4UDTB

T cell receptor (trav22,trbv7-9) structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLGGYEQYFGPGTRLTVTEDLKNVFPPEVAVFVPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Staphylococcal Enterotoxin E in Complex with Tcr Defines the Role of Tcr Loop Positioning in Superantigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C R
total genus 61
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4udtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4udtB02
3JWDH 1QOKA 1RUML 5CSGA 1I7RA 1L7IH 2EDNA 4M1CD 2WV3A 2ESVA 4DWHA 5KG9B 3VXRB 2HFEA 4JQIH 2Y06H 2NXZB 1NMCC 1EEYB 4HLJA 3D6GA 3EBAA 1MWAH 3MUY1 2WBWB 4Y5VB 4QRSB 3UJTL 3U4AA 3GMNA 4EOWL 1EHLH 2R0ZL 1R3JA 1E4XI 4LOUD 5H94B 5C0AB 1F11B 5A2JH 3VD7A 2NY3D 2WWKO 4K3DH 4HMDA 3VWKA 4HPOH 2N56A 1OGAE 2V9TA 4IDJL 2ZUWA 4ODTL 5KSVB 3BAEL 1M1SA 3QQ9D 5GXBB 3Q6GH 3ZZ1A 2ARJA 4JCMA 1N5AB 3TBTB 4FNLL 1R5IA 4I0PD 1WLHA 3JV0A 3ULVF 1SJEA 3L7FB 4TOYL 3QG6B 3WV0A 3K8KA 4V2BA 5F1NB 1B2WH 1A4KB 4P59L 2GT9A 4Q0XL 1A3RH 3BIBX 4XWGH 4MYWB 1DANT 2WIMA 3BZ4B 1LQSR 3FO2A 1ULVA 3BDYH 2YD1A 2I60L 1AR2A 4QKXB 2HRPH 3AB0B 4DFIA 3GBNL 3D39D 3ARED 1LILA 4HFUH 4OD1L 4OF6A 8FABB 3WIHH 4YUEH 4BSWA 2VKXA 2CKBH 1EAPA 3WCYA 3ZE1E 1MHEA 2Y07L 2VABB 1ZLUK 4PJ7F 2FRGP 3EJJX 4UAOB 4N9GA 4NKOA 3ZKSD 2UZYB 1AQDB 3VXPB 4YE4L 5EB9A 1WCBB 3QDMD 5AZEL 1P69B 1V3JA 5C08D 4Y5VA 5F8RC 3DRTB 2FL5A 3DXAD 1JGEB 5C07B 4OM0H 2AJXL 3HNTL 4MAYB 2ILLA 3TO2A 3EOTH 2Y36H 5CIPB 4AT6A 4D9LH 5C9JA 1TZHB 5GZOC 2AJZB 1NCBH 1OM3H 4ONGL 3TBYA 1FNSL 1FLTX 3QUKB 3SO5A 4FQLL 3RZCA 4U7MA 2XT1B 5IF0B 3H9SD 3EO1B 4JO3L 2JLLA 5JXAL 2EDWA 3SKJH 4YHLH 5GZND 3S98A 1E27A 1FLRH 3NTCH 3OWEA 4ODBD 4ZFZA 5I15L 2DM4A 4HX1A 3S4SA 1IAIM 2A1WL 1CGUA 3OR6B 5IG7A 4XNMA 4MSWB 4L4VB 4JO2L 5F96L 4PRHE 2ZWLT 2OZ4H 3MV8E 3KLDA 3L95B 2R29L 2XWBA 5GGRB 3MUZ1 1IC5L 4ZOAA 4RGNC 5MHSD 2GKIA 1KCLA 1NCCL 3O6KH 2HJKA 3TLRA 1VDGA 4JQXC 4NO0A 2YC1A 4DUWA 5MI0C 3ORJA 4M48H 3IXTB 3UTTB 5IOPA 4M6OL 3WKNA 5D1ZB 3SGDH 4NDMA 3T65A 3UBXG 4AT6B 2FGWL 3QUZC 4IIQC 3QPQC 4NQCE 3GBLA 3EDFA 5CS7A 1A8JH 3NABH 1T0MB 5AZ2L 4HS6A 3DECA 2ZNWA 4JREC 5JORA 4D0CA 1I4FA 1GVIA 3S37X 5DMGD 4KKLD 2BMKA 4NO2B 4UAOC 4AIXA 1BVKA 1NUFA 4G3YL 2X7LA 3KLAA 1N5YL 5JUEL 1NGPL 2V9QA 3QXAA 3LKNB 3ZHKA 3FQXB 3MNWB 4YGVA 3KPSE 1NKRA 2IQAA 5HI4C 3ZTNH 3BJ91 1ZT1A 1BJ1J 4N5EC 3ZTJH 3HI1A 3QUKA 5TPWL 3QG7H 5D2LF 5FDWB 2IH3B 3FT2A 2R1YA 4HPYL 4P5MB 5T3XH 5JOFA 3RVVD 2BRRH 2XY2A 3NZHH 5KJRL 4UV7H 2IBZX 3D9AL 4FQ2L 3KYKH 3VRIA 1RZIA 1URLA 2ED9A 4XVUD 4WUUE 3BP7B 3WXWH 4BFGA 1CGTA 5SWSA 1EJOH 3QUZD 3E2HB 4Z9KB 1WZMA 3OJDB 1HHKA 4IS6B 5GGUA 5C0EA 3O81A 1RZKH 4HWEL 3IJYB 1X5AA 3RVTC 1BJMA 4IRSB 1OB1B 3V5DB 1U9KA 1G84A 1G0YR 4P2QE 3S36L 4LARH 1QLEH 5D7LB 1CBVL 2OM5A 2GSGB 1DDHB 3MRLB 4RA3A 2PR4H 4PS4L 3RU8H 1SBBA 1D5IL 1HNGA 3GSUB 4EKXA 1A7OL 2D7QA 4TTGA 4BQBA 3OTTA 1YMHA 4H25A 5MEQB 5FYLL 3VW3L 3NZ8A 2V7HB 5IK3A 3FKUS 5KSUA 5I2IA 3QNXB 3IDJA 4FXKB 4F15B 2QL1A 2FX7H 1TPXB 4DTGH 2HYMA 2BOCB 4XWOD 3MJ8B 5ANMA 2FX9L 3PJSB 3Q3GA 5SX5H 1Q9LA 5BRZB 4JFQB 3AAZA 3WO4C 2IWGA 4NO5A 2HFFA 1CGSH 4KJYA 4JN2B 4LCYB 2BNRB 1FO0A 2ZKHL 3BDBA 2V17L 3C6LC 4LSSH 1BBJA 5DHVB 4ZQKA 1CFNA 4OZFA 3TJHC 4P2YA 4X7TA 2RGSA 1FIGH 4HFWA 4FABL 4F7MA 1JTPA 3NCYP 1UC6A 4KDTA 3LS4H 5KN5B 3LKSA 3UC0L 3BSZL 1ACZA 2NY2B 5B38G 4TUJA 1Q8MA 2K1MA 5F1OB 1EV2E 1RU9H 2E7MA 1K5NA 4KVNL 2NTSP 3QFJA 4FRWA 5I66A 3ULVE 1I8MB 3AGVA 1AD0A 3AXLA 1KJVB 2E9BA 1PDKA 4OCXH 2C7UA 3RKPA 1DN0A 2ID5A 3PP3K 3TFKD 2UYLB 3GO1H 4IRJC 1MCWM 3VXRD 4OKVA 3WHXB 4BA8A 3B3IA 4S1SH 4ZFFB 4JY4A 3HZMB 1EEQA 2FO1A 2DKUA 1G7LA 4HXBH 12E8L 5IT2L 5L7XL 1YY8A 1KJ3L 4X83A 3V5HB 4QRQA 2Z31D 4NO3B 2VWEE 2DQTH 2XZZA 4CUCA 3S3PA 4LCCC 4EDWH 1AXTH 1DL7L 2E5EA 2VE6A 1WGOA 1FG2A 3QEQA 1AGBB 3EYSL 4I0PC 3D0LA 5HDLA 4M5YH 1PKQA 3P30L 2WP3O 3OAUL 5D1XD 2DIBA 2W9EL 1IQWH 2BY2A 5FM4A 4PJ5A 4YXHL 4LLDB 4F7EB 4EIGB 5CINL 4YR6B 2R23B 1A5FL 2OLDA 1JPFB 3RRQA 3W9DA 1QRNB 1N3NA 3BKJH 3S36X 5BVPL 3U0TA 2ARWA 3JVGC 4HQQL 3SDCD 1L7TH 5IEKA 4QEGA 5GRZA 3TVMD 1A3QA 4R6UA 3MRPA 4TVSa 3ARFA 1DN2A 1ZLVH 1ODAA 2A9ML 5J57B 1OAYH 5D93B 4KK8D 3PGCB 1RZGA 1W8NA 1YQ2A 2XZCH 2YEZA 5F7EH 3T0VA 4ELMA 5IFJB 1GGUA 4LNRA 3O2DH 3NPSC 4ZNCD 4AH2B 2XQBL 2E9IA 3OKLA 5D1ZC 1QLFA 2E9WA 3KXFD 4XHJC 3AS1A 2XOTA 4Y5YC 1FH5L 2VIRA 3ZT6A 5HYFA 1IAIH 3GMQB 1D6EA 2YD9A 3BPNC 5FIEA 4OUUA 3D87B 4LSVH 4YDIL 1RULL 1A7RH 5F89A 4JJHA 3F58L 1MCPH 3O6LH 4LHUA 1I9IH 4PRHD 3JWOL 4GG8B 3SCMC 4L29A 1RJZA 3BIKB 4A6YL 3VD4A 5D71H 1AC0A 2H2PD 1WFOA 4HUKB 4ONHB 2EE3A 1C12B 5DK0B 1JE6A 1UQSA 4I5BB 3JWOH 4JFPA 4JFDE 4LCWB 5J13C 3G9VA 1PAMA 2YD7A 1FO0L 1T2XA 1S9WB 2DMKA 3HNSH 4Y4KA 4ELMB 3DX8B 5IFJA 3DGCR 4NIKB 4C4KO 5BV7H 3LVEA 1IAIL 5D7JA 3P77B 1AJ7H 1A3LH 1FH5H 3X12A 1CD1B 2MHAA 1FNGB 2RQ8A 2QTEA 5EH1A 3GK8H 4FA8A 2P5WB 3HTLX 4Q58C 5C70A 1S9YB 2XPGB 3G6AA 4C58B 3HUJA 4OUOA 1U8QA 5DD6A 5I30L 4WU7B 1D9KA 5F7EL 5GRXG 3LQAL 1JF5A 5JW3H 3WIFB 2GQHA 4XCCL 1TZIB 1LDPL 4U1LB 5T1KD 4FFVC 4P9MH 3LQZA 1UH2A 3I84A 2DI9A 3PABB 2X9WA 5IEHB 3IDUA 1ZA6A 4KAQL 4OGXL 4Q9QH 3CLEL 2I07A 1NAMH 4MA3A 3SJVD 1HWHB 1OTSC 4YHIB 1AR1C 2CRIA 1NFKA 4POZD 3CFJA 2DYPB 4X9FA 2QHLA 1U93A 4JFPB 3EFFB 1NPUA 3P0YL 4XRCB 3LN9A 4I3RH 4HWUA 5GISH 1L0YA 4H8WH 1LNUB 3P0VL 1G1YA 3E6FB 2YWZA 3G5YA 4KU1A 5FGSA 5DVKA 4YBQC 1RJZB 5D5MA 4EXPX 4PYGA 3TESA 3SCMA 1JV5A 1MCRA 3BIKA 1BQHG 5DD0L 2ZUQC 2GJ6E 2L7JA 1AD9A 4ZUWB 4JCLA 1YMMB 4GKZA 1BFTA 5IT2H 4FQHB 1CN4A 3KYAA 4GO6B 1RZJC 1CK0L 1F5WA 2AXFA 3QEGH 1JPSL 5DEGB 1Q1JL 4NQVB 4IRSC 1OAXH 5K9JH 4ORGB 1XZ0B 4JFXA 3VWJC 5F72S 1MHHB 1QHPA 5I1HL 1G7IB 1A6AB 1X4YA 4CVXB 1TJGL 4JRYB 1DVFA 2VDLH 1WIUA 2OS7A 2VC2H 4LGPB 4U1HB 2V5MA 4W4OC 5FYJL 3SE3A 3VG0H 3ECBA 5D9SA 4EUPB 2GFBA 5GS3A 2BVOB 4JRYE 4WW1A 1SM3L 3KPQA 3VDAA 4HKJB 1KPUB 1MRDH 4JPWH 4N8VG 2CMRH 4DQOL 5IBTH 3OAZK 5IW1A 1QSEB 1QVOA 2FD6L 4X6EA 4HDIA 3NIGE 4O02H 2YPLB 2Z0BA 4IRJD 4HS3B 3U30C 3FRPA 4TVPL 2EYSB 3C6LB 4NBZB 1S8DA 5MENE 2WWKT 3D85A 4EN3D 1XGPA 4BUHA 2R4RH 4G9FB 4D2NA 4P49A 3SKNB 1KC5H 4QRQB 3CK0H 4KRPB 4LLVB 4PUBL 1INEL 4KV5F 5GS1C 1T1YB 1TVHB 2GUOA 4Y8AA 2PO6D 5FGBC 1ZHKA 3PQYE 1XCTA 3UYOD 4XCFH 2XG4A 2DRUA 1JHLL 3L3DA 1JHKL 3CFKA 4RISH 5JW3L 3WNMA 4MQTB 3TN0B 4NQDB 1FGNH 1XGYH 1YN7A 3C5ZA 5DEZA 4NQUA 3DUUB 4C54A 5DQ9A 4M1GL 5CJ8A 3LPWA 2RAMA 4YBLB 3I3DA 3SE9L 4R8WL 4MXQD 3GI9H 2DL9A 2DLEA 2VL5B 1ZSDB 4IHOB 2ADFH 2YBRA 3OKNB 3OKMB 4QF1B 4RFEA 4YHOH 3VA2C 1JGUH 4HK0B 4J3OC 4OLWH 4PRPD 1PW3A 3MMEA 4KK5D 5I1GL 3G5VB 3RX8A 2ZOKB 2XN9E 1J5OH 5HYSB 5ECJE 5DJ0A 2AV7B 4XNXH 2X05A 4XX1E 2NY0B 4UQ3A 3MGTB 5IW1B 2OK0H 3LB6D 2DIJA 3ARUA 4APQC 3WMSA 4JFHE 43CAA 2C1PA 3HN3A 4ACPA 1LEGA 1BZQK 2F53E 1JZ4A 4ZS7L 3WXVH 1RULH 2CR3A 1UWEH 5DRWB 1L0XA 5D7JC 5DA4A 3SE8L 2H2SC 1YN6B 3VFPB 2ESVD 4X5WA 3BFOA 5H2BB 5C3LD 1QFWI 4WTWA 2I9TA 1C12A 1WF5A 2AJSH 4WO4D 4RNRA 5JIKA 1JK8A 4ODWB 3JTSB 3IU3A 4PJAB 3M07A 1V7MH 4XP9H 5FA4A 1DQQA 4XNXL 5ALCH 4Z78B 1KPVA 2V2WB 4IMKA 1FYTE 4FQIH 1G9MC 2E7LC 2FIRT 1BBDL 2IAMB 4X9HA 3TIDB 4XP5H 3B5GA 5DQ9B 4LEXL 3IS0X 2OMBA 3V6OC 3RTQD 1IC5H 4X7FC 4ODUB 3NH7L 4IBLT 1L7TL 5HVWA 5JXED 3G5XA 2PXYA 3GJFH 3LKQA 4HQQH 1MIEL 4OZHF 4WV1A 5D7IE 5DA0B 4GRWH 4HGMA 4YHYC 2QQNL 3RPIB 1I7ZB 3PL6D 2B5IB 5LBSH 5SWZD 3T8XA 1LO5A 3HC4H 3U7AA 5JHDE 3L9RB 3E6HA 4WHCA 1F00I 3DXAE 4GMSL 5F88B 2Q6WB 1JHLH 3GJEA 1U8MB 3MV7D 2A6DA 3PABA 3WFCH 2IAND 4WW2A 1EX0A 4FQLH 5J11C 4OLUL 3GFUA 4P46C 3GMNB 3GSRB 1K6QH 3RDTD 1BVKB 3GEWB 5CGYD 4YBQD 3MLSL 4JE4B 3HNTH 5GS1A 4S1SL 4R7DA 2DM7A 3UDWA 1U8IB 4MJIA 2GJ6A 5MHSE 3N1FC 2AV1B 4O02L 4UNTA 5TDOA 4LSRH 3RTQA 3U48A 3MV8D 4NZUH 3GMLB 4U3CA 1PBYA 5E99H 4RAUB 5LAXB 5HHOE 3VG0L 5TF1L 3CSYA 1KB5B 3WFDH 1T83C 4F8QA 5ICYB 2NY1C 1BEYL 2I60H 4GRLB 4QO1A 4K71C 4U6YB 1NANH 4AIZA 1HYSC 4JDVA 5DXWA 1TVBB 2I25N 4KI5F 1IEBA 5D2LE 1QSFB 4NNYA 4GW5A 3GSWA 4LFHD 5HYEA 2AEPH 4UI2A 3BEVA 32C2A 3MJ8A 1UJTA 2XY1A 4HV8A 1RZ8B 1BQHA 3NVQA 2VDML 4GAGL 1ZVHA 3P4LA 1IBGL 2IPTL 4LRIC 4PJGF 1HHIA 4QRTA 3ALWA 3AUVA 4RSVA 3TA3C 3QZWG 5F7LB 2EO9A 2WZPD 4IJ3C 5MENA 1K9TA 2I5YL 3QFDA 5HGGS 2UZIH 3IVKA 2EXYC 1D5ZB 3BPCA 1A7OH 4PJCF 1G7PA 2ZSVB 1KCRL 3LD8C 3UPRB 1G1CA 2LU4A 2YC1B 3PV6B 3QNZB 5IGXH 1FNLA 4NQDE 3R06A 1MJUH 1UCBH 3PJSA 3GZKA 4HWEH 3WL9A 1E4WL 4YX2L 2V5SA 5H8DA 2HLFD 3AM8C 2N1KA 4ISVB 2NYYC 1T3FA 3ARGA 6FABL 4P23C 3WLWD 1X4XA 2YRLA 4YBLC 3NIGF 1JVKA 4F7TB 2EDJA 3MRBA 4ZO6A 3A67L 3TN0A 2ZZUT 3WFZA 1FSKB 4K7PH 5E8EA 4OF5A 2XN9B 1K85A 3QWQB 4NO3A 2X1OA 4CAGA 2Y5TB 4JQVA 3LRSA 5ESQA 5EBGA 4HC1A 1U95B 4GAJH 4OIAA 4NWUL 1FYTA 4R3SB 1A6TA 4V1DD 4HD9A 4RFOL 3DHJA 5T33H 4JQXA 1SEQL 3I6KB 3GMPB 4Z7UF 1NCTA 5JUEH 7FABL 3BD4A 4NDMB 4DEPC 2DQHH 3IDGA 4KKNA 3R06B 4GQ9H 4JO4L 1G6RA 3MODH 2VNCA 5BRZE 4OSUL 4QRPD 3U0TB 1P4IH 2OP4H 5AG9A 2AJ3A 4XXCC 3HHRB 1KNOB 1ONQB 3GKZA 1U58B 2NYYD 1UYWL 3ARFB 1IRAY 1U2CA 3TA3D 4QHKI 4FS0A 5EU5B 1A14H 5LXGL 1SYSB 3TA3B 5FB8A 5A2FA 1I9IL 1XF5B 3KNBB 2QV2A 3AB0C 3LKPA 3MNZA 5HHPB 1QNZH 2H9GA 1F3DJ 4GUPB 3MNWA 4M5ZH 3FFCD 3OBAA 4YR6A 4U1SB 4K23H 3ULUF 2E6QA 1K4DB 5GGTH 3HS0B 5GQBA 2R2HB 4J8RA 5GSVB 4WW2F 2FJFB 2HKHL 4D0DA 4XPGH 2JJSC 4Y1AB 2J8UA 4ISVA 1J11A 3SHSA 4NPYB 1U95A 5DVLA 5EC1A 4YQXL 3LPGA 1XF3B 3G6DL 1A7QL 4LF3B 1E4JA 5KVEL 3IU3B 4PJAA 5AD0B 1EHNA 2ERJB 3QIBC 3MOBL 4BKLB 5I15H 4AYFA 4R96A 2AEWA 4RZCA 1N64H 3TYFA 3U0PA 4DN4L 5A43C 5D70H 4P2QA 3B9KC 5T1DL 5I9QB 4JN2A 4L3EB 4YFLI 2GEEA 3OJDA 4HUMB 5JDSA 4G8EB 1ZTXH 5DK0A 1JHTA 5EA0H 4OTXH 4AZ8A 3KVQA 2CKBA 5IB1B 1R0AH 1VEPA 5IROC 3MRGA 2AERT 3QUMB 5E8PA 3TA3A 43C9A 4LSTH 2B4CC 3GSOA 5B39G 1DSFL 4OM0L 1BD2D 5FGBA 2LAGB 4ZXBA 5FF6B 2B2XL 3SDCB 4BELD 5IW6B 1TNMA 1T2QH 2BX5A 4QXGL 1TQBC 1BM3H 5D5MF 1NLDL 1RJCA 1NQBA 1AIFB 3TC9A 4I48A 4CNIA 1S5IH 5MERB 4K3JH 1WWBX 2HT4D 4DEPB 2IH1B 4XCYA 5C0IA 4BH7A 3SE3C 5SWZE 1JNJA 2AS5M 5ANME 4NJ9L 4U6VH 4Y2DD 3IT8D 5E2TL 3QHZL 4RX4A 4GRWE 5L7XH 3GUTA 4ETYA 5HGDB 4HXBL 4GW1B 1JRHL 4OLYH 4TQEH 4PRBA 3WFBH 4FOMA 5CEXA 5IB2A 5BRZA 2QLVB 5JW4M 1PZUB 2R1XB 2AEQL 1OPGH 4PY8J 2CUIA 3LCYA 4HKBB 4OBRA 3L95A 1RUAH 2HKFL 4GKNB 3PIQB 1NGZA 2DBJA 4XNZB 2VERN 3LV3A 3RTQC 3O4LB 3OKOB 2RHEA 1N26A 1TETH 3AREA 4TTDC 4Y88A 3OGCB 1HZHH 1IC4L 2V2XB 4ZTPH 3UTSB 3ESVF 3R1GL 5DRXB 1I85A 1R3IL 4D8PA 3TYFB 3U0PB 4Y19B 1MAKA 1K5NB 1DBBL 5IHZA 2X41A 4PJ9D 1QFUH 5JDJA 3LDBB 4NN5B 4DW2L 4BQCA 1GIGL 1U91A 5INCA 5IHLB 2NY2D 5JXEC 2YRZA 4XCYB 2JCCB 5DJYB 3S35H 5K9KB 5B3JE 1LE5A 3IXAB 2FX9H 3GHBH 4CADA 1T0NB 3BUTA 5C0BB 1JFQH 2D9CA 4OZHE 3K4AA 4UOJA 2VLRD 2XA8L 3S97C 1UXWB 3MRNB 5F7MC 5DT1L 1JUFA 2VIRB 4XP4H 3LEVL 2I27N 1NGZB 1BEYH 4Z95L 1JN6A 3RKDC 3SEPA 5ACLA 4TN9A 3ULVL 2H2SD 4NP4H 2X89D 4PJIA 1D5BB 2NZ9C 3PV6A 1V05A 4LLYB 4OLXH 4G5ZH 4KK6D 5E2TH 1AI1H 2VH5L 5F6HJ 3MCLH 1NAKH 1G9NC 2P5ED 1I9JH 3WL9B 4R0LA 3DX9A 5DUPH 2HWZH 4PJFE 3LN4B 4JM2D 4M6AA 2OYPA 3QDJD 2FLBT 4AEHL 2F74A 4QRUB 3HPJB 4NQCA 1MHPH 1EZVX 5FM5O 4NKOB 3CDGA 4LVNB 1A6VH 4JFFA 1FFRA 5TQ2H 5BMFL 4Y5YB 3V8OA 3V2AR 5E8EB 5FFLA 1M7DA 4WUKL 4FMFA 5C07A 5KJRH 3S5LB 5EOTB 3QI9D 5GZNC 4HUWB 4I4WB 5I8OH 4NQXA 1IQDB 4OLUH 2FX8L 2R2BA 2YKLH 4I18C 1IZKA 1S3KH 2AJZA 2DLFL 3HZKA 4OFVA 4HUVA 4EQ2A 1OL0A 1UZ6F 2BCKA 2ADIA 3QXVA 5L2JB 1N64L 4FXGB 1NC4A 4AEEA 4H5SA 5DMYA 4OM1H 5C0RH 2J88H 4HGWA 1KGCD 3VFSB 4HAGA 3MBXL 1GC1H 2JJVA 3LMJH 1S7RB 1HXYA 5J13B 4ELKB 5DMKB 5B4MD 4K23L 3VFRB 5GS0H 4XMKL 4KUCF 4A6YB 1QR4A 4U7SA 3C5ZD 2WMPA 3WD5L 4LVOC 1JGVL 1PSKL 4M7LL 1F6FB 5DTFB 3SDXE 3QIWC 4JFFD 3ROOB 1RAMA 3ESUF 4OI8A 4RGMC 3IFPB 5LGHH 3QUZA 4XP6L 2BSTA 5D1ZA 4QXUH 2B20A 3MRDB 2FSEA 2EDXA 4F33A 2EH7H 5ADOL 3K1KC 4EJ1C 3UTTD 4L3CB 2OZ4L 2AQ3A 3MJ9H 3LIZH 1T20B 3MBXH 4OZGF 4RFEB 1MELA 4ZS7H 1IFHL 3F62A 4GRWF 5IQ9A 1WZKA 4AIOA 4M1DH 2QKIB 4DUXA 3GSVB 3KXFA 3IDMA 3MYJA 2X4UB 3SPVB 2QJDA 1MH5A 3MFGB 2NY2C 2IPKB 1R3KA 3QQ9C 1G7IA 1S3KL 2DLFH 3NCEB 3QCUL 1AGCA 4NFCA 1L6ZA 5EZLA 3RNKB 1G7QA 2F58H 3SGEI 3PGFH 1P6AB 4MB5A 2OQJB 4JFEE 4X99A 3V52H 2BSSA 2MWCA 4PJGE 4Y4HA 4DN3L 1U8JB 3JXAA 2NR6C 4Y4KC 3B83A 4N9GB 2YD2A 3B2VH 4TTDD 3I2CL 2Z93A 2IANB 2IALB 5HVHB 5D8JH 3SQBA 1JV5B 1DEDA 3CZFB 4G9DB 1B0RA 4Z0BH 3Q48A 4YX2H 25C8H 2BSRA 4GKZB 1HI6B 4U1MA 3PWVB 1WV7T 3O4LE 4D9QD 5JNYB 1JHKH 2JTDA 1HNFA 4OLXL 3EHBC 3X3FL 1CDBA 4XCFL 5E7FA 2VLLA 3QDMB 4OZ4A 1X4ZA 4LBEB 4RWYL 4M7KL 4DCQA 4HF5L 1IEAB 3PWNA 5D7LE 1I1AD 3L5XH 1DVFB 3BDYL 2B1HH 3CXHJ 3I6LD 4XWGL 1P6FA 2R4RL 4TRPH 3T4YB 4Q0XH 1JFQL 5I6XB 2R8SH 3W81A 2FHFA 1Y18B 4K7PX 4NNXB 4TVPH 2XQYG 4Z7VA 3OAYH 5HHQB 1UEMA 3NFSH 1Z9LA 2ESVB 2F53D 1W2KT 5DD3H 2WWMC 5E5RB 3TCLB 5CGMA 5KVFH 3NPZB 1PZ5A 2VITA 3RX5A 1QA9B 1ZHBB 2XKSA 3PWUB 5C6PB 1FVCA 3NPSB 4EDXA 4ONHA 4N8CL 1J0HA 4HF5H 3CVHL 3MLZH 5C0GA 3DETC 1QFUL 3VGAC 4IHOA 1MREH 3BO8B 5KTEL 1I3GH 1N0XH 5GIRA 1A1OA 4UTBL 2EDKA 1A0QH 1F4WH 3VFWA 5DFVC 2VC2L 2EYRA 1DUYA 1JZ8A 1DBJL 3N50A 4LSRL 3OXSA 4WWKC 4P0DA 4MD5A 3PWJA 2R0WH 5HI3D 3F7PC 1JUFB 3NACL 3RUGE 1TIUA 3QUXB 1RUAL 3C8KA 4UBDC 1CTNA 1MCJA 5D8JL 4RFNC 1OPGL 2XZAH 4F7PB 2HAZA 2C7UB 1NEUA 3VGDA 5EN2A 4X98B 3VH8A 3QZWA 1UXSA 1ZAGA 4JKMA 5IMOA 5I74C 4P2RA 4RMSA 5HI5C 2F5BL 2OTUB 2XFXA 1GHFH 3U4BH 3PNWB 5CP7A 4YXLH 5EPMA 3FT4B 1TCMA 5D1QC 2B2XH 4MDJA 2Z9TA 4Q6IA 5LVEA 4HH8A 5HPOA 2P5WD 1A6UL 3AS3A 4JFOB 3HLAA 1FCCA 4WU5B 5MEND 2X4RA 2VLRB 5D2NA 1GGIL 4K7PY 4UBDD 1HHJB 3AMLA 5HY9B 3OXSB 1MIEH 4UQ3B 3EJZD 2R2BB 4CDGC 5F6HI 4Y4HC 5HI5D 3PWUA 3L5HA 3RHWF 2EIZA 1EGJL 5D7SH 2WWMD 4F7CA 4IRSA 4RAHA 5IFHL 2PNDA 5A40E 1VGEL 5T3XD 3DTXB 1CF8H 2EC9T 4LPXA 5KSAA 3PQYD 4PB0L 1MVFA 2GY5A 2VXVH 2YPLD 5GRUH 1W72B 3CU7A 3FFCA 1MQKL 3CIQA 3ZT5A 4JJ5B 2EDDA 3A6BL 2QHRL 4GAYB 1A7QH 4PRHB 1A1MA 2CGRL 2PCPA 3QNYB 3KS0H 4ZAKC 1G7JA 4PV9A 2Q8BL 1ORQB 4ZUTA 3SO3B 3UTSD 1I9RH 1L9MA 2W0LA 5I1KL 1GC1L 4P3CH 1E4KC 5JO5B 1E28B 1XF4A 5KS9A 3RIFK 1BVLB 3U2SB 4PJHB 3IAQA 5C09E 3WN5A 4KVCL 4O4YL 3Q5TA 1CGWA 1OSPL 1INDH 3E8UL 5IMOB 4H1LA 4JRXE 1SY6H 4X4YA 2OXHA 3G5XB 4L3AA 1B3JA 3LKRA 3QIUA 5DZOA 1M6OA 5FUZL 5ISZD 3R4DA 1SJHA 1SY6L 2IC2A 4UQ2B 4X7TB 4AL8H 4DGIH 5A2KH 5B3NA 1H5BA 4GKOA 4GSDH 4TNWF 5C0FB 5C71A 4WUUD 3DTXA 4PJHF 3L9RA 2E6PA 4MWFB 3T2OA 5KN5A 3SDAB 2DQHL 2RFXA 4P3CL 4S1QL 2NW3B 4TUOB 1NLBH 5KAQG 5D7LA 4JFDB 5D2NB 5LQBH 1I3VA 2HVJB 3VWJB 1PGRB 3QFJD 5HGBB 1UA6H 4RGMB 1LK3H 1E6OH 5DUPL 3KHOA 4XCNB 2PW1A 4S1RL 3MCLL 4F8TA 1J1PH 2OQJA 4HWBA 4QGTA 4QCIB 1S9YA 3ISWA 3H0TA 1VGEH 2H1PL 4LMQE 4Y4HB 4X8JA 4OZIB 2R0KL 5I75C 1IAKB 4MA7L 4OF7A 2HG5A 3RVTD 3ULVH 1N7MH 5IMMB 5DEFB 2VE6B 1WBYA 1XGUA 3FAXA 1FAIH 2ZPKH 4JB9H 2P24B 2BZDA 4BFIA 1J12A 3WJJA 5IBLC 3GSNL 3U30B 1VA9A 3RZCC 4PJHA 3GHBL 1OARH 1TJHL 4Y1AD 4PRDB 4QHNB 1IC7L 1WIOA 1QRKA 3S35L 1P7QA 4PB9L 2J5LB 4CNIB 4OAWA 2X4QB 1HINL 4Z76A 2G5BA 2IFGA 4XCEB 3KDMB 2MCPL 4DQOH 3ARSA 2IBGA 4XBGA 1EH9A 5DMJB 3TZVD 4Z8FH 1FORL 4YZFE 4DW2H 3IB4A 5I66B 3D39A 2YMXL 1GPOH 4OF0A 4Y4KD 2C3VA 2VDMH 3C9NB 4GAGH 5BVJA 5TDNA 3ARFD 4W6XB 2E27L 1EXUA 3SDDD 4NQEB 2WIIA 5DRZA 2OJEB 2BNRD 3HE7A 1ZHNA 1S7SB 4ZOEA 3HMXL 3HE6A 3LB6C 3QISA 3T4AB 3Q6FA 5KSAC 2M1KA 1BGXH 3TPKA 3QB7C 1FC2D 3C2SA 5GSRB 3U7WL 4TSBH 4YAQA 4ORGA 1DQDH 1OTUD 4Q7DA 2BVPB 4J6RH 1A0QL 4J3WA 4YHKL 3WFBL 4JKWA 1MREL 2F19H 5FYKH 4V2CB 1MCFA 1QSZA 4KGLA 3DARA 4P5TC 5DVOA 3VXNB 4XVSL 2EEBA 3K3QA 1JF6A 1JNHA 4U6VL 5ETUA 3GSQA 5DFTA 5DMGC 1LE9A 5TE4H 3WLBB 1BFSA 1HHKB 4LDLB 3GBML 3NFSL 3FRPG 4HJGB 1KFAH 1L9NA 4H8WL 4FFYL 4L8SA 2R8SL 4U33A 1RIHL 4NKQB 5DJZA 3ARZA 4CADB 1DSFH 4X7CC 5EN2B 3J8F7 2HVKB 3UO1L 2VAJA 5CIPA 4U0RC 4KJQC 1EFXB 1KIRB 1OY3B 4RA0C 4U1SA 1ZHNB 3D5OF 1NDMB 3LRSB 1P7QB 5ESQB 5I17A 2MMXA 2AQ2A 3AXLB 5LKNA 5FYLH 1ZTXL 5EA0L 4ZYKB 4J23A 1FFNB 4P99A 4MA7H 5HYJE 5IV2B 5EO9B 3W11C 3KS0J 4M43L 4MA1B 5GJTL 4AY0A 4BUGA 1T21A 5JHDD 4KMLB 5EUOE 5E2VH 4DN4H 3V6OA 1WBXA 3VGHA 4FQPA 2DTMH 5MEOB 1OGTB 3EYQC 3F12A 2MPAL 1J1OL 25C8L 5F89B 5KVEH 1IAOA 3O0RH 3W2DH 4ZPVB 5LQBL 2CK2A 3QPXL 4FG6D 1KXVC 2C1OA 2OR7A 4OFYD 3BRGC 1G6VK 1OQXA 5CBEB 3H7LA 2CKNA 3RP1A 4WO4A 2HKHH 3BESR 5GRYA 5BV7L 4JM2A 4N0YH 1FZJA 4HIIB 4XP5L 1KB9K 4KK6C 1IGJB 2YPKA 4PRPA 1WQVT 4TUJB 3F8UB 5ALCL 4D3CL 1G6RH 5FF6A 1YPZF 5LCVH 3N1QC 2AJUL 5B39A 1LO4L 5D5MB 4A6YH 2FDBP 5E00B 5GGTA 1T04B 1QBLH 2XTJE 5I8EB 1DANU 2ORBL 5JW5B 2BDNH 4LF3A 3ZTNL 3VFGH 2MFNA 5L2JA 1KIPA 4OSUH 2R56L 1EMTL 2DJUA 2O26U 3E1F1 5AWNH 3HI5H 1WEJH 5DJCA 5L2KA 4JO4H 1DJSA 1U8HB 5HGDA 3WXVL 4WI7A 1U8QB 4M6NH 2DQFB 5C0BE 1NH6A 1EMTH 3HC0B 5EOTA 1HE7A 4LKCA 4Z7WE 5T33L 5DURB 1VACA 4U1NA 4HKXA 1ZVYA 2BVQB 2YUXA 5BRZD 2QHRH 1ZT4A 3K4ZA 4KROB 5I1CH 1H8NA 3UTSE 2KH2B 1UM5H 5D2NC 2NY5C 2JJWA 4NNPL 1G6RL 5C0FA 1EEZA 4AENA 5C09D 3D85D 2R69L 3KPSB 2RBLA 5H35A 3GSOB 2NTFA 1YNTA 5T1LA 4IMKC 1VADB 4Y2DC 5E95B 5FA4B 3H9HA 1P9MC 3TZVC 1S7RA 1HQ4B 2HT4C 2XA3A 3ZKMD 1IAOB 5DK3A 1JNNL 1ES0B 1N6UA 1GGIH 4Y16A 4IS6A 1FIEA 2CDGA 5GGUB 2YPLA 3VXSE 3PGDA 3GUTB 1I1AB 2E8YA 5A1AA 4TNWK 5MP6H 3C5JA 3ET9F 2IMNA 3T77B 4HIJB 5CEXB 1I7ZA 1R5IB 3SY0B 1AGFA 4R4BA 3U4BL 5DDHB 4M43H 2YKLL 5ID1A 4LSDA 4PJBB 4GKNA 5I1LB 3B9KA 2UZIL 2E3VA 2QSTA 1KLUA 2ADJB 3MNVB 3PP3H 4WUKH 1B9ZA 4I3GA 1CFTA 3AREB 5SX4H 3MBEA 2Q7NA 4WU7A 1GH7A 1IBGH 1EEZB 3OB0K 4P23B 3MV01 4K8RD 1X3DA 4LK4A 5DVMA 1T89C 8FABA 1T1XB 3KPSD 3BVNB 1A7BA 1HQ4A 4YE4H 4G80B 2FD6H 2QADB 1CFNB 4OZHA 4XCEA 5DUBA 3ARRA 5DRNA 2VJXA 5IG7B 5IJVB 4YNYA 2Q20A 2X9YA 5IBTL 1RHHB 3ARWA 4LCWA 1AI1L 5IWLA 3FOMA 4XVSH 1L0QA 4Z7UE 1S5HA 5J9PB 3FMGL 5CWSA 1ZS8B 2NPLX 3DYOA 4KROC 1BVZA 5DRZB 4ZS6C 3U9PL 1BF8A 4GQPH 3OG4B 2AAVA 3GMRA 2VDLL 4PGCB 5SWQA 3Q6FB 2H2PC 1TTUA 4IMLA 5HVGB 3T65B 3R0MA 5EUKB 4D0BB 4P4KB 3OF6A 4W81A 4MLSA 3WIIL 1KG0B 2XZQH 3WIHA 4TOYH 4LVHB 1RUQH 1EO7A 4DKDC 3MUJA 3NCBB 4R96B 3BXNB 2DLGA 5D1QD 3V95A 3E3QC 4TRPL 5GGQL 3WHXA 3T77A 4OLZL 3RWCA 2VN7A 3RA7H 1DFBH 2R4SL 3HR6A 3ULUE 3EOBA 4KTEH 5CEZD 1SMOA 1JWSA 1J88A 2YXMA 2ZUUA 2MCPH 3O6FA 2W0FB 3WLBA 1BF2A 4HPOL 3V5HA 4YHIA 4NKMA 4KKBD 3F6IA 3K80A 2DM3A 1IC7H 3DYPA 4PS4H 3RU8L 4PGEA 1NFDF 3H3KA 1V5JA 5DS8B 3VMPA 1JBJA 2PO6B 4CN4A 1CBVH 4JLRA 1EBPA 4YHPA 3S36H 2R0ZH 5GISL 1A9BA 1HYRC 3T0BA 2R15A 1P2CA 2A0LC 4PP2A 3WFHB 5KS9F 3DPBA 1WWWX 4P23D 1YPZE 4MJ6A 3CDFA 4IMLB 1JNNH 5C0DA 1XT5A 4V1DA 4S0TD 4QOKA 3WXWL 1U8KB 1JRHH 2R0KH 1JZ2A 4PP1D 3BXNA 4MD0A 1S5HB 4LPUA 4XNUH 5E6ZA 2Q6WA 5M7QA 1J1PL 4L9LB 4HSQA 3F12B 3WKML 2LV4A 1IT9L 2F58L 4AK1A 1WTLA 3MRBB 3DI3B 5EFIA 1E6OL 1NLDH 5D5ME 3VA6A 1BQSA 4NCC2 5JW4N 3QG6A 3FRUA 2C1OB 3W9EB 4G6AC 4UTAH 1P84J 1B4JH 3TO4A 1N5YH 3CFKB 2GYSA 2R1YB 2YRPA 3LIZL 1E4XL 1R0AL 4KZEL 2PUQT 5BV7B 2ESVE 2C9AA 4GSDL 4PJEF 3WBDA 4DGIL 3EOBB 4U2ZA 5DHVH 1C5CL 3VFGL 5EULV 3HB3C 3MQIA 4ONOA 3RBGA 5EZIL 1I3UA 2F8OA 2WBKA 3GMMB 5FUZH 4MD4B 4Y5XA 1I8IB 4IOFC 2G2RB 3ARDA 4P57A 5I19H 3EHBD 3T2PA 1C1EL 4JR9L 3K8LA 4DAGH 1TITA 4GG6B 1VHPA 1H15B 1H3GA 1WFUA 4OZFB 4KKAC 3QJHB 1IM3A 2ZOKA 3DRTA 3U0WH 3MYJB 4N0YL 4L8DB 3GMOA 1ACYL 4U6YA 5J89A 1U2HA 3TFKC 3TZVB 2CGRH 4O2CB 3LAFA 1YYML 4G8GB 1XGQA 1EVUA 4OFDA 1U8KA 4OFPA 3BPNB 2VR5A 4LNVA 1OF2B 3RIAK 1D9KC 4Q9BA 1NEZB 1FLRL 1CDYA 1HCVA 1KELH 3PDDA 4RISL 4PTUA 3BISA 4DVRL 1UWGL 4HIXL 4BK5A 2BVYA 2BSED 4H1LB 2A9MH 1FFOA 4X4YB 3SE4A 4U05A 2NXZD 2VISA 1A1MB 3BMVA 3ZKMC 5T1KB 3T0ED 2N7BA 4HX1B 3S4SB 1UKSA 1FVCB 2JF1A 1P84K 1V7NH 4RBPH 1P1ZB 3JTSA 5HHMB 3BKJL 2P5WE 5JO5A 1KC5L 1DUZB 3EOTL 5CINH 2GIYA 4MQ7B 1A6VL 3EOAA 5ADPH 2D7TH 2FJGA 1RIHH 2A6KA 4HIEB 5DJ0B 4KJWD 1D5MB 4CJ0A 3MLUL 3O3DA 3P30H 4F37K 4HBQA 3OHXA 5AZEH 2D0FA 1CT8A 2YR3A 3UYRH 3F6LA 2F5BH 5JHDB 1S7QA 3CD4A 4Y2DB 5TE4L 1JP5A 3C8KB 3MLTB 5HI4D 3KPPA 3JBG7 4RRPA 4X6CE 1MJ7H 3A67H 3ZYZA 5L8KB 2X10A 4YUEL 2FIKB 3OX8A 2F19L 2ADGA 2Y23A 3GBNH 1ZANH 4JAMA 3QJFA 3FQUB 5D7IA 4H26A 2W60A 1GXEA 4J6RL 2EYTA 1NC2D 1XF1A 5FAAA 4YPGB 3D2UD 3QXAB 1HOCB 5B38A 1JTTA 4IIQA 2AK4E 5AYUL 4QTHA 3IDJB 1UACL 4ZUUA 2CXKA 5HHXL 1B2WL 3I9GH 1NGQH 2GW5A 1YMME 4DKAA 3VMNA 5KOVC 3O2VH 1MLCA 3DVIA 4WI6A 1D5ZA 1JPSH 3VJ6B 1KCRH 1B6UA 4CVZB 3VDBA 1NL0H 3FO9A 1IAKA 2YMXH 1BECA 5DGQA 3EDJA 3RI5F 3CVHH 4PG2C 3WN5C 1TVDA 1U58A 4XBGB 2IPTH 3I3BA 3ARPA 5E03A 2X70A 5KVFL 4MB4A 1MCEA 4BFIB 1K3IA 3UJJH 1BAFH 2G75A 2CPCA 3D2UB 2DIAA 1DUZA 4MAYA 2AEPL 1OARL 5F1SA 1IC4H 4KK5C 3VH8B 4GMTH 4KRLB 3O3AA 3MV11 2DI7A 4DOHB 4EOWH 1EHLL 3P0YH 4ZG1A 1QRND 2WLYA 2EDQA 3MLVL 4GRLA 1LO2H 4Y4KB 5DHXB 2L0DA 3MRHB 5FYJD 4KI5E 1VEOA 2K7PA 1IEBB 3RWFB 1AO7D 3MLTA 3BP6B 5B8CB 3TIEA 5J1AB 2CRYA 3MRKB 2DS4A 5D7KE 2PETA 4HJJH 2BC4A 5TDNB 2H1PH 4YDJA 1VPOL 1A02N 4ERSH 2MJWA 3T0XA 5J3HD 3B8YA 3RKDD 5DO2D 5BS0E 2O93L 2J6EH 5ETUB 2FH6A 4Z5RA 4FQXA 3KLHD 2FEEL 4PJEE 5HYQA 4HUUA 3MRRB 4QXGH 1TZGL 3GIVB 3MLUH 1JMXA 1C5BL 1NBQA 4Z7NE 3W5NA 1J8HA 3QI9C 3B2VL 3MCKB 2D7MA 4LSUL 3HKFA 4X6FB 4XPFH 4U3XA 3MLSH 5EU3B 1WWAX 2QQQA 4AEFA 1MI5A 3HNSL 4GBXD 1Z9SA 3IU4H 2AV7A 4JHWL 3PGFL 5DJ8B 2XWTA 4P3DB 3T0AA 1R24B 4HH9A 3DIFA 2AJYH 5F7DA 1V3MA 5D71L 3MACL 2IANE 1YEHH 3A6OA 1P5UA 1LD9A 4URTB 3MRHA 4F15C 3LY6A 3HAEH 1IQDA 2YUVA 5D70L 4OT1L 2OTPA 5FYLE 5TH2B 4M1DL 3N1MC 1IGTA 2KZ1B 1MCPL 3O8XA 2CK0H 3MOBH 1HH6B 4UV4H 3O3BB 4HMCA 5DWUL 3G6DH 1A1NA 2XKNB 4JDTL 3OKEB 4PJCA 3IDXL 4GS7C 1ZMYA 2VITB 2EH7L 3QIUB 5ADOH 5K9OB 3VFMB 3QDGE 1UM6H 3T1FB 3IVKB 4L9LC 3GMQA 4NKDA 2XICA 1KENL 4XP6H 1ED3A 3MUHL 5LGHL 3QEQE 4WUUA 3A6BH 1XZ0A 2NX5D 1VENA 2JB6B 1QNZL 4JFXB 5TFSH 3JSSA 4WDIA 3AS0A 4PY7B 5E6YA 3MA9L 5BW7C 1JK8B 3OL2A 4ODWA 4M6OH 2PW2B 2HLAB 5GRUL 5E1HB 3QIWA 3V5KA 5TFSL 4L8CB 4KTDL 8CGTA 1AQKL 3HG1E 1DEEB 3L3HB 5F9WB 4LLDA 1EGJH 5D7SL 4OLVH 2Y25A 2LVEA 1ZWIB 3I6GB 5BVPH 4S1DD 5FHBL 1IGIL 4OCNC 4WHTA 1UGNA 2EDEA 1WCBA 1QFOA 4WCYH 4PLJD 1MCLA 3QCVL 4XI5C 1B4JL 1SEQH 1RZFL 5C8JA 5EUOF 3WHE0 1T20A 4M62H 3OAUH 2OK0L 1CG9A 4YXLL 5IMMA 2P44B 3CMGA 4JO3H 5ALBL 2BOBB 3B9KD 2CDEB 4GLRH 3B2UD 3ILQC 4ONGH 2Y9RT 1CICA 1RIUL 5I1GH 3FB8A 1CE6B 2BOCA 2VR4A 5IVZA 5EZJB 4RIRA 3HLAB 4HIEA 1JMZA 1N0LA 1CFSA 4ZFOA 2E9JA 1MI5E 2XKNA 4WFGE 4RCAA 4QTIL 4WWKB 1CT8B 3LPFA 5JPMA 4ENED 4EVNB 2NY5L 2DMCA 3DUSB 2HWZL 3LRGA 4OD2B 3QUYB 1YEGL 4JG1L 3MRMA 1NAKL 1TQCB 4CBPA 1ADQA 4LPWA 5FM5M 3L5IA 3IDNA 4F2MB 4DZBA 5KTEH 3ZYOA 1XIWC 3HE7B 3PDGA 4K94L 4WFHD 1FZMB 2MCG1 3SKUD 5ITFA 2JB5H 1DQML 3SCMB 2GJJA 3CK0L 3LEVH 5D1ZD 1HOCA 5B38B 4NCDA 4JPIA 4NN5C 1DLHA 3OMZA 3ME0A 5B3JF 2XTJD 1C8PA 5GGQH 3T08A 4P59H 1I3RB 2BJML 1QZ1A 3Q0HA 5ITBH 2F54B 5L2KD 3CGTA 2F5AL 2Q76B 1FNEA 3OJ2C 1NMAH 2D7NA 1HXYB 3VI3E 2VAAB 4NM8L 1J05A 1ZT1B 4JFFE 3OKDB 2ZSVA 1ZHBA 2ITCA 3QH3A 2YK1L 5FYJH 3BPCB 2YPKB 2F74B 6CGTA 3MV7A 4WGWB 1QG3A 1IKFL 5DHYA 1PG7W 1AHWC 1UEYA 3I9GL 5HHXH 4C56E 5CP3H 5E94A 4GRLC 2YZ1A 2VYRE 2A0LD 3FQTA 2NY5H 1MNUL 3KPTA 5FOBA 3X14B 1S9KC 3WEXB 4NBXB 3REWA 1WISA 3TBWB 4HHAB 2AEQH 1MCWW 2BNQD 3BP6A 5B8CA 4ALAL 3MLXH 4RMQA 3BWAA 4F9LA 4B7IA 2F54D 3QUXA 3FAWA 3KYKL 4FTVA 3FO1B 1ZXQA 4R97B 2YN3A 3RGVD 3P4MB 2VL4A 2GJ6D 1UJ3C 4OB5L 2GTZA 5HI3C 1PFCA 2LE9A 3DSFL 3M1BA 5HGAA 1FV1A 2AGJH 3V6ZB 3VFUB 2J8OA 4P4KA 5D2NE 3QQ4B 5TPWH 4LIQE 2OL3A 4TUKL 1T66D 4OUUB 3NFPB 3EDDA 1T2QL 4HLZH 1JF1A 1EEUA 3NZ8B 1K2DB 4JLRB 1Z9OA 4PJBE 5DRXA 4X6FA 3V0AC 5JW4R 3RWCB 3TEUA 2QQNH 1MFEH 2ICEA 2Q3AA 1NAML 3S96B 1M05A 1W8OA 3WNNA 1WBZB 4KAQH 4WWKD 4LEXH 4YLQT 2HLFC 4KJYB 4M02A 4OGYH 4KTDH 4X6CB 4UDTA 1CLYH 1F90L 5DFVD 2C3GA 3K46A 1HQRB 4DVRH 1QYGH 3FHAA 3O11A 1MWAB 4OF3A 1V7ML 5CEZL 1JGEA 4FQQB 5IWLC 1JPST 2IF7A 4LKCB 3C6LA 3U9UA 3GK8L 4D0DB 1AY1L 3W9EA 5JQHC 4ORZC 1NUDA 2ZUXA 5I1DA 5J1SC 1ACYH 1RUPH 1KJVA 2ADIB 1AKJB 2FECL 4JDTH 4ZSOB 1F02I 2J88L 4PY7A 3UROR 3VGFA 3JV4B 1S7TA 3FB6B 3HI5L 1UADC 1T7VA 3MLRL 4PTTA 3SDXB 2J7LA 1C1EH 4JR9H 4DAGL 3MA7A 2WANA 4OT1H 1R3LA 5I19L 2ORBH 1O0VA 2DN7A 1MCCA 1QBLL 4I3SH 3P3YA 3MACH 3FB7A 5KS9E 5FV1L 2AJYL 2FX8H 2D2OA 4RBPK 5CHNB 2NX5E 5IJVA 3CDGB 1PKQB 1DQQB 2XWBB 1LEIA 4JRXB 3TO4B 3SDXF 1NBZB 1JGUL 2Y36L 3BQUD 1M7DB 3L3KB 1S9XA 4YO0B 5TQ2L 5C0NC 3MRFA 5INDA 3GMOB 2A6JB 2NLJB 3KPOA 1N3NB 3QPXH 1AH1A 3PG2A 4QY8B 1WBZA 1AD9B 4CL7A 5FCSH 5LGJB 1CFTB 4M1GH 1IEHA 2JE8A 5MERA 1KJMB 2WUCH 5GHWH 1VPOH 4XBEL 4H20L 4RQQB 1U3HC 4PPTA 3WIHL 3DO3A 1XGTA 1UZ6E 3TCXA 1G9EA 2X4UA 1A6AA 1K4CB 1SJEB 2V5TA 3L7FA 4KV5E 5DMKA 5ICXA 5DUBB 5F70A 2P5EE 3D0VA 2IQAB 3O45B 1RK1B 1RVFL 3HAEG 4G8GA 2E7BA 3MZTA 4K2UH 3MLVH 1KCUH 1D6EB 3DBXA 3OR7B 3DNKA 1W0WA 4XC3H 1A3RL 4JM2B 3QIWD 3TT1H 4GBXB 2PF6A 4W68A 2V7HA 4BFEA 3EUUA 4RAVA 1A6TB 4X9BA 3HMWH 1JWMB 4KC3B 2AP2A 3ELAT 3EYSH 4WFGD 3UJJL 4FNLH 2X09A 3EYOA 4OGZA 5C1MB 4AQ1B 4HMEA 4EDWL 4P2OB 1T6WA 3LQAC 4N90D 3S35X 2I5YH 2E8ZA 3PL6A 4HEPG 5C0CD 1P1ZA 4MVBD 1CXIA 2X89A 2APWA 1XR8B 2J4WL 5F3HB 4YHKH 3DGGB 4MHHI 5C0EB 5ESVB 3IXAA 4Y5XC 4JAMB 3R1GH 3DX8A 2BHUA 3HZYA 1ZLSH 4NRXB 1RUQL 2XZQL 1LO5B 1WUNT 4CJ1A 2M8XA 2OJZH 3DMMB 1JWSB 1U8OA 5I1HH 2BVQA 1J05B 4Y2DA 4KVNH 5KANI 5K9JL 4JPKH 1ZLVK 4PGEB 3GB7A 3WFDL 5EU4B 3CZJA 1TLKA 5L2KE 2J3SA 2DDQL 2PTTA 4ONFH 2VLKD 3QUML 4Z7VB 1UJ3A 2DF3A 1YEIH 3FT4A 1BD2A 4BZ2H 2IJ0C 4Z7WF 1E27B 4NJ9H 4OCYL 4MLIA 3V4VL 1Z6JT 2V17H 1G7LB 3B5HA 3OKKB 5ENWA 4R97C 1Y6NR 5DI8A 3VXQB 1U8IA 2VRAA 4MJIB 1X7QB 4R0LB 2VLRA 4NC0B 4OCWH 2R1WA 1IAII 3BWAB 2WNGA 1G7MA 2D7TL 4MNHB 4X4ME 2G60L 1NEZG 5JA9A 4L8SC 5IB4A 3QDMA 1S7WB 2VLLB 1BMGA 5IROA 1H0DA 1JPTL 5HTSA 3SY0A 4Y4FB 3PHQA 5GGSY 4PJBA 5I1LA 3CLEH 4OTXL 4XMPL 4NQSA 4X5XB 1N7ML 1KACB 4KMQA 3QFJB 2BCKB 3HRZA 5DSCA 5JIPA 2G75B 3VMOA 2PR4L 4HIXH 3W39B 1LDPH 4MXWL 4Y8DC 5EC1B 4GMSH 1YPZA 4HS6B 4XVTL 4LARL 1WZLA 1I9EA 1FVDA 3CFBB 3LN5B 4QXTB 4LHUD 1LK3L 3AMKA 4ZFFA 1IKNC 3L1OH 4CN6A 4MCYB 3EJYD 4PBVC 3W0WA 2YPVL 4PG9A 1EPFA 5ICZB 4FZ8L 4RNRB 3NH7H 2MQ0A 5EBWB 1U3HA 3VXMB 4S1QH 5JDSB 4TSCL 2AABH 1HQRA 3SO3C 2V2WA 2ICES 2P8LB 1CCZA 1BX2B 4UV7L 4PJHE 2X4SA 5D96B 4JRXD 5JQ6L 5CMAA 3AREC 4FQQA 5HHOB 4HPYH 3STLB 3VE0B 1NAMB 2H6PA 1HHJA 2VLJB 5DD1H 3ULVD 5F3BA 5ENWB 3X17A 4PP1C 5EZIH 5KW9H 5GS2D 1C5CH 3W9DB 2Y7QA 3RQ3A 1P4IL 2FL5B 3T8XB 4ZTOL 2GSIB 1XF5A 3KNBA 1E4XH 5AEAA 2VLJE 1WZ1L 5HGBA 1S7TB 4YDIH 7FABH 1JI2A 1FNFA 5I1KH 1AKJD 1H3PL 3LRHA 1KEML 3FFCB 4EUPG 4FQXD 4NZRL 2Q8BH 1XCQA 5FKPA 5EU6D 2EDFA 1OD9A 1Q72H 2BDNL 4UTAL 4PJXA 3T1FA 4GAJL 1T1YA 2A77L 4EI5D 1MQKH 3MV8B 1BREA 4Z7NF 4KMTH 5MEQA 4MNGE 4WJ5A 4KKCD 3CSGA 4M48L 1AO7A 3BP4B 1RJYA 3O8XB 2BSSB 4QRPB 1BZ7A 4YHPB 3UJIH 1M71B 3KLSA 4YHOL 4RGNE 2GAZA 4L4TE 2YA0A 1IJ9A 1DEEA 3L3HA 5HJ3A 3TYGL 5DJXA 1ZHLB 1FL5B 2I24N 5KG9A 3GI9L 4P2OD 4K55A 2W1NA 4JREB 3QDJA 2XIDA 2P47B 5BS0B 1J1OH 3QUMA 5E9DE 5E8PB 1MJUL 1UCBL 5B21A 2W9EH 1R5WB 1FGNL 3BGAA 1TDQA 2W60B 4EBQL 2F9BT 5FO8A 5EOCL 1AXTL 1DL7H 1ZE3C 3NAAH 4GH7B 5D2LA 5FCUH 1V3LA 3OAZH 1K4CA 1T0MA 1N8ZB 3KWWA 2DQDL 2DQJL 4N68A 1INEH 3O9WC 2BERA 2Z4QA 4M7ZB 4BH7B 4JZJC 1K4DA 1HIMH 3GSWB 3P40A 2R39A 1W72H 5E6IA 1GZPB 4I18A 4C83B 4TPRH 1DFBL 4FFVD 1X5HA 4XPTL 3UO1H 1ZGLA 3ZTJG 3LKNA 2HH0L 3IDIA 3VXOA 4E41B 3S6CA 2J12B 2WQ8A 2B0SL 4RWHA 4LRIA 4JO1H 3QAZB 1IM9A 3R0NA 3TVMA 1BHGA 1FYTD 4JHAL 2R0WL 1SJHB 4UQ2A 2DICA 1WBYB 3DMMC 5FDWA 4X4MA 4CN1A 4PRIA 4XPBL 3E3QE 1MHHA 5H2BA 4BQ9A 5GRJL 4UTBH 3U9PH 4O58L 4QRRA 4KK8C 3BP4A 1GCFA 3BH8B 4C57C 3JTTA 3TIDA 1DUYB 1FIGL 5HBBA 4PD4K 5ERWA 3QRFM 1CDIA 4XP1L 3VFWB 1IGMH 4QNPE 1RMFL 2HTKD 1LEKA 4EEEA 1DVFC 1FZKA 1KPUA 4NQXB 4U7KA 1WTGT 5IVXA 3O3EB 4UDUB 3K0WA 1MQ8A 1CGXA 1MAMH 3THML 2AK4D 4YC2B 1OAXL 2BC4B 4K94C 2VUYA 4ZDHA 3C9NA 2W91A 1IGTB 2F54A 5IQ7L 2FX7L 1P9MA 3IGAA 3KJ6L 4QGYA 4P5TA 4TPRL 3Q6GL 2CJUL 3BZEB 2XQYK 3CDCA 4HAFA 1U8MA 3BGMA 4Q2ZA 5EBLB 4N1EA 5JHLH 2YEZB 4LCCB 4P4KD 2Z8WC 2DQDH 1ZVSA 2DQJH 1S7XB 1IGYB 1WT5C 5GS0D 1JJUA 5DI8B 5GGRY 2Q87A 4MCZB 3WFCL 3ZKQD 2BVPA 2EKSA 4NM4L 1TJHH 2SEBA 2HTLC 3MUGB 4JKPH 1WITA 1FDLL 3N1PC 1ZHKB 5D1XC 1YQVH 4EZMA 1G6RB 4U1HA 1OLLA 2HFFB 5LBSL 2WUBH 4LHUG 4OAWB 3NA4A 1G9NL 1FNHA 2JK5B 2QADD 4APQA 3I2CH 3DUUA 3MO1A 4XNQA 1FBIH 4JHBA 4OGXH 5IVXB 3FN0H 1EHAA 5EIIA 3MRJB 3BJLA 3I02B 1KN4H 4UT7L 4PJEA 4K3EL 5BQ7B 1YPZB 2LTQB 1GOFA 2EDYA 2XG5A 4P2QD 4G9FD 2R69H 2HJKB 4FXLA 4UB0L 4QF1A 5DFWH 2EXYD 4XP9L 2X4OA 4PJ5D 3C6LD 3B9KB 1F11A 3VRJA 3BHBA 3FQTB 3CSYB 4JFEB 3IS1X 4L4JA 1RQ5A 4OF8A 4XVJL 3V7MA 1K8DA 3LEXB 2F8XC 3V0VB 1PYWB 1IFHH 2UWEB 3RWEA 1FL6B 1UWEL 2VZSA 3RGVA 1QSFA 4NNYB 1WBXB 4ZTOH 5AWNL 3P4MA 3S37L 3S96A 4UT9H 4QXUL 3C5ZB 4MJ5B 5CZXC 3T0EA 1CE1L 3NABL 1JZ3A 5JOPD 1IGYA 3WUWG 1CGYA 3PXJA 4J7RA 1EHXA 1EEYA 2ZP0T 1R3HA 4LL9A 3UTTE 1CFVL 5JOPE 2Z8RA 1CDUA 3BUYB 1NGXA 1RK0A 3O6LL 2HFTA 5C8JB 2WINB 3HPJA 4NQCB 3QHTC 5K9QI 2VXQH 1MEXL 3RBSA 3CX2A 1QTYT 1CXEA 4DUVA 1F3JB 4GOSA 5C0CA 5E56A 3K8MA 5D96C 3QIUD 3LMJL 3G5YB 4QHKJ 3MPCA 5DURD 3SE9H 1AHWA 3SJVE 2XQBH 4U1GB 1RZ7H 5FGCE 3MRKA 1CE6A 1I1YA 4C4KT 1XMWA 5DJCB 2DTML 4GW1A 5L2KB 4PTTB 1OT2A 1W0VA 43CAB 2YPLE 5JXAH 3T4YA 2YZ8A 1LWRA 1CF8L 2NY3B 4OFKA 4F7PA 4YGAB 1PJ9A 5EU6E 5GJTH 1YEEH 1FZOA 2BXYA 5CJ5A 5T1MA 4KJPD 1LGVA 2ZCLL 2DJSA 3IYLW 3MRMB 3NCMA 1OHQA 5CILL 3V0VA 4MNQE 4G80A 3MV9A 1BZ9B 4OZFG 4JRYA 3EZ8A 3G08A 4YXHH 1KCSH 3TPUB 1S9XB 1SJVA 3SDXA 3GSRA 2H3NB 5I1IH 5BS0D 4JVWA 4G6JL 1MHPL 4FFYH 5SV3A 3ZE2F 4LLQA 2NW2A 3UBXA 3OQ3B 2D31A 3EOAB 2L4OA 2EYRB 3KWWB 4NWTL 4X6BB 4GS7B 3T2NH 3TBWA 1OWRM 3DURB 3NCJH 3RVWC 3BW9A 4G5ZL 1MRDL 2VKWA 4BSJA 1M7IA 5E1AB 3CMOL 4CMMB 1OAQL 3LKPB 3VWKD 1EXUB 4PRIE 1FNEB 1CDGA 3ZMRA 4J2XA 2VLME 4XP4L 3X12B 4TSBL 4JPKL 4QY8A 1VESA 3BKCH 3FQNB 2XA8H 4ZUSA 3BZDA 3EDKA 4I13B 4KI1A 1AHWB 4KI5D 4GAYA 4ZSOE 4NC1E 1QSED 4R26H 2OZ4A 1F4WL 1NC2A 1YC7A 2E27H 5E2UH 3LS4L 3NA9H 4S11A 4ZXBD 1B0GB 3H2WA 4Z8FL 4RGND 4JY5H 4HZAA 1WT5A 4IDJH 1MLCB 4ODTH 3VH8G 3VJ6A 4ZFGH 5JMRA 1LO0L 5DD0H 1KCKA 3MRCB 5H37G 3ULSA 3IKKA 5D6DA 5TE7H 3MJ6A 2IALA 4WHTB 5SX4I 3QIUC 5GIRB 4P46A 3QEQB 2P1YA 1TETL 2NXZC 4QOKB 1ORSB 2YUWA 4OIIL 4X0KA 4WW2C 2HJFB 5SV4A 3D2UA 2PO6C 2NX5B 4LAJH 3UJTH 2O5ZL 4Y1AE 3GKWH 4RAUA 4LIQH 1CG9B 1MWAL 4XH2B 1WCQA 1Z3GL 4ZUVB 3QHFH 2VDQL 1P4LB 4U49A 4OZGE 2VDPH 5EZOL 4P9ML 4H20H 3IFLH 5CUSL 3QZWB 4XCCH 3VG9B 1EZVY 1HEZA 2J2ZA 1BD2B 2X42A 2PTUA 4PRNA 3GGWB 3V4PL 1K8IA 5I16A 4HK3N 3CFCL 1BM3L 2FWOB 1UZ8B 4KY1H 4MZ3A 4JG0L 4HS8L 2H8PA 3SGKA 3D1MC 1T66C 3S7GA 5BJTB 3ARDC 4BH8B 4R9HA 2FO4B 3WDIA 3H7BB 35C8L 4LDEB 4PJGA 4U1IB 1AGDB 3P0GB 5BCAA 2VQUA 3MRRA 5D9SB 4EUPA 4EDXB 1H5BB 1C7TA 2YD8A 4O9HL 1MI5D 3VXSA 1CFQB 1X5IA 3Q5YA 3CC5A 4PGCA 1T5XA 2HJLB 4N1HB 5JHDA 2EIZB 1RURH 1SMAA 1RZJH 2DTSA 3C2AH 4JPIB 5INCB 4HG4K 1X5KA 2AXJA 2FHCA 3VXUA 2FIKA 4OJFH 3DHMA 5F9OH 2KUTA 3AROA 4Y4HD 4P5KB 5A16A 1U92A 2VZ3A 5IB4B 3QJFB 2PW1B 2O5YL 3UPAA 1TQCC 2OXGA 3OZ9H 3UPCA 2DLIA 3GSUA 4MS8C 1KOAA 3P4OA 3VWJD 3O3BA 3VXUE 4R7NB 5GGTL 1X5XA 3DMMD 4G8GE 4B50A 1VACB 1E0OB 3TBYB 4HZLA 3ZHDA 2IBBA 2CIKB 1I7TA 5E4EB 1BVLA 3ZDZE 5LWYH 3CXHK 2EECA 1J1XH 5BW7A 1OTSD 1D5BA 2AXGB 5T5NG 1CQKA 2Z93B 4PP2B 1FVEA 4PRAB 5EIQA 1J7VR 4QOKD 4V1DB 3TWCH 4LCWE 4XNMB 1ZA6B 4WWID 2B5IC 3AU1B 3QCTH 2G2RA 1N59A 5HHME 4AJ0A 4L3EA 4ZQKB 1I1YB 3EYVA 4B5EA 1I4FB 2YD4A 4OCMC 3T0WA 3V6BR 3DLQR 2BVTA 4JFDA 3NIFE 1PEWA 4G43B 5EC2B 1I7RB 3VFTB 3O41B 3MJ7A 1I8KA 1F8TH 3N06B 3P4OB 2XTJC 1MCNA 1BQLH 4POUB 2HN7B 1X5JA 3REVB 4OB5H 2EYTB 2DQTL 1AD0B 4XTRD 5I8OL 4WNQB 5JIHA 3MBEB 5I73C 4K7PL 4YK4C 4ZPTA 1KJ3H 2GSIA 3VDCA 4JKKA 4FXGA 4PBWD 4IIQB 4NNXA 1TVBA 5JOFB 2VMFA 3TNMA 1DE4A 3GI8H 3X11A 3OAYK 1MUJB 5SWZA 4WEMB 1EO8L 4HKZB 3OZ9L 3RIAF 1ZGLP 3NACH 3RX7A 3ZSSA 4CVZA 1G9MH 4Y5XB 3BN9D 1DLFL 3F7VA 1OAUL 3QUXC 3OKLB 4YHYB 1I9JL 1DBJH 1CDCA 3HI1B 2VH5H 3L5WB 3QFDB 4MQXD 4FQCL 1I1FA 3FT2B 4P5MA 3OGOE 5E70A 1KTLA 2BVEA 1KXQE 2NY1B 3OGCA 1MPAH 3MLZL 4Y4FA 4G43A 5EC2A 4J3VA 3IAPA 3KPNA 4XHJD 5AYQA 5ESAA 5F7WC 4Y19A 4LSSL 1QPXA 2Z4QB 4W6YB 3INUL 2NY4B 2ZKHH 4U0QB 1NGYA 2KDGA 1QFWM 1KULA 3L3JB 2BNRE 2HVJA 2F5AH 5EG6C 5IK3B 4JFHD 2Q7YB 1DR9A 3B9DA 3E2HC 4RDQG 1FVDB 3CFBA 3LN5A 4QXTA 5J1AA 3TIEB 4FMKA 2NR6D 4KZDL 4P9HC 1JGLH 3RWIB 1MF2H 5E8DH 1U8NA 3PWLA 1MHEB 2B1HL 1JYNA 1SEBA 2JELH 1F97A 4LMQI 2KKQA 4ZUUB 4RWYH 5TF1H 2IFFL 1KPRA 1YDPB 3PV7A 2P5WA 3MGOB 2APVA 3RWHA 2X4SB 2A6KB 1D6VL 1F6AA 4JG1H 3OHXB 2JJTA 3KPSA 4X9IA 4L1DA 5IBUG 3WFHA 4PBXA 4DFHA 2HKFH 3ARDD 2HFEB 5C0DB 1TPXC 4JFQA 5HYJD 2J8UF 3KPRD 1LP9A 2OL3L 2X4PB 4K7FB 4OLYL 3KPRA 1LO0H 1A6WH 2WK2A 5E9DD 1I1FB 1YEDA 4G6FB 1RUMH 3VXTB 4JY5L 4E0RB 4JN1L 1AE6H 1UB5B 3WJJC 4IOIA 1KN2H 2WAHA 2UZXB 2PYEA 4X6CF 1U8NB 3PWLB 1S5IL 5ICXB 5E2UL 1YY8B 2GITA 1KB5H 4YZFF 5ACZB 3QIBA 4GFTB 2R2HA 4OKDA 4WFEE 4G7VL 2DI8A 5IIEA 5FKAA 4PJGB 4U1IA 5DGRA 5TE6L 3IJHA 3TO4C 1C08B 3BKCL 4WCYL 3BZEA 2A83B 3GRWA 4N0CD 1QSVA 1TMCB 4Z7UA 1AXSB 1LP9F 4PJ5B 1F4XL 3OJVC 2VDOH 4PYHA 3G9AB 3SQOL 5E9DB 3VG9C 5CZVL 2GT9B 4WO4B 4P2QB 4QNPF 4LP4A 1JNHB 1LDSA 4JY6A 3WS3A 3W11D 1KUMA 2EKJA 3P73B 3NCJL 2ENYA 4P9HH 5BS0A 4BSVB 4G8EA 3BDXA 1R5WA 4P2RD 2YN5A 4ZXBC 5C6WH 3WD5H 5IW3A 3B5TA 1JWUB 2X4TA 5BO1L 1AGEA 5GS0L 4GBXC 4JZNA 3ABZA 1KENH 3PWPD 3HA0A 3MLYL 3LKOB 2E7HA 4I0PB 1D7FA 3D69A 1UM6L 1YJDH 1OP3H 1FGVH 3CVIH 2VQ1A 3HG1D 3IDXH 2NNAB 2ERJC 3QIBB 1OP5H 1YEFH 1T1ZB 1X5LA 4K8RH 4JFZH 1QR1A 1A2YA 1BZ7B 2IH1A 2ZCLH 5I1DB 3S3JA 3A6CH 3PUCA 4FQHA 4Z77B 1UXSB 1HILB 4K9EH 5LXGH 3HC0A 2ARJQ 4P23A 3OB8A 4KJQD 5DJ6B 5BV7C 3OKEA 3IETA 4U0RB 3LSOA 3FHQA 3HCVA 1PEZA 3RY6C 4YHNA 4U6TA 2EC8A 2OP4L 3VXQA 3F7RA 4U3HA 4WEBH 3MODL 1MFCL 3P73A 5FUCE 1INQA 4WTZA 2WINA 3HG1B 1WAAA 1YNTB 3KJ4B 4YDKL 1ZLWH 4Q6IC 2AJXH 4LLMB 1CWVA 2Y5EA 2XWTB 3TN0D 1C16A 4NT6B 1NBZA 1MEXH 4NWUH 2QQKH 2CDGB 4FP8H 4L4VA 3PWPA 2VQ1B 1L6XA 4MA1C 1GZPA 3BX7C 4B53A 1ERNA 3C5JB 3OX8B 4Z7VF 5D7KD 3IGAB 4WO4C 1HILA 1QFWH 4ODXA 4NP4L 1LE5B 3SKMB 4PJAF 4AMKH 5HSFA 1HK6A 1R5VA 3VFUA 2FEEI 5C0BA 2PXYC 2BOBA 1NCWL 1MFNA 1ED3B 2JIXD 1E4WH 2P43B 3HFML 4HKXB 4JM4H 3DXAA 1BZ9A 1GAFH 5F9DC 1ADQH 3MFFA 3QO1A 4YH6A 3CLFL 2A2QT 4XVJH 5I1JL 4E9LA 3JTTB 2WP3T 3QEUB 3OKDA 1NGWA 5C0JB 1MCBA 5H94A 4Z77A 1NDGA 3LDBC 2AK1L 4LASL 4HV8B 4G7YL 4OFYA 1M7XA 3KPNB 1GIGH 3FO9B 3RZCD 4APQB 2N7AA 1HHIB 4QRTB 1I8LA 5IM7B 2CKBB 4UT7H 4HJGA 3BKMH 1GGCL 4JRYD 2A9NL 5TGBA 1Z2KA 4Y89A 1DBBH 2I9LA 2V7NA 5IB5A 4G6KL 2ATPB 1R3IH 3U4EA 5BQ7A 4N8VA 4XGZA 4OV5A 1G9NH 4Z0XA 3BT2L 5KVGH 4KPHL 5HHNA 2CD0A 3S8WA 4XMLH 3UBXI 5E8NA 5EUOA 2FYYA 5I76A 1IAMA 2H32A 2AEIT 1D9KD 4TUOA 1R5VB 2NW3A 3WDJA 1J0KA 5ABDE 3VFOB 4KHXH 3DMMA 2Y06L 2KL6A 1CDJA 1BOYA 5KSVA 3AY4A 4NQED 3Q5OA 1FV1B 2CLVB 3GSXB 1MCSA 2X1XR 4EI5B 4JRWA 4F57L 2M2DA 1X5FA 1IZJA 1OSZB 4WWKA 2IG2L 5DC4B 1T5WB 1DTUA 1UJ3B 3ULSB 1NCNA 4G6AD 4TNVF 1NCUA 1PG7H 3P0VH 4PJ9B 4X7SH 3BPOB 1MAML 2A74B 1NBYA 5F9JB 3RVUD 3L5JA 4MNGB 1O5DT 5C0GB 3UTOA 4QYOA 1GZQA 4MNQD 4R2GC 4XNYH 1YEDB 4ODSL 2XNAA 3D48R 5J11B 3O4LD 3VU2A 3OSKA 5E94B 1YA5A 1MCKA 4OD3L 1U6AL 1DBKL 1RPQA 4NRYA 4X9GA 4GT7A 4LPCA 4KXZI 3RIFF 5ILTH 5E8OA 3REWB 1IGFL 5GRJH 3T3ME 5K9KA 3NOIA 4F58H 3V8CA 4HUXB 1QBMH 3LQAH 3GIZL 4UU9B 1PLGH 4HS3A 2HT3D 2AJVL 5IR1B 4U1NB 4KHTL 3TO2B 5F7UA 3K2MC 4RMWA 4YQXH 2ED8A 4PTUB 5DMIH 2ZCKL 3T09A 4XPGL 4KKBC 1P7QD 1R3HB 1Y6KR 2PYEE 2EDBA 1N4XL 4I1NB 5J6HB 3D39E 1FO0H 4BSVA 4PJBF 3DROB 4QRSA 2YD5A 3SKOA 3G5ZA 3ZLQC 3OG6B 3H3PH 5AD0A 4WUUB 4BZ1L 1JL8A 1CFQA 1LEIB 4NN6B 4NBYB 1A14L 1GC1C 4L8CA 2P8LA 2Z91B 2AJSL 1FNAA 3LKOA 1ES0A 3MOQA 4WU5A 3L3KA 4YO0A 5HYSA 4O00A 3SDYH 3V4UH 3OKYA 2NLJA 3HI6H 3KPOB 2IMMA 4N8PA 1ZV5A 2N4IA 5FK9B 3WFEL 5JW4Q 4KZEH 1A7RL 5A16B 1UVQA 3D0LB 4UU9A 5D6DC 3KPMB 1ZA3A 5HHVL 4LRNH 2ED7A 3UPRA 1MJ8H 3UTTA 1KBGH 1OCWH 3FQRA 3QULA 5DJ6A 5LAXA 4Q9CA 1Y6MR 2P5EA 3BPOC 3M1BB 5HGAB 1FG9C 4M61A 3UJIL 1LO3L 5KAQF 4ENEC 3L6FA 3UMTA 3O2DL 2IGFL 3RWGB 2HTKC 2EZ0D 2XZCL 1F58H 3MGTA 3S9DB 2EDLA 3G08B 2C4XA 4Q6YA 4CVUA 2I9TB 1OAYL 2ATKB 3FQWA 5IB3B 2FHBA 1BJ8A 3MXWH 3RWFA 3RPKA 1Q72L 5KS9B 3VGEA 2GTWA 1WJ3A 4NZRH 1Z9MA 4WHYG 4QWWD 4LGRB 2VDNH 4XTRC 4YFDB 3B2UC 3C08L 4MA8L 4JFYA 4HBCL 2BHYA 4EVNA 3JUYA 1MLBB 3DV6A 3DV4B 1X7QA 4IDLA 6FABH 4UIKL 3HNVL 3LKRB 3WFEH 2YSSA 4ZAKA 5FGRA 2OCFD 3HI6L 4JRXA 1H3WM 3P4NB 4PJ8B 4MZ2A 1UVQB 5KW9L 3VRLF 4HIIA 2NMSA 4MWFA 1FZMA 3E6HB 4KUZL 3F7YB 4UOW0 4XH2A 1MI5B 3KPLB 3O4OB 3EYUL 1HH9A 1RHFA 3V6FA 4NHUB 4OCRL 3BD3A 2VXTH 3EO9L 4NN6C 3TH3T 1U8OB 1FE8L 2ZSWB 4JZJA 5T1LD 3LKQB 5E6ID 1I3RA 2Y6SC 4FTVE 2UWEA 3FZUC 4FXKA 5CIPH 1UB6B 3QWRD 3BH9B 4F7TA 2IQ9H 3GO1L 5FM8A 5L9DH 2FEDC 3P11L 3QO0A 3UAJD 4X98A 5DJ2A 1PLGL 1WWCA 2CXGA 5DZLA 2OJEA 4O51A 2O61A 3LEYL 3B4NA 3P77A 2CMRL 2DQUH 4WW2B 2VISB 1EJ6A 4JPWL 4OI7A 4ZPTB 4NUGH 3UC0H 5J0BA 1QEWA 5DC9B 5MEPA 4U1GC 3ARQA 5E99L 4XMPH 1T7WA 3HC3H 5DR5H 2ITCB 3RZWA 1D9KB 4X7DC 4WDIB 1RIVH 4U6XB 5ESAB 4QT5A 1J0ZA 5DHYB 1TJGH 3RAJH 1CGSL 4NRZA 5DQDH 1YUHA 4S1DC 4YHZL 1T22A 1TENA 2UVFA 3ILQD 1RJLA 2F53B 4NHUA 5IHUH 5HY9A 3WUWB 3GJFK 3ULVC 3EJYC 3KDMA 2D3VA 2CLVA 3IKCA 1OGAA 2W07A 1V3KA 2Q86B 3HZMA 1UT9A 3L3DB 4L8SB 4OCYH 1A7NH 3VW3H 1HH6A 1UZ8A 2FBJL 3HZVB 1FJ1B 3C5ZC 4W4NA 2FB4L 1KJ2A 2O61B 1OAZL 3LH2L 4HUWA 2HT2D 3HE6B 4JJ5A 5K9OA 3QA3A 1QD0A 1CLZL 4E5XA 1ORQA 3X3GH 2Y4SA 3CDYA 4QTHB 5J3HC 5T3XE 2D7OA 4JFED 4EUPH 3KG5A 2G9HB 4MMZC 1RZKL 2XNAB 5EWIL 1U8LA 5CJQL 4HIHA 1KTDB 2LU3A 4XAKD 1H3UA 4KPHH 1RZIB 5L9DL 3HPLA 2D03H 1RZ8A 2HFGL 1EJOL 1U36A 4O51B 2EE2A 3PXHA 1YY9C 1WC7B 3BE1L 3MCKA 1QFPA 4X6CA 4ELKA 3MV7E 4UOW1 5B4MC 1BBDH 1FCGA 2XRAL 2BRRL 4FQIL 4XNQB 3OKOA 1S7VB 1FP5A 2BK8A 3MRGB 5IVXE 1MOEA 2W9DH 3BIAX 1YYLH 3H9YA 3U7YL 4FQ1H 1QLRB 5CKGA 4J1UB 5H37H 1UM5L 4UUJB 1VFBA 2C26A 2WBJC 5L88H 1AJ7L 1CLOL 1P4BL 3EO0A 3SE8H 5KVDL 1UENA 3MRDA 5GGVY 5D1QB 3KLHC 2ICWI 2AXHA 4TSAH 3MRPB 1OP5K 2BY0A 3G5ZB 4QRRD 4MXQC 2A6IB 5FA3A 1WEJL 3FB8B 5D72L 2FBOJ 3STBA 5I1EH 1MCDA 1KTDA 4HIHB 3ARBA 3RGVB 3BP7A 1T0NA 4P4RB 3RL1A 1BFVH 2B4CL 1NFDA 4ZFOB 1O7VA 4WHDA 3BGFB 3PDOB 1CS6A 1LO4H 4LLVA 1F4AA 1QKZL 2EIEA 4PLOB 5EBWA 3VXMA 2V2TA 5HJ3B 4D3CH 5JIIA 2O5XH 3EYFB 1J5OL 4G8IA 5CCKL 5F7HA 2G9HA 4X99B 3L3IB 4OV6F 3BUYA 4LRNL 3ETBF 5EBMB 5CBAB 4KI5C 5F88A 4D9RD 1LEKB 1OLZA 2P4AB 1EUUA 1OTUC 1YMHB 4H25B 4R8WH 5DSCB 3LHPH 1N6QL 1I8MA 4D9RE 4XVUC 1WSST 1LMKA 2DKSA 5IF0A 4NYLB 3NIFF 2VTFA 4PLKC 3L7EB 2CIIA 2DWDB 1XGYL 2UYLA 4KWUA 3SKJL 5TH2A 1S9WA 2UY7A 4OCSH 3ROLA 4K9EL 1X6LA 4X7EC 5IBLD 1MRFL 3KXFE 1G7JB 4XBPA 5I1EL 1B6DA 4Y16C 1FO0B 3JV6B 4I4WA 1GSMA 1FNGA 4HWBL 4K8RL 5BXFB 4X4XA 1A5FH 2X4NB 2SEBB 5C7XH 1YNLH 1NJ9B 3RWHB 3SDAC 4C56A 5DMIL 1L4IA 3EFFA 2A6IA 2APBA 3H42H 4KHTH 2GI7A 3BKYL 4WFHE 1TZIA 2VZ1A 2R9HD 3GBMH 4FQ1L 2NY6C 5KSBA 4C59B 4X6DE 4LCUB 3CX5K 1FL5A 1JPFA 2GK2A 3GIZH 2XRAH 2Y07H 1C5DA 4F58L 4MA3B 2ZSWA 5ILTL 3QDME 4OD1H 2QR0B 3ARDB 4P57B 4MQSB 5T3ZD 3V7AE 3WNKA 3QQ3A 4E41E 2C5DC 3C60A 3AVEA 5E2JA 3K4DA 3QJHA 2OR8A 3FL7A 3Q1SL 1H5BC 2EEDA 1XH3B 2DJ4A 2W0KA 4OCXL 3S5LA 3TZVA 2KZWA 3TF7C 5F9WC 5EO1A 3HB3D 7CGTA 4LCCA 1YDPA 3CPLB 4TUKH 3KGRA 2FSEB 5DLML 5E08L 1IILE 2VZTA 1GPOL 3O2DA 1KG0A 1OF2A 5FHAH 1AE6L 2OTWB 3BAEH 4G8FA 4FQXB 4JPVH 3ROLB 4NGHH 5FV2A 1ETZA 5IQ9B 1Z0NA 2DQCH 2C3WA 1HDMA 4NRZB 3QI9A 1HXMB 4XB8A 2VSDA 5DK2B 4ALAH 2BRQA 5BXFA 2BNQE 3NN8B 1J18A 5T3ZH 4C56D 4MNHA 3ZDZF 4Z6AT 4OV5B 2R1WB 3BPLC 4I3RL 4PJ7B 5I8CB 3B9VA 4XNZC 4JB9L 2PO6A 1TJIH 4QWWC 5IESH 1IKFH 4P3WA 1U8JA 4JQIL 5IM7A 3O3DB 1QLFB 3PHQB 4Q9QL 4G6KH 1I85C 4LDOB 2FCBA 2A9NH 3CZFA 4LVEA 3JWDL 4LSQH 4BFBD 4M93C 2A83A 3DX6B 4P5TB 2GJZA 2HTLD 3QQ3B 3ZE0E 2LTQC 4S1RH 1RD6A 3BYTA 1YMMD 4U4BA 4MCYA 2EDHA 4ODHL 2X1PA 1T5WA 3IDGB 3ILPA 5D7IB 5ANMB 3UTZB 2UV3A 4RQQA 1T83A 4MAYC 3UZQA 4JM2F 4JY6B 3EKCA 1A3LL 1Q0XL 2IQ9L 1BD2E 3PP4H 1XIWA 2OBGA 5IP4A 5EFIB 2PYFA 3RVXC 2HA1A 3QEHB 2P46B 4XXCA 2CDFB 2P8PA 3RNQA 5GPRA 4OCRH 3HE6C 4FQ2H 3NZHL 3MBEC 4XHQA 5I73B 5C0AA 3VI3F 2OR9H 4NQDA 5DUML 4M00A 1V8HA 1WFNA 2VLJA 2NTFB 2XI9A 5T1LB 1NAMA 2H6PB 4UDUA 4L4VE 1DBAL 5D6CB 1INDL 1DQJB 3MSPA 1YEGH 4YK4B 3VRLE 4M9PA 5LGKA 4ZUWA 1NGPH 4K3HA 5AUMB 4UIKH 5J12B 3CUPA 1DQLH 3H8NA 2C4FU 2BY3A 1KIQA 1CIUA 1KJMA 4I9WE 3RGHA 3TJEH 1VEMA 1I9RL 5GJSL 5IBUB 3O3AB 4AEIH 3CSBA 5CEZE 3IF1B 5C3TA 3B9EA 4WY7L 4UINL 5EO9A 3T3PE 2FNBA 4P2CG 4RRPG 1WAAE 4M1CC 3ARGB 4Y0GA 2DKMA 3QO1B 3PHOA 2P8PB 3RNQB 3LS5L 1B0GA 1N6VA 4XAWL 1JI1A 1RJYB 3O6KL 1NCCH 1A7PH 1NDGB 5EU6B 4H5SB 1OCWL 4YDVA 2E6JA 1JNLL 3UTZA 5HDBF 2R29H 1JYWA 4P2OA 1F2XK 3BVNA 2VOTA 1FZJB 3C8HA 5HYQB 3EGSB 1ZHLA 2PYFB 2I9LB 2V7NB 3QCTL 5JR1H 4P48A 4OZHB 1I8IA 1A6UH 1T0PB 1JNLH 1CU4L 3PNWA 1NANI 1J86A 3RY4A 1N59B 4J3XA 5K93A 3B43A 3SKMA 3U46A 3A0OA 3CVHA 2AKRA 4M5YL 2ICWJ 5C9JB 1PQZB 2EIBA 5BO1H 1X5GA 4PRBB 2ZJSL 2CO7B 4JZOA 2CLRA 1N8ZA 1DBMH 2B1AL 1BIIB 3ULUH 2VXUL 1X5ZA 1PYWA 4JANA 4M7JH 1EVTC 5SWQB 1ZT7A 4PJXE 3LV3B 1S7QB 1XAUA 4PJAE 1XGQB 3RI5K 5C0JA 3W5MA 1AKJA 2ZCKH 1MY5A 1F4XH 2XZAL 4X6DA 3IRZA 1AFVL 3TJEL 4ZS6D 2R0LL 1IM9B 2YHGA 2VQTA 3H9SA 3QNXA 1NCDL 4LHUB 3VFMA 1RK1A 3U82B 4OGAD 1R3LB 1QHOA 5J12C 3ZL4L 4LLUB 5TDOB 4GBXA 1QBML 3D18B 3Q3GB 2CKBL 3BSZH 3MROA 3RWDB 1IGFH</