4JFDD 4RWHA 4JFYA 3KPNB 1FVEB 3T0ED 3SKNA 5D5MF 4DQOL 2VZTA 3A6CH 4PRDB 1GOFA 3OKNB 1WEJL 3PDGA 3MZTA 4ZOCA 3X12B 5J06A 3X11A 4BK4A 2IWGA 5KVEL 4U6XB 1MCWM 3D85A 5FCSH 4A6YA 1GGUA 5H35B 4UOJA 1A7QH 3RWGB 5T1MB 3RL1B 2KQNA 2V2WA 3D3VE 1X5AA 5CBEA 3QCVH 3RPIA 2GTWB 4WUUA 5D8JH 4YUEL 4EUPH 1BF2A 3OKLA 3NABH 3IDUA 5J6HB 4NOFA 3VGBA 2GK2A 1T04B 1AGBB 5F44A 3N1MC 3ZTNH 1MHEB 2HT2D 5ISZA 4L8SB 4LSTL 4D3CH 3H7BA 2XWJA 4EDXB 4JM2C 3BDYL 1T2JA 1UVQA 2UVFA 3G5ZB 3PL6B 5KZCB 1BAFL 5MENE 4KI5D 3NFSL 4Y5VA 3QEUA 5GGVL 5J13B 1WZKA 4Y0GA 3G6AA 2EDLA 3LMJH 3O4OC 4YHZH 2FL5B 4R4BB 3L5WA 4JKMA 3OPZH 1F45A 4JR9L 1C5BL 1XCQA 1TJGL 4QHKI 4OCMC 5HYIA 4PLKC 5DFVC 3UTSA 5KS9E 3GGWB 2DQHL 3OAZK 4KHXH 3OX8B 3FOLA 3EJYC 2BVYA 4HH8A 1JWMA 3P2TA 1VA9A 3BGMB 4P2RB 5GGUA 5DVKA 4PRHD 3OJ2C 3U2SB 2DBLL 2FATH 4UIMB 5HHVH 3Q6GH 1E27A 4U4BA 4OLUL 1JUFA 3DX7A 3HPJB 1MWAB 5FKPB 4XPGL 4X4ZA 4X5LA 2CDFA 3EOTH 1WIUA 5FM8A 5HHPA 1FNFA 3LRSB 5IQ9B 5JXAH 2YPVH 4KVCL 3CUPB 2DQGH 5J7CC 1IFHH 1Z3GL 5SWSA 3JV0A 3UBXG 4FFZH 3G6JA 5DQJB 3RDTC 5E5MA 1N5YH 2DN7A 1TQCC 1F4YL 3TLRA 4H1LA 1Q1JL 4PJ8D 3BPOC 3IDGB 1T3FA 3GI8H 3R1GL 2AJ3B 3MYJB 2J8UB 3MRIA 2JJSA 4KY1L 5FYLH 1P7KA 3MV11 3QI9C 3VWJC 2JJUA 2ADGB 5C08A 4GKZA 2BY3A 3AFLA 5L6YH 4MQXC 2VN4A 1DN2A 3ROLB 5CIPA 2FJHA 4XAKD 5GSVA 4LQ1A 4QWWC 1GAFL 3H0TB 1H3WM 5T3XL 4NKMA 3GSRA 4WUUD 1CICA 5IF0A 1EZVX 1W0VA 4N0FB 1AE6L 3SGDH 1U3HA 1TNNA 5DHVB 3MA9L 2ILLA 3D25B 2E7MA 3STZB 4I3RL 3UTPD 4J8RA 1JK8B 5JOPE 5C92A 5FGCB 1X9QA 4M48H 4GAJL 3WXWL 3DI2B 2X70B 2JB6B 4LVEA 5FYJH 2D4FA 3F5WB 4HIHB 4PJCF 3VFRB 5CCKL 2ZOKB 5ISZD 1MFAL 1IM3A 3B9AA 3BEVB 1FSKC 1UB6A 3VGFA 4KGLA 4ODWB 2X1OA 4Z8FH 1V8HA 1SJHA 4ZFOL 4FTVA 3GSXA 1S7VB 1YEEH 3CFJA 1D5IL 1F11B 3MRLA 1CZ8L 3EO1A 2IPTL 5D6DC 5EU4A 3BP6B 4AMKH 1OLZA 4NQXA 1DQJA 3LEVH 4JFZL 5ICZA 2NX5B 2B2XH 4N90D 4MHHG 4JN2A 3UTSD 5HYJE 3GM8A 1A7NH 4ZODA 1K6QL 4M6ML 2C4XA 4JHZA 4QRTA 3S96B 2DYPB 1HIML 3E2HC 4H26A 4WU7B 3KS0J 4X4YA 1SBSH 1FZJA 1A22B 4OQ1A 4WI3A 4ELMA 1KJ2B 2DQTL 3SCMC 4XWOD 5D1QB 4PGJA 4FHBD 4K3DL 4N1CA 5B8CA 2XA3A 5IFAH 4WNQA 5T5FH 1OAUL 4ZFOB 3MCKA 3MRJB 5F1KC 2AKRA 1NFKA 3UJJL 1FPTL 2MJWA 4JANB 5J57B 2C1PA 4GAYA 4HKXA 3STBA 1NCWH 7FABH 1HHIA 4J2XA 1YEKL 4KZDH 5AYQA 3MJ7A 3KYMA 1CDCA 5TE7H 3FTGB 3QQ9D 4G8FB 5DD0H 5SWSD 3KGRA 5KANG 1BGXL 4OLWL 1PJ9A 1DBAH 2X1WL 3E6FA 3S88L 1ZVHA 2FSEB 1HINL 5HI3D 4YGAB 1VFMA 4F7EA 1MFEH 1QBBA 5BQ7A 4JZJB 2OL3L 5I1KL 4LLDA 3U1SH 5K33A 5CEZL 3M17A 4QRSB 3NOIA 1AQKL 1I9RH 4EXPX 3O8XC 2Q7YB 4W4OA 5JORA 4MA8L 5IWLA 5C08D 1U3JA 2XFXB 1JRHL 1CD8A 2A6KA 4JDTH 4PBVC 5IEKA 4NQVA 2W9EH 4F7CB 4M8QB 5L2KB 3JTTA 3WE6A 5CP7A 3TIEA 1AY1L 4LSPL 1CICD 2H2SD 4I13B 1MAKA 1U3HD 3EW3B 1IZKA 3C6LB 1A6WL 4P5TB 4CL7A 5JO5B 2OLDA 4X6DB 2HJFB 3UTTB 3X13B 1XF3B 3N1PC 3DXAA 1ED3A 4F7TB 2OL3B 3U4BH 3GBNH 1YEGL 1U8JA 3P9MB 3KWWA 5CSZA 3MA7B 1WAAA 2RQ8A 3U9UA 3HZVB 1MCWW 2ENYA 3HZYA 3RP1A 3S6CA 4BQBA 4XPFH 3HE6C 2A77H 5KW9H 1XGPB 4HC1A 1NC2A 1Q9WA 1ZHBA 1ZOXA 3LN9A 5F89A 4FTVD 4TSCH 4YXKL 5GGSB 4KDWA 5H8DA 1RJYB 4W70A 4WI5A 3ET9F 3BYTA 1LD9A 1XGQA 1REIA 5I74C 4DQOH 1WEJH 4YBQC 2VDML 2X4TB 1RI8A 5JPNA 5A1AA 5EFIB 5KVEH 4ELKB 4V1DE 5DD3L 3QAZC 4HWUA 4D0DA 5D1XC 2AABL 4YUEH 5DURB 1HILB 2Z93B 4JFXB 2I9LA 5DJYA 1N6UA 4NN5B 3BD5A 4W6YB 1UXSA 4WI6A 4WGWB 3VI3F 1G7PA 3WEXA 2Z0BA 1KJMB 1SJEA 3ARBB 1BIHA 5SV3A 4ETQA 4LSTH 2BCKB 1CDBA 1MLBA 5FKPA 3PWPA 3G9VA 5IJKC 1IGTB 1VDGA 3BDYH 5D1ZA 4PB0L 1Z0NA 3NAAL 4L1HA 1BAFH 4P2OD 2C1OA 3NFSH 3NIFF 1OCWL 5GGVH 5JHDA 3ZSSA 1A9EA 4K94L 1ZA3A 2EXWD 2Q76A 3P4NB 1BIIA 3MUGA 1V3LA 2AJZB 3DV6B 3KPLB 5JMOC 1DJSA 4JR9H 1C5BH 4MA1B 5E6IA 1TJGH 1B3JA 3V6ZB 5IV2A 4UDTB 4OI7A 2DQHH 3V7AE 5BCAA 2EYTB 1DQML 4Q0XL 3SKUD 3C5JB 5HBBA 3EHBC 1P5VA 5BXFB 5DJ6B 1Z5LA 1IGFL 3MRKA 5D2NC 4LAJH 2ZOLB 1G9NL 5E9DE 2DBLH 1H5BB 1OB1B 4OLUH 1H0DA 2BVPB 1XGRB 3VGEA 3FB7B 4NT6A 3CCHA 1I8KA 1ZVYA 2RAMA 4XPGH 5T3ZL 3DXAD 1YN7B 2PTTA 1G7JB 4Z5RB 3UPRA 3LCYA 4UILL 1RIVL 3HMXA 3HI1A 3AROA 3PIQA 4KVCH 1KIPA 5EN2A 2R1YA 3GIZL 1Z3GH 5CSBA 5H37H 3DUUA 1NC2D 4P9HL 1H3PL 1F6AA 3IS1X 1UWXH 1F4YH 2EZ0C 1Q1JH 5FUZL 3NCYS 1BWWA 4RIRA 4PJBE 4Z78B 3R1GH 2FX9L 4HCRL 3GRWL 5CFHA 1LQSR 5FIEA 3C8DA 3MRFA 1SYVB 3LQAC 3MOQA 4KY1H 1FL5A 1LK2B 3FT4A 1IQWL 2YUVA 1P7QB 1U8MB 4JAMA 2DMBA 3QXDA 3W39A 2FYYB 3UZVB 3T09A 3CH8A 1FO0B 2XPGA 3UTOA 1S9WA 3ES6A 1FFQA 1GAFH 3QWRA 4HGKC 3A0OA 2VQTA 1J7VR 1AE6H 1R24A 4YZFF 1LEIB 1MHCA 4QYOA 5B4MD 1NBYB 3M45A 2XTLA 1BZ9A 4CVWA 4K9EL 1UJ3A 4P2RD 4I3RH 5GGTA 1ORQA 4D0BB 4GAJH 3WXWH 4WEMB 4MXVF 5C9KA 1ZE3C 1A4KB 1PZUB 5CCKH 3V5DB 3DUSB 4PJHA 1MFAH 1D5BB 1QLEL 1TPXC 4LPTA 1SVCP 4XXDB 2RFXB 4OGXL 1DP0A 3ZDXF 5D1ZD 5I6XB 1D9KA 3QIBB 2EH7L 5ENWA 1QOKA 1TVBB 1HCFX 1UG9A 2GK0A 3DIFA 4H20L 5IBTL 3SKOB 5JHDD 4H0GA 3HI6L 5KSBB 2G2RB 3QEQE 1D5IH 3HC4L 1CDGA 1CZ8H 1IBGL 2IPTH 2V2XB 1T7VA 2P8MA 1GXEA 2A73B 1R5WA 4N9GA 1CLCA 1R3HB 4ZOAA 5J12C 1BBDL 4UNVA 5D2NE 4NPYA 4IDJL 1RK1A 3SO5A 2F5BL 5E6ID 4F8QA 1A1NB 1HQRA 4YNYA 5F8QC 1T21A 2C5DC 4MX7A 1K6QH 4M6MH 1HXYA 1HIMH 5LVEA 1NKRA 2K7QA 1DBBL 3O6FC 4XGZB 3PQYE 1EAPB 4NWUL 3U30C 1OP9A 1BOYA 2DQTH 3AS3A 4K3DH 1PAMA 2C3HA 5JLZA 5K9QI 1TXKA 1OAUH 4R0LC 1KGCE 2XZZA 1KXVC 4Q9CA 3O3AB 3UJJH 1NLDL 3KPMA 4JFQB 1FPTH 1SEBB 2ADIB 5E6ZA 4PGCA 4WVRA 4OD2A 5IKCA 4ONOA 1YEKH 3KHOA 4JHAL 3QFDA 2CDEB 3F8UB 3WLBB 4WW2B 5EU7C 2VZSA 4ZPVB 1BGXH 4OLWH 4RFOH 3TH2T 2AXGB 3S88H 1NEZG 5E8OA 1CN4A 1HINH 3KXFE 3QNZA 4N8VB 2P7TA 3MFFB 4GRWE 4LF3B 3QIWC 1I8MA 5I1KH 3QEGL 3IXTB 2H3NA 2OL3H 1EJOL 5FO8B 1UCTA 1UWXK 3TA3A 5CEZH 2HA1A 3ZE1F 1T66C 1T7ZA 4L4TA 1AQKH 2X4NA 3PHQA 4MA8H 2OR9L 4HPYL 1NL0L 4HJ0D 5ICYB 1JRHH 5C09E 5CHNA 3REWA 3QWRD 2ARJQ 4RGMB 1AY1H 4LSPH 3UBXI 2V7HB 4CVXA 5HPMA 2R0KL 3QDMB 4OV5A 3T0BA 1MHHA 4Q2ZA 4JFEB 4S0TD 1A6WH 2WSKA 1DSFL 2VXQL 3FRPA 2VXVL 5HDBE 1TZGL 4U3XA 5D1QD 3TIDB 2OQJB 1XIWB 1CFSA 1YEGH 2IANE 4FZ8L 5AEAA 3MREA 4ZS6C 1D9KD 3VXME 2FIRT 3PXHA 3LB6D 4YXKH 3U46A 1AR1C 3KJ4B 4LCUA 3SJVA 3RIAF 4LFHG 4KK9D 5HY9B 5BOZG 5E00A 2WMPA 5DHXB 3RVXC 5HSFA 2A9NL 2B1HL 3D2UB 1AKJA 4KPHL 5MERB 3FT2B 4R4FL 4RAUA 3B9KB 2VDMH 4HUUA 5EOTA 3RNKA 2V9QA 4X83A 5B3NA 4OZFA 3QDHA 2XYCA 2NTFB 1YMHA 4XP1L 5DD3H 3T0DA 5I73C 5FF6A 2AAVA 3R8BB 3HPLB 2CLRB 4NKDB 2AABH 1M6OA 4O2EB 3MMEA 5FB8A 4IMLB 5EU7E 2DMCA 2AP2A 4NQUA 2APXA 4U1KB 4LVHC 5E7FA 4XX1E 3SGJA 5BXFA 3KYOB 4MQSB 5TDPB 1DE4B 3RKDC 2HVJB 5KTEL 1KPUA 5I1CL 4KTDL 2GY5A 1I1AB 3QISA 4P5TD 4ZAKB 2FO1A 1PGRB 5BS0A 4XZUA 1FL6B 4G8EB 1FL3A 3NN8A 3NIGE 3RZCC 3JWNC 4PB0H 3NAAH 2EO9A 3B9VA 1OSZB 1OCWH 4PRBB 3OXRB 1HWGB 4ZTOL 1JGVL 4K94H 4WO4A 5JDSA 4N5EC 2OMBA 5F7KC 3ALXA 1V3MA 4NKOA 4L3CB 3TA3D 3WS6C 1P1ZA 2ITDA 4JFHD 3BUTA 1N4XL 3QSKB 5GS1B 4PJAA 1V7ML 3X14A 3TO4B 3TT1L 4ZNEE 1G6RB 4YH6A 1DQMH 4Q0XH 3KLSA 3C60B 1NDMB 4NP4L 4EI5B 3QUXC 4LVNC 2G60L 4YPGB 2DMKA 3VXOA 1G9NH 3O81A 5DDHB 5IEHA 2M26A 4QOKE 4I2XB 4GG6B 1XCTA 3O2DL 5IVZB 3SN6N 4PLOB 3S4SG 2E6QA 5T3ZH 1UM4H 3AXLB 5E94A 4F15C 2AJSL 4UDUA 2HTLD 3F7VB 3GNML 4JVUA 3GMQA 1BECA 4G42B 4UILH 1RIVH 4KDTA 1A14L 2P5EE 1EEZA 1ZA6A 1AD0A 5F1OB 2CLVA 3GIZH 2X40A 3G04A 4X7EC 5EBGA 1YUHB 4P9HH 1H3PH 5F6HI 1S9VA 4OD3L 5C0AE 4G6JL 3TJHD 3EYUL 3GSQB 3VXRB 4NRZA 4CADA 4RSVA 3QH3A 5FUZH 3IDYB 2V5YA 4HCRH 3GRWH 3W0WB 4P46C 4QRPB 3VI4E 2XG4A 5JA8B 5HYFA 4KMTL 5F7EL 1AKJD 4WUKL 3IAPA 1IQWH 3CX5K 1FNGB 2D03L 2HRPL 4Y16C 1KTLB 4F2MB 1A6TB 5FECA 4P4KC 1U8NB 2A9ML 2C3VA 1ZHLA 1B0WA 5F8RC 5HYEA 4NO2A 1EDQA 2V17L 3LEXB 5CSGA 1JP5A 4A2LA 2WBJA 4GJTB 4K9EH 3HTLX 4IOFC 4OFIA 4HWZA 3G9AB 1I1YB 5F1NA 4UIKL 5ANME 4YHML 3ARFC 1FIGL 4X7DC 3SDAB 4NQEA 1QTYT 1QZ1A 1ZV5A 3O3AA 1QLEH 5BS0D 4OQTA 1WIPA 5ESQB 4OGXH 3S35X 5ILTL 4Z95L 2EH7H 1R3JB 5IBTH 4H20H 1UH3A 3HI6H 2ZCLL 4QLRA 4J3XA 4WO4D 3L3OB 1S5IL 3HC4H 1IBGH 2R1WB 2ICEB 4OTXL 1P4IL 4DK3A 3QG6A 5C0DB 1BBDH 2FX7L 3MJ8B 3BO8A 4IDJH 3RGHA 4EIZC 2XQYK 3O9WC 4CUCA 3GFUA 5FM5O 5CKAA 5F88B 3ULVD 4NFDA 1IAOB 5FK9A 1VPOL 3CVHA 3GMLA 4PJFF 4KXZI 4FG6D 1DBBH 1FJ1B 2QLVB 3BXNB 2GSGA 5TGBA 4NWUH 3NTCL 2ATPA 3WIHL 5INDB 4E5XA 1C08A 5CJQL 2FWOB 2GT9B 1MELA 5A40E 1YPZB 4P2YA 4M03A 5HGGS 1NLDH 2NXYB 5ACLA 1T20A 3N85L 3Q5YA 3KYKL 1KEGL 3BN9C 1J86A 1FVDA 1MRFL 4JHAH 1JWUB 2I24N 3VXSE 2ADFL 2ID5A 5L88L 3LN5B 3IDIA 5JNYB 3WUWG 1R3LB 1XFPA 3DRTB 5GS0C 1G7MB 1T6WA 3HB3D 3ZKNC 1MHPL 4R9HA 1ITBB 1HQ4B 2ZZUT 4K7FB 4ZSOB 4ZG1A 4RMUA 3OAYH 4KRNA 1LMKA 4LRNL 1EVUA 3QEGH 3QIBD 1EJOH 2BHUA 2DM3A 1IC7L 4K7PL 2HFGL 3EYFB 4GBXB 4JFDE 4LPCA 4QHMA 2OR9H 4HKBA 4HPYH 3C09C 1NL0H 5C7XL 3OQ3B 5B3JF 4MB4A 3THML 3F12A 3P0GB 3WLWC 1LEKA 3QA3B 4EKXA 1XGUA 3HZMB 1SEQL 4M93C 2R0KH 3K3QA 3ARGB 5D5MA 4Z76A 2WBJD 4F58L 1DSFH 2VXQH 2VXVH 2YEZA 1TZGH 2YOCA 2Y07L 3BD4A 2A6DB 4ZXBB 5B38A 5J3HD 4FZ8H 3QXAA 4NQED 5CLWA 4YFLF 4DW2L 4QXTA 5FFLA 3WNMA 5KSBF 5JTWA 3MRBB 1JHTA 5CBAA 2AV1B 5KSUB 1QSFB 4OZHA 2P24A 2I27N 4GUPA 1YNKL 4U2ZA 3SBWA 2PXYC 1QSVA 1I7RA 2VLJA 5AD0B 4H88L 1OAKL 3G08B 4QRRB 4DAGL 3H9HA 1K8IA 3CSPA 2A9NH 4PGZA 2B1HH 2AK4E 4AEFA 4TTDC 3VE0A 4KPHH 5H94A 4R4FH 1K5NB 5DO2D 3QPQC 2HJKA 1Z9SA 1U92B 3QDGA 3OGCA 5SWQA 3D0VA 3K7UA 4XP1H 1RK0A 2SEBA 1I7UA 3TJEL 5HHOA 1QBAA 3DX8A 2APBA 3C60A 3BYYA 2QSCL 3I3DA 1FGNL 2H2PD 3TVMA 5DRZB 2BOCB 4HK0B 4NHUB 1I85C 2HMIC 3FRUB 1VFAB 5KTEH 5I1CH 2YPLB 4KTDH 4WWKA 3FFDA 3EJZC 2ZUVA 4LSUL 3VFUA 3CIQA 3MUHL 3SGKC 4IMKC 3VFTA 1NGPL 1KBGL 3TBTA 1QFWM 2BSSB 4L3EE 3CFDB 1UKQA 1JGVH 3O6LL 1B6DA 1ND0B 2ZSWA 4Y4FB 3T8XB 2WUBL 1TZIB 3ALPA 3JWOL 5GZOD 4L4JA 1XMWA 2MPAL 1RJZB 4NUJA 2LAGB 4HUXA 3RY6A 3QCUL 4HBQA 1RUQL 3OAYK 5K93A 1N4XH 5KVGL 4P4RB 4RMWA 2EXYD 1HXMA 1V7MH 1DTUA 4XNMA 2K3TA 3MCG1 3TT1H 5KAQF 1QVOA 4JG1L 3SKJL 4NP4H 2G60H 3I85A 3WJJA 3KPOA 1VERA 2YUXA 1FNSL 3T3PF 3ILQD 5ID0B 1NBQA 1NMAL 4XAKE 4YWGL 5C07B 3ZDZF 3O2DH 4S11A 4ORGB 12E8L 1RUAL 5I0ZA 4UUJB 4CU6A 1QHOA 3DVGB 4N5UA 3VFNB 2AJSH 4GT7A 5CP3A 3GNMH 3SGEI 3IDJA 1A14H 5GRVL 2CO7B 2X4SB 5GRUL 2C3GA 5J9PA 4DN4L 5ISZE 1JPFB 4M7LL 4Q7DA 3U36B 1I1AD 4JKWA 2XA8L 4OD3H 4G6JH 3EYUH 2N4IA 1X5XA 2Y6SD 4PJCA 4ZUWA 1YQVL 2HT3C 1MQKL 3GKZA 1T1XB 3S8WA 2VABA 3QZWA 3HCVA 3O2WL 4KMTH 5F7EH 5FA4B 4WUKH 4E41E 3U6RB 2JCCF 2Y5TB 2JJTA 2D03H 2HRPH 4GS7B 4EUPA 3EOAA 3C8KB 4K8RC 4CNIB 3QDGD 1IAIL 4X5XB 2O61A 5I1LB 3FCTA 1H8OA 2P5WE 4YAQA 3DWTA 1TDQA 2A9MH 4R97B 4AENA 2E6JA 1T7WA 4OSUL 5HHOD 2X1XR 2BNRB 4BKLB 4ZUUB 2V17H 2Z91B 1KPVA 4PP1C 5HGDB 4NYLA 1HZHL 3C60D 1A6AB 4DGYL 1FFRA 3TVMD 2ED9A 4ZFFA 4XPBL 3KPRE 4MNQA 5I15L 5HI4C 5DJ2B 2G75A 4IRSB 2APVA 1N3NB 4KKLC 4UIKH 4YHMH 4WWKD 1FIGH 5EULV 4FZEL 2Q86A 1RZJL 1WJ3A 4QY8B 4BUHA 4TUJA 5ILTH 3CFEA 4Z95H 4Q97A 4G8GA 1U8HB 3FAWA 1R5IB 1PQZB 5AUMB 2ED7A 5FYKL 4HD9A 2F53A 2ZCLH 4PJDE 1S5IH 5SWSE 3G6JE 4OTXH 1AO7B 1P4IH 1X4ZA 2FX7H 2Q20A 4AYFA 3WN5C 4MYWB 3IU3A 2MHAA 1UYWL 3QRGL 5C8JA 4RRPA 1QKZL 4ZSOA 5F7UA 5DRNB 1VPOH 5ID1B 2VE6B 2GJJA 5IMOB 3TZVA 1T89C 4OF0A 4BSWA 3ULUC 4I0PC 3T1FB 4J4PC 3MO1A 3NTCH 5C08E 3WIHH 4MA3B 5CJQH 5D7LE 4GG6F 4Z0XA 3DVNA 1RURL 1W72L 2XWBB 3MBEC 2Y06L 3QDJA 3AU1B 4G7VL 3W9EB 2WANA 3CFIC 4BH7B 5CINL 2NY4C 3VXNB 4QRQB 3GSOA 4N8PA 3BZEA 3HZKA 1ERNA 3HE7A 2FJGB 3TC9A 3TFKC 3N85H 1IEAA 3KYKH 5GGSY 1KEGH 4GW4A 2CQVA 3O3BA 2F54B 2ADFH 3LKRA 1UT9A 3L3DB 4HLJA 5L88H 3OR6A 3IAGC 4B7LA 5KVFL 4POUB 3MV8A 1WBZA 1Q94A 3QO0A 3C9NA 2OZ4L 3SDAD 2EE2A 1MHPH 4KJQC 2NY0B 5IOPB 4LLVA 3UMTA 1M7IB 5JW4R 1CFQA 2AK1L 3DV4B 3L5IA 1W72B 5DF0A 3MUJA 4LRNH 3RTQC 1Q9LB 4FTVE 1KPRB 4KROC 5KSAC 5IIEA 4ZUSA 1IC7H 4K7PH 2HFGH 3QEHB 4LAQL 5GRYA 5C7XH 3DGCR 1HHHB 3QUZC 3THMH 2Z8VC 4NC1C 3QNYB 5EIIA 4HZLB 2BXZA 1MJJA 1SEQH 1Z6JT 4XP6L 2EE9A 1PZ5A 5E2JA 3K80A 4F58H 3PWUA 4Z77B 1B0GB 1KUMA 3K1DA 4PJGA 2HN7B 5J8OA 5D7IE 2Y07H 2YD1A 4PJ9B 1J05B 2MTPA 2ZUYA 4MD0A 4MNQD 2Q87A 3SDCC 4A2MA 3W5NA 4U1GB 1GVIA 4ACPA 3MV7E 1ZT1B 4P2QB 3H9SA 3B9EA 3BAEL 3BW9A 4OFPA 3SDDC 4RDQF 1FZOA 4DW2H 4RQQA 3N50A 1ZSDA 4JE4B 4Q9BA 4HFUL 4GKOA 2R4SL 2F15A 4G8GD 3WHE0 3TBWB 2F53D 3P4MA 1JHLL 2XKNB 2YK1L 3ULUE 2ITCA 1YNKH 1Q9OA 3F7PC 2CR6A 5TH2A 1X5JA 4H88H 1OAKH 4DAGH 1CQYA 2VDQL 3CFCL 1T7XA 3CSGA 4LLWB 2EDDA 1MCJA 5C0BB 1AGCB 3EDJA 3KG5A 5CJXC 1E4KA 5D7SL 4KK6D 2QQLL 2CIIB 4Y19A 4I0KA 3TZVD 3GMOB 1RJZA 2XN9B 5EZIL 5D7JB 5DT1L 3VFWB 3GSNB 2UZXB 3KDMA 3I6KA 2VIRA 4J3SA 2UY7A 3NCJL 1LE5A 3TJEH 1Z9LA 4HS3B 5DR5L 4KJYA 1QLRB 5HGHB 4WI4A 1G0XA 5E2VL 3QDJD 3IYLW 2WINB 3OKDA 1NBZA 2QSCH 1FGNH 1SY6L 3UBXB 3S34L 4LCWB 4F7MA 1T80A 4XH2B 3HE7D 2CR3A 3U7WL 3B2UC 5DEFA 3SO3B 4CVZB 1MCQA 3BH9A 2VXUL 4LU5L 3MLTA 4LSUH 3BP5A 1HSAB 1PKQE 1Y0LB 5D70L 2IADB 4NDMB 5E8DL 1NGPH 2AI0L 3BVNA 3DXAE 1KBGH 4ZXBD 1MAJA 5BJTB 2BVOA 3B9DA 3OXSB 4EI6B 1JYXA 4NN7C 4OF8A 5DFWH 1ZHNB 2EH8L 4NC1E 3LKNA 5FYLD 1GGBL 2GUOA 3O6LH 1VB9A 2APFA 1JMZA 3JWOH 2MPAH 5HD8C 4AQOA 3VG9B 3QCUH 4Y5YA 3DETC 3V6OC 4U1SB 1RUQH 1KB5L 4H5SA 5KVGH 4M1DL 3F7YB 5C2BL 2Y7QB 1NC4A 3SKMA 3QNXA 5DLML 5JXED 5MP6L 1K4DA 1X4XA 3RWFB 1BVKB 1P9MA 3QULA 4MNGB 4NRXA 4I4WA 4JG1H 4PJ7B 3SKJH 3OB0K 2DLGA 4AIXA 4CNIA 1FNSH 1NMAH 4YWGH 4EN3C 4U6YB 12E8H 1RUAH 1M7DB 3VXPB 1OTSD 5E5UB 5KJRL 1F58L 3DJ9A 3BZ4A 2JTDA 3IU4L 4NBZB 3IJHB 4KAQL 5BV7B 1VADB 4KGJA 2D4DA 3H9SD 2QKIB 3WV0A 5E8EB 2GJZA 1F8TL 5GRUH 3DX9A 5HVGB 4U1LB 2E9BA 3BQUA 4DN4H 3NFPB 5I1GL 4M7LH 2XA8H 3PWPE 4XCNB 3WHXB 4FQHB 5CD5D 4Z7UB 2H9GB 4LLUB 5HDLA 2V5SA 5F93C 4HHAA 5FAAA 1GYAA 4RGNB 4BQCA 1YQVH 4CN6A 3VFSB 1MQKH 2WK2A 3CFBA 1CU4L 3O2WH 8FABB 4XPAL 4L9LA 3FB5A 4RFNC 4R7NA 3IJYB 1YNTA 1IAIH 4H1LG 1L0QA 2IQAA 2X4UB 1WTLA 3ZKXB 2R9HC 3FB8B 4YIQB 3DYOA 4X7CC 3VXUB 4YDJB 3MRMA 3ARDA 4OSUH 3TGXA 4Z7OF 5C0GA 3C5ZC 1JFQL 1OSPL 3O3DB 3CPLB 1M1SA 5E2UL 1LP9B 1JGEA 1V5JA 1HZHH 3DROB 4DGYH 4GFTB 3DX6A 5EU6E 1G7QA 3WFZA 5LGJA 4XPBH 5I15H 4BQ6A 3MNVB 3MGTA 5C07D 2WQ8A 2ZPKL 5BRZA 5EU5B 4FZEH 5E8PA 1ZGLA 4PUBL 4BFIA 1RZJH 3WHE1 1IC1A 3V6OE 1OAXL 5I9QC 4LDEB 1K85A 3MNWA 5A43C 5TDOB 5I30L 1JCKA 5FYKH 3O41B 5FXCH 5JUEL 1WBYA 1DQLL 1FORL 1WT5C 1QBML 3IDXL 3PV7A 4GMTL 4X6BA 3S3SA 2Z4QB 3ELAT 2BY1A 3GUTB 2WW8A 3T4AA 3EYOB 1CDJA 4F3FB 4Y2DB 1CI5A 4ZTPL 1UYWH 3QRGH 1KB9K 1FAKT 1QKZH 1S8DA 4XVJL 3UTZA 1H3UA 2BFVL 3D3VB 1FH5L 1NC4D 4NQTA 2VXTL 3H7LA 5EUOE 3T0XA 4XNQB 4S1QL 4U0RB 2IG2L 1DBML 2DLIA 1S9YB 1RURH 1CS6A 1W72H 1MCOL 2Y06H 1VGKB 1XF4B 1XZ0A 4G7VH 5D93C 1A5FL 1FRGL 5CINH 3WS3B 4JZOB 2BHYA 3BWUC 3NPSB 3P4OB 2D0HA 4MWFA 4ZUTA 1PFCA 1WWCA 2I07A 3H42L 1QLFA 3FHAA 4PRPB 2PW1B 2VLKA 4P48A 4R2GB 1N7ML 5MENB 2H32A 3DGGB 3F62A 4KWUA 1DEEA 2FRGP 1IJ9A 2NXZB 3MROB 5KVFH 4K71C 2NYYD 4MXWL 3BQUD 2P8LA 2OZ4H 1CXIA 1U8KA 1FZKA 3HAEA 2CUHA 2DIBA 4QCIA 1XR9A 4MVBD 5FO7A 3MXWL 2AK1H 5KS9B 4RGOL 3R0MA 3TPUB 2FH8A 4F37F 3FO9A 1QNZL 4KKAD 3MRRB 3RWDA 1T83C 2XTJC 4LAQH 4OUUB 2FR4B 4JREB 3TYFB 5IB2B 3FQUA 2VLLA 4QTHB 3BESR 3ZYJA 2O5ZL 4P57A 2DQFB 3WCYA 4BH8A 3ARDD 1FGVL 1A6VL 1P69B 1WFNA 2X42A 3ESUF 4LLQB 4FXKA 2NY2C 4HQQL 4XP6H 1YEJL 2R2BB 5ALBL 1U8LB 4PP2B 4DGIH 1NANI 2R2HA 1MVUB 2QSTA 5EZOL 3SY0A 4R6UA 5IVNA 3V8OA 2ZUQB 1KCRL 4I48A 2VAAA 3BAEH 3Q48A 1CTNA 3UC0L 4GRLA 4PJXB 3X3FL 1I7TB 1YY8B 5EORL 2NY3D 2DLHA 5EUKB 2BSED 4HFUH 2HYMA 4X6CE 3RGVB 4IRJA 1N0XL 2R15A 2R4SH 3NZ8A 5FDWA 1G7HB 1GZQB 5C0ND 4N0YL 1JHLH 5DSCA 2YK1H 3MGOB 5C0FB 4JFPA 3AREA 1S7SB 3LSOA 5JW5A 2D7OA 3UDWA 2MKLC 3M1BA 5TF0A 4PG2C 4HIJA 1RJCA 2VDQH 3CFCH 4Q58C 3PDDA 4OM0L 4XMPL 3CZFA 3BPNC 1A9BB 5D7SH 2F9BT 5HHME 3OHXA 4S1DC 2QQLH 2EIZB 1JGUL 3MYZA 1NDGA 4FXLA 2W0FB 4GAFB 4L4TE 5EZIH 1BX2B 4JM2B 2XWTA 3NCJH 4PJEA 3ZTJG 5DR5H 2I25N 5E2VH 4YK4C 2CSPA 4D0CA 1A21A 1HSBA 1LILA 4X7SL 5F7DA 1QO3A 1DUYA 3SE4A 2AXFB 2YKLH 3S34H 4OZ4A 4AQ1B 2Q3AA 3U7WH 1UEYA 1JZ8A 4QHUB 3QUYB 4PY7B 4OCXL 2VXUH 4LU5H 1CFTA 3BH8B 1UACL 2VO5A 5D70H 2VL4A 4LP5A 5E8DH 2AI0H 2UWEB 3RNQA 4LSRL 3JBG7 2P43B 3BHBA 2X4PA 5T1KB 2X4OB 3O11B 1GGBH 5IJVB 1TETH 3LV3A 4F9LC 1IEBA 3MRPB 1OWRM 2AW2A 4U1IB 4AM0B 1VFBA 1DUZA 4EDWL 1EO8L 4F33B 1KB5H 3SJVE 5T3XD 4KDTC 4F57L 2DWDA 5C2BH 5I17A 2FD6L 3WKML 3FOMA 2VB5A 2NZ9D 1BF8A 2R56L 5DEGB 5DLMH 5MP6H 2ICES 1N5AB 1FFPB 3QP3A 4PLJC 4P3CL 4N0CC 5DI8B 2ARJB 2DTSA 1TVHB 5IB1A 1CFVL 5DJ0A 1A3QA 2XN9D 4YIQA 3KPQA 5C0JB 5KJRH 3FO1A 1F58H 4GSDL 4G9FA 3IU4H 4LHJB 5BW7C 3QQ4B 4WI2A 4KAQH 4UNTA 4Z7NF 2HFTA 4GRLD 2PYEA 1MCFA 1CVRA 1L0XA 1F8TH 3S3JA 5HHNA 4DEPC 5GXBB 4IRJD 1EEQA 4AIZB 5I1GH 4BA8A 3T3MF 5BS0E 1KCKA 4GMSL 5CWSA 8CGTA 1ULVA 1CXKA 3ARED 2HVKA 1GPOL 1A64A 4NNXB 1CVSC 5EO1A 3V0VA 4WWID 5BVJB 3KLHC 1CU4H 3LKQB 4Y4HC 3GSWB 1LHZA 1ES0B 2WBKA 1MCPL 2L7UA 1UKTA 3H9ZA 4XPAH 5IBLD 1U2HA 4OB5L 3RWIA 1EEUA 2O93L 4HLZG 1HYSC 3ULVE 4HKJA 3RVVC 3IFOB 1FG9C 3WNLA 1FSKB 1NFDF 1XF5B 1MCHA 3DHMA 1JFQH 2JK5A 1OSPH 3ZMRA 2J6EL 4LBEA 3HRPA 5E2UH 2GSIA 4PGDA 4PJFA 1Q9KA 3LQMA 3BPLB 4KC3B 3I6LD 5L0QB 1OT1A 3VXTA 4KHTL 1P53A 1BLNA 3RIFK 1NEZB 1QRNA 2EDRA 1P2CA 2CKBA 2QADB 4PUBH 4N0UA 2PKDA 1OAXH 4RAVB 4P23C 4NCC1 2MKWA 2N7BA 3TH4T 3LDBC 1QFWI 4RA3A 5I30H 4WIQA 2EDNA 4K7PX 1S5HA 4I18C 5JUEH 1DQLH 1FORH 4GMTH 1QBMH 3IDXH 4X9HA 2VYRE 2OK0L 5T1LA 2OTUA 3CLFL 1EEYA 2HJLB 4PV9A 3TV3L 3ZE0F 1JGLL 3CSYB 2XI9A 4ZTPH 4M1CC 4V1DB 4TVPE 3O4LE 3W9DB 4XVJH 4R8WL 43CAA 2BFVH 1YMME 4WV1C 1FH5H 1C5CL 2VXTH 3VRJB 4IIQC 4S1QH 2IG2H 5D2LF 1DBMH 4PBXA 3CMGA 2OXHA 4OUUA 4AK1A 1EO7A 4QF1A 2NY6D 2CRZA 4O58L 1MCOH 1I8IA 4MD5B 2OR8A 1YYLL 2EKSB 1A5FH 1DFBL 1FRGH 5LAXA 1MCCA 3PWJA 7CGTA 2Q8AL 1AD9A 2NW3B 4LVOC 1JNLL 3H42H 3ZHLA 4Y8DC 4BFEA 3OKOB 1ZWIB 3PWNB 5GSRA 4R96A 2PYED 2Z31B 1S7XA 1N7MH 1KJVA 3GO1L 1G7IA 2E6PA 3VFOB 1CF8L 2XNAA 1JTTA 4KXZH 1JPST 4CAGA 4MXWH 3C8HA 3GRWA 4NQEE 4HIEA 4CKVX 4J3VA 3I2CL 2XKUA 3JUZA 4IHOB 3WKNA 1S7QA 3MXWH 3Q3GB 4JO1L 3ZKMC 2PYFA 2D7NA 1CE1L 1EHNA 3U79A 4RGOH 2QQKL 2H8PB 4Q9RL 5EA0L 1QNZH 2BNUB 3MRDA 1MCLA 4L8CA 1A7OL 2NQCA 1HWHB 1T22A 5F3BA 2O5ZH 4AG4L 4C4KO 2DL9A 2V7NB 1T1WA 1FGVH 1A6VH 1LP9F 3MLRL 5DK2B 1RV6X 4HQQH 1YEJH 2GAZB 5ALBH 3LKPA 2FHBA 5DRWB 1JMXA 4UV4L 1TVDA 1O0VA 2R69L 1QA9A 2Q8BL 5EZOH 5LCVL 2YRPA 5CKGA 1BFSA 3QIUC 4CMHC 4YHIA 1KCRH 4JDVA 1QRND 32C2B 3UC0H 1JZ3A 4UQ3A 3X3FH 2R0WL 2CD0A 1JYWA 3L3HA 5DMYA 2QBWA 3P9LB 1T0NA 1N0XH 3FRPG 4MD4B 4ZUVA 5INCB 4N0YH 1CG9A 5D6CA 3BEWB 4KZEL 1OP5H 4XBPA 5K59E 2BP3A 4L8DB 1P7HL 1PYWA 1JZ6A 2EEDA 3OKMA 3C87A 5T1LD 4JLRA 2X7LB 4KRPB 3WXVH 4OM0H 4XMPH 4I77L 4PS4L 4J1UB 5ICXA 1K4CA 4PREA 1JGUH 5HYJA 3MJGX 4UU9A 4J12A 4OGAC 5DJZB 4G8IB 4JFOA 4YDLC 3MV9B 5A16B 4PJ5B 2NY1C 5I75B 1D6VL 1IILE 4NSKA 4NZUL 1DEDA 3PNWA 4XNUL 2VH5L 4U1JB 2UZYB 4OZFG 2A2QT 3TNNB 5D5ME 1RJLA 3RDTA 1GGCL 2AEIT 4AT6A 3D48R 2EDOA 4LEOA 2FIKB 5BZWB 4OCXH 4WJ5A 2YC1A 1NSNL 4KK8C 3S37X 1GRWA 1OLLA 1UACH 1W0WB 3PGCB 1HHGB 4MMXC 4X0KA 5B39A 1V3KA 4LSRH 3QEQB 5J1TC 1EBAA 2AVGA 3QCTL 1BHGA 3QI9A 3VWJA 4GW5A 2D31A 4WHTA 5I8KL 3N1GC 5C9JA 2Z35B 5FOJA 2XQYG 2FHFA 4MAYC 4M61B 5IMLA 3FQTB 1UM6L 4RBPH 2E7LC 4ZFZA 4EDWH 1EO8H 4Z18A 3L95B 1CDIA 2VLJE 5F9JB 3JTSB 4F57H 3PQYB 2FD6H 3VFGL 3WKMH 2VITA 2NLJB 2R56H 4TUOB 3MOBL 5FA3B 4P3CH 1YDPB 3TEUA 4XCYA 2ESVE 4U7MA 4O00A 4RX4A 1AGFA 3QDGE 4LGPB 4XNZB 1CFVH 2R1XA 1KLGA 2JCCA 5CMAB 4ALAL 4JM2D 3L6FB 2W60A 1KACB 4HUWB 1AHWC 5GRWA 4YHLL 4GSDH 4PJXF 5DJ8A 5JOPD 1ODAA 3IDMA 3HS0A 3FQNB 1EXUB 3IGAA 4K2UL 5ITFA 5D6DA 4WFHE 3SE8L 2IFFL 1R5VA 1TITA 5F7WC 3MRGB 4QT5B 5J11C 3VWKB 4HJGB 1XF2B 3KXFB 4OZIB 4PLKD 5DFVD 1SMAA 3OJDB 3OAUL 4OIAA 4L4VE 4GMSH 4PG9A 1ZVSB 2YD5A 2YPKB 3EJYD 3MRNB 4TVSa 4Y5XB 1GPOH 4XC1L 2FZ3A 1CLZL 5FEBA 2WQRA 4XBGB 5T1KD 1KYOK 1OP5K 5J1AA 3D18A 3L3IA 3ARWA 3SCMA 1ZLVH 1MCPH 5C09B 4PJIF 4UB0L 2C7UA 2W0PA 4OB5H 1EHXA 1U8OB 5HYJD 1ZEAL 3HG1A 3STLA 2I9TA 2EYSA 2EDEA 2GCYA 3LN4A 5DJCB 3GEWB 1BZ7B 1J0ZA 2RR3A 3KYNB 3QQ3B 3TM6A 1IAKA 1FN4A 2J6EH 3GSVA 5HGBB 1AGEB 1INEL 1UWGH 3V5KA 1RIHL 5DHYB 3VU2A 1FVCA 3WUWB 1RUMH 1CFBA 4YHNA 3BD3A 1FFNB 4Y2OA 4KHTH 3ARRA 2E27L 2X6MA 4WEUD 4MDJB 5I1EL 3O3EB 2UWEF 4OM1L 3FB6B 2ZUTA 4DUWA 1DBJL 3BRDA 1F4HA 2DS4A 2ICWB 3TBYA 5JW4M 1WVZA 3E8UL 3GJFH 3RVTD 3QI9D 2PO6C 3DTXB 3O8XA 3VGHA 5C2UB 1DVFB 1U91A 4MQXD 1H3GA 3GMRB 3VFOA 3GMNA 2OK0H 4Z7WA 5FCUL 3G5YA 3QUKB 4QWWD 3B6SB 3CLFH 1B0RB 3EOBA 3TV3H 4IRZL 3ARXA 4YFEA 1JGLH 4PGEB 2J2ZA 3RY5A 1I1CA 4PJCE 1ACZA 1K3ZA 3GSUA 4R8WH 4ZS7L 1Q72L 3VCLA 4M5YL 5DJDA 1C5CH 4Q6IB 4GG8B 4RBPK 5CD3A 3MLZL 3FONA 1XGTA 3O2DA 5EBWB 3X17A 3GHBL 2ICCA 4RX4D 1F3RB 4O58H 1CD1A 2YS4A 2IC2A 3CH1B 4N8VG 2I60L 4GLRI 2VZOA 4APQC 5C0CB 5JR1L 4NQDA 1YYLH 5E9DA 1DFBH 3HE6A 5CZVL 5T5NG 1WC7A 2Q8AH 2CRIA 2BK8A 1JNLH 4MSWA 4ODUB 2ZJSL 4ZQKB 1F97A 2NW2A 3GO1H 4ORZC 4XAWL 3TYGL 1CF8H 2FLBT 5IW6A 3PJSA 4XC3H 3WDJA 1YEIL 3RBGA 4OCYL 3I2CH 5EBLB 2GFBA 5GS2D 1FC1A 5DJXA 4FQXC 5A2FA 1KCSL 4G8GE 1CE1H 2BDNL 4CVUA 2YA1A 1M05B 2KDGA 4XI5C 2QQKH 4ODBD 4PJBA 5I8CB 4BK5A 5D1XA 4Q9RH 5E8NB 5EA0H 1G7LB 3SCMD 4LPVA 3T4YB 3VMOA 2VDOL 1A7OH 2B7DT 4DVBA 4CW1B 3HG1D 3QJFB 1HOCA 4P9ML 1UQSA 4AG4H 5LGHL 4YHPA 3DO7B 2Z8RA 1PSKL 2E8YA 3K2MC 1KTDB 3ISWA 1JE6A 2GJ6A 4Y4KC 3MLRH 1IGCL 4YHKL 3WO3B 5I71B 5IJKA 1F4WL 1S7TA 3H8NA 4UV4H 5I16B 4EQ3A 2R69H 2Q8BH 4QRUA 1X5ZA 5LCVH 1NAMB 3QDJE 5CEXB 3V6FA 2R0WH 5DC0A 1HHKA 4FQ2L 4HUNB 4U1MB 4ZYKB 3O8XD 4JJ5B 1HI6A 4KZEH 2ZG2A 4ISVA 1HH6A 3MV8E 1T4KA 1PY9A 2ATKB 3WSQL 3P11L 1TZHB 1YZZA 2G5BB 5J6GA 4WFFE 2LABA 2FNBA 5FYLE 5I19L 1WBXB 2HFFA 1GHFL 1A3RL 5D2NA 3HNVL 4I77H 4PS4H 1IQDA 4D9RE 4XWGL 3EYQC 1U8QB 1FQ9C 2GTZB 4LCCB 4MJ5B 4EXKA 4X4XA 5DQ9B 4JQVC 4OFYA 3RWHB 5H2BB 1J8HB 4U1HA 2FBJL 1D6VH 4NZUH 1NJ9A 3OKKB 1MCSA 4HG4J 4NQDD 5E9DD 4XNUH 2VH5H 3HE6D 5ANMB 2BSTA 5LG1A 1Q0YL 3ZLQC 1JV5B 4TOYL 5C71A 1GGCH 5FYJE 2E8ZA 3ROOA 1NSNH 4NRYA 1GZPB 5KSVB 4HUWA 1Z9OA 3JUYA 1UH4A 1IGYB 1D5MB 1RZGB 1OHQA 3H9SE 4PTTB 3QCTH 5HJ3B 1QSEE 3ZHKA 4YBQD 1D3CA 3EFFB 3I3EA 5I8KH 1Z2KA 3C6SA 2CDGB 4FQLL 2IAMB 1YEDB 4E0RA 1B2WL 4M9PA 2C9AA 1D5XA 3VI3E 2X89A 1UM6H 5D1XD 2DL2A 4F15B 4JZNB 3FT3B 1WSST 1BM3L 3GMMA 2Q7NA 4XCFL 3VFGH 4QNPE 4EVNA 2V6HA 2G5RA