2KDGA

Solution structure of the 1st ig domain of myotilin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GAMGPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myotilin
publication title Solution structure of the first immunoglobulin domain of human myotilin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kdgA00
4HIXH 3C08L 1AY1L 1MCIA 3MFFB 1DVFB 2A83B 2P8LA 5IJKA 5AD0A 5C2BL 5ISZA 4YQXL 5AYUL 1K6QH 3D9AL 5E2UH 5AAWA 5T5NF 3U9UB 1U2HA 3VXMB 5DRXB 1NCDL 1P7QB 3QAZB 3ZE1E 3UZEA 1RAMA 4WO4D 4WHTB 4NUGL 2ORBL 1NCUA 3X3GL 4HW6A 5JW3H 3GRWA 3NCJH 3SKNB 5DJDA 2NY5C 3TWCH 1IAMA 5BCAA 3G04B 1JGVH 3VWKB 2FJFA 1TTFA 5C0EA 4IRJA 4H0IA 4Z77A 5DJZB 1P4BH 1DQTA 2NQCA 3RTQB 2CDFA 5CINL 3MV8E 4JVWA 3MNVA 4J3XA 4MAUL 1F97A 3O3AA 4UBDD 5KSBE 1PDKA 4N8VA 3T4AA 1AGCB 2H2SD 1OOAA 1SY6H 3OJVC 1FGNH 1J0IA 3MRKA 2G60L 3DUUA 4P0DA 3TN0D 1GOGA 3DARA 4ERSH 3FN3A 2ZUSA 4M7LL 2HRPL 3RQ3A 4QY8B 3HC0B 2NW2A 2JIXD 1EGJH 1LNUA 5DQDL 1BQHG 3U46A 5L0QC 1S78C 5E95B 1H3PH 2AXJA 4YO0A 1WZLA 2D7NA 5CMAB 1JK8B 5TE6L 4KK9C 2HT4D 2I9LB 4IJ3B 1UACH 1IGTB 3KPNB 3JV5A 3PIQA 1NLDH 2HN7A 3GSXB 4Z0BL 3X12B 2MCPL 1TJGH 5DEZA 5DVMA 3TO2A 1MELA 1OVZA 1J8HE 3QUYA 2CXKA 4LSDA 2IH1A 3I02A 4XVTH 5FB8A 3QDJB 4LU5H 1S7XA 1BEYL 4JZNB 5E99L 4OLVH 4LMQE 2F5AH 3EYOA 3CVIL 4V1DE 3RWDA 4DEPB 1BFOA 5CKGA 1J1XH 4F7CA 2OZ4H 4LLUA 2VWEC 4WEUD 1R3LB 1QFWL 2V2TA 4J6RL 1HXMB 3VH8G 3VFNB 5K9JL 4XMLL 3BZ4B 3NFNB 1BVLA 1JWMA 3GBMH 4DW2L 3EUUA 1EHLL 3L95B 4G3YL 5F89B 1QFOA 4FQQB 2CLRA 1AGEB 2IF7A 4EVNB 4OZIB 5B8CB 1DR9A 3KG5A 4H20L 3REVB 1BAFH 3VU2A 5FM5M 2PW2B 1JP5A 4WUUB 2F53D 4F9LA 3SCMA 3MMEB 1NKOA 4KJQD 1HI6A 5LAXA 2A9MH 2ERJC 3OB0H 5D8JH 3BP7A 5HGDA 2FATH 1INDL 4PLJD 4F37K 4NRZA 4PRIE 2W60B 4ZFFA 3NPZB 4G9FA 1UEYA 2X4SA 5AD0B 3W0WE 2WLYA 5C0CA 3IVKA 1NGXB 1EA9C 1AHWA 4U6YA 4MA3A 5HHME 1F58H 3WN5A 1W72L 3HUJE 3TO4C 3V5KA 2WIIA 5AZ2H 1OARH 2WIMA 5ITFA 3IF1B 5JQ6H 1ROWA 5DJDB 2X4QB 4PS4L 2X4NA 3UTSA 1IVLA 1SJEA 3RIFK 4PJXE 2FJFB 5C92A 3RHWF 2DWEA 15C8L 4Z77B 2MQ0A 4RRPG 4ZUUA 2QLVB 2DWDA 3RWFA 2IJ0C 1H0DA 4OCRL 3O3AB 3TBWA 4OLXH 4P48A 4N8VB 2X2YA 3B9KB 3BUTA 4GRMA 1JNJA 4M93B 4NWUL 2FX9L 4O51A 3MLYL 5DD6A 3O11A 3T0EE 2ZSWA 3DBXB 4HUNB 3BPLC 3DUUB 3QA3B 4NHUA 3PNWB 3G6JA 3SKJL 5JIPA 3CFJA 3KYNB 3NABH 3Q6GH 4D9QD 4YHPA 4I2XB 1YN6B 3PP4L 5CGYD 3D39E 4LCIH 3ZT5A 1MQ8A 3AAZA 1XGUA 3U46B 1A2YB 4LLDA 3TJHC 4XP6L 4XI5C 1QEWA 5AEAA 4KWUA 5E9DB 4AJ0A 3VXTA 3PIQB 5JLZB 2ICWJ 4XBEH 5A16B 2HN7B 4PJXF 3ILPA 1PQZB 4Q6IC 4U1LA 2A6IA 5BOZG 3TO2B 4I3RL 3T0XA 3Q0HA 4RIRA 3BAEH 1QZ1A 5MEOA 1Y6NR 2IH1B 3E3QE 5FB8B 1NMAH 1S7XB 3C8HA 4LPUA 2Z8WC 1LO2H 2BOCA 4HWEH 2R1WB 3V5DA 3NPSC 4OQ1A 3RWDB 1G9MC 1BFOB 4KTDL 4OLWL 1T83C 3VXRE 4POZD 4LLUB 4FZ8L 2V2TB 4YHOL 3INUL 1DBKL 1M4KA 2VLJB 5F70A 4NYLB 1AFVH 4X6CA 1HXYA 4QRQA 1ZLUK 2O61B 3NZ8A 1YMMA 2CRIA 4W4OC 2CLRB 1R3IH 4Z7WE 1GL4B 3HI6H 3AXLA 4XH2A 4MZ3A 5ADPH 4D2NA 5F6IB 3LQMA 5LAXB 2IPKA 1QSFD 4TVPE 4JCLA 2BSRA 4PJ8A 1FV1A 1B2WL 1SQ2N 1KPVA 1BWWA 1U8QA 3BP7B 1QVOA 5HGDB 5I19L 4NRZB 1B4RA 2X4SB 5ELIA 3MLWH 4L5FH 4JG1H 5C0CB 4O4YL 1TETH 4MA3B 2PXYC 4QOKD 4HGMA 1NFDA 1S9YA 1J12A 4BZ1L 4FQ1L 2WIIB 5D71L 3VWJD 1UC6A 5ITFB 1WITA 1BLNA 3N1QC 5DGRA 2X4NB 1FGVH 4U7MA 2O5YH 1BHGA 2G5RA 3RUGB 4JPIA 4HG4J 1UM6L 3I85A 4NNPL 2H2PC 4ZUUB 3W9EA 2E5EA 4FG6D 3QWRD 3LS5H 1H0DB 4MJIE 2AK4D 4IDJH 1UM4L 4M6MH 4PRPA 1TQBC 2G9HB 4ODVH 5ETUA 3UBXA 4C58B 1PG7L 1CIDA 3DMMC 3RKDC 2HYMA 5TE4L 4NKQB 5DD6B 3BP5A 5DO2C 3O11B 4U1KB 2ZSWB 4Y0GA 5EULV 1YJDC 2BVQA 1LEKA 4NC1C 3VJ6A 5FCSH 3T3PF 3V7AE 1PYWA 1RFDL 1TLKA 3CFJB 4OD1L 2AV1B 2VUYA 1GGYA 2LQRA 1C08A 1RU9L 5GXBB 1AXSA 3AAZB 3GMRA 4F57L 3M8OH 3VGBA 1DUZA 4U1HA 4JO4H 1QEWB 3E3QC 3QIBA 5C3TA 3SBWA 3MGTA 3U4AA 4YAQA 3ARDD 4Y16B 1QBLL 2VLKD 1YQ2A 1FNHA 4I77H 2O5XL 3H7LA 4ZFZB 4HGKC 2P5WA 3DI3B 2D7QA 3BT2H 3MRPB 4KQ4H 1VEMA 4BJLA 4Y5VA 2P45B 4J2XA 1NGZA 3X14A 3DHJA 4P2RA 4K7FA 1GSMA 4NHCH 5T1MA 2E27H 4GUPA 2C3VA 3V5DB 5F44A 4FFWC 1RK1B 4LPCA 4PGEA 5HHVH 4YXKH 2ZCKL 5FA3B 2HLAA 2IEPA 3NGBB 1RURH 4JPWL 1AQKL 5CEXA 1IZJA 4ZPVB 4GXVL 1Z5LB 1A7OL 1G7JB 3DSFH 4GJTB 5D96B 3NBNA 4MA8H 1Z3GL 1YMMB 2NZIA 3NZ8B 4P2QD 1DLHA 4AENB 4R26L 1U8KA 3AS2A 3AXLB 5H2BA 3UTQB 1FFPA 3C6SA 4XNMA 4M5ZH 5D6DC 4PJ8B 5F88A 1FV1B 4NFCA 1KPVB 1N59A 1QRNB 2XQBL 1BQHA 5A3ID 1S7RA 4YE4H 2XY2A 3P4NB 1V7NL 6CGTA 3N1PC 4EEEA 1A6WH 4NZJA 3QUXB 1AXIB 3DETC 4LSUH 3ECBA 2H3NB 2J6EL 2DQJL 1MI5E 1E0OB 4J1UA 4JPKH 3RWEB 1S9YB 9CGTA 4KPHL 4KZDL 3ARFC 1EZVY 4I5BA 4I3SH 3P11H 2GJ6D 5I6XB 4LHUB 4ZOBA 1OAYL 3VXUD 1RHHB 4N0CC 2IADA 3G5ZA 5DWUL 1MREH 3WNLA 4KZEL 2DKUA 4J3WA 5BV7L 4I8DA 4U1GB 5L2KE 4LOUD 4NN7C 2VXTL 3B3IA 1YA5A 1PG7X 3VH8A 3U36B 4PRPB 4L3CA 5ETUB 4ZMAT 4DKFH 4WDIA 4ZS6C 5JHLH 4S0SD 5TQ0L 3BP5B 1QOKA 4GW4A 4F15B 1ZA3A 5DD0L 2BVQB 35C8L 3JV0A 1LEKB 5EO0A 2PYED 5ICYA 1RJZB 5KTEL 2R4RL 1CLYL 4JJ5B 1C08B 5T1DH 5EC2A 1I3GH 4DKEL 3GMRB 4DQOL 4QRRD 1AGFB 4U1HB 4ZTOH 4WO4A 5IEKA 5KANI 3GNMH 1ZANL 4YAQB 3O8XB 4WI5A 4X98A 4RGMC 4ONHA 3BMVA 5IHBA 5JHDE 4XXDB 3RHWK 2C4FU 2R0ZL 3MRLA 2P5WB 4U6VL 5D7JB 4JB9H 4PP1C 2VDOH 1N7MH 4Y5XC 3QEHA 3X14B 1RZFH 3GSUB 4P2RB 2IQAA 1IQDA 4OGAC 1NUDA 5T1MB 5D70L 4MXWH 5F7DB 3F65A 3ZT7A 1IGIL 5DRNB 4LNRB 4FTVE 4FZEL 3CD4A 4MAYD 3RJQB 1CD9B 1U91A 4S1RH 5IQ9A 5CEXB 1EFXD 4OF8A 2XKUA 1KSRA 2CDEA 3V0AC 4KJWC 3TT1H 4MS8C 4NQXA 5D1XA 3BSZL 2JIXA 2WSKA 2EDFA 3O9WD 1DLHB 4MXQC 5KSUA 3FZUC 1U8KB 3GSOA 5H2BB 1P9MC 1OF2A 1FFPB 3C6SB 2EIDA 4XNMB 1GGBH 1PEWA 5F88B 3ZKXC 4RAHA 5ENWB 4HH8A 4PG9A 2Y07L 4NCC1 3QNXA 3FTGA 2HKFL 4PY7A 4M7LT 3BE1H 3B2VL 5HI5C 3IFLL 2HJFA 3D2UD 4WJ5A 2GI7A 4QXGL 1VFOA 1NC2D 3NCEB 3ECBB 1NC4B 1WGOA 4NQCB 2R9HD 1Z9OA 4OF6A 1FC2D 1KCUL 3A6BL 4L4TB 4J7RA 3P0YH 4O5LL 1QO3A 5LBSH 5HHOB 4I0PD 4ZDHA 4Y4FD 4WCYL 3ULUE 4HG4K 1HYSC 3MR9A 4PREA 5BZDA 3OXRB 3G5ZB 4XTRD 3AFLA 1U3JA 1IAOB 2ARJB 2CIIA 4XAWL 5IWLA 4LQFH 3CX2A 3V4UL 3S4SB 1JNNH 3MBXH 2F53A 3FO9A 3WIFA 5I1KH 4PBVC 4HKZB 4WW1A 3SE8L 4OM0H 3WS3A 1JHTA 1IQWL 4PRAB 3OKNA 2HKHH 5IUSA 2E7LA 3R0MA 4Y89A 4LEXL 1I7ZB 4GW4B 1DEEA 2EDYA 3HLAA 4KV5F 4ZUWA 2XQYK 4HFWA 4YWGL 1JF1B 2JJTA 3SDAD 5ICYB 4H25A 4X0KB 4EIZC 4LSPH 2P8MA 4P3CL 5EC2B 4WWKD 4TSCL 5MENE 2F54B 1DCLA 3ARTA 4KROC 3BEVA 3U0PB 2BXYA 5IEKB 5SWZE 1C7SA 5D1ZC 3L3GA 3FAWA 4WTXA 3ULUF 1JPSL 1ZGLB 4JFDE 2DYPD 3CLFH 3ZMRA 4ONHB 3BEWA 1TZHA 1AIFB 4OIIL 1LE9A 1K4CB 2EZ0C 4M6NH 3QEHB 4G6FD 1FJ1B 2D7TH 3AREC 5LG1A 2H8PA 3CC5A 1CGSL 1P84K 2W9LA 3C5ZC 3CDCA 4R2GD 3L3KA 3D48R 3SE9L 2X89D 2FX8H 3IETA 3L6FB 2FH8A 4CBPA 2V7HA 1JZ2A 3BUYB 1OTSC 5B39B 5EOTA 2N7AA 1P4IH 4L8CB 4RZCA 3JWOC 5IQ9B 2EYRA 3OAZK 1WEJH 1CL7H 2FGWL 4M4PA 1MFDH 5BS0B 1F4YH 4WHCA 3GI9H 2W91A 4H8WL 4RMRA 5D1XB 1NCCL 2X9WA 5FFLA 5KSUB 3P3YA 2HT3C 2R0KH 3GSOB 4UT9H 2RAMA 5H35B 4TUKH 3CCHB 2HLFC 2NCMA 4U1JA 3Q2CA 3RWJB 1T03L 3W9DA 2VR5A 3H0TB 4NO2B 2P24A 4PG9B 2WWMD 3FTGB 5FGSA 1I7UA 1JNLH 3ULUC 1TNMA 1JHKH 4JO2H 3AB0B 1PLGL 2ZUVA 1NFIA 4MWFA 5JO5B 4NC2B 1WICA 2W0KA 4OSUH 3RDTD 2UY7A 3ZE2F 2FEEI 4D94A 1CDHA 1QO3B 2WV3A 3HC3H 3TZVC 2AQ3A 4JZOA 3L3OA 3NAAL 3MACH 2Z35A 3AROA 1J0ZA 3QIUB 3BIAX 3AVEA 3CFIC 3SQOL 3MR9B 4FXKA 4RISL 5BZDB 4KDWA 3ZDZF 5JA9A 2E7MA 4KJYA 1CE6A 1MIML 2CIIB 1RZ7H 3RL1A 3LKRA 3D25A 3FO9B 3WIFB 1RD6A 1JHLL 1MFAH 1F5WA 4WW1B 2AJSH 1QSFA 3LKQB 1A7RH 2NY0D 1TITA 1SEBA 5IQ7L 5KVGL 1WSST 3IAPA 3UPCA 2Q3ZA 3LQAL 3EFFA 3HLAB 4ZUWB 4WGWB 3CVHL 4HFWB 5GJSL 4YHKL 4XC1H 1JPTH 3RPKA 1U8JB 1WK0A 3GJFB 2P8MB 4ZPTA 4QOKA 4O58H 3BEVB 3MRFA 3AM8C 3VWJA 3LEVH 3IDYC 2J5LC 3MOBL 3PGDA 1G1YA 4OLYL 3FB6A 1AC6A 1NMCB 2E9BA 1QKZL 4KHXH 2DI8A 2ZCHL 3VE0A 1Q1JH 5DURD 3SGEI 1F6FB 5CJXC 3QWRA 2H8PB 4P2CG 3CC5B 1X7QA 4XPTL 1T5XB 3TT3H 2AK4A 1T22A 3HN3A 3CSBA 4XCCH 3OJDB 1KENL 5IJVA 3KJ4B 1CFVL 1VFUA 3MTRA 4HIIA 5ESAA 5EOTB 5FYKH 2I9TA 5CZXD 2V2WA 5L6YL 1M05A 5ALCH 4UMGA 3OZ9H 1EERB 1G7IA 4KTEH 3UCRA 1J1PL 1BVZA 4LCCA 3QDMB 4YHZL 4JKPH 4P2OB 3VXOA 4TUOA 5DZLA 1F90L 4KI5D 3C60C 2DBLL 3QXWA 1FHGA 1YEKH 4UV4H 2DLHA 4XZUA 1KB5H 3PQYD 3DOSA 4Y4HD 3RWCA 1AD9A 3ARDA 3W9DB 5I8CA 2VLKA 2G75A 2QSCL 5E8DL 4PJGA 4UTAH 3H3PL 5AUMA 2R29L 4LLAA 4YIQA 4WEBH 2KBGA 1RUQH 3X17A 4M8QA 4OFIA 5JMOC 1WFNA 4NIKB 2P43B 5C0ND 1FSKB 4Q0XL 2FO1A 3LN4A 1S3KH 3FO0H 4PG2C 4MWFB 2XTJB 3BKMH 3OR7A 5BW7A 3WJJC 5D72L 2VISB 5KS9E 1CGTA 4JZJB 5GRVK 1BOGB 2QL1A 2Z35B 4MB3A 1S9XB 3QRGL 2C4FT 4N90D 2DRUA 3ILQD 4P9HC 4LEOB 4DAGL 1CE6B 4P2QA 1LDPL 1XF3B 1X5KA 3TA3D 3JWNC 2CR3A 2XKSA 5E5UB 4YBQD 1QSFB 4UOW0 2Z8VC 5ICXA 2OJZL 4PGZA 5JXEC 3QFJE 3NIGE 4MQXD 3R06A 3I6GB 3EFFB 5IMOA 2FIKA 1GGIH 4TNWF 3V0VA 4KY1H 4BFGA 4BZ2H 3QBTB 4I0KA 5E7FA 3U1SL 3LH2L 5GRXG 2NY4D 4JFYA 4AEFA 1H3UA 2ZUQC 1F4AA 3MV7D 2LVCA 2OLDA 2IFFL 5FUOL 2FIRT 2UZIL 3LDBC 1KLGA 2VN4A 5F7HA 3LHPL 3MRFB 4M02A 3HR5B 1YYML 4YNYA 4M7ZB 2ICEA 3PGDB 2GJ6A 4U6XA 2CIKA 2XN9E 1U8MB 1RZJH 1P5UA 3VXUA 3LN5A 3OXSB 2B0SL 3LEYH 1BIIA 1GZPB 4JQXC 3NA9L 3VE0B 5E5RB 1LP9A 5IBUB 3ZZ1A 3DVNA 4KKNA 4NQED 4N0UE 4LKCA 2YMXH 3IFOA 4QO1A 1T22B 5DC0A 2MTPA 3LPWA 5IJVB 1QACA 4HPOL 2PCPB 4FMFA 5ESAB 2NZ9D 5DS8A 1YZZA 2QHRL 3SJVE 2PYEA 1G7IB 1IKNA 2YPKA 1FH5H 4O02L 5E2JA 4OCLC 2YPLD 2OR9L 5C0AD 3VXOB 3LQZA 1ZS8A 1MHPH 2EDHA 3MREA 1YEEL 4CNIB 4KRLB 3UJJL 4QRRA 5HHPA 1AO7E 4QHMB 4AK1A 2H9GA 2ITDB 2QQLL 1YYLL 1G6RL 4WNQB 1AD9B 4NZUL 2VLKB 2G75B 2YEZA 5D2NA 5I1LB 4K9EC 5E8EB 1FVDA 4LLVA 4DGIH 5E6IC 4WV1C 2V5MA 1DL7L 2XI9A 3IFPB 3GMMB 3S37L 2MSPA 5DSCA 3LN4B 1F4XH 4QLRA 5IV2A 3OR7B 3QG7H 1HINL 5HHXL 1G9NH 4KXZH 4MAYA 4FABH 5IHUL 3H2WA 3LV3A 5FYLH 4PJDF 3C6LD 3VMNA 1Y6KR 5DQJA 1EFXA 3V6OC 4RDQF 5CJOL 4QXWA 1I1AA 5KJRL 2IGFL 4X6EA 3JWDL 2VDQH 4GKSA 3IFNH 4P57A 5D5MA 3WUWA 2FJHB 3DYPA 4JO1H 4TULH 1KPUA 3BX7C 4ENEC 5HYFA 4O00A 1KPRB 3P4OA 5ICXB 1M6OB 2QHLA 4NRXB 1ZHBB 3R06B 5IMOB 4WTWA 2ESVE 1RJYB 3NIDF 1L0QA 1AGDA 4Q9RH 4MX7A 1GC1H 1H3GA 1GHFH 3D2UA 5HD8D 2AEPL 1VFMA 1NC2A 4X4MA 1T7XA 4H88H 1INEH 3BGFC 1ZHKA 3WFDL 1DFBH 4OCYL 5GJTH 3A6CH 3MXVH 1KLGB 5B38B 5GS3A 4JG0L 4AMKH 4YNYB 4Z7VA 1T2QL 4FFZL 4I0PA 4KC3B 3GMLA 5C0GB 4Y4FA 1KEML 1YEGH 2ICEB 4XNYH 4UB0L 1G6VK 3STLA 3G6DH 1CR9H 2YD7A 1NL0H 3EDFA 1B90A 2C4XA 1WT5A 3WHE1 3EZ8A 1UJ3C 4LASH 3ZKND 3DVNB 5F1KC 4Q6YA 2J8UE 4LKCB 1DUYB 3AS0A 1G7HA 4PJ5B 3O6KL 4PBXA 2CDGA 1CD1A 1R5VB 5KZCB 5EBMA 2MMXA 3LKPA 1P1ZB 3DIFA 1N26A 2VB5A 3SPVB 3WO4B 2PYEB 3EYQC 2H26A 3SDAA 2YPKB 4LGPB 4ZOEA 2QQNH 5K9OA 4WWKA 3LQZB 3FFCD 3LOWA 2AERT 5HHPB 4C59B 2H9GB 2CH8A 4OT1H 4NQVA 3IJSA 4U0RC 4HK3N 5SWSD 4TSAH 3REWB 4PPTA 2V2XB 1FZKA 1J0HA 4UNVA 2ZUTA 5MEQA 2BK8A 5IF0B 2DYPA 4MNQD 1EO8H 1UEMA 3LRHA 4HS8H 5D7IA 1FVDB 1A7PH 3O3BA 5KBNC 2NLJA 5EORL 1EHXA 1KGCE 3QIWD 4XNUH 2WK2A 3CK0H 5F9WB 4IOFC 2AKRA 5HGAB 2ZNXA 5FCUL 1BZ7A 4U1IB 1HOCA 2IQ9H 2X89A 3MNZA 1JPST 4HQQL 4JO3L 1QSZA 2RGSA 4F7MA 1X5XA 3MOAL 1S9VA 3LV3B 4K71C 2KKQA 4PGBA 4AIZA 2HH0H 4H1LA 3RP1A 3V52H 3HG1E 5DQJB 2R8SH 5FKPA 4M6OL 1ZHNA 2ADFL 2EDJA 1I1AB 3SE4A 2XACC 2DQDH 4X6EB 2DAVA 3CZFA 3I2CL 4RWYL 5D5MB 3WUWB 3BI9X 5HYJE 3EO1A 1BECA 2B5IC 2FLBT 4W70A 3HMWH 3EYSL 4JN2A 3P4OB 5CUSH 3C5JA 2FECI 5IVXA 3F7YB 3V4VL 5GSVA 3VG9C 4FFVD 4FQJH 3SGKC 2DQGH 2Y5EA 1CGWA 1AGDB 5L9DL 1J0YA 4MX7B 1YNTB 4Y1AE 5IBTH 4EOWH 3D2UB 2IBGA 3ZKMC 4X80H 5FAAA 1U3HD 5KSAC 3MRRA 3UTZA 2DLIA 2LE9A 3RDTA 4UUJA 1WC7A 5ID0B 1I8IB 1ZLSH 4O2EB 5CEYB 1U2CA 4Z7VB 4NKDB 4HIXL 5BZWB 5IBLD 4Y5YA 3ULVD 3F58H 4U1MB 2DIAA 4WFFE 2MHAB 1K6QL 5F3HA 5E2UL 1OP5K 1ACYH 1JBJA 3QFDA 3S7GA 1AR1D 2J2ZA 3CMOH 2P46B 3EDEA 1G7HB 3BZDA 1H5BA 3P9WB 4EI6B 5JW3L 1G1CA 2CDGB 3NCJL 5EBMB 3CPLA 3QQ3A 3LKPB 3TWCL 1D5MA 3DIFB 4TNWK 3IDMB 3I9GL 5IT2H 5F72S 2BJMH 3SDAB 3VG0H 1FDLH 1QBAA 3SHSA 3SOBH 2E3VA 4APQC 1K9TA 1E4KA 5EOCH 1ZT4A 5DUPH 1W0VB 2HMIC 3ES6A 4NM8L 3TIEB 4K3GA 1A3QA 5J12C 1SY6L 3IJSB 5BXFA 1QFUH 3MROA 3IS1X 1YPZA 3MCLL 3U4BH 4K3EH 3UYRH 4QGTA 5D7IB 2FD6L 3OHXB 4ERSL 3T4YA 1I9JH 3B2UC 5IOPB 2NLJB 1IC4L 2VLMD 2PW1A 1H3PL 3VFWB 4ZTPL 1UXWA 3PJSA 2AKRB 1PW3A 5FHBH 5HDBE 1UACL 5DGQA 3MLTB 4ODWB 5JA8B 3MNZB 3PHQA 1NLDL 3RFZC 3S36X 4CU7A 4G5ZH 3RGVC 2GAZA 3GBNH 1REIA 4PLOB 1EVTC 4B50A 1S9VB 4NZTL 1MEXL 4AIZB 4H1LB 5CWSA 3B9AA 4GKOA 4XVTL 1ZHNB 2GEEA 2ATKA 1T83A 2WBKA 2P47B 3ARSA 1JWSB 3GFUA 5CD5C 1BD2D 3Q3GA 3CZFB 5DJAA 1RZIA 2P8PB 4PP2A 3PQYA 1J1XL 2PN5A 4Y4HA 5IHZA 4LSRH 1UVQA 5DRZA 3C8KB 5IVXB 5GSVB 3GBML 4XPFH 3QJHA 5E4EC 3FQUA 1VGEH 5GGTA 4A6YH 4JGMA 1BAFL 5HDBF 1T3FA 3RY6A 4F80A 1AH1A 1OP9A 4NPYB 5C09E 5F1NA 1W0YT 4YFEA 5HBBA 2A9ML 5F93C 4XP1H 5HYIA 3UTZB 1A6TA 5D8JL 4UUJB 2R39A 1ADQH 3U48A 4BFIB 1VSCA 5FDWA 4FQHA 4Y5YB 5C0BB 2P7TB 1KTRL 1XIWC 4Q9BA 2R4SH 5EBLB 5EUKA 1RUML 4POUB 5F3HB 4LLWA 1SBBA 3MV11 3QFDB 3ARRA 2XRAH 5BO1H 5LXGH 4MSWA 4PJCE 1CG9B 1F58L 5DA0B 2OR7A 1H5BB 2NY0B 5JQ6L 4LNVA 4E9LA 3QQ3B 4P9MH 1D5MB 4LPTA 2F74A 3ET9F 2JJSC 3W5NA 1ZLUH 1IMHC 5KVFH 1ZLWK 1HDMA 5T3ZE 3NIFE 4JREB 4OZHA 1D6VH 3T2QA 3DX7B 3MV7A 5CCKL 4OLXL 5HI3C 4HBQA 3WFCH 2F15A 3IXAA 5IKCA 1J8KA 5I1GH 1DQJB 1I1YA 5BXFB 1ITBB 1YPZB 2GSGA 4JRXA 1J8HB 2B1AH 5AZEL 3UC0H 4HUWB 1RPQA 1QLEH 2OR8A 1S7QA 3NABL 1K3IA 2YA1A 4LCIL 2PW1B 3MLUH 4JQVC 5DURB 4OQTH 5JOPE 5CSGA 5IESH 4NQEA 4Q6IB 3PJSB 3OAUH 1WWBX 3FQTB 5DHVH 1CZ8H 3EYFA 3PHQB 3KPSE 5F21B 1KTKE 2P4AB 2WANA 2C1OA 4KHTH 2D7PA 2E6QA 3NIFF 3NPSB 4M1GH 3BAEL 3MLRH 5HYSG 2YPLA 4KK5C 4RFEB 5C0AA 1NMAL 4IMLA 3KDMA 2YD4A 4R4NC 3HPLA 1LO2L 4HWEL 1R5IB 3Q3GB 3QXDA 3BGMA 4HXAH 5DJAB 4Z95H 1RZIB 4GG8B 4Y4HB 5GPRA 3HNTH 1Z0MA 5C07B 4PRIB 1UVQB 3IRPX 5CP7A 5DRZB 4XHJD 1AFVL 1NBZA 3FQUB 3P30H 5J1SC 4OLZH 4AEEA 5CSZA 1R3IL 5E08H 1CK0H 1T3FB 3HI6L 4HJJH 3V0WH 5ADPL 3LN9A 2DQCH 1S7WA 5KVMC 2NMSA 5FYJD 4NO3B 4L9DA 1KJ3H 2UWEE 3M1BA 4PJXB 4XNZC 2BY1A 1KCVH 4PJHA 3VXSD 3N85H 2PXYB 3C6LA 3GSNB 4FQHB 4PGCA 4ZSOA 4GRLD 1EDQA 1B0GB 3MLWL 4DGVH 1ZTXL 3GMNA 3GK8H 1YQVH 4LLWB 2F19L 1TETL 2MCG1 5MERA 5DJXA 5HDLA 5FGCE 2IH3A 1AQDA 2A0LC 3HE6C 4NKMB 4YZFF 1FNFA 5IB2B 1Q0XH 4M03A 1C12A 1OM3H 3KLSA 2ATPA 2SEBB 5ITBH 5TQ2L 2F74B 3GMPA 3QUMB 3QXTA 2O5YL 5D7KE 3L5WA 2GT9B 5ESQA 3VXME 5L8LB 1E6OH 1OGAE 1A9EA 3LS5L 1HK6A 2IBZX 3MV7B 2BVEA 4IDJL 4M6ML 3KPRD 4ODVL 4KI1A 4G6MH 3SO3B 5IKCB 1BX2A 3VFTA 5FECA 4MQSB 4YHYC 4G7VH 4JRXB 4LAQH 3OGCB 5CAYB 1S9KC 2VSCA 2VE6A 4KKCC 4OBRA 1SBSH 1A3LH 3MRIA 4JRYD 3QWOB 4HS6B 2AQ1A 1LO0H 2EE3A 3M8OL 5I18H 5J56B 4JO4L 4FQXC 4TQEL 4XP5H 3VFUB 1CI5A 4RFOH 4YDIH 1KELL 3T2OA 4I77L 1FYTD 2Q86A 2C1OB 3S5LG 4P49A 4CUCA 3BT2L 2YHGA 4KQ4L 1KIUA 5J9PB 3VRJA 2X1QA 4K8RC 2VNCA 1MCQA 4IMLB 2DN7A 2IPUK 1QNZL 3FFCA 4NHCL 2E27L 2IAND 2A77H 3WIHH 2CXGA 1UH3A 4CVWA 4R4FH 1QYGH 2AJYL 5SWSA 5MP6L 3S88H 5HHVL 4YXKL 2FO4A 1VFBB 3BW9A 4BK5A 7FABH 4P5TC 1MRDL 1HIMH 1RURL 3CFCH 1ITCA 4Y2OA 4MNQA 4IIQC 1KV3A 3D0VA 1NJ9B 4IRSC 3IS0X 1W8OA 1I1FA 4NP4H 5CP7B 1T6WA 1TJHL 1F3DJ 1P9MA 5EA0H 3B43A 1XR9A 2IALA 3QDJE 3DSFL 3MRQA 4MA8L 5I73C 3QIWA 4F3FA 5CSZB 2V17H 5HTSA 3RY4A 2VZTA 3TGXA 2J12B 4X7EC 5DFVC 1S7WB 5HDOA 1U0QA 5D93C 2VL5A 1MH5A 2X4TB 1G9MH 3ARVA 4MVBD 4NFBA 3M1BB 5ICZA 1A7QL 4YE4L 3C6LB 3GEWB 1FIGH 4PGCB 4OZIE 5E5MB 2J88H 2X1OA 4WUUE 3GMNB 2JELH 3ARFB 4YPGB 4LSUL 4OCXH 1I7RA 2K1MA 2YN5A 7CGTA 3O4LD 1T20A 1SVZA 2V7NA 4JPKL 3L5JA 3BIKA 2IH3B 1MHHB 4KMTH 1K3ZA 1QBBA 1CFQB 4I3SL 3P11L 3EYUH 2ATPB 2FSEB 1NBYA 5ISZE 4QXTB 4FNLH 4L3ED 3V4PH 1MREL 3KNBA 5ESQB 4OLEA 1QLFA 1MHEA 5D7LD 3L7EA 4X5XB 4JY6B 4HWUA 1A9EB 5I1DA 3WYRA 1U3HA 4WFGD 1WBZA 2LAAA 1JMXA 1QQDB 4DKFL 2X42A 3GSNH 4TPRL 5A2FA 1BX2B 3VFTB 5IB3A 5JHLL 3L3HA 1OW0C 3QCUH 3G08B 4OZIF 3FFDA 2IBZY 3TBTA 4GAFB 3GSVA 4AH2B 1Y0LA 4KFZC 1MJ7H 2NY2C 1IZKA 1CQYA 1O7VA 5T1DL 3VXNB 3K3QA 2JTDA 2Y5TA 5TH2B 2XG4A 3IDNA 1LMKA 1R6VA 4RGMB 4WFED 3GNML 2YPVH 4UIMB 1I8KA 4Y5XB 1A1NB 3TYGH 3EAKA 5DTFA 4OF3A 1LEIB 3AU1A 1YJDH 1I85A 4JB9L 3VRJB 1IEBA 5DK3A 2VDOL 1N7ML 5IMMB 4NQDD 3TCLB 4AT6A 2ZKHH 3FFCB 5E9DE 5DMGC 4KKAD 5GRYA 5KANG 4MXWL 2FGZA 4Z6AT 4DEPC 1FO0H 5SWSB 3PWNB 1A7BA 4X7SL 2FO4B 3BW9B 4CVZA 4S1RL 4MNQB 1XGQB 1U36A 2YD1A 3D0VB 4HC1A 4I18A 1I1FB 4PLNC 3M07A 2IALB 3FOLA 4P46D 1TZIA 3BFOA 2HFGH 4HJ0D 3IGAA 4LVEA 3TT1L 2AJXL 3EOTH 5TFSH 3F12A 5GGTL 3ZKXB 1HNGA 2HFFB 4XWGH 2CRMA 5JXAH 2W9EH 2A74A 1Z6JT 2KQMA 1VESA 1GGBL 1MJ8H 2VL5B 1MH5B 3F6LA 5IG7A 4XVUC 4OFVA 3U0WH 2VLJE 4RQQB 5CJ8A 4L8BA 1RIHH 5IJKC 3FT4A 3DV6A 3K80A 2VYRE 1I7TB 1I7RB 2EE9A 1BD2A 1T20B 4QRSA 4LSTH 5JW4M 3BIKB 2J8HA 2WUCL 1S7SA 3EFDL 4RGNC 3P0YL 3QPQC 3RA7H 1MUJA 4DFHA 2ZOKA 4X99A 3DPBA 1NCTA 5HYSA 3UJIH 5F7MC 3O41A 4ZNEA 3OAZH 1N64L 3VFMA 3MLSH 4G9FE 5GSRA 4M7JH 1RULH 1NBYB 3KR3L 5C0CE 3CFKA 3QULA 2YRPA 4OGXH 3S3PA 1JYVA 4IRJC 5I71B 5GZOD 1QLFB 2B8OT 5EPMA 1MHEB 4LQFL 3L7EB 4JFXB 4QHLA 2VDMH 2W38A 4PJFA 1JNNL 3RL2A 3MBXL 3VI3E 3MYZA 5I1KL 1HKLH 3ISWA 3IJHB 3ESVF 5JPMA 1WBZB 3R8BB 4U2ZA 3L3HB 5GGRB 3FHQA 2Q6WA 1U3YA 2OXGA 3FFDB 4ZFOA 3RUGE 2BP3A 4WEMB 3GSVB 3ZTNL 3ROOB 5E00A 3FHAA 1CDGA 4LSPL 5HPMA 4HDIA 1W8NA 2Y5TB 4WI6A 2FJGB 3GSQB 3IDNB 3C2SA 5LVEA 2VLRB 3DGCR 3MV8D 2ZP0T 4OI8A 2N4IA 32C2A 3JV6A 1I8KB 4KKBC 3CLFL 2WAHA 5CJXA 3AREB 3QISA 4RMVA 3MRMB 3AU1B 5BQ7B 3EJYC 3BVNB 3QUYC 3VI3F 5T1KD 2D7TL 5DJ8A 2QADC 1RIUH 2C7UA 4W68A 3P2TA 1KC5L 2FX8L 2DQUH 1WBYB 5C08A 1F8TH 3D3VB 3TVMC 4YHIB 1P4IL 1YEHH 1E27A 2MPAH 3VGAC 2MWCA 1WEJL 1NMBL 2BVOA 5CGTA 4Z7QE 2VDPL 3FAXA 3DRQA 1HILA 3CIQA 3GI9L 3EOBB 1TZIB 4ALAH 3QZWB 3IGAB 4Z76A 4JDVA 2MKLC 5JUEH 3F12B 3LB6D 3IDXH 2R0KL 3VFPA 4HZLA 3FQNA 5M95B 1MJJA 4F9LC 3SCMC 5F6IC 3G6JF 5IW3A 4UOJA 3HMXH 1HKFA 1F2QA 1G0XA 5IG7B 3EGSA 1AP2A 4LF3A 5I0DA 5EO9A 4LDLB 3WDJA 5AYQA 1JNLL 4JDTH 4L8BB 1YMME 2A9NH 5D4QA 5LWYH 3WJJA 5CEZE 5J7CC 1JHKL 1FZJA 3FT4B 4JO2L 4LSVH 3LVEA 2AJ3A 3DV6B 3TZVB 1AHWC 2DJ4A 5DD3H 1Q94B 3L9RB 4GKNA 3G9VA 1YY9D 4OSUL 3S5LA 2CD0A 4GKZA 3WN5C 1MUJB 4X99B 1YECL 4Y2DD 3HC3L 3CXDH 3LAFA 3MACL 1KCKA 5GSRB 3LMJH 4EXKA 3C5SA 2XZAH 3CFKB 4X5WB 4HKBA 3QULB 2Q20A 3BQUC 4MD0A 1T1YA 2GITA 2JLLA 1NFDE 5EPMB 4BA8A 1RMFH 1RZ7L 2R1XA 4QHLB 4PJFB 4JY4B 1INQA 1JWUA 4DCQB 1MFAL 2AJSL 2Y1VA 5HGGS 4IBLT 3SY0A 1A7RL 1EMTL 5GRJH 5J89A 1XMWA 4H26A 4NQTA 4UT7H 4X6CF 5HHMD 2VZUA 4HK0A 3KPOB 2CGRH 2Q6WB 4JPVH 1IE5A 3DECA 3VXSA 2R69H 4GRLA 1X9QA 4LSSL 3MA7B 1JPTL 4XC1L 5EU6B 1UB6A 1I8MA 4AQ1B 3VI4F 2HWZH 3B83A 3IDYB 2Y4SA 2J5LB 4PRPE 5CJQH 3MRJB 3WL9A 3DROA 2NYYC 5SV4A 1JUFA 1EO7A 3LEVL 4JQXA 3BO8B 4L8DA 1GVIA 2BVPA 3T1FB 1FN4B 2FX7H 1YN7A 3V5HB 2O5ZH 4JJHA 1NFDF 3RNKA 4HBCH 2VXSL 3T0ED 5C9KA 1Q1JL 4KK6C 1NGYA 3V8CA 2DQIL 4UV7H 3TT3L 4M43H 2C7UB 2E7BA 3KPRA 1YDPA 4NDMB 1RHFA 4NRYA 5C08B 3U4EA 5IB4A 5FYKL 1PGRB 1E27B 2RR3A 3WLWD 2P5WE 5ALCL 3C60B 3NGBC 3OZ9L 4PJ9D 1WAAA 4KTEL 2BVOB 2NX5A 1P2CA 4P2RE 4JKPL 8FABA 4JRYA 4Z76B 4J8RA 3U6RB 1MCWM 2GKIA 2KQNA 1ZA6A 3UAJC 4HZLB 4GG6A 1EO5A 2FHBA 3Q1SL 1KB5L 1QFWI 4X9FA 2OK0L 4G8GD 4BSJA 4WU7A 4KK8D 4NJ9H 4F7TB 1AP2B 1WUNT 5DZNA 1FYTA 5EO9B 2BSSA 2A2QT 1T0MB 2CKBA 3VXRD 1U8HB 4WEBL 3RVVC 1FL3A 1DTUA 2AJ3B 1ED3A 1S3KL 3FO0L 2IANA 3BP6A 3CUPA 3MJ8B 3BKML 1EEZA 4B41A 4GKZB 5J6GA 4EKXA 5GZND 3O81A 4YXHL 4TVPD 1NPUA 3C5SB 4OD3H 4HKBB 2NPLX 4MD0B 1MCPL 4NQCE 2R1XB 3ULUH 2R2CA 4U1GC 1D3CA 5C0RL 1INQB 1JWUB 4OUUA 4WU5A 4NM4H 1HQ4B 1TCMA 1JTPA 1T5WA 3SY0B 4M1CC 1FFNA 5K9QI 3QEQD 1RI8A 4MJ5A 5LJYH 2AK1L 2RFXB 3FQWB 3C2AH 3DUSA 4F15C 1PJ9A 3LQAC 4YDKL 3VXSB 1FZMB 1GGIL 4JDZB 2NXZC 4KY1L 2V9TA 4BZ2L 3LDBB 1UB6B 2Q7YB 1J0JA 4XPBH 1A64A 4W6WB 2JCCA 3O4LA 3DROB 3QIBC 3SBWC 1T1ZA 1UJ3A 1V3LA 2IMNA 4IRZH 4ZNCD 4P59H 5D1QD 4YR6A 3K7UA 3I3EA 2FHCA 1RZJL 2ZPKH 3B8YA 2X9YA 3H3BC 5GS2D 1RUAH 5D9SA 2GY7B 5SV3A 2GSIA 1YC8A 3PWPB 2Y06H 1T4KB 1NGYB 5D7LA 4WUKH 4Y5VC 3W81A 4AQOA 4K07A 1J05B 1KJ2B 3LS4L 2YMXL 3TV3H 1WJ3A 1MLBB 3MCKA 2W0PA 1ZHLA 1KCRH 1YDPB 3HRZA 1AGBA 3QCVL 1OQXA 4U3XA 3RPIA 3H3KA 3U4EB 4M4RA 3A67H 3T1WA 4HC1L 3CDGA 1IAIM 4YJZL 5C7XH 3C09C 2A6DA 5DMJB 2NX5B 1FH5L 3EDJA 2XQYG 8FABB 4JRYB 5TDPA 4J8RB 1MHPL 2OL3B 5FO7A 3RVTD 1WZMA 5A1AA 3IJYA 4M1DL 1L7IH 5HGBA 2I27N 4NNYB 4PRHA 4DGYH 2HVKA 1QRKA 2A1WH 5E6IB 3OPZH 4WV1B 3H42H 2V9RA 2QSVA 4WU7B 4J3UA 2EYSB 3U7WH 2DQEH 5E24E 4BH7A 1D5BB 1MJUH 1FYTB 4M9PA 4NO0D 2BSSB 5DFTA 2VTFA 2CKBB 1UADC 5JIKA 4I4WA 2Y6SC 4NQDA 3D6GA 1BWMA 1ED3B 3STZB 4HWZB 2IANB 3CUPB 4H5SA 1QPXA 3QJFA 1F4XL 5HVHC 2ADIB 1OAQH 4M9OA 1FPTH 3GHBH 2CO7B 4WI2A 4FABL 3MJ6A 3H9YA 1CDJA 4S2SB 5DRWA 3GSWA 5C9JA 1WIUA 4P46A 1JIBA 5D7SL 2Z8RA 4JFED 1BQSA 4MS8D 2VDQL 3QUZD 4OZFB 1NBVL 2APXA 3IFNL 8CGTA 5JIHA 2E7CA 4OUUB 3TFKD 4TULL 1LVEA 3B5TA 3O2DH 1ZE3C 1T5WB 4Q9QH 1NQBA 1A3RL 1MI5D 4F33A 4G6KL 4KKLC 4X7CC 3DUSB 4ZFOL 5EWIL 3BGFB 4HD9A 3EHBD 4QCIB 3MO1B 1L7TH 4POYA 4BKLA 1E6JH 1QSED 1GHFL 3KS0H 1KTDB 4U31A 4Z78B 2VXQH 4P9HH 2JCCB 2YKLH 1INEL 1HE7A 4LDEB 1DFBL 5EO1A 1UWGH 3A6CL 4WO4C 3MXVL 1ZVYA 5F7WC 5KVEH 5L2KD 2VRAA 4JR9H 4TTDD 1T1ZB 1UJ3B 3V7AG 3IDGA 1YEGL 4XNYL 3OKDA 3O45B 1CR9L 4PJDB 1OCWH 3QDAA 1NL0L 2G5BB 4BQ9A 4IS6A 1NAMH 1XF1A 3I3DA 4HZAA 1J11A 3EOAB 4LASL 2GSIB 4E5XA 5FA4A 5DI8B 4B7IA 3HZVB 2F9BT 5DJ2B 2DLTA 1I4FB 4MJ2A 1ZHLB 4UBDC 4ZOAA 3HRZB 4WHDA 1CXHA 1R0AH 2H2SC 1FVCB 3RPIB 5GGVY 4OIAA 5CHNA 3KLAB 5F7KC 2CUHA 3UEZA 3PGCA 3B9VA 3TN0C 4KDTA 3L5XL 3NN8A 1PX4A 1XGYL 1FAIH 3CDGB 3PWVA 2A6DB 2QQNL 3X13A 2XA8H 2R1YB 5C8JA 1IEAB 2EYTB 5JTWA 3IJYB 3QEGH 1A4JA 2QKIA 4PRHB 3OBAA 4DK3A 4KROD 4TSAL 5TDNA 2HT4C 1M7IA 4XVJH 5KSBA 1GCFA 3NA4A 1MNUH 1DLFH 4HS8L 3VA6A 1E4WL 3QDME 3R4DA 4R96A 5FYLE 1KJ2H 4FTVD 2Q8BL 2XIDA 4G8EB 4XNUL 3CK0L 1HEZA 1M71B 2ICCA 5T1KA 2EZ0D 3ZDYF 4GAYA 4NQDB 1B0RA 4GOSA 1ZKAA 3GMOA 4EUPH 1UKTA 4K71B 3MUGA 3Q6FB 1JGUH 2IQ9L 5CSBA 3HAEA 2XWJB 4U6TA 4N5UA 3QDHA 2NY1D 3MJGX 3SKOA 2F5BL 5FM5O 5I76A 2OL3H 2HH0L 4UQ3B 4OKVA 2R8SL 2IBBA 5C9JB 4K9EH 3L3DB 2FH6A 2OS7A 2B5IB 5GGSA 3QH3B 2D4DA 1UYWH 2DQDL 2XTJE 5IWLC 4L8SA 2DQHL 4M7KH 1WWAX 2ADJA 3VG9B 1D5IH 2Y36H 4KJQC 3RY5A 3GHEH 1A7NH 4TVSa 3VD4A 5CUSL 3LD8C 3EJZD 3BXNA 4F33B 2E7LC 1FNEA 4NQSB 4WW2A 4FQJL 4PLJC 5KSAB 2DQGL 4X9IA 3L1OH 2JJTC 2XNAB 5IBTL 2XWBB 5BVJB 1KG0A 5B22A 1KBGH 4KGLA 4X80L 5J4MA 5TPWH 1QSFE 1UQSA 5C0IA 5EO1B 5B4MD 1PSKL 5I1EL 1ZLSL 4OLUH 4CJ0A 3HRPA 4Y2DA 1C7TA 1GPOH 1RZ8A 2B7DT 1KB9J 4HHAA 2F8XC 3OKDB 1MFEL 5L2JA 4TUJA 1U9KA 3F58L 4IS6B 2VQ1A 4PLKD 1UB5A 1JZ5A 3ZHDA 4Z0XA 5FA4B 1NDGA 1RIVH 1T2XA 4QT5A 3CMOL 4F2MB 1MF2L 1CLCA 4PUBH 2XWTB 4JKWA 4OBSA 2H1PH 2EDBA 5MEND 3KJ4C 5DVLA 4BSVA 3RAJH 3LPGA 1N0XH 1S5IH 5CHNB 2XZZA 2Y23A 2X9XA 4EQ2A 4APQB 5SWZD 3TNNB 3HUJA 1EHAA 2XKNB 3NCYS 4U33A 3VCLA 3PWVB 5IT2L 3VG0L 2BJML 4XCFH 1FDLL 4JFDD 3X13B 4ZXBD 5C8JB 3LKNB 3VRLE 1MRCL 5DQ9B 5CGYC 2AK4E 3MLVH 5EOCL 3WFEH 3QQNA 3U30C 5DMKA 2QKIB 3MA9H 4YBHA 2ID5A 43CAA 5TDNB 3U0TA 3FN0H 1QFPA 4HWBH 5FHAL 3BKJH 2FEDD 5GGQL 1M7IB 3U4BL 1LE5A 3OGOE 4K3EL 4OF7A 3BH8B 1I9JL 4ZS7H 4X83A 3MUHL 3MLXL 1KJVA 2OMNA 4B0MM 4DZBA 5T1KB 1HEZB 1ND0A 4P23D 1OP3H 4CADB 1MAJA 3RGVB 1B0RB 3VFVA 2QJDA 3HPJB 1P5VA 5FHBL 1OGTB 1NANH 2VLKE 3HAEB 5DJYB 1Y18A 5DDHA 3LKOA 3VXQB 3UO1H 4C54A 1VENA 4G5ZL 4GH7B 1L6ZA 3GBNL 4POZC 3UYPA 5E2WL 4X8JA 3SKOB 4PJ9A 5I76B 4G43B 3GB7A 2D2OA 3VRLF 4PJ7A 2VAJA 4RMTA 1GIGH 1BBDH 4YXLH 5H94A 1SJVA 5HI4D 1X5GA 3BP4A 3DVGB 4D0BA 4Y19B 4L8SB 2ADJB 3RU8L 2ZCLH 2BOBA 1CE1H 5E4EB 5FYJU 3ZLQC 2R23B 4G8GA 4ZFGH 4M61A 1YEIL 3BXNB 4XP4H 4LSRL 2EH7H 1FNEB 5LGHH 4XPFL 4UILH 4P5KB 3VXRA 1VGEL 1NSNH 1BQLH 4A6YL 3PL6D 3QQ4A 5F1IA 5SX4I 2X4OA 4HSQA 3LY6A 1U93A 5EUOA 3JTSB 3HC4L 4PJGF 5E0QA 1UQSB 4XP1L 1UKQA 2C3XA 1ADQL 1D9KD 4R7NA 2VSDA 4Z7WA 5ILTL 3VWJC 1TVHA 4N0FB 4Y2DB 1LK3H 1K8DA 4XBPB 1JYWA 4M7ZC 5A2KH 2WP3O 1YEFH 5L2JB 1S7VB 4N1CA 2R4SL 3HE6A 5E56A 5EC1A 2VQ1B 4KUZH 5J6HB 2XPGA 4ONFH 4HIJB 5LXGL 5BO1L 5JW4R 1NDGB 2BMKB 4FG6C 2I07A 4WFHE 2H41A 3S96B 2B1HH 3IDJB 1RQ5A 3QEQA 2GJ6E 3RRQA 4XCNA 4BSVB 4P9ML 1TJIH 4NNXB 3HS0A 3QXVA 4S11A 2G2RB 1UWXK 2RBLA 3VXUE 5DJ0B 3DURA 5KVFL 5L7XL 1OB1B 4LCCC 3WDHA 1JPFA 1D6VL 1A0QH 1WVZA 3GJEB 4PJ5E 5I8KH 1KNOB 4PY8I 3PDOB 5I1GL 1HSAA 5HYEA 3BDXA 3VFGH 1K8IA 3ARDC 3UC0L 1JZ7A 5HY9A 2EH8L 2PYEE 2FBOJ 5D1QA 1QLEL 2H32H 1IAKA 5ADOL 4JFOA 5I8OH 4NKOA 4QRRE 4DZBB 5C70A 4OQTL 4C83A 4BQBA 1KFAL 3VFVB 3MUJA 1NKRA 1CZ8L 5E8PA 2UUDK 1ZLVK 2ENYA 1A21A 5DDHB 4F37F 5BW7C 5DVKA 4KHTL 1LP9F 3KXFD 4GFTB 4PJ9B 4X4YA 1U58A 5CGMA 2Z31A 4PJ7B 2K7QA 1T0NA 1FVEB 5C09B 4I3GA 1UM5L 2DLEA 5E6ZA 2NY3D 1X4XA 4MDJA 4HXAL 1TQCC 2BOBB 3IRZA 4G8GB 3HNTL 4AEHH 4M61B 1JFQH 5AWNL 4MDIB 3RIFF 4QHUB 4NO0A 5A3IC 2X5PA 3P30L 4OLZL 3QQ9D 2X7LA 1ORSB 4RMWA 5F1IB 4EIGB 2X4OB 2FRGP 4PIRF 5D5ME 4I48A 4HJJL 3UBXI 3E8UH 3V0WL 2DQCL 5DR5H 5EUOB 5JDJA 1VCAA 3OKMB 4K3JH 1KB9K 1KJ3L 2EXYD 2WINB 1MLCB 1V5JA 1TVHB 5IW6A 1KCVL 1EPFA 3N85L 2KZ1B 3V2AR 1HN1A 4G6AD 5E2TH 4XBGA 3U9PH 4DGVL 3HE6B 1W72B 3GK8L 5EC1B 4X4ME 4QNPE 3JV4A 4R90H 3U7AA 4X7TA 1YQVL 2XPGB 3ARUA 4JFEA 1NDMA 2ITCA 3QUZA 4LOUC 3BH9A 5FK9A 2X1PA 4Z7VE 4ZQKA 1M1SA 3IT8D 3MJ7A 4PRBB 5EU4B 1OM3L 3QEQB 4DVRH 1MVUA 4GMSH 3NZHH 3MRNB 1A9BA 3WO4C 3KPMA 5D5MF 4OZGA 1IKNC 1E6OL 1QSEA 2X70A 1JPFB 1A1MA 3VMOA 4YHYB 2GFBA 5AYUH 5F9OH 2OCFD 4BSWA 3DUHA 1JN6A 1T0PB 1QPPA 2GJJA 1CU4H 2OTUB 1MIEH 4G6ML 4XPAH 5IMKB 4Z7UA 3OR6A 1NCDH 3T77B 4FQ2L 5L2KA 3B5GA 4G7VL 2PR4H 1AXTH 3ARBD 4V2BA 3SDYL 5T33L 4E0RA 4LAQL 5HY9B 3CSGA 5D1QB 4PJBA 4QNPF 5D2NC 1EFQA 4FQXB 1IAKB 1BJ8A 3W39A 2PNDA 5EIVA 4JFOB 2JB5H 4P3DB 4Z18A 3HI1A 3M17A 1LO0L 4JFFD 1C5CL 4NKOB 3K4DA 5F9WC 4HUVB 1Z9MA 3G5VB 3SJVD 4Z7VF 3SKUD 2KPNA 2K7PA 2HTLD 3S36H 4XP5L 4DWHA 4FQIL 3MLZH 3WNOA 4RFOL 5FO8A 3HCVB 5IK3A 1P6AB 4YDIL 4EUPG 2RHEA 5D7IE 1KCSH 3CFEB 4MAYC 2Y25A 1DBBH 1XCTA 4PTTA 5CP3H 4MHHG 4X4YB 4ELKA 4KGJA 1U58B 2G60H 2Z31B 4OD2B 2AP2A 1JGEA 4RWHA 2FYYA 1OSPH 1Z9SA 5IFJB 3O9WC 4M7LH 2A77L 3DVFA 3WIHL 3WMSA 4IRSB 2VXVH 5DQDH 5EZJB 1QYGL 3BHBA 1VADA 3S88L 5I9QB 5I73B 1HIML 3CFCL 2AXHA 1WFUA 1S7UB 4NP4L 5EA0L 1RJLA 5LGJA 4FTVA 1LK2A 2VWEE 5D93B 4LPVA 1JRHH 4JN1H 1K2DA 2X7LB 1RZGB 4UDTA 5GS0D 4QYOB 3B6SB 4I48B 2JJUA 1M7XA 4HWNA 3TIDA 1G7QA 4PRDA 2WLZA 4PV9B 2R9HC 5D7IF 4HLZH 4JLRA 1FZOA 2W1NA 3MJ9H 2GQHA 4R97B 4QTHA 5IVXE 1MY7A 5JMRA 4I0PC 3P0GB 1IAII 2J6EA 4Y4FC 1SYSA 1FIGL 1MPAH 1OGAB 1FG2A 1TZGH 3I6KB 4J6RH 2XY1A 2JELL 1WT5C 5K9JH 1MCOH 4X7TB 4XTRC 2FBJH 2WBJD 4JFEB 4DW2H 1NDMB 3T04D 5F1SA 2ITCB 3QUZB 5H37H 1ZT1A 4JY5L 2YWZA 3WKNA 3BH9B 2J4WL 3UDWA 1CT8A 4NSKA 4ZQKB 1AJ7L 1TIUA 1X5IA 3MJ7B 3EYUL 5FF6A 1J10A 3MQIA 5C0BE 1AKJB 1HHGB 1U8NB 2Z93A 5CIPB 4FNLL 3V4PL 1Z9LA 4K7PY 5EZOH 4HH9B 4G8IA 4YPJA 3SDAC 1QSEB 2X70B 1IC7H 1A1MB 1Y6MR 4WWKC 4JM4L 4R3SA 1JN6B 5IVXF 1X5YA 4DTGL 2HJLA 5INDA 2NY2B 4Z7UB 5IR1A 2YUWA 5JR1H 5T3ZH 4BYHA 2VERN 3LRSA 1W72H 1FBIL 5D6CB 5L8JB 3HE7D 1ES0B 2EIEA 3ARGD 4PJBB 3SE3A 1MJ7L 2AXFA 5JQHC 4NOBA 4Y4KD 3WUZA 3W39B 1LO3L 3FRUA 5AAMA 3DX8A 2DF3A 1N5AA 1CF8H 1LHZA 2GTWB 2EICA 2QR0A 4KRMB 3KPQA 4J3TA 5I66A 2YSSA 1E4XI 4N5ED 3DI2B 1IFHL 4OCNC 3Q5TA 4XGZB 1J9CT 3UTPE 2YPVL 4R2GC 1GAFH 1YPZE 2IWGA 1CGXA 1YEDA 1LD9B 5MENA 3TYGL 1VGKA 5SWZA 2FX9H 3MLYH 1YJDL 4ELKB 3PWLB 4JFDA 2DDQL 4ZXBA 3TVMA 3DO7B 4QRPB 3RVXD 5F7FA 4X6BA 2ZKHL 2AEWA 2MNUA 4HX1A 3SE4C 3PP4H 3MRCA 4XRCA 1FNSH 1FO0L 1QBML 5IFHH 1CICD 4IHOB 1S8DB 3EDDA 1OAZH 4C56A 3V95A 1VADB 4XP6H 1VFAB 3DRTA 1E4JA 1NEZG 2XFXA 4KVCL 3S8WA 1Q9OA 1BJ1J 2VC2H 4RAVA 2WWMC 4CN6A 1RJLB 5LGJB 1U8OB 1LK2B 3DXAB 2X4PA 4ZUVA 3WXVH 3EOTL 4I0CC 4FHBD 5TFSL 1K2DB 4HS3B 3RBSA 3WKMH 4P23A 4XWGL 4URTB 3K0WA 5JXAL 1YPZF 4K8RH 1G7QB 2YD9A 3GUTB 3ALPA 1MJ8L 4XAKD 5C07E 4BFEA 1T21A 2P8LB 1FZOB 3RDTC 1OPGH 4KAQH 3SGDI 3WLBA 1BFTA 5ISZB 3U0WL 2X44D 4P4KD 4QTHB 1IGJA 4OLWH 1SYSB 1RIHL 4TVPL 5EIQA 5HYQA 2WUBL 1D5ZA 1JTTA 4Y5YC 4NGHL 4RGNB 3DWTA 5DA4A 4YHOH 4BH8A 3N50A 4XX1G 5MI0C 1KJMA 1MWAH 1HCVA 3O6LL 3QCTH 4Y1AD 2R0LL 2VABA 4R8WL 1F3DH 4NSKB 4U1NA 3BPOB 4CMMA 3BQUA 1R3JA 3UJIL 1H5BC 4IRJB 5C0EB 2NY0C 4XT1C 1BIHA 3MLSL 2CDFB 5BV7B 4M7JL 3PWUA 1RULL 1XGRA 4KI5F 3MNVB 4NZRH 4YEFA 4OGXL 4G8IB 1KYOK 3T4AB 3FQRA 3PL6A 4ODSH 5INCA 4JREC 3T0VA 4XNQA 4MZ2A 1HKLL 3MRKB 4WFFD 3TJEL 1NCBH 1E4KC 4R3SB 5F9JA 5ERWA 1PKQA 4LVHB 1D9KA 1VACA 2PF6A 3T2PA 2NW2B 3KYKH 1QG3A 5D71H 1LNUB 2R56H 3JUYA 1JPGA 2NXYD 2AXFB 4YO0B 4RA3A 2BSED 3FRUB 3GZKA 2JB6A 1N5AB 1KLUA 3MV7E 2QR0B 5I66B 4NC1E 1ZGLP 2YSSB 4EDWH 1CTOA 1UM6H 1TMCB 4C4KT 5FUCE 4JRXE 3QUYB 4N8CL 3RZWA 2V5YA 1YEDB 1UM4H 1VGKB 3F5WA 3I02B 3MCG1 2R2BA 5CZXC 4QF1A 2QADB 1NAMA 2ZSVA 1CGVA 3OB8A 1RUPH 3EYOB 3CU7A 3D0LA 4ZXBB 3TVMB 4X6BB 4F7CB 4FS0A 1H8OA 2C1PA 2VAAA 4KI5C 1EVUA 3VGAB 4CW1A 1RU9H 4LARH 2DQUL 4D9LH 5DJCA 1F8TL 1BVLB 4C56B 5IIEA 1BGXH 1JWMB 3GM0A 1YEHL 4Y4HC 2Y7QA 2D7MA 3DRTB 4OZHF 4FQCH 2XFXB 1T89A 1Q9OB 4LRIA 4NT6A 1QBLH 3SCMB 1Z2KA 1LQSR 1HI6B 2X4PB 3ARZA 5LGKA 2OTWA 1T04A 3ARPA 5C0NC 1NAKH 4LKXA 3RY6C 3ZYIA 4ZFFB 2YWYA 5I8EA 1QUNA 4G9FB 3HMXL 1FP5A 3T3PE 1EZVX 3KXFA 3Q5OA 4K23L 5DHYA 3IVKB 1AHWB 4QWWD 4U6YB 1X6NA 5LWYL 4JPWH 3WN5B 1G7PA 5K93A 1EH9A 3F7VA 3V5KB 3ILQC 4GT7A 5BRZD 5I2IA 4EUPA 5DD3L 1KJMB 5I16A 1UG9A 3TA3C 5J11B 4OFYD 3UTSB 4O9HL 3UTOA 3W11D 4CRPA 4ETQA 4YBQC 1SJEB 5F71A 3BQUB 1R3JB 2DM4A 5JOFA 2DWEB 3CXDL 2CJUL 3IAQA 2DWDB 3PWUB 3RWFB 1XGRB 3HZYA 4ZAKD 4MQXC 3CJJA 5HHQA 2W59A 2XZAL 3TBWB 5F8QC 3VDAA 5KS9A 1QA9A 2GUOA 3FQRB 1RMFL 2CQVA 5INCB 4GRMB 2FLRT 2H45A 3U83A 4O51B 2NY4C 4OCSH 5EFIA 3MV9A 4NHUB 3CVHA 5F9JB 5C71A 5ERWB 1PKQB 5GRJL 3G6JB 2DQJH 3SO3C 4UT7L 1LILA 4YHPB 1P4LA 2CGRL 4JHAH 4JPVL 2H6PA 4KPHH 5FUCC 4WY7L 4PJEA 1RVFH 1UZ6E 1XGUB 1CFTA 5KSVA 2EE2A 4LLDB 3GRWH 5KG9A 3BESR 2D9QB 1OAYH 5CJQL 3QI9D 5DLMH 3VXTB 5JNYA 5DWUH 3WNNA 2I25N 3ILPB 4PJHF 1DJSA 1GRWA 4U1LB 2A6IB 5T3ZD 2EDTA 3DGGA 2VXTH 5CD3A 2R2EA 4RIRB 3MPCA 5MEOB 3T0BA 2O5ZL 2NZ9C 4QF1B 4NO5A 2ZSVB 5DUML 4D0DA 1HHJA 2BOCB 4JFHD 2VIRA 5B21A 35C8H 4F9PC 1P84J 2AV7A 1CLYH 3FOMA 4Y7MA 4CAGA 4GRWE 5JIIA 3TBSA 4M00A 4QHNA 4J4PD 5DJCB 3E6HA 5C6TH 5JOPD 1UZ6F 1W0WA 4X6CB 3ARBA 1HXYB 4QRQB 1YNKL 4XVSH 4RSVA 4M3KB 4GBXD 4XH2B 1A6AA 3KPSD 5HXMA 3FFCE 2IPKB 4JFFA 4X6FA 3MRGA 2R0ZH 2BSRB 1U8QB 1T04B 1QVOB 4X4XA 4DOHB 4OV5A 4LKXB 3D1MC 5SWSE 4A2MA 2DQTH 2NNAA 3FB8A 1Q8MA 4J3SA 1BZ9A 4HWBA 4CU8A 2ZOLA 2EIBA 4MNQE 3T2NL 4YUEL 2CLZA 3ABZA 3P73A 4ZUTA 3KXFB 3O2VL 1QLRA 3OMZA 2NY6D 3C6LC 1NFDB 3PDGA 1VERA 4GRWF 1T2JA 1XAUA 3CFBA 5I16B 1BLNB 3EYVA 3ORJA 3P77A 1DDHA 3BSZH 3VMPA 1JV5A 1N6QH 1FRGH 3FT2A 2NTSP 5H37G 3OTTA 3HNVH 4JPIB 3NCFB 5JORA 3W9EB 5E2VH 4UDUA 5HHQB 1OWRM 4OD3L 3HR6A 1HH9A 1QA9B 2GUOB 3UBXB 1QR1A 4R9HA 2HKFH 3ULUL 3P9LA 5JPNA 3OKOA 5HD8C 4U2YA 3S3SA 1WZKA 4NM4L 3CDYA 5EFIB 3MV9B 3CVHB 2NXZB 1QSVA 3VJ6B 1PYWB 3OKLA 4NCC2 1EJOH 3LEXA 3C2AL 3IU3A 2H6PB 1KCUH 1AXSB 2YXMA 2N7BA 4PJEB 4ODXA 4KRPD 4HEPG 1DUZB 1SJHA 1FNLA 1DVFD 3QIBB 4XPBL 3MGTB 2WBJA 1K4DA 5JNYB 5EG6C 3ZKNC 5D7KD 1OTTD 1P7QD 4XAWH 3HB3D 1UA6H 12E8H 1TNNA 3DGGB 3PHSA 4IRZL 1HHHA 2CMRH 4NN6C 4OCWH 4P59L 5CD3B 5SX4H 4YGAB 1MCCA 4Y5VB 1PZ5A 2DLGA 1NGZB 3ULVE 2ZPKL 1U6AL 4K7FB 1KLFA 1RUAL 4NO5B 4D0DB 4PRNA 1MRFH 1HHJB 4LEXH 4GUPB 2C3VB 3BPNC 2VIRB 2Y06L 2V9QA 4WUKL 3VWKD 1F02I 2I24N 4ODHH 4PGEB 5F7EL 5E1AA 3RTQD 3TV3L 3FOMB 2VLRE 2N1KA 4M6AA 2HLAB 4RRPA 3TN0A 1CD0A 1KCRL 1FNGA 2IG2H 3C09B 3QEUA 3CSYA 3K8MA 3P4MA 3E6HB 5HJ3A 4GS7C 3ARBB 4W6YB 3A67L 1H3TA 2VR4A 3T3ME 3HE7A 3BYTA 1GZQA 1P6FA 4D3CH 5C7XL 3ARGA 2GW5A 3RWGA 5TDOA 3ETBF 2FWOA 1A6AB 3ARQA 4Y4KA 5F7NC 3WHXA 4Y88A 2X1XR 1G6RA 4JFFB 4X6FB 3MRGB 3QIWC 4OIIH 1N59B 2UZYB 4X4XB 2GIYA 4DGYL 3F62A 4OV5B 3D3VE 1BQHB 1Q9WA 2A1WL 2IMMA 1S7RB 2NNAB 3FB8B 3OPZL 4MXVE 1BZ9B 3ULVF 3H42L 1IILE 2ZOLB 4KV5E 2BY2A 2DQEL 1BP3B 1FLRH 1A6UH 2CLZB 4G7YH 4LPYA 4IOIA 1I3VA 1D5XA 1Q9LA 5CKAA 3MGOA 4J1UB 5HVHB 3RX5A 3D18A 3G5XA 1CFNA 1A22B 3B9EA 4ODUA 1TFHA 5DMIL 3B4NA 2LFGA 4I5BB 1B4JH 5LCVH 3P77B 3T0AA 1CICA 1OAQL 2D03L 4L3AA 5CEZH 1I75A 3T3MF 1FPTL 2LTQC 1HZHH 2R0WH 3GHBL 2IADB 3FT2B 3VFRA 1WBXA 4JRWA 5KAQF 4OB5H 3B3IB 3BRGC 3VH8B 4FFVC 1OTUD 2EKSA 3CH8A 1BFSA 4L3CB 1FORH 4NC0B 5I71C 4WDIB 4HK3J 4LIQE 3E2HB 4MXVF 2I5YH 2VDNL 2PYFA 4TRPH 1ZA3B 2XZCH 1WIPA 1U3HC 5I1IH 4Q9QL 5EO0B 2UZXB 3OKLB 3T0WA 3S35H 2BFVH 2BVUA 2NR6D 4P4KA 4R4BA 3IU3B 4OI9A 4ODXB 1L7TL 1L0YA 5IBLC 1SJHB 4WO4B 3ULVC 4X7DC 4PJFE 1E6JL 4UTBH 2A73A 2BNRD 5DC4B 4Y8DC 3D87B 1UCTA 4UT6H 2VXQL 4P9HL 2WBJB 4Q74A 1K4DB 3JBG7 4X98B 1UWGL 1AR1C 1ODAA 3V6ZA 4JAMA 4Y1AA 2XG5A 3MRLB 4JR9L 4ONGH 5J1TC 1KEGL 4Q97A 1PZ5B 1JYNA 2HP4A 5EU6E 5IQ7H 2IQAB 1IQDB 1RZJC 1NAML 4FXGA 4Q2ZA 1OL0A 3K8LA 4PRNB 3LQAH 2AW2A 2D0HA 2OYPA 1I85C 1IKFH 1NGPL 3ARWA 3TP4A 3WD5H 5E1AB 3TN0B 1F4WH 1YY8A 1U91B 3ZE2E 2ILLA 5A2LH 3QEUB 3WFHA 3P4MB 3O6ML 2CDEB 5GGRY 3B9KD 5EB9A 4NQXB 4S10A 2E7HA 2JIXB 4PJFF 4GW1A 2ZUUA 1FAIL 3ZDZE 4I18C 3MOBH 3RWGB 2FWOB 4Y4KB 3WHXB 1OF2B 4Q7DA 1CDUA 1G6RB 1PEZA 4L4JA 1JVKA 1MCRA 3ARXA 3VFOA 3QEGL 3ZL4H 5C08E 5E6YA 1XGPA 3RX7A 3QNXB 1Q9WB 1KIPA 1A6ZA 1OHQA 2VDLH 4LP5A 4PY7B 3VXPA 3ALXA 4XVJL 5E9DD 3H9HA 4F7EA 2M2DA 2WWKT 2ADGA 1DLFL 1N8ZA 2HJFB 3WNMA 4WJ5B 3CXHK 4EN3D 1CFVH 3MZGB 4IOIB 1I9RH 3MGOB 3D18B 2DM2A 5C0FA 3KLHD 3QO1A 4X8XA 1CFNB 1HYRC 3F8UB 4XMKL 4CU6A 4ZDHB 5DF0A 1JGUL 2UVFA 2ZG1A 1F6AA 2EIZA 4YX2L 3SQBA 5EBGA 4LP4A 2QV2A 4PREB 2VJXA 6FABL 3BYYA 1FQ9C 2RIKA 4OZ4A 2OL3L 3CU1A 5A2IH 2HJKA 4U0QB 3LIZH 2F53B 4K9EL 5TGBA 4OI7A 2EKSB 4N0RA 2VLJD 2BHUA 4YEEA 3WS3B 1JHTB 3BN3B 3LD8B 3OKNB 1UYWL 3O3DA 2GHWB 4KH2A 4YGVA 4IOSD 2PYFB 5F8RC 1DEEB 1OAKH 1V3KA 3GHEL 4OGYH 1VPOL 2VZ3A 3UZVB 4H25B 3SGJC 3OKKA 4P4KB 1UZ8A 1E28A 4R4BB 3T65A 5D72H 2ZNWA 4AG4H 3L1OL 4IMKA 3RZCD 2A73B 3L3GB 4S1DD 3NFPA 1JNHA 5BRZA 3ZE0F 4KQ3L 3PUCA 5TPWL 5IVZA 1EIBA 5FYJE 3BEWB 3V6ZB 1CCZA 3V9FA 1TZHB 3QO0A 3ROLA 4CL7A 2AI0H 2B20A 1LE9B 1GPOL 3VXSE 1SM3H 3FO2A 4K94L 3KJ6L 4JVUA 4ZAKA 5GGVH 2OJZH 4XWOD 4Q2ZB 3L3KB 2MFNA 5GISH 4N8VG 2QSQA 3IETB 5HGHA 4HUXA 2V7HB 4UI2A 1RIVL 4TSBH 1KF9B 3H9ZA 1IAIH 5ECJE 4WTZG 3U1SH 4RZCB 3LH2H 4EBQH 5DEGA 1YY8B 2CUIA 2EYRB 1ZVHA 2X6MA 1DBJH 2H1PL 1QTYT 3VGEA 1N0XL 1S5IL 4PJCA 3BN9D 5FUOH 3JTTA 2AQ2A 4GW1B 3U30B 3T0DA 1G7MA 3PWPE 4XCFL 2NXYB 1SY6A 4WI7A 4U1JB 3MLVL 1X5AA 3QI9A 3WFEL 4LGSB 5IB5A 3VD5A 2P24B 3MA9L 3AGVA 4U6HA 3G6AA 2IAMD 4MCYA 3FN0L 1KIPB 4HWBL 1IM9D 1I7UB 3BKJL 1X5ZA 2GCYA 2OQJA 3KAAA 3VXPB 2OSLA 3H9HB 1EGJA 1WAAE 1EEUA 4Y16D 2NX5E 4HPOH 5BVPH 4JRYE 4GSDL 3CNKA 3TPUA 4WI9A 1NFIB 1F3RB 5C0FB 2QHRH 3KS0J 2L7UA 2PTTA 3QO1B 2DL2A 4GG6E 1F11A 2XXCB 4O02H 1FCGA 4JZOB 3L3OB 1F6AB 1OLZA 4XB7A 4PJAA 1JZ8A 3UO1L 5LKNA 2QQKH 4FXKB 1CBVH 1FYTE 1UWXH 4ORGA 1FL5A 1JYXA 4KJYB 1TDQA 3G9AB 1E4XH 3GGWA 4EI5D 2OTPA 4GBXA 3RL1B 3LKRB 3D25B 4XHJC 3WXWL 1HNFA 1GIGL 5TGBB 1Q0YH 3WSQH 4YXLL 2OZ4A 2IANE 1GGCH 1SEBB 3QDGD 3RVUD 5GS0L 3O3DB 2AXGA 1YMMD 3V6OE 3S37H 1H8NA 2ZCLL 3BWUC 1CE1L 1WAAF 2HVJA 4ZFGL 4U1SA 4KUCD 4XP4L 5I30L 3TF7C 1DBAL 4PJ8D 5LGHL 1QRND 4ZPTB 1DANU 5E7BA 4QOKB 4GG6F 1BQLL 5IHUH 1F45A 4GRLC 4MD5A 1JCKA 5MHSE 3VWJB 3NFPB 1JNHB 5BRZB 3ZSTA 3QUXD 5IB1A 3IDUA 3P0VH 1ZLVH 3FB6B 4F8QA 4PGDA 3O3EA 3I3BA 1KOAA 3ROLB 2CK0L 4HIHA 1LK3L 3J8F7 2C9AA 1YEFL 3U2SA 4HEME 1BVKA 1X7QB 4LHUD 4KUZL 2AK4B 2UWEA 4Y8AA 4ONFL 2JCCE 4CVXA 4QTIH 2ZJSL 4OUOA 1DQMH 1DQDH 2DBJA 4M62L 4TOYL 4HIIB 3MYJA 2I9TB 5T3XE 2AABH 2V2WB 2EDOA 3GJFH 5JZ7D 2Z91A 1M05B 2Z9TA 4RCAA 3WIIH 3UJTH 4N1HB 4PRPD 4LCCB 4PJDE 3DSNA 3JTTB 4KJPD 4TUOB 1BZQK 1WQVT 1G7MB 4HJGA 2VDKH 3UXFA 4XZUB 5F7UA 2A83A 1AI1H 3RWCB 4U7KA 1A0QL 3ARDB 4WFGE 3QI9B 5I8KL 1UH4A 5I8CB 5IB5B 1SEQL 4PJGB 1MCJA 1MCBA 1P7QA 5AUMB 3VFGL 2GCYB 4X4ZA 2OSLB 4YIQB 1LWRA 4HV8A 1H3WM 4M8QB 3NIDE 3O8XD 4MA1B 3SKNA 2JCCF 3KHOA 4BM7A 3TPUB 5I8OL 5CZKA 2HFTA 1G0YR 5D7JD 3VWKA 1IL1A 1DBMH 4PRHE 1WISA 5DJZA 4JHWH 5DT1H 3RTQA 4HLJA 1F11B 5CJ5A 4JM2D 2N56A 4PJAB 2YOCA 4GAGH 4ORGB 3O9WA 4P2QB 1V8HA 3GGWB 4U49A 1A5FL 4LLMA 4GBXB 1TQCB 4NQDE 2XA3A 4MD4A 2B2XH 2LV4A 5E1HB 4ELMA 2OP4H 3L5HA 3HC0A 2MKWA 3O2WH 2YUZA 3JVGA 2FIKB 2HVJB 5CMAA 4AEHL 3V0VB 1JFQL 2I9LA 4M48H 1LDSA 3KPNA 4GMTH 4JFYB 4MVBC 5KVDH 3GSXA 4LSQH 2L0DA 1U92A 2MOVA 4MD5B 4V2CB 1I9IH 4DN3H 1T1XA 2BZDA 4MLIA 3E8UL 4NKIH 4M6OH 1N4XH 4GXUN 4K3JL 2GJ6B 4LHUG 4JZNA 4U6XB 2CIKB 4DKDC 1NC4D 4PGDB 4NQCD 1WZ1L 4KMLB 3O3EB 3VXUB 3LN5B 4RWYH 2C5DC 1BIIB 1A4KA 1DQQA 2BNQD 2JKXA 4P3WA 4DUVA 4L4TD 4MNGA 1LP9B 5HHOD 5J13C 2X10A 3U2SB 1XGTA 5E2TL 2EDNA 4C57C 5A2JH 1HXMA 4WWID 2DTSA 3IFOB 5CLWA 4YC2C 3LKSA 2BVTA 4Z7NE 3L95A 3O6FD 5F89A 4FQQA 4EVNA 1AGEA 5B8CA 5DS8B 2Z91B 4BUHA 3TESA 2PW2A 3PV7A 3QHZH 3MMEA 4DVRL 1CS6A 1JZ6A 4GMSL 2PETA 1ZS8B 2EDDA 1VEOA 3MREB 4LGRB 4QRRB 3RVWD 2C26A 4HJGB 4KRPB 1FG9C 4HFUL 2W60A 2BNRA 4NOFA 5FYKD 5F9OL 2YEZB 4XPAL 1CU4L 1NGXA 1MIEL 1X5JA 5D2NB 2RJMA 2F54D 5GIRA 4LLVB 3MV01 2PR4L 1AXTL 1L0XA 5F6HI 4HV8B 3IF1A 2JF1A 5DSCB 3OWEA 2X4QA 3SO5A 2JB5L 4Z7NF 2PO6D 4LLQA 1N3NA 4PV8A 2BXZA 4BK4A 5IV2B 3I9GH 1IL1B 4PR5A 4HAGA 5K9KA 4HUUA 4MAYB 2VDRH 3GI8H 2ZZUT 2VQUA 3S36L 1C1EH 5B3JF 4KRNA 2V5TA 4KKAC 3BD3A 3MLZL 5C3LD 4EJ1C 5I75C 1ZXQA 1EFXB 5KW9H 4E41D 1KCSL 3ME0A 1BJMA 3B9KA 4NM8H 1DBBL 1IC5L 3O9WB 1UGNA 3DBXA 3MBED 2I60H 3MCLH 4WTZA 3QA3A 4GKSB 4G42A 4LLMB 4P57B 1G9EA 1WIOA 1NCNA 3PNWA 3EBAA 4P46C 2FD6H 5IP4A 2IFGA 3KYNA 2B4CL 3PHOA 1KPUB 4HJ0C 5I0ZA 1OSPL 4MD4B 4GAJH 5BS0D 2M8XA 4I2XA 4ELMB 1YN6A 3ZE1F 2C3HA 1IC4H 2VXVL 1ZEAH 5D1XD 2HT2D 1A2YA 2YUVA 4ZTPH 2D0GA 5E9DA 4B53A 5JLZA 4EN3A 5A16A 1NC2B 1OWWA 1PQZA 1ZHKB 1JRHL 4JN1L 3O4OB 1U92B 1KN2L 4NZTH 1MEXH 1T1XB 4Y19E 4JE4B 5CLTA 4I0PB 5KSBF 3GMLB 4Y4FB 1DZBA 3EZJB 3STLB 3MJ9L 2E9JA 2R1WA 4LVOC 2BHYA 3UMTA 1UKSA 3NVQA 1DQQB 1A4KB 2P5ED 4MNGB 3S4SG 3VD7A 4UAOC 1MPAL 4OFKA 1XGTB 1YEJH 1TZGL 1RZKH 3QIUD 4QRTA 3NH7H 1MCOL 2VLJA 3BDBA 2CLVA 2FBJL 3LKSB 2MQ3A 4G6JH 4NYLA 5GZOC 1CD1B 1XR8A 4ACPA 2O61A 1XT5A 5CS7A 3Q48A 1JGVL 1XF5A 2H26B 4CMHC 1P4BL 2O26U 3RJDA 1YC7A 5K9OB 4WWKB 4KDTC 5EZOL 1R5WA 1RJCA 3JUZA 5GS1C 1WFTA 3RZCA 4NQVB 2BNRB 1IC7L 1FGNL 4BELD 1FZKB 3S97C 1RUMH 5MEQB 2QEJA 2DYPB 3I75A 1O0VA 3W2DH 5JR1L 4WW2F 5GIRB 5T3ZL 3O3BB 3K1KC 1EGJL 4G6FB 4K3DH 1DANT 4N0YH 1KXTB 1C16A 4R2GB 1Q72H 1BZ7B 1CF8L 4LLQB 1HOCB 1N3NB 2HAZA 4PV8B 3ZSSA 5FKAA 3RUGA 4PR5B 5B39G 1I1CA 5K9KB 4HUUB 4F7MB 1QFHA 5KN5A 1TJGL 1MFNA 1TPXB 1GAFL 4PGBB 4OFDA 2XXMB 3TLRA 2EDKA 5CCKH 5MEPA 2G9HA 5FKPB 5J3HD 4LU5L 3RIAF 3S98A 1MCLA 4OLVL 4LCWD 4U1KA 2F5AL 1CLOH 4LHQB 3BGAA 4G42B 5AZEH 1BFVH 2X1WL 2AV1A 3PHOB 3QDMD 2OZ4L 3EO1B 3LB6C 4JN2B 4P2OD 5FYLD 3T09A 4KXZI 3C5JB 1FNSL 5IFHL 3AS1A 3HUJF 1OAZL 4L8SC 2IAMA 1MFCH 1IM9A 4ZD3H 1HWHB 2DI9A 2QBWA 2EO9A 3ZKSD 2F8OA 4Y16A 4PJ7E 2VC2L 4EN3B 1J88A 4WW2C 5F7YC 4ZFZA 3WXVL 3MXWH 2OXHA 3MRRB 3WKML 3RDTB 3MRPA 2XYCA 1WC7B 4PFEA 3K8KA 2FATL 4K8RL 4G8GE 1YY9C 1OPGL 1TENA 4KAQL 3KYAA 2XTJD 2VXUH 4MMZC 3AY4A 4Y2DC 5MI0B 1RK1A 1A8JH 5FA3A 4EI5A 2ZG2A 4F58H 3TA3A 3PABA 4RAUA 1MCDA 4QRTB 3AMKA 3KLDA 4ZPVA 5AZ2L 1OARL 2K9UA 1Z5LA 1G7JA 2CLVB 5EUOE 5GGSY 3QDGA 1QFWM 4K7PH 1XR8B 2EXWD 3CPLB 2ZUWA 4XXCA 1MWAL 3QCTL 4RMUA 4AENA 1XF5B 2D0FA 4N8PA 2J3SA 4PJ7F 1NUGA 3UTQA 4U3CA 2BCKA 5I1CH 4PYGA 1I3RA 3KPPA 3MRBA 4NZRL 4DK6A 1QRNA 3QT2A 4CDHA 1Z0NA 1ZT4B 1R5WB 3ES6B 3P4NA 3SEPA 4ODSL 4WI8A 3RZCB 3IKCA 3UPRA 2J7LA 3MROB 2YK1H 3HFMH 1NCBL 1ZTXH 3QUXA 3VDCA 3I75B 2H3NA 2BERA 2F19H 3QEQE 2OI9C 2NY5H 3L3IA 3Q6GL 3T4YB 3RWEA 4FXLA 4QEGA 1V05A 3KYKL 2R56L 3JZ7A 3D5OF 4Q58C 2DJSA 1UXWB 5EUOF 4MB4A 5GHWH 1C16B 4LHUA 2AJUH 3GKWH 5C6PB 4BZYA 5TQ2H 3NFSH 3T0EC 5DD1H 1RHHA 4XBEL 5DJ6A 4Z7WF 5FKAB 1EV2E 4EDWL 1JMZA 2Q7NA 2GAZB 5KN5B 2FB4H 1UCBH 4LHJB 3U36A 5CWSB 5MEPB 4F9PA 2IPTH 4QXUH 2ATKB 4LPWA 3WLWC 2BX5A 4S1QH 4L4VD 1RUPL 4PJ9C 5EDXA 1H15A 1RJZA 4PP2B 3PQYB 4JJ5A 5IHZB 1I8LA 4LARL 4YZFE 2HTKD 4D9LL 2VUOA 3F7PC 1AGFA 2IAMB 1BGXL 1IM9B 3QJHB 4XNXH 2EDXA 4WI4A 4TQEH 4FQCL 4KK8C 3O8XA 1H9VA 2V5SA 1KELH 5CZVH 5F1NB 1AD0A 4R6UA 4XXDA 3LRGA 1A6TB 5D7JA 4H1LH 5ANMA 1NAKL 3CMGA 3G5YA 5FDWB 3GSUA 4JM2A 1QNZH 3KHQA 5ACZA 2BY3A 5EUKB 3PXJA 4L5FL 5F7DA 4JG1L 5DRNA 4LNRA 5GZNC 2AJYH 5MP6H 4EI5B 4MSWB 1MRDH 3TA3B 3PABB 4RAUB 3QPXH 1TJHH 1RY7B 1A47A 3QDGB 2KH2B 4OAWA 5LQBH 2LU4A 1BJ1H 1FGVL 5C2UB 3WFBH 2BCKB 1HDMB 4R0LA 3UTTD 1I3RB 4OZHB 2NY4B 3KPPB 3FONA 3MRBB 5ENWA 3NCYP 3W5MA 1A7QH 3IXAB 4JFEE 4AZ8A 5I15H 5IEHA 1I1YB 1S7TA 3IKCB 3UPRB 5AG8A 4OCSL 2GSGB 1T66D 1NC4A 1V3JA 4NQCA 3GIZH 1S7QB 1DE4A 3L3IB 4LDOB 5HVWA 4JHAL 1AE6H 2BNQA 4WFHD 4L4TA 1RVFL 5IBUG 5HHOA 2XT1B 2DM7A 4OZGE 5D1QC 3GRWL 4NQEB 4X7FC 1QSEE 2ICES 2DLFH 4OIBA 1NGQH 1HQRA 4AY0A 5DLML 3EYFB 3OXRA 5DJ6B 4AEIH 1PG7W 3O6FA 3EOYG 5EH1A 4Z7UE 1IAOA 2ARJA 1RSFA 3S4SA 5KOVC 3WNPA 2Y9RT 4NBYB 4HKZA 25C8H 1UJTA 3NCMA 2DJUA 4PJ5D 4PJBE 4PRAA 2YPLB 5FV1L 4TPRH 5C0AB 5KZCD 3KDMB 3HPLB 3HHRB 3U79A 1I7ZA 3QXDB 3BGMB 3SDCD 2Z31C 1H15B 1BMGA 1JF1A 2X05A 4TNVF 1TVBA 4X0KA 4FQLH 3SGEH 3RVTC 3SKMA 3RX8A 3UPAA 2F54A 1DP0A 3I6LD