2KDGA

Solution structure of the 1st ig domain of myotilin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GAMGPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the first immunoglobulin domain of human myotilin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Myotilin
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kdgA00
3TIDB 4MJIE 2BMKB 4LLQA 1IGYA 5I1HH 1R24A 5K9JH 4IJ3B 3QQ9D 3EYSL 4NQVA 2BNQD 2BNRA 3S97C 5CJXC 1XR8B 2ZCHH 1VB9A 4QHMB 4UT9L 1XF1A 5DSCB 5GSRA 2DD8H 4D94A 3ZMRA 4TOYH 1XF2A 3MV9A 3VGAC 4WW2F 2CRIA 6FABH 3X3FL 4NO5B 1LO0L 3VXQB 4WI4A 4LLDB 5I18H 1ACYL 4XCCL 5CWSA 2VYRE 5DFVC 3OKDA 1K3ZA 4J3TA 4WU5A 5EU6D 4MB3A 3HI1B 2BVUA 2DLEA 1A4KA 1QRNA 3GSOB 1IRAY 1BM3H 4OT1L 3BP6B 3NN8A 3RWCA 4YHOH 5A16A 1R3IH 3FB7B 4TUKH 4Z76B 3BEWA 1BGXH 5I1EH 4F33A 3LEYL 4PJBE 1MAML 1T83C 4S1QL 4Z5RB 3PNWA 3AM8C 3U6RA 4F9LC 4NC0B 3U30C 2F53D 4ZUUB 5J0BA 1VKXA 1T1ZA 4LPYA 1U8IA 2JJTC 5FYJH 3DARA 3HE7B 3MFGB 3FB6B 2NY7H 4PJHE 1UH2A 1EUUA 1JI1A 4HXAH 5L6YH 4NM8L 2XQYG 3MCG1 3C5SB 4G80A 2R1YA 3BFOA 4JREC 5FO9A 1I9IL 3ECBA 3C09B 1LEKB 2VLRB 5A3IC 5BV7L 3UBXA 1CICA 3ZDXF 2LU3A 4M7JH 5D96C 5IG7B 3GI9H 3OAUL 3SHSA 4X5WB 1CVSC 5D70H 3GJEB 3V8OA 2FRGP 1D9KA 1W8NA 3D18B 5EZLA 1HHKB 3HZMB 5KSBA 3CAFA 5M95B 3KPRA 4DUVA 5A3ID 5BW7C 1DVFA 1MFDL 5BO1H 1GH7A 3O6MH 4OCXH 5C0GA 2P8MA 3QEUA 4RWHA 3H42H 1TZIB 5DHYA 5DI8A 5HYJE 1UWGH 4KUZH 4KAQH 1RUKH 4MD0B 3QUZA 1WWAX 1HZHH 5B38A 5CEZL 1FL6A 1DJSA 5EO0A 2H2SD 5HJ3A 2X4PB 1HIMH 4ZSOA 1KCRH 4NGHL 1UM5H 4Y16D 4MJIA 5DA4A 4K23L 4D3CL 5E03A 1X5HA 2PTUA 1ZVSB 4JAMA 3I02A 2RHEA 1OP3K 2P46B 1IGJA 1I8LA 1JCKA 4K8RL 5E1HB 3RA7H 1P6AB 4NO2B 4JDVA 4GKNB 5EU3A 2AK4A 2UWEF 4ZAKC 4K9EL 4Z7QF 3SDXB 1U8JA 1PG7W 4UIMB 4FABH 5IKCB 4E42B 3EFFA 4Z8FH 1FORL 4P2QA 3SOBL 5FGCE 4NJ9H 1IQWL 4NO3B 1UJ3C 3FRUB 5CHNA 3VH8B 1VESA 4UV4L 3QJFB 4GAGH 4HBCH 1VPOL 3V0VB 2D31A 4S1DC 1P1ZA 2FX9L 4GKSA 4JFZH 4M8QA 5D2LA 4Y5VA 4AMKH 1RUKL 5INDA 2VLJB 1U8HB 2PTTB 2WWMD 3L3GB 2JE8A 3PV6A 2VAAA 5A43C 1FNEA 1MFAL 4LCIH 2XWBB 4YGVB 3UC0L 4KVCL 5DD3L 1EX0A 1NSNL 4KMTH 4LEOB 4NUJA 1G84A 3O6FB 4IDJL 4NO0B 4L9LC 4ONGL 4DKFH 4BFBD 1OP9A 4RAUA 4G6JH 1LO2L 4MNHA 1JF1B 1XEDA 4WV1C 1T04A 2VIRA 1B0GA 2ZOLB 4NQCD 3D85D 1OAKL 2NYYD 3VI4E 3QJHB 1ZK9A 3VWKA 5D4QA 2OQJA 1JHKL 2OSLB 2PF6A 1NEUA 2IH3B 1CE1L 5FA3A 4LGPB 3TNMA 3NFPB 2J2ZA 1BFOA 1EXUB 4FZ8L 4NQTA 1ITCA 1L4IA 2NXYB 3E6FA 4TPRL 4J1UB 5HHQB 4XMPH 4HHAB 4XAKE 4BYHA 2WSKA 4WFGD 2ZG2A 5JHDD 4LLDA 4ELME 4HIJA 3HUJA 4PJDB 5C0DA 4JFPA 2G60L 2C4FU 1S9YA 1FBIL 4AL8L 5EU4B 1GIGH 1MCRA 1FL3B 5D71H 1X5AA 5J9PA 4LVNB 1E27B 3OWEA 4BELD 1JJUA 4MGXA 3TH3T 1DP0A 5ALBL 3VXSB 3F7YB 3CGTA 2OJEA 1T1YA 2UZXB 3FQXB 1YA5A 3HAEB 4IDLA 5F9AC 2DQEH 5ESAB 5C9JB 3OL2A 5KJRH 4X7SL 1S5HB 4XCNB 2AP2A 3HUJB 3CFCH 4WI6A 1G7HA 4X7SH 1HILB 4HXBL 4DOHB 3S34H 5HYJA 1MFEH 4GG6A 3ARFD 4BK5A 3WIIH 5SV3A 4WV1B 4MXQC 2X40A 1CD8A 1DDHB 4LPXA 4KJWD 4FXKA 4FS0A 3ZKXC 5IBUB 5CZVL 4PTTA 5E24E 2VB5A 2Q7NA 1KTRL 3FOLB 1JWUA 5J13C 2BZDA 5CD5D 4QHLB 3ZSSA 4S1RH 4OCXL 1AQDB 1JFQH 2VDMH 3K7UA 4PJ9C 3C5ZB 2X4QA 4UUJB 3N06B 4BH8A 5I1KH 4ERSL 4XPBL 1RZGA 3VXMB 2C3VB 4YFLI 3WD5L 4W6WB 4JB9H 3MUHL 3HS0B 1AD9B 5MP6L 3CX2A 4UDTB 1PZUB 1QFUH 1YJDC 5T1DH 3KPSD 2OCFD 1DCLA 1HYSD 5C08A 1FYTD 1RVFL 4JZOA 3KPSA 4MCYA 3QXAA 2R2EB 2DIBA 1XF2B 2YRZA 3RVTC 3GJFA 1YEEL 4PJDA 5JHLH 1DQQA 5FUOL 2NLJA 3MROB 4UQ2B 3ULVL 4OF0A 4AY0A 5T5NG 1QR1B 4N0UE 3VXNA 3FB5A 4HX1B 4OCYL 2APXA 2OL3L 2NXYD 3VFNB 1WZ1H 5HHNB 3VXMD 3PGDB 3IETB 2HJLA 3G04B 1MHCA 4NQDE 2R2CA 3MMEA 4HWNA 3HMXH 5L0QB 5DK0A 2BFVH 2F19L 2OTWA 5C07A 1J1PH 5KVEH 1J86A 2JJUA 1NCAL 1J1PL 4PY7B 4CN4A 4JR9L 5CEYA 1ZS8A 3HI5L 1KC5L 3BT2H 2VR9A 5L7XL 3HZVB 1WWCA 3EFDH 4ZFGL 3BZ4A 4NNYB 2IJ0C 3QDGB 3RDTA 1ZT1B 1GAFH 1Q94A 4LKCA 4AEHH 2MWCA 5EPMB 4MD5B 5AEAA 3W81A 2VZUA 4IIQC 3DRQA 4NSKB 4JG1L 2VZ3A 4WV1A 3T0EB 3ZE2F 4Q9QL 2HTKD 2R29L 3KG5A 5D7KD 4RGND 2NY3B 4JDZB 2RR3A 4O2EA 2EE3A 1CGTA 4QY8B 2Y07H 1CE1H 4XC3H 3RL2A 4DFHA 4GBXC 4N90D 1S9XB 1EO8H 3LN5B 1UM5L 3CFBB 2ERJC 3TM6A 3IVKB 4UQ3B 4I18A 2K7PA 4JQVC 5F7KC 1D6EA 3T1FA 3W82A 4JANB 5JW5A 1E4JA 3S88H 4R3SB 3T2QA 1MPAH 2V2XA 2C3HA 1P69B 2W9EL 3QWOA 1UGNA 3ROOB 4IS6B 2BERA 3HE7C 5KZCD 4RGMC 4LNVA 4L4VE 4Z0BH 3BIBX 4ZUWB 1WZMA 1TTGA 4NWTL 1U93A 4JREB 2AV7B 3OKMB 4U1NA 3GSUA 4NBZB 4YBLC 1E4XL 3K4AA 4HUNB 2PO6C 3CPLA 2RAMA 5I66B 4XC1H 2DLIA 4GAJH 4KI5C 4JPKL 1X3DA 1FNGB 3PXJA 5EU7C 5MEPA 5GGSA 1F4YH 5ESQA 5TFSL 3A67H 1IGCH 4G7YL 3MLSL 3ARSA 2YD1A 3V7AG 3RPIA 2X09A 4P4KA 1UEMA 3BW9A 4IIQB 3T0EC 1OGAE 1BQLL 3IKCA 3RNKA 2QQNL 3TO2B 5KSAD 3GK8H 1DZBA 3L95B 2W65B 1QUNA 3CDGA 3FQNA 2VXSH 5KVDL 1UB5A 2F15A 3V5HB 2J6EH 1JGUH 2ARJA 1F4AA 4YXKH 4HUVA 3EYOB 3EHBC 1G9MH 4KGLA 3C5SA 3F7PC 4P2YA 5J06A 5D2LB 1U41A 2DAVA 2CIKA 3SDAC 1XH3A 1ZGLP 3RWFB 3MXWH 4G5ZL 4QTIL 1JV5A 2WNGA 4GRMA 5JTWA 3CSBA 4ISVB 3V4VL 4M1CC 5KOVC 1FG9C 2UWEA 4LCYB 5E8PA 4UQ2A 1E4XH 4N9GB 3TN0B 2B1AH 2F53B 4JZJB 4ZDHB 1RZ8B 4CJ1A 1VEMA 1EK3A 3UPRB 4UB0H 4P5MA 5DEGA 1AXIB 3MRQA 4JHZA 3KPRE 1S7WA 5IMKA 4PJFB 5CSZA 4TUKL 2LTQC 3C6SB 4KUZL 3QDMD 2ARWA 1TENA 5EZIL 2BVQA 3O4OB 4BSWA 4YDJA 4CJ0A 3WFEH 2J8UF 3RUGA 1BFVL 2FEDC 2AJ3A 1ZSDB 5E6IC 4QRPE 1W72B 3F12A 3CFKA 3MNZA 2FATH 2D7PA 2D4FA 4K94H 3SBWC 2VE6A 1YDPA 4S11A 5EC2A 5ANMB 1QVOA 5C08E 1ZLWH 1PG7X 3K8LA 1MRCH 5DMIH 4EQ3A 2HYMA 2F74B 4P49A 1DFBL 4PJHB 1R3LB 5T3XH 2JCCA 4PV9B 5BV7H 2FH8A 5ICYA 2X4NB 1AO7E 1VHPA 5D7JD 4L4TE 5KG9A 1X5KA 3C6SA 4JM2C 3G6DH 3NFNA 1JPSH 3WLWD 4ZUSA 2Y72A 2YRLA 5C3TA 3L5XL 2HA1A 1IKFH 1SY6A 4HFWA 2ENSA 4JKWA 4QHKI 2XXMB 2NY5H 3DXAA 2X1PA 4URTB 4R26L 3LKSB 1BIIB 1UWXK 2CK2A 3SDAD 3B4NA 2GTWA 5I30H 3T65B 3LQZB 4G9DA 2XG4A 4Y8DC 3TBVA 2VLKB 4PJ7F 2HT2D 4I0PA 1CL7H 1DSFL 5DD1H 1EMTH 4F3FB 2AXGA 2RFXA 4FQQB 5IR1B 4BSVA 3RVVD 5FDWB 1U8LA 2GIYA 3SDCA 5LGJA 1JWSA 4AZ8A 4K23H 4N1HB 3BISA 3EGSB 3PNWB 3RWJB 4HF5H 4PRHE 4PYGA 1OTSD 1T21A 4PJ8B 4LGRB 1BD2D 1UACH 2XI9A 1LWRA 2AABL 1BBDH 1ZA6B 3HE6B 3RWCB 5HDLA 1FFPA 5HYSB 2FSEB 3VJ6B 3WBDA 3QRFM 1RZJL 4IHOB 3B6SB 2EDLA 1A64A 1EEZB 1KCVL 1MNUL 3OXRB 3MRNB 4HIXH 1ND0A 4M61A 4FABL 1Q72L 5B21A 3EAKA 2NY5L 4Q0XH 2XWJB 4NYLA 2OM5A 1JP5A 2IH3A 3Q5YA 4MD4B 4Z7UA 5I16B 4OV6F 3UZEA 3V6ZB 3GJFK 4HLZG 1KJ3H 5HHXL 4NC1C 4PJEB 4YDVB 3OXRA 5DMYA 5EO1A 5DRWA 4ZTOL 4M62H 4AMKL 3V4UH 2X4TB 3QCVH 1T0NB 5DUBB 1EO5A 3LSOB 1MY7A 2QEJA 3C09C 3QDAA 5AD0A 3OKKA 3CU1A 5GS0D 4PD4K 1OAQH 2NTFB 2V7NA 1M05B 3TT1L 1IBGL 2AJUH 3WSQL 1AJ7L 1SYSB 4Y4HA 5SX4H 2AJZA 4NNPL 3WHXB 4BZ1H 5F71A 3DROA 1N5AA 4MAYC 5T1LB 2RCSL 4DWHA 1KN4H 3O3AB 2WP3T 3P4MA 4WUKH 1UB5B 5FUZL 1S9XA 5E8DL 3T04D 1KCVH 1MNUH 2Y25A 1FZOA 2EH8H 4Z18A 3HZYA 5M94B 5FYKH 4WFGE 4OUUA 5GISH 5JHDE 4F9PA 4PRHA 4EIGB 1ZA3A 2APBA 4Y19E 5GGUA 1WTGT 4LPVA 2AXHA 2FIKA 4LCWE 4UIMA 1A5FH 1TZGH 2YEZB 2YMXH 1TQBC 2DF3A 4P9HH 5EA0H 5F8RC 5C0IB 4C54A 1J0KA 1JHTA 4ZTPL 2A38A 3DVFA 5IB3B 2APWA 2AK4B 3QO1B 4P3CH 1A7PL 5IKCA 1UWXH 4YNYB 3BP7A 1BEYH 2Z8SA 1RFDH 3QUYC 4OT1H 4YR6B 2OYPA 2EDXA 5ITBL 4OGXL 4K94C 4ZUWA 4ONFL 2Y5TB 4WFEE 4Z7UE 4NHUA 5F9WC 3WEXB 4QRRA 1OTUD 3CFKB 4IM8A 4V1DA 1PSKH 3QUYD 4OD3L 1EH9A 1P9MC 4X9FA 5FHBL 3O0RH 3FQUA 3RUGB 3MSPA 3GM8A 3LPGA 4QRQB 3RKDD 3DSFL 1KXVC 2R1XA 4HDIA 3FB5B 4HX1A 3EBAA 1YEHL 4ODXB 5T3XL 5CBEB 3TBVB 3N1MC 2MCPL 1HHGA 1ORQA 3D5OF 3PWJA 2NY4D 1DQQB 5LQBH 4CU6A 3LKPA 2EIZB 2HN7A 3V5KB 4MNQE 3VGFA 1EFXD 3LRGA 1G7PA 5FV2A 1A5FL 1TZGL 4ZSOE 1MY5A 1L0QA 4XPFL 5FYJE 2B8OT 4NOFA 3UJTL 3KLHD 4X80L 3DIFA 2IMNA 3QNYB 2EYTB 3FFDA 3MRRA 4MDJB 1UJTA 1YQVH 2ZCKL 4GW5B 3ZE0E 3WHE1 2E6PA 4YFEA 3MRKB 1U3HC 3ECBB 5D1QB 4FXGB 3MGAA 5IFJB 4R8WH 3OPZL 3AGVA 1MIEL 4Q9RL 1GSMA 2AQ2A 3I2CL 4K94L 3S9DB 1KELH 3TT3L 1FNLA 3VU2A 3WN5B 1YY9C 3DX8A 3IDIB 3FN9A 3O3BB 2DQFB 4DN4L 1FAKT 1I1FA 3WE6A 4P0DA 3P4LA 4LSSH 2XTJB 1EPFA 3BE1H 3QNZB 1RIUL 2CXKA 2ITCB 5DJ2B 5T5NF 4ZXBB 2BDNH 5IEHA 3NACH 4U1KA 5ELIA 1Z3GH 2JB6A 1I3VA 4E0RB 1MCWW 2YKLL 1ZWIA 4Q9QH 4F15B 2HLFC 2VC2L 5AG8A 1RUAH 4TSBH 2H3NB 5BRZA 5KS9A 5CJQH 4MXQD 1VDGA 4DW2H 5ID0A 5D72L 2H26A 1CN4A 1IAIM 3FHQA 1KOAA 2OI9C 5CEXA 4LOUC 4NDMB 1HINL 3UJTH 3VXME 4M48H 3RWIA 3S37H 2KBGA 1EBAA 4UAOC 5EWIL 1OAXL 2ZOKB 4MXVE 1SBBA 4H20L 4D3CH 1GGBL 2F53A 1MIEH 1T66C 1A14L 2VRAA 3TLRA 5JW4M 4ODTH 1F90H 1QSEA 1UKQA 1XIWC 3SQOL 1E4XI 3GI8L 3VXOA 2YR3A 1CIUA 3SDXA 2M26A 4KU1A 4LSPL 4OI7A 2B5IC 3QCVL 4DTGH 5CKGA 1ZLSL 5GJTH 4TYUA 4JDVB 5DJZA 5F89B 4Y5XB 4HK0B 5T3ZL 2F54A 2G5RA 5MHSD 2NY0B 4DKAA 4X7TA 3DBXA 5JZ7C 4RBPH 5IHLB 3N1PC 4LIQE 1FYTB 4HUXB 4OGYH 5DJAA 4OLUL 3GSQB 1V5JA 5TPWH 3X12A 1DLHB 3RVUD 5BMFL 1T1XA 3LEXB 1FZOB 3BKJL 3LS4H 5DFWH 2Y7QA 2XTLA 3IJHA 2GHWB 3RNKB 1UVQA 4JRYD 1IGCL 4G7YH 3REWA 3S37X 1FO0A 4LEXH 4I48A 3UX9B 2XZAH 1RHFA 5IB4B 1EZVX 4IJ3C 1DLHA 2ZOLA 2LTQB 4P2RA 1C5CL 1DANU 3C5ZD 1IAMA 5DUPH 1FNSH 3V6OA 4C57C 3K8KA 2FHCA 2J5LB 3H7BB 3QDJB 5ESVA 5GRWA 4WWKA 1HSAA 2DLGA 4PJ5A 2J7LA 1ES0B 4O2CA 4MJ2A 1QBLH 1MLCB 1NMCB 2XPGB 2DM7A 3MYJA 3MNWA 5KANI 3CIQA 1QPXA 3QO0A 5H35B 4Z0BL 4OJFH 1YY8B 3T4AA 5HHNA 2IAMB 2VISB 5D8JL 5E9DE 2EDBA 5DVOA 3CFJA 4QRPB 5F9JA 1AD0A 1R5IB 3UYOD 3GEWB 4O5LL 1ZHLB 4Y7MA 3DTXB 1S9VA 4PGBB 3RWIB 2YD4A 1AXTL 2DBLH 4EN3B 4EBQL 2X6MA 4NT6A 2I07A 3DLQR 4TSAL 4XPTL 2UZYB 5IMOB 3KLAB 2HMID 2FECI 2EDQA 1YJDH 4U6XB 5CILH 1CQKA 5DJDB 3RI5F 3VD3A 4HPOL 2VZOA 3STLA 3GGWA 1BJ8A 3KPQB 1N6QL 2X7LB 5GGTH 2DYPD 4DVBA 1H9VA 1DUYB 4ZS6C 2VN7A 3QJHA 4LF3A 2HKHL 3CDCA 2FX8H 1G9ML 4KI5E 1ZT4B 5DD0L 3HB3D 2IANA 3IDJA 3FN0L 5BW7A 1VACB 4Q6IB 4IRSD 5MHSE 1EFQA 1WT5C 2J4WH 3ZKND 5IFJA 2YD9A 4Y5YC 1JF5A 3QUZB 2YPVL 4FXKB 1IAII 4KHXH 2AQ1A 2HH0L 3V0WH 1AH1A 1IL1A 4Z7VA 4KH2A 4D0DB 3K2UL 4P4KC 1FNEB 3ULSB 2XZZA 3PWVB 3DXAB 5L2JB 1NJ9A 3MRGB 2IGFH 2JIXB 2EDEA 1H3VA 4QRUB 3T2NL 3VXTB 2UYLA 5E2WH 2ADIB 4PRPE 1S7RB 1G1CA 3G5VA 4JO4L 1LEGB 4PJXB 3SJVA 3L3DB 3VXUD 1QLFA 2EXYC 4HGKC 3WXVL 1M71B 1UCTA 4RQQA 5IW1A 5C9KA 4BFEA 3AXLB 3GO1L 4GOSA 4LHUG 5GIRB 1OQOA 4JHBA 3IDNB 5JPNA 4KDTA 2D7QA 3EDKA 4M7LT 4N8CH 4UDTA 3A6BL 5HHOD 3QUXD 4ZFZB 3HB3C 4V2BA 3BGMB 5EORL 4RMUA 2H2PC 2ZSWA 4BQCA 1Q8MA 1JGDA 3MBXL 4JFXB 1F2QA 3JWDC 2E6JA 2ED9A 3UYRH 4HXBH 3ESUF 3T08A 2VDKH 4MXWH 3UTQB 4P5KB 2ITDA 5DHVH 1NCAH 3TBWA 3RVWD 2QV2A 3VG0L 3X13A 3MV7D 4B0MM 4EVNB 4LLVB 5CZXC 3QI9D 2UUDK 3O8XC 4NT6B 3OKNB 4HGWA 4R4ND 5DEZA 4PJFE 4Q0XL 3SGJA 1OLLA 2BJML 1NGYB 4HC1A 1BHGA 3M45A 1UJ3A 5HGBB 3WXWH 5F7EH 3SO3C 5HVFB 3FOLA 2B39A 4H8WC 1RJZB 3QR2A 3MRLA 4FTVE 1YMMA 4OLYH 5J56B 2E7LA 3T0AA 3N9GL 4FMKA 1Z2KA 3WNPA 4HWZB 2X70A 1VFUA 3MYJB 3WIFA 4ZUVB 2RQ8A 3T3PE 4P59H 1HQ4B 1OQXA 1KCRL 2ENYA 3MQIA 3UBXB 1QOKA 4PR5B 4X9GA 4XVSH 2ZSVA 3INUL 1F3JA 5GGVH 5DMKA 4G80B 1QFUL 1MREH 2AABH 2AI0L 2A73B 1E27A 3I6LE 4GW4A 3W0WE 1YEKL 2OP4H 4WU7B 5E94A 3HPLA 3TYGH 2CDGA 5FK9A 2NCMA 3RWGB 1MCSA 3LN4B 5JOFB 5ACMA 2IPTH 1WIPA 4Y1AB 5JIKA 1NEZB 4O02L 2VLMD 4FG6D 4YHMH 2JF1A 3LV3B 4XNQA 1WCQA 2P47B 3DUUB 4H1LH 4M5YH 1VEPA 3VXUE 2HRLA 4XXDB 3MRJB 5DVNA 3MGTA 4X5LA 3QCTH 4JO1H 4P48A 4AEIL 4G6KH 1BWMA 3BQUB 4JFED 4JFYA 4N8VG 4QTHB 2VO5A 4XP6L 3M8OL 1ZLWK 4EZMA 5D7LA 1ZVHA 1NEZA 4C56E 3QHZH 5FDYA 4R4NC 3TBSB 1G6RH 3I84A 3U9UB 3MRPB 4P2RE 3O45B 1CICD 4MZ3A 3B8SA 4QRTA 1OWWA 1P7QA 1FLRL 1U8LB 5C07D 4OSUL 1HWGB 4HUWB 4QCIB 5DC4B 2I5YH 2D31B 2EDOA 4KMLB 4LCWD 2FIRT 1NGZB 4X6FA 5D5MF 3L3GA 4ZOAA 2L0DA 3P30H 4NO3A 2JCCF 3D39A 2K7QA 1U92B 4HJ0D 4MMXC 3DRTB 3FFCD 1ZT1A 4LKCB 4S1DD 1SVZA 1ZHKB 3QEHA 5C09D 2O93L 3LKSA 2UWEE 1LO4L 1ZTXH 3MCKB 1MLBA 3QH3B 4U1IB 2DLTA 5C0CD 5ETUA 5I76B 4KJYB 3UTSA 2IQ9H 2J88L 3RGVD 3DVNA 4XWGH 1P84J 3DXAD 5BXFB 5BOZG 1M6OA 1CFNA 1RHHB 2BRQA 3MC0A 2A1WH 3LRHA 1U42A 3QPQD 3BPCA 4Z5RA 3O41B 5FYLD 5DTFB 3RTQD 2CUHA 2EIEA 3I6LD 5I73C 4NIKB 4P46C 3OJDA 2IAMD 1T1ZB 3EDJA 1XMWA 1HXMB 3BN3B 2P5WA 4XTRC 5LGHH 5TQ2L 4NZTH 1FHGA 3TVMC 1ZXQA 4YE4L 2E5EA 2OZ4A 3KLHC 5C0BA 3QFJE 4HCRH 4MDIA 3VXRD 1NC4D 2I5YL 3HI6H 2AK1L 1AO7A 3QEQA 2J8UB 5BRZE 1HYSC 2R4SH 4K3JH 3U7YH 1BQSA 3OBAA 3V0AC 2Q8AL 4TVPE 1KTKE 5LG1A 1D9KB 3EO9L 1LE9B 3BEVA 5IFHH 1S5IL 4ETYA 1ZEAL 2MHAB 3HAEG 4R4BA 5DHXB 1D5MB 3ARXA 4QRPA 4XVJH 5F9JB 3MODL 2PYEE 2ZUUA 4MAUH 2F8XC 1DQLL 1FSKB 4P9MH 2A6DA 2V2TA 3BKYH 4H5SA 5C6PB 2A73A 1KELL 4UOW1 3LPWA 1VGKB 1Q9KB 1H15A 3PIQB 1EJ6A 4KK9C 1NANH 1G7QB 2NX5B 4R7NB 1KC5H 5EZJA 2RGSA 3VFWA 4QRRB 2XN9E 2X70B 3OXSA 3NTCH 4L8DA 2DMBA 5D70L 4I3SL 3FB6A 2A83A 1DDHA 4JO3H 4W4OA 3O4LD 1S7SA 1J5OH 5TDPB 3T09A 3SJVE 3BUTA 4GRWF 3SCMC 3NCFB 2X4SB 1PG7H 3REWB 3OKDB 4G3YL 1GPOL 3CPLB 4Y4FC 3MJ8A 3BP4A 2ED7A 3TWCH 4GXVL 5KAQG 3T4YB 3BOVA 2XZAL 1P2CB 4NQCB 1HOCA 3IDMA 4W6XB 5D7SL 4PY8I 1JNNL 4U1LB 2DTSA 3OX8A 3KLSA 1A14H 1WUNT 1ORQB 4X99B 5EIIB 2WUCH 2BNRB 3MJ9A 3VG9C 4QRTB 5DR5H 2NXZD 3CX5J 5I8KH 3X14B 3QDJD 1NGXB 4ZAKD 3SKMB 3U36B 1AGCA 3O45A 1KTDA 2V2WA 2BFVL 3MRPA 4M03A 3DROB 1AR2A 1Q1JL 1GGIL 4PJ7B 2AEQH 5GRJL 1CFTA 1R3KA 3MACH 4IRZL 3GNML 2FBJH 4NZUH 3RZWA 4OZHB 3BQUD 4JFEB 3U2SA 4I13B 1D9KD 4LPCA 1A4JB 4Y19A 5D1ZB 3QQ4A 4RGOL 5E00A 1BBJA 4OI8A 4OZ4A 3KVQA 4LFHG 4RISL 1BD2B 3KPPA 3DMMA 3L6FB 3TH4T 3ARGB 2XRAH 4GSDL 3TNMB 4LLYB 5E2TH 4M6NL 5E6ZA 1GL4B 2BY2A 4J6RH 2HFEA 4OSUH 5E8DH 5ADPL 4UNTA 4XRCA 2DWDB 4YXLH 2FJFB 4JRXE 1WAAA 1WAAE 5ID0B 4Y4HC 5C0EA 2FEEI 2Y07L 1ZVYA 5CGMA 3EYFB 2V9TA 1VFMA 4KDVA 1UADC 1I1YB 1KEML 1TNNA 2HLAA 3WN5C 2A0LD 3FCTA 1ZWIB 1XIWD 3EJZD 4FFZL 5HVGB 2YK1H 1T66D 1MHPH 1A6UL 2AJYL 4LSUL 3ULUE 2EXYD 4XNXL 5EPMA 2FJGA 5JOFA 3WUZA 4QNPF 2FHBA 2NR6C 5H37H 4FFWC 1RI8A 3BH9A 3TCLA 1H3TA 2ZUWA 1ZS8B 4Y16B 4PJAF 3SDCB 5DD5H 4U3CA 4XBEH 4KK8D 4PRPA 1X5YA 3MZGB 1EJOH 4ENEC 4KKLD 3WFDH 3U1SH 2QSTA 3HG1D 1HQ4A 4LLUA 1L7IL 1H8SA 4O02H 4YHML 2NX5D 4NZRL 3SJVD 5FO8A 4OGZA 3HC0A 3O4OC 5D96B 4KTYA 5TQ2H 2E7CA 5LGHL 4WNQA 2ESVE 1CGUA 1EGJL 3MRLB 3QQ3A 2N56A 4JKLA 3O8XB 2G60H 1J0YA 3PHSA 1ZT7B 5LQBL 2EE6A 4W6YB 3A67L 5JMRA 5IQ9B 3RUGF 3VD5A 2FCBA 4L3CB 2VDQL 1CDBA 2IQ9L 5DC0A 3JTTB 3N1GC 1LK2B 3OHXA 1FZMB 3MOAL 4S10A 3GUTB 5HD8C 4GKNA 5EU3B 4KI5D 4CVZB 3NABH 4OD1H 4F37F 3I75B 3BJLA 1HEZA 4FQXB 4Y4HD 3GKWL 2K9UA 3LMJH 3WFBH 3R06A 3FONA 1D6VL 3OR6A 1KN4L 4YBQD 3UEZA 2ERJB 5B4MD 4HG4J 1P53A 1IM3A 3UO1L 5C92A 1BZ9A 1I7RB 1P4LA 3KPOA 1Z9LA 1RZGB 2VITA 3OGOE 3QXVA 1Y18A 3KWWB 3D2UD 2MSPA 4RIRB 5FYKL 1N7MH 3SY0B 3C5ZA 4K8RC 1BVLA 4WTZG 5I8OH 1HOCB 3IDMB 3L5XH 1TVHB 3D18A 4ZAKB 4YX2L 4KI5F 2AEPH 1RUQH 2XZCH 4NM4L 1YEJH 5T3ZD 3T2NH 3JWDL 1RUAL 3HRZA 4AENA 4YDIL 3X11B 2Q3ZA 5GQBA 1JPTH 4YBLB 3FT3A 4S2SB 3IJYB 3UCRA 1K4DB 1GZPA 3QP3A 3WS3A 2R0ZL 1CG9A 2W0FA 3ARYA 3NMEA 4JQXA 1UM4H 2CGRH 1J0ZA 2GI7A 2HT3D 1R5VB 3QUMH 2XN9A 5EOCL 4Z78A 2CPCA 3LEYH 1P6FA 3PGCA 4S1QH 5I19L 1FZJB 4PJBF 2M2DA 1DQDL 3HG1E 4JJ5A 5LWYH 1EHLL 4I77L 3TYFA 1MCPL 2C1PA 3D0VA 4G9FD 1J8HE 5FM8A 1PBYA 3QZWA 2X7LA 5HGGS 2R4SL 1ONQA 2JK5A 5EUOA 3SPVB 1JIBA 3MYZA 4FQXC 4JCMA 4AQOA 1S9YB 2Z8VC 1AKJB 2YUWA 4KJQC 2I9TA 1MSPA 4JG0L 1NL0L 5I1DA 4ZQKB 1MHEB 3O6LH 1T0PB 4TSCL 5DC9B 2YSSB 3GRWH 2Z31A 3D39E 1U6AL 4PGBA 1MWAL 2MPAH 1F45A 3MV9B 4FTVB 3TN0C 3MLUL 5DJ2A 1J0HA 1CDCA 3HNSH 1T04B 5FM4A 1GGCH 4QHUA 1IC5L 2BVEA 4RMRA 2VZ1A 3TIEA 3MV7A 4L8BA 4U6TA 1DBAH 4GQ9L 4ONGH 4X7DC 3QULB 3ZE1E 3KS0J 5BVPH 3ZE1F 4LHUA 2R4RH 3RWDB 4OV5A 2IADA 1U8HA 2PTTA 4U31A 3GSRA 3MRKA 1MFBH 4EUPB 4E41D 2B1HL 2NY1C 4G43A 4PREB 1X6NA 3UTTD 2YA2A 3RTQB 3PL6A 3GMOB 4R3SA 5EC1B 3VRJB 3VXPA 1MLBB 3QH3A 4U1IA 1ZANH 4DCQA 5C71A 4JN2A 2BSTB 3EO0A 1ACZA 4UU9B 5GS0H 1I1CA 1DVFC 3T65A 5MERB 4P23C 5F7LB 4AH2B 4YK4C 3UMTA 2CR6A 4JFOA 2KDGA 3BAEH 2YD5A 5JNYB 5MEPB 4F80A 2WUCL 1INQB 4P2QB 3M8OH 4EUPH 4Z8FL 3DX6B 3MCLH 5JW4N 5FGSA 4DGIH 1OHQA 5K9QI 5MEQA 2OMNA 3IXTB 5B39A 1H8NA 4ACPA 2W9EH 1U8KB 3CMOH 3UAJD 4OV5B 1INDL 1U8NB 5ITBH 3FT4B 5IUSA 3FOMB 4IRJD 3DGCR 2UY7A 1KULA 1G9NC 1XR9A 4V1DD 3BO8B 3K8MA 4LSTL 4QKXB 1LP9B 3HC3L 4XWOC 4UOJA 3U0TA 1HEZB 4G9FE 5DURD 2FL5A 5E8NA 3PGDA 4F7PB 5JW4Q 4EDWL 5B38B 3VFMA 1BFSA 2HTLD 3DSFH 1OAUH 4KUCD 4JHWH 4QLRA 1XZ0B 1INQA 1ZLUK 3LZFL 3VXNB 3AS3A 2XT1B 4G42B 5JNYA 4ZO8A 5FKPB 3B8YA 5B39B 4UQ3A 2X05A 2MQ0A 4J12A 4OZGF 1JGEA 5E99H 5F21B 3GSNB 4XX1G 4JKKA 3QNXB 1HDMB 1W0WB 2OJZH 4NQEB 4QRRE 1D5IL 4GXUM 4XNQB 3CLFL 3LIZL 5C0CE 1UFUA 4ZDHA 1QFWH 4MX7B 3BN9C 4LDLB 3HR5A 2BY0A 2DQGL 2NPLX 2BOCB 4KZEL 3UJIH 5CUSH 4A6YL 3HC0B 4ODBD 4P3CL 4WFFE 2XTJC 1DVFD 3ARZA 4E0RA 2D3VA 1KJVA 2AXJA 2R1YB 3FRPG 3GSXB 4D2NA 5FYLE 4P4RB 3DO3A 3GKWH 1E28B 3RWDA 1QSFB 1B0RA 1U8OB 4P3WA 3RDTD 1QLRB 1H5BB 4M1CD 2A6IA 3B9VA 1QBBA 4Q6YA 4BH8B 3AC0A 5HDBF 4ZPVA 5BJTA 1UQSB 3CZJA 3SGEH 3VXRE 2VABA 1CG9B 2W0FB 2ESVA 4L5FH 2WIMA 4WO4B 4DZBB 4YHNB 5T5FL 3WIFB 5MEND 3HPJA 1H3GA 2D03L 2BSRA 5HY9A 2VC2H 5D1QA 2HFFB 2QQLL 3BQUC 3GHEH 4WU5B 4U6YB 3NIGF 3U46A 4GAYA 1BZ7A 3N0PB 3W2DL 3RNQA 5GRXG 3EYFA 4RNRB 4FN0A 1S9WB 4KUCF 4I0PD 4WI7A 3NIDF 4YFLF 4ZPTA 3P0YL 3MUGA 2B4CC 4JE4B 3SKJL 1DE4B 4BH7A 1OD7A 1YNKH 3WKMH 4YK4B 5F1IB 1AI1H 4F7CA 4L8SB 1IM9B 2ZUSA 2D7OA 5D7IF 5E56A 1AKJA 3ME0A 2PYEB 3CSYA 2VITB 4NQXB 3QQ4B 3GI8H 4QHKJ 2EE2A 2FO4A 4V1DE 3MREA 4F7EA 3SGJC 4S1RL 2NZ9D 4MXWL 5LGJB 3I75A 5D7JA 4TNVK 3I50L 1N0XL 5L7XH 5HBBA 3EYUH 1B88A 1N0XH 4GG8B 2DQJH 1WWBX 4AEHL 1T3FB 1UXSB 3U4EA 1IKFL 1K4CB 1U0QA 1R5VA 3KXFD 2FO4B 1YN6A 1NL0H 4X6DB 1E6JH 1FNHA 1OP5H 2ORBH 1GZPB 1K85A 3K0WA 1A6VL 1IM9A 2DDQH 4UNVA 1EUTA 3DOSA 2LE9A 4Q2ZB 3MV8D 2PN5A 4QXGL 5DYOB 2Z4QA 5L8JB 4LCCC 2QBWA 1T80A 5LKNA 1DQTA 4BK4A 1TJIL 3P0YH 4MA8L 4LEXL 3MLYH 2YPLE 5ECJE 4R7DB 4Z95H 3O9WD 4DN3L 5D7SH 1MHPL 5E6IA 5EWIH 1R3LA 3D48R 1B0GB 5E9DA 4FQ2L 2DKMA 5J3HD 2VH5H 1J1XL 4OLWL 2I26N 4PRPB 2O5YL 4ZPVB 1A6AA 2NW2B 1MVFA 2AV7A 5JOPD 4DJMA 1MCPH 2VQ1A 3HPLB 2BVTA 4MJ5A 3FB8A 4MNGE 2NY7L 3U82B 3WKNA 5J11C 3VFSB 3JUYA 3L3IB 2UV3A 3RIAK 1RIHL 4L3CA 3HHRB 2KQNA 5IIEB 1IC1A 3IKKA 5CBAB 4CNIB 5C6TH 4CW1A 5JDSA 2VZSA 5CJ8A 5FXCH 1PD6A 3VRIA 5D6DA 3TBTA 3V0VA 1A3QA 1QNZL 4RGNE 4P46A 3ILPB 1PLGL 3OV6A 3R1GL 5FGBC 4QEGA 3VGEA 4PJHF 4HS3B 1FJ1A 3R1GH 2FDBP 1WWWX 1PKOA 5HGBA 1KEMH 1D7FA 3S36L 4CDGC 5JIIA 3WS6C 4YPJA 1V8HA 5D93C 2C7UA 1KSRA 5FYJD 2HTKC 1RY7B 2ADFL 5GSVA 1HSBA 1LK3L 1I3RB 4FFYH 2HVJB 5KSBF 5AG9A 1E4WL 3E2HC 1NAMH 4PJ8A 2YZ8A 5DO2C 4ZD3L 3ZL4L 1DQJA 4QF1B 4TVPL 4NRZB 5LXGL 4RCAA 1F6AA 1N8ZB 3GSNL 3S5LA 2VLJE 1ZHBA 1BPVA 1WZLA 1FL6B 5EO0B 3H0TA 4F8TA 2A6KA 4QTIH 2FBOJ 4XNUH 2XG5A 3K4DA 4LQFL 3OJMB 3E0GA 1TDQA 2NY2D 4I0PB 3VD9A 3QIBA 4JQIL 4WGVB 1AC6A 2VR5A 4YE4H 5MEOB 1D5IH 3P0VL 4XCFL 2XNAB 5HGAB 1C5DB 3QRGH 4Z0XB 2QQLH 3LRSA 2VXQL 1EA9C 3QRGL 3CK0L 4R7DA 3QJFA 4Q58C 4U3XA 1AR1C 4OF8A 4BZ2H 1GIGL 2DWDA 4OLZL 5IG7A 3OZ9L 1RURL 3RX5A 5E00B 1ETZB 1A2YB 1FE8L 2QKIA 2ATKA 1KJMA 2OI9B 4HPOH 3CVHL 1NCCH 4LHUD 1C7SA 5C7XH 4EOWH 1UZ6E 1AY1H 5DJ8A 2NW3A 4OKVB 1MCFA 3BMVA 4IRSA 3HKFA 5CIPB 3EIFA 3FQXA 3T8XA 3MRMB 3TP4A 2IG2L 2Z92B 1XIWB 3UDWC 2P5ED 5DJCA 2KQMA 4WW2A 5HHMD 3U4EB 4RDQG 2VE6B 1F58L 2VL5B 8FABB 3DO7B 2HJKB 3U0WH 3VA6A 3CFCL 3MFFA 3EZJB 2R15A 3T0DA 4LQ1A 4PJ8C 1I8KA 3QFJB 3O3DA 3HI6L 5EBGA 3D25A 2C9AA 5TH2A 1D5MA 4MJIB 3ULUH 1NQBA 1X4YA 3IDUA 4CU8A 5TE6L 1VFAA 3FQWB 2DIJA 3EDFA 4R26H 3STLB 3RFZC 4RBPK 2IPKB 2J8OA 4HWBH 4MQ7B 4QOKE 4UV7L 5IBTH 2X9XA 4W70A 3OKEA 4ZOEA 5I9QB 4RRPA 1BOGB 4G3YH 5TH2B 4UMGA 3KYKH 2DQTL 1Q94B 4PRBB 3MLTB 1ZAGA 3QEGH 3EZ8A 4Z7OE 4DK3A 2OL3A 3FO1A 4JRYE 3CVHH 1D3CA 3TO4D 3VDBA 1FC1A 5ALCL 4DEPB 2WQRA 1YNTB 1G7HB 1HXYB 3GHBH 1RIUH 4NQVB 4QRPD 3R8BB 4NZTL 5T5FH 5IVZA 5GS1B 5FKAB 4FQCH 3HAEA 5DJYB 5DJ0B 5C0FB 1M71A 4RQQB 3PV6B 3K1DA 5IW1B 2OZ4L 1MRFL 3NCBB 4KRNA 3L3DA 5EBLB 1NMCC 2N1KA 1LQSR 4TUOA 1IKNC 1UKSA 2W0LA 3DMMC 3A0OA 3IKCB 3MLXH 1OT1A 5FFLA 1V3KA 4S0SD 3VI3F 4N0CC 3VXRA 5HHOB 3QFDB 4ETQB 4BA8A 3NA4A 1MFEL 4M6NH 5IP4A 2MHAA 1URLA 4LCWA 4RZCA 3OAYK 3ZTNL 2CDFB 3JZ7A 1FCCA 3QAZB 1G7IA 4LSVL 3D2UA 2IALB 5CWSB 4XMLL 4NRYB 1DR9A 1F6AB 1FZKB 1C7TA 4ODUB 1JPFA 3RU8L 5EUOE 5FA3B 3FQUB 2IQAB 5A2JH 3IAGC 3OF6A 3MFFB 1NCWL 5SWSD 4AK1A 2XXCB 1HSBB 1SHMA 2E9WA 3GHBL 3THMH 5ADOL 1JGDB 3KAAA 2BNQA 1GC1C 1RHHA 4YUEH 1J8HB 2EDTA 3TZVA 1T03L 4EDWH 1QACA 5FF6A 4M1DH 4HJJH 4XPGL 3BKCH 3KJ6H 4M1GH 4Q6IC 3MV01 15C8H 4JFYB 1CDGA 5J7CC 1L9MA 3AAZA 4J3VA 3TO4C 2XIDA 2F58H 3KYMA 4XI5C 1IJ9A 1QNZH 2CLRB 3TNNB 1ZT7A 1YPZB 3NOIA 1MH5A 1KPVB 1A1OA 3MRCA 3KPRB 2GUOA 3CFJB 3IU4H 1ZA3B 4H8WH 4NDMA 3SGDI 5MI0C 1C5DA 4UIKL 1A6UH 2AJYH 5LGKA 5I15H 5DZLA 1IFHH 1NGWA 2AAVA 3P77A 4PJ7E 4XI5D 4FQXD 1Z0NA 2EDJA 5I9QC 5J12B 5DVLA 2DQUL 4EI5B 4LIQH 5E94B 1TQCC 3IFLL 4R6UA 4FQIL 4FZEL 3GKZA 1U95B 2FEEL 2F5BL 4JM2B 1GHFL 5CEYB 5HI3C 1X7QB 1WBXB 2VNCA 2Q6WB 3RWEB 1UC6A 1KLUB 4R4FH 4O51A 3NCYP 4DVRL 3QWRD 4OFDA 4YIQA 4DEPC 3HNVL 3WNNA 5IM7A 2VERN 4XX1E 3WFBL 3OR7B 3ZKXB 5FCSH 3G04A 3QWQB 1JZ4A 3S35H 1D5ZB 5CJXA 4XAWL 5DYOA 3LD8B 3MJ9L 1QLEH 2EYSA 4K3JL 2CXGA 1DLFH 3HNTL 3RWHB 5HYJD 4JFQA 4OLZH 2HLFD 1M7DB 4KQ4L 3ZYOA 2EZ0C 4YPGB 4UIKH 2X1OA 3TGXA 4E41A 5EN2A 2FJFA 4KROB 4LCCB 3SO3B 3T2PA 1U8PA 4AEEA 4OFIA 1XGYH 2DQHL 1A9BA 4ZYKA 4IHOA 5BZWB 4MA1C 1YY8A 3GIZL 4XWOD 5HDQH 5SWSE 2DMCA 2UY6A 5INCB 3UTZB 2WW8A 3VI4F 1G9EA 3HUJE 1WIUA 1LD9B 1CU4H 3DHJA 4FP8L 5KVGL 2Y36L 5I1LB 1W8OA 2NXZC 4UDUB 5KBNC 4NN7C 2A77L 1KTLB 5MENE 4E5XB 1SEQH 3PV7A 4Y4FD 1QA9A 1FH5H 3F58H 2BHYA 3UTPE 5I19H 2D03H 3V95A 1NUFA 5D9SA 3RGVC 5SWZD 1JPGB 3P4OB 4P23B 3IJSB 3NPSC 4HWBL 1QKZL 1GCFA 3KHOA 1MRFH 4OGAC 3TJHD 2FEDD 3NIFF 5IHZA 1JHLL 3PHOA 5DJ6A 5L0QC 1UKTA 3FO2A 2XNAA 1QSZA 3OKNA 2OK0L 3EYVA 5FUCE 3WFZA 3S34L 3C2SA 3S35X 2CRMA 3VGGA 2C5DC 1UJ3B 3PQYE 2Y1VA 3UROR 3MLWL 4IEFB 5DK3A 3MLSH 5ERWA 2X41A 2OS7A 4GRLA 2ICEA 2FATL 3Q6FB 3HZYB 5GJSL 5HHVH 5SWSA 3KWWA 1MUJA 3RDTC 2EO1A 2R2HB 1TVHA 4RA0C 4P46D 4M7KH 4LARH 4H1LG 1JGVL 4YHIA 4ZFZA 4RRPG 1LO3H 1PJ9A 1QLRA 4Q7DA 1RZKH 4GH7B 9CGTA 1NUDA 5F72S 2HWZL 5KZCB 4G6AC 4G6MH 2R8SL 2QHLA 5AUMA 1FV1B 5DJ8B 5CP3A 2EECA 5F44A 4YHLL 5K9QG 3S8WA 4NKMA 4GBXA 2V2TB 4P46B 4TOYL 1M4KA 1XGUB 5EU5A 5IMKB 3TBTB 1IGTA 2VJXA 5T1KD 1SBSH 1HHJB 3BEVB 4QWWD 4MVBC 4JZJA 5IGXH 2F5AH 3GSNA 1GVIA 3DI3B 3DETD 4EUPG 1H5BC 2VDPL 2E7HA 5DDHA 1ZOXA 1NCBL 2BSRB 3BGFC 1G7LB 3A6CH 4OLXL 5DS8B 4M48L 3RNQB 3B9KC 1MQ8A 4M93B 5IVOA 2DQUH 1YYLH 1KB9K 2JJTA 3IRZA 5IJVA 4N0UB 2H1PL 1QRKA 3VXSE 4LEOA 3U1SL 4ELKB 2HAZA 1IQDB 5IB1A 4WCYL 4Q9CA 43C9B 3MV8B 3MBEC 3NN8B 1Z5LB 5CEZE 1U95A 4X4XA 3IU3B 4WI5A 1A8JH 3GI9L 4P4KB 5T3ZH 5I6XB 3OKLA 4OCMC 2BVOB 3DRTA 4ZODA 3ELAT 4TULL 1FORH 3SOBH 3TBYA 4D8PA 4U7MA 3QDMA 4XH2A 4P2QE 1R5IA 3ES6B 2FB4L 1SM3H 3LQZA 4X9IA 5F93C 1NGZA 4X6FB 4WHTA 3VGBA 3VGHA 2A0LC 2EKJA 3QXDA 1YN6B 3EOTL 4WTZA 1EGJA 3ARBD 4M43L 2CLZA 2IADB 4ODVL 3NH7L 2B2XL 4X83A 5J57B 3PWPA 3IFOA 1QBAA 1CICC 4HWUA 3TA3D 4BFIA 5D1ZA 3R0MA 4XVTL 2VWEE 1MAKA 3D3VA 1BJMA 2ZUTA 4EUPA 2H45A 3U30B 4I2XE 4LRIA 3U0TB 1NH6A 2JTDA 3KPPB 4J3UA 4EI6A 4LFHD 2QJDA 5C70A 1RK0B 3B9KA 4Y19B 5ITFA 4EKXA 4PLOB 4X0KB 4NKIL 4JFEA 4POZC 1IEHA 3U9PH 5CFHA 2C26A 4FFVD 4AG4H 2DJSA 4K8RH 1LNUA 2FX7H 4NRXB 4AG4L 4QHUB 1QG3A 2WQ8A 1F4XH 1TETL 4UT7L 3ZSTA 4EDXB 4MD0A 4NYLB 2AJXL 3MBEA 4JM2D 4OD2B 5F88B 3RL2B 5C0IA 4X4ME 2GKIA 5TDNB 2Z9TA 5KSBE 1RV6X 4X6CB 1HH6A 2B0SL 3EYQD 5CGYC 3AUVA 4LLMB 4EEEA 4NJ9L 4O2EB 4B7LA 1EFXA 3TA3C 2D0HA 1P4BH 1I4FA 1KLFA 4Y4FB 5AZEL 3ARPA 4JRXB 2FJHA 2D9QB 3QAZC 5FYKE 3SPVA 5KS9E 1NGQH 3QNZA 5A1AA 2QSCL 4K9EC 3NCYS 3WE6B 4GQPH 4LLAA 4LBEB 2BVPB 4G7VH 5ALCH 1RQ5A 5FKAA 1J12A 4GXUN 5DGRA 4M9PA 3W9EA 3BGFB 5GSVB 1NLDL 3M1BB 1RJCA 1OW0A 4XBGB 3RY6A 1B90A 5JORA 1QD0A 4UILH 2WWKT 4M7KL 1B2WL 3WL9A 3NVQA 3ZKMD 2ZOKA 3VG0H 1N2RB 2NX5A 5CEZD 2BVPA 4UBDD 1TFHA 2Q8BH 2GTWB 3NIGE 2V7HB 3OB8A 1QZ1A 2OK0H 1HH9B 3QIWC 4MXVF 3F6LA 5DWUL 5JW4R 1A9BB 5JDSB 2NY5C 1XGUA 3H3PH 3G6AB 2PNDA 4K8RD 4OLYL 1BWWA 4BKLB 4KKNA 4XMLH 3JV6A 1OTTD 1AXSB 1IMHC 1B6UA 4YHZH 3SDXF 1J10A 5GSRB 1BVKB 1BZ9B 1I7RA 1AP2B 5F96H 1XGTB 2Z35B 5SX5K 2X4UA 3QZWB 5F8QC 1HXMA 1UM4L 4PRIB 1TJGH 1YPZF 3RZCD 1YMMD 3KHQA 3QXTA 5DD6A 4U1JA 1YEKH 2OP4L 5GRVK 3FN3A 2CJUH 3BVNB 1OT2A 2X4OB 5FYJL 1ZLUH 5CSGA 4HJJL 2YPKB 4R2GB 2XWTB 3MLVL 3WLWC 3D69B 2DQEL 4ORGA 4H25B 1MJ8H 2Q8BL 4OKVA 2FWOA 3GSWB 3KGRA 4TN9A 5A2IH 4XCYA 3QHTC 3NFSL 4MA3B 5I18L 1TJIH 3QXDB 5E8PB 5D1XD 5IESL 4AENB 2A9MH 1GGYA 3PGFH 2BY3A 1MQKH 5I75C 2ZPKH 1U6AH 5JA8B 1KB5A 4OZHF 4NQEA 3ULSA 3LRSB 2Z91A 4I1NB 3MA7B 2KZ1B 2WM0A 1HHIB 1MCCA 3MJGX 3G5XB 4FTVD 3RPKA 1CFBA 4C59B 3VA2C 3BN9D 4PB0H 5FYKU 4Y88A 4BZYA 4FZEH 2O5ZL 1KTLA 1EBPA 1OCWH 1MJ7L 4XPAL 1DSFH 5DD1L 4WUUD 1XCQA 2C1OA 3VXUA 3D9AL 1AKJD 4YHPA 3D9AH 3WJJA 3PL6D 4N0RA 4Y16A 2HFGL 3M17B 4XZUA 3ULVF 4WRLA 1UZ8A 4XB8A 1F6LL 4I2XA 3RHWF 2O61A 2VMFA 2FGWH 3EFDL 3E1F1 2LVCA 1T4KB 3SDAB 1OSPL 2FLBT 4RFOH 4NNXA 5CD3A 4LF3B 5DJDA 4G6JL 4OI9A 2A2QT 3ZHDA 4N8PA 3RGVB 3CJJA 1FDLH 4OCSH 5DA0B 1LEIA 1M7DA 1RUPH 4JFQB 4ELMA 1TETH 4UT7H 2PO6D 2V9QA 1HI6A 4OFPA 4PJAB 4QRSB 3ZO0A 4K7PX 4KJPC 3QUKA 4DZBA 3D2UB 5T3ZE 5IQ9A 2ADJA 3KYOB 5FM5M 3DGGB 1F97A 4KJQD 3OZ9H 4ETQA 1A22B 3B2VH 1MCBA 4FG6C 2A74A 4LIQL 4PJEE 3QG7L 5ACLA 2FD6H 1YMME 1JPGA 1OCWL 4FQHB 2CO7B 1UT9A 1YNLH 5HI5D 4KV5F 5JXAL 4LASL 5F70A 3NBNA 5AYQA 1AO7D 4TQEL 3QUXB 4FFWD 1RULL 3KYOA 2CR3A 4HUVB 5FA4B 3ARBB 2HTLC 2ATPA 3TJHC 2H9GB 1Q9WA 3CFBA 4RMQA 3MX0A 3V79C 3F58L 2FYYA 5IVZB 5GS1A 4XGZA 2BHUA 3ARUA 3BH8A 3QQ9C 5C2BL 3S35L 1U3HB 2R9HC 5D1QC 4O00A 3I85A 4L8SC 4MQXC 4C58B 2DWEA 2VOTA 5J1SC 4CL7A 4F37K 1U3JA 5TJWK 1MH5B 1FO0B 3QHFL 3W11C 4PRBA 5D6DC 3EFFB 5DWUH 3PHOB 1A6TB 1FNGA 3SO5A 4YZFF 2ADFH 1NGQL 3FQTB 3X3GL 1C8PA 3BZEB 4U3HA 4MCZB 2OBGA 4TNWK 4FNLL 1VADA 4YGAB 2NY2B 2R69L 3GSNH 1FVCA 4N0YL 1UZ8B 1IGJB 3QDGD 5GRYA 4QXWA 3DX7A 4P99A 3VI3E 4L4VB 1NFDE 3MNVB 3PGCB 4WEBH 1KLUA 5LBSL 1BREA 2V5RA 1MJUL 4XPBH 5CMAA 2GJ6E 1KJ2L 2NY6C 3MLZH 3G08B 3S96A 1WQVT 3G5XA 1KB5L 3CSYB 4HKXA 2DIAA 4I5BB 3FT2B 1MVUA 3RTQC 1ADQH 3SJVB 3UZQA 4PRPD 4Y2DD 5J12C 5E4IA 1H3XA 5ANME 2NY0D 5C08B 1ACYH 4XCCH 3V7MA 4F9PC 4HAGA 1R3JA 2IH1B 1OPGH 1BECA 1FN4A 1TQCB 1RJYB 4UNUA 4R2GD 4KRPC 2K1MA 5E8EA 4XP9H 4U7KA 3BP4B 1SYVB 4N8VB 4JFFD 3QUYA 4XBPB 3PWNB 1BVLB 2ICWA 5SX5H 3IGAA 1MAMH 4XVJL 3MV7B 2E7LC 2OL3H 5JW3L 5GZOD 1ZT4A 2VABB 1YUHA 2VIRB 1NBVH 1IL1B 4HXAL 5ETUB 4ONHA 1C1EH 1Q0YL 3RGHA 4LSRH 2YA0A 4XXCC 4RGMB 4NRZA 1N4XL 3FO0H 2IEPA 4RMTA 1NCDH 4DVBB 4E5XA 3QEHB 3S3PA 2P4AB 2D7NA 3BW9B 4IIQA 4G6ML 2R8SH 2WINB 1CVRA 1N59A 3QNYA 2AJ3B 3BI9X 5ID1B 5IESH 1AXSA 3K1KC 1FZMA 3UPRA 1MWAH 5HYEA 3VCLA 4ZMAT 2VDRL 3GMQB 1ONQB 2CH8A 5CSZB 4H88L 4U1SA 1LP9F 5I30L 2C4FT 2ZUYA 1IAOB 3PUCA 1KENL 3MRIB 1CD0A 1NCBH 2GK0A 4R90H 5D7IA 2B2XH 2HMIC 4QRRD 3C60D 1OTSC 5J3HC 1EAPA 4JY6B 2J8UA 2NXZB 3CU7A 4LPUA 1V3LA 3ULUF 5AYUH 3U0PA 4NQUA 2NY4B 3IFLH 3TZVB 1RZFL 5DFVD 5IVXE 3PHQA 1LDPL 3MZTA 4CN6A 5HPMA 5EORH 1YEFH 4LRNH 5F7NC 3G9VA 1MEXL 4HS6A 1YEFL 1I8IA 4WW1B 3VE0B 1OL0A 1RMFL 5KAQF 1EFXB 3DVNB 2VKWA 3SCMA 4J1UA 4AIZB 5HHQA 4OZIF 3ZLQC 5L8LB 5KN5A 4RMSA 3H7BA 1T0MB 3DUUA 4JM2F 5ESVB 3BPCB 3NFPA 2PUQT 1F6FB 4L29A 2CMRL 1KIPB 1BOYA 5HD8D 2W59A 4CMMB 3UTSB 1PY9A 1PZ5A 5MEOA 3TJEL 5C0GB 1Y6KR 1TMCB 4HJGB 4FQ1L 3P77B 1SM3L 3U7AA 2V17L 4ZNCD 3QHZL 1S7SB 1HHHB 4XC1L 1CDYA 2EEAA 1PX4A 4R90L 4AH2A 1HHKA 3BKJH 3LS4L 3P4MB 4X5XB 3QUZC 4XB7A 4X9BA 5C7XL 3CX5K 3O2VH 3FMGL 5HDOA 3THML 4UT6H 3GSRB 4G7VL 1UM6L 2FZ3B 4GO6B 5C9JA 1MIML 3B43A 3GMOA 1DQJB 1EEYB 3UTSD 3BGAA 4RMWA 5DJZB 2ZCLH 3UO1H 3WSQH 5MENB 3T3ME 3AAZB 2ZCLL 1JMXA 2ID5A 3EW3B 3DBXB 1WC7B 3HC4H 1NDGA 2ZSVB 4NNPH 1RUML 1G7JA 1FL5A 4ZS7H 3WIHH 4KJWC 1OTTC 1U8QB 4XNUL 3U4AA 3H9SA 3X14A 1P5UA 4G8GD 1FJ1B 5DUBA 3F5WB 2P5WD 5AZ2H 5K9JL 1H3PL 2Q20A 4QTHA 3MROA 3TVMA 4Z7UB 2VDLH 4KK6C 4XP4L 5JLZA 3IF1A 1TCRB 1ZTXL 4XC3L 1Q0XH 2GK0B 4KZEH 1D5XA 3RL1A 5C09E 2D0GA 3AB0B 4FQ1H 5GPRA 4G6FD 1T2XA 2BP3A 3QG7H 4MB5A 1AE6H 2VSDA 4LGSB 1LVEA 1KPRA 3O2VL 3ZKMC 1OP5K 3TYFB 2CLVB 5HVHB 5AAWA 3BX7C 3ZYZA 1TXKA 5FM5O 12E8L 4NCDA 3VXMA 4O51B 2A83B 4JFDB 2O61B 4DGVL 5HHVL 4HWEH 1CFSB 2EH7H 3L7FA 4G8FB 2XN9B 5GS3A 1U2CA 2ICWB 2Y23A 3TT1H 1S3KH 5IQ7H 3RVXC 5IJKC 3LPFA 3O6FA 5I6XC 5F1SA 2EDHA 1RZJC 1SYVA 2FGZA 4N8VA 3EJYC 1I1FB 4C4KT 3O3BA 1T5WB 3QIUB 3PF2A 5I1AA 2WLZA 3G5YA 2VLKA 5A2KH 1OAKH 1FGNL 5L6YL 5J6HB 5I1GH 5E08L 1NMBH 4G9DB 3C08H 5I1IL 3L7EB 1A2YA 5HI4C 1RU9H 2VSCA 3VFNA 2VWEC 2Z4QB 1KB5B 5SWZB 3SKJH 3ROLA 3DMMD 5JHDA 4N9OB 1HYRC 3PWUB 4BQ6A 2UVFA 4FFVC 3SGDH 1NAKL 1NGYA 1CICB 3X3GH 4XPFH 4HKBB 4E42A 1DBML 3S36X 3MJ7A 3HNSL 1JZ3A 3ZDZF 4A2LA 1R3KB 4JO4H 4Q6IA 4PJ7A 4NO0D 2WBJA 1IEAB 3QB7C 1R6VA 2G5BB 4PV8B 3UTSE 4Z7VB 3SE9H 1OARL 4APQC 2BX5A 4XWGL 4Y2DB 1HE7A 4M6ML 4WEBL 1AGFA 4JY5H 3VFPB 1VACA 1JUFB 4M6MH 4R0LA 5J9PB 3EYSH 4GMTL 5B8CB 3DVIA 4XHQA 1NLBH 1FFNB 1XGRA 5K93A 4L1HA 3O3DB 1ZV5A 2D2OA 4PJDF 5EC2B 2H1PH 1IEAA 5LAXB 1LMKA 1AHWC 1AFVL 3H2WA 1H0DA 1IC4H 3HI1A 3MLVH 5IFAH 3PWNA 4PG2A 1CFNB 2L7UA 1DE4A 5H2BB 5HYIA 2Z8WC 2Q1EA 4LOUD 3RIFF 2IWGA 3AMKA 4NO5A 4YO0A 3VXQA 2A6JA 3OB0H 5JO5B 4LCWB 4RNRA 1U8NA 2YWZA 2AJSL 1RPQA 3IU4L 1P7HL 3O2WL 3BP5B 1F5WA 1KNOB 3VRIB 2UZIH 4QHMA 3RAJL 5BV7B 4ZUTB 4XCNA 4YC2B 2BJMH 2IFFH 3U7WH 2BOBB 5HHMB 1Y0LB 1TZHB 3ARFC 1RZ7H 3QQNA 4I5BA 1JGVH 3CH8A 2MKLC 4X4YB 1NBVL 1QSFD 1TIUA 3HCVA 5E2VL 1J88A 1OARH 2FHFA 4IRZH 5I0DA 1GOGA 1IAKB 3GB7B 2YUVA 4OAWA 1HIML 2AERT 1KB9J 3VD4A 1Q9WB 5TF0A 3DPBA 3DUSB 5TE7L 3LB6C 3WV0A 4LDOB 3WNKA 5HYSG 2DI9A 1U8PB 4Z7WE 1NKRA 4GKZB 1TCMA 3OAUH 1MCEA 1T0NA 2FECL 1N8ZA 5DT1L 3LOWA 1I1AB 2P5EE 1ED3A 3HR5B 3N85L 3RPIB 1FYHB 1BQHG 1S7VB 4MNQB 5GS1C 3VWKD 2NY6B 4MA7L 3X17A 3F7VB 2R2BB 4NKDB 2YC1A 3EOTH 2R23B 4QXUL 5DJAB 3K4ZA 5A40E 2HFTA 4MMZC 1T89C 1S9VB 4WJ5B 4Y2OA 3C6LD 1TJHL 3O3EB 4GMSL 2IAND 4KKCD 4GKOA 4UINL 5C0JB 4PYHA 3OJDB 5TF1L 3TVMB 4ZQKA 1NAML 3HE7D 4OZHA 5HDQL 4HS8H 3N50A 2NY6D 4NRXA 4L4JA 3VDCA 4PJGA 1MCNA 3JSSA 1O7VA 5ISZE 1P7KB 1GGBH 3NPSB 4P4KD 4HH8A 3K2MC 4OCNC 2APVA 4CW1B 4Y0GA 5C0ND 5I8KL 1XCQB 3U2SB 4QNPE 1L7IH 4PJXF 3SKMA 4WI8A 1RZJH 2I27N 1MWAA 3MV7E 4WWKB 3WUWB 2YD2A 3B9DA 1F4XL 1CDIA 5DMJB 5EUOF 1AQKL 2ZCHL 1NFIA 1FVDA 4A2MA 4P2RB 4M6AA 4DZ8A 2JKXA 1T2QH 4XP4H 5E5RB 3R4DA 1SMAA 2CLZB 1I8LC 1BAFH 3HZKB 5EOCJ 1B3JA 5I1IH 1RZIB 2VDOL 4XPTH 43CAB 3MLWH 4EOWL 1M7IA 5EC1A 5K33A 1F02I 4KPHH 1EV2E 3PL6B 1QYGH 3HMWH 3UYPA 5L2KB 4ORGB 3D0LB 3I6GA 3RX7A 4K7PH 2ZUXA 3CDFA 3IDXL 3RGVA 1XGPB 5J1AB 4L3EE 4F57H 3LIZH 3H0TB 4L29B 1DN0B 5CS7A 3AY4A 1PKQB 3U9UA 1X4ZA 2CKNA 3RVWC 3WN5A 4X80H 1N64L 4ONHB 1JGUL 1QBML 3GSQA 3X12B 1YUHB 3QWRA 5ANMA 2HT4D 1FFOA 3STBA 3O9WB 3MRBA 3I2CH 2X4NA 1NC4A 1I3UA 4PGDB 2H32H 4NM8H 2PR4L 3JTSB 1OGAA 4G5ZH 2GJ6A 3KLDA 3QIBC 1KCUL 3MUJA 4YDKL 1RU9L 3BP6A 5LCVH 1YECH 5F6HJ 3LQAH 5I1JH 2DDQL 4CADA 1F00I 1OAZH 3VG9B 4X6DE 4OCRL 2NLJB 2W1NA 3OGCB 3ZE0F 3CLEH 2X89D 2DYPA 5I2IA 5I1CH 1TVBA 5EG6C 1UEYA 3TV3L 2IANE 3QFDA 3WNMA 1IGTB 1BM3L 2A9ML 4J3XA 3MRDA 3T0EE 12E8H 5F6IB 3PDOA 4K7PL 3QXAB 2YPLB 4DQOL 3QUMA 4KXZI 1QTYT 3HS0A 4N8CL 5ISZD 2BMKA 2BRRL 3AS2A 4LLQB 2GJ6B 3OGCA 2YD3A 5IROA 2J8UE 5GGTL 1CXEA 1ES0A 1K5NA 3TZVD 3LKOA 3QI9C 2YOCA 2Q86B 3NABL 4OD1L 1IZJA 3ZTJG 1ZHNA 3E2HB 3H7LA 3LMJL 1B9ZA 3M1BA 4MCZA 3RHWK 1TQBB 3VW3L 1A0QH 5F3HB 3PE9A 3L3JA 5C08D 3MA9H 4OZFA 3W9DB 3E6HB 4KI1A 2WBWB 4YNYA 3J7HA 3K2UH 3MLTA 5ERWB 2DQJL 3GGWB 3KPQA 1D5BA 2OTUB 2SEBA 3V4PH 2EDYA 1M7IB 1ZGLA 1W2KT 2GY5A 3FO9B 4JG1H 3P2TA 4OGYL 5TPWL 4TSBL 3LEVH 2ZZUT 3CUPA 4G8EA 5AWNL 2ZWLT 4IBLT 2ITDB 4KZDL 3G08A 2P8LA 5D72H 4AQ1B 4XAKD 1VFAB 3FQWA 1CWVA 4D9LH 1KBGL 2E8ZA 1DBBH 4JKPH 5HYJB 2W07A 4KAQL 4GXVH 3SKUD 1OLZA 3PQYB 2LU7A 3DYPA 4HT1L 4EXPX 3Q2CA 2AJVL 1F11A 5JXEA 3K74B 2AJVH 2QR0A 5HGDA 1OAXH 5IOPA 3WUWA 3OKMA 5HVHC 5FKPA 2GJZB 3GBNH 1GXEA 2AJZB 3RX8A 2XPGA 1F90L 4WUUA 4M1GL 4NQDA 2QADD 1MEXH 1CF8L 3B2UD 3I3DA 1ZE3C 4O58H 1UXWB 4WHDA 1RUMH 3WUWG 1JRHL 5JW5B 1DBJH 3FQTA 1KIRA 2VDKL 4OLVH 4HMDA 5F3BA 3UTTA 2DTMH 1VADB 4X7EC 3P9LB 3VGAB 4P3DA 4XNMB 3OJ2C 2D0FA 4U0RC 5T1KA 1FNFA 1HI6B 1WBZA 4PJAE 3WDJA 2NYYC 3NPZB 4MVBD 3MRHA 1RIHH 32C2B 1SJXA 2YEZA 4KC3B 3RIFK 2Z31B 5I71C 1KYOK 1CXLA 4YQXH 4U1LA 2PYED 2XRAL 4Y1AA 3S6CA 1P2CA 4NQCA 3T4YA 1EVUA 1Z9SA 4BFGA 3W5MA 4YXHH 5EOTB 3LN9A 3BXNA 3MGOA 4Z77A 1LO5A 2F9BT 5BQ7B 5IV2B 5D2LE 2FYYB 2ZJSH 2ESVB 1NFDA 4R4FL 2YC1B 2QQKH 4N0UA 3BPLC 2EH7L 1EVTC 4NSKA 2W92A 5FDWA 3T0EA 3VXPB 1JZ7A 1DUYA 2FGWL 1A6WL 4BSVB 2DLFL 2YD8A 5C86A 1R3HA 3BT2L 4LU5L 4ELKA 4NQSA 1JWSB 3MJ9H 1FC2D 3KR3H 3I3BA 4NP4L 4MDJA 2FNBA 1NAMA 2B1HH 2J8HA 4TTGA 3WFDL 5C0EB 4OJFL 3IFOB 2VLJA 2YPLA 1I9RL 1MI5A 1ZANL 4Y5VB 4ZUTA 1YECL 5D2NC 1T22B 2EC8A 1OW0C 1TZHA 4POYA 5TF1H 2NY1D 5C09B 4CRPA 1WK0A 3NCJH 5HDBE 2DQDH 4NBYB 4OB5L 4NNXB 5CD3B 2FWOB 4FNLH 4PRDA 4ELMB 3QDHA 4LASH 3KYNB 3FTGA 4HZAA 2ICES 3EUUA 1AO7B 4XP9L 3F12B 3GBMH 2JB6B 4AT6B 3VDAA 1NBZA 2W0PA 5F1NB 1JYXA 4HWEL 4DGVH 1NSNH 4OGXH 4ONFH 1KCSL 2P42B 4CU7A 1S7TB 5BVJA 1AGFB 3VFPA 3REVA 2AGJL 2B4CL 1BF2A 3Q6FA 5IK3A 4Z6AT 2W60B 3FTGB 3LQAL 2OR8A 5KJRL 1FFNA 1XGRB 4RSVA 2HJFA 3BGMA 1T21B 1ADQL 3DSNA 4X6EA 5IB5B 4Z7WB 3FFCB 4C56A 1JWUB 4UUJA 5I1GL 3NZHL 5EBMB 3ARGC 2IFGA 4TSAH 5E8OB 5IR1A 1G7IB 4HUUB 5D7KE 2XQBH 4LSVH 4JLRA 4UTBL 1J87A 1W72H 1X5XA 5IVNA 2UZIL 4A6YB 3DUHA 4LMQI 7FABL 2ADIA 5DQ9A 3RU8H 2R69H 3HFMH 5EZOL 1FG2A 2PO6A 2KZWA 4N90E 3GMPA 4EXKA 5I71B 4HKJA 3ALXA 4K2UL 3WXWL 5AWNH 1EHNA 1JFQL 1UENA 4LARL 4U1HA 2FX8L 3H9SD 3BKYL 5KW9H 5E2VH 1KIRB 4OFVA 4XPAH 1LILA 1LO3L 1F4HA 2J88H 2M1KA 3FFCA 3P4OA 5FCUL 3FZUC 5JPMB 1C1EL 3PDDA 4NQDB 2Q7YA 2GITA 4R96A 3DI2B 5AYUL 1A47A 5D5MA 1JE6A 3SY0A 4CKVX 2NZ9C 3ESVF 4M1DL 3PDOB 1CFSA 3MA9L 3ZZ1A 5GGTA 1IAIH 5JQ6L 5IB2A 3KXFE 3KPOB 5E70A 3L95A 4I3SH 1IAIL 1NGXA 4K3EL 3AREA 1FPTH 1WFOA 4HW6A 4JFDD 4ZUUA 4CN1A 1IT9H 2CIIA 3BSZL 3BXNB 3L7FB 4G8FA 1QRNB 4MQSB 4MA7H 2ICEB 3O2WH 3RJDA 4HHAA 2DTML 5JIPA 3GMNB 2XQBL 3O3EA 3ULVH 2X5PA 4TVSa 2BSED 4ZOBA 1IFHL 2IMMA 4XPHH 1MCDA 1TCRA 1T7ZA 3JV5A 3S37L 4PJFA 5KVMC 4ODHL 4XXDA 4LLYA 5EZOH 4PJ5E 3ARGA 1KIQB 3F5WA 1GOHA 5H35A 1F8TH 1YNKL 2C3GA 1J8KA 3LV3A 4ZO6A 4GBXD 4W4OC 2MPAL 1FFOB 4GS7C 1FAIH 1RZ8A 4JVPA 2GJJA 3JBG7 3KYAA 3NZ8B 1FAIL 3HMXL 5IVXB 5FYKD 3T4AB 1H8OA 4M62L 5C0RL 2GQHA 3BD5A 4X8JA 1P5VA 3RKDC 5ILTL 5F7FA 4GW5A 1KTDB 1JZ2A 3EOAA 1CD1B 1AQKH 4K9EH 3RWEA 2E3VA 4LSSL 4P57A 5GRVL 3N85H 4JANA 1PKQE 1AHWA 4MHHI 4YH6A 1VERA 1YY9D 1AC0A 2I60L 5GGQL 1NEZG 1ETZA 5H94B 4NQED 3P40A 1LGVA 1HH6B 4G8GA 1FLRH 2NY2C 4PGCB 4E41B 5F88A 1U3HD 1XZ0A 3BP5A 4K3DL 3E6HA 4X6CA 1B4JL 3UJJH 3T77B 4FZ8H 2E7MA 2O26U 4U1NB 3REVB 1JK8A 3IXAA 4PJ9B 3ZL4H 2WUBH 2QLVB 1OGAB 1VA9A 3IS0X 2HFEB 1MCKA 5H37G 1LDSA 4X8XA 3RVTD 3HG1A 2I25N 3S5LB 4XZUB 2NMSA 3GSUB 2WANA 5EZJB 4QT5B 3LHPH 3MR9B 1ZA6A 3HE6A 4BUHA 5KSAB 1U2HA 3VXOB 2R1WB 3TBWB 3D3VB 4K3HA 2OXHA 4FQIH 4WFHE 1Z9MA 3BD3A 4RAVA 4CVWA 1ROWA 4NHCH 3EGSA 3RWJA 3KPSE 2BK8A 4EI6B 4IRSC 1A1MA 2UUDH 4NHCL 4PBWD 1D6EB 3T1FB 2HP4A 1AGEA 4YEFA 1NFKA 4RGOH 5BXFA 1A7QH 2VXQH 5MEQB 4NFDA 1DN2A 3FKUS 5CP7A 1FGNH 1C08A 4X7FC 5I2IB 5E08H 1G9MC 5BS0A 4JPKH 1SJEA 1CQYA 5MERA 1J1OL 2IBZX 4EBQH 2HG5B 4AM0A 5L88L 5DLMH 3WMSA 2ZUQC 4MDIB 1F4WL 1IQDA 4NQDD 1CGYA 5DJYA 1NFDF 4L3EB 2DJUA 1BFVH 3HC4L 1K2DB 5K59E 1SEBA 3IU3A 5EBLA 2YZ1A 4MJID 3IDIA 1LK3H 2MKWA 1EEQA 2AGJH 25C8H 3I9GL 2GSGA 3GJFH 1U8IB 3I9GH 2VDNH 4PRHD 5DQJA 2PTVA 2RBLA 5M7QA 1BD2E 4UT9H 3GMRA 4R7NA 4PRIA 4HAFA 3SEPA 4Z7VF 1I7ZA 1YMMB 2Q76A 1HN1A 1PGRB 4PGEB 5SWZE 3G6JB 2W9DL 1VGKA 1B6DA 2EDFA 4GRWH 4OIIL 3QUXC 2BDNL 6FABL 4FXGA 5T1DL 3GIVB 5EU6E 4XBPA 2NY3C 5IBLC 1QR1A 5GGRY 3BRDA 2L7JA 4GAJL 4U1MB 1I85C 5E7FA 3HZKA 3T0ED 5E6ID 1JVKA 3H6JA 4D0BA 3LKQB 3SDDB 3P0GB 3KLAA 1II4E 5KW9L 1WFTA 2R56H 4PJIB 3S4SB 2OJEB 3GO1H 5ENWB 3IS1X 1BGXL 3JWNC 4Z7WF 5I1EL 2BRRH 4WW2B 5ESAA 1JV5B 2GJZA 2R1XB 4JFFA 4NWUL 1MCWM 4HKXB 3QCUL 1G9NH 4ONOA 1F11B 1I8KB 2P8PA 3KXFA 4Y16C 2H32A 3WO3B 2R2HA 3IDGB 1I9IH 3SQOH 1FPTL 3FT3B 2E9IA 3TIDA 1CK0L 4RX4D 3BJ91 3BPOC 4HKBA 4P5TD 1BQHA 2HH0H 4JR9H 2NY3D 2NW3B 4OF3A 1WFNA 2AXFB 3BE1L 1Y0LA 3MACL 3ZTNH 3DX9A 2OL3B 5I8EA 1JN6A 2YN5A 2J5LC 4HZLB 3NA9H 4HUKB 5EBMA 4J8RB 1S7UA 3L5WA 3MRGA 1G6RB 2X4RB 4JVUA 3L1OL 2R29H 4LVHB 3L1OH 3I6KB 4I3RH 1KCKA 4PJCF 5GGUB 4HSQA 3EKCA 5GRUL 5FECA 1X44A 5KSUB 4M02A 2WBKA 5GRUH 4XVTH 1QSED 1HINH 5I8EB 2GEEA 3PG2A 3WFEL 5FB8A 2BSSA 4DFIA 4NO0A 3P11H 1LNUB 1JL8A 4HT1H 5KVEL 3WD5H 3ZKSD 5F7WC 4YHYC 1WEJL 3NCCB 1BQHB 5EBWA 1P4LB 2VAJA 4RAUB 4HUWA 4QCIA 4HS6B 3SDDC 1DUZB 1QO3B 1OSPH 3TESA 1FNSL 4M5ZH 5D7JC 4XGZB 4NUJB 3EO1A 2PXYB 4L4TB 2C7UB 2OTPA 3VXSD 1NCNA 5FA4A 5B3NA 3BUYA 2NTFA 2Y5EA 4WO4C 4OIAA 2FBJL 2EXWC 3G9AB 3QXUA 4JY6A 2LU4A 2J6EA 4WCYH 2ATKB 1K9TA 2GJ6D 4JZJC 1T22A 3LKNB 3JWOL 4GAFB 4F7MA 4NJAH 5C09A 1C08B 4Z7NF 1HDMA 1W0WA 1BAFL 3ROLB 5JHDB 1VPOH 2DMKA 5HI5C 2H2SC 5LVEA 2VLME 3OAZH 1AGDA 3V8CA 3VXTA 1BP3B 3EO1B 1IILE 1A7PH 5J6HA 3W5NA 3CXHJ 4PPTA 5FF6B 3AS0A 5KS9B 3SDAA 5MENA 1YJDL 4LDEB 5CILL 4JY4A 4P59L 5BOPA 1BQLH 4YIQB 1I7ZB 1Q1JH 1XAUA 2HVKB 2EDWA 4ZSOB 3QYCA 2GFBA 4IRJB 5DMGC 2KUTA 3AREB 3BWAB 4P5TB 5DQJB 5KVDH 2VQTA 3LN4A 1BF8A 5GXBB 4WI2A 1T2QL 4NP4H 1W0YT 2I60H 3DYOA 4GW4B 4I3GA 3V52L 3ARTA 4RMVA 1OTUC 3RBGA 5DF0A 4LCUB 5HJ3B 4PTTB 3TEUA 1KPRB 3P3YA 4Q97A 4KQ4H 4TTDC 4PJEF 3IDNA 5JPNB 1AGDB 3L3KA 3WIHA 1PQZB 2Y7QB 2IPTL 3WIIL 1F3DH 1F4YL 3VFRA 4GG6B 3TNNA 1MCIA 2B1AL 4TPRH 2QQNH 3CLEL 1ERNA 4B5EA 3ORJA 1KJ3L 1J9CT 3UTTB 4TUOB 4FRWA 4KVNL 2BNUA 3N1FC 5JR1L 3IDGA 1CXKA 1QHOA 5T1KB 4LVHC 1OWRM 5JOPE 1QBMH 2CLRA 2EIZA 2HN7B 4PV9A 5DVKA 2V2WB 3LH2H 3HE7A 1KUMA 3DJ9A 2VISA 4DQOH 5KG9B 1SJVA 4S1SL 1IZKA 3NGBC 4E9LA 1KEGL 5CBEA 1NDGB 4GS7B 1CFTB 1GOFA 4LLVA 4ZFFB 4X7CC 3ZTJH 1G0YR 2X44D 3BUYB 1KCSH 2F8VA 3LDBB 1Q9OA 3VRLE 2NY4C 1V7MH 2PKDA 5BS0D 3VRLF 3U83A 1TTUA 5LCVL 1YDPB 4PGZA 4IOIA 2ICWJ 2WZPD 1IC4L 4L5FL 4L8SA 4PG2C 1TNMA 1XF3B 1GJIA 5GGVY 4RFNB 5AAMA 4Z76A 3ARFB 3PP3K 2VDOH 1WF5A 3OQ3B 4HJ0C 3AREC 1JPFB 3PGFL 1A7BA 1D5XB 2BSSB 1DVFB 1GC1L 4PFEA 1S7VA 4MNQA 5HHOA 3MJ7B 3U46B 3O6KH 4HQQL 2VZVA 3JV4B 4HZLA 4NM4H 4PLKD 2LAAA 3SDCC 1WICA 3DTXA 1YEJL 1JYNA 3B5GA 4ODHH 4CAGA 5IBTL 3LEVL 3IT8D 5D7LE 3G6JA 1AD0B 5KTEL 3TC9A 4K2UH 2HKHH 4N9GA 3TN0A 3PP4H 3QFJA 1XH3B 3TT3H 3S4SG 5DK0B 4MJ6B 4R8WL 3S3JA 1XGYL 2DQHH 2HJKA 1ZHNB 4GRWB 2C3WA 4S1SH 5DJCB 5DXWA 5DMKB 2VLJD 4M7LL 3WFCH 4WIQA 1MHCB 1JNLL 3DYMA 3L3OA 4OZGA 1YEIL 2ARJB 3ARWA 5CIPA 1LEKA 4JFDE 2DD8L 2OR9L 3QDJA 1PYWA 4X4MA 1T6WA 1OAZL 1SEQL 5D2NB 2MQCA 4MB4A 5HYQB 3D3VD 4M5ZL 1CLCA 2IANB 4Y5VC 1B0WA 1NBQA 3JV4A 4PJIF 2VDRH 3NACL 1FDLL 5LWYL 2XN9D 2XA3A 1I3GH 4LHQB 5E9DD 2JJWA 4P4RA 4U6HA 4KZDH 1ITBB 3BZFA 3O4LE 4F33B 3RY5A 2P49B 4PJ5D 2DL2A 5CD5C 3GZKA 5A16B 4PJAA 4XPHL 3QEQB 1NKOA 5IB5A 1EEUA 4L4VA 4KKLC 3O6FD 1VGEL 2VKXA 4X7TB 4G42A 3WEXA 2R39A 5DMIL 1XGQA 1NBYB 1JGLL 4JRYA 3WHE0 5C0RH 2R1WA 5KOMC 2NR6D 4EDXA 2ADGA 1JGLH 1JF1A 2IF7A 5BS0E 4CDHA 1I3RA 5EIVA 1WBXA 1QRND 4M7JL 4Y8AA 2OR7A 3QDJE 1VFBB 5EU6A 1WC7A 2OR9H 2OXGA 1GGIH 4HD9A 1P7QD 1A3LL 1QFHA 1MREL 2AI0H 4JPWL 3VFUB 1A6TA 5C0BE 1QPPA 2DM3A 4BJLA 1EEYA 1JHTB 4WHCA 4PJ5B 5E8EB 4D0CA 3GSXA 4MA1B 4JVWA 3VFRB 3P9MB 4OLUH 4I4WA 1V7NH 1CBVH 4I3RL 3G6JE 1S7XA 3LZFH 4RFNC 4WVRA 2EDDA 5ADPH 1NJ9B 1P7QB 4PP1C 4OM0H 1L6XA 5D7LD 1RZIA 3CC5B 4JLRB 3V4UL 4IMKC 3ZT7A 5FGRA 1PZ5B 5IIEA 4G8EB 4X98A 4KK8C 4NKQB 1CT8B 4XNZC 2P7TB 2BSTA 3EO0B 1N6QH 2YBRB 5EU6B 3QIBB 1WCBA 4OF7A 1CR9H 4R2GC 2WUBL 4LNRA 2B20A 5FAAA 1HWHB 3C9NA 1BBDL 1OB1A 1E4WH 3ULUD 1J8HA 3T0VA 4ZD3H 5IK3B 5GJTL 2B7DT 4Y2DC 4H1LB 1KG0A 4OTXH 5IB1B 2HJLB 4LHUB 4ZXBC 1JHKH 3MGTB 1ZLVH 5K9OB 1FSKC 1JTOA 1LO5B 2EO9A 3MMEB 1QQDA 4U6XA 1RJYA 2ZNWA 1RULH 4NJAL 1NDMB 2ZNXA 4Y4KA 2YXMA 3X3FH 4XCFH 4Y5YA 2NX5E 1V7NL 1X5ZA 5DRNA 1CBVL 4BQBA 1KFAL 3ETBF 4M61B 4PP1D 1SMOA 4MCYB 4XHJD 5JZ7D 2ZJSL 3FT2A 4B53A 3D1MC 4L1DA 3LKPB 3EHBD 5DLML 1GC1H 5IB2B 4GLRH 5C6WH 3MRQB 1INDH 4UAOB 3MRFA 2Q8AH 3RQ3A 4FQPA 5BV7C 4F58L 3MNWB 2NY1B 5J8OA 2VXUH 5H8DA 4GG8A 5D1XB 5IQ7L 1NAMB 3WKML 2C3VA 3T3MF 5SWQB 3HTLX 4L9LA 3OPZH 1C12A 4LSDA 5KSVA 1A21A 3QIWD 25C8L 1MRCL 2QR0B 4CVUA 5DJXB 1CCZA 1V3MA 4PR5A 2ITCA 1AGCB 3L3OB 2DQCL 1K8DA 4DK6A 1CLZH 5JDJA 1SY6L 2DJ4A 3I6KA 4N1CA 1B4RA 1KCUH 3BKMH 4YDKH 3IGAB 4U2YA 2GT9B 4M4RA 1S7UB 3VMPA 2YD6A 2IGFL 2MQ3A 1BIIA 3O6KL 4OB5H 3DX9B 1I4FB 4NN6C 2JJSC 4HC1L 3QDME 3GSOA 1A4KB 2Y6SD 4APQD 2DQGH 4GRLB 5BCAA 4UB0L 4XCEB 3JWDH 4YFDB 2JB5H 1H3WM 5L2KA 3U7YL 5H2BA 3RIAF 4Q9RH 1O0VA 2EDNA 3LS5L 5KSAC 1EMTL 3ARBC 3MBEB 4IOSD 3FJTA 2F54B 3P9LA 4X9HA 1OPGL 2KPNA 1NCCL 1T4KA 1NUNB 4OFYA 2GT9A 3R06B 1XF3A 4J23A 1HKLL 1PSKL 2P1YA 2W91A 5TQ0H 3QCUH 5HYSA 5ICZB 4ORZC 2G9HB 1R24B 1AFVH 3MREB 4F7EB 5IFAL 1ODAA 5D9SB 1D6VH 3TPUB 1U8MA 2PXYD 3FN0H 1CK0H 4L4TD 5L2KE 2VR4A 1IT9L 3BHBA 3DWTA 3O11A 3FONB 5EU4A