4UDTB

T cell receptor (trav22,trbv7-9) structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLGGYEQYFGPGTRLTVTEDLKNVFPPEVAVFVPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Staphylococcal Enterotoxin E in Complex with Tcr Defines the Role of Tcr Loop Positioning in Superantigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C R
total genus 61
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4udtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4udtB02
1Q9OB 4PJCA 3F7VB 3UJTL 1X5LA 3W5NA 4QRRE 4GBXA 5HI5C 3B9KD 4XCCL 4M8QB 1CDYA 1P1ZA 4MA3A 1QRNE 5GS0C 1MHEB 5C3TA 5IT2L 5FUZL 4BSWA 2R2HA 3H9YA 2AW2A 1PZUB 3ZTJG 5EBMB 1IVLA 2DM4A 3JTTB 4HZLA 1KYOJ 5GJTH 2NNAB 2VYRE 3FT4B 3GSRB 1CG9B 3OAYK 4WCYL 1OP5H 4WVRA 5CCKH 1YN7B 3PF2A 5C0AB 3MRCB 1CIDA 3KS0H 3LV3A 2X44D 4WGWB 4Y4HD 1OGAA 4LVOB 3VI3F 5L2JA 3KXFB 3K46A 3VD9A 1MY5A 1S7RB 4BJLA 3QNXB 3AREA 4Z7VE 2NR6C 3MYJB 3DJ9A 1EZVY 1G7PA 3S6CA 2HJKB 4R3SA 4K94H 4H8WH 1A7NL 5L8KB 4KKBD 4G9FA 4K7FA 4PJ7A 3UPRA 4I4WB 2MCPH 3S36X 1T1XB 5IUSA 3MJGX 2AKRB 4KMTH 2P47B 1M7IB 4Y5YA 3TH4T 5L2KE 1AGCB 1PDKA 4LCWE 2Y1VA 1F3DJ 4WO4B 1FG2B 5IQ7L 5BQ7A 4J6RL 1EVUA 3UC0H 2QQLH 1YEFL 2VR4A 2NY1B 1WJ3A 5D2LA 4QCIB 2AS5M 4XCEA 1MWAB 4PJIF 4LLMB 1FN4B 5GGSB 3QFJE 3T3ME 3ALWA 3HAEA 5FCUH 5B8CA 1QUNA 3SEPA 1ZVYA 1A14H 3OKNB 3B83A 1DBBH 5JLZA 1T1ZA 3MMEA 2GSIA 1MI5D 5L0QB 5E2WL 3V8CA 4NBYB 2A2QT 2V5RA 2XXCB 1IQWH 3BKCL 3RIAF 4JVWA 43CAA 5CGYC 1AXIB 1NCUA 4X6EA 2BY3A 4NQEA 4JHAL 1Q72H 5IBTL 3V5DB 1WBZB 2ADIB 1ED3B 5GRYA 2XWBA 4CDGC 1YMHA 3VXMB 2MPAH 3IGAB 3V0VB 3NOIA 3RY5A 4OF5A 5BMFL 4HWUA 4NDMA 3HB3D 1S9YA 5HI3D 3ULUD 1NCWL 4S1QL 5I1JH 5E4EC 3TH3T 1F02I 3CFJB 4ODSL 4JO4L 3S9DB 1SYVB 5DUPL 5JW3L 2RFXB 2ICEB 5FM5M 1QSFB 4WCYH 2NZ9C 3I6LE 4RGOH 5I75C 3U9PL 5FO9A 3A0OA 4WV1B 3RZWA 5I1AA 5FIEA 4N0UA 4OQTA 4PJDF 4WNQA 2EEDA 5E2JA 5E00A 4J2XA 4MXWL 1GL4B 5LQBL 3VGGA 1FLTX 4R4NC 1T7WA 4M93B 5TH2A 5HYSG 4JRYE 2MNUA 1YEEH 1RUAH 3QEUB 1S7VA 4O58L 1XGYL 3T08A 5DRNA 1WAAA 1FNEA 5SWSD 5EC2A 1A7RL 1QSED 3UX9B 3RWFA 5F96H 5DJ6B 4P9MH 5HD8D 2JKXA 2NY7H 3PWPE 4YDLB 1OTUC 1AXSB 1Z5LA 2P8MA 3ARFA 4IRSB 1FPTL 3OG6B 3DPBA 3EOTL 3UDWA 4RIRA 5CWSB 1K6QL 2BDNL 3EJJX 3SDCB 4GBXB 3STZB 4RGND 2C1OB 4KMLB 4DGIH 1R5VB 1R3IL 3A67H 1I1AB 5EBWA 3X17A 2DB8A 3LIZH 2VSCA 2BSRB 3PXHA 3G08B 4OAWA 4QWWD 5J12C 3EAKA 1OPGH 2UWEA 3QFJB 3HCVB 4XVSH 1DEDA 4M48L 2UVFA 4OCSL 4MAYD 3WLWD 5BZDA 5FHBL 5DJYB 3KAAA 1J12A 1P4BL 1U8IA 2V5TA 1T7YA 3JZ7A 3JV6B 4F7EA 1IEAA 1CIUA 3RGVB 5T5NG 5CIPH 3VFRA 2OTWB 5I8KH 5HDQL 1QBLL 3L1OL 4S1RL 5JW5A 4UOW1 1JYWA 3O6KL 4JPIA 1A6VL 2BP3A 3LVEA 3W39A 2R8SL 1RJCA 4OV5A 3MV8A 4NN5C 4R90L 5BV7C 4P4RB 3PWPA 1L6ZA 1SMAA 1HYSD 5IIEB 2WQRA 2CXGA 5GGSA 1SHMA 4KK8D 1A7PL 1LNUA 3AMKA 5CEYB 4FQ1L 3IRPX 3U7WL 4UB0L 1HHJA 3N85H 4M5ZH 2H2PC 4M6OH 3QDJB 1F6AB 3FQUB 3TEUA 5BXFB 3N1FC 3GMLB 3HHRB 4QHLA 2IAMA 5B8CB 3O4OC 5GSRB 3U36B 4QXGL 1BBDL 5C0EA 4XX1E 1TZIA 4CUCA 4OKVB 2R15A 4KHXL 3UZQA 4NFDA 1JK8A 3NABH 2WWMC 1T6VN 1FORL 4DW2H 5I66A 2DS4A 3ZZ1A 4B41A 4WW2F 3S5LG 2C4FU 4ZTOL 1IGIL 2MOVA 2YR3A 4WHTA 3P4NA 3B2VL 5GS1A 1XR9A 2HN7A 5F7HA 3TBSA 5JNYB 2NY3D 4FTVD 4KUCF 3NN8B 4NJ9L 3GM0A 1UZ8B 3U1SL 3RNQB 5TDOB 2EC9T 1I4FA 5GGTA 1DN0A 1D5IL 4EIZC 4YGVB 4QWWC 3CFCH 4QXWA 5AYQA 1MH5A 4I48B 4X6CF 3O6LH 4KQ4L 4N0UB 4NWUH 4FQ2L 1FG9C 4MAYC 5BOPA 1RUPH 4NWTL 1T0MA 5FKAA 3ZLQC 1QSFA 2VZSA 4JCLA 4A6YA 2Y7QB 4A2MA 2CKBL 2IANB 4J8RA 4NHCL 1IM3A 4U49A 1WWAX 4LKCB 5AWNH 5CSBA 5H94B 4LMQI 4E41D 3U30C 1DJSA 3QCVH 5ISZB 1C08B 4OLYH 3AU1B 4GXUM 1ACYH 4P5TC 4ZUTB 3CDGA 3C60C 1XGQB 1DBKL 5E70A 3RUGE 3HA0A 4HKJA 5KN5B 2YSSB 3UC0L 1IQDA 4IJ3B 4HXBH 4OZ4B 5TH2B 1MHPL 2GJZA 2FATH 4DK3A 1CXHA 1Z5LB 1H8NA 2GTZA 3GKWH 4GG6F 2BY2A 1BFVH 4KFZC 5BZWB 2ARJQ 3LN9A 1CICD 1BQUA 3C8KA 2JB6B 4MMXC 4WFGD 1ZS8B 1QSEB 2KQMA 5T3XD 3OKOA 5I71B 4R2GC 2BVYA 3L95A 3V4VH 1F4YH 3HE6D 4FRWA 4RMTA 3STZA 3V9FA 2ZUSA 3C6SB 5CKAA 3VFOB 3IU4H 2VXSH 2VO5A 1FVCB 5C7XL 4LU5L 3HFMH 4UILL 5CGMA 4JM2D 4P49A 1UKTA 3RX5A 1Q94A 3P4MB 2V2XA 4BZ2H 1JF6A 2BSRA 4P57A 3HLAB 5JIIA 4U6TA 3A6BL 4ZUWB 3QIUC 2CUMA 3DVGB 4I2XE 1OVZA 3LEVL 1S9VB 4GUPA 4J3OC 4PUBL 4OLZL 1MEXH 2J1KA 3PDDA 4NNYA 4XRCA 3OAYH 1HSBB 5DLMH 1KIRB 5DD6A 3STBA 3VFPB 4KAQL 1RZFH 5IWLC 2E9IA 4OCYH 3TA3C 4L1DA 1P84J 4WI9A 2E7CA 2UY7A 5HGDB 4XHJC 3LN5B 5EWIH 2VUOA 3W39B 3T4AB 3GKZA 2XA8L 1EFXB 3ZKXC 3W0WA 3VA2C 2HLFC 5ALBH 5I8OH 2WINA 1ES0B 1R24B 3HPLB 1OM3H 5J3HD 3L9RB 2JK5A 4YUEH 5C0EB 4QHKJ 1HHJB 4PLJC 2XQYG 2R29L 2XN9E 1A7OL 3I50H 4G6ML 3ALXA 2IPUG 1CXKA 1ZLSH 3F7QA 4PLOB 5SWZE 3LY6A 1YMMD 1VDGA 3E6FB 4NGHH 2NY5H 4HH9B 2DI9A 4YIQA 2DBLH 3CXHJ 2DI7A 4OT1L 5C0ND 3GUTA 5KVDH 4Y4HC 4DAGL 5ICYA 4JFPB 4KHTH 4P23C 3QHTC 4NIKB 3J7HA 5CUSL 2OP4L 4KKAC 3R1GL 4GW1B 4FMFA 2W0FB 5LWYH 3BKMH 4YGVA 3ULVD 4Q9CA 3LZFL 5IEHA 5J6GB 4BUHA 2ZZUT 4XB8A 5KTEH 3RL1A 3K4ZA 2IMNA 1ZT7B 2DJUA 2O5ZL 4XNQB 2P48B 5EU6A 1GHFL 3O9WD 5HGBB 1RHHA 3RVTD 4UTAL 4G6KH 1BOYA 2ZUQC 4S0SD 5F7DB 4FG6C 3I02A 2ZSWB 2C1PB 4WFHE 1BZ7A 5EUOA 2J3SA 1F11A 4LLQB 2QR0B 2R0KH 4OUUB 1JGUH 1FC2D 1T1YA 5D70H 2BRQA 3NCEB 2N7BA 5GRVL 1JGEA 3OKLA 3LH2H 3DX6A 1NFDF 4KROC 4O51A 3CDYA 5SX4H 1EZVX 1DBJH 4GG8B 2CDGA 4L9DA 1U8PB 3WE6A 1OTSC 2R23B 1P4IL 1C5BH 1DDHA 4YHZL 5E08H 5DFVD 2FLBT 1AQDA 2HJFA 1P9MA 2FNBA 3N9GL 4U3HA 4TUKL 1BBDH 2H3NA 1KTKE 2DLIA 3LKQA 5J3HC 5BZWA 4MQSB 2XNAA 2YD9A 1MJ7L 3WIFB 1AFVH 2DLEA 3GSWA 4OD2B 1FFOB 3EZ8A 3P4LA 1XGPB 1X6LA 4QNPF 3P4MA 3IKKA 3L5HA 1RFDL 1JUFA 4MXQD 1P4LB 3QHZH 4ZSOB 4G7VH 3DVGA 3BWUC 2DIAA 4PY7B 2YMXL 3TPUA 1RQ5A 1F2XK 4YXKL 3T1WA 3BSZH 4YBQD 3QUXB 5T1LB 3MLYH 1D6EA 1HDMA 4UUJB 4ZUSB 1YYML 5AG9A 1KCSH 3H9SD 2NY2C 1RUML 3TT1H 3FAWA 3OAUH 1QFWI 1X5IA 3D3VB 2WBJD 1FHGA 2I07A 2IFGA 4QOKE 1HH6A 2CKNA 2KUTA 4K23H 3SCMD 4NQDB 5HVWA 2W9EH 1GAFL 1Y6MR 4TULL 4HPOH 3G6JE 2DQGH 4LLDA 3ARDD 1MLBA 1JZ5A 4KK9C 2Y07L 5DQJB 1ADQH 3V79C 4RGMB 2CJUH 1AY1L 1LO2L 4HXBL 4JJHA 5EZOL 1NJ9B 5C1MB 4I18A 2AJUL 1JCKA 1GGTA 3S35L 5KVEH 3C5ZB 2XWJA 3A67L 5D2LE 4CADB 4OF3A 2ZUTA 5CEZL 5IMLA 1D7FA 1QLRA 3LKPB 3VCLA 4LP5A 2C5DC 1TXKA 1V3LA 4U1NA 1REIA 1ETZA 5CHNB 4LIQE 4NO0B 3GBNH 3NIDE 1RIUL 1PSKL 1EEZA 1HIMH 4NGHL 3PWJA 3W0WD 5F6IC 3TVMD 5F7WC 5EOQL 1RZGA 5ID0B 1IJ9A 4JFXA 3FB7A 4XZUB 5ICZA 5I1EH 3QXVA 3VFNA 1QD0A 2Z35B 1X5ZA 2DL2A 4P48A 25C8L 3GGWB 4YHOL 1IBGL 4X99A 3X3FH 5F1IA 3FO2A 4G3YH 5IHLB 3SE9L 3DECA 4PJEA 3RL1B 1CICB 4RIRB 2ZOKB 1U3HC 2E5EA 3RIAK 2VWEE 2B1HL 2EH8L 1KELH 1T5WA 1DQLL 5GRJH 2FHBA 3MZGB 2GI7A 2ERJC 3FB8A 4W68A 3QFJA 1A6PA 1HWGB 2J8UA 3G6JF 2AJSH 2R1YB 2C3VB 2GIYA 2AGJH 4UBDD 3BAEH 4HUUA 2FZ3B 4DVBB 3CK0H 4V1DE 4JQXA 5HHMB 4NKOB 5DJYA 3ZKMD 4J1UA 3ZT7A 4GG6B 5ITBH 1WEJH 2XIDA 1IAOA 2EDWA 5AZEH 4DQOL 1J05A 3IFLL 5CEXB 2Z31D 3ZDZE 1KIQB 1S7QA 2OM5A 1VFOA 1QKZL 5K59F 1GGIH 3GJFA 1FYTD 3RWJA 2VWEC 1T3FA 1LO5B 4KVNL 4NP4H 3RWEB 3UROR 5I18H 5FOBB 3LKOB 3MRRA 2N7AA 4XHQA 3BT2H 5IHUH 1EO5A 1JUFB 1TTUA 3ZT5A 3P0VH 4R26H 1MF2H 4ZSOA 4LAQH 2I24N 3TLRA 2PW1B 4ODXA 4HEPG 5MEND 4HCRL 4KY1L 4JFDB 4JAMA 1CGUA 4GH7B 3WNPA 4E42A 4J3TA 1KUMA 2MFNA 4LHUD 1NLBH 2PTVA 5E1HB 5I74B 3REWB 1MCPH 4EDXB 2VAAB 3V52L 1MLBB 1NGZB 1Q9WA 1TTFA 2GJ6D 1I7UA 4I18B 3SKMA 1MCOH 3MRLA 3KPOA 2EXYD 3MRKA 4G6MH 1QO3B 1KNOB 2R29H 5GZOD 4X4MA 1Z9LA 2O26U 5DURB 4P3CL 4G8GA 5SWSB 1FZOB 4UDTA 3L3DA 4U7SA 1MHHB 5E8OB 1CVRA 2IADB 5F3BA 3DV6B 1C16A 2ATPA 2YPKB 4NT6B 4XH2B 5DQ9B 2BY1A 5EIIB 4YEFA 4B5EA 5ID0A 3RIFK 3THMH 4KHXH 3P9MA 4FA8A 4NQED 4EN3A 3F7VA 5H35B 1IC4H 3OB0K 4X5WB 2C3GA 4XPTH 4HKJB 1U58B 4AMKL 5KN5A 1R0AL 5C0JB 1FFRA 1U8MA 4FQLH 1TENA 5EU5B 3BZ4A 3UAJD 3RU8H 3MO1B 5GRJL 3TVMB 5SX5K 4S2SB 2QADC 5C92A 2X4PB 3WSQL 3QSKB 3QIWC 4LEOB 4YHZH 1KPVB 2CXKA 4C59B 5I1CH 3ZHDA 4PJGE 1JI1A 35C8L 3L5XL 4RRPG 2A1WH 3CFEB 3V95A 2HT4D 1T66C 4K55A 2GJ6A 4M00A 5FO8B 3QULA 1U92A 2EE2A 3QNXA 5J57B 2NY5C 3DV4B 3T65A 4JFQA 2R1YA 3VFSB 2XACC 3IVKB 2AJZA 3MRCA 2GAZB 1MCBA 4BYHA 1ZVSA 4ZOEA 1D9KB 4RMQA 2VLKE 5HDLA 5DHYB 4XNXH 5CILL 4XC1H 3L3OA 4LCIH 3NA9L 5B4MC 4HUUB 1FL3B 2IMMA 3DXAA 4F7CA 1YEJH 2CMRL 4CBPA 3T4YB 5TE6H 4D0DB 2PKDA 4C56B 1MNUL 4L29A 3SJVA 2VLLA 4PJ8B 3TBWA 1IEBB 3QB7C 3GI8H 2FWOA 2V2TA 1U95B 4L8SA 4EJ1C 1H8SA 2JCCE 2DQTL 3IDNB 4DOHB 4X6DA 3BSZL 1OB1A 1Y18A 1T0NB 4AENA 1WWBX 3GO1H 1ZGLA 1TPXC 3U7YL 4PLNC 1ONQB 5IVXE 3SQBA 4IEFB 4HUXB 1LDSA 2YHGA 2Z31A 1P7QA 3QDGE 3MQIA 4Q74A 4TVPE 3LQAL 4M4PA 1LP9E 1M05A 2XTJE 3REWA 3WS6A 4I2XA 2P8LA 4YE4H 3ULVH 1MCWM 1OTUD 5BVJA 4WWID 3OGCA 4PJXE 3WD5L 1KACB 1YNLL 2AV1B 3H0TB 3RJDA 3D85B 4M6AA 3WN5B 3O3UN 1U6AL 1BWMA 1Q1JL 4EVNB 1ED3A 4K7PX 4RAVB 3MV8D 3K8LA 4PD4K 2X1QA 4K9EC 3SOBL 5IOPA 1MIEH 5KAQG 2LAAA 4XCFL 3FN3A 3U79A 32C2A 4G8GB 2GITB 5SWSA 4XI5C 5KVGL 4LSDA 1U91B 4LSTL 4DN3L 3H42H 5TDPA 4Z7UF 2A6DA 2FDBP 4NCDA 4X5LA 1RZIA 4I1NB 2E27L 1ZLVK 5E4IA 3IU3B 1CGTA 1DBJL 3SE3C 1HINL 2PO6D 4UDUA 4UILH 1I85A 1SBBA 2XZQH 4OD3H 3OZ9H 4Z0XB 2R9HD 4MA1C 3MTRA 3S98A 3KPMA 5I71C 3F65A 3SJVE 2YD6A 3L3IB 4JKLA 4OZGA 1P5UA 1P7QD 4MVBC 5CWSA 2EDQA 4MX7B 2X4SA 2D0HA 1AXTH 5F88A 5D9SB 4YK4C 3NZHH 1G0YR 4DN4H 5E2VL 2AV7B 3U4EB 1MRCL 4LLWB 2QQKH 4JFZL 3BPNC 4U1GC 1FNGB 4IRJB 4HKZB 1E4KA 3VDBA 1OAXH 5E94B 4TSCH 1QBMH 4XPAH 3NVQA 1VFBA 5EH1A 4XHJD 5HPMB 3DV4A 3T65B 1WBYA 2ZPKH 4MHHI 3VFSA 2XPGB 3BFOA 1YEHL 1P6AB 1FFOA 4OZFH 4R7NB 3VJ6A 1CGVA 3VFMB 2CGRH 4KJQC 2BOBB 2RCSL 1J8HD 3P73B 1A6WL 3PIQB 3EDDA 3MV01 5E8EA 5I15H 4DQOH 2P5WA 5E6IB 3EYQC 1FGNH 5CSZA 2HAZA 2P8PA 5HGAA 3VXTA 2A73B 1FFNA 2WSKA 3GRWL 3BYTA 3V5HB 2LU3A 2R56H 4OFYA 1QP1A 3ZKXB 3I50L 4P2RA 3O11A 5D7IA 1ZLUH 3D2UA 1ORSA 4JHZA 2VDKH 1UJTA 4PJ8A 4X6DE 2F5BH 3WXVH 1QFUL 1YPZA 4I3GA 1ZANH 2VDQH 3MRPB 1QYGH 2ENSA 2PF6A 3PXJA 3C5JA 1KC5H 1MWAL 3SKNB 2AERT 4CMHB 4FABH 2XA3A 2XY2A 3LQAH 3TC9A 3PWVA 4NC1E 1DL7H 4Z9KB 1K3ZA 4P2QE 5JW3H 4GJTB 4F57H 1RMFL 4PB9L 2B1AL 1RZFL 1MVFA 4QT5B 2JF1A 4UIKL 3ZDYE 2P8LB 5IQ9A 3OAZK 1IGTA 2IAMB 2L7UA 4PJ9B 3MUGB 4JPVH 4N5ED 2ICWB 3C6LB 3QEQE 3E3QC 3FQXA 1OGAD 5JW4M 4GAGL 3QAZB 1I9IL 5FGBC 2YUWA 3V5KB 3P0YL 3GIVA 1EHAA 2JCCB 4S11A 1UZ8A 3AS3A 1NANH 1P9MC 3WS6C 2XV6B 2H8PB 1OCWL 2H45A 2Y06H 3D85A 4GKSA 2YKLL 2BOCB 2ZUQB 2GITA 1XR9B 2HN7B 2ORBH 1FH5H 4LSQH 4PJCF 2SEBB 3VRLF 3SDYL 3IS0X 1KULA 1F4YL 4F15B 1II4E 2WIIB 3BO8B 5C08A 3IDGA 1URLA 2Y7QA 5FYKH 3GGWA 4GXUN 2VXQH 4X9GA 5TE7L 4Y2OA 5I1KH 5KAQF 4BFBD 3SKOA 1C12A 2BY0A 1P6FA 1DR9A 4Y4FB 4YDIL 3QYCA 5GJSL 1CU4H 3L6FA 2ORBL 1NFDB 3P9LA 4KK8C 3T77A 4IHOA 3MRHA 5IR1A 1LEKA 4H5SB 4Q0XH 3ARTA 1B88A 4YPGB 1YNKH 3VI4E 1VSCA 3EO9H 2VXUH 2A6KA 2QHLA 4LCUA 4WO4C 1RY7B 2QLVB 4AY0A 3V6FA 5HGHB 5ESQA 3WL9A 3NFPB 1KG0B 4WU5B 4PJ7F 1H3TA 4U1JA 1LE9B 3MLYL 1RJYB 5C0CA 4D8PA 3DO7B 4FXLA 4NWUL 2VXVL 2X40A 1ZS8A 5KVFH 3KPRD 4WI2A 4Z7VA 1VB9A 2C26A 5FUOL 1MCIA 1XH3A 5I17B 4K7PL 5LVEA 1UB5A 2QBWA 3T3PE 1BJ1H 1FJ1B 5LCVH 1G9MC 4PJAA 3K74B 3PP4L 2GSGA 5FUCE 1HHGA 3DOSA 1K5NB 3BKYH 4QCIA 1QLEH 5K9QI 2P5WB 2PXYA 4P2RE 4LSRL 5A43C 1BD2E 3VFMA 4LSVL 3IXAA 3D25B 5JZ7D 4NNYB 4OCNC 2IJ0C 5JLZB 1AC0A 3KVQA 5JOFA 3PE9A 1JTPA 1WZ1L 4XP6L 3DX8B 4HUNB 4MAYA 4BK4A 4APQC 5I1JL 1BPVA 2Y25A 2EE3A 4R2GD 1H8OA 3V5HA 3CGTA 3VFPA 5E2TL 2DQTH 5INDA 1WBZA 2ADIA 1XF5A 4YAQB 3VRJB 2HRPH 4JM4H 1G9MH 3G5YB 3S36H 5F1KC 5HYIA 5I1IH 5MEOA 4LSUH 2X9WA 2HT3D 4GO6B 4HWZA 5CGTA 5CD3A 3ARDA 2O93L 4M93C 1S7TA 1RZJH 3STLA 3MOAL 1J9CT 4ZS7L 1UWGH 1INEL 5FM5O 3RVVD 3BH9A 4JGJA 4HH9A 4UQ2B 3QXDA 1K85A 4M1DL 1NBYA 4XNUL 5MENB 4PJDA 2F9BT 5D1QA 5T1MA 1R3HA 4RAUA 1I1FB 4WNQB 1MHHA 4YDLC 3WNOA 3SDAB 2R4RH 4F9LC 5K33A 5FAAA 4D0CB 2ATKA 1PKQA 3SDCC 1BEYL 4HWNA 2CJUL 3S36L 5HY9A 1T21B 4ZYKB 2VJXA 5D1ZA 3QEUA 4Z0BH 5ABDE 5IK3A 4OZHF 1S9XB 4OD3L 4IMKA 5IVNA 1WF5A 1BGXL 4S1DC 2GFBB 4RQQA 35C8H 3L5XH 1A3LH 1U58A 3ABZA 1YUHB 1FZJB 3PHOB 2E27H 3EJYD 1PZ5A 3I02B 1EGJH 2J4WL 1PY9A 3OAUL 4D9RE 1Q9LA 2P44B 5EUOB 4AIZA 1JJUA 4GG6E 4XP1L 3BO8A 3FB5B 4L8BA 5EU6B 5IBLC 1FL6B 2AI0L 4Y2DB 1X5JA 1RHHB 2Q76B 2J88L 2WZPD 4I0PD 3RGVC 1LE5B 5EBWB 4LPVA 3QUZB 3MROA 5J9PA 3CSBA 3H7BA 4FQJH 1E6OL 3QULB 5F1NB 4LHUG 1MFAL 4HJ0C 1S78C 4LSSH 3E6HA 2FO4B 3IF1A 4KJYA 1DE4A 3EGSA 5BV7B 4GRWE 2HJFB 5BZDB 5KJRH 5IT2H 4OKDA 2Y36L 2VN4A 2YZ8A 4HXAH 4HGWB 3O41B 2PYEB 3VXNB 1B0RA 3JV5A 3UMTA 1DDHB 4K7PH 3OSKA 5E6YA 3MFGB 5GGSY 5JW4Q 4QRTA 3EO9L 1A3RH 4UMGA 5C6TH 4D8PB 1FNAA 1I7TA 1BBJB 4U05A 4EXPX 5ADPH 4LRIC 4ZXBB 4BZ1L 3WIFA 1J8KA 5CJXC 3ULSA 4YDVB 4EIGB 4WENB 2EEBA 3IFPB 3QUXA 5HDQH 3H6JA 3ESVF 4WY7L 5HHOE 2H6PB 4HJGB 1MCCA 1DZBA 4HFUH 5IB3A 3SDCD 4OGYL 2E7BA 1EBAA 4PY7A 1YNKL 3EO1B 3ARQA 4EI6B 2HT2D 4X9IA 1MCDA 2YWZA 2IBBA 1JVKA 3GSXB 3U0WH 4KDVA 3X13B 3H8NA 5JOFB 1UM4L 1NBQA 1E4WL 4WEBL 2WNGA 2Z93A 3VXSA 5IFJB 5DS8A 1NMBL 2DQEL 1N6VA 3FT2B 4MAYB 3MNWA 2APWA 3ARBA 3MOAH 5CP7A 5FYLD 3ZKMC 3S37X 5DJ8A 4TYUA 1CLYL 3KPSB 4DGIL 4J3XA 3O3BB 3QEHA 3U46B 4NQCB 5HD8C 4JHWL 4WW2C 4WY7H 4QOKB 1DEEA 1IC5L 4TVPD 1YY8B 2B7DT 3MRFB 4HKXB 1GIGL 3QPQC 1R3HB 4IJ3C 5A2JH 1IARB 1IRAY 5AD0B 3L5JA 5GSVB 1N6QL 1KB5B 1L7TH 4H88L 4UBDC 2EDEA 4YHKL 3PUCA 3MOQA 2CDEA 4UQ2A 3C08H 4FXKB 5HHQA 3FKUS 1CGSL 2VNCA 3VXRA 3BPLC 3VGAC 3SE4A 3VWJA 5MENA 2R2BB 3ILPB 1JNHB 3KWWB 4PTUA 2CK2A 1KC5L 4KZEH 2P24A 5ISZA 4X4YB 3SN6N 4CU7A 5JUEL 1MFEL 3GBMH 2VTFA 3OR6A 5CGYD 2FBJH 3WFCH 3EYQD 1EBPA 5GGQH 1LO0L 4RZCB 3FN9A 4GAJL 5EOCL 2JLLA 2F54E 3KG5A 4KV5E 5F9OH 4M7LT 5IK3B 1VGEL 4Y19B 3HRZB 3IKCB 4U1SA 4X8JB 3UTSE 4MNQE 1CDJA 25C8H 1HXMA 2Y9RT 1EHXA 5BMFH 1UB6B 5F6HI 2ZG2A 3RWDB 3SCMC 5IGXL 4J4PA 2NNAA 3GSRA 2QQQA 3G6AA 3VXMD 4PRPA 3GRWH 1H3GA 1YY9C 4ORZC 1LDPL 3TA3B 3V8OA 3KXFA 2D4DA 1BLNB 4HCRA 4KUZH 3L3KB 3DX7A 3BHBB 3WUWG 1B0RB 1IAOB 3MBEA 2PR4L 3T04D 4X5XB 1S9WA 1S8DB 3HB3C 4Y1AD 1S9VA 3VW3L 4DUWA 3V2AR 4U3CA 3JV4A 1DQJA 1OF2A 3EHBC 5F3HB 4K7FB 3I6GA 1ZWIA 2ZCLH 4JKWA 1H3VA 3O41A 2W9DH 3T0EC 1JIBA 5CLWA 3RKPA 1TPXB 1G7JA 3EYOB 3T8XA 2JJSA 3RWGB 1YPZB 4G8IA 2X7LB 1MCJA 4RDQG 2BSSA 2VN7A 4TSAL 4JG1L 2ESVE 4HJGA 2I9LA 5D7LB 3CXDH 4XI5D 1T04B 3KLAB 1FQ9C 2NY1D 4FZEH 3Q5YA 3WO3B 1WTGT 2RB8A 4P23B 3TF7C 5HI5D 5J1AA 3DI3B 2BDNH 4K2UH 3RPKA 4O5LH 3IDIB 3H42L 1J0YA 1B0WA 4FFYL 4NZUH 2W9LA 5TF0A 3BE1H 2XN9B 1U8QA 2HMID 1AGEB 1MCHA 4I3SH 1NGZA 1Q9WB 4WIQA 1D6VH 1I75A 3AY4A 5A2KH 2PO6C 1QA9B 1OSZA 4OV6F 4RISH 3PP3H 2BHUA 1W72A 1BAFH 5ERWA 4AK1A 3GJFK 5CZKA 4KTYA 3AUVA 3MBED 1UKSA 1YECH 3HS0B 2W0FA 3QQ4B 1AGBB 2J6EA 2BOCA 5DD1H 1JRHH 3HZYA 4AG4H 3UEZA 3SCMA 2PTTB 1ZSDA 2WIIA 2VDMH 1KJVB 4HS8L 1CD1B 2YOCA 3DGGA 1XGUA 5E4EB 1CL7I 5T1LD 5HDOA 3BEVB 4B50A 1FNFA 1I9JH 2N1KA 3O2WH 3T0AA 3BQUC 2CLVA 4DJMA 1OAZH 3N1PC 4JN1L 3FRUB 5I75B 4LRNH 4O02L 1U8LA 2LU7A 4ZMAT 5HHQB 4HS6A 4IRJC 3WNNA 5I73C 5EU5A 2CLRB 3QIUD 4FQQB 5INCA 1P7HL 2HLAA 4GKZB 1I1CA 4KZDL 3FO0H 2EYRB 5KSAB 4TVSa 2J12B 3B6SB 2R8SH 3VH8G 2UVEA 3FOLA 1BFVL 4Q58C 5ANMB 1SJEB 2ILLA 4X6FA 5DJ0B 4IS6B 2ED8A 1KG0A 7FABL 4Y5XC 5KTEL 3HI6L 1JGVH 1FBIL 4Z7WF 5K9KB 3IKCA 3IETB 3DTXA 1DBKH 3KYMB 3GMNB 4QXUL 1CXIA 1UA6L 3CFEA 3LMJL 1XIWB 3GSWB 3VD3A 3LEXA 3DVNA 1H5BA 4YNYB 3RUGB 2IH1B 3QJFA 4M7ZC 1VFMA 4OCRL 3P3YA 3VXUE 3TWCH 3TCLB 1JNNH 3A6OA 4BUGA 4WUUA 3TP4A 2HTKC 4OLWL 1M71A 4K23L 3BX7C 2DTMH 1PX4A 4QGYA 2IPKA 4Q6YA 5D2NE 4PGEB 2AEPH 5JA9A 4PJFF 3FOMB 1E4XH 5AEAA 1CTNA 1NKRA 4NYLA 4P2OB 4H0GA 2Q8AL 1J8HB 4CDHA 3WUWB 4JPVL 2V2TB 4CW1A 3NH7H 4XP9H 4BZ1H 2GK0B 4L8SB 2HFFB 2A6IB 2VDPL 2APVA 1KN4H 2D7TL 3G5XB 1DBAH 2AGJL 1IEBA 3DI2B 4JKMA 3MCLL 3JWOH 4HV8B 4WI5A 2A77L 2D0GA 2FBJL 4HWEL 5F44A 3QZWB 4XWOC 2A6JB 1JHLL 1DCLA 4RDQF 4X7SL 3LDBC 2IAND 4NO2B 1NLDH 3KPPB 3MREB 5FA3B 4PP1C 3BH8B 1CK0H 1QLFB 5ISZD 3ARFD 3BKJL 3PNWB 3UJIL 2NXYC 4XC3H 2YN5A 3FFCE 2IBZX 2VZ3A 1L9MA 3C08L 3WFDL 1UACL 5L8JB 1P4IH 1CFQB 4Z7WE 2EIDA 1DVFD 3UYOD 4PYHA 1UWEH 4L4TB 5FO7A 1JYVA 4N0CD 4D0CA 1BOGA 1B0GB 5DA0B 4XCYA 2XKNB 3K81A 4JG0L 1JF5A 2B4CL 2DWEA 1E28B 2HA1A 3RBGA 4JO3L 4M62L 5TDPB 5TDOA 4H88H 5E8PA 1OOAA 1HHHA 4HFWB 4PTTA 1H15B 4KJQD 1FZJA 3PHOA 2VAJA 5JDJA 4BQ8A 3GMMA 3CFDB 4YQXL 1CICA 3WHXB 4XXDB 2FGWL 1A7QH 1T0MB 3D9AL 5FKAB 5EU3A 2GKIA 4XPHH 3RVWD 5T33H 3RY6A 3S34H 1TETH 4EDWH 1SBSL 4KVCH 1QEWA 1HQ4B 1EX0A 3QH3A 4PBVC 4KRPC 4YWGL 4ZUTA 3VDAA 3OAZH 4NC2B 3CDCA 1X3DA 1ZHLA 1U8LB 2OR9H 4EKXA 3D18A 3U6RA 4JM2C 1FNGA 1SJEA 2GJJA 3ZE2F 1X7QA 4P5TB 1M7DA 4PD4J 3QDMB 3FT3B 3SE4C 3VWJC 3MRDA 3B6SA 3QDGD 1DUYB 4ONGL 2NX5D 4LF3A 4KMQA 3VXPA 2CH8A 5C6PB 4OFYD 4D9QE 1JPFB 3PWUA 4YUEL 4AEEA 5KS9B 4O2EA 1FNSL 3IJYA 4P5TD 3CC5A 3O2WL 1LO5A 4NRYB 1DVFB 4WUUB 5LBSH 4JRYB 4UIKH 2OQJB 3BDXA 1EO8L 1VFUA 3LEXB 3Q6FB 3W9EA 3VJ6B 3VH8A 5HVHC 1L7IL 3QWRD 4O4YH 4LHUB 4N1EA 3MA9L 4N9GA 4Z8FL 4PRIB 3RI5F 3RKDC 3KPRB 2UV3A 5IM7A 1BM3L 4I18C 1JRHL 3DGCR 3K0WA 2XZAH 3IS1X 3QIBA 1DQDH 3C5SB 4PRIE 1JMXA 1XZ0B 5GGTL 4C83B 1YEKL 1TCRA 2G2RA 3QIUB 4PB0H 1KIRA 3NPZB 2CDFA 3O11B 4MB4A 1ORSB 2UZYB 4I77H 5EPMA 4RMWA 5DURD 4EQ2A 1L7IH 3VXME 2OL3H 4ZO7A 1A6AB 5IV2B 2ADFL 2QQNL 3EOAA 2H9GA 4JRWA 2VXSL 3HPJA 3MV8E 1KPRB 4J3VA 3QI9B 2MPAL 1A6WH 1NLBL 1DQQA 3IDJB 4YR6A 4BFIA 2YK1L 1DSFH 1A14L 4KRPD 1JHKL 1VADB 5D6CA 3LOWA 3O0RH 2AAVA 4Y4FD 4N0YH 4OLWH 2BNUB 1BVZA 3B5GA 4K8RC 5JO5B 4OCXL 1CD9B 4M1GL 4MS8D 2Q86A 2DLFH 1KEML 1ADQA 1G7IA 4GBXD 1I7RA 2OTUB 3SE8L 1AD9B 3PV7A 5I1KL 2ZCLL 4NO0D 2VIRB 1J7VR 4W4OA 5I18L 1IGJB 3IFOA 2ZNWA 2EIBA 3MLVH 4J3UA 4YPJA 3C9NB 1Q0YH 4XNUH 1A7NH 3QUXD 4OGXL 2B4CH 1FL5A 3KDMA 5ALCH 1FDLH 5E9DE 4OZHA 2DDQH 4LSQL 5F7EL 4E5XA 5TDNB 4QRRA 3Q1SL 3WNMA 2HYMA 3CCHB 4FQCH 1KTDA 4QNPE 4NCC1 4KGLA 3X12A 4ERSL 3PDGA 4FFZL 5IR1B 1UB6A 5DEGB 1F11B 4FS0A 4KU1A 5DUBA 2AP2A 3VFUB 3VGDA 4DZ8A 1JL8A 1IE5A 1NCTA 5C0AE 3B3IB 5IFHH 1QR4A 5MP6H 3WIIH 1DBML 4GW4B 4F9PC 4NPYA 3WLBA 3J8F7 4MHHG 1KGCD 4O51B 1LE9A 1SY6H 1KLFA 2XQYK 4GG8A 5A2LH 2RR3A 4QRQB 3REVB 4ALAL 3T0EA 2FHCA 3HMWL 3L3OB 1HEZA 3DX9B 4G43A 3S3JA 3MRNA 3HTLX 1JPFA 4PRHD 2BNRD 4ODWB 4ODSH 4OTXH 1RVFH 2FO1A 3FT3A 2ADJA 3RZCB 4U1KB 2ZUXA 3NCFB 3GB7B 4C56A 3SDAD 4P3CH 2OQJA 3GSNH 2X4OB 2OXHA 1QFUH 3QHFL 3RIFF 1MUJB 3LEVH 1IC1A 4QKXB 1HZHL 4Z7OF 2FIKB 2JJUA 5JHDA 3V0AC 5JXAL 2AEPL 3IJYB 2F53E 3CU1A 1FV1A 4AQOA 3NGBB 2DTML 1JZ7A 3DLQR 3HZVB 2P8MB 1F4XL 2ADGA 4LCWD 3W9EB 3QR2A 4E0RA 5IW1A 3QXWA 3LH2L 4JFEB 3BP4A 1A5FH 3QCTL 4MDJA 3EYSL 4AL8L 4EI5A 3IAGC 5E0QA 3EJZD 3WNLA 1KJ2H 2P7TA 4GRWH 1I1AA 2X05A 3MODH 4AQ1B 5CJQH 3O9WA 5GGRB 3VXUB 2G9HB 1W0WA 1YC7A 3VD5A 1IM9B 3TJEL 2DMBA 3OXRA 2NY0C 5IESH 1T03L 1S7TB 1WIOA 3LHPL 1JNNL 4PGBA 4QEGA 4D9LH 1KPRA 4P3WA 1PQZA 2NW2A 4DKEH 5EPMB 4TULH 1M7XA 4XPFL 2GTWA 1K4CB 3B5HA 1IKFL 5JXEA 3ULUL 2EDDA 3EBAA 2YKLH 4PJBF 3HS0A 4OF6A 5TQ2L 4WFED 3ARDB 1UA6H 1INQA 4IOFC 1XGRB 4GOSA 5D7IE 2V9QA 4Y16A 4MA1B 1U91A 3BQUA 3MJ7B 3VWKD 4NQSA 3AM8C 4M62H 3AMLA 5EO0B 3FTGB 1CFTB 1BECA 1TQCB 1WT5A 4RA0C 1JNLL 2MKLC 4XT1C 5E6ID 4NN6C 3TT1L 2FSEA 4YH6A 2FB4L 2VC2L 2DBLL 4POUB 4XVUC 1UWEL 3KYAA 1Q38A 5EZJA 2VITB 2VMFA 4ZOCA 4LNVA 3C9NA 2JJTA 4TVPL 1T21A 4ZYKA 4PLKD 5B39B 5TPWH 5BRZB 1I3UA 5EO9B 2DQUH 1NLDL 4LIQH 4AIZB 3HG1D 4NO3B 4POZC 4NO5A 2FEEI 1IGJA 4DEPB 2YRPA 2EEAA 1RD6A 2AV7A 5C0RH 5I0ZA 2AJYL 4YDJA 3JWOC 4G7YH 4OLXL 4XCCH 1NFIA 3LQZB 2DTSA 5FYLL 3SDXE 1X5GA 3NIFF 5B3JE 1OAYL 3ZTJH 1PZ5B 5FKPA 1NQBA 3N9GH 3CVHL 3D85D 3QIWA 3MBXL 3P4OB 5I19H 2I9TA 2VLJB 4I8DA 4OF0A 4OZHB 1A9EB 4R6UA 4UV4L 1E0OB 4WW1B 1P7KB 4UTBL 4KTEL 3UYRH 2VL5B 2VOTA 1VERA 2PETA 1LE5A 2HKHL 4OIIH 3VXRD 1U3HB 1CBVL 4G8EA 4MQXD 1NGXB 4M6OL 1TMCB 3H9ZA 2IH1A 3QJFB 5C0AD 2GUOA 4UB0H 3T0EB 3VFVA 5DUBB 2PYEA 3T2OA 2FO4A 3IF1B 2ERJB 5EOQH 3NCJH 4ONGH 1EVTC 1WAAF 4R3SB 1ZGLM 5E6IA 3U7YH 2ZG1A 1HSAB 3DUSA 4RFNB 1M7IA 1TDQA 2R2CA 3PDOA 3RNKB 3PWPD 4U4BA 1U42A 3MLTA 2DQJL 5D7IF 3H9SE 5D5MB 1FYTE 4BH8A 1X5HA 2BHZA 1XGTA 5E9DD 2NLJA 2K3TA 5GZOC 5DTFB 4YDKL 1LK3L 3KPSD 5HVGB 5GHWL 1J1XH 1MJ8L 1YPZE 1XEDA 5GQBA 4HIEA 5DMGD 1V7NH 2GTZB 3HZVA 1PJ9A 1YEFH 4C4KO 3HG1A 3QAZC 3OX8B 3WDHA 2EIZA 2IG2L 2Y07H 3K8MA 4YJZL 4QLRA 5FECB 1I9RL 2PR4H 43CAB 3F62A 3KPLB 5C0CE 4LDOB 4AH2B 1RUPL 3IXTB 2OJEA 3QQ9C 3WFBH 4MQTB 1MCSA 3BJ91 4NO2A 1C7TA 4L9LC 3MGTA 2V5SA 5CJXA 4P3DB 1XF2A 1FLRH 4LSUL 4F15C 3MV11 3FQTB 5IGXH 1NCCH 2MHAB 2Z93B 1EPFA 3CJJA 3DO3A 1CGWA 1CBVH 2BCKA 2G9HA 5EO1A 4JJ5A 1IGYB 1JV5A 4MD5B 2ICEA 4UU9A 1BOGB 1TCMA 3CX2A 3SKMB 4PJBA 4XP5H 5E03A 1IZKA 3A6CL 4NQCA 4X98B 3BQUB 4MNQB 2I5YH 4PRBB 3V6OC 4F2MB 2DQHH 4LSTH 1I1AD 1MI5E 1HHHB 4HFWA 4PTTB 4KTDL 4Y19E 5I73B 4QOKD 1T2QH 4LCYB 5HHOD 5JUEH 1IGIH 2F54B 4N1HB 4Q9BA 4N68A 4Z78B 4PJ5E 4PRID 1U93A 5E00B 4OTXL 1JF1A 1SY6A 4PUBH 4JFOA 2IPUK 1Y6NR 4G6FB 1HILB 1DQLH 2JIXB 1FNEB 1BAFL 5DQ9A 1B2WL 3FO9B 4Y8AA 5D7SL 2X1XR 1EFXA 1K9TA 4FQJL 5DJ6A 4OZIA 4TTGA 4B53A 3P9LB 1KCUL 3X3FL 1GVIA 3HRZA 5DRNB 3LS4H 5I76B 3K7UA 3BUYB 2WWMD 2VC2H 5FEBA 4NSKA 1UJ3A 1BMGA 5E1AA 3RWFB 4G42A 3MV9A 1NBZA 3ZHLA 5FUCC 1NFIB 3LQZA 2BVUA 2V7HB 5LAXB 5ESQB 3WL9B 5GRUH 3RWIB 3NFPA 2EYTA 2VLJA 4M7JL 2X4PA 5H2BB 4ERSH 1N64H 4DFHA 4M6ML 1I3GH 4I0KA 2FX8L 3GJEA 4NOBA 5D93C 4YDJB 3W82A 2IH3B 2VL5A 4NQCE 3NAAL 4LARL 4I5BA 4HIIA 3QIWB 3GKWL 1A9EA 5KS9A 4ENEC 1U8IB 2ZKHH 1UB5B 4X7CC 2WP3O 4R0LC 3CC5B 4NRYA 4P2OC 5IEKA 3ARGC 5TE6L 3CSGA 1YYLL 1SBSH 5LXGL 4G8EB 3VH8B 3I6GB 2XRAH 3N1QC 1YZZA 3MRBB 2FJFB 3QIWD 3PABA 2NY3C 1IEAB 2F5AL 4WWKC 3MUZ1 3NAAH 4JDZA 2XZQL 3C09C 1VHPA 3JV4B 3U0WL 3ES6A 5FYJU 5HHOB 2ZOLA 3BUTA 3GMOA 1MRDL 3MCKB 4AEFA 1T1YB 3OKDB 5JPMB 4O2CB 2JJWA 3NIGE 4JY4B 3DX6B 3TIDB 2H32B 4KRMB 1RUMH 4M7KL 4LHJB 1AIFB 1R3KB 2DLHA 4QHLB 1UZ6F 1U95A 2VLMD 4TUJB 1TNMA 2XFXA 3IXTA 1FRGH 1IAKA 1WC7B 4XNMA 4MXVF 3FB6A 4H25B 5DGQA 5EZIL 2Z92A 2F8OA 3HC0A 4QHKI 1YQVH 4NHUA 3KLAA 4OB5L 5LGJB 4PRNB 3U0TB 5C0BB 2JJSC 4CJ1A 5JR1H 1AKJD 4JDVA 4BFIB 2M1KA 1HQRA 4GRWB 3RJQB 3DMMA 4ELMB 2HT4C 4TTDD 2YA2A 7CGTA 1T5XB 5D4QA 5GRVK 1X5KA 4YHLL 1NCAH 3U4BL 3TYGH 5JNYA 2ZCKL 4LSPH 4Y2DC 5IMKB 1EGJL 2J4WH 2VLRE 5KOVC 1G7HB 1G9EA 1YDPA 5EU6D 5DMKB 4K3EH 4MD5A 5ESAA 2MJWA 4G9DA 4I0PB 5FK9A 3CVHA 4N8PA 3MYZA 5HYQB 3OKKB 4JQVC 1MFCL 4U1MA 2R0LL 1H0DA 1JF1B 1MCPL 2WUBL 4KRPB 3S8WA 4BH7B 1BJMA 4M02A 4JREB 3U0PB 1HH6B 1DLHA 5TF1L 1HXYB 2IANA 4J8RB 3Q6GH 2VLRA 4KJWC 3TN0B 1N5AA 1MAKA 4Y16C 1MCOL 4PLJD 1KCVL 2CKBB 3F7YA 1UYWL 4WWKD 1RIUH 2V7NB 8FABB 3NCYS 2EYRA 2X09A 3AS2A 5KSAA 2JIXA 4W70A 1MQKL 4XVSL 4BSVB 1WZLA 4I0CC 3B43A 1I7ZA 3HUJE 2CLRA 2CO7B 3HC4L 5DUMH 2NXYD 5M95B 4GKZA 2P45B 2R1WB 2Z8SA 4XWGL 1QPXA 4YZFE 5EOCJ 5ETUA 4U1HB 1DVFC 2QQLL 4N8CH 1U8KB 5EZOH 5KSVA 3VI3E 4ODVH 3D9AH 3OKOB 4PG9A 4JHBA 2AEQL 3IETA 1FP5A 1CCZA 1K8DB 1W2KT 1BVKA 1JPGA 1RZ7H 1XF3B 5M94B 2X4UA 3RUGA 1JGLH 5IHBA 2H6PA 4HKBA 4LRNL 4O02H 1CD8A 2VDLL 3BOVA 3TCLA 4PJ9D 3LRSA 5KJRL 4PGDA 5HGDA 1R3LA 2A73A 3TBVB 3JTTA 1A1NB 2YC1B 3FONA 3ULVC 2NXZD 4P2RB 1X4XA 3DXAD 2VLKD 3KXFD 2HG5B 1HKLH 5KSAD 3U2SA 4PRPE 4L5FL 3NA4A 4HC1L 2KKQA 2ZOLB 4LGPB 3AREB 4NOFA 1IMHC 1QLEL 3NH7L 5EC1A 3TFKD 5D1XB 4XNMB 3V0WL 2C3VA 1BWWA 4W81A 3W0WB 5CD5D 3MACL 5JQ6L 4Y4KD 4M5ZL 4R4FL 4MDIA 3MJ9A 1NAKH 5FA3A 3GEWB 5F8QC 5F1SA 4XP5L 3ARXA 4O2FB 4KDTC 4Z7OE 4AEIL 3DYOA 1YQ2A 4WDIA 1J18A 5IVOA 2BSTB 3QUMH 4JKPH 2W60A 4ZFFB 4CVZA 1KCRL 3RWJB 1G7QA 1HQRB 4XCYB 2GT9A 2NR6D 5IFAL 1NFDE 2YZ1A 4Y7MA 1AI1H 4G6FD 4YHIA 4JFPA 3P30H 3H9HA 4PJ9C 3CXDL 2EDRA 4U6HB 4CU6A 5HYFA 4PREB 1GOGA 1H3WM 3C6LC 2EDYA 2ARWA 4G6JL 5C9KA 2VDNL 3ZE2E 2B5IC 1YA5A 3UPAA 1RI8A 3IT8D 1S3KH 2R69H 4RZCA 5IB4A 3I6KB 43C9B 1OQXA 5JHDD 1G7HA 1TJIL 1FZMA 2FEEL 5J6HA 4L4VE 5FDYA 1ZLWK 4B7IA 3WHXA 1PG7H 3SGEI 1FO0A 1KLGB 4NO3A 4Z5RA 1MRCH 3U9UA 4HGMA 1INDL 4LLQA 2P5EB 1GOHA 3MRGB 3O0RL 5F70A 3VXUD 1XAUA 3OKKA 4XPBL 4EDXA 1H3PL 1VEOA 2NY2D 5F7DA 1IGMH 2WQ8A 4WI4A 5BJTB 3HI6H 1QKZH 3OKLB 1K6QH 5DZOA 3UO1L 1NAMH 2LV4A 1C12B 4Y4FA 4OUUA 1H3UA 2EZ0C 1N59B 1OP5K 3LS4L 1AE6H 3MRKB 3L3GA 4P5TA 2FHFA 3N0PB 3QEQB 5T3XE 4H5SA 4X9HA 4M7JH 4Y4FC 5JOPE 3DX7B 3JUZA 3D18B 1FZOA 1NMCB 5IKCA 2AK4B 4L3EA 3U4BH 1YJDL 2BVPB 2CSPA 2FECI 3VGBA 4P2QB 3PWUB 2XICA 2X9YA 3NIFE 2H26B 4U1JB 1EAJA 4QRPB 5E5RB 3UTOA 4P5MB 1OTTD 3JWDH 2GYSA 3MUJA 1CF8L 3U4AA 1Q0XH 1TVHB 4F37K 4JO1L 1QQDB 2A83A 1G6RB 1KSRA 4EN3B 4Z77A 4WU7A 3CVHH 1C5CH 2IPTH 4PJ5D 2ITCA 3MLRH 3RUGF 4AM0B 1KN4L 1NPUA 3RL2A 4I3SL 5CBEB 1ZT1B 3DVIA 3S5LB 2I9LB 3M17A 3LRSB 4KQ3L 4ISVB 4MB3A 1QNZL 3RTQD 3GSQB 5I15L 1NL0L 1F58L 4ZNCD 4EN3D 3JSSA 4FFZH 2UYLB 4X7TB 3QIBB 2NYYC 5IB5A 1YEHH 5DRXB 2BFVH 5AAWA 4OCLC 1C8PA 5MHSE 1WCBB 1RZ8A 1Z0MA 3OR7B 4X80H 2QHRH 4O5LL 5DJZB 4LKXA 1TQCC 5CJOL 4APQB 3GSOB 3MLWH 4WI6A 4H1LH 1H9VA 2NTSP 1ZHNA 3LKPA 1V7MH 2PXYD 2G75B 2ZSVB 5T1KB 1BQHB 3SDDA 3TBTB 3ULUH 2AJUH 3BIKB 3C5ZA 1S7XB 1ZEAH 4GQ9H 2D31A 4G9FE 4ZUVA 1QRND 4UZGA 4OV5B 1WIPA 1VADA 2BFVL 3SJVB 1EEYB 5HHPB 4RMVA 1QR1A 2BSTA 1VENA 2GCYA 2DWDB 4P9HL 1F00I 5IG7B 1AD9A 1T89C 1UM6L 3MLXH 2Q6WA 4CVZB 3BXNB 3GSNA 3QO0B 2J8OA 2DYPA 4XBGB 2CR6A 2YEZB 2YD2A 4HAGA 2D9CA 4K94L 1FO0H 5EIVA 4KUZL 1NUFA 3FB7B 3SDAC 2DM7A 2FEDD 1V3KA 3RPIB 4Y4KC 4PJEB 3H3BC 5LGKA 4Q6IA 4RQQB 4YFLF 4M7ZB 4MNGA 1AJ7L 4PV8B 2UUDH 3WNKA 1HZHH 2R1XB 4R4FH 1FL5B 4WW2A 4GAYB 3KNBA 15C8L 3MPCA 5D1QD 1X5AA 1KLGA 4Z5RB 2HT2C 4JPWL 2ZNXA 3BPOC 2F8VA 4LLUB 1RJZB 4NZJA 2FX7H 2Z31C 2V6HA 2YD4A 1T2QL 3L3HA 3NZ8A 5HHXH 3G04A 1MEXL 1ZMYA 4MJID 4RAVA 3QPQD 4IOFD 1AO7D 2YXMA 5F9OL 1TVBA 1T22A 4RGOL 2C3XA 1XF4A 2CIKA 4PJXB 4ZNEA 1Q1JH 2FJGA 1J0IA 1E6OH 3ARVA 4RISL 4L8SC 4NQTA 3UTPD 1AJ7H 4QRUA 1N6QH 4FMKA 2IQAA 2XTJB 1LP9B 5C07A 3GO1L 1CD0A 4N90E 1Y0LA 4BK5A 3DHMA 3QEQA 1DBMH 2Y4SA 5TE4L 3WFZA 2FH6A 2XXMB 3IDUA 4DGVL 3MNVA 3QUMA 5HTSA 2ZUWA 2DQFB 4HC1A 1HKFA 4JHWH 3BEWA 3HE6B 4HBCL 2VZUA 4NZTL 4P2OA 4DOHE 2DYPD 1WQVT 1NC2A 1MNUH 4RWHA 5HHOA 4ODUA 2AJVL 5EBGA 4W6YB 4AM0A 3MCKA 3TT3H 2PYFB 3Q1SH 3UTZB 2R2EA 4UT7H 3RWEA 2GSIB 3IU4L 3N1MC 5HSFA 1G6RA 1U0QA 4HJ0D 5EN2B 1NAML 1NDMB 5B39G 5JIKA 3SO3B 5GGUB 1AIFA 1T66D 5DC4B 3P11H 1GRWA 3T3PF 4PJ8D 4L4VB 1D5MA 4JB9L 3W11D 5T5FH 3TBYA 1CXLA 2UZXB 5DRXA 5AUMA 5CUSH 1PG7L 2FD6L 2IGFL 2FEDC 4LDEB 4PRNA 1KN2L 3BQUD 4OCSH 5J1SC 2JJTC 4Y0GA 5HPMA 3C6SA 3QXAB 1K4DA 4F8TA 4MLIA 5I1LB 5KZCB 3C87A 1MPAL 1N3NB 5DJZA 5BCAA 3NIDF 3WFHA 3BMVA 4KMTL 3LV3B 5CZVH 5JPNA 1HINH 5E5MB 2BC4A 5E2UH 4GSDH 2O5XL 4IIQB 1WISA 4P57B 1K4CA 1T5XA 4CN1A 1WCBA 5D7JB 1BQHG 4M6MH 3RWCB 5IMOB 1B0GA 4XP4H 5C6TL 3UBXB 2HJKA 1J1OH 1NAKL 3HNSH 4ELMF 3KPOB 1S7XA 3P2TA 2WUBH 3QXUA 1OWWA 1V5JA 4PJGB 1K8IB 4F58L 4X8XA 1KNOA 4OLUH 2NX5A 4ZAKA 2XY1A 4OM0H 3MRFA 4R7DA 4P4KC 1F4XH 4OZIF 1NC2D 2Y6SC 2Q3ZA 5HHPA 3ETBF 3IAPA 1HWHB 2LFGA 5CZXC 5DJ2B 4DVRL 1SM3H 5ENWA 1MHCB 5C09B 5DT1H 2VZ1A 3U0PA 5MERA 5ESVA 3MXWL 5DK0B 3VWJB 1BZ9A 1HNFA 4KAQH 3F12A 4NN7C 3QNYA 2R0WH 1UVQB 3OF6D 5FGSA 2M2DA 4MXWH 5CEZD 5IB2A 3FMGH 4TRPH 3WO4B 5IFHL 4PY8I 4IRZH 1U3YA 4HIXL 2YEZA 5BO1L 3QO1A 3MXVH 5DD5L 4TQEL 4MD4B 3HZKB 1UT9A 2C1OA 5C09D 4J7RA 2YRLA 1LGVA 3SE9H 4NNXA 1DQML 1YMME 2I9TB 4PJXF 4KC3B 1LMKA 2OSLB 5DWUL 3EDKA 4MJ6A 5IW6B 2WBJA 2YPVL 4GMSH 2XQBH 3FZUD 2OK0H 3QG6A 2QJDA 3UO1H 1CDHA 2DLTA 3U7WH 3IGAA 1TJGH 4ZG1A 1WWCA 4ZPTB 1ZVSB 4QY8B 4LLUA 2PW2A 4FNLL 1JYNA 3I2CL 4LLYA 4FQHA 4RMUA 3JV6A 4F7EB 4F3FA 4QTIH 3CMOL 3DROA 3TZVA 5ADOH 1T22B 1IQWL 4GXVH 1QBML 4XPAL 3H3KA 3L3KA 3L3JB 3WDJA 3KPRA 2VL4A 4XXCA 3V6ZB 3ARZA 4YBLC 4OSUL 3CSPA 5IIEA 1S7SB 3MNZB 1UFUA 3QXTA 5DJCA 4PJIB 1EERB 1LEIA 5FHBH 3SKOB 1QHPA 3G9VA 1SQ2N 2GQHA 1AO7A 5JW4N 1PG7W 2MSPA 4OFVA 4BH8B 1NFDA 1VEMA 3C6LD 5KG9A 4X80L 2R0LH 4ZAKC 5D8JL 4JANA 3GMLA 3BT2L 4YPGA 5IHUL 1FH5L 2VLRD 5DHVA 3LIZL 4HK0B 2Y06L 1KJ3H 3DBXB 5ITBL 1UG9A 3ZTNL 4NKMA 2H9GB 3IDMA 1T0NA 5EN2A 1ZTXH 1KLUA 5I1IL 4XBEH 1ONQA 2FCBA 4UQ3A 3MGTB 4BSJA 4NJ9H 2YD1A 1FVDB 3T0XA 1CE6B 2YPVH 1D5MB 4IOIA 3PV6A 2HVKB 3CPLA 4M5YH 2DAVA 4QRSB 1VKXB 2E8YA 4ONFH 4H20H 5EOTB 4RAHA 4M3JA 3IJSA 1A9BA 4N0FB 1XFPA 2MHAA 1OTSD 2X42A 2PXYB 4JZJB 1MH5B 4I48A 4K7PY 4PRBA 2OTUA 5E5MA 3OG4B 4RRPA 4JREC 1GZQB 3GMRA 3HZMB 5D7JA 5C0BE 1HDMB 3L5WA 3ULVL 5KVMC 2X5PA 3VFRB 4YFEA 4PGCA 4LKCA 1ZK9A 5H94A 1F97A 4NQDD 3AAZB 3ARGD 1SEQL 1ZSDB 3ZSTA 5KVFL 2HVJB 1JPSL 4Y1AA 5GISL 1PGRB 2VDPH 4QGTA 3DRTB 3QUKA 1DFBL 1XF5B 1JZ2A 3G5YA 1FZKB 5MEOB 2W1NA 1F6FB 5CJBA 1CXFA 1CU4L 4F8QA 2XZCL 3QEGH 5ENWB 1P5VA 1FO0L 3LN4A 3BUYA 5AYUL 4OGXH 4U0RC 3PWNB 3GSUB 5DQDL 1ZHBA 2V5MA 3C8KB 1IM9D 2X1PA 1D5XA 1CVSC 2EYTB 1P4BH 1EJOL 5D96C 3WKML 4ZTPH 4LAJH 4PBXA 3W81A 1HYRC 3QQ9D 4PYGA 4G42B 5D1QB 5T1MB 3QP3A 1MFBL 1MIML 5T1DL 4UOW0 4R26L 4OZFA 1FAIH 5DGRA 3UZVB 4X0KA 5DMYA 4JPKH 4WI8A 5KSAC 1PLGL 1QBAA 4U1LB 1TIUA 1OGAB 2AK1L 3LZFH 4KI5F 4QYOA 2PW2B 1S7RA 1F90H 3KYOA 3TBSB 3F58H 3GB7A 4HGKC 2XYCA 2XPGA 3NN8A 1AY1H 4NQDE 2NXZB 4XPGL 1JHTA 5EFIB 4KI5D 5DHXB 3EOTH 3SKUD 2OBGA 2Q7YA 5FV2A 3OZ9L 3UPRB 3MRBA 2HLFD 2BNRA 1KYOK 1BFTA 4X4XA 1UCBL 1JMZA 4PY8J 2NY4D 3SDXA 5EORH 4JQIH 4DFIA 4E0RB 3VD7A 1ZE3C 3AREC 1SEQH 2OR7A 1MRFH 3BGAA 3MRPA 2WV3A 4Y2DA 1SYSA 4JM2A 4KGJA 1E4JA 5EUKB 3BD4A 2Q76A 1GGBL 4TSBH 3ARDC 2VERN 2WW8A 4LMQE 4X7TA 3FZUC 1C08A 1Q9KB 4HUWA 3B2VH 1IC4L 1X44A 4LSRH 4RMRA 1R3KA 4HIHA 4PJIA 4OQ1A 2FECL 2HFFA 3G6JA 3GZKA 1QYGL 3C2SA 3OXRB 4UIMB 2XFXB 4PR5B 3AY4C 1JFQL 2GJZB 2ARJA 4UAOB 4PJ5B 3BKJH 1AR2A 3UJIH 4Z7VF 4DVBA 4Z8FH 4X6CE 3GSOA 4U7MA 1I8IB 1MI5B 2VQ1A 3MUY1 4NKDA 4PJAF 4WEMB 5DD1L 3RDTC 4QXGH 4ODTH 5BS0A 3QJHA 3DBXA 3F5WB 1WCQA 5SV3A 2B0SL 1AFVL 1EFQA 3IFNH 4MD0B 1U8JA 1J0ZA 4WHDA 4U3XA 5MHSD 1KB9K 3RDTA 3QRGH 4GLRH 4X7DC 4XP1H 4MQ7A 1CDUA 1BFSA 4GMTH 1FG2A 3V0VA 3V6BR 3VFOA 2H8PA 4Y88A 3PNWA 3VMOA 5EOTA 5BRZD 5EA0L 1RZ7L 3VGFA 2G5BB 4DEPC 3FQXB 1MWAA 3OQ3B 4Y5VC 1LQSR 3DSFL 4RNRA 3CFJA 3B9KC 5IG7A 2ZPKL 5F89A 1DN2A 1TZGL 3OJDB 5ESAB 4HT1H 2HJLA 1EH9A 3BN9C 4RFEA 4PJHE 5C07E 2CGRL 3GHEH 5B39A 4MZ3A 5F9DC 5DMKA 5E8PB 1P2CB 4KVCL 3S96A 1B9ZA 1DLHB 2RJMA 4Q6IB 3X13A 5A40E 4YC2B 5DJDA 3CVHB 5DZLA 2GK2A 3I6LD 3S7GA 1IFHL 4R0LA 3HMXA 2EYSB 5BW7C 5FKPB 3SDDC 3ULUF 3CLFH 3F7YB 4N90D 2DQGL 1UM4H 4RFNC 1ND0B 2H41A 5CILH 2F15A 1EJOH 3O3BA 1OAQL 2R23A 4S0TD 4YXHL 2RIKA 1FVEA 4WHYG 3ET9F 4FNLH 4QOKA 3MODL 3ISWA 3T1FB 5D2NA 4QHNB 1YEIH 5AYUH 2B4CC 1F58H 5FGRA 1A5FL 3KLSA 3FQNB 1OM3L 4EN3C 3WIHH 2XQBL 4P46D 1Y0LB 1KB5A 4OCWL 3BWAB 1XGPA 4KTEH 5HI4D 3UYRL 3X14B 2JTDA 4POYA 2X4QA 3RAJH 1UJ3C 2MQ3A 1ZLSL 1XH3B 4MSWA 2NY0D 3DIFB 4S1DD 2E6PA 1XCQB 2YPLD 1MREL 3HN3A 5E8NA 5DYOA 3GSNL 4ODUB 3R8QA 1ZLWH 1WAAE 5C0JA 1S7WB 4HIEB 3O2DL 3FHQA 1K5NA 3SDXB 4LASL 4PRAA 1OHQA 1N8ZA 4WJ5A 4NQEE 3SDXF 3MCLH 3IXAB 3RGVD 1TTGA 3VRLE 1WGOA 4PRIA 1C5BL 4XVTL 1YQVL 4X8JA 3NTCL 4G6AC 5BRZE 2VXTH 3QDAA 4G9FD 1NEZG 3MRJA 5C86A 1NUDA 1A22B 2Y5EA 1WLHA 3MJ8B 5AUMB 1KFAL 4FTVE 5FO8A 3G6AB 4WV1C 3HR6A 5I1EL 1JTOA 3C60D 4CNIB 4OLVL 1F3JA 1CWVA 5KSBF 5HVFB 4P9HH 3F6IA 4Q2ZB 1G9NH 5KSBB 1D6VL 5FA4A 4K94C 2BX5A 5GSRA 1N0XH 1NMAH 2AEQH 4GFTB 1S5IH 1U8JB 4JVUA 1S9WB 1WZKA 1AGDB 5C0IA 4TOYH 2YD8A 2O5ZH 2BVTA 4BM7A 2W60B 4XPGH 3VWJD 1NCBH 1MI5A 1J5OH 1S78D 2K1MA 4WTZA 3QUYA 4JZOB 5HHVH 3WBDA 5MEQB 1U93B 1PLGH 3H3PL 4XZUA 5L7XL 1X9QA 4XBPB 4P59L 3B9DA 1U8NA 4LPXA 1AHWB 3P0VL 4OCXH 4NWTH 4Z7QF 1UEYA 5HY9B 5D93B 5GS1C 4PJDE 4JY6B 4HPYL 3DMMD 3BPOB 1KTLA 1C1EH 1L0QA 2D7OA 1S9KC 2Z31B 2DF3A 1AI1L 4JFEE 1ZA3B 3U9UB 1F4AA 1CT8B 3MLZH 1KJ2L 5EBMA 3BN3B 3QO1B 1MJUH 5E1AB 1TJGL 2MWCA 1FL6A 5HBBA 4N0UE 3B9AA 3MACH 2F53B 3VMPA 4X4ZA 1X5YA 1KFAH 3PWLA 5FHAH 1QA9A 3H7BB 3G9AB 3EYVB 3WN5A 1CZ8L 2XTJC 3OB8A 2IBZY 3BGFC 2IH3A 1FORH 1FVEB 1MAMH 4U1IB 4NNPL 1L0XA 4GMTL 4ETQA 1A6UH 3C2AL 1CN4A 4J12A 5DD0H 4MJIA 4NN5B 1YEDB 4GG6A 2CIIB 5FB8A 1N59A 2XWJB 3Q0HA 5GGVL 5LQBH 1G6RH 1DE4B 3BN9D 1R5WB 4OUOA 4QTHA 3L95B 4E41B 3K80A 3MV7A 1MVUA 3V7AG 4KPHH 1T2JA 2B20A 5DR5L 1RK1B 3GHBH 4NFBA 2VR5A 3ZKND 3PL6A 3VRIB 5EU7E 4L4VD 1EO8H 4JFFB 2PCPA 1CZ8H 5JHDE 3SGDI 2KH2B 2ITCB 4OCWH 4YDVA 2X4QB 1CDIA 3G5VA 1QPPA 5F7EH 1BBJA 2C3WA 4F7PB 1TVHA 2JELH 4K8RH 2E6QA 3RBSA 3VFNB 4R4ND 4GUPB 1J0HA 4BFGA 3OV6A 4OI8A 3WMSA 1B6DA 5F88B 5AAMA 4XP4L 3O8XB 3ULVF 5H37H 4XRCB 5EORL 1R6VA 4X6FB 5DJ0A 4UNVA 2D4FA 3DVFA 4LVHB 5FYJH 2Y6SD 2CQVA 3ZYJA 1CFVH 2HKFH 2EH7H 1KLUB 2ZG3A 3SKJH 6FABH 4YDIH 1RZJC 1VFBB 5L88L 3FT2A 3QFDB 1FVDA 3LN5A 4HZAA 4ZO6A 3I9GH 5IB1A 5IF0A 5D71L 1BF2A 3K4DA 4HCRH 3CPLB 2WINB 5L6YH 1UXWA 2DQEH 4RGNC 4N8VG 1LO2H 4CGTA 1B3JA 4HX1A 1A7QL 4DAGH 3U46A 2Z4QB 3V4UL 2DMCA 5EZLA 4I13B 1CDGA 1PQZB 2NW2B 2P8PB 2FLRT 1TZGH 3C60B 5F21B 2BNQD 2YN3A 3QQ3A 2NY0B 3ZDZF 2FH8A 4B7LA 1EK3A 3UAJC 1U2HA 2JE8A 3FOMA 5HYQA 4CJ0A 5CEXA 1QFHA 1DSFL 1KIQA 4U1MB 4NZTH 1GC1L 3WO4C 5C8JA 1S7VB 4HJJH 1NL0H 3IFLH 3VXRB 2W07A 1V3JA 3W9DB 3G5XA 1AD0B 1OGTB 4R2GB 1QR1B 3UTSA 3AS0A 3PWVB 4U33A 3RPIA 4NN6B 2NW3A 3MC0A 1ZT7A 1T1ZB 1MFAH 3MBXH 1KB5L 4Z18A 4YHLH 4HIXH 4MQXC 4J3SA 4JO4H 1TFHA 3DSNA 1MWAH 4M03A 3HUJA 4YBHA 4LBEA 3KPRE 5GIRA 5JIHA 1LEGB 4AT6A 1QSFE 4U6YA 3PP4H 4X6CA 4U1SB 2HWZH 3U9PH 1OQOA 3I3DA 2FX9H 4FQ1H 1V05A 1CFSB 2DLGA 4PG9B 3VXRE 1L7TL 1XF4B 4PJXA 5I8EA 4FXGA 1QFWH 4ZO8A 2CIIA 4DKFH 2ZUYA 3OMZA 4N0RA 3NFNA 4YHOH 2ZCHH 2UUDK 2FB4H 2SEBA 5D8JH 4Z95L 4ETQB 5EFIA 1D5BB 3GNML 1JE6A 1LO3L 3IDXL 1ZWIB 1OAUL 3O3AB 4XMKH 2AABL 1BIIB 2A38A 3G6DH 3B9VA 1LP9A 4XAWH 5CS7A 5D1XC 4F7TB 3HE7D 1JPTL 1HIML 5E2UL 3MBEC 1Z3GH 1C16B 1QHOA 1NGQH 2FWOB 5IQ7H 2YD7A 5J06A 1T83C 2KPNA 4WEBH 1EAPA 3ARGA 2Y72A 1E4KC 4F33A 2HG5A 1MHPH 3BEWB 3HE6A 5DK2A 3MA7A 4MWFB 1F45A 1OB1B 3MSPA 4G8GD 4XWOD 4N9OB 1NCDL 1AXTL 5L2KB 4EDWL 5EC1B 1GH7A 3KGRA 4XMKL 4CMMB 4L8CA 4PP1D 4IMLB 5DC9B 4JM4L 1M7DB 1NEZB 3HKFA 4RA3A 2OK0L 5CFHA 3DO7A 3FFCD 3QJHB 3IDIA 1RIVH 4L4VA 2ADFH 2QQNH 5IF0B 4P23D 4GS7C 2B5IB 3VXPB 4HULB 1VACB 4OD2A 5FYJD 4MVBD 5JDSB 4XMPL 1VGKA 3KPNB 1ZA6A 1UACH 4Z7VB 1P69B 4LLDB 1RZKC 4PJFA 4L4TE 3KXFE 1NC4D 1FJ1A 5IMOA 4P2QD 5IOPB 2GT9B 4HX1B 32C2B 5E2TH 4X9BA 1A1MB 3WFHB 4AMKH 3FFCB 1JZ4A 1F8TL 4CRPA 5IMLB 3KLDA 4R7DB 3NCCB 5HDBE 3QQ4A 2HH0L 1E6JH 2J5LB 3SPVA 1QRNB 4KROB 1NC4B 4NBXB 3A6CH 1BD2D 1DTUA 5FYLH 4F2MA 5C09A 4URTB 4C55A 1H3XA 1M4KA 4LFHG 3FRUA 2APFA 5J56B 3OBAA 4JFYA 1TZHA 3OL2A 5DD3L 3LSOA 4JPWH 3ZSSA 1OT2A 2VH5L 15C8H 1LNUB 2FBOJ 5D1XD 5K59E 3HNTL 5DVLA 4OBSA 4HWZB 4Y1AE 1SM3L 1XCTA 8CGTA 1J8HE 1TQBC 1T20A 3ZTNH 4BQ9A 5INCB 2NY1C 1YNTB 1UZ6E 5C7XH 4NQCD 5D2NB 2J6EH 2ZOKA 4P9HC 5E99H 4Z7NF 4U1NB 4NSKB 4JRXA 1PYWA 3L1OH 5J0BA 4PJDB 5IKCB 1J1OL 2NXZC 4FZEL 1AGFA 3LPWA 4P2QA 4U2YA 5H2BA 3TH2T 4MJ6B 2NY2B 1ZV5A 3FQWB 3MOBH 1ITBB 1JPST 1KBGL 3V4PH 3UTTD 1ADQL 3QG6B 2VDOL 1G7IB 1EHLL 3WEXA 5CD5C 4M1GH 2FZ3A 3QIBC 2BRRL 3D39D 4ELKB 1CLOL 4EBQL 1PX3A 4MXVE 2EDNA 1BIIA 4X7FC 1A2YB 4G8FB 3FO0L 3MFFA 3S5LA 5ANME 1LP9F 4PV9A 1QSVA 1S7SA 3MNZA 4ZS6D 4UOJA 1LEIB 4L8BB 4BQBA 3GJFB 4NZRL 5KSBE 4WO4A 4JFFD 4Y19D 3C5ZC 3ARGB 5CZXD 4XCEB 2LVCA 2DQIL 3WJLC 2EDKA 5T3XL 4K3EL 5I6XB 1CQKA 1XGQA 3K2UL 4HK0A 3DYPA 3ZE1E 2NY3B 4FTVB 5JORB 2JK5B 2AXJA 4WWKB 3U1SH 3BD5A 1CK0L 4J23A 3V0WH 3SGKA 4UQ3B 2W91A 5GGTH 3LKNA 2N4IA 5L2KA 2YRZA 3VXNA 1CR9L 4XTRD 2X2YA 4NQEB 4IRJA 4JGMA 1DQTA 2EC8A 2VLME 4G43B 4OLZH 4C57C 4OBRA 2K7PA 3KPNA 3TN0D 2C7UB 3BZFB 1MFNA 5EOCH 5F7LB 1DBAL 3IJHA 4IMKC 4GKNB 4Y4KB 5I1GL 1I7UB 2WIMA 3D39A 2OR8A 1CICC 4PP2B 3MRRB 1D5ZB 1EIBA 5I1HH 3NCBB 4Q6IC 2VDLH 4PRPD 4MNHB 4UNTA 2PN5A 4Y16D 3UJJH 1NANI 4WTXA 4TNVK 4Z7UB 4N0FA 2JB5L 1QRNA 1K2DA 2EIEA 3JBG7 3ZDXE 3EZJB 2G60L 3FFCA 5DJAA 5B4MD 3DV6A 1MLCB 5HI4C 3FAXA 4MLSA 2P42B 2YPKA 2DQCL 1IKFH 1A4KB 3UBXI 4P99A 1H15A 3BKCH 4YHPA 1AKJA 4PJBE 3L6FB 4TSCL 3W5MA 12E8L 3CFBB 3SGDH 1QEWB 3LN4B 4TTDC 5CP7B 1HQ4A 5L6YL 2P5WD 1T0PB 3LQMA 3UTPE 2YS4A 2X10A 4ZS6C 1ZLUK 3UTTE 5K9JL 1HXYA 4MZ2A 1AQKL 3SKNA 4TUOA 2FJHA 3G04B 4ZQKA 1HNGA 4I9WE 1G1YA 1KGCE 3ARFB 1G7LA 3L9RA 1TJIH 4JE4B 4ZFOB 3Q3GB 4ZOBA 2Q87A 1XCTB 1BVLA 2QHRL 3KJ6L 3TN0C 1ITCA 2NX5E 3MRDB 3OGOE 1XGRA 4QT5A 3L3DB 3ROLA 2B39A 2GHWB 5E2VH 4JR9L 2MCPL 2A0LD 1V7ML 2D0FA 3ZHKA 1AR1D 3RI5K 3QCVL 2RAMA 5JIPA 1I9EA 1OAUH 5DJXB 5B8CC 4QYOB 5EIIA 4LOUC 2ZJSL 3QZWG 1FPTH 2J6EL 1RURH 4X4YA 5J13B 2BVOA 2PYED 2LVEA 4HS3B 2F54D 3G5VB 4ZD3H 4NUJB 1ZOXA 4CKVX 2YD3A 5JXAH 3BAEL 5SV4A 4IRSA 3R06B 1RUAL 4Y19A 2E7LC 2PNDA 3D3VA 3ZE0E 1RFDH 5ID1A 4XNQA 1FL3A 3WFCL 4M61A 1QNZH 4MAUL 4YGAB 5D7JC 5FF6A 2CDFB 3BESR 1WICA 1UQSB 2IC2A 4ZODA 4GW5B 1CQYA 5GGVH 2UZIL 3FJTA 3TZVC 3VRJA 4YAQA 2UWEF 3S3PA 2IPTL 3OTTA 3GMPB 4LSSL 4UT9H 4UIMA 5EUKA 5IV2A 3VMNA 3ARPA 5F7UA 2L0DA 3FQUA 4M5YL 5HHNB 3T2PA 1VPOL 4KI1A 2VB5A 1I8IA 3JUYA 4OM0L 1Q8MA 5FYJE 3WIHL 2O61B 4MD0A 4AIOA 2ARJB 4WEUD 1FIGL 5BV7L 1A1OB 2A9NL 1K8IA 4WI7A 2C7UA 5F3HA 1AHWC 3OKYA 4YHNA 4JPIB 4DKAA 3F5WA 1KV3A 2AV1A 5H37G 1MCRA 5GS1B 1B4RA 2VISB 3D39B 1GJIA 2WBKA 2EKSB 2QADB 3KPSE 4JPKL 5C8JB 4FZ8L 3KYKL 4LVEA 5CEYA 1QBLH 3OB0H 3OJDA 3NFSH 3S4SB 2Z35A 4PJAB 4EI5C 2VIRA 3PL6D 5MERB 1KBGH 2YPLB 3CH1A 4MCYB 2YWYA 1K2DB 1P1ZB 5FGBA 3BKML 1T04A 1IT9H 2DKUA 1MJ8H 5DUML 4KROD 5A3ID 2OJEB 4YZFF 3MRMA 2DN7A 5J7CC 1GOFA 4MD4A 2I26N 4XTRC 4AJ0A 1I3RB 1LD9B 1DFBH 3EO0B 3IU3A 4MJIE 3QUZA 1FO0B 2DM3A 4AEIH 3H0TA 4KZDH 3CFCL 3P4NB 2G60H 4HD9A 5F1NA 1KPUA 3AB0C 5IROC 4EVNA 3X12B 3GDBA 3CVIH 2OL3B 4WGVB 3CFBA 1IAMA 2H2SC 2JELL 3QRGL 3RNQA 5I8EB 1L9NA 4GRLB 4TNWK 1R0AH 4PJ7B 4Q9QL 1ERNA 4X83A 4K3DH 2VLJD 4PJ8C 4N1CA 2WAHA 4IDLA 3EYUH 3ZYZA 3SOBH 1I85C 2PTTA 3QQNA 1G7LB 3DWTA 5J11C 4ODWA 4UT9L 3VI4F 4LRIA 3UXFA 5BO1H 4AG4L 2F54A 4FQXA 3TYFB 2BNQA 3O3DB 4PB0L 1FVCA 5C0NC 2XT1B 3VFTA 1F2QA 1DANT 2FX7L 2W0KA 1WFNA 5MP6L 2R4SH 3CDGB 2FIKA 3HR5A 4DCQB 5E8DL 3KPMB 3LQAC 5FUOH 3L7FB 1AH1A 2VDKL 1MJJB 4FP8L 3L3IA 1ZTXL 4OZGB 3O3EA 4YHYB 1Q72L 5EU6E 5CSZB 3VDCA 1N26A 4X6BA 5EUOE 4ZUUA 5IVXA 5I2IB 4KK9D 3WKNA 1S7UA 3K4AA 3VXOA 4DTGH 4OD1L 4M7KH 4RGNB 4HK3J 3G5ZB 4PLKC 2R0KL 1ZVHA 1F4WH 2XTLA 2P1YA 5C0AA 2WP3T 4Q0XL 1OW0A 1V8HA 4I5BB 4R7NA 3QEHB 5TQ2H 3WXWL 1GGCH 3NPSB 4LAQL 4PJFB 4LEXH 3FB8B 4Z0BL 2GTWB 3KR3L 3SE3A 5GPRA 1A9BB 3HNVL 5FO9B 4DKDC 4HG4K 4YQXH 5CMAB 5HXMA 1INEH 2EDTA 5MENE 5DSCB 4HQQH 4PGEA 5T5FL 3MUGA 3U83A 3Q6GL 1LK2A 4OGYH 4YIQB 3MLUL 1BQHA 3L7EA 4U0RB 2MMXA 1LVEA 5C0IB 4PGCB 4JDZB 9CGTA 5L88H 3MJ7A 4AL8H 3ILQC 4HPOL 3ROOB 3HAEG 4LARH 2EDFA 4M1CD 1U3HD 5JPMA 3TT3L 2OL3L 2LABA 4OFIA 4LLMA 5D1QC 3TIDA 5E7BA 3JWDC 1MELA 1WZ1H 2M26A 4EUPA 5BS0E 1C5DA 4LEOA 5C08B 3PWNA 1YMMB 3DUUA 2LTQC 4HLZH 5JOPD 1T20B 2F8XC 4NM8L 2BHYA 3B9KA 1HCVA 1OD7A 5GGRY 1VPOH 2ZSWA 2EDOA 4JFDA 3C5ZD 4YFDB 1QLFA 1DLFH 2HFEA 4KRLB 3IRZA 1DL7L 4ZDHA 1BD2B 4APQD 1Y6KR 1KPUB 3O81A 3OKEB 3I84A 3O45A 5C0FA 3VXSB 1U6AH 2VAAA 4NKIL 1YMHB 4NZDA 3WHE1 4ONHA 5DC0A 4GW1A 3RFZC 5C09E 4NDMB 2NY4B 3M1BB 5DJ8B 3LKSB 1QBBA 3MRLB 1P7KA 5C70A 2HMIC 2DQDL 2EXWD 3MBEB 4Y89A 3RGVA 4OI9A 4U1IA 1I3VA 3UJTH 1WFUA 4XNYH 2I5YL 4P5KB 4OQTH 4YLQT 5IVZA 5HYJB 5BOZG 5GS0L 3MV7B 2BVEA 3ILQD 1MCFA 1SVCP 2BNRB 4KDWA 3RTQB 4RGMC 4KKCC 5I1AB 1VESA 4HPYH 2BNQB 4FQCL 3HG1E 4GRLD 5EUOF 5ICXB 1J11A 1PKOA 1RURL 4XXDA 4BKLB 2LQRA 3VU2A 2X70A 3MNVB 3S97C 3BI9X 1MJUL 1IEHA 1RK1A 5F6HJ 2FRGP 2P24B 3MRHB 4QO1A 5BXFA 1UXSA 1W0VB 3WFBL 4HSQA 3S35H 1LO4L 4X5WA 3RGHA 2H2SD 4HLZG 3MR9A 5I8CA 1P7QB 2X1WL 4M48H 3BRFA 4Q7DA 1VCAA 4GXVL 3O3EB 2VDOH 5TQ0L 2K9UA 3QDMA 1CFBA 1GAFH 1N2RA 3EJYC 3BPCB 1N0XL 1NMAL 1QFOA 4P3DA 3QEQD 2FX8H 4AH2A 5KSVB 1OSZB 2HFTA 4WHTB 1FNHA 3INUH 3HAEH 5TF1H 2QADD 4JFQB 2J5LC 1KEGL 2DQJH 2KL6A 1HHGB 4YC2C 3KJ4B 2QEJA 1JPGB 5CMAA 1XF3A 3MLSL 3TA3A 2UWEE 4IIQA 3O9WC 3D0LB 4G7VL 4ZUSA 4Q97A 3LCYA 4V1DA 4RSVA 3QI9D 3SGEH 1IGFH 1S8DA 2Z4QA 4RFEB 4NO0A 2GY7B 2CO6B 5HGGS 4LPYA 3DXAB 4LSVH 2VE6A 4F7CB 2QTEA 4YXKH 3QIUA 4JFOB 4UDUB 2XA8H 1OD9A 4FN0A 4Z0XA 2D7MA 2X4RB 2XZAL 4JEGB 4P4RA 4QHMA 1UH4A 2R0ZH 3EYOA 4JFXB 3S3SA 3OXSA 4U31A 2QL1A 4ZFGH 4FHBD 3E8UH 4PJCB 1JYXA 3DRQA 1BZ9B 4X6DB 1UJ3B 5HHXL 1T6WA 3FOLB 4OZIB 3BZEA 1OGTA 4CADA 2IFFH 4NQUA 1B4JL 3DYMA 4IS6A 1HH9B 4ZFOA 2R2HB 4PJEE 4O2FA 3HNSL 1NBYB 3TZVD 3OKEA 5C0FB 1CTOA 4ZAKD 4KKLD 4PG2A 3DVNB 1PW3A 1AE6L 1T1WB 3EKCA 3BE1L 2DDQL 3M1BA 5A2IH 5CBAB 1BD2A 4MSWB 1G9NC 4YHIB 1A0QL 1IL1B 1CFSA 1FLRL 2N56A 2Z8RA 4NM4H 4ONHB 1F3RB 3BDYH 3PP3K 4G9FB 4XWGH 4F80A 3O3AA 4NUJA 3CZFA 2AJ3B 2ZUUA 4BZYA 5DD6B 3NFNB 1CLOH 2DD8H 4PRAB 5I6XC 5MI0B 4KHTL 4BKLA 1OP3K 5IVZB 5C07D 1WITA 3VWKA 4OJFH 1T03H 3CCHA 2VDNH 3ARUA 2FJFA 1GCFA 3MOBL 1KCVH 1LO4H 2QQKL 2KQNA 1T3FB 2W0LA 3T4AA 3KPQB 3PGDA 3BP7A 5C9JA 4XAWL 1JWMA 2VKXA 3AU1A 5D7KE 1FN4A 5IW3A 3MCG1 4ZXBD 3LKRB 3IFPA 1AC6A 2A9NH 4AEHL 4DZ8B 3MR9B 4WFEE 2MQ0A 3GMQB 4KUCD 4O2CA 2DIJA 4YBLB 3EYSH 4KJYB 3RVVC 4KDTA 1FGVL 2VRAA 4JY4A 4AZ8A 1W0VA 3ZDXF 2PW1A 1SMOA 4DKFL 3O6LL 4KQ4H 3OPZL 3GSXA 2NZIA 4FQXC 4LLWA 4XX1G 1A3QA 4LCCA 4GAFB 1FIEA 4OZIE 2AJSL 3T0DA 2Z92B 3HC0B 4QRTB 3V5KA 1OARL 3TVMC 5JQHC 1JWUA 4YHNB 2ZP0T 3ARBB 4KWUA 3KYMA 5JDSA 2W38A 5I1GH 4Z77B 3VG9B 5D7KD 3QG7L 4LDLB 5DRWB</