2KDGA

Solution structure of the 1st ig domain of myotilin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GAMGPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Myotilin
publication title Solution structure of the first immunoglobulin domain of human myotilin
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kdgA00
5CJXC 3A6OA 4GBXB 3NCYS 2E7LC 2P43B 2B2XH 2XA3A 4JN2A 4OLZH 5KS9F 2ZUUA 4ZDHB 2ORBH 4N8VA 3MV8A 5JR1L 4PJAA 3H9HB 1G9EA 4HF5L 4PTUB 2QADD 4PLOB 1TNMA 2DIAA 1TTFA 2R1XA 5D7LB 3JTSB 1A7RH 5J12C 3AAZA 1FGVH 5LJYH 2GJ6A 2W65A 3C60D 3J8F7 2UWEA 4LLDA 4Y5YB 1N64H 4DCQB 5EOQH 1I3VA 2JJSC 1JFQL 3HKFA 1JK8A 4YC2C 5CJQH 2EXWD 1T20A 3KXFD 3FN3A 4HQQH 3KPPA 32C2B 2ZUYA 3NABH 2HTKC 2V5MA 2LU3A 4DOHB 1W0YT 1WGOA 1J7VR 4Q74A 1JPGB 1NC2B 4KZDL 4WI7A 1AFVH 3CZFA 4O02L 3ILPB 3FHAA 4X9IA 4ZUUB 1OAUL 1MAJA 4PG2C 3T2NH 3AY4C 1UB5A 1MOEA 4GO6B 3OQ3B 1PZ5A 4HH9B 4GAJH 3MXVL 5C3TA 2IFFL 1JI1A 4H8WH 1QHOA 4NQDB 3HCVB 3PXJA 3PL6A 3ARRA 4KJWC 2BVYA 1NCUA 3AU1A 4ZO8A 3ROLA 4U6YA 4Y8DC 1S5IH 4MA8H 1QACA 5DJZA 1EEYA 4WUUA 4ZUTB 4WEBH 4J4PA 1LP9E 2VXTL 3O2WL 3QO1A 5JOPE 4JFDD 3ZKNC 4TOYL 2BMKA 4Y4FA 3BP5B 4LQFH 2IAND 4GW5B 3PGFL 1LEIB 1CR9L 1GIGL 2DM2A 4NZTH 5MI0C 1CFNA 4LSQL 3QCVL 1WZ1H 5IVNA 2EIBA 3S35L 3GSNL 1K5NB 5ADOL 1DLHA 4L5FL 1J88A 3K2UH 2W0PA 3PQYD 1P4BH 1DSFL 4WWKB 5EU4B 4N1HB 3KPLB 3FT4A 3ZE0F 3WNLA 2R69L 3BAEL 4WFFD 5IKCB 2EDHA 3RL1B 3TGXA 1FVEA 5TE4H 5HVHB 1QRKA 4KRNA 4QRUB 4R90L 3QDHA 2QADC 3RY4A 5TGBB 5HGHA 3S36H 1JGEA 5D7JC 3ARUA 4PJDA 4PLJC 4XMKH 4FQXB 4NQCE 5FGRA 1U92B 3C60C 5B39A 1D9KA 4I2XA 4OQ1A 1UJTA 4LCYA 4Z77B 5IEHA 3VD9A 1FL6B 4PGCA 2WWKO 3RWDB 2VDKL 3I9GH 5TF1H 2A6JA 2X70B 2NR6D 1ORSB 3FQRA 4RA3A 5IHLB 2BHZA 1KC5H 2R1WB 3D0VB 1MH5B 1N6VA 4PBVC 5D8JL 3A6CH 1T22B 2VZUA 4JN1L 4RISL 4S0SD 3DO7A 5GGSY 3B6SA 1JIBA 5ITBL 5J11C 5IJVB 3SKMA 5KOVC 4XVUD 1U3HD 3CSGA 4RBPK 1UVQA 5GS0L 4D94A 5FA3A 4LHUB 3O81A 1CDJA 3QZWA 3KR3L 4I0KA 1JWSA 1P4IH 4TSBH 3KVQA 1LNUB 1J05A 4HIHB 2EXYD 2IBZY 5I19L 1UWEL 1TJHL 3VXSD 3CVHL 2QR0A 5GGRA 4NN5C 4XPBL 1I8LC 5D6DA 2W1NA 1QRNB 2Q86B 3K46A 5DJAB 3OKDA 4NRZB 4EBQH 5DJ8A 2Q6WA 3O2DL 1ZLWK 3HAEB 2Y06L 4X80L 4PRHA 2YD2A 4LLYA 5DUML 1T4KA 5GRZA 5EZLB 5HHOA 1AGBB 3PNWA 5C0GB 5LBSH 3MLZL 1PKOA 5DQ9B 2AGJL 2LQRA 1S7QA 1A6TB 4QRTA 3W9EB 3WV0A 4MSWB 4KK9D 5B4MC 3BXNA 2B0SL 4JG1H 4JRXA 3RJDA 3UPRB 5HD8D 5D96B 3W39B 5C7XH 1MCEA 1T2XA 2PO6B 3SOBH 4JFED 1RSFA 1R3LA 4LASH 1KCRL 3C6LD 4K3DL 1CL7L 3LZFH 3CMGA 3MOBH 4JZOB 2YZ1A 4ERSL 4PJEE 3OPZL 2JK5A 4ISVB 3MJ8A 1FCGA 1FORH 3KGRA 3ZE2F 4DKFH 3L5IA 4ZXBD 3QNZB 3O8XB 2CO7B 2CQVA 2OMBA 4LLWB 5C0JA 4GW4B 4AEFA 4PRPB 3C5SB 5I0ZA 3WXVH 1JUFA 1WFTA 5F9AC 1KJ2L 1DQQB 1ZT7B 4NJ9L 2Q7YB 3G6AA 2BNRD 1FO0H 1T04B 5JZ7D 4U2YA 3QJHB 5SWZA 3SPVB 4OLYH 1PBYA 2JJTA 4ONOA 1Z3GH 5DK0B 2QTEA 3GB7B 2VDLH 2B1AH 4KI5F 2AABL 4PJ5E 4LCCA 4BH8B 1WCBA 1OAKL 1RJLA 1I9IH 4X6DA 3HR5A 3GUTB 1PGRB 4B7IA 4JFPB 5FYLL 1KGCE 3HE7C 1VFAB 4PGDA 5F6HI 5ICXA 2GY7B 4V1DA 2AK4A 1X5JA 2DJSA 2VR4A 5J0BA 4XVUC 1U3HC 1HDMB 4H8WC 3P0YH 4RZCB 5GRJL 5K9QG 4KUCF 4FS0A 3NIDE 4HHAB 2XXMB 3E0GA 2DI9A 3TYFA 1IAII 3HE6A 2IGFL 1JGLL 2DQTH 5IFHH 4P3CL 2EXYC 5FM5O 3VI4F 1D5XA 5I18H 1FSKC 3T4AA 3QEUB 4CVZB 1BZ9B 5IMOB 1N8ZA 4MZ3A 3PWLA 3FFDB 3Q6GL 2J8HA 4M9PA 4UU9A 2IPTL 4WTXA 5BXFA 3KPRB 4CDHA 4WY7L 3TV3L 1O7VA 3ULSB 5L2KD 4OD3H 1JRHL 3DO3A 4JFOB 4F57L 2WSKA 1I3GL 2NYYD 2AQ3A 3T09A 1XF3B 1OAXL 1CG9A 3EYOB 4K07A 3TBTB 5D71H 3WL9A 1VACB 3AREC 4OAWB 4ZS6C 4OCXH 3RDTA 1PEWA 3DMMA 4LCWB 1M6OB 3DX6B 1QVOA 3REWB 4KK9C 1YN6B 4PUBL 2CLZB 5AZEH 4P2QE 5T33H 5HD8C 5J89A 3BI9X 3PP3K 5EZIH 4F7CA 3MOQA 5JPNB 1FIGH 1YNLH 3C6LC 3IDJB 1NCAL 3KPNA 3D3VE 1JE6A 1MCPH 1L9NA 5F7DA 3N1PC 3LEYH 3UROR 3P0VH 1GOHA 4NSKA 1ZSDB 5JHDA 1NDMB 3T3PE 4BELD 3FZUD 3C2AH 3R0MA 3RWEA 3GIZL 4MQXD 5IVXA 4LSRH 4JO3L 3TZVA 4F3FB 4ZXBC 4AEEA 1NMCB 2PR4L 1MJJA 4LLQA 1ACYL 1XAUA 1IGCL 4XP4H 2GCYB 3GBNL 3CUPA 2IBZX 4PLKD 4HKBA 4L4VB 5DRNA 5T1LB 3T0VA 1NCDL 5HY9B 1CU4L 3U30C 4UT9H 3ULUH 1EGJH 4JQXA 1PX4A 1AR1D 3WS3B 5EFIB 1NBYA 2XXCB 3FRPA 1T3FA 1M7DA 4WFEE 4X9GA 3TFKC 3FAXA 3MBXL 4PGBA 2XPGB 4HZLA 3CFKB 5EBLA 2P45B 2XA8H 1B2WL 3RTQB 5EO0B 3DGCR 4ZPVA 4CMHB 4FFVD 3MJ9H 3BYTA 5EBGA 1JZ4A 3JV6B 5DD3H 1ITCA 1EEZB 5DJXA 2ADIB 4I0CC 4UT7H 1A3LH 1FFNA 3VFGL 2UYLA 1R3IH 3HC0B 4Z7QE 4XP6H 2BHUA 3VJ6B 1M7XA 4XRCB 2P1YA 3WO3B 3PHSA 4Y89A 2YD8A 2YA0A 3QUZD 1G7JB 4LDLB 5TE6L 3ULVD 4XBEL 1KNOB 1QR1A 4LNRA 2NYYC 4M43H 4DGYL 1TIUA 3R8BB 1PY4A 3NPSB 2WBJB 4JPVL 4ZO9A 5IVZB 1RURH 2VE6B 3BKCL 1H8NA 4IDJL 1KCSH 1RK0B 2ZJSH 4APQA 2X4SB 5J9PA 4QF1A 3MRHB 1B0GB 3K7UA 1CT8A 3F8UB 2VDML 4GQ9L 4OZIA 4NC1E 5TE7L 1G6RB 5GGSB 3HI6H 4QHMB 3FRUB 2P7TB 3SJVE 1DVFD 1T5XA 4ODVL 1TJIH 1EERB 1NGZB 3QI9B 4OF3A 3TNMA 3MLTA 3EKCA 5JA9A 4NO0B 1X5GA 2HFEA 5DQJB 4GUPB 2YPKB 4HXBL 3KLAA 2AI0H 4JQVC 4QXGL 3EOAB 3OR6B 1WWCA 3V7AE 2VLRB 1TJGH 1YMHB 2CXGA 2FATH 3HG1B 4LRIA 4JCLA 4RGNC 1D3CA 5L9DH 4WEMB 1RJZB 3C9NB 5EBWA 4U1IB 1KTDB 4J6RH 3SQBA 4L4JA 4WVRA 3I85A 1MCNA 4PLKC 4UBDD 5ALBH 4A2LA 4BZ2L 1XR9A 3WKML 1FNSL 1K9TA 4KTDH 4YDLC 2CK2A 2WIMA 3UC0L 2C1OA 3BH8A 5HGDA 2B2XL 2PYEA 2ORBL 3RJQB 4N0CD 1YDPB 5I1GH 5DYOB 1URLA 4JB9H 5EUOF 1YEFH 1FNEB 3T2OA 3B9KC 1DQDL 2OI9B 5JIHA 4UDTA 1VKXA 1SYSA 1YYMH 4MDJB 1A1NB 5A3ID 2WINB 3BEWB 3GIVA 3WHXB 1N64L 2ATKB 3I6GB 4UINL 5AYUH 5EOQL 2WWKT 1YEJH 3WSQH 3LKRB 5KS9A 4OLUH 3JWOH 5ESQA 3L3DB 3NZ8A 2QQKL 5DEFA 4HQQL 3ZE1E 4OV6F 5E4IA 1YMMB 1A2YA 3QUZC 4JY4B 3TA3A 5F8RC 1DQJA 4NKMB 3ULVC 1U8KA 4RIRA 3OG6B 2V6HA 4P0DA 5E56A 4B0MM 5E6IC 4XWGH 4IJ3C 4WW2C 4ONGL 3MLPA 1XF5A 3NOIA 4XVTL 2GI7A 3EFDH 1R0AL 2CKBH 1ONQB 3WFEH 4GAJL 3OJDA 4HWBA 5EU6A 4WENB 4H8WL 1WT5C 1XH3A 1O7SA 4WNQA 4TTGA 1NFDB 1OGTA 5TF0A 1H15A 3V79C 5DRXB 5GS3A 5EO9A 1P7QA 5E1AB 2NX5D 4YK4B 3ZDZF 4L8BB 2X89A 1DVFC 4WI9A 3OKMB 4LVNB 4MJIE 1K4CB 1TPXB 1FZKA 1CE6A 3PHOA 4UUJA 3LD8C 4EN3D 5I66B 4O2EA 5AUMB 2ITDA 4W81A 1ZHBB 1S78D 4N9GB 1WFUA 2EDTA 2HRPH 4NZTL 4ZNEA 2ICWJ 3CFEB 5I1HH 2R2EA 4UBDC 3CLFL 1V05A 2Y23A 2X4TA 3C5ZB 5EBMA 1KCUH 3K2UL 4M62L 3BT2H 5AAWA 3V6ZA 4X5WB 2X09A 4HWUA 5F3BB 2BVQB 4ZUWA 5IMLA 4FHBD 3G08A 4ONHB 3VXOA 2YS4A 4N0CC 1I7UB 1YC8A 3OKOA 1A6WH 1BVKB 4QXTB 5K9OB 2KDGA 5H94A 2V9TA 5DJ0A 4GRWE 1LK2A 4A6YH 5A3IC 1AH1A 1LP9F 4U6HB 4OFIA 2FJFB 3MV11 1I85C 1MCHA 2J6EA 3O9WD 4MNGA 5DK2A 1HCVA 1NCWH 2EE2A 3I9GL 2NW3B 4MMZC 4XP5H 4R2GD 1KC5L 3BO8A 3ARXA 3BP4B 1Q94B 4MD0A 1ZHKA 3P11H 1WVZA 2HFGL 1WBZA 2IG2L 3OAZH 1QNZL 1I1AA 5T3XH 1TZIB 2ZOKA 2EKSB 2P44B 3JVGA 3E6HB 1J8HA 4FABH 5L88H 5FO8A 2VXUH 4PJGB 2AXGA 3EJZD 4P23D 5JXAL 1UWXK 3BHBA 1P4IL 4NZUH 3F7YB 3LQMA 2FHBA 4C56B 3UYRH 2NXZB 1B9ZA 4KROD 4XVJH 3U4EA 4R97C 5IHUL 3VI3F 4GMTH 2OLDA 2F15A 2J8UE 4KV5E 2EYRB 4L4TB 4ZQKB 3BUTA 1FG2B 4X5XB 5E99L 5E8DL 4EBQL 1ZLUH 3JV5A 4G3YH 4YBHA 4Z76A 3UYOD 5JIIA 1I1YA 1OCWL 5HTSA 4HC1A 4LLVA 5LBSL 1BFOA 5C0AA 4UIMB 1U3JA 1OW0A 2UY7A 3EDFA 2GT9B 1A1MA 4EN3C 1A0QL 2Y36H 5ID0A 4IS6B 1KXTB 3U0PA 1WBXA 2YBRB 4JG1L 5KSAB 2MFNA 5ETUA 3U48A 1FLTX 2MMXA 3R0NA 4GOSA 4XCFL 1S78C 1F2QA 2GHWB 1QUNA 4TRPH 5C7XL 1QBLL 4NP4H 5I1CH 1L0YA 5DFVD 1T1XA 1X7QA 1OGAE 1XR8B 1XF2B 3V4UH 2H9GA 4UNVA 1EK3A 5B3NA 5C6PB 2BXYA 1P9MA 3LZFL 4G43A 2QQNL 1F90L 4RGNE 1EHNA 4H1LH 1JPTH 4G8GA 5C0ND 2LU7A 3MOBL 1UM6H 1HI6A 3FAWA 1OB1A 3L7EA 5FO7B 2X4RA 3RX5A 3MFGB 4M7ZC 3T8XB 4Q7DA 3T0EE 4X6FB 5F9OH 4K7PH 1MJUH 2P8LB 5GS1C 5I8EB 1BPVA 4U1JB 4Z7VB 5F7NC 1OWWA 3BIKA 4DK6A 1QFPA 1J11A 5GGTL 5HHNA 2EIDA 1BHGA 1A64A 3QXAA 3U0WH 3EOTH 3IS0X 3JWOC 5C0CA 5K9QI 1FHGA 5BW7C 2P8PA 3FJTA 1JPSL 5CD5D 1KPRA 3VG9B 3ECBB 1N2RB 4OLYL 1U8HB 1Z3GL 1SHMA 5FUZH 5T3XD 3TIDB 5KSBF 2H26A 2VDLL 4R2GC 5C0FA 1YEDA 1Z9SA 2X1OA 2YPLD 1I9IL 2BVEA 3KLHD 2F5AL 3WE6B 3W0WE 4BFBD 2NZ9D 2H2PD 5HYSA 3BSZH 3QULA 3ZT6A 3G5VA 3S34H 4YAQB 4XNYL 1AP2A 1RHHA 3E6FB 3EJZC 3O6FA 1K4DB 1KCVH 4P23C 2I9TB 2ED9A 4H0HB 4D9RE 5I1IL 5IFHL 5DTFB 3BWAA 3FN0L 4KPHH 4KROC 1ZVHA 3BW9B 5I18L 1WQVT 3ARYA 2HVJA 4ZFFA 4P4KB 5MEOA 3V5KB 3GHBL 1A3RL 1MVUB 4NOBA 3ORJA 2GQHA 4OD3L 3WIIH 4FFWD 4TTDD 2Z35B 2G2RA 2ZSWB 4EDXA 3GEWB 3CFJB 3MV9D 5D71L 1N7MH 2VNCA 2BSRB 1K3ZA 3CH1B 1NGXB 4GS7B 1TTUA 3ULVL 5B38A 3WUWG 2N56A 3VGAB 5HHXH 2Y9RT 5JO5A 5E8OB 1BF8A 1BJ8A 5C0BA 1XGUA 1BFVH 1UACL 4MCZA 1HILA 4GLRH 3OG4B 3PV7A 2DDQL 5C0RH 3L7FB 3CZJA 5AZEL 4HAFA 2ZPKH 1LEKA 4P3DA 3TYGH 1AIFB 4Y4HD 2BOCA 3MRDB 5EZIL 3KJ4B 4E41A 5BJTA 2DLIA 2XY1A 3IDYC 1UCTA 4QYOB 4JFZH 2OZ4A 4DN3L 5DO2C 3QIBA 4HKZA 5C0NC 3LEYL 1HWHB 3LEVH 1A4KA 2Z31A 3MR9A 3ULUE 1YMME 1G0YR 3C2AL 1KN2L 1KTRL 5MENB 1QSEB 4LSRL 2X6MA 4NQCD 4OZGF 5TDPA 5HGBB 1AO7E 3FQTA 2HAZA 3OKNB 5JIKA 5BOPA 1CDHA 4X6CA 2J7LA 3MGOB 4MVBD 4P5KA 5I1JL 3AGVA 2D9CA 3OXRB 3OJMB 1ZGLM 3H7BA 2AEPH 3AS0A 5DEZA 5IW3A 3VFOB 5CD5C 3LS5L 2YRPA 4UT9L 2D7QA 1KYOJ 4IIQB 2OSLA 2R2HA 5EIIB 1FGNL 3T4YB 3SGJC 4KY1L 5DJ6A 1X5LA 2OM5A 4EXKA 4HULB 4M1DH 1WWBX 3VXUB 3SKUD 2F54E 2NZ9C 2H2PC 3WMSA 5TFSH 5BS0B 2CR6A 4LRNH 3QISA 4PBWD 5SWSE 1SVCP 2Z4QB 5IJKC 4YJZL 5D7SH 4K94H 4P4RB 5DD3L 5DI8B 2RJMA 1AI1L 1A3LL 3T3PF 3PWPE 5EC2A 1R3IL 3MBED 4Z95H 4LDOB 3VWJB 4XP6L 1BJ1H 5E24E 1SQ2N 4UMGA 3FB6A 4RDQF 1LO4H 3G6JE 2OBGA 4PJFB 2W0KA 5ICYA 1MHHB 3GSUB 1JV5A 5F1IA 1BD2A 4U49A 2ARWA 2F19H 4FFWC 4TTDC 3RUGF 1H0DA 1M4KA 2LTQC 4Z0XA 4N8VG 3G5XA 4DW2H 2CLVA 4M7LH 1NEZG 5DD6B 2W9LA 1BQLH 4U3XA 5IBUG 4YHMH 1QSFA 2Z8WC 1LO5A 4CN1A 1ORQA 1CD9B 3A6BH 4ZTPH 4OZHB 3SO5A 4HWNA 5HHVH 2O61B 4OZ4B 3OAYH 4KJYB 4PRNA 4Y4HC 3HI6L 4YDIH 4WO4B 3SQOH 4PV8B 2ITCB 1S9WB 1TJIL 5JDSA 2ERJC 3LKNB 2EICA 3N50A 4UILL 3LS4L 3SDAD 1JGUH 4P2CG 5EG6C 3I02B 2OK0L 1CGUA 4JDVA 2X10A 5I8CA 4N5ED 2D0GA 3VXME 4JG0H 5ACMA 4MJ5A 2Y7QA 2YD6A 4NFCA 4MVBC 1WZKA 2DN7A 5KVMC 3QEQB 1DBAH 2OQJB 1DBJH 3SGKA 4NKDB 3MX0A 4YZFF 2H6PA 3H0TB 1KGCD 4P2OA 1FAIH 3KPSA 1IC7L 3QPQD 2XKUA 4LKXB 1T80A 4KTDL 1NC4B 2H3NA 2B4CC 5IEKB 4MHHI 2CRYA 1FZOA 4RGMB 4AH2B 1WSST 5CJOL 4Z18A 2VXSH 5B8CC 4FQJL 2D2OA 2VN4A 5FO9B 5T5NG 1JGDA 1PG7H 5E8PA 3V5DA 4CUCA 4AEIH 2FECI 4HK3N 3DV6A 2QEJA 4WDIA 1PYWA 2JJWA 4TNVF 4HT1L 43CAA 5BVJB 5IK3A 1Z5LB 4JKWA 4MB3A 1EEUA 2ICEA 4GW1B 4XXDB 1KIRA 4YR6A 1A14L 3MBEC 1FAKT 4NM8L 1LO3L 4FQ1H 4OLUL 2XKSA 4GBXD 4CVXB 3M1BA 4NRXB 3BPOB 1MREH 4JQIH 5EUOA 5C08A 1J86A 2BVPB 4N68A 3T1WA 2E6QA 3MRBA 4F7MA 2DQIH 2HG5A 4MD5B 1MFAL 5FDWB 1JPST 5IB2A 2NNAB 3N0PB 4G9FA 5D7LD 4ZSOA 4D0DA 4X4YB 3P9LA 3EFDL 2OYPA 2CKBL 2BNUB 3DXAE 4RFOH 4S11A 3WFEL 3BD3A 5FGCE 4PJBB 3BZ4B 2BOBA 5KZCB 3MRRA 4P2RA 2E9BA 5ALCH 5B39G 5DVOA 3LPWA 3UJIH 1VFOA 3IS1X 3WFHA 1T0MB 1IGFH 2E7BA 2A83B 4MNQA 2E7CA 1S9YA 2WANA 2F53A 1NC2D 1IL1A 3H9YA 3D2UA 4RX4A 3RWIA 1A7NH 4R4BA 1WAAF 1BX2B 3SDAC 4X7SL 3QFJB 4NNXA 3BZDA 1UH3A 1XZ0B 4N5EC 4TVPD 3QZWG 4NQDD 4U7MA 4EIZC 2WUCH 1JYNA 3IXAA 5JOFB 3IDXH 1TDQA 4KKLD 4FFYH 5JQHC 5E4EC 5DD0H 3TIEA 4H25A 2FWOA 5I1HL 5LGJA 2XT1B 4U1MA 5HYQA 3EO9L 5KN5A 4ZD3L 5KTEL 1KCUL 5IVOA 2V7HB 1L9MA 4O9HH 2IH1A 3BT2L 3QPQC 5D70H 1U8PA 3LIZH 4K7FA 1CE1L 4WFGD 3VWKB 1YECL 1BVZA 1EFQA 4FQLH 4M6NH 3R06A 3WNKA 3P3YA 2OL3B 5GJTH 3N1FC 4Y5XB 3IFLH 2V7NB 3NCMA 1PJ9A 1OAQH 1FBIL 4X7TA 1DQLL 4LFHD 1XCQA 3DBXB 5F1NA 5GZND 3LV3B 4PJ8B 3RKPA 2O5ZL 4B50A 4X4ME 3BN3B 1FYTA 1DL7H 1NCWL 3SCMA 5EOTA 4XP5L 4G9DB 4O00A 4WWKD 3S37X 4HG4K 2P8MA 3RPIB 1LWRA 1BFTA 3P11L 2RGSA 4JPWL 3QUKA 5D1ZA 5T3XL 1BBJB 3GSNA 1UXSB 2K1MA 3BVNB 2DQFB 1YN7B 3L5WA 4DWHA 2R4SH 4Z7WF 4FABL 3T0DA 5L88L 4O58H 4JRWA 3V6FB 1IM3B 2VXUL 1A4JB 4FTVE 1QSEE 1BOYA 4FQXD 4JO1H 1RK1B 4NZUL 3KNBA 2R23B 4WHCA 4XVJL 2E27H 3VXRB 4TUOA 4GMTL 5DJYB 4NRYB 1U3ZA 1HIMH 2XQBH 3DUSB 4FQIL 1LD9A 5D5MF 4JRYA 4AT6B 3MTRA 2JIXB 1LEGA 2QHRH 5IR1B 3QDGA 1QFHA 4LDEB 4QWWC 2A6IB 2XIDA 4G3YL 3GNMH 3N85H 4U1KB 1YY8A 4HMDA 3G9VA 4D9LH 2VWEE 2CRIA 4PREB 5FYKE 4LHUD 2FZ3B 5T1KB 4OF0A 3VFUA 5D1QA 3V52L 4KVCL 2Y36L 1ZMYA 2B5IB 3ARSA 1C12A 1IQDA 3LQAH 2VLME 1QFUH 5DURB 5GSVA 3RX8A 5F7MC 4KKLC 1MFCH 5HDQL 4TRPL 3L6FB 5I1CL 1QRND 4QHNB 5FUOH 1NAML 1J0YA 1P7KB 4L9LB 3L9RB 5CP7A 2NY2B 3V4UL 4UAOB 4DEPC 5I71B 5FEBA 2A9ML 3MRIB 3P77B 4R96B 1UM6L 3N1MC 4LKCB 1A6AB 5DHYA 1YEGL 2EECA 3CVHA 2NLJA 3MV7A 3W11D 5F9OL 1MJUL 4X83A 4HBCH 3B4NA 3BP7A 5JLZB 2MKLC 3KYAA 4OGAC 3O2DA 3UTSE 3U0WL 5GGRY 5GZNC 2PO6D 2OR9L 3WDIA 1DLFH 4WI4A 5GRUH 1QFWL 1DQMH 3C8KA 3QHTC 5HDBE 1MLBB 3WUWB 1E6JH 1TZGH 3OL2A 5F7UA 5FUZL 2W9EH 4WWKC 3MGTA 3V0VA 3WFBH 4BQBA 2DD8H 4NNPH 1MUJB 3IDMA 3SE4C 1Q72H 5E8EB 4PGZA 2O5YH 3LCYA 3O8XD 4JCMA 2B4CL 1O5DT 3VA2C 4E0RA 4F7EA 2X4QA 3GO1H 2ZCLH 3QUYC 4PRPD 4QTIL 1DUZB 3FO9A 3S34L 5FB8B 3ES6B 4M93B 4I8DA 1QBAA 3SE8H 5CZVL 1KB5L 5GGUA 1Q1JL 1KCVL 3GFUA 3V4VH 5DHVB 5KSBA 5D7IF 1X5YA 5DJDA 4O4YH 1VGKA 1I3RA 5HHPA 3FB8B 4K8RD 4U6XA 4PB9L 4AIZA 3L3GB 4N0RA 1KJ2A 3DVIA 4PP1D 3WIIL 1X6LA 1FNGA 5HPOA 3T77A 4NPYB 1PKQA 3KHOA 4PJ7F 1DANT 3X11A 5ACZA 1F3DJ 2GITB 4GRLB 3RKDD 3UTZA 3KG5A 1DN0A 3GSWA 2YSSA 1P6AB 4G6ML 1FRGH 2IF7A 3QDMB 2WIIB 4HIEA 1WFNA 1I7TA 5CJXA 1NMAH 2VLKE 5C0RL 1NUFA 3I75B 5I76B 2E7LA 2ZPKL 1HINH 4KDWA 4AIOA 1IM9B 3PDOA 3KPRD 2BNQA 1MRCH 1OSZA 4IRSB 2AJ3B 3HS0A 3QWRA 1UEYA 4JFYA 4P5TB 3SGEI 1G7HB 1IQWH 5C92A 3WIFA 2AK1H 3ULVF 3LEVL 1BMGA 3GSXA 5DD1L 4WW2F 1CBVL 5IW1B 1NSNH 3W11C 1E4JA 1AKJA 4ORGA 3CU7A 4LCWD 5GIRA 2JJSA 1N6QL 2WBWB 2A77H 1DR9A 3EO0B 3NN8B 1ACZA 2WM0A 4FXKB 4KHXH 4YBLC 3B9AA 5D96C 3DYOA 1I7RA 5IFJA 2Q76B 3VRIB 1PSKH 2AEPL 2VLJB 1GZPB 1G6VK 1RZ7H 1ZE3C 5DDHA 1NEZB 5ENWB 3WUZA 4OD2A 5D2LB 5IBUB 3ZHKA 2FH6A 1JHLH 2IH3A 4OZGA 4PG2A 5C07A 4P3WA 2FO1A 4ZAKB 3AY4A 5J06A 3L5XH 3W9DA 25C8H 1TTGA 4GG6E 4ODBD 1ZV5A 3QUXB 1SBBA 3O8XC 1LE5A 4PJIE 2AJUL 3QUMB 3W2DL 1T20B 1H3PL 1H5BB 3FO2A 4MA7L 3DI2B 1Q0YH 1KJMA 2W59A 3P4MA 3QFJE 4L8SB 3WEXA 3RWFB 1IGMH 3MV01 4L4VD 2YUWA 3QEHA 5T1LD 2GJZB 1YPZE 2LFGA 3KDMA 3AXLB 1HOCA 3JTTA 1PLGH 4GXVH 2Q8BH 1LO4L 4PRIB 1J1XH 3S96B 4BA8A 1F4XH 3SDXE 5KSVA 4PP1C 2F19L 1YZZA 5IROC 1EO7A 4LGSB 4JGUA 1RUKH 3MCG1 4HEME 3RTQD 5K9JL 1KEGH 4D9QE 3FQNA 5LWYH 4DW2L 1HEZB 2AJZA 2E7MA 4OGXL 4M7LL 1YY9C 1BQLL 4FQHB 1A22B 2IBGA 4DTGL 3MLWL 1F6AA 3A6BL 3UCRA 4RMSA 1B6UA 1ZAGA 3ZSSA 2FIKB 5HHVL 5HJ3A 3RUGA 1MCLA 1TCRB 1U8QA 2VERN 3WFDH 3A67H 4YDIL 3OKEA 4H26A 5DD5H 5GGVY 2WBJD 2NY7L 3FO1B 1S8DA 1UWGL 1CFNB 3MLRH 4CMMA 4M61A 1XGTA 3C60A 1OLZA 2GK0A 4Q9RH 5J13B 1OT1A 1FFOA 3EDDA 4JG0L 4X9HA 4U6TA 3F58H 5FF6A 3QG6A 3MLVH 1DBAL 3KXFA 4M4PA 2A73A 1KLFA 3QR2A 5DR5L 1FVEB 4TVPL 1V5JA 1D6EB 4JPIA 1OY3B 1L0XA 1FAIL 3PL6C 1RHFA 3NA9H 3QI9D 4OTXH 3SEPA 1OTSD 1UJ3B 2CO6B 4UQ2A 4NO0D 1N26A 1EJ6A 1EBAA 1MI5B 4KZEH 1DANU 4LCYB 1J1OH 4F8QA 4MJ6B 4PGCB 2VXSL 2VLRD 1AJ7L 4NCC2 3HG1D 1JZ3A 1PG7L 1NMCC 1RY7B 3CFBB 4MNHB 4AEIL 4XPHH 4IRJC 5EWIL 2E8YA 1I8LA 1RU9L 3TCXA 4M02A 4LCIH 5IOPB 4UQ3A 5H8DA 4WV1B 2EYTA 5TH2A 1S9XB 3M17B 5BRZE 5CZXD 1MREL 4JQIL 5SX5K 2OP4L 2I07A 3SY0A 4BKLA 4JFDA 1JWSB 1W0WA 4POZD 4WWID 2OS7A 4PJXE 2IANA 1ODAA 4ZFOB 1UWXH 5SX4H 2QR0B 1WZMA 2DTMH 4Q2ZA 4G8IB 4CMHC 4GQPH 3TWCH 2V5TA 1FZMA 4YPGB 3HUJB 4L1DA 1JHKL 5DJ8B 3I6LE 4WU7A 3X12A 3CSYB 3FQXB 3U46A 5HDLA 5ALCL 2FLRT 3HNTH 3PQYA 2BDNH 3PNWB 3QCTH 1YNKL 3UJIL 2HFTA 3RL2B 1IGFL 5A16A 1YMMD 4IDLA 3MRNB 3DSFH 1VSCA 3VXTB 1F3JA 5CILL 1CDCA 4ZOCA 3NFNA 3U7AA 3BXNB 1J1PH 1NBZA 3WJLC 1Q0XL 4OCYH 3NPSC 1P84K 1YQVH 2WBJC 4OFYD 4ZMAT 2UUDK 4TUJB 12E8H 3CH8A 1ZEAL 4HEPG 3RVUD 4HZAA 2AKRB 5ICZA 2DQCH 2YD4A 1IZKA 4JO2H 1SY6H 4FFYL 3RNKB 1M05A 2GEEA 2Z93A 3MRFA 3MJ8B 1I8KB 3GSVA 4PV9A 1SEBA 4MCYB 3HE7A 1S7WA 4OI8A 5IB1A 3SKOA 1WAAA 4ODUA 2NXYB 4YE4H 2PW1B 1PG7W 5D70L 1U91A 5D6DC 3QI9C 1U3HA 4U1HB 1OTSC 3LIZL 5F7HA 2P24A 4NHCH 8FABA 3GGWA 3LKOA 3U7WH 4FQLL 2IQ9H 1VFMA 1GGIL 4XNXL 5GJTL 3QXDA 2ESVB 3O3DB 3O45B 3IFLL 3VFNA 1E4XI 1CFQB 1UZ6E 1EZVX 2X4PA 4J1UA 4RFEA 5JW4R 1OAQL 3BZEA 4UV7H 2VIRA 1WCBB 2ARJQ 1QP1A 3LSOA 5MERA 1I8IB 5JMRA 1CS6A 3QDME 5K9KA 1KIPA 1I1CA 2GTWB 4V1DB 3C5ZD 4ODHL 3EOBA 4B7LA 3D39B 2HJLB 1T2QL 1HNFA 1KEMH 4YEEA 1QEWA 4POYA 5A2JH 1MNUL 4ZYKB 3EYVA 3RWHB 3DTXA 3AREA 2AW2A 3MJGX 4WJ5B 5CZXC 4ETQA 2H32B 3BGFB 3TYFB 3U79A 1GOFA 1C5CH 5K33A 2XZAH 4LPYA 2WLZA 2HKHH 4JLRB 3REVB 2OI9C 4L9DA 2R4SL 5SWQA 4O58L 2D31B 5CP3A 4L3AA 1R6VA 5BXFB 2Y4SA 2C1PA 1AY1L 4JFEA 2IPKB 4BSJA 1A1OB 2QV2A 5K59E 3C6LA 2E27L 3LKQB 1CG9B 1E6OL 4H20H 1F4YH 2XQBL 2UY6A 3MV8E 1AXTL 4PJAE 3C8HA 3RDTB 3LHPL 1H8SA 4NUGL 4Z7WA 2I27N 1KLUA 4ZXBA 5TDNB 4PJCF 1CICB 1AXSA 3GNML 4K8RL 4FOMA 3HLAB 1IAMA 2JKXA 2WMPA 3BDYH 4D9LL 4ELMB 4M5YH 2GJ6E 4M8VA 2WUBH 5HYSG 2UWEE 3MRJA 1U8JA 4OFPA 2EDJA 3CIQA 2BNRA 3LEXB 5E9DB 4C56D 1X3DA 4RQQB 4HK0B 2NXZD 3HMWH 1IGJA 4K3GA 4UI2A 5D5MA 1DDHB 3EYFA 3KPNB 1HQRB 4M03A 2J1KA 5JHDB 1MFCL 4L4TD 1A9EB 2D4DA 1T7WA 1X5AA 2PCPB 2CMRL 5IG7B 3C87A 1YNTB 3MO1A 4LLQB 2Y07H 5F70A 1Q9LA 2OTPA 4LVNC 1F6FB 1TPXC 1ZHNB 3S5LA 5LGHL 4RFNB 5SX4I 1S7RA 3VGDA 2AV7A 3TO2A 3DUHA 3DVNB 4HBCL 2R8SL 2QJDA 4YLQT 1KB9K 5B38G 4JREC 4YHIB 5KSAD 3MOAH 3VFWA 3PWVA 1U8IA 1I9RH 4F15B 4EDWH 3WXWH 5I8KH 1PD6A 4EOWH 4K23H 4HWZB 4JZNA 1IC4H 1DLFL 2XZCL 2FYYA 1DQML 5CWSA 1GH7A 5L2KA 5EBLB 4WUUE 3C5ZC 3FT3B 5DJ2B 1E6JL 3QXTA 1TZGL 2D0FA 1J0KA 2DB8A 4HWBH 2XTJB 2W9EL 3ZHLA 1U2CA 1U2HA 1MFDH 4UOJA 1MSPA 5E00B 4X6BA 2O5YL 1DBBL 3BPLB 2RQ8A 2VDNL 1FN4A 3K80A 1Q9KA 2ZCLL 3GZKA 4U6VL 5B22A 1HSAB 1MY7A 1UT9A 3SE8L 1AGCA 3ZT5A 1QR1B 4O4YL 1INEL 4OI9A 4LPUA 5FOBB 4JJ5A 4BYHA 5IWLC 1NPUA 1OD7A 1OAZH 1WTGT 2VLLB 1JBJA 3DRQB 1P4LA 3S88H 2MOVA 2D0HA 5DWUH 5GGTA 4JQVA 3FFCA 1NCBL 4ELKA 4YQXH 3CMOL 4XAWH 4JQXC 1D5MA 4XCCH 2Q20A 4I3RH 2DMBA 4OLXH 3ZDXE 4PJDE 3HRZA 3S3SA 3DRTA 5D7IA 1Y0LA 4I2XE 3QRFM 1FRGL 5E8NA 3OF6D 3L3OB 4M1CD 4FMKA 4HKJA 3E3QE 5EORH 1QBBA 3ZTNH 3KWWA 3HNVH 2HFFA 1OF2B 1NMAL 1U8NA 4MX7A 4K3JH 1TXKA 3D87B 4LSSH 1HINL 4YEFA 4U1NB 5JXED 4QRSA 4XI5D 4PJ7A 1MRCL 4XWOD 1U8LA 4F9LC 1HK6A 1QBMH 3X17A 3B9KA 1WEJH 1IQWL 3KYMA 5MHSD 3Q6FB 4Y5VB 2VISB 5DC0A 2P5EA 3LMJH 3VGGA 1C16B 1KTLB 3GMLB 2R1YB 1NSNL 1S3KL 1S7VB 3V5HA 4K2UH 2A77L 3WFZA 1U93B 4RGOH 2C1OB 5FA4A 5E5MB 5KSAC 4HUVA 2VRAA 5E70A 3QUZA 2XWTB 1PSKL 1S9KC 1YEEH 3MRPA 3IFOA 4OT1H 4HX1A 1NDGA 4L29A 4PRHE 3QQ4A 4JEGB 5JW3H 5AYQA 3QNYA 3LDBB 5HHOE 5E6IA 4WW2A 1BEYL 3DUUA 1JTPA 1JHLL 2YWYA 1CLYL 4OCMC 3TJHD 3ARTA 4NBYB 1G6RL 3L5XL 1XGPB 5MEND 4D3CH 1QSED 2XFXA 4PP2A 1NGPH 4IHOA 4XNZB 4OV5A 4JRXE 1WT5A 1IILE 4X7FC 1LDPL 3DYMA 1IGYB 3OSKA 4WFHE 1Q0YL 3T65B 4OZFH 4YO0B 3IFNH 1RZKH 1Q9WA 1A2YB 3MCKA 3O4LB 3VFVA 3ZKMD 1DQJB 2IC2A 1IGML 5E2VH 5L0QB 1W8NA 1I4FB 1RZIB 1U8KB 1DVFA 1U3YA 2RFXA 1PLGL 2CK0L 1ZKAA 2AEWA 2JELH 4GXVL 1A7OL 4R0LB 3Q5TA 5D9SB 5I74B 5FYKD 5C6TH 1J1XL 1QLRA 4XPTH 1K8DA 1F4XL 5EU6B 2IAMB 3C8DA 3VXUD 5CBEA 3NCJL 3HTLX 1MQ8A 1MAMH 2C3VA 5BS0D 4QHUB 2VLMD 1OGTB 4N8CL 1KEGL 5EO9B 5LCVH 3JWDH 1WJ3A 4Y16B 4S1QH 5SWZE 2BY0A 4KGJA 4M1CC 1RZFH 4RRPA 3O3BA 3AM8C 2DL2A 4QRRB 3VWJD 3EJYC 4X6DE 5F6IB 1MRDH 4XP9L 1UXWB 4QLRA 1AD9A 4ODWA 5JXEC 4V1DE 2NZIA 3A67L 4XBGA 2AK4E 4XI5C 1NJ9B 4X4ZA 1LILA 2EIZA 3HB3D 5C2BH 4XCNA 5DD5L 2DLHA 5HGAA 1U95A 3H6JA 1G9MH 4NT6A 2DYPA 4GS7C 4YDVA 3CFCL 2H8PB 2C26A 1I85A 3VGAC 2X4TB 2ZWLT 2ATPA 3D18A 3SDXF 1EO8H 1BFSA 5F89B 3LN4A 3S4SA 5JW5A 2ZOLA 3CC5B 4Y1AB 1RIVL 5FYJE 4K9EC 4F7TB 5B3JF 3NIGE 3IFPA 3Q5YA 3E8UH 1N5AB 1AGFB 3KJ4C 4QXWA 4WO4D 4HUWA 5C3LD 3W5NA 1F97A 3DX9B 3ESUF 4OTXL 4XH2A 2ADJA 1IARB 2IALA 1G7QA 5GJSH 5H94B 3TJHC 5FV1L 1LK2B 1ZLVH 2R4RH 1G7IA 2MPAH 3BO8B 1JHTB 4I48B 1XIWC 3ZHDA 3QEQD 4PJ9D 1T6VN 1ZHKB 3OR7A 2DLFL 4OIIH 1WBZB 4LCIL 5M94B 5J6HA 2NX5A 4MQTB 1GGCH 3BJLA 5FDYA 2MCPH 4J3VA 3B9EA 2ZOKB 3FMGH 2VB5A 1CGXA 2EDRA 2VO5A 5JHDE 5GS2H 1NC4D 1IEAA 5FO8B 4IIQC 2QSVA 2XACC 2AXGB 5IVXE 3DGGA 1EDQA 3GMRB 4EN3A 1FIEA 5EO1B 4D0CA 3OKLB 4EJ1C 1MFEH 2J5LC 4UDUB 3U7YH 5CLTA 4YDKL 1JWUA 2F74B 1C5DB 4ACPA 1WF5A 2OZ4H 5BVPH 1ZVSA 4PJHF 5TDOA 3VU2A 4Z76B 3P73A 3OMZA 1KT2A 1G7LB 4KC3B 5LAXB 1U0QA 2BSSA 3PV6B 2M2DA 3HNTL 3VWJC 2APBA 5GRVL 3GJEA 5CAYB 4R3SA 1BFOB 1U8MA 4GG8B 4XBPA 4NBXB 3CDGA 5GS1A 2DIJA 3C09B 4NQSA 5MEPB 5LVEA 1R3JB 3QQ9D 1T7VA 3UBXB 3U0PB 2GAZA 4XX1E 1J1PL 5I15L 5D2NB 1YQVL 1SJHA 5IB3A 5T3ZH 1OQOA 12E8L 5BW7A 3FT2B 5CJBA 5C86A 4OF8A 2AV1A 2DQCL 5KZCD 1INQA 4QRPB 3B3IA 5KVEH 3RWGA 4JO2L 3THML 5DZLA 1HI6B 1SY6L 2PW2B 1OB1B 1UGNA 1F6LL 3DPBA 2X4RB 2Y6SD 1A6VH 3QRGL 4YHNA 1Z9LA 5F9JA 2OTUA 2A38A 4M8QA 1QTYT 1F5WA 2BC4A 2CKBA 4HPOH 3U9UA 5CEZD 4G6KH 5HPMA 3RBGA 1F58H 5IQ9B 1MPAH 4LU5H 2EDWA 5GZOD 4NHCL 1T1ZB 4JGMA 4P23A 3QFJD 3OB0H 3X3GL 3MFFB 1RZKC 4NHUB 1KPRB 2IQAB 2EDBA 4O51B 4LOUD 2ZUXA 3Q3GB 4OZIE 5C0FB 1VFBB 2CDEA 3PWJA 1OW0C 4PJ9C 1M71B 3L3IB 1TMCB 5DK3A 2EDNA 4Q9CA 4Q9QH 3F5WB 5HI3D 4ZFGH 4Z8FH 5HYSB 5I6XB 1UENA 3UTQB 2HT4D 3B2VL 1HXYA 2FJGA 2GW5A 2DWEA 1EXUB 2VAJA 3MODL 1AP2B 1TETH 3VWKD 1IGTB 1XF4B 4U1LB 4RGMC 4GT7A 1BGXH 2Q7NA 3NCEB 5CFHA 3JWDC 1C5CL 1FVCB 4YDJA 1FFPB 1KBGH 4U1GC 2HKHL 1N0XL 4ZFFB 3MRLB 2FX9H 5C8JA 4PS4H 1JNNL 4OJFH 3OZ9H 3PABA 4PJ8D 6CGTA 4NGHL 5CKAA 1S5HB 2ICES 4EDXB 5I75C 1F4HA 1DUYA 3BQUB 3S37H 1F4YL 3T2PA 1RUAL 2PYEE 1UZ6F 3BPOC 5FUCC 1QA9A 2Y5TA 3KLSA 3BEVB 4AENB 4NFBA 5JO5B 1G9MC 1PX3A 4PB0H 4DAGH 2W9DH 3IVKB 1LEKB 3MRKA 5CMAA 2BOCB 3CCHA 4QTHA 1D7FA 2K3TA 1DE4B 1FCCA 3TH3T 4ODSH 3IKCA 3IU4H 3HMWL 5KS9E 3MLSH 3VXRD 4X6EA 4Z5RB 2R0KL 5IMMB 5DS8B 5TQ0H 4QKXB 3MR9B 1AQKH 3HZKA 2Y6SC 2YPLA 3MNZA 5I1DA 3HZMA 3U6RB 4YH6A 4PJCA 2JIXD 1X44A 3M45A 3MRQA 2ADFH 3AVEA 3B43A 3MUGB 1FZJA 2DMCA 4HD9A 2X41A 4Y2DC 5E94A 2FD6H 1AXIB 1W72B 5GZOC 5IJKA 5H2BA 2NY5H 4PGEB 5T1KD 1Q9OA 2R15A 3R1GH 1ZGLB 5EU6E 1ETZB 3IJSB 1T5WA 3LN5A 5E6ZA 1NUDA 2IWGA 1QLEL 4KRPB 5DURD 3SDDB 2R2HB 4N90E 3ZL4H 1E27B 3MOAL 2GYSA 1I9RL 1YEHL 3WXWL 2DICA 5DJ6B 4EOWL 4WHTA 1II4E 3LQZB 2NY2D 4LQ1A 2B1HL 2HT4C 5J6GB 4K9EL 3MV9A 3RZWA 3LKPA 3R8QA 3VWKC 1ULVA 1MFDL 1FDLH 1WIOA 4HWEH 3ET9F 3PHQA 3I3BA 1TQCC 1NAMA 3INUH 4NO5B 4F7PA 4PRDA 4JVUA 1XGQB 4ZNEE 5EUKB 2E9IA 3BPCB 5F71A 2HN7A 1S7TB 4H1LA 3WBDA 5KG9A 4OM1L 4Y4HA 4PJ8C 4GRMB 2HJKB 3VMNA 3BYYA 1G0XA 1DBML 5IESL 2XWBB 1QSZA 1SMAA 1OAZL 3G5XB 4UV4H 1MHEA 3BKYL 3C6SB 2J2ZA 5I0DA 1IBGL 4L1HA 3G5ZB 4XPAH 4KZDH 4O02H 3TNNB 1CD1A 2DBLH 5JW4Q 1QFWM 4BJLA 5F72S 2CRZA 4I3RL 2NW2B 3RVWC 1F2XK 2DWDA 2VAAB 4PRNB 3VXNA 1F13A 4MNGE 4O2FA 1CFBA 4KJPD 3ZE0E 5EORL 1N4XL 3RZCB 3HNVL 4HV8B 1HHIB 3GSOB 4MA1B 5GHWH 3QQ3A 4QY8B 3RX7A 4O2CA 4NM4L 5T1DL 3ARBC 3X13A 1KB5A 5B8CA 1QBML 2Y7QB 1J8HE 4QT5A 5T1MB 3UTPE 4PTTB 4GRLD 1BLNA 2ADGA 4TOYH 4GAYA 4WTZA 1HZHL 4ZNCD 5CD3A 3OKKB 3SKNB 3QDMD 4P5MA 5C2UB 3V4PL 5D72H 1NLDH 4D0BA 3MBEA 3BFOA 4R7DA 4QGTA 1UC6A 4QRQA 1D6VH 3S35H 3GSNH 4RDQG 1IM9D 1R5VA 4X98B 5ADOH 4L5FH 5IM7B 1MCRA 4OT1L 1KIQA 4L9LC 3BZFB 4IRSD 1CQYA 2NY2C 4QXUL 5E8PB 2OCFD 4UAOC 5IB5B 3V5DB 1KPUB 3DV6B 4QCIA 3NCBB 1EV2E 2X4NB 5DF0A 3BAEH 5C0AE 5IK3B 4D3CL 5CKGA 1NGPL 4R90H 4YR6B 1N6UA 4LP4A 3EW3B 2VITA 1SMOA 5I2IA 3P9WB 1R3HB 3L3KA 4LIQL 1Q38A 1RZKL 1NQBA 4ZFZA 3VRJA 1AD0A 4KJQC 4URTB 4BQ8A 3QSKB 5E2VL 3BOVA 2VLJD 1NBVH 4YFLF 4G8GE 5DRZA 5F7FA 4L3EA 4G9FB 1Y6KR 5D8JH 4OFKA 1KELL 4DGVH 4ZAKD 3SDAA 4RISH 4B53A 2B39A 1YC7A 1SJVA 1OM3L 3QUXD 3GSQA 1RJCA 5C09B 4I5BB 1K8IA 4P2RB 1CDBA 4EUPB 5GS0H 1A7PH 1ZOXA 3TBSB 5E03A 3SE9L 1MELA 5C0CE 3ZKSD 1BZ7A 4M93C 3JWDL 4PRBA 3WNMA 1WK0A 4FQCL 4JFFB 5INCA 4U2ZA 1RZFL 1UWEH 1TJHH 4F9PA 4KJPC 2SEBA 1IL1B 4UZGA 3RAJH 1KLGA 4LCUB 3RWIB 3FCTA 1OTUD 1ZT4A 3WHE1 1AE6L 1HSBA 2FSEA 3DV4A 4KQ4L 4PRID 5ESVB 3OBAA 1NGQH 2NY5C 3LB6C 4LLUB 5DUMH 4C54A 5C2BL 4NN6C 3I50H 1G9ML 3IJHB 2VUYA 5TQ2H 5ADPL 5KN5B 4KQ3H 2AGJH 3SDCC 1I1FB 4G6JH 4YWGH 1GGBL 1S7XA 4JY6B 1OAYL 4CU6A 2HVKA 4HCRH 2VMFA 1NUGA 4U1SB 3WIHH 3HHRB 4MZ2A 4K3DH 4ZDHA 3TM6A 2BXZA 4IRSC 3H9HA 4X7DC 2A6KA 4ERSH 4PTUA 1N59B 3OPZH 5D7LA 2QL1A 3JTSA 5GJSL 1MLCB 1BQHA 3U2SB 1WFOA 4X6DF 1KJVB 5C0BE 3SDXA 1FYTB 5CEZL 3I2CH 3SCMB 4YHLL 5EOTB 3ARGB 4LVOC 4DCQA 1J9CT 2F8VA 2MPAL 4Z78A 3V9FA 2R39A 1VENA 4CADB 2CIKA 1MCJA 4U05A 5CLWA 4OIIL 4XCYB 4E41E 2K7QA 1EAPB 5BMFL 3WNOA 1NFDF 2FGWH 3QUKB 1GGCL 2MCPL 4X99B 1JPGA 1NC2A 1BQSA 1KENH 3L5WB 1LP9B 3CPLA 3IF1B 4RWYL 4RNRA 4X0KB 4XXCA 5EU7C 3B83A 4ZAKC 3QHZL 1MI5D 4GJTB 4JFHD 5EULV 3OGCB 3F7VB 4GKSA 1WWAX 4X6CE 5JW4M 3QUXC 2EDFA 1MFEL 1ZK9A 3P9MA 4NQDA 5GRJH 3OAZK 2A74B 3HCVA 1MWAH 4J3XA 5INDB 1RMFL 1LD9B 1H5BC 3EHBD 3IRPX 3S6CA 2OL3L 5JIPA 4L8SC 2IGFH 3ZYOA 5BVPL 1JGLH 1AGEB 5IB4B 3MMEB 5A2IH 4P46C 1YYLH 5T3ZE 3BIAX 4JFXB 2GSIB 2HYMA 5E2JA 3UAJC 1OTUC 4I77L 4WY7H 1JRHH 5C71A 3F62A 3VFUB 4DGIH 1OAXH 5KAQF 1C12B 2R0LH 3BP5A 3HPLB 5GSVB 2VDQH 4IRZH 2GK2A 3M07A 3V0AC 3GKWL 2NPLX 4GW5A 4JDTL 1ZLUK 1EJOL 1LEIA 3O41B 2H32H 4C59B 3C5JB 1FLRL 1VERA 1FNLA 4PJHA 5IHZB 4MXQD 5HBBA 2XNAA 5CSZB 3QXUA 1K5NA 5KVEL 4HJGB 3ZKXB 4I0PC 4WWKA 4NKOB 2CJUH 5DHYB 1A6VL 3KPLA 5F7EL 3V7MA 3SE4A 1BD2E 3MYJA 3NMEA 5IKCA 4Q58C 3RL1A 1JI2A 3BP7B 3ARDB 3QUYA 4S1SH 4LU5L 5CS7A 5TGBA 3GIZH 4PY7B 2V5RA 1ROWA 1ND0B 1QSFE 2RBLA 4H5SB 4N0FB 5FKAB 3T04D 3C8KB 3Q48A 2R0WL 1FL6A 1AC6A 2RCSL 4PJGF 5J13C 1UKQA 3O2VL 3HFML 5E2TL 5H35B 2DF3A 3GBNH 3GI9L 3MGTB 1ORSA 2X1XR 4G8FB 4KMLB 3MACH 2R1WA 3D0VA 1NCDH 3NFPB 4QGYA 5AD0A 4Z8FL 4HW6A 2NXYD 2XKNA 1K2DA 5IJVA 2D7NA 5HHQB 1UJ3C 1Z6JT 3DX8B 3MBXH 4M00A 4LHUA 1FL5A 1BGXL 3QDJA 2ESVD 1LNUA 1RFDL 3IETB 3S5LG 1B2WH 4HIHA 1KBGL 5BV7B 1I3RB 3PWNB 1ZS8B 1EIBA 4R4ND 4LSPH 2FX9L 3SHSA 4PRAB 4O5LH 3EHBC 3ISWA 2Z9TA 1QRNA 1LDSA 2KH2B 2Q86A 3AUVA 3KPSE 3HI5L 5DJAA 4N0UA 1FNGB 4V1DD 4WV1C 2YKLH 5C0EB 3ZYIA 3B5HA 3D39D 1CN4A 5ACZB 1CL7I 2WQRA 3BGMB 4EI6B 3S37L 1WIUA 3UEZA 5EZLA 5TE6H 1AGBA 3CJJA 1ZT1B 5C0GA 4I1NB 4DGYH 3UDWC 4Y4KB 1KN4H 2A9NH 2RHEA 3N1QC 4JPVH 5DQ9A 3QIUB 3W9EA 4DAGL 4MSWA 3BKCH 3UPRA 4IDJH 1YA5A 2A2QT 5KVGH 2C4FU 5FYJD 1ZA3B 3TBYB 4MXQC 3VXPB 4ODSL 5A43C 3IU4L 1G0DA 3MLSL 3G04B 3OHXA 2VDMH 4ZO6A 4GQ9H 3VA6A 4XAKD 4PJ5B 5EUOE 5GSRB 5C08E 1JCKA 2ID5A 4FQ2L 4HDIB 3NCYP 4HGKC 1BOGB 4ISVA 3HRPA 4W4OC 3RDTD 4NQEA 4ODVH 2O93L 5GIRB 3VFRA 3QNZA 4G9FE 4ZSOE 3O8XA 4NIKB 1CICD 2AJYL 4LLWA 4HXBH 2COQA 1MHCA 2FD6L 4PRPA 3C5SA 1RIHH 1J8KA 1PDKA 3QXVA 1T03L 2NY5L 4YGVB 1I7RB 3SGDI 1DQQA 1ZT7A 3VRLF 1T04A 5E9DD 2UV3A 4P2RE 3QJHA 5JORB 2G75A 1M7IB 3SPVA 2ZZUT 4OZGB 3QJFB 5C07B 5DK0A 3GB7A 3NPZB 2ZG3A 3V2AR 4MNQE 4BH8A 2AXFB 3EIFA 3MQIA 3GUTA 4BZ2H 2F53E 3WKMH 4G7VL 3UPAA 1UKSA 1VFAA 3QO0B 1LE5B 3UC0H 5IROA 2EEAA 3FO2B 4MD4B 1HDMA 3P4MB 1P53A 4HHAA 3VFSB 1FDLL 1VEOA 1FE8H 4HWEL 3MLYH 3X14B 1KSRA 1DQDH 3KDMB 1MVFA 1JJUA 3INUL 2BFVL 3JTTB 5ISZA 5CIPB 2ZUQB 4P2QB 3ZDZE 3QEUA 5IMOA 1BZ9A 4R4NC 2YEZA 4P9HH 3FFDA 4J12A 5I30H 2W07A 3T1FB 3KPRA 4LLMB 4UINH 5KSVB 2A1WH 3ULSA 3VXQB 4JFOA 3D3VB 2QQKH 1HH6B 3GM0A 3TBTA 2XTJD 3JZ7A 4UV4L 1CDIA 5MI0B 2AJZB 1VACA 1C8PA 4OAWA 4XPAL 5IV2B 3BGFC 2XZQL 3GMQA 3O3AB 2Y1VA 2DBLL 2Q3AA 4ONGH 1UYWH 4LCWA 1F6AB 1M6OA 4XVTH 3DX6A 3S3JA 3UTTA 1R0AH 3REWA 3BE1H 1B3JA 1YN6A 5GRXG 2CLZA 3ZTJH 5C9KA 3RUGB 3IKKA 2MCG1 3SKJH 5F9WB 1FYTE 2BSED 3QUML 5CEXB 1FNHA 4LSUH 3QFDB 5JPNA 7CGTA 4IBLT 4DZBA 2YHGA 3IDJA 5FCSH 5D7JB 4HPYH 2XN9A 4MXVF 1S8DB 5JNYB 1CGTA 2I60L 1ZSDA 5GHWL 4KKAD 1RPQA 4OUOA 4LBEB 3OAYK 3AS2A 3MUHL 4F3FA 2AS5M 1HQ4A 5FF6B 1CICC 4IRJA 3MA7B 1NANI 2XI9A 2CDFA 2GCYA 3FB5B 5IBTH 4FG6C 2PXYC 5DA4A 5FHBH 4L4VA 3HN3A 5T1LA 5D72L 5HY9A 3VGFA 5J11B 1NLDL 4NYLA 2HKFH 4ZUVB 4JRYE 1GGUA 3CLFH 1D6VL 1H3VA 4UTBL 3QDGE 4FZ8H 4M62H 4D2NA 5CP3H 2XPGA 3ALXA 3CFKA 1J5OL 1IAKB 1BQUA 4S1RL 4PJFF 1U8OB 1CVSC 1VPOH 1GAFH 5I9QB 4MB4A 5EO0A 1E4KC 3RTQA 3EO1A 3BRGC 3BD4A 3VI3E 5L2JB 3EGSB 3JV6A 4RFNC 1IMHC 1EEZA 2ADIA 4EZMA 2I5YL 2IPUK 4LSTL 3HC0A 2JTDA 3STLB 4AL8L 3IU3B 4LVHC 3VJ6A 2X44D 4XRCA 4BKLB 1G7JA 2AEQH 3OJ2C 5GGQH 3SJVB 3S4SG 5IF0A 1NBVL 2E6JA 2ZSVB 1KNOA 2D03L 2FCBA 2EXWC 3WJLA 4Q2ZB 3ZT7A 2WBJA 4GSDL 4JZJB 2XTJC 5IVZA 3K2MC 4DGVL 3MV7E 2HFGH 2VE6A 4JM2B 2IG2H 1ZA6A 1FZMB 1QNZH 3I6KB 1NCNA 2P46B 1TQBB 1RK0A 1JPFB 3X12B 5I16A 1G7PA 2X4SA 3D25B 5ANME 1A7PL 2LVCA 3TCLB 3SO3B 3V8OA 4Z7NF 5JXAH 4DK3A 3O4LD 2YXFA 1F3JB 2W0FA 1G6RA 5GGSA 5IHUH 3FQUA 3BMWA 4XNUH 4QHMA 2OJEB 2YWZA 3FRUA 1CLOL 1E28A 2P7TA 3RAJL 4NZDA 5DMGD 2C3GA 3QI9A 1NGZA 4YIQB 4I9WD 4W70A 4NO0A 3S36X 4XGZB 5DJCB 1FFRA 2YPKA 5E99H 1MCFA 5E8DH 4KKAC 3RHWF 3QHFH 1ZXQA 3DVFA 5EU6D 1NGQL 2IAMD 4ZO7A 3MNVB 3OR6A 1BIIA 2L7UA 2VLRA 1OCWH 3HG1A 2CRMA 2Z93B 1RJZA 3C9NA 3I50L 4U1IA 4N90D 5KSBE 1A0QH 5F7WC 5TQ2L 4Y16D 3TT1H 3HE7B 4YHPA 4KQ3L 4G6JL 3UX9B 3IJYB 4YWGL 4ZFOL 2X89D 4QRRD 4XCFH 3WDJA 1I3UA 4HCRL 1QBLH 4K55A 3WIHL 3BESR 4JFQB 1WV7T 1F90H 2QQNH 1YDPA 1PKQE 5DYOA 1D5ZB 1JF1B 4F58L 1FNEA 1Q8MA 2X4OB 3BZEB 4KKCD 4M6OL 4Y5VC 2EH8H 2AXHA 1A1NA 1KIPB 2WINA 4FXLA 1CXLA 1BJMA 1MAKA 3SN6N 4P9HC 1RAMA 5FYLE 3BEWA 3WHXA 3I2CL 5GGTH 2ATKA 1JNLH 3I6GA 4LF3B 1Y6NR 4PJBF 3LKRA 2HH0H 3AREB 3L3DA 4XNMA 2NTFB 4ETQB 2WBKA 4M7JL 4Y1AD 2BNQE 1HXMA 2LAGB 4G6FB 1JPSH 2NY4B 1J0JA 3QG7H 4XPFL 4JY4A 1INDL 2FGWL 4X4XA 5BO1H 2NR6C 4NKMA 1L6ZA 5EU3B 5CGMA 1KENL 4MJIB 4F80A 1FL3B 3LDBC 2F5AH 1TENA 2C1PB 3MUZ1 4HFUH 1ONQA 4AG4H 4HG4J 5IW6B 5JA8B 4XNZC 4XCEA 4R7NB 4L3CB 1MWAL 4XNYH 5I1KH 1NFDA 4KTYA 5DRXA 5DMKA 5I1IH 3FN0H 5E1AA 1KLUB 2VABA 4LP5A 1YYLL 3NH7L 5BZWA 4CNIB 3BDXA 4L8BA 5KVDH 4OD1L 4OZGE 5DMGC 5C07E 3GHBH 1A3RH 1K4CA 2GUOB 2Z92A 4MAYB 3UTPD 3EOYG 4R0LC 4I18B 4Z7UE 5I74C 4Z0BH 4DGIL 2ZUWA 2R0LL 2IAMC 5D5MB 3U30B 5AUMA 4R9HA 3MLXL 1I7ZB 2BY1A 4XHQA 2VDQL 1ZHBA 4IRZL 4CN6A 4XMPL 3ULVH 4N9GA 4GRWB 1T7XA 3CFEA 4Y16C 1UACH 3S97C 3C5ZA 2DDQH 4X6CF 1C7TA 4X5WA 2CJUL 5F6IC 5F3BA 4FFZH 4ODXB 2BVQA 4OLVL 4NWUH 4HUUB 1S7RB 4Y8AA 3TO2B 4ONHA 5LG1A 5ABDE 3WLWD 4JO4L 2EKJA 4DN3H 2APFA 3D0LB 5HYIA 3NBNA 5ILTL 3MCLH 1I7UA 2VZOA 3BDBA 4S1SL 1U8IB 1KN2H 4E42B 1QHPA 1BVKA 5K9OA 3QQNA 2XWJB 3U1SL 4JZNB 4TULH 1CDUA 2ZG2A 4U6HA 1PZUB 4MWFB 1U36A 4I13B 5LXGH 5FCUL 2UZYB 5IWLA 4QRPD 5I1JH 1N5YH 1XEDA 2J8UB 2NW3A 3RUGE 3MACL 4HIIB 3BP4A 1Q94A 5JZ7C 4X6BB 2H1PL 4IMKC 3K8MA 1CK0H 3LS5H 4NDMB 1IT9L 2IMNA 1KG0B 1VESA 1ZHLA 1TZIA 2EKSA 5HVFB 2YUVA 4BUHA 3E6HA 4U31A 1FGNH 4ENED 4ZUSB 4KY1H 1T1WB 3NCFB 2VZSA 4WUKL 1SY6A 4PJGA 3L3JB 1N3NB 3QA3B 5FXCH 4Q6IB 3FOMA 1KFAL 1U6AL 3F7YA 4C56A 1B0RB 1NGWA 2MHAA 3UJTH 1QKZL 3KXFE 4LSPL 2EDKA 4UTAL 1GC1H 2FO4B 4O5LL 3FFCB 1AI1H 4ELKB 4L4TA 3TPKA 3VFTB 1JTOA 1OGAB 1FG2A 4X5XA 4F9LA 2Q8AH 1FO0B 1D5MB 2VL5B 2YKLL 4RGNB 3AMLA 4J8RB 2PUQT 1HHHB 2DL9A 2Q1EA 4OCSH 3HRZB 2EDXA 5CJ8A 3QCUL 1HH9A 3N1GC 4QHKJ 4H0IA 2V17H 3QIWB 2VDPL 2N7AA 2P42B 4X9BA 3T0EB 1JZ6A 1EX0A 5GGVL 2PTTB 4HKJB 4WHDA 2GT9A 4KI5D 2YPVH 1KN4L 2A9NL 3KWWB 3OKYA 4IS6A 4X8JA 2C7UA 2C3WA 4YZFE 1LQSR 2YBRA 4OGZA 5KSAA 1JMZA 2UZXB 3DROB 3O6KL 5KVGL 5ID1B 3O4OB 3QNXB 1RVFH 3UP1A 2OR7A 4C83B 2DQJH 5DRWB 5C9JA 1U8LB 4Q9BA 1XR8A 3B9KB 5F88A 1XF2A 4H1LG 1H3XA 9CGTA 4JDZB 3FQWA 3BQUD 3VFMB 2P5EB 4JFDE 3VD3A 3EYUL 5FO7A 1MJ7L 2FJHA 3W0WB 3T8XA 4X6FA 3IXTB 1TVHB 2P8LA 2IANE 3V5HB 3C09C 1FPTH 3O6MH 4U1JA 2PTVA 3Q1SH 4Z7VA 4UILH 5HGGS 3LS4H 4CW1B 2OK0H 3FZUC 1RIHL 4KTEH 4YNYB 5D2NC 2ARJB 4MQXC 4UB0L 3MJ7A 5DFWH 4E9LA 3IFOB 3CVIL 4L8CB 2JE8A 5F44A 4L29B 3TVMB 3QQ4B 5DMIH 3PQYE 1NL0L 4JVPA 5E6IB 3MZGB 1LO0L 4IJ3B 4WW2B 1OPGL 1U8HA 5DQDH 3ESVF 1UA6L 4WFFE 5EOCJ 3ZYJA 1IC7H 5JTWA 4KI1A 3WE6A 5GRWA 4EI5B 1AR1C 4JAMB 1M1SA 1X4ZA 4MDIA 5CGYD 5ECJE 2WNGA 4L8DB 2X4UB 3VFVB 4YAQA 3MREB 5CJOH 2ZUVA 3E6FA 4FQJH 2EH7L 1FE8L 3MLYL 3OF6A 1LVEA 2VZTA 2Y25A 2RFXB 3AM8A 4KRPD 5DTFA 5F1SA 2WZPD 4WTZG 2HLAB 2JJUA 4FFVC 4HT1H 4R8WH 2XG5A 3BW9A 4KDVA 3SDDD 1GYAA 1EVUA 5T5FL 4P9HL 3WD5L 4XT1C 3V5KA 2XY2A 5I30L 5JXEA 1MVUA 1WAAE 2A1WL 4G8EA 4FQPA 4MHHG 1A14H 1RZGB 1OD9A 4NM8H 1LO3H 4BFGA 2WWMD 4J3TA 3UJJH 5GRYA 1T21B 2Z35A 5I6XC 1BAFL 5CJ5A 3CFJA 4JPKH 1I9JL 3OAUH 4CGTA 4NO3B 3CH1A 3TPUB 4ZPTB 1MFAH 1AO7B 4OCWL 1JTTA 3F7RA 4P2YA 5E8OA 1UYWL 4HSQA 1SEQL 1T2JA 3BKMH 1WZLA 4HFWB 3BE1L 4HUNB 4N5UA 2A6DB 1R24B 4FQQB 1AD9B 5I73C 3SKJL 3VH8A 1DEDA 2V5SA 5I1AB 3WO4B 4LSUL 5DC4B 4U3CA 1RJYB 2DQUL 2M26A 5F97E 4QYOA 3H3PH 4HPYL 3BQUC 1F00I 2DYPB 4YDVB 2FR4A 5C6WH 4Y19A 5MENA 4I3SL 4MMXC 5D2LF 3DVGB 2F54B 4JHAH 5HGBA 1HHJB 2HWZH 3OKNA 5IIEB 5SWSB 1NBQA 3MGOA 4X7SH 1XIWA 3FL7A 4NNYB 4JFEE 5IBTL 3PWPB 2UVEA 5FHBL 4EUPH 4HUWB 2AJSL 2ZKHL 3TO4B 3VFOA 3RZCD 1VGEH 2HKFL 4K7PY 2DTSA 4MYWB 4OBRA 4IIQA 5EIIA 2CH8A 4IOSD 3G6JB 3EO9H 2HTLD 4ZD3H 1R5WB 5KTEH 4Z7WE 1IAOB 3T4YA 4FZ8L 5EA0L 2EC9T 1Z2KA 1VDGA 2X2YA 1CXFA 3MLUH 1CE1H 4KGLA 5BS0A 2D7OA 4CU7A 3PGCB 1SYVB 1YECH 5CGYC 1VPOL 1GAFL 3G9AB 2BNRE 2Z4QA 4P4RA 3ARWA 2JCCF 5DI8A 5D5ME 4OM0H 4GMSH 4CAGA 1GC1C 1FBIH 1LE9B 1DQLH 2VDOH 2CUMA 4KRPC 4G42A 5CHNB 1IEAB 2X1QA 4NFDA 1NMBH 3VWJA 2HT2D 1BVLB 3EDJA 2O5ZH 1DFBL 5EU5B 3DIFB 4PJFA 2AEQL 4K3EL 3MJ6A 5GGQL 1W2KT 1MHHA 3GSUA 2P5WA 3TN0B 1SJEB 4U0QB 2WWMC 4ONFH 1V7MH 3GSRA 4QHLA 1TZHB 3U83A 3GBLA 1V3MA 4IOIA 3PP4H 1U41A 3CFDB 5D93C 4JPWH 1UQSB 4M6MH 3ALPA 4NQXB 4QOKA 5DD6A 5J1TC 4BQCA 3VXMB 5FECB 1D5BA 1BQHG 6FABH 1ADQH 5JPMA 3GRWH 2YD3A 1IC1A 5IUSA 4OZHA 1XCTA 1CCZA 3H9ZA 2VXQL 4HIXL 2O61A 4OZ4A 4YFEA 4R4FH 3KS0J 5L2KE 1F8TL 5H37G 1NUNB 4MS8D 5EDXA 4EVNB 4XNUL 4JHWH 4MAUL 2P48B 4WO4A 2KQMA 1BWMA 3WN5B 4PV8A 2ITCA 1T83C 4FQIH 4G9FD 1S9WA 5I17B 1S7SB 5BZDB 3H3BC 1V7NL 2BRQA 1X4YA 1KUMA 1OP3H 4TUKL 1IFHH 3I02A 3QHFL 4HS8L 2OJZH 4OZFA 4FP8L 4LMQI 3IB4A 4XB8A 1QPXA 5C09D 4KKNA 3RWGB 3WNPA 3CNKA 1H3WM 1UCBH 4YHNB 5HHMB 4PJ9A 3V52H 4KVCH 2OQJA 4RA0C 3IDIB 2C4XA 3TT1L 4OKVB 4JFFD 1P84J 3ROOA 3QH3B 4F33A 4DZ8B 3RZCC 5HDQH 1YUHB 4MGXA 1QPPA 4LKXA 1NC4A 4U0RB 4AY0A 1NAMH 3FFCE 5IEKA 5EPMB 1KPVB 2IPUG 1WBYA 1VB9A 3D85B 2A9MH 1OARL 2G60H 4JHBA 1ED3A 3V6OC 1P2CB 5FO9A 2I26N 3ARZA 4LPXA 5AZ2L 1YEGH 5D7IE 2VQ1B 3PE9A 2EH8L 3DXAB 5IMKB 4NQVB 5FGCB 3PWUB 1PW3A 5BVJA 3MRGB 1Z5LA 2K9UA 4LFHG 2VL4A 1QO3B 4TPRL 1JNLL 2AEIT 1S7UB 1HHKA 4DKDC 4BK4A 2HH0L 3HUJF 1UG9A 4V2CB 4OF5A 2OR9H 4CVXA 4NRXA 2BP3A 1WUNT 1ZTXL 3EJJX 4TSAL 1QFWH 1XGRB 4PJ7E 3LH2H 5EH1A 2BVPA 3QG7L 3O9WC 5EN2A 2YC1A 5BO1L 4MD5A 3BPNB 4YDJB 2K7PA 5FDWA 3QWOB 2NNAA 4OCRH 4YHZH 2P5EE 1CIUA 4X4YA 5C8JB 2YN3A 3JUZA 1CYGA 3L5JA 3PABB 2CUHA 4HFUL 2QHLA 2B4CH 4ZS7H 4PJBA 4AG4L 1FYTD 3BZ4A 2J4WH 4QTIH 3SCMD 3RU8H 3ARGD 4Q0XL 5CZVH 5HI5D 1KB5H 2BSTB 5I1KL 4BQ6A 1Q1JH 3T0WA 3GJFB 4YHKL 1TVBB 2Y5TB 4AYFA 1OQXA 2FRGP 1T0MA 3ULVE 2A83A 4F37F 4MS8C 1JL8A 4A6YB 1OOAA 4Y2DA 5KVDL 3P4NB 1FJ1A 2WAHA 1UADC 4U33A 4PB9H 2EC9U 2E6PA 3MRKB 3U36B 2YRZA 3D5OF 4CKVX 5JOPD 2GTZA 5JQ6L 1BX2A 5JUEH 3N9GL 5I1LB 2FB4H 4Z0BL 1WIPA 3IKCB 1NGYB 1XZ0A 1EA9C 4HGMA 4LHUG 3TP4A 2X7LA 3BP6B 1HHGB 4RAUB 5JOFA 3B8YA 4G6MH 1J18A 5A2KH 1U58B 3HZMB 3X3FH 5BV7H 2ENSA 3LRGA 3Q0HA 2R2BB 2V7HA 3SDYL 4ZTOL 3F7QA 1WLHA 1LK3H 2XOTA 3FTGB 3E2HB 5DFVC 4FFZL 3VWKA 1FNAA 5EZJA 3FB7B 4NWUL 4Q97A 3L95B 1PQZA 2OL3A 5CSGA 3NIFE 4KK5D 3MCLL 3EAKA 1DZBA 2V7NA 5EC1B 2ZCHL 5DD1H 4YXKL 1L0QA 1CBVH 4FTVB 3B8SA 4ODTH 3LV3A 2HJFB 4TULL 4OBSA 4PJ8A 3MRMB 1N6QH 4M48L 5LXGL 1CI5A 4Z7UF 1OHQA 2LTQB 2R2CA 1N5YL 1WTLA 2Z8SA 4G9DA 1KB9J 3VMOA 4TSCL 3RPIA 1RD6A 3PHQB 1CK0L 4HAGA 3OXSB 2CPCA 2J8OA 4N8PA 2QSCL 3W82A 4NKIH 3ARDD 2UZIH 3Q2CA 2B7DT 5FHAL 3DURA 5F1OB 1UXSA 3BVNA 2DQFA 1YN7A 3FKUS 1FYHB 3H9SA 3KPMB 3KLHC 1IC5H 3V6FA 1IM3A 1A4JA 1KXQE 1RK1A 2AJUH 4JY5H 3W2DH 1H3PH 2R23A 4MA7H 2ERJB 3VXRA 3HC4L 3ARGC 1W72L 3OJVC 3UJTL 5SV4A 4KU1A 4BSWA 5HI5C 4NRYA 1UB6B 1RZ8B 2CXKA 3DUSA 1GC1L 4W6YB 1S9VB 5ERWB 3ARBA 3HI1A 2JIXA 2Q8AL 1BIHA 3JBG7 2A6IA 4OCSL 2EDLA 4U1KA 2GIYA 3UPCA 1T1YA 3VCLB 2W60B 2V17L 4PBXA 4PREA 5DT1L 2FZ3A 5T1KA 2GFBB 5CEYB 3TBWB 2YPVL 2YUXA 5K9JH 5A1AA 4Y0GA 3UTSB 4OGXH 1HE7A 5GISL 3QQ3B 4O2CB 3BH9B 3GMPB 1RVFL 2NX5E 4GKZB 2DQJL 4QHNA 4YHOL 4DTGH 3ARFB 1P7KA 3MLWH 4QO1A 1UFUA 4HLZG 4L9LA 4RAVB 3L9RA 4EEEA 4N1CA 5C0DB 1QFWI 2QKIB 1T89C 1AGDB 3P77A 4KKBD 3KYNB 1T7YA 5C1MB 3VE0B 1A6AA 5H37H 4RMRA 3JV4A 5IFAH 1EMTH 2BHYA 5CD3B 2DLEA 1A21A 1TNNA 4NQUA 4Y4KD 1OTTD 1FPTL 3O6ML 1CDGA 5MEQB 3O11B 3Q1SL 2NY7H 4NUJB 5DLML 1UWGH 3QIUD 2QLVB 5JLZA 1JMXA 4KTEL 4BUGA 5E08L 1R5VB 2YD7A 5I1EH 4LMQE 5HDOA 1EAJA 1ES0B 3GMMB 1A6ZB 4M4RA 5DMIL 2QQQA 1MLBA 4DVBB 4NZRL 3ZKXC 5DQDL 1G7MB 4ZODA 4P57B 2CSPA 4PJ5D 5DR5H 4TVPH 4JANB 4OKDA 3MROB 1MUJA 4OCNC 3K8KA 3ZDYF 5I2IB 3OX8B 5L8KB 5BQ7A 2W38A 2YN5A 3ARDC 1DUZA 3GM8A 1ZWIB 3LRSB 4LEOB 5FB8A 3O0RL 3ES6A 4DVRL 4ZOBA 3W81A 3DNKA 2RIKA 4BFEA 3VDCA 1AJ7H 1Z0NA 5DHVA 3TEUA 5GPRA 5DRZB 4L3EB 2YD1A 5EWIH 3F65A 2VLKB 1RU9H 5FKPA 4R8WL 5C07D 3EFFB 1AHWB 4GLRI 5HHME 3FB8A 4N0YL 3IDGB 1QLFA 5HYJA 4X9FA 2OXHA 4RMUA 3LN9A 4PD4J 1FV1B 3UJJL 3DX7B 5ELIA 4PYGA 4NPYA 2OP4H 4JPKL 5E4EB 1F11B 1MQKH 1BZ7B 2GITA 3OAUL 4PRBB 4AZ8A 1QQDA 3B2UD 1IKNA 1BM3L 1P69B 3SDCA 4OI7A 3H7LA 3P30L 4PG9A 2WIIA 3RHWK 5FOJA 5BV7C 3BKML 4P2QD 35C8L 1EHAA 1CFTA 3DV4B 5I76A 3I75A 1JHKH 3U4AA 1FVDB 4OLWL 3ZKND 1IM9A 3MA9H 1CWVA 5EOCL 4IRSA 2R9HD 2AJ3A 4CVWA 3NZHL 4IMLA 3D3VD 3T0BA 5EIVA 1DEEB 1YNKH 5KSUA 3H3PL 4DFHA 4OUUA 4GG6B 5CILH 1OT2A 4JHAL 3GMOB 2NY3B 3DETD 4PJIB 1Q0XH 4Y4KC 2HWZL 3H42H 2HVKB 3IDNB 2W0LA 1UM4L 3EO0A 3NN8A 3QIUC 4FXKA 2E3VA 1E4WH 1L7TL 4HIJB 1ZEAH 1MCBA 1ZVYA 2Q76A 3VRIA 1YPZB 4XZUB 1W0VB 2VLJA 1GZPA 2A6KB 1VGEL 1IEBB 5ENWA 3HZVB 1NEZA 2MQ3A 4HS6B 5F6HJ 1JGVL 5D7JD 5D2LA 1BQHB 4WFED 4PLJD 4ZAKA 1CQKA 4F9PC 3SDXB 3EZJB 4POUB 4HKXA 3QUXA 4MA3B 3MLUL 3QXWA 4AK1A 1TVDA 4LGPB 4XNQB 3RWCB 4Z78B 3QUMA 2I9LB 2CIKB 1H5BA 4UOW0 1CFSA 1GGIH 4XNXH 3HAEH 3V8CA 4L8SA 1Y18B 2ZCKL 4OM0L 4MQ7B 4GMSL 3RWFA 4P46A 1ZLVK 3KPQB 2GJZA 1T0NB 2VDOL 5T3XE 3AXLA 3CPLB 3U4BL 3CX5K 1NMBL 2WV3A 2YPLE 4RNRB 4PJCE 5FK9A 4EQ2A 4PRIA 3S96A 4GKSB 4ODHH 1T2QH 4YX2H 3P9MB 5L6YL 1MNUH 1HYRC 4OGYH 4ONFL 1V7ML 1GHFH 4GBXC 3CX2A 2V2XB 2JCCA 3HMXH 1JWMB 2W91A 2APVA 3PP4L 1A9BB 3EDEA 1HEZA 4M6ML 3B2UC 4GKNA 3BD5A 4DEPB 1JN6A 4FQHA 6FABL 4Z7OE 1ADQL 5DEGA 3TLRA 1MF2L 4NWTH 2FL5B 3GRWL 4I0PA 2ZUQC 3CAFA 1AY1H 2FIKA 5LGKA 4R4FL 1EFXB 4Y5YC 5L7XH 2CLRB 2Z91A 2FEEL 4AM0A 1TCRA 4AEHL 1E6OH 3SJVD 3L3HB 4JHWL 4G7YL 4WTWA 2R9HC 3MV9E 5B4MD 4BM7A 3NFSL 1T7ZA 3S7GA 1IAIH 1Y6MR 1AXTH 4PJHB 3FO1A 1IFHL 3LHPH 4JM2D 4NUGH 2XNAB 2BZDA 2OJZL 5D7KE 1JVKA 4K8RH 5DVKA 3DETC 3MRCB 4HGWB 2V2TB 4XXCC 3RGVB 5D1XB 3IT8D 5ESAB 1UCBL 1SBSH 2H2SD 3MYJB 2OTWB 3BX7C 4UIKH 5F9WC 1D6EA 2JB6B 4MJ4A 2PYFB 3D69B 3QUYB 5BRZB 3AMKA 1UJ3A 2CGRH 4MJ2A 2CMRH 1ITBB 1MI5A 4HLZH 3K1DA 4MJ6A 1TITA 4PJXB 4WHYH 3C08L 2G60L 1YQ2A 2VXVH 4MNHA 3CFBA 5LGHH 1A6PA 4WI8A 3VGBA 4MXWL 3CSPA 2R8SH 2G9HA 3HE7D 5IOPA 5AD0B 4WV1A 3OB0K 2XKNB 1K2DB 1MEXH 2I24N 3LKSA 5ANMA 1S9XA 4W68A 3M17A 4GRWH 1PY9A 5F3HA 5KVFL 1FC1A 1FL5B 2XZCH 1RIUH 3QDJB 3LH2L 43C9B 4HUXB 3UDWA 3V95A 2BCKB 5KAQG 4BFIB 4OCRL 1JF5A 4K3HA 4YHZL 3U9PL 4ZFOA 2LV4A 5I9QC 3FO0H 4JKMA 3M8OH 4G8IA 1DBBH 4HCRA 2WW8A 5ITFB 2VDNH 5HVHC 4N0UB 4ZS7L 3WIHA 4YPGA 3HUJA 2J4WL 4U6VH 3RU8L 2F8OA 1GOGA 2NY6B 3G5YB 3CSYA 3FQXA 2IADA 5A40E 3ARED 4FQXC 4CJ0A 1P1ZB 2MNUA 2DQHL 3GMNA 4NC1C 4ZS6D 4G6FD 3RL2A 3TH2T 1INEH 2NY4D 2N4IA 4LLAA 4W4OA 3MRNA 3VXTA 5EB9A 3ARPA 3O3UN 1DP0A 4CVUA 1MIEH 4MJID 4YBLB 2J3SA 1NCBH 4JZJC 1DTUA 5JUEL 3CMOH 3K74B 4JM2C 2FB4L 4TUJA 3FRPG 2I25N 1X5XA 1TQBC 3OHXB 2AKRA 4JR9H 1IRAY 4S2SB 1F4WL 4GFTB 3NACL 3DHJA 3FN9A 3RNKA 3SO3C 1O0VA 2H2SC 1I8KA 4XX1G 4NQEB 3X3FL 3MUJA 4L3EE 4MCYA 3VFRB 5BV7L 4YFDB 2PW1A 1MHCB 4JVWA 4U1HA 5HXMA 1LK3L 3QWQB 3MNWB 4MAYD 1MWAA 5EIQA 4BZ1H 3BWUC 3CDYA 5J3HD 2ESVA 3O3DA 3O45A 2G75B 1CFQA 4PR5B 4JM4L 3BRFA 2EYSB 3TFKD 2NY1B 4ODTL 3RPKA 1R5IB 1S3KH 1I8IA 2GTWA 1H3UA 4NJAH 5FAAA 3HNSL 3D39A 2HJLA 1NFIA 3C2SA 4JN2B 1X5ZA 3KPTA 4X7CC 4ZYKA 4N8VB 4XMLL 2PO6C 3RWHA 3MV8B 3I3DA 4PJAB 4WJ5A 4FRWA 2GSGA 2H32A 4WCYH 2R1XB 5ISZB 1BEYH 1CLYH 4NKIL 3AAZB 4WI3A 1G6RH 2UZIL 4JLRA 2GJ6B 1F3DH 2W65B 2YEZB 3REVA 2UWEB 1IC5L 2Z8VC 4LLDB 2D31A 4Z7UA 1SM3H 2IPKA 2OMNA 1JK8B 4JY5L 1A1OA 1LDPH 3QYCA 3UYPA 3KPPB 3LKQA 1UEMA 4LAJH 3NIFF 5CBAA 3PDDA 2PNDA 2KZ1B 3CZFB 3UO1H 2NY4C 3GMQB 2CK0H 4GH7B 5KJRH 5D7LE 5TDNA 1A7OH 3UTTB 1CICA 1UB5B 4P99A 4K8RC 3HLAA 1HCFX 1PZ5B 1UKTA 4ELMA 1NKOA 4F2MA 2KQNA 2PXYA 1CFVH 4LEXH 3NCJH 3LEXA 5E9DA 3CD4A 3PL6B 4N8CH 4HK0A 4RQQA 4DZBB 2E8ZA 2PTUA 4OIAA 5B3JE 1HYSD 1DDHA 3RKDC 5KANG 3AU1B 2XN9B 1HQRA 3UXFA 4BH7A 3ROLB 1BREA 4U6YB 4ZOEA 3FFCD 4DOHE 3L1OH 2JLLA 1A9EA 5F93C 1OGAD 2PCPA 5DJZB 5IG7A 1EEYB 4WUUB 1HQ4B 1YNTA 4RGND 5FM5M 2IJ0C 4IRJB 3QO1B 4XP9H 3RVXD 1E4KA 3K8LA 2BMKB 2CDFB 1ZHNA 2J88H 4Y4FB 4MAYC 3QIWD 3T0ED 5IFAL 1EMTL 4I18C 5DFTA 4TVPE 4NQDE 3DVNA 4NYLB 5J3HC 3PGDA 2XICA 4YHIA 2EC8A 3CFCH 3D9AL 2E5EA 1DLHB 1ERNA 5I1EL 2CR3A 4HWZA 5C70A 3B9KD 3FT4B 3FT3A 5DJ2A 4WFGE 1RIVH 3VH8G 3EO1B 15C8L 4R26H 2P5ED 3WFCH 2NMSA 3W0WD 5E00A 4QEGA 5HGHB 1XF1A 1JGEB 2DM4A 2X1WL 1CZ8L 4PJDB 1CLCA 4PJHE 1F4AA 1HSAA 4DN4H 1D9KB 5B39B 1BBDH 4I2XB 5IEHB 4OF6A 2YMXH </