4UDTB

T cell receptor (trav22,trbv7-9) structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
b'TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLGGYEQYFGPGTRLTVTEDLKNVFPPEVAVFVPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C R
publication title Structure of Staphylococcal Enterotoxin E in Complex with Tcr Defines the Role of Tcr Loop Positioning in Superantigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 61
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4udtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4udtB02
3KPPA 1S7SA 2HVKB 8FABB 1NLDL 3DX7B 2XKUA 1N6UA 2BRRL 3P4OA 3QUZD 2H41A 4N0FB 3DV6B 4FXKB 4YZFE 4MD5B 3VFUB 4JRXE 4JFXB 3T4YB 4U49A 1CGWA 3BEVB 2A0LC 4KROD 4FQQA 5BW7C 3X12B 1PQZB 2OTWA 5DEGB 2APBA 4L8DB 4LIQH 2AP2A 3PQYB 3QDJB 3NIGF 1S7RA 1LDPL 4KQ3H 4BZ2H 3HMXH 3GMRB 1LQSR 1IC4H 3U30C 43CAB 3O3BB 1S7UB 2JIXD 2NX5D 1V7NH 3FQWA 1M05B 3QFJB 5I74C 3TN0C 3QEQB 5A2LH 1QRNE 3QIBD 3ILPB 4O9HH 2FWOA 3GI9H 4NC2B 4X4YA 3U79A 5FB8A 5EO0A 3RWDA 1R0AL 5D7LA 4LOUD 2KZ1B 1KLGB 5IMLA 4TTDC 3MV9B 1D9KA 1A1NA 1UA6L 4RWYL 5BZDA 3KYAA 4GRLB 4R4FH 4GH7B 5F8RC 1TZIA 3MLZL 3UAJD 1NMBH 1FGVH 4ONGL 1MLCA 3MRMB 3GSRB 4O4YL 3DBXB 1IAOA 3RL1A 3RVVD 1EFXD 3SGKC 4ODXA 5KSAB 2WSKA 1MFBL 2MKWA 3JTTA 3CFBA 3D39A 5D2LF 4IJ3C 4IMKA 4YFDB 1R3KB 5SWZE 1WBXB 1IZJA 3O4LE 4XNYL 1UXSA 5CS7A 1MWAB 2IPUK 4CADA 2PYED 5I1IH 4U2YA 4UIMB 1KB5L 3CVHH 3GIVA 4G3YL 5IVNA 3D9AL 4H20H 2DQFA 3DRQA 1U3JA 3NCEB 5K9QI 3U2SB 4F7CA 4Z0XB 3SDDA 1NC2B 5CBEA 4KDTC 5D1XA 1JGDB 1XH3A 5SX5H 5EZOL 1J0IA 2MPAL 25C8H 4O02L 3QISA 5T1LD 5DHVA 3PP4L 2VLRD 4Z0BH 4C58B 3V5KA 2GAZB 3TFKC 1SEBB 3TJEL 5EOTA 1F90H 2Y5TA 1OAKL 1S8DB 1P1ZA 1PKOA 4WI9A 2PR4H 5EPMB 1IKFL 1H3PH 3F7PC 1FE8H 4M9OA 5I19H 5C2BL 1NCCL 4NRXB 2VB5A 4X98A 4QOKB 5IW1B 3NFPA 3T65A 1PY9A 1DLFH 1IGTB 2QADC 4L4VD 1D5MB 4K3JH 1ORQA 3MRRA 3HC4H 1I3GH 3L6FA 3RAJH 4NYLA 1T1ZB 5I76A 2G60H 3PG2A 4P5TB 5EC2A 2NXZD 5EH1A 5D96B 5B8CC 1L6XA 3LRSB 5BV7L 4IEFB 2AJSL 2ATKA 1NCDL 2VDMH 2AV1A 5EUOA 4WEBH 1U92B 3V6FA 4WO4C 3VXMA 3MUZ1 4R7NB 1CGUA 4TULH 3K8MA 1KPUB 3TNNB 2DQIH 3ULSB 2CGRH 2OR9H 3MLWL 3X11A 1RHFA 3ULUD 4OIIH 3UCRA 4NFBA 3S34H 4KZEH 3MCKB 2FL5A 1A2YB 4K8RH 2XFXA 1JHKL 3SBWA 1Q94B 1F11A 1IGFL 1DQJB 1JBJA 2IPUG 1RI8A 2LTQC 3QEUB 4M5ZH 2CMRH 1BLNA 4QNPF 1S7TB 4L29A 1ORSB 4NQCD 1X5YA 3OF6A 4G8FA 2YD3A 1JTPA 4OLXL 5F96H 3S35X 4C54A 5T3ZL 1TENA 1D6EB 1K8IA 1AP2B 2CJUL 2EDKA 1MFAH 3HN3A 2VLKB 3GFUA 4OT1L 4ZPVB 1I7UA 2A6DB 2DM2A 5KZCD 1FFOA 2EH8L 3F5WB 4RGND 5FK9A 4K7PL 5ESAB 3RWIB 4J1UB 2HT3D 2P42B 1EGJL 2B0SL 1KACB 3MRFA 3EYSH 4RMTA 4Z7WB 1DUYA 2HMIC 3WSQH 3EOBA 4HF5H 1WFNA 2P4AB 4PP2A 4JY6B 4DCQB 4XCNA 3H7BA 3UPRA 4PLJC 1I85A 3B83A 1HSAA 4PJ8D 1MHEB 2HFGL 3WO4B 4LHUD 5IQ9B 3FT2A 4MNHB 1JGVL 5H94A 3N1QC 3OKDB 1XGYH 2X4RA 3CU7A 2ADJA 1PG7W 2ADIA 1QNZL 4Y4KC 5K33A 2H3NA 3PL6A 4PJ7F 5DFWH 2ZSWA 2MMXA 1CXKA 4LQ1A 1U8NB 4O5LL 2I07B 4R4NC 2AXGB 1HOCA 4GRLC 2IADA 3BH9B 3QRGL 1BOGA 3QJHA 1CDUA 4PRPD 2WBKA 4FTVA 4F8QA 4B7LA 2X44D 4P57A 5EZLA 1ONQA 1EAPA 5KSAC 4IOSD 4Y5YA 4ZUSB 3L7FB 5D7LE 4UNVA 5E1AB 2WBWB 1KJMB 1FZKA 4OZ4A 4KI5D 2Q87A 1EHAA 2ZG3A 3VRLF 5I1EH 4F9PA 2Y25A 3VFVA 1F97A 3OMZA 3G04A 3WFCL 2BFVL 4ZYKA 3QNZA 2W59A 3CFDA 2H1PH 3BPLC 3LKNA 5DTFB 2NZ9C 3D39E 2I9LB 3ARDB 3VG0H 3DO7A 4OF0A 3ARZA 4Y16D 1BJMA 1GSMA 3H9SA 1UQSB 5EN2A 1LO2H 1YJDL 5HVFB 2A73B 4HAFA 4NUJA 5J06A 3FO1A 4Y7MA 1FV1A 5FDWA 2ZCKL 3WUZA 4JKPL 1KTDA 1YA5A 1NMCB 2H2PC 5JQ6L 3L9RB 5EBWB 4EN3D 1B0GA 5JZ7C 3WLBB 3NPSB 1F00I 4X6DB 1INQB 1IFHH 3N9GL 1MFCL 3PIQA 4HIEA 1N4XH 1G7HB 3CX2A 4OGAD 1HKFA 5MEPB 1G9NC 2ZCLH 3VG9B 4JHBA 2Y5EA 1EK3A 1E4WL 4I1NB 1JPGA 2EXWC 1P4BH 3K8KA 1ZANH 2I5YL 2HFEB 2X42A 4BH8B 2ARJA 1U93A 2EE9A 3C6LD 4TYUA 4ZTOH 3L3DB 3BJ91 3FQRB 4N8CH 2Q3AA 4QF1A 4PTUA 4P5TC 1HHIA 4AQ1B 2R1YA 1P9MA 4P46B 4NM8H 2AK4D 4XXCA 1XF4B 1B2WH 4ONFH 1A6VL 2K9UA 3MLRH 3VDCA 1J18A 5HDBF 1HYRC 4QXUL 2IAMD 3WS6C 3BGFB 3WXWL 1OAXL 3W2DH 2Z4QB 3S8WA 3S37H 3AY4A 4RZCA 4NPYA 2RGSA 1IM9A 2HFTA 4MSWB 2M1KA 4PYGA 4FXGA 2JB5H 5EUOE 3EO9L 3GDBA 5IFHL 4HCRL 4M7ZB 3D18B 1DFBH 2NY0D 3CD4A 3VXME 4ZQKB 3WIIH 1CICD 1DBMH 5F7HA 4WFGE 3F7YA 4B50A 1X4XA 4GKSA 2VLMD 4GRWH 2IG2L 4ODUA 4BZ1L 2WP3O 3K1DA 1CL7I 3U48A 3IFPB 2AJZA 3KXFB 1K3ZA 1SMAA 4OZFH 4K7PX 3ARED 4N8VG 3X3FL 4FQJH 1J1XH 5FECB 3T2QA 1F6FB 4PS4H 3HE6D 1J1OL 5DEFB 1ZVHA 4MNGB 4UIKH 3I50L 2AEPH 4Y1AA 3QHFH 3TO2B 2ILLA 5SWQA 3WUWG 4LASH 4PRBB 2X70B 4Q9BA 4F3FB 1CU4L 2GFBA 1X7QB 5D2LB 4A6YH 2P5WA 3D25B 1Y6KR 3MLUH 5SWSB 2ZUWA 3BN9D 1UB6A 2CKBB 4KMTL 4YHOL 4EVNA 2F53D 4WTXA 3WHE1 1QSFA 5ERWA 3O6LH 5F70A 1UZ8B 2Z35A 1FN4B 2OX5A 4JFHE 1LO5A 1MREL 3JV0A 3PNWB 4YUEH 2DD8L 4C55A 1FBIH 4ZMAT 2WANA 3MLSH 3SQOL 4RA0C 5JXEC 2VXSL 4JZJB 2DJSA 1S5IH 5FHBL 3D1MC 2YR3A 2Z8WC 3QQ3B 4JHWH 4IS6B 1X5FA 4WDIA 4FQXB 1AGEA 3QNYA 4JRYB 4LEOA 2Q8AL 2CRYA 4LAQL 3GHEL 3GO1H 4ZFZB 2VWEC 2GQHA 3O6KH 2ITCB 1M7XA 4WWKA 4FS0A 3DSNA 5ACZB 5DJZB 4I77L 1MCOH 1FNLA 3MRJB 3BEWB 3QA3A 3WN5A 2JJSA 3KPMB 4PJHA 2EDXA 4OD1H 3G6JF 5DJ6A 2BJML 1DTUA 4OGYH 2B2XH 1FYTD 1XFPA 3HE7A 1OTTD 2XY2A 2DQHL 3LD8B 1FO0B 1KPVA 5GGQH 5FDYA 2XZQL 4FTVE 1WZKA 2AW2A 5DHYA 1YUHA 3NZ8A 1KN4H 3VFGH 3HFML 4L3CB 4OCRL 5HGBA 2NXYD 4X8XA 3W9EA 4YHZL 3MV7B 3ARDC 1Q9LB 3I3BA 2EYTB 2W0FB 3CFIC 1E27A 3GMMB 5DO2C 2PTTB 5HD8C 1LNUB 3V6OA 5JHDA 2JCCA 2M8XA 5I9QB 3I6GB 4FQCH 4JO1H 4OUUB 5GRUL 3TA3C 2R15A 1NMCC 4LRNL 3PDOA 4MHHI 3IFNH 4JANA 4R90H 1W72L 5C0BD 1AGCB 4OLUH 4C57C 1KT2B 3QIWB 1A3RH 2IEPA 3VFRA 1QFUH 1OARL 1TZGH 5KVDL 2F19H 4G8EA 4UB0H 3H9SE 2HT2C 4I2XA 1D5IL 4H26B 3BPOB 1FORH 1ZWIB 3HPLB 4YAQB 3G5XA 2AXFA 3GIZL 3LIZL 1TVHB 5CJOL 2EO1A 2EC9T 4X7SH 1NAMA 4MWFA 3KG5A 3HB3C 1I1YA 4NQDD 4C4KT 1T5WA 1WIPA 1I8KB 2QR0B 4JO4L 4S1SH 3LKRA 3VXRD 1A4KB 2AJYL 3WJLA 5JMRA 1A8JH 1UYWL 5FCUH 4JG0H 1RY7B 1KGCD 2P5EA 3QHZH 2I9TB 4YHLH 5LG1A 4G5ZL 1BQSA 3RA7L 5BMFL 5M95B 4G6FB 5E5MB 2DDQL 4GBXA 4M43H 4P46C 3P4NB 2YRZA 3O3DB 5IROC 3VD4A 3CPLA 5I1DB 3GSOA 2NW3B 4OFYD 5F7FA 1HWGB 3ZKNC 3QSKB 4NKOA 5KOVC 5CEZE 2EDNA 3LHPL 3BGFC 1BF2A 1SY6L 4HH8A 4CU8A 3BGMA 1YQVH 3ARBB 12E8L 2N1KA 4KRPD 2FZ3B 1OQXA 5HYSB 4X6EA 2QQLH 4JFDB 5CEXB 4EI5B 1ND0A 4M4PA 2EXYC 3ZYZA 4E9LA 4M7ZC 2UY6A 3QQ4B 1QSED 1K5NA 1P7QA 5IMMB 1WK0A 5IUSA 1G7IA 5F9DC 43C9A 3ULUF 5JR1L 5GISL 1AKJD 4FNLH 3HHRB 4OCSH 1NCTA 2MKLC 3NABL 1NSNH 4PV9B 5I1GH 1EBAA 5SV3A 3WDIA 4HS6B 1JZ4A 5MENA 1ZSDA 1RAMA 1CG9B 32C2A 2FJFA 3ARRA 4K71B 4MX7B 5BW7A 1OLLA 1F3JA 1EHXA 1M6OB 2CIKB 4HGWA 4KK6C 3UXFA 1Q1JL 3DVIA 5CGMA 3NN8B 5HGDB 4PG9B 1YEDB 1BZ9A 5ISZA 3HUJA 4DAGH 3UYPA 1T2JA 2APTA 4PB0H 4ZUUB 3D85A 1ZHNA 4AM0A 1LE9B 4WI6A 3VFPA 4XPAL 3GBNH 4PR5A 3O3EB 3TN0A 2DJUA 3PJSA 2DIJA 3QQNA 3A6BL 1CFVH 1ZA3A 4Y1AE 1J0ZA 5IJVB 4P9HL 4JZJC 2KUTA 5E6ID 3S6CA 4HULB 4ZFOA 2P5WE 4YHPB 4TPRL 4FQXC 1QSFE 3PWVB 5LGKA 1JRHI 4E5XA 4N8VA 1MLBA 2DMCA 4AH2A 3KVQA 1T89C 1OT1A 5EB9A 1KLFA 3VFNB 3DX8A 1MVUA 3SGKA 2VUYA 5TDNA 5JXAL 2PW1B 4FFVC 4P3DA 2W60B 1OGAB 5FYJE 3OG4B 2DQEH 5DK3A 4S1RH 4F15C 5BVJA 1ZLSH 2A6IB 3VRIB 5E7BA 4MQXD 1VPOH 4NQXB 1X5GA 1XGTB 3ES6B 4LSPL 4KY1H 3EFDH 2MSPA 4WHTA 3CFEA 2J4WH 1P2CB 4K07A 4UDTA 5B38B 3IAGC 1AGDA 3DUSA 3U9PH 2H32B 3MRIB 5IFAL 1CE6B 2V9QA 3DX6A 2H6PB 1KB5B 4YQXL 1GC1C 1JFQL 1JF5A 4QXTB 2HRPL 4NQVA 4YDLB 2PN5A 1MJ8L 3U36A 3IDNA 1G9NH 1BJ1H 1EVTC 3DIFA 1MAJA 5HI5C 5JDSB 1JWSB 4U3HA 3MNZA 4PYHA 4YDIH 4QRRD 5I9QC 3IU4H 2G2RA 1YMHB 5L6YL 1Z9SA 4V1DA 1ITCA 3HMWL 3C5SA 4U4BA 4W70A 3WFEL 1NC4A 5BOPA 2UYLA 4LQFL 4WI4A 3QIWC 4UINH 1MH5B 4M1GL 2P7TA 4GG8B 3OPZL 2F5BH 3K80A 2CRIA 3IYLW 1KLUB 2VTFA 2QQKL 4UILL 2O5ZH 3U1SL 5HDLA 4CDGC 1J0KA 1F42A 5F7DA 1U8KB 1T1YA 3FB6B 3V6OE 1SJEA 2Y06L 4RMVA 1AGBA 2JCCE 4GMTH 4NC1C 4XNUH 1A64A 4PRID 2XZAH 1KSRA 3DVNA 4XWOD 2BOCA 4MQSB 5B8CA 3IFOA 2LVEA 2R2EB 2DLFL 3FFDB 3RBSA 4Y4FB 4AENB 5D5MA 1A7BA 2LVCA 5LCVL 3TO4B 4NBYB 3G6AB 4I2XE 4NHUA 5HDQH 1RPQA 5CJQH 4YEFA 5BV7B 3SE3C 4QY8A 3KLDA 2GEEA 3MNWB 3WIHH 4D3CH 1CLZL 5EA0L 1Z0MA 4HWBH 4NNXB 4U1MA 2D0GA 3HZVB 3ZKXB 4KJYA 2P5EE 3ARBC 5TGBA 5J57B 3C9NB 3NH7L 2E9JA 3CSPA 3EYVA 1L6ZA 1G7QB 1I8MB 1YN7A 5GRVL 4X80H 3IT8D 4OGXH 4EI5C 3V6ZB 3PHOA 6FABL 4TVPH 1S9KC 2PCPB 5BRZA 4X5XB 4LLMA 4P2QD 4OLEA 1CZ8L 1N64L 3Q6GL 4GXUN 2HVKA 4IDJH 8FABA 3DX7A 1ZKAA 4LKXB 4LCIL 4N0FA 2CR3A 5C0AD 3DV6A 4J4PD 4YBHA 4FXKA 1JV5B 4MD5A 3VFUA 4KMLB 1DQTA 4JFXA 3T4YA 1ZLUK 1JE6A 3D6GA 4Z76B 4LVHB 3BEVA 1YNTB 3VDBA 3X12A 1PQZA 2J8UE 3SE8H 3OB8A 5DEGA 2AEWA 5I15H 1XGPB 4OCYL 1RIVH 3G6JB 4J7RA 2YD5A 3IU3B 3VFWA 4WTZG 43CAA 1T1XB 3HI6H 1JGEB 4M6OL 5F1NB 2AKRB 2FX9H 5FYKE 5MENE 1M05A 5A3ID 4MD4A 4P59H 4E0RB 3QEQA 4K94L 3RVTD 1FG2A 2DM3A 3N85H 4YC2B 1BX2B 4X8JB 3ILPA 1N2RA 2W0LA 4KJWC 3RHWK 3F62A 5ISZE 1KLGA 3HUJE 3MV9A 1F3RB 2NY2D 4GRLA 5EIIB 3VGHA 1WUNT 4R8WH 2ZSVA 1T2QH 3GSRA 5IWLC 1QZ1A 4P9MH 1G7PB 3LN5B 3RP1A 4HFUL 1A3QA 5F88A 5KSAA 3D2UD 2Q86B 1C5CL 3NFNB 1MELA 4P4RB 4HJJH 3TM6A 3BOVA 3T0BA 3OKMB 1R3KA 2WBJD 1WBXA 1EV2E 4LSTL 4TSCL 1MWAA 3BXNB 3PGDA 4NP4L 1F8TH 4P4KB 1UH4A 3K74B 5DD1L 4UIMA 4LK4A 3VGGA 4QLRA 3FO2B 3RGVD 2ZG2A 1NDMB 1PLGL 3QCUL 3SGEI 4UBDC 3RI5K 3AFLA 4P0DA 4Z0XA 1NC2A 4R26L 1FGNH 3LEXB 3DI2B 1H5BB 1CDGA 4YDLC 5AUMB 3ZE1F 5HHNA 4PY8I 1PZ5B 1DE4B 1S7QB 5DRXB 3W11C 2VDKL 5E8OB 2GAZA 3TYGH 5F93C 1SEBA 5JNYB 4UT9H 1S8DA 1IAKB 4PJ5B 3JZ7A 3X13B 1CE1L 1DJSA 2J1KA 5EPMA 3IJYB 4FG6D 4XC3L 3I6LE 3O2WL 4LSDA 5C8JA 4QXGL 3RY6C 4OZIB 4ZXBD 4QOKA 2BNRA 2XWJB 4XPTL 3MV11 1L7TL 4LFHG 1QLFB 2IQ9H 1D5MA 1S9XA 1X44A 3SDYH 3ESUF 1HCVA 4M8QB 4HBCL 1ZLUH 3RTQD 1C5BL 5CZVL 4KZDH 2Z0BA 3UTTD 3CDCA 3QCTH 4V1DE 5JW4N 1NFIB 1EHNA 3O4LD 3IDMB 1HHKB 1KPRB 3KHQA 4Y4FC 5A43C 1U92A 4XNMB 3VFOA 4NZTL 3TO4C 1KPUA 4AEHL 3ULSA 2J88H 4GAJH 3WMSA 3WS6A 5C0JB 3HC0B 1WZ1H 4PJAF 1JNNL 4Q0XL 5J6HB 4MXVF 2C7UB 3MCKA 4GW4A 2VZ3A 3EOAA 1A2YA 4X4XB 3ARGB 3ORJA 1LO3L 1Q94A 3ZKXC 3VGAC 1DQJA 1WIUA 3WFHA 3KDMB 5D5ME 5C6WH 3ZDYF 1KIUA 1QVOB 3TPUB 3LZFL 5EO1B 5LWYH 1KCUH 2K1MA 1ORSA 4OB5L 5C0DB 5ICYB 1EBPA 3S5LB 1HYSC 4XCYB 3VI4F 5B3JF 5I1KH 1RIUH 1D6EA 1UWGL 1AP2A 1F4XL 2KH2B 3ESVF 1IGCH 1J8HD 3SO3B 1BMGA 3DO3A 4ZPVA 2A6DA 2YK1L 3ARFA 4KKAC 3F5WA 1E4KC 3BPNB 5ESAA 4J1UA 1WGOA 3O4OB 1U3YA 2X09A 1FAIH 1NCWL 1AE6L 4LVHC 2APXA 3VMPA 3KPLA 5EBLB 3LS5H 4Z7WA 3U7WH 4I13B 5BRZE 4DGIL 4MA7H 2W9DH 2ADFH 3G9AB 4OLWH 5B4MC 1J1PH 2FD6H 4JY6A 3GK8H 4DCQA 3BX7C 4EI6B 1TCRB 4MYWB 2X4NB 3KPSB 1EFQA 2AGJL 1INEL 3GRWH 2GJ6B 5DJ8B 5IQ9A 5I1HH 4LGRB 2XKSA 5JXEA 4XCCH 5CP7A 1D5XA 5DC4B 1FHGA 3B2UC 3OKDA 5EO9B 2IAND 2YD8A 1KOAA 4YC2C 1I1AD 5C6TH 5KAQF 1RVFL 1EUTA 2F54A 4MDJB 4FQHB 4JFFB 1U8NA 5CIPA 5KVFL 2I07A 3BPCB 2AXGA 3C2AH 3EJYC 3BH9A 2WQRA 3KJ4B 3EYUL 3H9HB 3QEQE 3WIFB 1N8ZB 1ZA6B 4YHIB 2Y6SC 5LGHH 1PVHA 3T0AA 4ZUSA 5FYLE 5IHBA 2YKLL 1KJMA 1GC1H 4WTZA 3ZMRA 4KUCD 3MV9E 2QJDA 2V17H 4WIQA 35C8L 2ORBH 5IEHA 4GXVH 2ZCHL 5F7KC 4LSUH 3ZO0A 5C0IB 3VWKB 5ITBL 3K4ZA 3T3MF 1KJ2L 2R4SL 2W38A 4BJLA 4WGVB 4J23A 3QPXH 5DJYB 2I9LA 1MRCH 3ARDA 2WLYA 1MI5B 4Z77B 2QQNH 1L7IH 1UQSA 4I3SH 3T0EB 2A73A 1H5BC 2ZOKB 4UV4L 3QO1B 5EU6A 4A2LA 4HWZA 5EBWA 1CR9L 5D4QA 3WLBA 4PJDF 3NIFE 2EKSA 3MRNB 1INQA 4X6DA 1MCHA 1YJDC 4RRPG 2VE6B 4MLSA 1BF8A 4DGYH 3C6SB 1UWEH 2X4SA 3MOBL 5MEPA 1FNGB 1JYXA 1UH2A 1W72B 3QEGL 3R8QA 4YHNB 3DUUB 4PGJA 4I5BB 4YXHH 3A6CH 1QHPA 2E27L 2EDOA 1WC7B 4Q9RH 4BH8A 4BFIB 3FB7B 3QZWB 4GQ9L 3FQRA 3BZFB 1KCRL 2ICWI 3ISWA 4QOKE 2BNRE 2FEEI 3MREB 2RFXA 2Y7QB 2DTMH 5E0QA 5F1SA 1ADQH 5ALCL 5IR1B 3V7MA 4P46A 2IQAA 1SHMA 3UTSB 5IROA 1WLHA 1XF4A 2D31A 4JZNA 1P4IL 4JDTL 5TDPB 3ARXA 4JFOB 5GGUB 1PJ9A 1FIEA 1IQWH 5DHXB 3DURB 3D39D 4JHAH 4M8VA 4CN1A 2Z4QA 3T4AB 5HY9B 3V6BR 3MFGB 2ADGB 4KRNA 3ARGC 2V5SA 2EEBA 4MSWA 2VLJD 1N0XH 2IC2A 5JUEH 5I1JL 1IGYA 3D18A 4LLVB 3TVMA 4ZQKA 2D03H 2FJHB 3LKSB 2N7BA 3S35H 5CILH 3DETC 3SDDD 1EHLL 5D1XD 1J7VR 2IWGA 4IRSB 1DVFB 2B1AL 3VXPB 3SO3C 5I8KL 3SN6N 5DEFA 4TUKL 4MNGA 3GSNL 1MPAH 3O4OC 4I0CC 2R69L 3O9WB 1A7OL 2FB4L 5I0ZA 3B9AA 4LLYB 2X70A 4PRBA 4PRDB 4M7LH 3STLB 5TE4L 1MJ7L 1X7QA 5D2LA 3D25A 2XQYK 2CKBA 5DUML 4XP6L 4R9HA 4WCYL 4EDWL 4MJIB 5T3XH 2VJXA 3U4BH 2RAMA 3I2CL 1UZ8A 5KVMC 1FN4A 3MCG1 1TZHB 1FJ1B 1O5DT 3LVEA 3PNWA 1ZTXH 3RIAF 3W0WD 3HKFA 1RJZB 3HZYB 4NQEA 1WT5A 3DGGB 3CCHB 2NY7L 3FFCB 4J8RA 4Z7WE 4JZJA 1H3VA 1E28B 2XT1B 4HK0A 2YUXA 5JIIA 2X10A 3QQ3A 4IS6A 4XMKH 4FQXA 4EXPX 1CD8A 4JRYA 4O4YH 3VXMD 4D2NA 4YHKL 2KDGA 3PGCB 4ZFZA 3U0WL 1CLOL 1SMOA 4WFGD 4YFEA 5E1HB 2ITCA 5ACZA 1U8QB 1VFBA 3KJ4C 5DJZA 4XAWH 4DKAA 4MQ7B 3RZCB 3BEWA 1SEQL 4NQUA 3AC0A 3KPMA 1BFVL 2VC2H 4ZFFB 2DBLH 2F54E 2OJZH 1UJ3B 2EDLA 1KCSH 3BMVA 1C12B 4LDEB 5J7CC 2EDEA 1HWHB 2B1HH 3NFSL 1FP5A 1B6DA 3O2DL 4OCWL 3MCLH 3BWUC 4PJEF 2AJUH 1FO0A 2OK0L 5GGSB 4XZUB 4Y5VA 4F7TB 4LLQB 3L3KB 5D7IF 3MLYH 4LGPB 5EZOH 3QDHA 1JPFB 1UWXK 4J12A 4MS8D 4F7EB 1JUFB 3ZTNL 4L3CA 3CFCH 3FMGL 5GRJL 5B22A 3STZB 4RISL 1E6JH 1BVZA 2EYTA 3DXAD 4JFHD 2W0FA 3TH2T 2ZUTA 3GMMA 3Q3GA 2ATPB 2PTTA 1LNUA 2YRLA 2D7MA 5IT2L 2EDWA 5JA8B 1HEZB 4G7YH 4KKCC 1YMMB 4PJAB 4NZRH 1AGCA 5J3HC 3FQTB 2EDRA 2EE3A 4ODSH 3QIWA 4KHTL 3C6LC 4MJ5A 4OIBA 1BQHB 1R5WB 2XQYG 3TT1H 4CMHB 5CHNB 3K3QA 3RVWC 3S88L 2R56L 4XGZA 2PW2B 4PUBH 4H26A 1ZWIA 5I71B 3HPLA 4YAQA 4JKWA 1TVHA 1I7ZB 3LQAH 5EU6E 4XP4L 3HI5H 4WI7A 2GJZB 3OZ9L 3F6LA 1I8KA 2QR0A 1ES0B 3RPIB 1MOEA 5C08D 1A4KA 4H25B 4KV5F 3MJ9A 1GOGA 3PL6D 4L3EB 4X6DE 3BDYH 4RDQF 3FOMB 4Y2DC 3FT3B 4M48H 5FA3B 1NCBL 4CU6A 5D6DA 4GW1B 3ZL4L 5E5MA 2X4UB 2NY1B 1F3DJ 1VERA 4JDZB 4W4OC 4XHJD 3V4PL 3WFDH 3P4NA 3O3DA 3SE3A 3S3PA 2NY0C 3FN0H 3NBNA 2J6EA 2GUOA 4Y4HD 5AG9A 5I1DA 3INUH 2NW3A 3RPKA 1KIPB 3OKNB 4JPVL 3MA7A 5I1CL 1G7JB 4DN3L 2VIRB 3ARBA 1YYML 3UPCA 5DVKA 5HYSA 3IS1X 4WFFE 4JFDA 4QHKI 4X4MA 4DK3A 3IDXH 4EI5A 4YO0B 2W1NA 1I3RA 1C8PA 5C0CB 3QQ4A 5JLZB 5IMMA 3GSUB 2DQUL 2FSEA 3GSXB 3CX5J 5I2IB 2UZIL 2WP3T 7CGTA 3O8XB 1I7TB 3NIGE 4PV9A 3DOSA 4K7PH 1KJVB 3H9SD 4YHMH 2DS4A 3BN9C 1AQKL 5EC1B 2YXFA 4HS6A 3WNPA 3LPWA 1DVFC 3F12B 4XNXL 5GGVY 3IFLL 1KXTB 1CG9A 4P5KB 4MX7A 3RJDA 3V4VH 4UU9B 3HG1D 2CIKA 3O9WC 4RMQA 3NN8A 4Q97A 5HGDA 2ARJQ 1YEDA 4R0LB 5IG7B 5JW5B 1UWXH 1DBBH 4OGZA 4U6HA 5LXGL 3UTOA 2OJEB 4J3WA 1FC1A 1QYGL 1LE9A 1AY1H 3RIFF 2VXQH 3MV8B 5DQDL 3KWWB 4LRIC 4MNGE 4P2RB 2DAVA 3FRUB 3NCYS 2PO6B 1BOYA 3QG7H 15C8L 2PF6A 1MHHB 5IJVA 1CYGA 5D2LE 4LSRL 4YHPA 4UV7H 5B3NA 4DUXA 3L3IB 1F4WH 1ZT4A 1OY3B 1TDQA 3PWVA 1ACYL 1J11A 5DC9B 3MXWL 5IWLA 3VFNA 4EQ3A 4P9HC 1T22B 1XZ0B 1NDGB 1EPFA 4DUVA 1PDKA 4QHUB 2PW1A 4F7PB 1L0QA 3UBXB 4NQEE 2W60A 4LPVA 1IGMH 3RZCC 1KG0B 5D71L 1LO4L 1QEWB 2WUCH 3BKCH 2A6IA 1R3HA 2R23A 3VRIA 3WDHA 1IM9D 3MR9B 4NQXA 1UJ3C 4JRYE 1XGTA 3ARUA 4U1NB 5CSGA 1AR1C 1FVDB 5HHXH 1P2CA 1RMFH 4O51A 3DV4A 5B38A 4K8RD 2H32A 3RVUD 3MRIA 2XXMB 3WLWC 2N56A 1YJDH 4RCAA 1E4XL 4KU1A 3JSSA 1XIWA 5F89B 4WU5B 2NTFB 2H6PA 1KB5A 5KSBA 1P53A 4QXTA 3KPRB 1NH6A 1YZZA 2B8OT 3QPQD 5JQ6H 4GJTB 4PLKD 1JWSA 3DMMB 4L8SB 4Y1AD 4JPWL 1EJ6A 1ZT1B 1YMHA 4HHAB 3TT3L 1GZQB 3O6ML 4K23H 3SGJC 3BW9B 1U3HD 4KRMB 4W6WB 4MD0B 4ZS6D 3ULUH 4UT7H 2P5WD 1T83A 1MH5A 2NW2A 3P9WB 4GG8A 5DLMH 2AK1H 3UMTA 4LARL 4CMHC 1EJOH 3WD5L 5E95B 5FGBA 1FRGL 5C07B 1CXHA 4F58L 2I5YH 2R0ZL 2R39A 1HI6A 1MCDA 3FB6A 3VD7A 3LKPA 1RZ7H 2YSSB 7FABH 5FYJD 3S5LG 3GMPB 2BSSB 5JPNB 5EORL 3VJ6B 3T0VA 3CX5K 5I8EB 3P9MB 4AL8L 4KVNH 4Y5XB 1JNLL 3WJJC 3MUGB 2R2EA 4Y88A 4RNRB 4N1HB 3REVB 3FFDA 4PG2A 3VXNB 4Y4FA 4AENA 4YWGL 5E2WH 3NCJH 4XHQA 4LCWB 4PTTB 3B8SA 4XPFH 3G6AA 3Q5OA 5CD3B 2IJ0C 3AM8C 2NY1C 3V8OA 4WWKD 1VFOA 5KN5B 4NC1E 3Q1SL 1CFNB 3D87B 4NBXB 2AJXL 4DKEL 1N6VA 2IPTH 3MNWA 5JHLL 3PWPD 1KENH 1RURH 5EOCL 1CQKA 4NNXA 1P69B 3HZVA 4PJIF 1B0WA 4KUZL 3C9NA 3AVEA 4ZUTB 1I8MA 3HE7D 5D1ZB 1W2KT 2NYYC 1LEKA 1IBGL 3D3VB 1CWVA 2XN9D 5DVLA 1TJGL 5F7NC 5T5FL 2PCPA 1YYLL 2XKNA 4PP1C 4X5XA 1NBZA 5ALBL 4U6XA 5HSFA 4KI1A 4PGEB 1H3XA 1B88A 3C8HA 4JO2H 2ZUVA 1OCWH 4R6UA 3BKYH 3L7EB 3PXJA 4LKXA 2DI9A 3VA6A 1UG9A 1JV5A 1QKZL 4LVEA 4NM4H 1FVEB 4JFDE 4M7KH 4X4ME 3KYNB 3SKOB 3FJTA 1BVLB 4MNQB 1YNTA 1ERNA 1U8PA 1JZ7A 3S7GA 2XI9A 5F7WC 5GGRB 4KQ4H 2QSQA 2XRAL 4AQOA 4MZ3A 1EGJA 3G6JA 3IU3A 4NWUL 3UEZA 4M1DL 1KV3A 2IH3B 2DL9A 1D6VL 3JWNC 4UTBH 1NJ9B 1JGEA 3B6SB 2AKRA 4FA8A 1HHHB 1F3DH 2A6JB 2IBZX 4JHZA 4PJEB 5IVOA 5HGGS 1RUQH 1DN0B 3OKLB 4KMQA 5D7IB 4ZUWB 1BX2A 2PO6C 4TRPH 1UM4L 2MHAB 1A7RH 2MCPH 1KIRA 2P5ED 5CLTA 3D0LB 4G43B 1PYWB 4FQIH 4RAUB 1GGCH 2CDEB 1KTRL 5GSVA 2BOBB 5EIIA 1YC7A 2QKIB 4I77H 2FH8A 3VGFA 3CAFA 1WBZA 3N50A 4NIKB 1U8IB 1G7PA 3LN5A 3TBYA 2E8YA 2BDNL 3V0WH 2LU3A 4KH2A 1EMTL 1CT8B 4O2FB 2FEDC 2Q86A 3NFNA 4JFZH 4P4RA 3TESA 3OKMA 4OZFA 4FFYH 3BXNA 5EUOF 1UCBL 4P4KA 2ZUUA 4MGXA 1U2CA 1DQLL 2R29L 4DQOL 3KNBB 1QRNB 3HFMH 1QBML 3FO2A 1CL7H 1KEGH 4H8WC 4TQEL 1NDMA 4OCRH 1OM3H 4OQ1A 3BO8A 2YUWA 1DN2A 3NACH 1URLA 1OGAE 5MERB 3QDMB 5T1DL 3EOTH 2D7QA 1U8JA 3B9EA 5KOMC 4RMRA 3QI9C 1P7KB 4FZEH 5C09D 1H5BA 2GITB 5L7XH 4WNQB 5FYKD 5MEND 5AUMA 1KJ2B 1PZ5A 2A0LD 4DUWA 1DE4A 1S7QA 2GCYB 3IJHB 1W72H 5DZOA 5E8OA 2YPLB 5AYUL 5C1MB 4M4RA 3DMMC 4TNVF 4L8SC 4NO5A 1IAKA 3LV3B 4PJ5A 1NKOA 1FNHA 1A7NL 3IJYA 1JPSL 4P2YA 4JKKA 4Z78A 3OJVC 5I8CB 4ZPTB 3BFOA 5SWZB 1MCWW 4OZIA 2XWJA 3ULVL 3GIZH 5D7JB 1ZVSB 3D85D 1QLFA 2C3WA 5GZND 3RRQA 5KSBE 1T7XA 2ESVB 2ZUQB 1R3LB 3TN0D 3BHBB 5E9DB 1MFEH 3VFMA 3NTCH 3FAWA 3JV6B 2YPVL 3K1KC 1J0HA 1UYWH 3FQUB 1FPTH 4U05A 2P44B 1T03L 4GQPH 4Z8FH 2O5XL 3LEYH 1NFIA 4HSQA 4Y5XC 4TTDD 5BMFH 1Y18B 4TN9A 4K7FA 3C09B 3U7YH 1HHKA 5HDOA 1I9RL 1KPRA 3V7AG 3EYFB 3CDGB 5FM5M 5GZOC 1MCKA 4XNMA 1XR8B 1FNSH 2CH8A 3MOAH 4OLZL 3GBLA 1X6NA 5C0JA 1PEWA 3HC0A 3WDJA 2V2TB 4PJFB 4HT1H 5J6HA 2C7UA 3IDGB 4X4XA 1T2XA 3ARGA 1LK2B 1P4LB 1YEGL 4XH2B 5F7UA 1DEEA 5GGTL 1A1OB 5E2TH 2CDGB 5EO1A 4Q6IB 4NO0B 5FOJA 2Z31B 5C0DA 4HS3B 5ICYA 2Q7NA 4P2OB 1BBDH 4LSQL 4HCRA 3ECBB 1JPTH 4WFEE 4E41B 3QWQB 4F37F 4AY0A 4WRLA 1KJ3L 1CQYA 4ZNEA 5H2BA 3I9GL 3GSWB 2EYRB 1XF2B 1YECH 4JAMA 3TFKD 3QDGD 2ITDB 3ELAT 1Q9WB 5GQBA 1BZ7B 1NEUA 3MJ8B 4V1DD 2R9HC 4LEXH 4MA3B 2A77L 4P3CH 2QADD 4EI6A 1TCRA 3GSNB 2X4NA 3KPSA 3U9UA 4HXBL 4NBZB 3MBEB 1MQKL 4OFVA 2GJ6A 4XMLL 4G7VL 5DJ8A 3GHBL 5T3ZE 4HH9B 5LBSL 1GAFL 4BK5A 5EO9A 4KROB 5GRVK 5KVEH 2DKSA 5TJWK 4OQTH 3GEWB 4ZO7A 4MDJA 4FQHA 3G6JE 1NUFA 1EO8H 2IALB 1OD7A 3BPCA 1WQVT 5F44A 3C5ZA 5L88L 1T0NA 3EYOB 1ZV5A 4DN4L 4ZTPH 3H9HA 3BD5A 3ZE0E 4BSVB 4XPGH 1Z3GH 3WIFA 1N8ZA 1TITA 5DQJA 5KW9H 1JHTA 4LGSB 5GS3A 1BQHG 1IARB 3CXDH 3KYKH 4AIOA 1X6LA 4NQTA 3L5WB 3SPVB 3MUY1 4HXAL 2V2XA 5HYEA 4PJCF 4M3JA 1HH6B 3MLTB 4FQQB 3LRHA 4NRZB 2ED8A 3VWKA 2OTWB 4G6KH 4JO3H 3MFFA 1EFXB 5HYFA 1JFQH 1U36A 5GJTL 5E08L 2NY4B 5GS1B 3MZGB 5DJYA 1MIEH 4HKZA 4I18B 4Z77A 3GI8L 3IAPA 3T0EA 5CKAA 2ZOKA 3QO1A 4WY7H 3RX8A 1I1CA 1UCTA 3AS2A 2HMID 1TXKA 1WWWX 3LB6C 1DSFL 3PQYD 3QDJD 5EWIH 4X4YB 1A22B 4JPKH 2VE6A 4YDKL 5D7LB 4PJIB 4PLJD 2FATL 5C2UB 4UNTA 2BXZA 2Y06H 1FFPB 1MF2L 1FNGA 5D7JC 4YHNA 3VU2A 3UP1A 1JJUA 2ZUQC 1UADC 3T2NH 3QFJD 4I5BA 2JB6B 1VFUA 3QEQD 4MVBC 1WICA 5E2VL 3RL1B 3VFTB 4TVSa 4Y4KD 1WC7A 1RZKL 4PJ5E 4WUUB 4Q58C 1OAQL 4BFIA 5KAQG 2H2SC 1RUML 3CFBB 3QZWA 4LCYA 4ZUVB 1CK0L 1Q72H 4R4ND 4OZIE 3MV9D 3MREA 4KKNA 3C09C 4O58H 4GRLD 2Y7QA 5IR1A 4ODTH 4W4OA 1A6AA 4M00A 4MAUH 3UTSA 2L7UA 1C1EL 5EA0H 2LAGB 5LQBL 2WWKT 4HJGB 1Q0YH 4JFOA 5KSAD 2DQFB 2UZYB 4QHMB 3DURA 3TCLB 3T4AA 5HY9A 3V0AC 3IDIB 2ADGA 2OCFD 4N0YL 3X14B 1XH3B 3CSGA 2NXZB 2CLZB 1HQRB 2NZIA 4ESKA 2FR4B 2Y72A 5BO1H 3A67L 1WTLA 4LLVA 1SY6A 2J7LA 3U4EA 3V52L 1CZ8H 5MEQB 2Z91A 2Y5TB 4UOJA 2FJHA 3LKSA 4Q6IC 5MI0B 5DR5L 5F9OL 3ULVF 1IC7L 2J12B 3NMEA 4P2OC 4NN7B 2NZ9D 2ZKHL 2GKIA 1NC2D 4NQSB 4EIZC 5DEZA 4PJHF 2QSVA 1A6UH 2DQJL 3NFPB 3NZHH 3T65B 3KPNA 1QFPA 4XVJL 2MFNA 4IRSA 1J5OH 1S5HB 3TH3T 1MNUL 1DVFA 2OTUB 2UWEB 5F9WB 3VXPA 2R2HB 3MSPA 4PRNB 2H2PD 4ODVL 1DANT 2EH7H 5DVMA 5JZ7D 3L6FB 5I0DA 1QFWH 2LAAA 3KJ6L 3O9WA 4HDIB 4R7DB 3UBXG 1IGIH 1AFVL 5F7MC 4LLYA 4PRDA 2XA8H 5D70L 3JWOL 3V4UL 3EIFA 3CK0L 5GS0L 3BN3B 3TWCH 1F45A 2BVYA 1I9EA 4DWHA 1VB9A 3X3GL 1CGYA 4RFOH 2CRZA 3BT2H 4ZNEE 5JA9A 2EXWD 4OIAA 5DRWB 1QR1B 1TZHA 2DQCH 1FJ1A 3MBEC 2J5LB 4LLAA 4LRIA 3RIAK 4S2SB 2JCCF 4FFZL 3BIBX 3RL2A 1RJZA 3HZYA 1BD2B 2DL2A 3DGGA 1DL7L 4NKDA 3FFCA 1U6AL 5ENWB 1E28A 3JWDC 4P5TD 1G0DA 1KELH 3VWJB 2OZ4H 2FL5B 5IQ7L 2XFXB 5DJDB 1IKNC 1A47A 3KPSE 4XNZB 4NHCH 1QOKA 2GJ6E 3UC0H 4PJ8B 4Z6AT 5CJ8A 4LSSL 3U46B 4KK5C 4R2GB 4H8WH 2UZXB 2W0KA 4MQ7A 5FM4A 4NJ9L 2FHCA 3OKOB 2VXTH 4L3AA 1UJ3A 4G6MH 3EO0B 1C12A 2VDQL 1YEFL 3NA9L 1FFOB 4RX4A 2WK2A 1QQDA 3QCVH 5HHOB 2NY6B 4HC1A 2RB8A 3L3KA 2E9WA 1QFOA 3T2OA 1W0WB 4YR6B 4U1JB 5T33L 4I3GA 5CFHA 3THMH 1JPFA 4F7EA 3CNKA 1JUFA 4XCNB 1R3IH 5MEOB 4UT6L 3RWJB 2NY4C 5ADOH 5GS1C 3STZA 2VLKD 2K3TA 1BVKB 1ETZB 4D94A 2FBOJ 1A1MB 2DQTL 4I18C 2ATPA 5FYLL 5JOFB 1F13A 4BQ9A 3PGFH 2OSLB 4ETYA 5H94B 1MRFH 4HUKB 3SGJA 3GBML 1HEZA 1YMMA 4PJAA 5CZXD 1NBQA 3FQTA 3RZWA 3QUKB 2ZSWB 1TMCB 1R5WA 4L8BA 1A3LH 2A74A 5EOQH 2RCSL 1YEHH 3MA9H 1C5BH 2VDLH 1D9KC 3KS0J 4XCFL 1U41A 3T0EE 2P24B 1BOGB 1Y6NR 1I7ZA 1HZHL 5JXED 4D0BA 2A9NL 2GJZA 1JGUL 2ERJB 4FTVB 4TSAH 3O6FA 1ES0A 3MNVA 4LU5L 1KYOJ 4NNPL 4ZSOA 3RPIA 3WJJA 3H3BC 2GT9A 2B4CL 4H25A 2QSCH 3HNSL 1EAPB 4L3EA 1NUDA 1NBYB 4Y5YB 2N7AA 2PYFB 3FOMA 3RNKB 3HUJF 3FT3A 5FA3A 4IMKC 4GW1A 4KKLC 1OF2B 1TQBB 1BAFL 1DCLA 4OZ4B 3S9DB 2X4UA 3AM8A 4JDZA 4P23B 4GW5B 2JJTA 2AABH 4Q0XH 3DGCR 2VL5B 3ZE2E 3P0GB 5MP6L 1QFHA 1N5YH 2IPKB 1KIPA 3OKNA 5DT1H 3KLAB 2VR4A 1C5DB 4HK3J 1WWAX 4J6RL 1U58A 2VIRA 3BP7A 2B7DT 1HKLH 1RHHA 2YA2A 1MVFA 3P4LA 1NFKA 4NOFA 4XTRC 5DJ2B 4YO0A 2VXUL 5AD0B 4FQLH 3FO1B 1FV1B 1WJ3A 5C0CA 1ZOXA 3UTSE 3TIEA 1Q0XH 5JLZA 4N9GB 4ODWB 4P5MA 1CGSH 5MI0C 3GSXA 4IRJB 2FGWL 3UO1H 4X5WB 5I2IA 4NN7C 3O8XA 1I7TA 1B90A 2YK1H 3ARDD 3PHSA 4HIEB 5BXFA 1KJVA 1FIGL 5DO2D 5TF1H 3TC9A 5HHPA 5JPMB 3AMLA 3K8LA 4JKMA 3F12A 4PJ9A 5F9WC 4YHYB 1S9WB 4H1LB 1QTYT 4YGAB 3SDXA 4C4KO 4AT6B 4UU9A 4H88L 1JL8A 1U93B 3S36L 4V2CB 1J05A 1JYWA 3GMOB 4R0LA 4D0DB 1N0LA 1JGLL 5JW5A 4IOIB 4ORZC 4B5EA 2R1YB 2HT2D 3BIAX 4G6JH 4JQIL 2R0WH 5C7XL 4PJCB 1ED3B 1BGXL 3HB3D 3MV8A 3KWWA 4WV1B 2J5LC 4P2RA 5DD5H 1RVFH 2PO6A 2YUVA 1MHHA 5ACLA 5HGHB 1YC8A 4RDQG 3UJTL 4N0UB 4EUPA 3EGSB 5L9DH 3RWCB 5F9JB 1BEYH 3BGAA 1CGXA 3TZVA 3OKKB 2VAJA 3L1OL 3L3IA 1DBAL 4P46D 2VDRL 4QRSA 4D9QD 4QTIL 1AXTH 4XNZC 1T22A 1XZ0A 1OSZB 3ZKND 4QHUA 5FA4B 4F7PA 4ZFGL 1OAYL 4R2GC 2AS5M 3FFCE 1RULL 1CXFA 4ZAKB 5DD0L 2AJZB 4MJ6B 3L3HB 1PBYA 2HA1A 2NNAA 2VDNL 3QT2A 1TJIH 2EXYD 2YHGA 5I8OH 5D5MF 1CBVH 3P0VH 3L3JA 3DSFL 1MCCA 5DXWA 3HLAB 1PZUB 2R1WB 3HAEA 4U1NA 3LY6A 1E4JA 1FVDA 1NLBL 1OAZH 4G6AC 4DKDC 4OLYL 3QEHB 1KYOK 1J12A 2NY6C 4XBEH 5F89A 3KXFD 4CMMB 4WU5A 2NTFA 4JVPA 5ERWB 3KPRA 1RZFH 4JB9H 4X6BB 1I85C 2HH0L 5K9JL 1CR9H 2VH5H 5DZNA 3DMMA 4I9WD 1FYTB 4L8SA 2VLLB 4NZUL 1A7PL 4KK6D 4QTHA 4GKNA 3F58H 1ZT1A 1JI2A 1GZQA 3S96B 3BW9A 4POZD 5FGSA 4MD0A 3I84A 2PXYB 2AJ3B 5SWSD 1CXLA 1FZJB 1S3KH 3CGTA 1HINH 4ZO9A 3SJVB 3L5IA 2GTZB 5C07A 1I8LA 3SE9L 4BQBA 3GMNB 4XHJC 4GQ9H 4OCXH 4W4NA 2YSSA 3GMPA 2BSSA 5JPNA 2X4OB 3VJ6A 1YMME 2ERJC 3P9MA 4PJAE 5H37G 4AEFA 3QA3B 3WN5B 3HC3L 1JHLL 3BE1L 4MXVE 4PJHB 3MUGA 4G9FB 4RNRA 3RWEB 3REVA 4FQXD 4Y5YC 3SDAB 3VXNA 1GVIA 5A40E 5E99H 3CVIH 1OD9A 1T7ZA 4LCWA 4PTTA 4JR9L 5ANMB 1RZJL 1QLEL 1TQBC 5CD3A 5ESVB 3ZDYE 1PSKH 5I18H 3CDYA 5C9KA 1HIML 1G6RH 4FFVD 4P23C 2HKHH 5KN5A 1CFNA 2IFGA 2Z93B 2VMFA 4ZSOE 3VI4E 1F4YL 1K8DB 4L3EE 4L4JA 5HGBB 4KKBC 4LBEB 1IAIL 1MAMH 3W9EB 4U3XA 2BHZA 5HVGB 3W9DA 1K4CA 4PRAB 4ZUTA 5D1ZA 1MCNA 5BS0A 5IGXH 5JHDB 3D3VA 4OM0L 3BWAB 2CO7B 3QFDB 1B4JH 4ZD3H 5DMIH 3X17A 4PGEA 5DVOA 2FBJH 1ZLVH 1CDHA 4IRJC 4HPOL 4G80B 5GGVL 1CGVA 1ZEAH 2XA3A 2VDOL 4FZ8H 3L7EA 3MV7D 5CCKL 2Q8BH 1FG9C 4G8EB 4XRCB 4KAQL 3OTTA 5HI5D 3QJFB 5EZIH 1FVEA 3WKNA 5CGYC 3KYNA 4Z7UA 3G5XB 4M93B 1BWMA 3SKOA 5C0CE 4YHYC 4TOYL 1BVLA 4MNQA 2FX8H 1F58H 1VGEH 1X5HA 3LKRB 2ZOLB 4ISVB 4FMKA 4K9EL 3JWDH 2XXCB 1CVRA 3QIWD 4ZO8A 5GGRA 3BKJH 1MIML 1E6OL 3O0RL 2R0KH 1HH9B 4G8IB 4OJFH 5J11B 2IH3A 2Z9TA 5IVXF 3MBXH 3ZYIA 1NJ9A 4GBXB 3B6SA 5BVPH 2NY7H 3SOBH 1HHHA 4ODHH 4YBQC 4XXCC 2A6JA 5ITFA 1YEKH 4PJEA 5J0BA 1DN0A 3OKLA 3SDXE 3NAAH 1YNKL 4ZUWA 4ZS7L 4IM8A 3M8OH 3MLXH 1BQLL 2MHAA 1DBJL 2QBWA 3H42L 3BGMB 2BSTB 4ZDHA 1QP1A 2HFFB 2XQBL 2BNQB 3GGWA 3D0LA 3FO0H 4G43A 5IFJB 1FL5B 1PYWA 3U0WH 1ZHLB 4RAUA 2CDEA 4G6FD 2BOBA 2IMMA 1ND0B 4QWWC 4U1SA 4K3HA 3RFZC 2QKIA 4I0KA 3MV8E 3EDJA 4P2RE 1G7IB 3B2VL 3EDDA 43C9B 4O2FA 1GOFA 3T3ME 5GHWH 5J13C 2VXVL 4F57L 3ARBD 1JVKA 1CD9B 3NFSH 5IVZB 4ZAKC 4JFDD 4Y8DC 3T0DA 4CL7A 4EI5D 1P6AB 4JPIB 3IKCB 4M6NL 1KEML 1GHFL 1T04A 4KTEH 5EOCJ 3KNBA 2YC1A 1WFUA 1UM6L 4BSWB 2CO6B 3QP3A 2YZ1A 1H0DB 1KB9J 5MERA 1NAKH 4L9LB 5ISZB 3QDMA 2AV7A 2A6KB 4PB9H 2G75A 3ZYJA 3AXLA 1KN2H 4FQ1H 1P7KA 1YEIL 2W9EL 2H8PB 1KJ2A 4AM0B 3BDXA 3VFPB 2OMNA 2GCYA 4PR5B 1YN6A 3PJSB 5E8DH 4KTDL 2YPLA 4TNVK 3IDJB 3LV3A 2HWZH 1ZA3B 1J88A 1WVZA 4DTGL 4HWEH 1RIHH 4FQ2L 4XB8A 1XGUA 5HYJB 5I8CA 3P11L 2R56H 1MCJA 1NGQH 4ZPTA 4PRHD 1UZ6E 1MRDL 5D7JA 1ZVSA 1OAUL 4E5XB 4AH2B 2ESVA 3KPRE 4I3RH 3BHBA 5E9DA 1OP9A 3QIUB 3CLEH 3JV6A 2A83B 1DLHB 4JQVA 2ICEB 4KJWD 3FQUA 2BY1A 1G0XA 4P3DB 2VZUA 4Z7WF 1QPPA 4QRRB 4M5YH 3ULVC 2ENSA 4HZAA 2Z92B 5FV2A 1Y18A 4BSJA 3WN5C 5BVJB 1LVEA 1UKTA 2DYPD 2YXMA 4UDUB 3SDAC 3EYFA 3KAAA 3R1GH 5F7YC 3HZKB 5C07E 3WNNA 1XR8A 5AYQA 4KQ3L 1UC6A 2EE2A 1M1SA 3HMXL 5DHVH 3F7RA 4XPHH 2V2TA 1LEGB 1QO3B 4I8DA 4PJFA 1OGAD 2Q1EA 2NTSP 4PRIB 1V7NL 1X5AA 1TVBB 3IDGA 4L4TB 4GMSL 1G0YR 1N59A 1P4LA 4O9HL 3GI9L 3MODH 4LCWE 3V8CA 2CDGA 3V6OC 4NO0A 2Z31A 4HS3A 5I30L 4P2OA 3FKUS 4PBVC 4UBDD 1XF1A 1NC4B 3ECBA 4LPCA 5FIEA 2R0LH 4F37K 4E41A 5C92A 1HILB 4MXQC 1H8NA 5DRNB 3BVNB 1NQBA 3GSWA 2EYRA 3O3UN 1XF2A 3W11D 1JZ2A 5L2JA 2ID5A 5CP3A 1UJTA 5F7DB 5BS0E 4UZGA 1BQUA 3GKWH 2ITDA 4M93C 3O45B 1Q9WA 3D3VE 1INDH 4HLZG 1BZ7A 1GGTA 3MJ8A 1XMWA 5IB1B 4JY5L 3KPTA 5I1IL 3IFOB 4MA3A 3WJLC 3CVHL 3GSNA 2J6EL 4NUGL 4NZJA 4DEPB 2JKXA 4H20L 3GNMH 5J11C 2OR7A 3QUZA 1EEUA 5C0AB 3PF2A 4GBXC 4Z7UE 4BUHA 4FHBD 4MQTB 4NKMA 3NVQA 1CF8H 5DURB 4HH9A 3VGBA 4JDVB 4MNQE 25C8L 5HI4C 4YNYA 1D5ZB 5D72H 4HLZH 4XP5H 1KB9K 4N5UA 4X6DF 2NLJA 5DD6A 3AROA 2CUMA 3SKJH 1U2HA 1F90L 1IKNA 4Y4FD 2PR4L 3BRFA 4POUB 1SVZA 1H3PL 4Q2ZB 1FE8L 3TO4D 5I19L 2IALA 1ZS8B 3ZLQC 3VE0B 1KFAH 5ICZB 4Z7QF 4OF7A 1IGJB 3EYOA 5EU7E 1IZKA 2KQNA 1DLFL 3BAEH 5D71H 4PJEE 5BRZB 5K93A 4BSVA 4K3JL 1NGYB 2A1WH 3MXVH 3HC4L 1OTUC 4WFED 4AMKL 1AXIB 1OWRM 3QIBA 3RAJL 4X6FB 4K3GA 3L5WA 3OAUH 2G60L 5JIKA 3SPVA 3EAKA 4JEGB 1Y0LB 3HNTH 2C3HA 4WU7B 2FLRT 4GSDL 2VDML 4HZLB 5A16A 1HH6A 1RUPH 1SBSH 3MLTA 5E4EB 1HYSD 4NRZA 1E4XH 2C9AA 4WEBL 2GHWB 4XI5C 1EFXA 4TULL 1R24B 4Z7VF 2DQIL 1SM3H 2CGRL 2OR9L 3O2DA 5GS1A 4GAFB 2BNUA 4L9LC 1LWRA 4DZBB 1DBKH 4OIIL 3VFWB 4KKAD 4I18A 5JIPA 1I4FB 3S34L 3TT3H 5GZNC 1JWUB 4KZEL 1YNLH 4RIRB 4YXKH 5T3ZD 2RJMA 1PX3A 4K8RL 1WZLA 5F6HJ 4MD4B 4YDJB 3TP4A 2PYEA 3CH1B 1FG2B 5DUPH 3G5YB 3OBAA 4JJHA 4XVTH 3RWHB 5B4MD 2IF7A 3RX5A 2CMRL 1N2RB 4KV5E 3WD5H 1FH5L 1A14H 4PJIA 3QDME 1JNJA 4ZODA 1A6PA 4H0IA 1FFPA 5FYJU 5ACMA 2Y4SA 2QLVB 3SKNA 1FLTX 2HVJB 4JREB 2ZSVB 2Q76B 2JB6A 3B2UD 3VFTA 3QIUC 2YPLE 2VLRA 1S9VB 4GAYB 1G7MA 3LH2H 4WUUA 5F88B 1FNEB 3S4SB 1V5JA 3W81A 1PG7L 2QHRH 3ZSSA 4YWGH 4ZUVA 3EYSL 1PFCA 3T0WA 1DQQB 3EJYD 3WSQL 3PGDB 4HF5L 2CDFB 2ESVE 1RZKC 4GXUM 4H1LG 5E9DE 4N0CC 2VITA 5TE6H 5IKCB 2RHEA 5IJKA 4HJGA 2Y6SD 4HIHB 4GKOA 1WTGT 3WXVL 4QHMA 4RFNB 3TCLA 4M62H 3NIDF 4I4WB 4LP5A 4U6VH 3O2VH 3IDIA 5JIHA 2WUBH 3X14A 1XGYL 4Y0GA 2CLZA 1HQRA 5IVXB 2FR4A 4J2XA 5FUCC 2K7PA 5HHNB 4P4KD 1LE5B 1QSZA 5ALBH 5MEQA 1WBYB 2B39A 2VABA 1RZIB 3RKDD 4PJFE 5FHAH 5CEZH 5C8JB 3BZ4B 4NQSA 3B9KB 2BNRB 3R0NA 2PETA 1I3VA 1S5HA 3BI9X 2OTUA 2UWEA 3AAZB 4KK8C 1S9XB 4LHJB 1HNFA 2R2HA 5EUKA 2ZJSH 4PRNA 4XMPH 3H3PH 3LPFA 1BFSA 4GFTB 4PJ5D 3VXOB 4R7DA 4HDIA 1TJHH 3GM0A 2FYYB 4NQCA 1EH9A 3S98A 4NWUH 2VN4A 4Z95H 4UOW0 4K55A 5I1EL 4E41E 4NWTH 4DEPC 3VFOB 3FQXB 2H1PL 5DRWA 1QR1A 4QCIA 4UUJA 4S2SA 3VG0L 5DFVC 3JWOC 1W0YT 5GS0C 1BD2A 2EIBA 1LO2L 3OWEA 5ENWA 1AC6A 2VSCA 4YLQT 3VWJA 5M94B 4GW4B 3A0OA 3EOAB 1A7QH 4R3SA 5DJDA 1I1RA 4MCZA 1N6QL 5HTSA 3WFHB 5HYIA 3EJZC 2BDNH 5HHVH 1IFHL 1N4XL 4PJ8A 4LHUA 3U46A 1GXEA 2ZCLL 5KSVA 2VZOA 4YFLF 3B8YA 4DW2H 2GK2A 1IT9H 4PJXA 1P4BL 4OSUH 5BJTA 3ARGD 1G1CA 3AGVA 3CC5A 3OKOA 4LCCB 1CDBA 4U7KA 3MRPB 3EO0A 4RFEB 1DQLH 4WGWB 5JO5B 4UTAH 4RQQB 3J8F7 4ZTOL 3ARFB 4QEGA 4N8CL 3DVGB 3RDTB 5INCA 5HHOA 3V9FA 3PHQB 3KPLB 3DETD 4OV5B 4JLRA 4NM8L 1GGBH 2DMKA 1W0WA 4YR6A 4U1JA 5FYKU 5FYJH 1B2WL 1PW3A 4ONFL 5D9SB 4XNQB 1OP3K 3MLRL 5MEOA 3RWJA 5C0EB 4R4BB 3VXSB 4OI8A 1BVKA 1ETZA 1KCVH 1A1MA 3W2DL 2UVEA 5JW4M 4DGVH 5JOFA 2OSLA 3AS3A 2CIIB 4WFHE 2DMBA 5CP7B 1D5XB 2BVUA 4L5FH 5DWUH 2JB5L 4BELD 1RUAH 3TNMA 1GGYA 1DFBL 2X2YA 3VGEA 2F54B 3VD9A 2EDDA 3QUKA 4ORGA 1DBML 3LEVH 5CIPB 1MJUH 2GJ6D 2P24A 2E7CA 4LPUA 5HGAB 1OGTA 4JREC 2M2DA 1RU9L 4BZYA 3TCXA 2PYEE 4FFWC 2X1XR 1F4HA 4FQJL 2XIDA 4PS4L 4W6YB 1NBYA 4UIKL 2PYFA 4K7PY 1R3JB 3RNKA 1LEIA 2AEPL 4JFFD 3QHFL 4PJIE 4LLUB 1MCIA 4LASL 1OF2A 4NFDA 1LHZA 3VW3H 4P23A 2XPGB 4A6YL 4GW5A 5DS8B 3MLUL 5IEHB 4H0HB 4OI9A 2WWMC 2VL5A 3QUMA 3O6LL 2L4OA 5C0RH 3U0TB 2VLRE 3TF7C 2IPKA 2HLAB 4WUUE 5F71A 3KLAA 1C5DA 4RFNC 1CDIA 1FBIL 3MLSL 4YXLH 2LABA 1MCBA 1JF6A 1I1FA 4X9IA 1S5IL 4P3WA 5DJ2A 5AD0A 5JOPE 3WE6A 4JHWL 5EU6B 2BP3A 4KHXH 1ZLWK 3T08A 4HWZB 5D1QB 4N9GA 3VWKD 4ODWA 3U4AA 1NAMH 3CH8A 3GO1L 2EKSB 4IRJA 4U6TA 4X5WA 2VZVA 3O11B 2NY5C 3UROR 3I9GH 1M7DB 3O6KL 3IDUA 3LRGA 1G7LB 3B9KC 1MI5D 1RZ8B 1GRWA 5GPRA 1MCOL 3HR6A 2X4SB 3HTLX 1G9MC 5JPMA 3WNOA 4JN1H 1S9WA 4G42B 1LO0L 2VLJB 1A21A 4H1LA 4NCC1 4KKCD 4OD1L 5EIQA 2EYSB 3QRFM 5J3HD 4AT6A 2NCMA 1N7MH 3AU1A 2B2XL 4OGYL 4NKIH 1CICA 4KGLA 1CDJA 3KR3L 1RUKH 3JUZA 3GMOA 1WEJH 3TJHC 2DQGH 1I7RB 4D0DA 2EC8A 1MQKH 4IOIA 1KCLA 3RVWD 4RGOH 5GGQL 5D96C 5KSBF 2RFXB 4G7VH 1OP3H 4KWUA 4MZ2A 4M7JL 5LBSH 2UWEE 3VFGL 2IQAB 4PJCA 1ED3A 2D31B 2JJWA 4JZNB 4V2BA 4WV1A 3MZTA 2D7TH 3HE6A 3MUHL 2V9TA 4JCMA 1QR4A 4MA8H 3VD3A 4Z7VB 4NQCE 1V3JA 4Y2DD 5HGHA 5TDOB 2E6QA 4N0UA 4FQCL 3EGSA 4JO1L 3RWCA 3LS4H 5F9JA 4D0CB 1OB1B 3OKKA 4R90L 2F8OA 4X9HA 5ESQB 5ADPH 1IVLA 4OLUL 4KK9C 1IGYB 1A3RL 3UTSD 5JMOC 3TVMB 1D3CA 5FYKH 3RJQB 1QFUL 4RBPK 5J6GA 1OSZA 3L95B 3DNKA 3MLVH 2F19L 4RGNE 5FA4A 4JQXC 2VDPL 3W0WB 4UB0L 2V7NA 4HUWA 1BD2E 1I9JH 1ULVA 1T3FB 4YJZL 5IBTH 4LCUB 4ZAKA 4X7SL 1HSBB 4MJ6A 5FO9B 4OLVH 4S1SL 3L3HA 5DRZA 1MFDH 3HLAA 2R1WA 3ARFC 3GSVA 5FCUL 5C0FB 3ARYA 3RDTC 3QHZL 4YHLL 2XZCH 3G08B 3QEHA 1IC5H 3Q0HA 3UZEA 1JMZA 4C56D 4M43L 3S3JA 5CZXC 2YWZA 2XOTA 4PJXE 4HGKC 4CMMA 3H9YA 4LLDB 4JFEB 1DVFD 3E6FB 4X6BA 2JK5B 3B43A 5E24E 4OFIA 2BVTA 4DVRH 5A2KH 1YQVL 5J12B 1FYTA 2VLLA 5HHOE 3WO4C 3O9WD 3IJSA 1JZ6A 2QQLL 4NQEB 3P73B 4J8RB 1ZLWH 3S96A 2DQDH 1FSKB 4OTXH 4QGYA 4HK0B 1MF2H 2PXYA 2AJ3A 3MTRA 1FZJA 3LDBB 3OX8B 5KVGH 3U0PB 4MJID 3SJVA 4KC3B 2GTZA 4FNLL 4OCSL 2E8ZA 3DXAB 5HPOA 1NSNL 4N8PA 5I1GL 3IKKA 1FNFA 3GMNA 2HJLB 5IIEB 2UUDK 2DLTA 3FFCD 1VFBB 4QGTA 2X4OA 4JVWA 1X3DA 2UVFA 1I9IH 5IW6B 3WHXB 4G9FA 4RMWA 1WCBB 3RWEA 3SDAA 2NMSA 1EO7A 5I17B 3LKQB 5ANMA 5LQBH 5ESVA 2FIKB 4DAGL 3MACL 1FL3B 3LQZB 4PB0L 5EU3B 3ZE0F 4Y5VB 1GIGH 2SEBB 3OR7B 1PKQA 4OF3A 1T6WA 2Z93A 3RZCD 3GBNL 5DD3H 3MYZA 1K8DA 3WCYA 5KSUB 4PJGF 5IBLD 5C08B 1U0QA 1CFVL 3DRTB 3MYJB 4FABH 4LBEA 5ICXB 4GT7A 4S1DC 4LMQI 3QXDA 3GJEB 4PRAA 5B21A 3K7UA 1T20A 3Q3GB 1AR1D 5IB5B 5F9OH 4Y2OA 3ZHLA 5F21B 4AIZB 3BWAA 1CDYA 3QFDA 4ELMA 1DANU 4RBPH 4MXWL 2JELH 4S11A 5D1QC 3WLWD 1N5AA 4Y4HB 3SKMB 4Z18A 3NPSC 4OFYA 5GGTA 4G80A 1TNMA 4MJ5B 4HUUB 3QUYB 5DVNA 2VISB 4OFKA 4Y19B 1QBAA 4BQ6A 4MLIA 4XRCA 3QJFA 4EOWH 4XGZB 1CXIA 4S1RL 3VG9C 4ONHA 1ZLSL 4NKQB 4PGBB 4HV8A 4K2UH 1VPOL 1YMMD 5GS0H 4PJBB 2BMKB 1QSEA 4JZOA 2ZOLA 4ISVA 3VI3F 4NFCA 2MOVA 2AAVA 3EFDL 4KY1L 5I1LB 3OG6B 4XPBH 2J4WL 4KVCL 1FZOB 4G8IA 1C7SA 1HH9A 3KLHC 1T80A 4LDOB 3U9PL 1K6QH 4F80A 2OI9B 2XZZA 5C6PB 1U6AH 4K9EC 3CVHB 5D2NB 2GUOB 5JDJA 2DOCA 1YEEH 1BJ8A 1G9NL 4HX1A 4L3ED 3MA7B 1V8HA 5HJ3B 2BSTA 4X7CC 2HFFA 4YDIL 5FKPA 4N0RA 2VLME 3IU4L 2EDTA 4OZIF 2BNQA 3C08H 5EDXA 5IFJA 1FL5A 4JG1H 1ZHLA 2X89A 3MMEB 1JZ8A 4DJMA 2IGFL 4HQQL 2NY1D 3VDAA 4XWGH 1I3RB 4U0QB 4UINL 4PJCE 2DWDB 3TVMC 2F5BL 1XEDA 2O5ZL 2DM7A 1S78C 2FSEB 1AQDA 3GKZA 4GMTL 3P4MA 4N0UE 5IVZA 4PGDB 2G5BB 4XC1H 4XNUL 2XZAL 5E6IA 2NYYD 2DIBA 4YPJA 4JPIA 3LMJH 5C0CD 3IKCA 3DX9B 4BYHA 4PP1D 1DQDH 1BM3H 2P46B 4LPTA 1YQ2A 4BSWA 3S4SG 1BZQK 5IV2B 1H0DA 3GJFA 5HDQL 4L9LA 4POZC 2A6KA 5CJQL 5FYLH 2I27N 1A5FH 3QUXB 4U6HB 2CRMA 3WIHL 4D3CL 2H8PA 1XCTB 3KPOB 5D7KE 2AEQH 3IDJA 5J12C 4XP1H 1S9YB 4N9OB 5E2UH 1WT5C 4LPYA 4TVPL 1FSKC 3GB7B 5HYJA 3U6RB 1H15B 4X7FC 1VADA 3LDBC 5K9OB 4K3EL 1ZT4B 3RY5A 1IL1B 5GJSH 3P2TA 5HYQB 1MWAH 1H8OA 4IDJL 1M4KA 4LU5H 4X99A 2Q6WB 3CSYA 3QIUA 4P2RD 1ZHKB 4S1QH 4ELKB 1FYTE 2A83A 5JORB 1DLHA 2PO6D 1CFQB 4HIXH 2ICEA 3P77B 4QRRA 1FLRH 3BUYB 2Z92A 3OXRB 1KIQB 5SX4I 1OP5K 4GS7B 3MO1A 3P0YH 4MMZC 3FCTA 4HC1L 4UDUA 1R3HB 4GUPB 2R23B 3SE8L 3SJVE 3FZUC 3ZDXE 5I15L 4CKVX 2D2OA 4HBQA 3HZKA 4PD4J 1OPGL 1RIVL 4O51B 5AZ2H 2FEDD 3DV4B 3WKMH 4NJAH 4J6RH 1LEGA 1QO3A 3HI6L 3LD8C 3ULVE 4Y5VC 1WV7T 4PRIA 1PX4A 2FX9L 2NY5H 4RMSA 2L7JA 5DA4A 1TVBA 1XIWB 4L4TA 2Y36H 4PJHE 1QBLH 4G9FE 5KSBB 1TETH 3HNVH 3N85L 4JN2B 2P43B 4HD9A 3FAXA 2APVA 3HZMB 1G9MH 2RR3A 2BY0A 4RSVA 5ANME 1VEOA 1VHPA 1AI1H 2EDHA 1A0QH 4KJPC 5F7EH 2WLZA 3C60B 1PKQE 4R8WL 1QFWI 1T2QL 3CXHJ 1JI1A 3QI9D 5GRWA 3QG6B 4P9ML 1HILA 2NW2B 3PWPB 3TBWA 3QUYC 3KPRD 5DRNA 3BVNA 3EHBC 2I24N 3OXSA 3DMMD 1HI6B 4HJJL 4CW1B 3BPOC 3E8UH 3LKPB 5JHDE 3O45A 5JW4R 4JGUA 5GGSY 4ELME 5IB1A 4W68A 1F8TL 2B20A 1KF9B 5CAYB 2BVQB 1NCAH 5KS9B 4X0KB 1UACH 1A6ZB 3UBXI 2HP4A 4U1LB 5C07D 5D6DC 5EFIA 1K4DB 3K0WA 5C0AA 5J1SC 4IHOB 3ABZA 4DKFH 2OI9C 3E0GA 1OOAA 1FGNL 4C83B 2OTPA 3UJTH 5A1AA 1NBVH 1B6UA 4JDVA 4WUKH 5D2NC 1M71B 1D5ZA 1SYSA 1NGXB 3H6JA 1QSEE 3BRDA 4URTB 1FZMB 2FECL 5JW3H 5CEYA 2WIIB 4UT9L 5TE7H 3MUJA 5GZOD 2BSED 4LCWD 4Q2ZA 2VRAA 3D0VA 1ZS8A 3VE0A 4EEEA 5KTEH 5ICZA 1LEKB 1OAYH 4KTYA 1IGJA 3ZE2F 3H0TB 1S7WA 1TNNA 2IQ9L 4DZ8B 2XKNB 1NBZB 4G8GB 1HK6A 4U6XB 1NGYA 2EIZB 3SDYL 3ZKQD 5GRXG 2OMBA 3EKCA 4NT6B 5DSCB 1RK1B 3QQ9C 2WQ8A 4M6MH 4KZDL 1OP5H 3MRQB 4X6FA 3QWRA 2BNQE 4OZHF 5D1ZD 5TQ0H 2MWCA 3QCTL 4OLYH 2XG4A 1Y0LA 3D3VD 2HN7A 4WU7A 4EBQH 3ZT5A 4HZLA 2HTLC 4L1HA 4NO3A 4K71C 4J3XA 1U8PB 3WFBH 5CINL 2C4FT 2XG5A 4F9LA 2AXJA 1EAJA 1R24A 1WIOA 2ENYA 2YD9A 3D2UA 4GG6F 1QRKA 4DZBA 3BQUB 1WZ1L 5C71A 3QR2A 1I4FA 2WBJA 3UTPE 5CIPH 1JWUA 4PD4K 4RIRA 2ZNWA 1GPOH 4MNQD 2R9HD 4YDJA 3HRPA 3CH1A 1J8KA 3D69A 3G5YA 4ALAH 3RWHA 1A6WH 1G1YA 4PJGB 1IAIM 5LWYL 1KCUL 2EKJA 1U8LB 1KIRB 3FN3A 1CLYH 3ROOB 2LV4A 5IBUB 4QRQA 4QRPB 5GSVB 5DK2B 2OS7A 4XVSH 1NL0H 4U0RB 4HUXA 5I1KL 5C09B 1U3ZA 2ICES 1UM5H 2HVJA 1RIUL 2Q76A 1WBZB 1IGCL 3TBYB 1JHLH 3BSZH 4N90E 4GAYA 1S9VA 3MROB 1H9VA 1R5IB 3BIKB 1FNEA 5DYOB 3S4SA 5LKNA 5C86A 3CXHK 4XBGB 5CSBA 5HYJE 2N4IA 1FAIL 4GS7C 3RX7A 1DQQA 4JRXD 3RUGB 3U7WL 1HIMH 4NGHH 2ED9A 4OZFB 1MCLA 2COQA 4MA7L 2W9DL 2CDFA 2ADFL 4L8CB 4OLWL 1J1PL 2FD6L 3GK8L 5CJ5A 1E0OB 2ARWA 5IKCA 2K7QA 4HIHA 3RTQA 2HAZA 3BO8B 3GRWL 4AEIH 4R96B 4QRRE 3UTTA 3FT4B 5I1HL 4A6YB 1HQ4B 1U8JB 2XACC 4I4WA 1XIWC 2GK0B 1EEZB 5IVXA 2X1QA 5C6TL 1OW0C 5T1MB 1LE5A 4OZGB 4OCLC 2DLIA 4OF5A 2CUHA 4GRMB 1T0MB 2FH6A 1QRND 4NO5B 4HPOH 1WBYA 1Z9OA 3EOYG 4QHNB 5E5RB 3UYRL 1RZIA 2AJVH 3V5DB 3C5JB 3C60C 4PRIE 4Z78B 3BZ4A 3B9KA 4TUJA 4L4TE 1T83C 5FUCE 3AAZA 3G5ZA 5LGHL 5FGBC 4HUNB 3VFMB 3PDGA 1NUGA 3LB6D 2YPLD 3CIQA 1JP5A 3VXOA 3L5HA 1KBGH 4D9RE 3CLFH 2FYYA 2V17L 5TQ2H 2ORBL 5SWZD 4K7FB 3LOWA 4GXVL 3SE4C 5D7JD 4EIGB 3HCVB 4PG2C 2ESVD 3FQXA 2EICA 1J8HA 4MVBD 2APWA 3QPXL 3QAZB 1MRCL 1DBJH 3TH4T 2OL3A 1KC5H 2QQNL 2H2SD 1L7IL 2WWKO 4I3SL 5BV7C 2CLVB 1NEZB 5FGCE 4POYA 3IF1B 1LGVA 2P47B 3ALPA 1U8OB 3RU8H 2P8LB 3TYFB 3TV3L 1DEEB 1DQMH 5C0AE 1MJJB 4DGYL 4QXWA 4JQXA 3CJJA 1UWEL 3K4DA 3DHJA 3ZT6A 1NGZA 1Y6MR 1HXMB 5CD5D 2VKWA 5LJYH 3Q6FB 2IANA 4YXHL 3A6CL 4OD3H 4LCCA 3MRPA 4Q9RL 2CKBH 5H2BB 4RFEA 5JO5A 4RQQA 4X5LA 4CNIA 4EZMA 1AJ7H 4JAMB 4X6CF 4WO4B 3DVGA 4XXDA 2OP4H 5EZJB 3RDTA 4P2OD 3PHQA 3SDCB 2DTML 1ADQL 4OV5A 3ZHDA 2HJFB 2E5EA 5DJCB 5D9SA 2W9EH 4XNQA 4E41D 4ZNCD 1I75A 5C0EA 4NO2B 4R4BA 3VXSA 3U9UB 5E00A 2GJJA 1IQWL 3BQUC 3CMOH 4I48B 3WS3B 4JHAL 3WEXB 2HTKC 1I3UA 2EDQA 3IVKB 3BP6A 2BK8A 2MQ3A 2CIIA 2VZ1A 3T0XA 1N0XL 3R8BB 1MRDH 3O3AB 1IEBB 1V7MH 4HS8H 5FUZH 2D03L 3S35L 1PAMA 5CILL 2VNCA 3MBED 1IMHC 3P30H 5HHMB 3O81A 3C5ZB 4U0RC 1Z5LB 2FHFA 1T0NB 5HGAA 3SDXF 2GY5A 1FO0H 5AZEH 1U9KA 2OLDA 5DQJB 1GGIH 5GGRY 1JHTB 1MPAL 3VA2C 1MQ8A 1R3JA 1SJVA 5ILTH 3UJIH 3L5XH 4LLUA 1UEYA 1UXWB 5FUOH 1RFDH 5KJRH 4M7LL 3QXWA 2DKMA 1RJLA 2V2XB 3ZDZE 2XPGA 5DS8A 5TPWH 4P4KC 4KK5D 1B0RB 5T3XL 3U4BL 2EIEA 1ITBB 3U0TA 1HHGB 5C9JB 2XWTB 3G6DH 3MFFB 4GMSH 2HLAA 3IDYB 1ZTXL 4Y4KB 4CN4A 3RKDC 4Q9QH 5IESL 3RHWF 2V6HA 2R4RH 4W6XB 3TPKA 4HKZB 3FONB 5AWNH 1YDPB 5I30H 1UKSA 2CK0H 1HNGA 4XMKL 3ILQC 4G9DB 4WFHD 2F74B 1AIFB 2X4PA 5D1QA 2JF1A 4Z9KB 1GJIA 1CVSC 3O11A 3BD3A 2NY4D 1AR2A 1M7DA 3MJ9H 1V3KA 3UTTE 1G7LA 1JZ5A 5HYSG 3MRBB 1RZ8A 1NGPH 4OM1H 4XAWL 1UVQB 4KPHH 4AG4H 5IVXE 5FAAA 5BZWB 4GAGH 2ICCA 2VC2L 2YWYA 4G42A 2F58H 2DBLL 2VLJA 2OJZL 4JY5H 2FO4B 2EYSA 1KCSL 1TQCB 3VH8B 2B1HL 2EE6A 2J6EH 3AS1A 4NUGH 2F8XC 4LCYB 3VD5A 5D7LD 3BPLB 4LVOB 2AXHA 3JV4A 3MCLL 1I7RA 2ZPKH 2AJUL 1UZ6F 3OGOE 3S97C 5EBMA 5K9KB 3RI5F 1D9KD 4OZHB 3HRZB 5L2KB 5D7SH 2AERT 3DYPA 3MLYL 1A6AB 4BFGA 1QLRB 5KBNC 3CFCL 1OSPL 3QAZC 3UJJH 1E6JL 3UX9B 4WUUD 4HWNA 1HE7A 1CS6A 4Z7VA 1QSVA 5TDOA 2V5MA 4XP9H 4GG6B 1EEQA 5E8NA 4KKLD 4D0CA 2R8SH 5E94B 3R06B 4G7YL 1OB1A 4XX1G 5ESQA 4NZRL 3DROB 5JOPD 5FKAB 1XT5A 2VZTA 1IAMA 1REIA 3PWJB 1Z6JT 4ODSL 1J8HE 3U4EB 3TT1L 2Z91B 2UY7A 4AMKH 5IHUL 3L95A 4JFPB 5DC0A 1RZGB 1NLDH 2VN7A 3ARWA 4N5EC 1IJ9A 3W0WA 2MCG1 4PUBL 2BRRH 1T3FA 4U7MA 4AEEA 1EX0A 3LQAL 2AI0L 4LCUA 3RQ3A 1T0PB 3HI5L 1JWMB 4HUVA 4XTRD 1HSBA 3KPNB 4M1CD 1F6AB 5FO9A 4GSDH 4CBPA 1CGTA 3BDYL 5H35B 1AD0B 5C0FA 3BPNC 3FQNB 4M48L 3K2UL 2FO1A 5C0NC 3G08A 4UQ2B 1LDPH 5CKGA 3SDCC 3MGOB 3H9ZA 5HVWA 2O93L 3WFDL 2V9RA 3FN0L 2IANE 4LLDA 4JFEA 3RVXC 3INUL 4JGJA 3E6FA 5IB3B 2JK5A 3NCBB 2EZ0C 2P49B 3ZZ1A 5DJ0B 4X7TB 3WL9B 3RL2B 4ODBD 1R0AH 5B38G 1FH5H 3P73A 4NKDB 3IDXL 4BKLB 1MHCA 5DFTA 1UA6H 4RWYH 4U1KB 3T1FB 3MLZH 3OX8A 1Q9KA 3U0PA 2QQQA 2E9BA 4ONGH 3BKML 3VXSE 1RK0B 3MRLA 4MB3A 3HI1B 3DXAA 4Z7UF 3C5ZC 1PG7H 1MFBH 3GSQB 4LP4A 2HJLA 1BD2D 2PUQT 4YHML 5IIEA 2YN5A 2HKFL 5E8EB 5DQ9B 2XYCA 3VWJD 3E3QC 4XNYH 3IRZA 5IW6A 3WHXA 2H32H 4Z7NE 3DPBA 1WCBA 2Q20A 3V4VL 5F8QC 1UT9A 1KB5H 1ZXQA 5I17A 3GM8A 3LKQA 5IMOA 1QQDB 2O26U 4G3YH 1P5UA 3D9AH 2FIKA 2W65B 3WXVH 5HVHB 1DBBL 1FL3A 2X9XA 3LQZA 3OF6D 2IFFL 4R2GD 5EU3A 1WZMA 2SEBA 3OR7A 3KYOB 1AY1L 1F6LL 3VWKC 2VXQL 2MPAH 5KSUA 4AJ0A 4FN0A 4NDMB 1AD9B 3IDYC 4O02H 5C08A 5FV1L 3DRTA 3MYJA 3HMXA 4HUMB 3QXAB 5ICXA 4JE4B 3RNQB 3PP4H 3V79C 4HJ0C 3QG7L 3GJEA 3TJEH 1OAKH 4G6AD 5HHOD 3T0EC 5IB5A 1IKFH 4AIZA 5C2BH 1NCCH 3TBSA 4UV7L 2NY6D 1F4WL 3QH3A 4HPYL 4U1IB 4Y4HA 5C70A 3SKMA 3PWNA 4HUUA 3QUYA 4L8BB 2VISA 2GSGB 2A74B 4Y19A 4MCYB 1OVZA 1AXSB 1IGML 1Z0NA 2WUCL 4PGBA 3BKCL 1CFTB 5ID1B 1T4KB 4D0BB 2X6MA 1CTNA 3O6FB 4PJBA 2BMKA 1TQCC 3MNVB 4ZSOB 2AJSH 5BV7H 1NCDH 1VESA 3H3KA 2GT9B 4NCDA 5I1LA 2KZWA 1HDMB 5HHXL 2NR6C 4HW6A 3TBTB 1RMFL 4LVOC 4Y8AA 1FZOA 2DIAA 3MLWH 3QULB 4X6CB 2DN7A 3SKUD 1LD9B 1J87A 4JM2F 1AO7B 4Z7QE 2ZP0T 4IBLT 3CVHA 2VLJE 4NN5B 5D2NA 2FX7L 4FTVD 3TA3B 1JHKH 2AQ1A 1N6QH 1IGFH 2V5YA 3K81A 3HG1A 5HJ3A 5J1AA 1U58B 2OBGA 2EEDA 3BP7B 5BOZG 1RHHB 4K23L 3MMEA 3ULUL 4P23D 1OT2A 2R2BB 2WAHA 4UT7L 2V7HB 3TIEB 2DWDA 1HHJA 4OLXH 5DLML 5IMKB 2AK1L 3HR5B 5T3ZH 4ZO6A 5I66A 1EJOL 4P5MB 2CJUH 4PIRF 1L0YA 1DEDA 4HG4J 4F2MB 4KKBD 4KDWA 4Z7VE 1E4XI 4OT1H 4BUGA 1RZ7L 2KQMA 5BXFB 2EH8H 4PGDA 2G5BA 7FABL 5IBUG 1EGJH 2B0SH 5HHPB 4KVNL 1FL6B 2VSDA 4IRSC 5BQ7B 1V05A 4PJ9B 2VUOA 1SVCP 1W8OA 3EDKA 3M17B 3DX9A 1UB5B 2YD4A 3SDXB 1TIUA 5T1KB 3WNLA 5HPMB 4HKXA 5E2WL 3NCJL 4IRJD 5D8JL 4PJFF 3W0WE 4XPFL 1J05B 5IV2A 3VMNA 2HFGH 4OZFG 5CGYD 3QUXA 2IPTL 4IRZL 1JGVH 2D9CA 1KENL 1XCTA 3KPOA 1JYNA 1RURL 3BP4A 4UI2A 3G9VA 1QNZH 4AYFA 2Y23A 4I0PB 2J8OA 5CEZD 1S9YA 3PV6A 1FQ9C 2P45B 3OHXB 2BVOB 4O5LH 4EUPB 3GB7A 3U6RA 1H15A 4M6AA 3TZVB 1KXVC 5K9OA 3QRGH 4JFEE 1IL1A 4QRSB 1RU9H 4YBQD 5HYQA 4JO2L 2DLGA 1OCWL 2CXKA 3BKYL 2Q6WA 1ZHKA 4QRTB 4ELKA 1U42A 5JORA 1CFQA 4NM4L 1JIBA 3P77A 4M7KL 2X1PA 2GSIB 4LKCB 4CAGA 1LILA 2YUZA 1QA9B 3BUYA 2XTJB 2YRPA 1KIQA 3OXRA 2NY3B 1U3HA 3JVGA 3NIDE 4N68A 5IBLC 4GUPA 4QWWD 2NNAB 1JZ3A 3L3JB 4J3OC 1BJ1J 3WFCH 4KQ4L 3HAEB 2BFVH 1L0XA 5E70A 5TF0A 1MUJB 3DXAE 4R97B 3OSKA 3GMLB