5FYLD

Crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122 and 35o22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
242
structure length
242
Chain Sequence
QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords BG505 GP120 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 33
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylD01
2WBJA 1JTPA 2Q6WA 4UOW1 1KC5H 2HRPL 1XT5A 2EZ0C 4TOYH 3AS1A 1UGNA 1KLGA 1R3JB 4X4ME 5T5NF 4OV5B 3ARDA 4Y19E 1PKQE 3QDMD 3MRKB 4WTWA 3UAJC 1MJ8L 3RWCB 4JHWL 4OD1L 1CICB 1V7NH 3BZ4B 5DSCA 3U4BL 1WZMA 5E7BA 1UKSA 2BVTA 4YEEA 3WHXA 2NY1C 5EU7E 4NNXA 4KMQA 3DX7B 3VRIA 4KK6C 1SVCP 3FB6A 3WV0A 2YUWA 1MFBH 4KKCC 3WKMH 3FONA 2DQCL 4JRXE 4EDWL 5EA0L 5DJ8A 4WW2F 4HEPG 5GGQL 2NMSA 4LVEA 1QEWB 4UQ3A 2YD1A 3MO1B 2P5EA 5B4MD 4CVUA 4PRBB 5MEPB 4F7PB 1YEIL 2PYED 1SY6H 4K07A 1KTDA 4WW2A 4GRLC 5E2UL 4RAVA 5JW4Q 1UCBL 5HI4D 4D9RE 5LWYH 4JQXA 4KJWC 4QHNA 3NCJL 1TTFA 1BFVL 4YAQB 4X6DF 3VD9A 1BBJB 1XR8B 5ETUB 4A6YA 4PJ8C 2ZNWA 3M45A 1UVQB 1JZ5A 3T77B 4PY7A 3GIVA 2DQDH 1A1OA 1FFOB 3MRHB 3FQXB 3D5OF 1N2RA 2A0LD 4N8VG 4NSKB 2C3XA 4HWEH 1VFOA 4QNPE 5FYLH 3BQUC 4YFLF 5ALCL 1EHNA 3MUJA 1Q9LA 3WFEH 3BH8A 4HV8A 1A6WH 3U7WL 5E00A 3FN3A 3VD4A 1L9MA 4NRZB 4B7IA 4PJXF 1VEMA 3GB7B 3QEQE 4YDLC 3QXWA 2MJWA 2ZUUA 5FM5O 2CPCA 1N6QL 3B83A 4FTVB 2ZSVA 1J05B 3K8MA 4OLUL 1SBSH 3I6LD 1ZOXA 2F8VA 3UTPD 4L4TD 1R0AH 4DN3L 1EFXD 1OY3B 5IWLA 1KYOK 3KYOB 1E6JL 4JRYD 4ESKA 1ZHKA 3WN5A 4B5EA 5D7JA 5CILL 4DKFH 5HHOB 2IC2A 4NQEE 3FO2B 3BIAX 4HWBH 1I3VA 4B41A 3MV8A 1AXTL 2DLTA 2CRIA 5I1JL 5GGVH 5I17B 3MRJB 2L7UA 5EBGA 4P2RB 3V95A 3RWHB 1A7NL 2AJSH 2BVOA 2AV7B 5C09A 5EO1B 1A9BA 1G7MA 3T3MF 3CX5J 5HHMB 5D7JC 1ND0B 4WI3A 4D0CB 1EEYB 5JIHA 3ARPA 5AZEL 1X5FA 4JFDE 4PRAB 4WUUE 4QOKA 2FATL 2J8UA 3QRGH 2C1PA 2QBWA 4NKIH 1R5VB 3H42L 2F54E 1FDLL 4D9QD 4S1DD 1ORSA 5I18L 5ITFA 4J3SA 4KHTH 4APQA 1JHKH 1UJTA 4XPTH 3OPZL 5I16A 3CXDH 3BW9B 5FGCB 3SDCD 1S7RA 1NUGA 3ESVF 3P30L 3SJVA 5F7YC 3FFDB 15C8L 4R97C 4CJ0A 3MRNB 1LVEA 1FH5L 3C09C 5D1QB 3BHBA 4ENEC 4JAMA 1IM9D 1VPOH 2NR6C 5JOFB 1Z9MA 5GS0L 4Y1AA 1V7ML 1ZSDB 2D0HA 5AUMA 5F9OL 4IOFD 1SJVA 4NGHL 3CFEB 1CGTA 2XNAA 5LXGH 3QNZB 3VG0L 3WDHA 3HLAB 2X41A 4OCYL 4JRWA 4PV9B 3VFUA 4O2CA 1ETZA 4OT1H 3BIKB 2ARJQ 3MODH 2VAJA 4JZOA 4U1GC 3QCTH 2JELH 4QTHA 4XHJC 5EZJA 4HQQH 5GGVY 4MJIB 3HAEA 3RVXC 5C0DB 5MERB 1R3LA 3WKNA 2EYRB 5HI3C 3MBEC 3HMXL 2ICWA 3HZVB 3QDJD 3X3FL 1AC0A 3ZYOA 1TZHA 3HE6D 4P2OD 4M6OL 4ZDHA 1MRCH 2HT2D 2XWBA 3EHBD 1QSEA 1X6NA 5E24E 4NRXB 2IQAA 2A9NL 2WBKA 4U7KA 4G6AC 3U0TA 1J10A 5I9QB 4DEPC 2YR3A 5JHDB 1AQDB 4WHTA 5I30L 3I02B 4OQTA 1AGDA 5C6TH 1PY9A 4Y4FB 1FL3B 4ZOAA 3BYTA 1WAAE 1XGQA 4QRPB 2EZ0D 4NO5B 4N9GB 3F7QA 5EZLB 3O4LA 1QRND 1ZLVK 5IVZB 5F6HI 2W38A 3LS5H 2B20A 1MCPH 1AGCB 4KK6D 4NNPH 3ROLA 3O9WA 4ACPA 5JNYA 2MTPA 3H8NA 5C0CB 4KKCD 3VWKC 3HR5B 3N50A 4HK3J 1NFDE 3QUKB 4U31A 1K8IA 1QVOB 2DTML 2YBRA 1W2KT 4YX2L 5JW4R 4XAKE 2JJSC 1FV1A 2C3GA 1IQDB 4X0KB 1GGUA 2H32B 4GRLD 2WIIA 3HRPA 5DVKA 1IAOB 2W0PA 3O81A 5D71H 5EOCJ 4RQQB 4NCC2 1JWMA 1A8JH 4X5WB 2Y5EA 4KJWD 5IJVA 5MENE 3N06B 1I7RA 3DXAA 3GMNB 5DJYA 1KOAA 3ILQC 4PJ8D 1YC8A 4PJEE 1ORQA 4G3YH 2IBZY 1WZ1H 5FO8A 3X3GL 4J3VA 4GRWB 3QZWB 5L8LB 3RU8L 1WSST 1NJ9B 2AEQL 3BQUD 2AI0L 4TSBL 3TJEL 5KVGL 1MWAB 1T83C 2IAMC 3RZCB 1KELL 4P59H 4G42A 4LP5A 4NPYB 2J3SA 2C26A 4M03A 4R7DA 4UV4L 1R3HA 5F1NA 4M61B 4N0RA 3T0EC 3FRUA 3JVGC 4LHUD 4NJAH 5FECB 2R9HC 2IF7A 5IF0A 4X98B 3NFSL 5J3HD 3NTCH 5C0FB 1A6VH 2HWZH 1KGCD 3BWUC 3IDIA 1VHPA 1KJMA 1AFVH 1EGJL 4XBGA 1ED3A 1LO3H 1XF1A 5LQBH 3GNML 3OZ9H 4PP2A 2FEEL 1NDGA 1TETL 1U8MA 1URLA 4D8PB 3RTQA 1GH7A 2R8SL 4EBQH 2Q8BL 3GJFB 1U3ZA 4TNWF 4PB9L 4AY0A 3UZEA 1FLRL 1YDPA 3CLFL 1LILA 2AS5M 3O8XB 1E6OL 3ULVL 5E8EB 4DGVH 3HNTL 1A3LL 2Y1VA 3D87B 4AH2B 5I1DA 1GJIA 2YHGA 3LMJL 3T2PA 1KBGL 3FQRB 5DWUL 1GGCL 3BH9B 2BRRL 3EOTL 2I9TB 5EOTA 3V6BR 3MGOA 3S36X 2F58H 1ACZA 3O3UN 2MPAH 3L3HB 4KU1A 3WDJA 1F4XL 1F4YH 3QSKB 3SE4C 3CVHA 3O11B 2B0SH 4WNQB 2H3NB 3LQZA 2BSED 4OZIB 4ODXB 5C6WH 3JTSB 1R24B 4N8PA 1JWSA 2GHWB 1ZANL 1GOGA 3K2UL 4LIQL 2P44B 2ZJSH 5E56A 4UT7H 1FYTD 1NCWH 3WNLA 2VAAA 2OLDA 3FKUS 2Z8RA 4YIQA 3U30B 4W4OC 5ABDE 2NR6D 4LNRA 4U3CA 4LFHD 1QA9B 2Q3AA 4L3ED 1CFSB 4JANB 2RAMA 2PYFA 2B1HH 2OZ4L 1J1PL 4JFFB 2W65B 5CIPH 1Y6NR 3C08H 4MAUH 4OCSH 5MEQA 1J8HD 2YOCA 3MA7B 4DAGH 4RX4A 4U49A 4XHJD 4ZOBA 1CWVA 4L8SB 4XMKL 5D1XA 1QFWL 3VXUD 5HI3D 3MBED 4OI7A 4YO0A 1BMGA 4Y19A 4ZQKA 1CU4H 3L7EB 3UPRA 4FQIH 2G60H 4JFEB 1FVEA 5F7DA 4P9ML 3CFDB 1IC7H 4MZ3A 3MRDB 1BZ7A 2DWEA 2YMXH 3GO1L 4G6AD 4LCWD 4XH2A 4PJGA 4BUHA 5CZVL 4JRXA 4BKLA 4K94C 4Q74A 2AVGA 4OZGB 5GRWA 3QISA 2VQ1A 2BNRA 4PR5A 4QYOB 1JNHB 4LCYB 4OFKA 4M1DH 1OTTC 4M02A 4U05A 1K4DA 3H7LA 3PP3H 3H3KA 5C6PB 35C8H 5TH2A 5D7IB 5EU7C 4CAGA 4ZNEE 5CWSA 1WT5A 4KK8C 2ICEB 3VFSA 4DCQB 5J8OA 2V17H 3GHBL 1XCTB 5L2KA 2RCSH 4RBPK 5E2WL 4J4PC 2V2XB 4EZMA 5JUEH 5EUOE 2MQ0A 4Y89A 1PW3A 3VWKD 3KXFE 3PUCA 3MLRH 4NQUA 1UM4H 4U0QB 1EUTA 5BW7C 2Z93A 2NX5D 2DYPB 3T0WA 4MD0A 4XVSL 4NO0A 3VMNA 3CU1A 1K85A 4Z7UB 5HHNB 4FQXA 5FYKU 4IRSB 1Z3GH 2HLAA 1DANT 1WT5C 2UYLB 3MRMA 3BE1H 1LD9B 5H8DA 2CGRL 3HC0A 3H9ZA 4HIIB 4JVWA 3IF1B 4JFHD 2VTFA 3ILQD 3X12B 1HDMB 4YLQT 3MJ8A 2YUZA 4U1NB 4YHMH 4LVOB 4X9GA 2NTFB 2I60H 1L9NA 1N64L 5EWIH 2PW2A 2VLKD 4K94H 4RA0C 2IAMD 4PJHB 3O6FB 1KIPA 4Q2ZB 4EUPH 3WFBL 1F00I 4BSWB 3FMGH 1MWAL 3MXVH 1W8OA 4S10A 4JFQA 1KTRL 3VXRA 4HUVA 1CXEA 3T0ED 2PCPA 1GSMA 2R9HD 3DX6A 2W60A 3FFCA 3MNZB 3QO1B 2Y25A 2YPKA 5DI8B 3SE8H 1DEDA 4OF5A 1ZGLP 4HIEA 5ACZB 3FO9B 1NCBL 3BKYH 3S4SA 1BOYA 5D1ZB 4D2NA 1YNLL 3PQYD 4WEBL 3U2SB 1G9EA 1Z5LB 2A6IB 4NRYA 5I66B 4NYLA 4I13B 1NMCB 1MHPH 4I1NB 5EDXA 1HOCB 1FC1A 4JFYB 4WI6A 3TPKA 4ZPVA 5HPMB 5K9KA 2P5WD 1I8MB 4U1KB 4QEGA 4K3JH 4YHLL 3GHEH 1JYVA 3F7YB 4JHZA 4Z8FH 4DGIL 2QSTA 3MLXL 1T7WA 2FZ3A 4H88L 1A5FH 4LARH 3EYUL 2IANB 3VGHA 3UTQA 1A02N 4R26L 3X13B 5E8OB 2GITA 1BPVA 4G8EB 4XPBL 5J6GA 2YS4A 3CFKB 1RU9L 4KWUA 3CDGB 3T0XA 1KPUA 3RWEA 4FTVE 2FNBA 3BDYL 3RNKA 2WUBH 3P3YA 1B3JA 3RA7H 4JFPB 1K2DA 3ZE1E 3CVIL 2YPLA 5TE4H 4WDIB 3UO1H 3JBG7 4I48B 4X4XB 4LQFH 5HY9A 3MRQB 1N5YH 2MHAA 1NAMH 5HHOE 3RIFF 3H2WA 1RHHB 3D85A 4XC3L 3LDBC 3LIZL 2A6JA 3ULVE 4RFNC 2BOBB 2UZXB 3EDJA 3CUPB 2Y06H 1S9VA 4XMPH 4GKNB 4Y5YB 4P2RE 3MJGX 4PGJA 3GI9H 2QHLA 3NACH 2EYTA 4X9HA 3IGAA 2HFEA 1P84J 3D39D 5GS3A 2O5XL 4M6NH 5HHME 4KZDH 4ZUSA 1J0HA 1FO0H 2HJLB 2FO4B 2CDFA 4E42B 2FDBP 4Z7VF 5DUPH 2P24B 1QBML 1L0YA 2R1XB 4RWYH 5F9WB 5M94B 3CSYA 1J12A 1YMMB 4QRQA 4Z7VA 3VW3L 4OFDA 5DMGC 2ZUQB 4FFYL 1ZE3C 4PG2C 5C0IA 4DVBA 3S5LA 2A6KA 5GZOC 4P5KB 4LIQE 5T3XL 4ONHA 4QF1B 5FGCE 2V7NB 4HDIA 1QBLH 1P2CB 5I1AA 1U8IA 2H26B 4M7KL 5ESVA 1A7RH 4PJ5B 3ZKXC 4XP1H 5F7NC 3U1SH 4ODUA 3Q48A 2X4UA 2DLIA 3ILPB 4GQPH 3IAPA 1D5IH 1TCRB 2QKIB 3B3IB 3LV3B 4JCMA 4MXWL 2A1WL 5IVOA 3SE9L 2JB6A 4YHKL 4GAGH 4RGNB 4DZ8A 4M7JH 3ULUL 1OTTD 3JWDL 4JGMA 4P99A 2Z31A 3WIFA 5DQJA 1LQSR 5I0ZA 2D7TH 2DMCA 4P9HL 1KJVB 4FQCH 2DAVA 4ZFGH 5MENA 4OSUL 4KK8D 2W9EH 5ESQA 1MI5B 4MJIE 1K5NA 2F74A 2P46B 1Q94B 5FYJD 1JHTB 4NC0B 4J4PD 3IU3B 1NCAH 2CK0L 4Z7WF 4L1HA 4BELD 3V9FA 5EN2A 3N1GC 3IFOB 2DM4A 5GS2H 3BSZH 3VCLA 3GK8L 3ZDZE 1IGYA 3OKNB 1M7IB 2F9BT 4Z7WA 5CEXA 2DWDA 1C5BL 5D2NA 4D9RD 2OJEA 3B9KA 1ZGLA 2MOVA 4U4BA 5JHDE 3VWJB 4AIZA 3IRZA 4KJPC 1BGXL 4EVNB 5F3HB 4K3EL 4YPJA 3DYPA 5IHZB 2CDGB 2H9GB 1KPRB 3HRZA 4DQOL 5CCKL 4N68A 4QRPE 1OF2A 1D5ZB 1QNZL 5F21B 1I8LA 4ZO6A 3IXTB 2KUTA 2E7MA 4MYWB 1UB5B 3FB8A 2C9AA 3ZT5A 4O51B 3GKWL 1UM5H 4MAYB 2FGWL 4J6RH 4Z76A 1YN6A 4P2QD 3AS0A 3B9KC 4FXLA 1XIWD 2A74A 2NY7L 5HHPB 5C0CE 1G7JA 4PLJC 3U46A 5F71A 3QEQD 5EU5A 4IRJB 1MF2L 3MREB 2X70A 1ZVSB 4IIQB 1U8KB 2CUIA 3CD4A 1I8LC 1WIUA 3OJMB 1NQBA 1SYSB 3WLWC 1S7SA 3PWPA 3DJ9A 3O45A 5BV7H 2VUYA 2R0ZH 5JMOC 3SKNB 3VJ6A 3QUMH 2QHRH 3TWCH 2BDNH 3RZWA 4NQED 5KZCB 1FJ1A 2N56A 4PJIB 4TTDD 4XCFL 5GRVL 4L8CA 1GGTA 1HHGB 4FFZL 4A2MA 4K7FA 2VZSA 1KJ3L 1G7HA 5KS9B 4G5ZL 4GRWE 2HRPH 3LB6C 4ERSL 5FEBA 4Q6YA 1U9KA 3MLVL 1YYLL 2FB4H 1TDQA 3EOAB 4CW1B 2VLJA 4MS8C 1MJ8H 4O5LH 4JHWH 5IEHA 4GBXB 3LN9A 4F58L 4OI9A 4KTYA 3TNMA 3U4BH 4J12A 2CLRB 3V6FB 4YR6B 3QG7H 1GPOL 2LVEA 4JFDD 4WUUD 2DQCH 4HKZA 3KDMB 2D7PA 5KG9A 3M17B 3V5DB 3WHE1 5GGQH 4F7CB 7FABL 5DK2B 4ZYKA 2F54D 1FFQA 1NBZB 2HKFH 2GJ6A 2N7AA 2IPUG 3JV0A 1LP9F 3FZUD 1AIFB 4UBDD 1UCBH 3Q1SH 3V0AC 5DRZB 3I3EA 4M8QA 1MNUL 3NCJH 3CH1B 3DV6B 5FO7B 1AD0A 1LP9A 2DD8H 1O7VA 3AREB 4MNQB 4PV8A 2CMRL 1HIML 1CL7I 5I1KL 2ZCHL 4MB4A 1M1SA 4RNRA 1JE6A 1FIEA 4I0KA 4L5FL 1G7QA 3GZKA 4OZFH 1UJ3B 4R90L 3KJ6L 1FAIL 4MXQD 4XNMB 5DHYB 1YEFL 2WK2A 4M7LL 3QA3A 1QHPA 1IGFL 3OG4B 2A2QT 3LEYL 3TZVB 1JPFA 2CJUL 4BFGA 4O02L 4WI5A 3VE0B 4UTAL 2CKNA 5DMGD 1WWWX 1N6QH 4MJ5A 5T5FH 4QXTA 1D7FA 3BPOC 3BPCA 2YRZA 4OLUH 1YQVL 4OZIE 5GZOD 3KGRA 4EDXA 4S0TD 4HWUA 4DN3H 1JGEA 1T5WB 5IR1B 4MXVE 5D7KD 5DZOA 2CR3A 1QRKA 1RJCA 4DKAA 1C7SA 3Q6GL 4KV5F 5GS0C 3FOLA 2Y7QA 3BP4B 4HIHB 4AENB 3HMXA 3ZKQD 4H5SA 4CMHC 1QLRA 3QI9A 1Q38A 5I1EL 5DVOA 4F15C 4LOUC 4PRPB 5DUBB 5I1JH 5IBTH 2ATKA 5HYSB 4LAQH 2R4RL 3V4VL 1A7NH 2FWOB 1SM3L 3H9HB 3QPQC 4JFFE 3G9VA 1H3UA 4HS3A 1NGYB 4S1RL 3VFOA 1E4XI 1NGZA 3P9WB 5IFHH 1IAIM 4HIJA 3BP6B 1VFAA 5FO9A 3QI9C 3TLRA 5F9JB 5T3XE 2FATH 3PE9A 4Q6IC 3H42H 3NPZB 1FDLH 5E4EB 2EDNA 2DDQL 5E8PB 3DO3A 3OJ2C 1VFUA 2VB5A 2X9WA 3QXTA 4JFEE 3BZ4A 1EFXA 4NBZB 3GRWL 4QO1A 3OPZH 1N0LA 2EDBA 1T7ZA 3R0NA 3P30H 4XNZB 3G5ZB 5EFIA 1F02I 1CLZL 4F7TA 15C8H 5GGUB 2VSDA 1FGNH 4QHKJ 1FH5H 1H8SA 4KJPD 4OZGE 1ULVA 3LKRB 3MBXL 3NVQA 4JLRB 3MV9A 3KPRA 1CLYL 3OKLA 5MEPA 1YPZB 1WFNA 4JDZB 5HI5C 1CICC 1VACA 2IADA 5F7EH 4CBPA 5D7IE 2VMFA 2PTTA 3VG0H 2R0WL 2H8PA 4MQTB 2VDMH 4V1DD 4XNXL 1KENH 4DKEL 4JKPL 1LK3H 3G08A 2X9XA 1UVQA 4LSTL 2NZ9C 4HKJA 3OXSA 1UT9A 4PLJD 2EDYA 1RIUH 2KQMA 4NSKA 4P2CG 4AQOA 4LRIC 2ITCA 3DUSA 1FNFA 2HG5B 5A16A 3GUTA 5JDJA 4Z7UE 4H25A 3KPPB 4M6OH 4Y8AA 5ISZA 3WLWD 4HCRA 3QUYB 4JGUA 1KCVL 4Y8DC 4W81A 5E2VH 3C8KB 3B2UC 4MJ6B 4HX1B 5CJ5A 3IDJB 3KYKL 5HDLA 3MRFB 3CMOL 1EGJA 4Y7MA 1IL1B 1LMKA 1N5AB 3W9DA 3LB6D 4PJHE 5EO0A 1RZIA 3NCYP 1A47A 4J2XA 5I76B 3GMQB 5DEZA 2JCCB 1NGQL 4KUCF 3A6CL 4R7NA 3DV4B 5IUSA 4HS6B 2Q76A 1BQSA 4YPGB 2LU7A 5EO9B 2WV3A 2XWJB 5E0QA 5I17A 4L4VB 1FG2A 2XOTA 3WIHL 1UADC 3L5WB 1OGAB 2DTMH 1NDMA 2BFVH 5EZIL 1ND0A 3P4LA 1I3GL 4NT6A 3E6FB 3RRQA 1NGPH 1NCCL 2EICA 4ODVL 1S9YB 3ULVC 2Z35A 2P42B 4HJJL 3WL9B 1A1MB 1H9VA 2WINA 2IALA 4JDVB 1R5VA 4G6FB 4JY4B 4ELKB 3BN9C 2KH2B 4U6YA 1DQLL 3C9NB 1OARH 2IANE 1MLCA 3RI5F 2AEQH 2BVEA 5J57B 5IKCA 5DJDB 3SKUD 1T6WA 1KELH 4D0DA 4P46A 5BRZB 1QRNA 1INQB 1P4IL 1HHKB 1HSAA 3K4DA 2DJ4A 1MCRA 4UV4H 4G7VL 5KSVB 1NEUA 1NBVL 4XI5D 2BOCA 5HHQB 5I1GL 3RDTA 2OZ4A 4QGYA 3CZFB 2E7LA 3SBWA 3QIWB 1U92A 3D25A 2Y6SC 4LASL 3DROB 1RIVH 2DQTL 1DUYA 4XPFL 4Y16A 4ZUVA 5L9DH 4PRIB 3GNMH 3UEZA 4YHIB 3HE7A 5D1QC 1TETH 1VGKA 3MNVB 3C6LA 1EEZB 1MJJB 4EN3A 5MI0B 3SO3B 1RUKL 4LOUD 3CLFH 1JBJA 2JK5B 4DGYL 2E7LC 1KXVC 3ULVH 4PIRF 3G6AA 1NL0L 4M9OA 3BEWB 4ZD3H 3HNTH 4EQ2A 5CBAB 1M7DB 1G7LA 1OB1B 2PO6B 4TVPD 1B4JL 1YMME 5DK3A 2HH0L 2XV6B 1KBGH 5CHNB 5DWUH 4LF3A 1GGCH 2BSRA 3IJHB 4KTDL 5JHDA 2BRRH 3EOTH 3BFOA 4EN3C 4YXKH 4CVXB 1TVBA 5CMAA 4XWGL 4OF0A 4X9FA 4LHUA 4NNYA 1FFPA 3KXFD 3LHPH 1P4BH 3TH4T 1RUML 4N9GA 2LQRA 2BVQB 5E6IB 1S8DA 4HUUB 5J89A 3TP4A 2APXA 3N9GH 4RSVA 3AY4C 2ZUTA 1ZANH 4HHAB 1S7WB 4PJ5E 2VIRB 5BZDB 5I9QC 1KB5B 1D5XB 3K2UH 4PGDB 1BJ1H 4LIQH 1YECL 2BHZA 2BY2A 4M62H 5DJZA 3IT8D 1LO5B 3BKCH 4Y4FC 1DLFH 1UZ6E 2G5RA 1BHGA 1QVOA 1MCQA 5EC2B 5DJCB 4FQHA 3ZKSD 1CTNA 4OLYL 3WFZA 1LO4L 3SPVB 4RGNE 1X44A 2WQRA 5D96B 5HI5D 5HYFA 1A3RL 4GW1A 3QXVA 2QSVA 3C87A 1J1XL 2VDNL 3P4OB 4P3WA 3KYNA 4HULB 1QSFA 4MD4A 3VFVA 2K7PA 3PGDA 4LBEA 1MQKL 5L8JB 3MRIB 4I3GA 4X6BA 4WWKA 5DT1H 1CGSL 4EOWL 3VFTA 3O3DB 4KVCH 5C07B 4R8WL 1UACL 4ZFFB 5T1LB 2PKDA 3U6RB 2X4PB 1QFWH 1MWAA 2EDHA 1INDL 5IOPA 3L1OL 4HK0A 2RIKA 5IQ7L 3RVTC 1R3IL 3MCLL 1TZGL 4P9MH 3FQNB 4JN1L 4UIMA 4KZEH 2J1KA 4WWKC 3GO1H 1G9NL 2FJGA 5IW1A 5GGSA 4M3KB 3BD5A 4JB9H 4RAUB 3FT2A 5B8CB 3LKPB 1YNTA 1R6VA 3O41B 2IBBA 3CFBB 2WUCH 5IV2B 2IEPA 1VEPA 2FHBA 5SV3A 1ZGLM 5DFVC 5AD0A 4NUJA 1DEEA 5DEGA 5F6HJ 1P7QD 3LQAC 3S7GA 4K3HA 3SO5A 2YZ1A 2BXYA 1J8HA 8FABA 3BUYB 5DD5H 5E2WH 3QUZA 4OBSA 2AXFB 4FTVD 1E4XH 3R06A 3JTTA 5CEYA 3L3IB 2DQJH 5K9OB 2R2HA 4NP4L 4AH2A 4UIKL 2GFBA 2AKRB 2EH8L 4BSVB 4HXBL 4OFYA 3FB7B 5KSBF 1QHOA 2D4FA 2I9TA 1CTOA 4LLVA 4PJIE 2H32H 2CGRH 3TA3B 4HMEA 5JMRA 4H26B 3I6KB 1EVTC 3AUVA 5KSBA 5KS9E 4JJHA 3O8XC 1U8OA 5DUML 5GPRA 3REWA 5ANMA 3VFNA 1S9XB 4JN2A 1A6AB 1R3KA 4KXZH 4RMQA 4P49A 5IBLD 3EGSA 1CE6A 1TVDA 3GSQB 5HHMD 3ZLQC 1ZA3B 5CSGA 4G43A 3ETBF 3GMPA 4GRWH 3EYFA 3WFBH 3EIFA 2HT4D 3BP5B 3PWUB 1C5DB 5KOMC 4MA1B 4R0LB 3WMSA 3ARXA 3OWEA 5HGHB 1W0VB 1KN2H 4TUOA 3OX8B 5LGJA 3LQAH 2IWGA 3BT2H 4MGXA 5MEOA 4H1LB 3G5XB 3VRLE 4L3CB 3V7AE 3FO1B 2PW1A 5C8JB 2Y07H 9CGTA 3BPLB 1XF4B 1DDHB 2E6JA 4WGWB 4NZTL 3W9EB 2Y6SD 4X4YB 2UY6A 4MNQE 1NCBH 3ZYIA 1MJUL 2HN7B 5JPNA 1IKNA 4G6JL 1JZ8A 5D1QD 1U3HB 4X7DC 5EOQL 1CDGA 4AM0A 5E4IA 5C2BL 1HILB 1ZHBA 1XEDA 3O3AB 1H0DB 3GJFH 5DD1L 4H0IA 2XA3A 3EYSL 4CU8A 2ZOKA 1OM3L 3PP4H 4G9FA 1C5CL 2UUDH 2VLME 4H88H 4KDTA 1FZOB 1I1CA 2V6HA 3EYUH 3P9MA 3GSUA 4NDMB 3TFKC 3KWWA 4YFEA 3MRDA 1ZT4B 3ZE0F 3E6HB 4NBYB 1X5IA 2FIKB 4XPBH 1S9WB 1ZHNA 1QKZL 5IFJA 4D94A 4EI6A 5K9JL 4QHLB 1DSFL 4MJID 3BDYH 5C86A 2QR0A 5JZ7D 1QZ1A 5T1MB 1YY8B 4M3JA 1IVLA 1SEBA 3CVIH 2OQJA 4HFWA 1U41A 4P2YA 4F9LA 2DF3A 5D7IA 1XGYH 5DJAA 3IRPX 5HHVH 2G2RB 3Q0HA 4XC3H 2XZQL 3LIZH 1IZJA 3VH8G 3KPLB 4PRPE 2CQVA 5F1IB 1KB5L 3QIBD 4Z6AT 5I8KH 3QXDB 1MRFL 4Y4FD 3JWDC 2OMNA 4P4KB 5FA3A 3T8XA 4WHYH 3WS3B 1ZHLA 1LEKB 4P9HC 4CJ1A 4F9LC 3SN6N 4IRSA 1U91A 5GSVA 2NY5C 4NKDA 4LLUA 3TM6A 5E08L 1I1YB 1Q9WB 5CEZL 4DN4L 3STZA 3KLAB 1MY5A 3NZHL 4PD4K 2L4OA 2YWZA 1D9KA 1CDYA 3U4EA 1B88A 3RKDD 4F3FA 5IHUL 3C5SB 1FNEA 1MIML 1R5IA 3I50L 2VDLH 4NUGH 4DWHA 1MEXL 1T1XB 4D9LH 1UM6H 3RWDB 2H2SC 4UU9B 4IRSC 3PV6A 4GW5B 5T3XH 3SGJC 3ZDXF 4PG9B 2EC9U 4LPWA 3RVTD 4M7KH 3VGBA 5DS8B 4WHCA 4BFIB 1U58B 1M6OB 1D9KC 4PRHA 5KAQG 3IDGB 5BOZG 4TNWK 1YPZE 1I1FA 4JZJA 1YN7A 1H3TA 4LLAA 1WFUA 4FQ2L 2VE6B 3HPJA 5AAWA 3D39A 2P45B 2V2TB 1BBDL 3KNBA 2OBGA 1ZS8A 1CFTA 5F72S 3RZCD 1HK6A 2OL3B 3QJHB 4UOJA 3PWJB 3WEXA 5E8DH 2ZUSA 5ILTL 5I66A 5DFVD 3STBA 1KN4H 4P9HH 1NEZB 4JKMA 3PP3K 4XT1C 2QQKL 2IBZX 1RULL 4NQCA 1PLGL 2NY5H 3VU2A 2W0FB 2V7HA 1IARB 2NNAA 5C0NC 4FFWD 1ES0A 5IESH 1GYAA 4QRSA 4S1SL 1JI2A 1NFIB 5GIRB 5C08B 3V52H 3CSPA 2EDQA 3BAEH 1QACA 1J0IA 2VNCA 5D1ZC 1EK3A 2Q20A 2GEEA 3QPXH 1PDKA 1C5BH 2RGSA 1NMCC 3CFKA 1Q9KB 4QXGL 3QWOA 1XF2B 1K3ZA 1T1YA 4BYHA 4K3EH 4QRUA 2EXYD 2MSPA 1U8LA 3WUWG 5CCKH 2V5SA 1DBBH 1IC5L 5IVXF 3U48A 4DQOH 3O8XD 5SWZB 4I48A 1DBJL 3S34L 1QNZH 3N0PB 2R0LL 4OCWL 5IVXA 4X6FB 4NWUL 1HQ4A 2JCCE 3RWFB 1RHHA 3D9AH 4P3DB 2FYYB 4NWTL 3GSNA 1CD1B 1KCSH 3QJFB 5AEAA 2NY7H 4K8RL 2I25N 2F53D 2BNUA 4L4VE 1WWBX 4WU7B 1WBYA 5C0AB 2ADIA 2V2WA 1UWXH 4X5XA 5FF6B 1MF2H 3SKOA 4XP5L 1OGAE 2ITDB 3QIUA 2BXZA 4GG8A 3L3GA 1UKTA 1S9KC 1T0NB 1NBYA 2NY0D 3CAFA 1MVUA 2QEJA 4WVRA 5HVHB 1HH9A 3DSFL 4ZOEA 3VFMB 5FUCE 5FCUL 2VLLB 3C5ZB 1JZ4A 3QFDB 3LSOA 4AT6B 2WQ8A 4Y5YC 2VZOA 3NMEA 1BQHG 2I5YL 1P7KA 1VDGA 4FP8L 4XCFH 1YJDL 1X4ZA 2X5PA 5DRNA 4GRMB 3MYJA 5F9AC 3QIUC 1JL8A 1YEDA 4H8WL 1OP3H 2VYRE 1KJ3H 2YD6A 5D7LA 1KTLA 1X4YA 3I9GL 4WW1B 5C0JB 1T89C 3NFPA 3V7MA 5HD8C 1P2CA 1YYLH 3CX5K 5E9DA 4JFFD 4LCIL 5BRZE 3TN0A 5F9WC 1U42A 4X99B 1S5IH 1IMHC 4M48H 5DJ6B 1D6EA 1V3KA 4PJ5A 2ZUQC 1NLBH 3UMTA 2BZDA 2CIKA 1VESA 4OZ4B 3GBLA 2ADJB 3BRFA 1HNGA 4AJ0A 5T3XD 1Q9OB 2VDKL 1IEAB 2K7QA 2AEPL 3S97C 7FABH 1A1NB 2Y4SA 5GSRB 4MSWA 4P5TB 4YQXH 5A43C 5KSAA 2X7LA 1ZT1A 1AKJB 4PRIE 3L7FB 4JFED 1V3JA 1KJVA 4U6HA 1J1OL 2VISA 2EYSA 5JDSA 1C1EL 4HUMB 3S37H 2C7UB 1T66C 1HIMH 3MLTA 5I1KH 2ZCHH 4Y88A 3SDYL 3IU3A 3F12A 3GRWA 2XZCL 4E0RA 4L29B 5A2IH 4D0BB 4R90H 4ZSOA 4RGNC 4JHAL 1YEFH 4OGXL 3CNKA 3STLA 5I8CB 4HH8A 2EEBA 3LEYH 1T20B 4J1UA 4YHPA 3Q3GA 3UDWC 2GSGB 2CJUH 1HYRC 1BD2B 2FHFA 3V6ZA 4E9LA 2D7NA 5C1MB 1CE1L 2P8LA 4PLKC 1D5ZA 4LLQB 1UB5A 3KAAA 2DYPD 4JPIB 5EU3A 4ODBD 3DI3B 1FE8L 5FKAB 2H2SD 1ZTXL 1XR9B 4G6MH 1FZMB 5I8EB 3WLBB 3VWJC 3WFHB 4P0DA 4IMLA 2YSSB 1I8KB 3NIDE 2FECI 4PUBL 5LGHL 3CH8A 4IRJA 3ZTNL 1NPUA 3QFJD 4UV7L 3VFPB 1U8PA 2AQ2A 1FGVH 3HCVA 1IEBA 3EUUA 4FQQA 1U8KA 5CEZE 5IMLA 1TNNA 2ZCLH 3LKOB 3V4VH 4MAYC 2F5BL 4XC1L 5I1HL 2KZ1B 3O6FD 4OAWA 1HKLL 1WEJL 1KJ2B 4WUKL 4S1RH 2GCYA 4IRJC 1MAKA 3S9DB 2OL3L 1IGTB 1JV5B 6FABL 3CCHA 5C07E 5I2IA 4CNIB 3PHQB 4UMGA 1CLOH 5IM7A 3TIDB 5C0ND 2HKHH 5T1KB 3C2AL 2DDQH 3HNVH 3OAZH 2GSIB 1E28A 3K74B 4KY1L 3MCG1 4TNVF 2AJ3B 2CO7B 4C56A 3DSNA 1IGJA 5D1ZD 3S6CA 4LSPH 4QKXB 1HHHB 3NN8A 4D3CL 1LWRA 5ADOL 2IH3A 1J11A 4Z0XB 3MBXH 1YMHA 3MCKA 3SE3C 3PHOA 1CLYH 3OKEA 4KMLB 2H2PC 1OAYL 2YPVL 4GBXC 2HTKC 2IAND 1TZIB 2IGFL 3DURB 4PJBB 3GSWB 4Z7OE 4HEME 2I27N 2R0WH 2VR4A 3AREA 3G5YB 1I8IB 2VO5A 2A38A 2DICA 3BXNA 3H7BB 1QFUL 5DA4A 4FQJH 2BJML 2EDKA 4YHZL 2IH1A 4ODWA 2A73A 4ZFZB 4J3XA 4P57A 2IFFL 3O6KL 5DHVA 5I75B 4UNUA 1GCFA 1IGIL 3FOMB 1B0GA 1CFQB 3AREC 3MRRB 1OPGL 3N1QC 1WQVT 3QQ9C 1FVCB 1U8JA 3BPNB 4EI5B 1XGTB 3LD8B 1UJ3C 1F4AA 3GIZL 2P47B 3CMOH 1RZFL 1QQDB 5GGTL 1XGUB 3HFMH 2AK4A 5FYKE 3MLUL 1DLHB 3Q6FB 4C54A 1S7UA 4NQVA 3TZVC 5HD8D 1BOGA 3LZFL 4PJCB 1FL5A 2DLHA 1RZ8A 4V1DA 3A6CH 1YMMD 3F5WA 4XNUL 5L8KB 4X83A 5C0BB 1Q0XL 3ALWA 5MP6L 1A7QH 1H3XA 4XNYH 4PRPA 3QG6A 1UH4A 5GQBA 3RPKA 4F37F 2EKSB 1GRWA 4R4NC 3WIHH 4MA3A 5I1LB 3EFFA 2FWOA 4OLXH 3BP7A 3DETC 3HG1B 2BSSB 3PHSA 5EZIH 2BCKA 2AABL 1U93B 5DYOA 1I3GH 2Z91B 1NANI 2QQNL 3V5KB 5B22A 1MCNA 1NCCH 1N3NA 2E3VA 1B6UA 4TUKL 3VFRA 3JXAA 1A9EA 1T66D 5INCA 3B6SB 5J1TC 5EBWA 4CADB 4KPHH 5E8PA 2A77L 2X6MA 2PTUA 4DZBA 1RIHL 1GZQA 1DQLH 1NC4A 2WBJB 3M8OL 2Q6WB 1J86A 5LVEA 1W72A 3H0TA 1S78C 4U2YA 4R6UA 5TJWK 4JPVL 4L3AA 3T2QA 4DTGH 5GHWL 1KLGB 1FNAA 4ZFOB 2W07A 2K9UA 1P4IH 1CXHA 1N0XL 3ARDB 2GTWA 1MI5D 4JLRA 4G7VH 5DSCB 1DFBL 5E4EC 3WHXB 1T6VN 4NNXB 5DC9B 3VRIB 2OK0L 3FB6B 3LN4A 5T1DH 5E6ZA 4UT9L 3FONB 4PLKD 3P11L 4Y2OA 2MQ3A 4HFUH 4HD9A 3X14A 5DJ8B 4XNZC 4LASH 1NGXB 3LEVH 4UQ3B 2DQTH 2P5EB 4JO3L 4XPFH 4NOBA 3VWJD 1Q72L 2DQEL 1KTDB 3KS0H 4WW2B 4RAVB 3B9VA 2JIXB 5E94A 43C9B 3MJ6A 5IJKA 4QHNB 4BZ1L 2HG5A 4NCDA 2O61A 3D18A 5CUSL 4A6YB 4PY7B 3GIVB 1NL0H 1N2RB 3CDFA 4MAYD 4FABL 2BNQB 4TRPL 1KUMA 3HC3H 4PJAF 3UJTL 1DQJA 1B4JH 2XZZA 3OAYK 1K8DA 4RMUA 2HH0H 3C8KA 1Q9LB 2ZZUT 3BH8B 3IDJA 4HV8B 4UINH 2PXYA 3VXNA 4N8VA 1KJ2L 5E00B 3VG9C 1EHLH 4XWGH 3RAJH 4RISH 1ZEAL 1SYVB 4U1JA 1RUMH 3IDMA 3MLYL 1HWGB 1FIGL 3CFJA 2KQNA 2ADGA 2ZSVB 3QUYC 2R39A 1KXQE 2BY0A 4PGBA 1KIUA 2UZIL 1F8TH 1KB9J 2M1KA 1Z0NA 4WGVB 5DK0A 1L6XA 1BJ8A 5ID1B 1ZHKB 4HH9A 3RKPA 3WN5B 4WFEE 4JPKL 2HJFA 3CZJA 32C2A 4UAOB 1JNLL 2DQHL 4OLYH 3S35L 5D5MF 1LO4H 4ODTH 2FCBA 4I0PD 1T1ZB 4IBLT 4GBXD 2OCFD 1EERB 4NN7B 1OAUL 5DJ2A 5D5MA 2VDNH 1L0QA 2BVOB 2ESVD 4OJFH 5A40E 3ZYZA 1GGBL 1IC4H 5C09B 1RUPL 3MYZA 1G7MB 1PX4A 1TQCB 5HDQL 3H9SD 1RJYA 4JY4A 1MQKH 4ELKA 3G6DH 3AU1B 1CGSH 2IPKA 4EOWH 1CK0L 1EX0A 1Q8MA 3UBXG 4QOKB 5C08E 1D6VL 5JHLL 4JJ5A 2C1PB 3L1OH 5IQ7H 4PJFF 1HN1A 1ORSB 3FN0L 1ZLVH 5FUCC 1HHKA 1PAMA 3CIQA 2V9TA 4MNQD 2GK2A 4APQB 3L3DA 1HXMA 4PJFA 1S7RB 3SJVB 2IG2L 5SWZE 4KTEH 4GH7B 4Z78A 5HBBA 4JY6A 2XKNA 3AGVA 2VLRA 3BHBB 4JAMB 2I26N 1YYML 2LTQB 2VLMD 5BO1L 1L4IA 4Y1AB 4PRNA 3TZVD 4GW4A 1CDJA 2AXHA 5AUMB 5DRWA 3FCTA 1OTUC 5C0AE 2XNAB 5FA4A 1MHHA 3DX8A 4HLJA 4Y5VA 3P0VL 3VFUB 3UYRL 5DD3L 4L9LA 4LVHB 4O2CB 5K9QG 3CMGA 3QIWC 1ETZB 4R4ND 3NZ8A 1KNOA 5JR1H 4JZOB 3DX9A 4QTHB 4NP4H 5EZJB 1OB1A 1JGLH 5GZNC 3HAEB 3VXPA 2EH8H 1LE5A 5D2LF 1R3LB 4HXBH 5HDBE 1OAXL 4GQ9H 2ICWB 2V9RA 1TZHB 4X80L 2WM0A 5MI0C 5FUZL 3SO3C 4ZDHB 2XWBB 5D2LA 5JW3H 2B4CC 1QSEB 5BCAA 5GRUL 3VXOA 5DMYA 2IQAB 4L9LC 3O0RL 5CD5D 3CPLA 3U0TB 2ZCKL 5DUMH 1HEZA 4NQSA 5KSUA 4WHTB 1HCFX 2J6EH 2PO6C 1AGDB 1KXTB 5BZDA 2B5IB 3OJVC 1JPTL 2CD0A 1XGQB 2Y9RT 1KG0A 1S78D 5J13B 1P7QA 1NMBH 2PTVA 4N1CA 3O4LB 3W11C 4IHOA 5EC2A 3ROOA 4ZFOL 2R2BA 4XPGL 4KJQD 1DE4A 5E6IC 3ROLB 3O2DA 3O9WB 5JNYB 1RFDL 3FHQA 4G7YH 1ZT7A 2VKWA 1K8IB 3R8BB 2YBRB 3RX5A 2F19L 4FQPA 5KJRL 4QY8B 4EEEA 5ERWB 1JNJA 1FV1B 2OSLA 4NKQB 4G6JH 3O3DA 2WIIB 2LFGA 1IKFL 4RMRA 1ADQA 1PSKL 5IJVB 2FBJL 1MJ7H 2MFNA 2X4PA 2BVYA 4KRLB 4U1IA 2OJZL 4I2XA 4MVBC 5D96C 2VC2L 5DD1H 3DXAB 3NIGE 5DJYB 2O5ZH 5C9JA 1C5CH 2B4CH 2AQ1A 1ZA6A 1ORQB 5CINH 4A6YL 2DQGL 2CKBA 4CN4A 3PDOA 1RPQA 2QQLH 4PS4L 5ICYA 5KW9H 4P23A 3BKMH 1CF8L 1CFBA 1HE7A 1RSFA 4G42B 2C4FT 1J88A 3J8F7 3MJ9H 1DSFH 4R7DB 4FFVC 1HNFA 1R3HB 5F1NB 1A14L 2FSEB 4HUWA 1ZLUH 3BMWA 3FRUB 5DMJB 3W0WB 4HBCL 3G9AB 3WD5H 2FIRT 2B8OT 5IF0B 4JPWL 4PLOB 5DXWA 3CFCL 3QUYD 3IDIB 2IFGA 4MQXC 1KJMB 4CRPA 2XZQH 2H1PL 4XBGB 5DO2C 1MPAL 4AG4L 1I85C 1EDQA 3P73A 1MH5A 1KB5H 4PP2B 2R4SL 1MRFH 2OR9L 5B8CC 1NDGB 1U8MB 5K9OA 3RTQB 1AY1H 3F7PC 5F3BB 4BQ6A 1G6RL 3HMWH 5CP7A 1FVDA 3RI5K 5E08H 1F42A 5CEZH 2MMXA 4M1CC 1FZKA 4NHCH 4KUZL 3AS2A 5I1DB 4XMLL 3HA0A 4L4VD 5IHUH 2ARJA 1MIMH 1XAUA 1S9XA 5JXEC 3I84A 5EOTB 3MGOB 4KJYA 1HZHL 3OBAA 5BS0A 4MLIA 3VI3E 3SGKC 4J3TA 5I1IH 3CVHB 1C5DA 2LU4A 3KPSD 3TA3C 3LQZB 2X89A 4RBPH 1KEML 1A7BA 4G6FD 5FV2A 1G0YR 1JWSB 1P4LB 1FCGA 3JUYA 3QIBA 4N8CL 5JW5B 1DVFD 4OUOA 4W70A 2ZSWA 3S3JA 1EV2E 5C8JA 1S7XA 4ETYA 4K8RC 3U9PL 2D2OA 2VAAB 4W6YB 3MFFA 4PJBE 3V8OA 4YIQB 5KVMC 4LNRB 4X7EC 3SCMA 4MA1C 5BRZD 1NUNB 1MCOL 2VKXA 5DDHA 3SOBL 1IFHL 5ILTH 1S7TA 2PYFB 1OTUD 4JO4H 3PWVA 2QQQA 5B38G 3ME0A 3H3BC 3IFNH 1OP5K 5MEQB 3BPLC 1EPFA 3QIWD 4R2GB 4S1SH 4NQDA 2CDEA 4WHDA 1YJDC 2Q7NA 4I5BA 4PRID 4H8WC 2R1YB 5D1XB 3RBSA 4O2FA 1KSRA 5KBNC 4OIIH 1WZLA 1S3KL 2FIKA 1U3HC 3IKKA 4CVWA 2ZOLA 4YO0B 2EO1A 1I75A 4QXGH 4ZQKB 1JPSL 3QHZL 4QHLA 1TENA 3UPRB 4ZUTB 1FVEB 5F7DB 1S7QA 4YXLL 5T1MA 2XZAH 5IROA 1IC5H 1BZ7B 2DWEB 3S34H 4XH2B 4B7LA 4PJGB 4XCYA 1OCWL 3K8KA 4UILL 3OR6A 3SDXF 2R0LH 4PJCE 4NWUH 2PO6D 3UTTA 2VQ1B 2BNRB 4HLZH 4NWTH 1GC1L 2DOCA 5C0BE 3D0LA 3SDXA 5FYKH 1I3RA 3ALXA 3KPLA 1K4DB 3NCMA 4K8RH 5F1IA 3TBWA 1AGBA 3QR2A 1T7XA 1TIUA 5TH2B 5IEKA 1BEYL 5DQ9A 1EO7A 5CWSB 4XP5H 4Z95L 2EKJA 3DNKA 3KYMB 3HG1E 1LEKA 3SGDI 1TJHH 3VFSB 4BFEA 5L2KB 1CBVL 4RRPG 2VITB 4HPOL 1DJSA 2DQUL 5E6ID 4K3DH 3DBXA 3OB0K 3WJLA 1AR1D 4MMZC 3DSFH 4H1LH 5CZXC 2Z93B 1VGEH 4PTTA 1RMFH 4MD0B 4NO0B 5H2BA 3GMOA 4FQXB 43CAA 3VRJA 1AE6H 4P4KC 4FP8H 2HLAB 4I18A 3MRMB 4XCCH 4POZC 4H8WH 2X4OA 1H8NA 1UZ8A 3KPMA 3NIFE 3HC0B 4HXAH 4ISVA 5GS1A 2JE8A 1NUDA 4MVBD 2HLFD 4KC3B 4F9PC 1RJLA 3DMMD 3PWNB 3MJ8B 3JSSA 2UUDK 1JRHI 1AO7A 2F53A 1FC2D 3NCYS 3FB5B 4F80A 3O2VL 1KIPB 2AERT 4GKOA 3ARFA 2VDKH 1F3DH 3E2HC 5C71A 2AEPH 1FL6A 4F8TA 4AEIH 4JFQB 3NA4A 3VXRB 4Y4KA 4HUVB 2I24N 2P5EE 4KH2A 2PCPB 1Z9LA 3OHXA 3DX6B 2W60B 3FFCB 4KKNA 3P9LA 1HINL 2YPKB 3TO4A 1J1OH 1LE9A 3E1F1 4MQXD 1OSPL 4HIEB 1G7PA 5DO2D 3MOAL 1GAFH 1MCHA 3S4SB 3SDYH 2X9YA 4M5YL 3L3OA 4NRYB 4OCLC 4NYLB 2AJUL 5C08A 1WISA 2QV2A 1IBGL 1UYWH 2BNQE 5B39A 4OGXH 5K9KB 4ZPVB 4WRLA 4CKVX 3D48R 5BMFH 1K3IA 1QTYT 2YD4A 4QRRA 2QLVB 2VOTA 2GJZA 4HKXA 4EUPG 2FZ3B 4M1CD 4L1DA 1OQOA 3JV5A 3HI1A 3MZGB 4WO4A 1NC2A 3UTQB 4HIXL 2DL9A 1CE1H 1EXUB 2GITB 5BZWA 2ZUXA 5BXFA 5J6GB 1W8NA 3AMKA 5JXED 1KPUB 3RWEB 3RNKB 3EOBA 4MWFA 3RWFA 3A6BL 5E99H 3VD7A 5GGRB 3TVMA 1FORL 1ZTXH 1K2DB 2IQ9L 1JFQH 2YPLB 3BKJL 2ZKHH 2J88L 4K9EC 2H6PA 2VL5A 4PUBH 5LGHH 1P6FA 3TA3D 3ZTNH 1WICA 5FF6A 5TQ2H 4AK1A 2VXTL 3MROA 5SWQA 3D85B 2WWKO 3IJYB 4TSAH 5ADPL 1P53A 5EZOL 4G8GD 4HJ0C 2DMBA 3LPGA 5BJTB 2UWEF 5FYKD 3SY0A 1S9VB 4CU6A 2F5BH 3HI5L 3VFMA 4XC1H 1MCEA 1UG9A 2VLLA 1IAIL 2ICCA 4EXKA 1M7XA 2UWEA 1HKLH 1WEJH 3AM8A 4LCUA 2JF1A 5C09E 3P0GB 4RFOH 3IGAB 2HFEB 3VXSB 3VDBA 3I6GA 4ZUSB 2CDFB 2OL3H 2P49B 3BGFB 3BMVA 3U0WL 3T3ME 1X5GA 4QOKE 4WW1A 3WNKA 4QRQB 4Z7VB 2EO9A 5HVHC 4PJ7F 1JYNA 5EH1A 5C0IB 3C5ZC 4DVBB 5SWSA 3T1WA 3S5LB 5SX4H 4PJ7A 1UB6B 1LO2H 3V8CA 3L5HA 1AR2A 4ONHB 1YEJL 1U3HD 4LPTA 4HDIB 3UBXI 5I1AB 2DI7A 1KYOJ 3H3PL 3SJVE 1U8IB 5ADOH 2NW2A 4CGTA 2XRAL 4KHXL 5ESVB 3CFIC 4GG6F 4K9EH 1BQUA 4YHNA 4URTB 4QXUL 4Y1AE 5CJXA 1KV3A 4ODUB 4GG6A 5TF1L 2VXUL 2X4UB 3VD3A 1LEIA 3S8WA 2NXZB 5TE7H 2FD6L 2JB6B 1HXYB 4ZXBB 3ZTJH 5T33L 4DZ8B 4YUEH 2Z31B 3WIFB 4DVRH 1TXKA 4U6TA 5DQJB 1ONQA 4L9DA 4BH8A 2BJMH 2R29H 1HHIA 1FHGA 4ZO9A 4P5TC 5MENB 2XQYK 4XXCA 2IMNA 1K5NB 5I8CA 3RPIA 2F74B 4KDVA 3F6LA 2WLZA 3WS6C 3PDDA 5EN2B 3FO0L 2R69L 1OPGH 3AAZA 4BQCA 5C0RL 1QSEE 5CZXD 3VCLB 1E4KC 1IGYB 5K9QI 3NCCB 4Z7WB 5CEXB 1OVZA 2DWDB 2UVEA 5D2NB 2OJEB 1ZGLB 3MNWA 2YA2A 4P4KD 4K23L 3MUGA 1H8OA 1RZFH 4AIZB 5GGTH 4POZD 5GRVK 3WUZA 5BOPA 3L3KA 3MLUH 1Y18A 3WO4B 4AEHH 1DN2A 3HRZB 1U8HA 1CFVL 2HAZA 4F57H 1OF2B 3LZFH 2ATPA 1XFPA 5GRXG 3FB8B 3O4LE 1Z2KA 4KKLD 4Z76B 1Q0XH 1YN6B 3TJHC 5MP6H 1PEWA 1VFMA 4GKSA 1I4FA 5IFAL 5ALBL 2A74B 2AV1A 4S1QL 1RUAL 3U36A 5ID0A 1G7JB 1YEEL 3U46B 1EHAA 2X70B 1TJIL 2RBLA 4I4WA 2AABH 4TULL 1X7QB 3OAUH 4HWNA 1LHZA 2QQNH 4M1GL 2ERJB 1S7SB 3PWPB 4OD3H 4XTRC 4TUKH 3O45B 2X40A 3W2DH 1MAJA 4OM1L 3VJ6B 1DBKH 4ZS7L 3DXAE 1FJ1B 2A77H 4L8CB 1H15A 1F6AA 4K7FB 1WTLA 2W59A 1DBML 1G7HB 2KBGA 4ZAKB 2VDRH 5IP4A 4JPVH 4YBLC 3GMLA 1XGPA 3I75A 1N0XH 2VLJB 3QUXA 1OOAA 2ZG1A 5IEHB 4HGWA 3MMEA 1T22A 1DFBH 3K81A 4MLSA 3TNMB 5DURB 5EUKB 4WI4A 1I3UA 4NZRL 3W0WE 1IJ9A 4UT9H 1CGVA 3P11H 4HKZB 5KG9B 3OR7A 3G5YA 4ZYKB 1T80A 4JO3H 2GJ6B 1FG9C 2EDTA 1Q72H 3UC0L 4KDWA 2DL2A 1IGCH 4FOMA 3PIQA 1H3VA 2CUHA 2KDGA 4PGCA 4M8QB 1HKFA 1YEGL 1AD0B 1LP9B 3NH7L 4PV8B 3VI4E 2MCPL 3X17A 1U0QA 4NFCA 4OLVL 2P43B 4JG0H 4RNRB 4UI2A 2NXYD 1G7QB 2OXGA 5EOCL 4FABH 3KJ4B 3EYOB 3PGFL 4LMQE 1AI1L 3QA3B 4HUKB 5C0AD 1KJ2H 1QO3B 2OR7A 4GXVL 1FP5A 3WSQL 5FK9A 2X1PA 5FGBC 2FJFA 1JRHH 1DLHA 1XCQA 2X4QA 3Q6FA 5I75C 1CDIA 2ENSA 3K80A 5D9SA 2GYSA 1FIGH 2NTSP 1WUNT 2ICWI 2WIMA 4QXTB 4WV1A 3C5ZD 1INEL 5DEFA 3EYQC 3BPCB 4KI5F 5AG9A 1I9EA 5E5MB 2NY6D 3BPNC 4EI5C 4EDXB 3LD8C 2UZIH 3W5MA 4GAYA 1JGEB 2B2XH 3EDDA 2EKSA 3DVGA 2O93L 1BZ9A 4YDVA 4JPKH 5ITBH 1B0RA 3QH3B 3FOLB 4KAQL 5KOVC 5JIPA 2VDPH 4OZFG 1JNLH 2DQHH 4H5SB 3ZO0A 1QLRB 4L8DA 1GL4B 2AGJL 3QI9B 3RVUC 4OLEA 4MB5A 2ATKB 1OAUH 3MV7D 4MQSB 1PVHA 3NAAL 4PP1C 4M6ML 1WC7A 3SDDA 4DOHB 3V0WL 4HS3B 5I8OL 3DRTA 3B6SA 3GI8L 3RFZC 1IC1A 3VFOB 3HB3D 1NGZB 4N0YH 4XPAL 4DKDC 1MY7A 1CK0H 5IBUB 4HIJB 2APFA 4X7FC 1D5MA 1VFAB 5FO9B 4YK4B 4P5TD 5EU6A 5F89A 5JHLH 1D6VH 4JCLA 4WY7L 4OUUA 2X09A 3T2NL 1AKJD 4J7RA 3MXWL 4RZCA 1T3FA 1XF5A 4ZFOA 3FN0H 3UJJL 5KN5A 2FHCA 5FM4A 3O4OB 3SDDC 1EFXB 2RR3A 1PD6A 5LBSL 3D3VD 3H6JA 5EFIB 2IG2H 1UA6H 2I9LA 5HDOA 4F7TB 2XTJB 4PJGE 5IW3A 2YK1L 5D6DA 2WBJC 3SQBA 1RZ7H 2ZG3A 5J1SC 4WFFD 1NGXA 1YYMH 2BNRE 3KPRB 3MV9B 4F33A 3M07A 3OKLB 2Q8AL 1WCBA 5BO1H 4XCNA 1LK2A 2VDQL 3ARDC 1VEOA 2Q1EA 1BD2D 1VACB 2IADB 2JIXA 43C9A 1CZ8L 3EZJB 3RGVD 5BVJA 2PTTB 2H8PB 1RUQL 3BVNA 3TJHD 4OCXH 5B3JF 3G08B 5CBEA 3UYRH 5L2KE 2GTZA 2XIDA 3C2SA 5DD3H 4LSQL 1JF5A 2V9QA 4HKJB 3OXSB 2R0KL 2CXKA 1ODAA 1OL0A 2BNQA 4X6DA 5ENWA 3IVKA 2ITCB 3MACH 3DUSB 3RY6A 1FN4A 2JTDA 4NQXA 4WW2C 2AK1L 5A16B 3GUTB 3TCXA 2AXGA 1A2YA 4H25B 4JQXC 4FHBD 5ISZB 5A2JH 5GRUH 1SYVA 3GSOA 3W81A 2COQA 2O5YL 3O0RH 4XVTL 3IAGC 1VCAA 5IB1A 2ZCKH 4MDIB 4PJXA 2UV3A 5GJTL 5A1AA 2VQTA 2XN9D 2JKXA 4N0CC 2YN3A 3LN5A 2E8YA 1G1YA 3N85L 1JPTH 4Z7QF 5BVPH 5C7XL 3W9DB 2HP4A 4OKDA 1K9TA 1AD9A 5EORL 5ID1A 3K8LA 5EO0B 1UFUA 1RZIB 3MLWL 1C12A 3QCUH 1RZGA 3P2TA 4MA7L 1G6RA 1I1AA 4R7NB 4FG6C 1JJUA 4XPGH 4Z77A 3VXRE 2Q76B 4R9HA 5T1KD 3T4AA 4KK9C 1L7TL 1FG2B 1T1ZA 1MFDH 5HSFA 1J0JA 2NW3A 3FFCE 3IDYB 3S37X 4U1HA 3TV3L 4UNVA 1NDMB 5IWLC 3IU4H 4XVUC 4JHBA 3WN5C 4KQ4H 4LSVH 3U4AA 4TPRL 3QDHA 2X42A 3AU1A 1I9JH 4NT6B 4UAOC 5FGSA 2L7JA 2Z35B 2FBJH 5DJXA 2WINB 1PG7L 2OJZH 2CRYA 1DQDL 2IALB 4NN7C 5FOBA 4LDLB 4A6YH 2DQGH 1BWMA 1AJ7H 4U6YB 3MRPA 1TQCC 1FBIL 5I15H 1SMAA 4PS4H 2XA8L 3ALPA 1MLCB 1V05A 5IKCB 1CF8H 4D0DB 4P46B 4FQLL 1M4KA 1QRNB 2X1WL 4YE4L 1BM3H 1HSAB 3WNPA 4ZUUA 3IJSA 4HBCH 2CIIA 1YEKL 2BOCB 3D69A 2YPLE 2FLRT 3RDTB 4JFZL 4U1LB 4BUGA 3CFCH 4APQC 1MSPA 4U0RB 1U92B 4YDKL 3D25B 4PTUA 4EI5D 2G9HA 4AG4H 2H1PH 1T1WA 1DUYB 4Y16B 4ZUVB 2R4SH 2OR9H 3HE7B 5CJ8A 1VGKB 3C6LB 1RURL 2LTQC 5F7HA 4WFGE 3TPUA 4BZYA 4EN3B 5GRZA 3RVUD 3VXSE 1Z9SA 1EJOL 4FMFA 1JMZA 3G6AB 1AGFA 1T0MA 5EG6C 4RMWA 5DRXA 3QQ4A 1C8PA 4KUZH 2ZWLT 5H35A 1G7LB 4PP1D 5HYEA 4LVHC 3WIIL 4Z7VE 5FYLD 3NA9H 4LF3B 2BSRB 2ZPKL 3T0VA 3HG1D 4GXUM 2AEWA 3EYVA 1TVBB 5CMAB 3TESA 4LHUB 3W39A 4JY5L 4NNYB 1FFPB 1F90L 2ZUWA 5CKAA 5TE6H 4UDUA 5EIIB 3RQ3A 4Y2DA 4QT5A 1S8DB 3UAJD 2Y36L 1A6UL 1KEMH 3V6OA 5LAXA 5I1CL 1BVLA 4X7SL 1A6ZB 2NY1D 4N8CH 1GC1C 3UTZB 4WEMB 1BVZA 5DJZB 3RY4A 1ZLWK 4XP4L 5E6YA 3VXME 2B5IC 2WBJD 1QSZA 4NHUA 2VWEE 4FQHB 5J13C 2RFXA 4EXPX 4QY8A 5F7MC 5ERWA 1MCOH 2FH8A 3ARDD 1IFHH 4GW1B 5TFSL 3QDGA 5IB4A 3KYNB 1QSFB 4MD4B 5F93C 3O9WC 3VFVB 3PGDB 2A6DB 4LBEB 25C8L 4ZG1A 1H3PL 4X6BB 4WWKB 5IGXL 4NKOA 3VFTB 4M4PA 2LE9A 4OF7A 7CGTA 4QRTA 2P5ED 3HUJF 5GRJL 5AYUH 5IOPB 3MGAA 3KPSA 1SQ2N 3KLDA 3FAWA 5JORA 4HK0B 3KYAA 3HZMA 4LSSH 4MCZA 3HAEH 4Z7WE 5D2NE 1JPSH 1MCLA 3QHZH 5E5UB 2EE2A 4XBEH 1EAPA 1I9IH 4YXLH 3EO1A 5AZ2H 1DVFA 1TFHA 2FSEA 4I9WE 4QTIH 4UIMB 3W0WA 4HCRL 5HYJD 1OCWH 3AXLB 2FJGB 5IW1B 5GGSB 4HC1A 1KCRL 4N0CD 3RHWK 2VH5H 5L6YH 3FT2B 1MFEL 1GC1H 4XBPA 1YNTB 2FO1A 1T04A 3ARSA 4OQTH 3PJSA 1EH9A 1V7NL 1J8KA 1FNSL 5AD0B 4NUJB 1DEEB 5DEGB 1A6TA 2BVUA 1DCLA 4Z95H 3WKML 4XGZA 5F3BA 1BJMA 4FG6D 1CBVH 2R56H 1J8HB 8FABB 4HJGA 4HPOH 1X5KA 4KK9D 2OR8A 3QUZB 4ZODA 1MFCL 4PLNC 3R06B 4NM4H 5AWNH 3JTTB 5KVEH 5CEYB 3PWPE 1F6LL 2R2HB 3SDAA 2GFBB 4R4FH 2AJVH 1A21A 1CGYA 5D7JD 4DFHA 5LWYL 5HGBA 3RTQC 4LLVB 3MV8D 3MPCA 1DQML 1HSBA 5KSBB 3MOBH 4KKAC 2MNUA 1U8OB 4XP9L 4HWEL 2JJUA 1J7VR 3A0OA 3REWB 5C70A 5ANMB 3VFNB 2ID5A 4JN2B 3VGEA 1R3KB 3NFNA 2VLJE 3EGSB 1CE6B 4R3SA 1A6WL 1P4LA 4G43B 3B5TA 2FJHB 3QHFH 4M4RA 5JW5A 5F97E 3GMPB 3OL2A 3EYFB 2PN5A 4NIKB 3O6LL 4QOKD 2AJZA 3DIFA 4N1HB 3QB7C 1EEUA 4ENED 5E8NA 4Q9QL 3DI2B 2IJ0C 4TUOB 2I07A 5LGJB 1GGIH 2GJ6E 3UZVB 1SBSL 3JV4B 1ZLUK 5MEOB 2F8XC 1R0AL 1HINH 2PW1B 4XAWL 2R23A 3I3BA 1LEGA 4LCCA 1OSPH 2F5AL 3VFGL 1LP9E 3SJVD 4KQ3L 4LGSB 2AJYL 4M93B 5JPNB 4CVZA 2A9ML 4M5YH 1E0OB 2AJUH 3VFWA 5A3IC 3THMH 4AM0B 1IBGH 2J4WL 1EMTL 5F96H 1QFOA 3O3BA 1ZHBB 2R1YA 3RVXD 3R1GH 1F5WA 1UXSA 1AH1A 2P1YA 4KMTL 4MDJB 2ZOKB 3QDME 4G9FB 4CMMA 3QZWG 5C0GA 1U6AL 4PBWD 4ZUTA 3P9MB 3GSUB 4HIXH 1I7UA 3KWWB 4R2GC 4Q58C 1ZHNB 2R2EA 5IFJB 1N4XL 4EI6B 4UZGA 4X8XA 5L0QB 4QWWC 5D1XC 2QR0B 3A6BH 4U1MA 2CRZA 3DHJA 1SEBB 1FORH 2IQ9H 2P8MA 1P1ZA 2OQJB 3BKJH 4HFWB 3ORJA 4KHTL 2J88H 1JHKL 2B39A 4Q9BA 4WEUD 2EE9A 1QSED 3MSPA 1PX3A 3CVHH 2BHUA 3D6GA 4GLRI 4M9PA 3OGCA 5DJAB 3KYMA 2AP2A 5ADPH 5JLZA 2VITA 1NH6A 1X5AA 3L9RA 3OKDA 5EZOH 5TGBA 5E2TL 3RP1A 4KV5E 4Z7OF 1PYWA 4IOIA 2P5WB 3HI5H 5FA3B 3T8XB 3BISA 1ZHLB 1GIGH 3VH8A 3ARGA 4DOHE 2VERN 4K55A 5LXGL 4LSUL 5GSVB 1U91B 3CU7A 3O4LD 4NKDB 4LLUB 3WXWL 3FAXA 5SX5K 1ZKAA 3STZB 3U0WH 1JYXA 4Y4HA 3QO0A 4OT1L 4Z5RA 4HG4K 3MODL 3O9WD 3TBVA 1ZMYA 1D9KB 4HQQL 3U4EB 4F3FB 1FNEB 1KLUA 1R5IB 3PWNA 5IMKA 3MTRA 4FZEH 3UTPE 1OAZH 1OT1A 3QEHA 3ARGC 3MV11 1I7ZA 2DM2A 4FQXC 2NY2B 3BN3B 3PV6B 1MRCL 3FB5A 3C8HA 1K6QL 3ZL4H 2WNGA 2XTJE 4JO2L 4JM4H 2JJTA 3S98A 3KLHC 1OAKL 5I0DA 4AMKH 4KHXH 1IT9H 3PWLA 3DXAD 3ELAT 5TPWL 3MV9E 3KPRE 4PRHB 4WHYG 5KAQF 1CIUA 4QXUH 1I1FB 4JZJB 1YN7B 3ARBA 5TF1H 1RJZA 2EIZA 4M00A 3HPJB 1BQLL 3D39B 4LGRB 4UQ2A 3KNBB 5FDYA 1ZS8B 1CFTB 4YHOH 2HMIC 1ZK9A 3WEXB 4E41D 1QYGH 4XB8A 3LS5L 1XMWA 3TBTA 1MCPL 3EDFA 2J12B 4NNPL 4NQCB 5JO5A 2V7HB 1JPGA 2X10A 2NNAB 3B8SA 1ES0B 2X4NA 2YD2A 3G6JF 4QRSB 1MCJA 3FO0H 5ISZE 5C0RH 2CLZA 3WYRA 3MLSL 4LEOA 1EXUA 3SKJH 3V79C 4LSDA 1MRDL 3DO7A 1MELA 4K23H 8CGTA 1GVIA 5D8JL 3LPFA 3QWOB 3TYFA 1EJ6A 1T1YB 1VSCA 4QRUB 1ZAGA 1LO0L 1U8LB 5GGRA 5CGMA 3WNMA 1CXKA 2FH6A 4IJ3B 3L6FA 1CFVH 4JFXA 1ZVHA 4LK4A 4LLMA 3BRDA 5IVXB 1HQ4B 4P59L 3WUWA 5F7FA 3IJYA 3GSNB 3REVA 5IFAH 1YNKL 2MKWA 1BFOA 3RVWC 3ESUF 3GEWB 3B9DA 5BJTA 4OGZA 2BNUB 2DQIL 2P4AB 4KK5C 1WBYB 3IFLH 2ADIB 2V2WB 4X5XB 3SKOB 3QIUB 1TJIH 2HFFA 4GG8B 3L3GB 3VXSA 2VXQL 1NBYB 1N59A 1MVUB 3B4NA 1AFVL 4M1GH 4JG1L 3RGHA 1LO3L 1HH9B 5LQBL 4OKVA 5DHXB 3IDXL 3OZ9L 1OLZA 4OM1H 1FQ9C 3DGGB 2ADFH 1LGVA 3LSOB 1Z9OA 2ZP0T 4ZS7H 1H5BA 3CLEH 1P7KB 3VGGA 5DRNB 1P6AB 2YKLH 3MYJB 4GS7B 1YEDB 1CXFA 1GOFA 5DGQA 2RQ8A 1EA9C 1UB6A 5D7LB 3AMLA 1KTLB 4DGVL 1T2QH 3RIAK 5D70L 1TNMA 1BQHA 3NFPB 3BGFC 2Z92A 3LH2L 3UTOA 5E9DB 1QRNE 5L2JA 3TN0B 2XTLA 2PR4H 1P5UA 1D6EB 1XIWB 1EHXA 3QHTC 3ARTA 2CIKB 2DLFH 3EDKA 4NZRH 3JWOC 4X4ZA 2F58L 4R2GD 5FOJA 3RNQA 4TQEH 5EPMA 3CK0H 4RX4D 2MPAL 3VXMA 1AXSB 4C83A 4QWWD 5D1XD 2B0SL 3QXUA 4P5MA 4Q9RL 3RWJB 4MSWB 3P4NA 1HXYA 4ZXBA 1JI1A 4Y19D 5KSAB 2X7LB 3I85A 3UC0H 1ZT1B 3O2WL 4ALAL 4BK5A 2BSTA 4U6HB 2VISB 2EYSB 3AROA 5JDSB 3NH7H 4DK6A 1NCWL 3KPNA 3MLTB 2MCPH 2MQCA 4JRXD 4LHJB 1JHLL 3GSVA 4LPYA 3F12B 5E2JA 4MNGA 2VWEC 2BNRD 4E0RB 5I19L 2NXZC 4JM2F 1CYGA 4ZXBC 4ZSOB 2Z31C 3STLB 3PL6A 4JM2A 2PF6A 3GSRA 3GBMH 4J1UB 4YHPB 3Q3GB 3WSQH 5L2KD 4H0GA 4UDTA 1AHWA 3V6ZB 2UY7A 2P8LB 5HVFB 4L4JA 2W9DL 3TIEA 1INEH 2J8HA 1QOKA 3JWOH 4NO0D 1U3YA 5EU3B 3UJIH 3ZKNC 2BRQA 2FBOJ 1CU4L 5D2NC 3D2UA 3I2CL 2YA1A 2G60L 1NAKH 3IXAA 3IS1X 4IMLB 1OWWA 5D93B 1EBPA 1JGUL 4PRDA 3EJZC 2YMXL 4KFZC 3WO4C 3KLHD 3CC5A 4HUXA 1U8PB 4OZHF 3HCVB 1IEBB 2EC8A 4BA8A 2AGJH 3DRQA 3GSXA 4FQQB 1X7QA 4DW2L 2FEEI 1JUFA 5IMLB 4OZHA 4M1DL 3F65A 3NAAH 5GGRY 2Y23A 4OAWB 1QSFE 1FAKT 3V0WH 1M71A 3GI8H 5HJ3A 4LDEB 2WWMC 1RK0A 4BFBD 3HNSH 2YD5A 1G84A 2GCYB 2V17L 2GJJA 3VXRD 3CCHB 4NM8L 4WY7H 5JUEL 5I2IB 1V3LA 4ZAKA 2W91A 2G75A 3MXWH 5A2FA 1TJGL 3MLRL 5IM7B 3FFCD 1UM4L 1KIRA 2ERJC 3CDCA 2DQFA 4WENB 3UJJH 2DMKA 5KVDL 1E28B 4IDJL 4OD1H 1Z3GL 5HVGB 4C56B 4F2MA 1IGJB 5EUKA 2QSQA 4KKBC 1IAKA 5E1AA 4MQ7A 5IG7A 3NN8B 2YK1H 1UKQA 4EDWH 5EA0H 1X4XA 2IH3B 4ZAKC 1YMHB 3MCKB 4GLRH 3UTSA 3PHOB 2Q8AH 3OKEB 1YEIH 2VDQH 4PJ9A 2BMKA 5FDWA 5DTFA 2Q86A 3FRPG 5E2UH 4NJ9L 1PJ9A 3C60A 4K94L 5CP3A 5L88L 3RVVC 2BX5A 1OTSC 1U8QA 2BP3A 2VDOL 1BFVH 3OKOA 4YHYB 4ORGA 3MXVL 5DVMA 1J8HE 3DUUA 4LSQH 3RVWD 3GSNL 3BXNB 4G9DA 4OB5L 2R0KH 4MMXC 3G5VA 4KK5D 2IH1B 3QNYB 4ODWB 2A73B 2YA0A 3V0VA 5BV7B 2YPLD 3VXUE 3EYOA 1YQ2A 3DTXA 5ALCH 4P57B 2CXGA 3SE8L 3QDMA 5DHVB 5FYJL 3QXAB 4PREA 4BQ9A 3UPAA 3LKNA 1YY9C 1QO3A 3U7WH 3U7YL 1B0GB 4C4KO 3D85D 3HTLX 4POYA 3D3VA 4N0UB 1QFWI 3NIGF 2O5YH 4U7SA 4XVTH 4XXDA 1KFAL 1MHPL 1U8JB 5KSBE 4PJDF 5GS2D 3L95A 5GJTH 4WFGD 3KJ4C 4WWID 5ANME 1PZUB 3GJEA 3JWNC 5E5MA 4J3OC 2AK4B 3GHEL 2PYEA 1V3MA 1F3JA 1PFCA 4Z8FL 5C7XH 1A5FL 3A67L 3D0VB 1E6JH 1S7UB 4NQVB 5EORH 2YXFA 1BOGB 5CILH 3KPQA 5EBLA 3RGVA 2OTWA 4AL8L 1FL5B 3QH3A 1RZ8B 4MA7H 4V1DB 3F5WB 4RGOL 1MCCA 1RZKL 5IB5A 1L7TH 1AXTH 5J56B 3QG6B 2WUBL 2AEIT 3RA7L 4MA3B 5DGRA 3EFFB 3OAYH 5TE4L 3WXVL 3UO1L 2NX5E 3BP7B 1CD0A 3TV3H 3DVFA 2JJVA 2BCKB 1NAML 3V5HA 4TPRH 4X6EA 3MUY1 5DYOB 2A83A 1B4RA 3L5XL 5AZEH 5BQ7A 2KL6A 1MIEL 3B8YA 1JPST 1N3NB 5AAMA 1KCLA 4FN0A 3VFRB 1PG7H 2R1WB 2Y06L 1DQDH 1A9EB 3TCLA 2A0LC 5INCB 3K2MC 5EBWB 5I18H 1VKXA 4G9FE 1MHEA 1X5HA 5TQ0L 4DZBB 1FBIH 4L4TA 4KZDL 1GZQB 3BDBA 4XAKD 2XA8H 1NC4B 2WBWB 5DUPL 4JRYA 2Z31D 1W72B 4XP6L 3H0TB 3B2VL 4FQLH 3PG2A 4YK4C 1D3CA 1U8NA 4KXZI 4YE4H 5MEND 2GTWB 5HGDA 1E27B 3V2AR 5C92A 4JZNA 3ZE0E 3ULUE 4YJZL 2GAZA 1QLEL 2ICWJ 1YEKH 5GS0H 5EIQA 3LN4B 1V7MH 2SEBA 2CR6A 3O4OC 5CJQL 5F9OH 5IQ9B 3LVEA 5FM8A 1W0YT 4NGHH 2OMBA 3X14B 4YDKH 3BI9X 3ZKND 3V7AG 4OCYH 2XTJC 3B9KD 3M1BA 3C6SA 4NZUL 5K59F 3EO0A 1I7TA 1HQRA 2M26A 4I9WD 2FL5A 4ELMF 3EJZD 1RURH 5E94B 4M43L 2P5WE 3VG9B 2O61B 3D18B 1OSZB 3HMXH 4ELMA 3MA9L 1D5IL 5H37H 3X3FH 1PQZA 3IETA 2OTPA 5DMIL 3SDCA 3P77A 1DQJB 2A9NH 4U2ZA 2D7TL 3WIIH 5CJBA 1K8DB 1KTKE 4MDIA 2ZPKH 4JFOB 3O3EA 2PXYB 3VXNB 2HJKA 2XFXA 4FMKA 1IM9A 3F8UB 1ZWIA 4N8VB 4PJAB 4R4BA 5I30H 4M8VA 1WVZA 3GDBA 1ZV5A 4JY5H 1NCAL 4U1JB 3IDMB 3CFJB 1NLDL 4GT7A 1S5HB 2VXSL 4JKKA 3SDCC 2D31B 4N5EC 2ADGB 4MS8D 2Y36H 3ZDXE 1MHCA 5I1CH 4PGBB 1VFBA 1DL7L 5M95B 4PRHE 5IB2A 2OXHA 3ZZ1A 5DK0B 1SY6A 1V5JA 4HH9B 4XP4H 4ETQA 1NKOA 2HJFB 32C2B 4JQIL 3D39E 4YX2H 5HYSG 3QDJA 4QCIA 2HVKA 2X1XR 3HE6A 4P2OA 2XY2A 2XXCB 2VLJD 2O26U 4BZ2L 1JN6A 1X5YA 4RMTA 3MRBB 5DJ2B 5D5MB 4NO3A 5DURD 5I73B 4BQ8A 5I71C 4NQCE 2XICA 4IMKA 5DZNA 1RJYB 5IK3A 1HWHB 3IDYC 4PD4J 1YZZA 5IGXH 5K93A 2IPKB 3OJDA 1RAMA 4QHUA 3X3GH 2GJ6D 3RU8H 4P48A 3TJEH 2AI0H 4JJ5B 4TSBH 5KVGH 4Y0GA 1JVKA 3Q2CA 4NCC1 5BV7L 2R0ZL 4NFDA 1YY9D 5IMMA 3UBXA 3NIFF 2QHRL 1J18A 4XX1E 4FS0A 1A0QL 2BDNL 3HPLA 1T5XA 3L3DB 1HXMB 4PJFB 3FQWA 5DVLA 4HCRH 3FT4A 3ES6A 3NFSH 4U1LA 4ZTPL 4Z78B 4LSRL 4O00A 1KCRH 4JY6B 4NC1E 2XKNB 1MFEH 5IVXE 2VLRB 3U82B 5KANI 2FB4L 4XB7A 1EGJH 4P46C 4HWBA 4O5LL 1KCUL 4GRLA 1NMAL 1FNSH 4PRNB 4G6KL 4GW4B 2E9IA 1IZKA 1REIA 1QBAA 5DF0A 5DRWB 2JLLA 5EC1A 2EC9T 5GS0D 3FCTB 2R8SH 3QG7L 2Q8BH 4IS6A 5FA4B 3ARZA 1MHHB 3DX8B 4PB9H 4PJ8A 4FRWA 3ZE2F 3RDTC 2N7BA 4Y5VB 1IAMA 5FYJE 4OIBA 4MD5A 1FLRH 1PZ5A 1MFCH 4L9LB 1E6OH 3SBWC 4U0RC 2HKFL 3NZ8B 1KNOB 5HYQA 2BERA 3BQUA 1A3LH 4RIRA 3DX9B 3QPQD 4Y16C 3V4UL 3VXPB 3Q1SL 2XY1A 4MCYA 1LE5B 3HE7C 3LMJH 4LLYA 3T3PF 3WNOA 2DD8L 1PY4A 3C6LC 2VZVA 5CSZA 3EKCA 5D2LB 3QI9D 1C16A 5HYJA 2IPTL 1DQMH 4Z0BL 4RDQG 5D7LE 3VXOB 1F4XH 4XP9H 1NCNA 3CPLB 4PFEA 5EIIA 1HEZB 4NQSB 5KSUB 5E9DE 2X1OA 2AQ3A 3T4YA 3EOYG 3PF2A 2VABA 4P2QE 1F58L 3LCYA 4K2UL 4C57C 1A6ZA 3UTZA 4U7MA 1CQKA 1KG0B 4UNTA 1P7QB 3O6LH 4BQBA 4XNQB 4Z7NF 1W72L 4UB0L 4IHOB 3ROOB 3PABA 5C3LD 1IRAY 2R2BB 3CSBA 4Q9QH 1UEMA 5J3HC 3TYGL 2Q7YA 1OGTA 5T5FL 3T09A 1DE4B 1SJEA 5ESAA 1CICD 3OXRA 5DFTA 4XAWH 1ZT7B 2OZ4H 1J1PH 3KR3L 2F5AH 4GUPA 3VFGH 3ULSA 4KQ3H 2XTJD 2AJYH 2A6DA 2C1OA 1UXWB 1SJHA 2OSLB 2A9MH 2NZ9D 3K7UA 4TN9A 3MV9D 1HH6A 3KPRD 2E7HA 3DPBA 2J4WH 1EMTH 1JK8A 3AC0A 1F11A 5IBTL 4JR9L 4LAQL 4ZSOE 4XMKH 4FXGA 1CGXA 2R2CA 4I2XB 4U1IB 2V5YA 4KMTH 5C9JB 1ZA6B 1U6AH 4FQ1L 3T65A 1EO8L 2CKBB 2J8UF 4XWOC 4V2BA 5HYIA 5FAAA 3PDOB 5IFHL 5ICYB 1GZPA 4P23B 1J0KA 3DOSA 1FYTA 3B2UD 4OGYL 3AXLA 5CZVH 4WI9A 3TF7C 1N4XH 3VXTA 1AP2A 2LU3A 1WBZB 5JTWA 4QXWA 4HUWB 4L3EA 3BZFA 1X5LA 5ISZD 4N5ED 2XWTA 3S35X 4YNYA 3GHBH 4O9HL 2NLJA 1OP5H 1FGNL 3MRLB 3FT3A 5E2TH 3BO8A 1MCDA 2K3TA 5D7SL 3LRHA 1BLNA 3P73B 1MH5B 3BWAA 3QCVL 3FN9A 5T3ZL 3VXUA 3OQ3B 3MBEA 4QHMA 5F7EL 4XVSH 1KT2A 4YC2B 2HVJA 4EJ1C 5CP7B 1FVDB 4LSUH 5HHOD 2VDML 3WXWH 1KENL 1LK3L 2YD7A 1FZKB 2AXJA 1NSNL 3ULVD 3NGBB 4LCWA 3QUZC 4TVPL 4DK3A 4KUCD 1RIUL 1QD0A 3BN9D 4NO2B 4P2RD 2ARJB 3MR9A 3NCEB 3OV6A 4IRZL 4KJYB 1G6VK 1N64H 2EIBA 4C56E 5D7KE 5BS0B 2FJHA 2DS4A 2K1MA 1K6QH 1N8ZA 3ARVA 1MWAH 1KIQA 2DIJA 4JO2H 1OAKH 5E2VL 4J8RA 3RUGF 1XZ0A 5TPWH 3ZDYF 3QIBB 3VWKA 3OB0H 4ZO8A 2QL1A 3JV4A 1UQSA 3RUGA 2ZSWB 4NN5B 2NX5A 1S7XB 5J9PA 3MFFB 1BQLH 2JJSA 4P46D 3SCMB 4HKBA 1WV7T 5DDHB 5J1AA 1YNLH 4WEBH 1VADA 3J7HA 1D5BA 1S7TB 5HVWA 1JF1A 4N1EA 3PWVB 2VQUA 3RDTD 1RY7B 4ZUWA 3N1FC 4MDJA 4YHLH 4YZFF 4LVNB 4F8QA 4DGIH 1UWGL 2BFVL 3MLXH 4S11A 3HI6L 4NQDB 3TBSA 5I74B 2CDEB 5ELIA 1JYWA 2GT9A 1SMOA 1T83A 2VLKA 2GKIA 2IAMA 4M93C 4N0UE 4Y16D 1S7VB 5B38A 1IKNC 4I5BB 4R26H 3MLSH 1NGPL 4O2FB 3HE7D 1W0WA 1MRDH 2EDLA 3NOIA 3K0WA 2PETA 1RU9H 2WWKT 2ZOLB 3A6OA 5D8JH 3T04D 3C6LD 5DD0L 4RAHA 4EN3D 1S7QB 3T0EA 3JVGA 2OTUA 1LO0H 3ZT6A 1RVFL 2AK4E 1XH3A 3PXHA 4KDTC 1OARL 1ROWA 4XCYB 1CXIA 3OR6B 4CDHA 3GMRA 2RB8A 3UTTB 2DI9A 3X11A 4V1DE 2EDWA 3D0LB 4XPHL 3SDXB 3U9UA 3PQYA 4E41A 5JHDD 1I3RB 1YNKH 3T2OA 5JA8B 4FXKA 3G04A 4AEFA 2GY7B 3FQUB 3TBWB 5L0QC 2DQIH 1AGBB 3ULUC 5IEKB 2VZ1A 2FEDC 1G7IA 5DQ9B 2P5WA 4JE4B 4LPUA 3SGEI 2D9CA 2DIBA 4QRPD 5CIPA 4S2SA 2O5XH 4O58L 2VXQH 5GGSY 3GGWA 1RIVL 4JG1H 3DBXB 5L9DL 3TEUA 3O2DL 1QBMH 3IDXH 3VI4F 5E5RB 4RRPA 5C0CD 1XGRB 4PTTB 3VW3H 3RJQB 1CS6A 4FFYH 5H2BB 3GMOB 43CAB 3VRJB 2KPNA 4I18B 2FGZA 2X4OB 1UZ8B 2H41A 3KPMB 1FFRA 3E2HB 3QAZB 3SE4A 4ISVB 5GS1B 4HLZG 4ZD3L 5D70H 3P40A 3IDNA 1ADQL 5IMOA 5JOPE 3LH2H 1RJLB 3B43A 5E03A 1QSFD 2BC4B 4XWOD 1AO7B 2B1AL 2CKBL 5IIEA 4YXKL 2F53B 4WWKD 1T4KA 5EIVA 1PGRB 3ARFB 1JWUA 1BVKA 4W4OA 3LHPL 1P4BL 2NY2C 1A4KA 1FL6B 3FQTA 2H45A 4Q9RH 3SE9H 4MXWH 2A1WH 2NY0B 4Y4KB 1KLFA 1E4WL 2XQBL 4H1LG 4YHKH 4KRPB 3N9GL 3ULUH 2P8PA 3JWDH 4HZAA 4X6CF 1X5XA 3O2WH 3OHXB 4IM8A 4ALAH 4G8IA 4YEFA 3P9LB 3TO4B 4OSUH 4M62L 1LE9B 4XVJL 4X6CA 3VA6A 3BKCL 1DLFL 1G7PB 4JZJC 2GIYA 5HGAA 3RWGA 5JXAL 1JHLH 1MLBA 5E70A 4OF6A 2CK0H 1HI6B 1CXLA 5I19H 3L3OB 1ZLSL 5J12B 1CL7L 5TDPA 3F7VA 3GK8H 5B39B 2BK8A 1OHQA 3U0PB 3KG5A 3MRCA 4RFEA 1OWRM 1BECA 4QRRB 3TH2T 2GJZB 4ZPTA 1OP9A 4HKXB 1BGXH 4PJAE 1DZBA