2HT3C

Structure of the escherichia coli clc chloride channel y445l mutant and fab complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3C01
1RZKC 3OKEA 3QXAA 4XCEA 1H5BA 2D9QB 1KCUH 2ZSWB 3QJHA 4M93C 3ARGB 1IGYA 1CDCA 1P5UA 1Y18B 2Y5TA 1FGVL 2P8PB 3HAEG 4EI5A 5DI8A 1J1OL 1CXIA 1OM3L 5JDJA 2EICA 5F9DC 3CGTA 2YD6A 1U91A 3L7EB 1DN0A 2V2WB 4TNWF 1OGAE 2MJWA 1JRHI 3MODH 3MRLA 5DJYA 1R3KB 5I8OL 3P73B 2RR3A 3FL7A 1YPZE 5GRZA 2R9HC 3UTPE 4KHXH 1HI6A 3QFDB 4P3CL 2NXZC 3PV7A 4AJ0A 3QP3A 5KSVB 3NCEB 4OV5B 5KS9E 1LEGB 4H0HB 4L8BB 1X7QB 2IH1B 5ESVA 5TE4H 5C08E 5BS0D 4OLYH 5C07D 3WD5H 1NAMA 5CIPH 2XA8H 2DQEH 3U7YH 5L2KD 1Z5LB 2GI7A 1QEWA 4ZUVB 1FLRH 4KDTC 4JFDE 1YNKL 4XAWL 2QQNH 2VNCA 1DQJA 5B39B 4WDIB 2BNRD 5DFVC 4TUKL 5I66B 3S37H 2DQIH 1RPQA 3EFFB 4BZ2L 4Y2DD 1RZ7H 3TFKC 3MLWH 1CD1B 3PWPD 5HVFB 3KPPB 4KHTH 2DLGA 4NKOA 1MFEL 5E9DD 4UQ3A 4G6JH 2BVUA 1EJOL 3GB7B 2BVYA 4OI8A 4XZUA 5TDPB 3KPRA 2VR5A 1ADQL 4ZXBB 3W39B 3UTZB 4GRLD 3GSNA 3GSNB 4OSUL 4CVXB 1QLEL 1MLCB 2F74A 2AJUL 3V4PL 1EZVY 4OGXL 5HXMA 1GZQA 1TQCB 4JR9H 4KRPD 5C9KA 3OKMB 4PRPD 1AD0A 1IQWL 3IYLW 1IC5H 1A6PA 5D6DA 5CJXC 1Q9OB 2PTVA 2OJZL 3LS4L 2JKXA 4WWKA 1VEOA 4BUGA 3HE6D 2XY1A 5HPOA 1BIIA 1HKLH 3GSVA 5LAXA 1DQMH 2CXKA 3WNMA 2VE6A 4MNGA 1L9MA 3BH9B 3BDYL 4P57A 2X4UA 5FIEA 4ZUVA 2X4UB 5D71H 3UBXB 2DQUH 3U9UB 1U8NA 1I7RB 1JV5A 5ADPH 3Q6GH 1ZLWK 4PJ9A 4RQQB 1CE1H 5JR1H 3QQ3A 2HRLA 2L0DA 1K8IA 1BX2A 3OKYA 4PJDB 5C6WH 3SJVD 5EU5B 4MCYB 3MRLB 4TPRL 4DGIH 4PRHA 1AGEA 1CQYA 3A6OA 3RWJB 3CK0L 3PDDA 5AG8A 5TGBA 2ZG1A 4QHUA 3EYSL 3BKJH 3BPLB 2VDNL 1E4KA 5BQ7B 1E6OL 4RCAA 4NJAH 1IEHA 1IVLA 3RBSA 1KYOJ 3ARGA 4P5MA 4TSCL 5SWZD 4X6BB 1GZPB 4IIQC 5KSBE 3IDIB 1JNJA 4WWKB 1A6VH 3ALXA 3B8YA 5FEBA 4YBQC 1S8DA 3RDTC 3FOMB 4ZD3H 2EDDA 4G6AC 3LKNB 3FFDA 3HTLX 3N1MC 4XWOC 3TA3C 1NCDH 2EKSB 3U48A 4QOKA 1D3CA 3OGCB 2HMIC 1QBAA 1RIUL 3GRWL 5EIIA 1BPVA 5MI0B 1U8IB 3MYJB 4NUGH 4LP5A 1RU9H 1DBAH 4OM0H 1ZLSH 2Y1VA 2VLRD 4JKWA 4MQXD 3WXVH 3TP4A 1P7KB 5TH2B 3NCJL 3D69B 2QHLA 3KYMA 5C0DB 1FL3B 1KIPB 2AJXL 2IALA 3HZKB 1V7ML 3RWDB 4Y19D 3T09A 1ONQA 4NYLA 2OYPA 1S7WA 1NC4D 1U91B 3AROA 1AD9B 5ELIA 4XPTL 1KACB 3HZYA 1LDSA 1G6RB 1SM3H 2E9BA 3KPSA 3KYOA 4WFFD 4RSVA 1CICA 4N9GB 5CJ8A 4GXUN 3EGSA 3X3GH 2A6JA 3P9LB 5D2LB 4U1MB 2EKJA 1FNFA 4F9LC 1S7VB 3W9DB 4ZPVB 3QSKB 2LAAA 5EB9A 1N59A 1YNLL 4P5KA 3BVNA 3ZKNC 1YEIH 4LFHD 5SX4I 2O61B 2BMKB 1UA6H 5L2KB 5EDXA 3VXPA 4R2GC 1A7RH 3X12B 4FFWD 3L3KB 4AQOA 1MFEH 1ZA3A 2ZOLB 5L8LB 1GOGA 3QIWD 5ANME 4OQTA 2IQ9H 2LTQB 4WI3A 1U8MB 1CL7H 2BMKA 2H2SD 4KI5F 5D6CA 3H9SE 4XP1H 2FECL 1NMCB 4QRRD 1MCIA 1D6EA 5L0QB 2CLVA 4Z7QF 4DZBB 3NIDE 4HS3A 4HFWB 2HT2D 3ZSTA 2X4QA 4OFIA 4ODSH 4S1DC 1TJGL 2J8UA 1RUPH 4LASL 4QNPE 1KPRA 3GFUA 5IB3B 1JYWA 4GKNB 3KYOB 3FQNB 5HHOB 3BKYL 4N1EA 1QFUH 4NN7B 5JXAL 5EORL 1CU4H 5CUSL 5JUEH 5T3XH 4PGEA 4B53A 3S96A 4WHYH 4YC2B 4LU5H 4H20L 3MFGB 2Y5EA 1KIPA 3HZKA 4H26A 5GRJH 2CK0H 1SJHB 2LU4A 1A0QL 1F6LL 4LSDA 3U30C 1O7VA 2F19H 3ET9F 1JWUA 1MCOL 1MCDA 5SX4H 3MRDB 3KLHC 5E2UL 1BHGA 4DJMA 4GRMA 2NLJB 1P84K 3MYJA 4X9BA 1A7OH 2Q1EA 1JFQL 5C8JA 4NUJA 2DMCA 4POZD 1WEJH 1NBZB 4OFDA 2GK2A 4LSVH 4JN2A 4WFHE 3INUL 3CSGA 4IS6B 3OKLB 4UDUB 3LAFA 1C5DB 4OFVA 4PJFB 3HRZB 4ZSOA 2B1HH 2VXSH 4HS8L 3NCBB 3BP4B 4ZUWA 2KPNA 4OCXH 5IMLB 5KZCB 1J1OH 1MAJA 4LSSH 4YFLI 3GJFK 4J3XA 4JY4A 4NRZA 2WWKT 4HF5H 4MJID 4Y5XA 5I2IA 1DVFA 4V1DD 1GHFL 1LK2B 2FIRT 1DZBA 2OP4H 1FFQA 5LQBL 1H15B 3R8QA 2ICES 1YPZF 1PBYA 3Q3GB 4P4RA 2ICCA 3UTTD 3GKWH 3TBWB 3IFLL 4Q7DA 1PG7W 3LN4A 2CO7B 2IG2L 1CZ8H 1A1MB 1YNKH 5CP3H 3HPLA 5D5MB 3TN0C 1NGWB 3CFDA 5SV4A 2EYSB 1NLDL 2HG5B 4D2NA 2P7TA 3S36H 1QLFA 3G6DH 4AG4H 4IOIA 4QEGA 3D39B 1P69B 3MLSL 4HMDA 1SY6A 2CKBB 4JKKA 3E6HA 3O6LH 1BJ1H 4O02H 3EO0B 2D0GA 4LBEA 2A83A 1FZKB 5IHZB 4JM2A 5I8EB 1G7LA 1ZMYA 4YDIL 4YHLH 3MJ7A 2DMBA 2DQGL 3G04A 4W4OC 1AXIB 2UWEB 3ARWA 3H9HA 1H8OA 3MLRH 4OIIH 2DQJL 5I1DB 2VXUH 5HYQB 4U1IA 5E5UB 1J7VR 2YPLB 3MYZA 1ZEAL 3DUSA 5HDLA 1DQML 3ROLB 5SWZB 2MQ3A 4G42A 5TE6L 2PUQT 2BFVL 4TSBL 3WFHB 4NZJA 2BVOB 4ZSOE 3ULUL 2CKBH 4JFDD 3PWJA 3OX8A 1MFCL 2VZ3A 4NQEE 4WEUD 5MHSE 1P4IL 2Y9RT 4CMMB 5EFIB 4ZAKC 3T4YB 1I8MA 1ZVSA 2BZDA 1BFVL 2FB4H 5GGRY 4X0KB 1FRGH 4KRNA 2OSLA 4ODSL 1NAMB 4PJXF 3AS1A 3PGCA 5L9DH 4GH7B 4MS8C 3I9GH 3KLAA 3WO4C 2VIRB 4Y4KB 3RL1A 2ZUWA 5DS8B 3BD5A 4WI5A 2AEPL 3O3UN 1WK0A 1CDHA 4JPKL 2W9LA 4DQOH 1F2XK 5GS0C 4PJCB 3E2HC 3ARBC 4NQXA 3EOBB 1GYAA 1OGAD 2DQTL 1GGUA 2IPTH 5KOVC 5EC1B 5T3ZL 3UJIL 3I85A 3LQAL 4M43L 2AJSL 2R2EB 2YXFA 3RUGA 4FFYH 3VCLA 5KOMC 2CLZB 4PRID 3O4OC 5FUOL 1YEFL 2BNUB 2I07B 5DD3L 5DR5L 5DRWB 4QRPE 3VD7A 2OJEB 3CLFH 4PRDA 2NZ9C 2WINB 1RFDH 3SKNB 3BKJL 3KDMB 2VDNH 4JKPH 4ZPTA 1SBSL 4LFHG 1FHGA 3MRQB 1LK3H 3SBWA 1CK0H 1S9WA 2CK0L 2F5AL 5DJ0A 4JRXB 3L95B 4KDWA 3FRUB 3WO3B 4I3RH 5CSZA 1PKQA 2DI9A 1T5XB 3KR3L 1MRDH 2HRPH 1UM5H 3FQXA 4C83A 3CXHJ 4Y2DB 1CI5A 4L3EE 5BV7L 4WW2C 3BZDA 2BHUA 5FM8A 1XFPA 1MCWM 1QBML 5CGMA 3PF2A 5D9SA 1GHFH 3D3VE 2F54B 2VKWA 4JJ5B 1O7SA 1RU9L 4F3FB 1KGCE 4XBPA 3HAEB 4LLUA 3UROR 2HA1A 1MI5B 5ICYA 3MMEB 4LVHB 2DLHA 1IGJB 2P4AB 3O9WC 4LDOB 5JMRA 4ZUTA 1RZKH 5K93A 1RZ7L 3BN9D 4OZGE 1YEHH 3IDMA 1A7RL 3MNWA 2FZ3A 1ZLVH 4JDZA 3CX5J 1WCQA 2PNDA 4XVTL 5L8KB 1GIGL 3U46A 4OGYH 3WUZA 2P5EB 4AENB 1CDIA 4H5SB 4PJEA 1UVQB 1XF4B 4NO3B 4Y5VB 5DDHA 3VFVA 1V8HA 3B5GA 4GG6A 4FG6D 3QIBD 4RMVA 5I1CL 3VWJD 3QO1A 3QHZH 4PY8J 4RZCB 2NX5E 4XHJD 3V7MA 1CLOH 1VPOL 1KB9J 2C1OA 2FSEA 4IOFC 4Y89A 3WIIL 1BZ7A 4ELMA 5HSFA 5DK0A 2GHWB 1MPAL 4E41B 3KPQA 4WGWB 3V6BR 4MA7H 3GSQA 3LMJL 4KPHH 2R0LH 4OJFL 3PV6A 4WFEE 3I6KB 3TCLA 5D7LA 1ZA6B 4KJPC 2HKHL 1ZE3C 4OCNC 2Z4QB 1MQ8A 1HWGB 2Z8VC 5D2NA 5DHVB 3NA4A 3FJTA 4HW6A 4BKLB 2EEAA 2Z9TA 2M2DA 2Q6WB 4BJLA 4CU8A 4UNVA 3SOBL 1ZWIA 4JCMA 3CFEA 3I6KA 1ZT1B 4FFZL 1G7IA 2C3VB 1HNFA 5TQ0L 1PKQE 2DJ4A 1Q0XH 3BKYH 2C7UB 5DJZA 2XA3A 1KFAL 1O5DT 1S7TA 4KFZC 4IHOA 4L3EA 3GKZA 1DANU 3TBYB 4P0DA 4P2RB 4NFDA 5H37G 4GG6B 3F6IA 1VA9A 1QACA 2MFNA 4OZHB 1U3HB 5DQJB 3KG5A 4J8RB 2ZKHL 1M05B 3DBXB 3T8XA 1A6AA 4M48H 2HN7A 3CCHB 5FKPB 1U3ZA 2E5EA 3FKUS 5ECJE 4JRYB 3S5LB 3SKOB 3P4MB 2YPLD 3UZVB 3I2CL 4PP2A 3QIUC 4JRXE 1KTKE 2DDQL 2ICWA 1WF5A 3C6SB 3L5XH 3C87A 3STBA 1HHHA 3LEYL 4K71C 3NZ8B 5IW1A 1MEXH 2OR8A 1NLBH 1TETH 4JJHA 3BUYA 4U2ZA 1SBSH 3MGOA 1Q0YL 4GW4B 5CZXD 4HIEB 5A3ID 2YZ1A 1FYTB 3D3VA 4UTAL 1IGTB 3TZVA 1BQLL 3EYQD 3UJTL 2W65B 2X4SB 2ESVB 5MEOB 4PRIA 2H2SC 1WAAF 4G6KH 3SDAA 4BSJA 3C60A 4FXKA 5H2BB 4Y2DA 3B2UD 4FQ1H 2UV3A 3O3BA 5EA0H 1KIRA 3CDGA 2FEDC 4POYA 2WANA 1LD9A 3LS5H 2WUCL 3RNQB 3X3FL 4I0PA 5SWSD 4PJ8B 1P2CB 2H32H 4LQFH 5D5MF 5ALCL 3G5YA 5DXWA 4HIJB 4HJJL 2EDHA 5EUOE 1RJYB 2RHEA 1E6JH 3TYFA 1YEKL 1MJUH 3ROOB 1J8KA 1CICC 5E8EB 3RU8H 1NLDH 3SDCA 4G9FE 3IDMB 1MIEL 3A67L 1G9NH 3PQYA 4J7RA 5KTEH 3HUJA 1OLZA 1OAKH 3UDWA 4N0UA 1JHTB 1TCRB 4KTYA 2FNBA 1NUDA 5HVHC 3PHOA 2NYYC 2IBZX 3KLSA 5E2JA 1UWGL 1MCFA 8FABA 1AIFB 3L3GA 4P49A 3LKRB 1J1PH 5IB4B 5SWQA 1OHQA 4N8PA 5EIVA 2ADJA 3MV9D 3LY6A 4GXUM 3QIUD 1EHLH 3SPVB 3WLBB 5I1CH 3SPVA 2HTKC 3N1PC 3D1MC 4X8XA 3FOLA 3DXAA 5F7LB 2HH0H 1EAPA 5C7XL 3ARXA 4NQCA 4U3HA 3HNVL 2X9YA 3DGGA 1F3DH 1NCCL 4NM4L 1DVFD 5GGRA 1F4XL 2YUWA 3QDMD 4MQSB 2GUOB 1GIGH 5CD5C 4P4KB 2NY6D 1BFSA 1QA9B 5DT1H 4ZO8A 4XNXL 4NQEA 1KT2B 3RVVD 3WFHA 2X1XR 3ARDA 4G6FD 3LN5A 1MQKH 1NKOA 5FDWB 1HIML 1P1ZB 5FYKH 2FHFA 4JREB 3V5DA 5FO8A 3MFFB 3OAZH 4MXVE 1A3LL 3ULUF 2OQJB 3IDNA 3RWIA 3V4PH 4DKAA 5C0IA 3CZFA 3RUGF 4FHBD 3D85D 4K3DH 4O9HH 3NN8B 3F62A 4DGVL 3I9GL 3NFNB 4PJCF 5BRZD 4FFVD 5K9KB 1T7YA 1JF6A 4PRIE 2FGWL 1CG9A 4FQCL 4HXAL 1WBXA 3CDGB 1YEEL 4PJIB 1GGCH 4NWUH 4GBXD 2BP3A 3EOBA 3O3BB 2C3HA 1E0OB 2XKUA 4RAUA 3SDXE 3BO8B 4G8EB 5FOBB 1IAII 3PQYB 3TH4T 4ORGA 1WLHA 3UPRA 4KKLC 3H3PL 3H8NA 2DQDH 3QUYB 1BD2B 3E6HB 5SX5H 2OSLB 4G80A 2EE3A 4V2BA 4K7PX 3O8XC 1FO0L 4DEPB 2YD4A 3MRKA 1B0GB 5J6GA 3U2SB 2B2XL 3TO4D 5GS2D 2AXFB 2BCKA 3LKPB 3PJSA 1V3MA 4ODHH 3T0EE 4PP2B 3K4AA 5MERB 3LRSB 3X17A 5HDQL 1SYVA 5IM7B 3X13A 3MRIB 4TULH 2ITCB 3MLUH 1TVBB 3G6JB 2G60L 4KROC 5D1ZB 4U1IB 3T77A 3FB6A 1NEZG 3NIGE 1WAAA 4XNYH 1HHGA 4XXDA 2FBJL 2EXWC 2I25N 3ZE1E 1E4WH 4L3AA 2Y6SD 3DO7B 3S8WA 5KVDL 4HDIB 1T66C 3VGAC 1J0YA 1S78C 5C86A 1NGYB 3BJLA 1NEUA 1WJ3A 4HKBA 3CZJA 1UADC 1XEDA 1JPFA 2CRZA 4O4YH 5GSRA 1TPXC 2D31A 1A7BA 1JNHA 4QRPB 2EIBA 2A38A 4OCSL 3WUWB 5ALCH 5EULV 1M7IA 3ULUE 4MSWA 1D5ZA 4KV5F 3D39A 4NQSA 3OKLA 4G43A 2R23A 4MLSA 4ZD3L 5E8DL 3VXMA 4WEBL 1NQBA 3GSWA 3VI3E 2Q7NA 4L4VB 5A3IC 3GSRA 1NCBH 2C4FU 1ZHNA 1U8HB 3B2VH 5CJ5A 4WTXA 1A47A 3F58L 4U6VH 5DJDA 2NTSP 4M7JH 1H3GA 1LEIB 1UWGH 1MCQA 3W2DL 5L6YL 1N8ZB 3MRIA 2NZ9D 1P4IH 4QRUB 3SE4A 1ED3A 1FJ1A 5F44A 4A2LA 1C8PA 2IADB 4G7VL 1T04B 3GMPB 1CT8A 5A16B 4TUKH 3V6FA 3O3AB 2Z8WC 2AV7A 4ZOBA 1EEZB 3P77A 1Q94B 1H5BC 4O5LL 3PGFL 4X6DE 4DVBB 2FD6H 5GRVK 2Z4QA 4F37F 1UVQA 3RGVB 4U0QB 5GGUA 3MLXL 2PYED 4X4XB 3MRBB 4Z5RB 2EC9T 4G80B 4U6XA 4JFEB 3UPCA 1JHKH 2IAMB 2XZCH 3F12B 1RD6A 1IKFH 4ODUB 3U82B 2PETA 1V7NH 1A02N 4I2XB 1MREL 3TVMA 3FO1B 4J6RH 3B5HA 1FFPA 4UT7H 5EOCJ 1CE1L 4IDLA 3CXDL 4LAQL 5ICYB 5E95B 1JGDA 3QXDB 3L5HA 1NBQA 2FJHA 4P3WA 3FCTA 4E9LA 2DRUA 4WHTA 1AQKH 1X5KA 2BOCA 1KB5L 1S7TB 3UTSA 3DLQR 4JZNA 2V5YA 4TRPH 2A2QT 4GJTB 5F97E 4OM1L 3J8F7 4U1MA 2R9HD 3MRMB 2FZ3B 4DZ8A 5E1HB 1BAFH 4X80H 1CICB 5F9WB 3STLB 3HI6H 5FYLE 5HYJD 5FUCE 4FFWC 4GO6B 4XRCB 1T21B 3VH8A 5D7JC 5I1IH 1B0WA 1SQ2N 1NCWH 4JRXA 3NBNA 4HMEA 1ZHKA 4RFNB 4LARL 5C0AE 3VGEA 1BJ8A 5C0EB 3MXVH 5ACZA 4OLWL 1D6VH 1S9XA 4HEME 4JQIL 4F33B 1FFNB 1J0IA 4H88L 2PYEE 4RRPG 2A0LC 3QG6A 3B3IA 1H3PL 5D2NC 2IJ0C 1ORSB 3RY5A 4PV8A 4RGNC 1U41A 4RRPA 3ETBF 1WWWX 3DGCR 2ZCLH 4TTGA 4N8VG 2I60H 2CLRB 1DLFL 3L3JA 2Y25A 3BPNC 4GRLC 1URLA 4JZJC 1SJEA 1XCQB 1I1AA 2EE6A 2IPKB 2AXJA 1R24A 3QZWG 3EYFB 3T3MF 5ABDE 3IDJB 3U1SL 3JSSA 5IWLA 1RSFA 2H8PA 4X6DA 3WIHH 1ZANL 3C09C 4FQXC 1KSRA 1CXHA 1OT1A 1YJDH 2BNUA 2P1YA 4J23A 2NXYC 1KCSH 4JFPB 1LO0L 1HOCB 4QHUB 3QI9A 3F7RA 3JXAA 3HAEA 4X98B 3VA6A 1GC1L 1RVFH 5EU5A 2ENSA 5JW3L 4JPVL 4PP1D 1NDMB 4N0FA 3C6LD 3CSYB 5IF0A 4POUB 3GGWB 5AEAA 2VIRA 3O2DH 1U9KA 2ESVA 2JCCE 4I0CC 5EU4B 4LGSB 3FB8B 3WS3A 5HHQB 3OGCA 1AC0A 4I18B 1OT2A 2CR6A 3GSOA 4Z7NE 2CIIB 1S9WB 2R29H 1A3LH 2VKXA 1ORQA 5CZKA 4HWEL 4YPJA 5F1OB 1T20A 2OL3H 4LLYB 4PJBB 5D7SH 4PJDF 1OAZH 4TSAL 4MNQB 4LBEB 4MNQD 1Q72L 1YJDC 3OV6A 3T2QA 2VQTA 1YECH 4XVUD 5FK9B 4RISL 3NACL 3TN0D 5IBLD 4CAGA 3BRGC 1BVLB 1JNLL 3RPKA 1F58L 1KENH 4PUBH 5IOPB 3O41A 2HG5A 4J8RA 1QPXA 2FEDD 3D6GA 1N4XL 2B1AH 5J0BA 1JZ4A 5C0BE 3HN3A 5EZOL 3SDCC 2P5EE 3MV8D 3BQUB 4IHOB 1EEYB 4HPYH 3O9WB 2A83B 4P2QE 5DJAB 5I66A 3BXNB 1OSPL 5F7YC 1NFKA 3NIFF 1SMOA 3HLAB 4GUPA 2AV1B 3UAJC 1U8JB 3EOTH 3OR6B 1WGOA 2NYYD 2PYEA 2BHZA 1LEGA 4R4NC 4Q9CA 2A1WH 5DQDH 5TE7H 3KPLB 3QUXB 4M5ZH 5IV2B 5D1ZD 1BFVH 3THML 2WV3A 3CLEH 1CTOA 5CBAA 2WUCH 4XNUH 2AEIT 4DVRH 4BM7A 1P6FA 4RX4D 4CVXA 3VRLF 3TBVA 1D9KC 1N2RB 4R2GD 3HZVB 4IJ3B 4X80L 1G0XA 4BZYA 2ICEB 3JUZA 4GQPH 4X4YB 4XC3H 3FMGL 3O6KH 4WTZA 5KSUA 3C5JA 3VFUB 5GZND 2AQ3A 3MNZA 5E8DH 4NNYA 2DIAA 3W5NA 4AIZA 4L8DA 1FNSH 3RL2A 5F7EH 5E94A 4K7PH 2HRPL 1KJMB 5D7IE 4G9DA 4ZQKA 1QVOA 1XGTB 2PW2A 3JV6A 2IBZY 5L7XL 3F5WB 4WENB 4O58L 4PV9A 2I9TB 3REWB 2HYMA 2QADB 2V5RA 5BOPA 5LXGL 5DUPL 3LQZA 2GKIA 5IHUH 4BFIB 1MCLA 3F7VA 4XPBL 4ELKB 2YMXH 4KUZH 3TT1H 1TPXB 4NKMB 4YHKH 1PJ9A 5DVKA 1JWUB 5C08D 3WS6C 5JOEA 4OFPA 5JQ6L 1S9KC 3WFBH 1QSZA 4KWUA 5EH1A 2X1QA 4LOUC 3CIQA 3MLRL 4UQ2B 2R4SH 2CUMA 3EHBD 1I3VA 3HCVA 3O4LA 4P2RD 1KIUA 3MCKB 4ODBD 4KHXL 4NSKA 1SEBA 3MRNB 1WCBA 4YDVB 3TN0A 5DO2C 3NFSH 4JEGB 3CH8A 4LKCA 2QHRL 3O6FC 2X1PA 3ZHKA 4Y5XB 1ZT4A 4X7FC 5CSZB 4U1GC 3JTSB 3GBML 4TNVF 2GY5A 3L9RA 3LQMA 1FORL 5EIQA 4DN4L 1S5IH 3VE0A 3MOBH 3FB7A 3FT4A 1AHWB 3GJFH 3RWCA 1JZ3A 5FM4A 3VWKA 1VFMA 3DROB 2FATL 2AEQH 4FTVD 1IBGH 1MSPA 4LSUL 4YDVA 4OAWB 5IGXL 3VXTB 4NFCA 3GM8A 3K3QA 5FB8A 4P2QA 4OZGF 5J6HA 2D4FA 3CFIC 4QRRB 5IROC 2PKDA 3QNXA 3MLVH 4PJ8C 4ZPVA 2EDKA 4UT6L 1YMHB 3OKNA 2ARJA 1T7XA 5JA8B 4X7EC 3CD4A 4OZIF 1WV7T 3K74B 1JGEB 1J0ZA 5DMGC 5CBEA 3KLAB 3ZKSD 5J1AA 1MHPH 3R06B 5CS7A 3OMZA 3ULVL 2D0FA 1JRHL 4U1LA 3HC3H 1MCCA 1T2XA 5TF1H 3HUJE 4HFUH 2VR4A 2D03L 1QVOB 4PG2C 1NGPH 4Z7VB 1FL5A 5BJTA 5HVHB 5F7FA 1F97A 1TNMA 3GMMA 5DEFA 2APFA 3VFWA 4ENEC 1QUNA 1VFAA 3MLTB 4ZFOB 3L1OH 3QFJB 4D3CL 2BY2A 1M71B 5FCUL 5TH2A 3NIGF 3HNTH 1EVUA 1HILB 1CGYA 4KJPD 5C07B 1JE6A 2Y7QB 1JVKA 5TQ0H 4AG4L 4BYHA 4QHNA 5HDBF 2ATKA 1EERB 4IDJL 4I8DA 5I1AA 4ACPA 1W0VA 4H88H 5I1DA 3K2UH 4U1NA 1II4E 4YFDB 4UUJA 5C3LD 4PLKC 1MAKA 4Y16D 1EEUA 3SGDI 2XNAB 3EYSH 3VE0B 3GBNH 4Z78B 1H3TA 3IXAA 3DSNA 1KBGH 4WO4A 5K59F 2VXQH 5D2LA 5EOQL 4WJ5A 2WBJC 2XPGB 3C5SB 4QTIL 4M1CD 2HFGH 4LEXL 1AR1D 3MODL 3QULA 5HHPA 1ZT4B 2FYYA 4W6XB 1NCBL 3BH8B 5FGBA 3C2SA 4G9FB 5F7EL 5LGJB 1AGBA 5TPWL 1CLYL 4OQ1A 4PRHB 4ISVA 1KNOA 5FO7B 2R0WH 5DJ2B 2NY7L 1CXKA 2DYPD 2GK0A 2R2BA 4D94A 3H9YA 2HFFB 1JUFA 1NUNB 1HNGA 1KTRL 3B9KB 3GMQB 3DV4B 3TBWA 2RBLA 2Y36H 5C0AB 3U4EB 1T6WA 2IFFH 5F7DB 4M5YL 3IFNH 1P7QB 4KV5E 5DWUL 2CGRL 4LCUA 3ZTJH 1AXTH 3PG2A 5B4MC 1QLRA 3V0AC 2AJXH 4PJXB 4JDVA 2DIJA 1MHEA 3DX9B 5D7JD 2VE6B 5EN2B 2DI7A 2W0FB 1DBJL 3RI5K 3C5ZC 4NBYB 5I19H 3EFDL 4XB8A 3QUMH 2WQRA 3I6LD 4YNYA 3MRJA 3NAAH 4YX2L 3CDYA 3I50H 4DAGH 5JQ6H 4M62H 2KZ1B 5GIRB 2G9HB 1IQDB 5F7NC 2FCBA 3R4DA 3TT3H 2XICA 1ZHLB 3SCMC 4IRJC 2XG4A 3ESVF 4LMQE 5EG6C 4LCUB 3BI9X 2F8XC 4QT5A 2AEPH 3KPRB 2VLKD 1K2DA 2GJ6B 1BQHB 5AYQA 1ACZA 3BKMH 1ADQH 1YEDA 3UYPA 2QL1A 4S1SL 3LOWA 1ZTXH 3T0XA 2KKQA 3R0MA 5AZEL 4U2YA 4MQ7A 5CHNA 5TQ2H 3LD8C 2BSSB 4OUUA 1FFRA 3HPJA 1CL7L 5C0GA 3R1GL 4TVPE 1FL5B 1OF2B 1DQJB 4XVSH 4HBCH 5DEGB 1MCSA 1L6XA 4ZUUB 4A6YL 3HFML 3T2OA 3AY4A 2CJUL 4H1LA 1QEWB 1R5WA 5DI8B 4DUXA 1IL1A 5FM5M 3GSXB 2B20A 4HIHB 3TCXA 3PABA 3HMXA 3SKMB 3PWPB 2GITB 4XNUL 4I9WD 4PJ9C 4MNGE 4QGTA 1EBPA 1I7UA 2YA0A 4KRMB 4FMFA 5F9JA 3TH2T 1DVFC 1TZHA 2CUHA 3EOAA 4HK0A 4YR6B 3NCYP 2MQCA 1X5ZA 3FQTA 1W0WA 2DQFB 1DJSA 1GOFA 1BVLA 3PXJA 5I75C 1NEZB 4WO4C 1X44A 1EFQA 3QXAB 1F8TH 3HMXH 3NABL 4TVSa 5KG9A 2B2XH 2EDEA 1F6AB 1MCPL 2GFBA 5FV1L 1HHKA 1KEGL 5D7IF 1AGCA 3EYVB 5AAMA 4NUGL 4CADA 5ICXA 5DMGD 3NFPA 4K3GA 1PQZA 1MCBA 5T33L 4NFBA 5CINH 1EK3A 5EBLA 1MCEA 2BK8A 4F7MA 4OFYD 1YEHL 4UZGA 2WMPA 3BOVA 1IL1B 1HYSC 2JELH 4ODTH 5J89A 2FBJH 2GSGA 3T3PF 1DSFH 1I9IH 4XCNB 5H94B 1HSAB 1S7WB 3MV7D 2D7QA 2R0KH 2FHBA 3I6GA 4JFFA 3X11A 1IAIL 5EOTB 4HJGA 3UTTE 4WI9A 3DO3A 3QRGH 2APBA 1NJ9A 2EDFA 4YHZH 4GSDL 2N4IA 3L5IA 5D1XC 3QXDA 5H94A 5E8PA 4ELMF 4V1DE 4CRPA 1K2DB 3L3IA 1U8IA 4UU9B 3LH2H 1QR1A 3SE9H 1HQRB 2MKLC 1KJVB 5DLMH 1AQDA 1EO8L 4FNLL 2PYFB 3OZ9H 1FVDB 3F5WA 2JJTA 1PQZB 3RWCB 4L4TA 4K3JH 3FB7B 4MYWB 4FA8A 4GW1A 2B0SL 4QYOB 2GTZB 1JWMB 5CKAA 1P7QD 3K1DA 2DM4A 4KH2A 4YEFA 4MJ5A 4YXKH 4NKIL 4NQDB 4M7JL 4CN4A 3KJ4B 1EEQA 5T1KD 3ZKMD 2YHGA 1BOGB 4J3TA 4FFZH 3CAFA 4S0TD 1I9EA 4NQDE 4GRWH 3MOBL 4MB4A 5IP4A 1OARL 5GJSL 1W0WB 3N0PB 1CDUA 3EOAB 1A4KB 2ID5A 5DMIH 4EN3D 4ETYA 1LEIA 3QIWB 2ZSVB 1KN4H 1CR9L 3TYGL 5DF0A 2NY1D 1K8IB 5C0NC 5B3JE 1R3JA 2G5BA 3L3HA 2E8ZA 2P44B 1EGJA 3TIDA 1A7QL 5GISL 1MI5D 4YHMH 1GGTA 3JZ7A 3BEVA 5F1NB 4QHMA 1AGBB 4UILL 4MNHB 3R1GH 4PV9B 5BS0E 3NVQA 4LPYA 5HHVL 5FYKD 1G6VK 4G9FA 4Z7WE 2J2ZA 1XH3B 2XWJB 4HS6A 2FYYB 3EJYC 5KBNC 1F90L 3VXMD 5C0GB 1IKNA 1FH5L 3SO3B 2XKNA 1CD9B 1MNUH 2P5WA 3LV3A 4WHTB 4ZOAA 5HGGS 4UIKL 3IKCB 1NGPL 3BP7B 4UBDD 4LKXA 4WUUD 2N1KA 4YWGL 2K1MA 3UTTA 5GZOC 4HUXA 5IVXE 3RKDC 3QDGD 1DEDA 4LRNH 1KBGL 5HYJB 4MD0A 3DYPA 4X7CC 4PLOB 1SEQH 2DF3A 3T4AB 3NCCB 3BZFA 1BBJB 4V1DB 1HH9A 2Z31A 5F21B 4WNQB 4X4XA 4Z5RA 2OLDA 3FQRB 3ARGC 1TQCC 1CF8H 5F7HA 5GGUB 3BRDA 1EA9C 2E9WA 5JNYA 1F8TL 3NABH 4PBWD 1FN4B 4WDIA 3T65A 5A43C 4R4FL 5GHWL 3ZHDA 1U8JA 3LIZH 1MCRA 1MHEB 1RI8A 5CZVL 2NY5L 1FNGB 3HI6L 1QLRB 4EN3C 3HB3C 3WNPA 1J0KA 2VDKL 4XX1E 5I1LA 3FHAA 1YEIL 4LHUG 2NTFB 2VYRE 2O5ZL 3ARBD 3D0VB 3K7UA 5IF0B 3BIAX 4OLWH 2FEEL 5I9QC 4FQXA 2AS5M 3VGFA 1QSEB 3HMXL 5FYKE 3QRFM 4PJAA 1UM4L 1CG9B 4Y5YA 3VXUB 2OL3B 4PJCE 1A7PH 3FO0H 5CGTA 3CUPA 4CDGC 4L1DA 1ZOXA 3DURB 4NN5B 1CDYA 1VESA 5C0RL 1A7NH 1MFNA 4GBXC 1LO0H 1T5WB 1NAKH 1Y6MR 4HULB 3VD3A 4L8CB 3V5DB 1NCCH 1CVRA 4M6OH 4PIRF 5FDWA 4X6DB 2JB5H 4HKBB 2H8PB 4LASH 2FATH 2D7TL 2B4CH 1JZ7A 5ISZE 1WT5A 3TWCH 1I1YA 3MNVB 3QDAA 5BVJB 2BSED 4UIMB 1XT5A 4OCYL 4G6AD 1T0NB 1CGSH 2J5LC 1KCVL 2JK5B 5I76A 4I18A 3ZT6A 2E7BA 4LU5L 8CGTA 2OM5A 4MXQD 4PJGA 1AJ7L 4P3DA 4JN1H 1I1FB 1QKZL 1UJ3A 4I77H 2EDYA 3SE9L 3IXTB 1HILA 5CCKL 5E2UH 1QZ1A 5J56B 4KDTA 1DN2A 3RVWC 2AERT 4IRSB 3G6JE 3LKRA 4N0CC 4M7KL 1Y6KR 1XGPB 1DQQB 1PFCA 2BSTB 1ZHKB 2Y72A 1OSZB 3BE1L 4LIQL 1G7JA 5BV7B 4WUUA 3HUJF 3KXFE 1Z2KA 4NKIH 4ZO7A 2HKHH 1B6DA 1GRWA 1PYWB 4OBRA 1I3RB 5F3BA 1MFCH 2DL9A 4JVWA 5IW6A 4TTDD 2DWEA 3V6OA 2RQ8A 4B50A 2WSKA 3UYOD 1XGTA 4KY1H 3JV4B 3B9AA 1G7HB 3KPOB 4XP6H 3DVNA 3TGXA 3UO1H 3OPZL 1F90H 3ZKQD 4UAOB 2X42A 5FB8B 3VWJC 2YPVH 4X4ZA 2YC1B 2XWTB 4JANB 5DVMA 4G5ZH 5KSBA 2EH7L 4TVPL 5F8RC 2DQHL 3GMLA 3UXFA 3CZFB 4JO3H 3MLUL 5E8OB 2G60H 1HXMA 1NMBH 4GQ9L 5C92A 3T0ED 3WV0A 3OJDA 4OD2A 2D7MA 1FYTA 3KYNA 2JELL 4ODTL 4E5XB 2DM2A 5J11B 1TZGH 5T3ZE 2BVQA 3F58H 4U6VL 1C12B 3QUKA 3HE7A 4R8WH 5IESL 4G3YL 3OR6A 3P0YL 5GGSA 4RA0C 1NCAL 2FLBT 3GMNB 4Z0XA 5I8KL 3UZQA 3MLYL 3QISA 4M00A 2IMMA 5CZVH 4G8IB 3TBTA 3QXVA 5D1QC 5FKPA 2D3VA 4GAJH 1MRDL 5DVOA 1ZGLP 2BOCB 3U4AA 2XT1B 4UDTA 2VUYA 3S3PA 1MHHA 4JPVH 3AB0B 4Y4HA 2FJHB 3WJLA 5JPNB 4JGMA 1FCCA 4KUCD 2J1KA 1GOHA 2DL2A 1GGIL 3KLHD 1YUHA 4BFIA 3RWEA 3RVTC 5I19L 1KLFA 3SJVB 1R3LA 3MV9B 1U2HA 3BHBB 4OLYL 1YJDL 1DDHA 3N9GL 2NY5H 4ZS7H 5FK9A 3H9SB 5F9WC 2E3VA 4P5TB 1G7IB 2GT9B 2NY4C 3CXDH 4LAQH 1INDL 5JW3H 4KJWD 2ZUQB 2IANA 3UTQA 1FDLL 1PSKH 4RWYH 4HKZB 1QPPA 4MB5A 5C0FB 3G08B 3ZYOA 3RZCB 3ARTA 4MB3A 1CR9H 2W07A 2MHAB 5INDA 4QCIB 4NNXA 5TE4L 4LCIL 4L8SC 5DJXA 5E6IB 4RX4A 1Z3GL 5HPMA 1NMAL 4XH2B 3G6JA 3CC5A 3RGVC 4MXVF 1KV3A 3PP4H 5MERA 1WVZA 1WBZB 3CSYA 3GI9H 4ORZC 4QCIA 4F8TA 5JOFA 4EDXA 4HWBA 4ZFGH 3BT2L 3LN9A 3H3BC 4GRLB 4OF8A 4RDQG 5DRXB 5SWSB 5EU6B 4X99A 1A6TA 1PEWA 2V7NA 1KN4L 3MRKB 3VW3H 1XZ0B 3TYGH 3V79C 1ZKAA 1RZGA 2BNQA 2R23B 5FGSA 4Z77A 1NH6A 4GW5A 5IJKA 4Y19B 4JFOB 2XYCA 4J3VA 1YN7B 3I3DA 4LLWB 4WI4A 4UOW0 1KXVC 1MCHA 4TUJB 3SKOA 7FABL 4HC1A 1H3PH 1M7IB 4X5WA 1YYLL 1FVCA 4G8GB 5ADOL 3C6LA 3QNZB 4ZFOL 1FC2D 4EIZC 3KYAA 1OTUC 4QY8B 5CEYA 3IU4H 3SJVA 3WFDL 1KB5A 2VLRA 2X09A 1U3HA 5DQJA 4A2MA 1G0DA 4RAVA 1YUHB 3B9KC 4MA1C 4O2EB 1UJTA 2VAAB 1UM5L 1QHPA 4G6MH 5I9QB 2W0PA 2ATPA 1QSFE 5FUZL 1F3JA 1WTLA 2FX7L 3U1SH 5CILL 1U8OA 3QXWA 3L5XL 2NMSA 4XBEH 3TBTB 1UZ6E 1FGNH 3NPZB 1ERNA 4NO2A 4DEPC 2I9LA 2XQYK 1CK0L 2NY4D 4TVPH 4MNQA 4X83A 1E6OH 3P3YA 3RY6C 2Q7YB 1ZT7A 4WWID 3LKPA 2WLZA 3GMOA 3FMGH 5CD5D 2GJ6D 4LLMB 1RJZB 5C0EA 1UYWL 2YRLA 5TF0A 5HGAB 2V17L 5E99H 4FQ1L 4K8RD 5F93C 2Z35A 3ZDZF 2IQAA 4ETQA 1EDQA 4XHJC 2PXYA 3TC9A 5L7XH 1CQKA 1NCDL 3M17B 1QHOA 3OWEA 1IAOA 4NRXB 3BZEA 2IAMD 1BEYL 4X6EA 3QDJE 3ARUA 2DIBA 4OLXL 4C59B 5I73C 4X8JB 5KVEL 1YMMD 1RUAH 3ARBB 1AIFA 3L3GB 4GKZB 3U0TA 1IJ9A 1I9JH 3LKQB 4W81A 1NC2A 3OJ2C 4YHIA 1W72A 4M61A 1TZGL 4X8JA 4XC1L 3QEQE 3QDJD 2YZ8A 3PL6D 5DQ9A 3RL1B 5FYJL 2VUOA 1B6UA 4GLRI 5FA3A 5I15L 3B9KD 4KMLB 1FVCB 4CJ0A 1ZLSL 3MRBA 4ETQB 4U7MA 2NY5C 3DHMA 4NQUA 3VWKD 1OSZA 4XPGH 4XBGB 1JZ6A 3RNQA 1JGVH 2PCPA 2PO6B 1A5FL 1X4XA 4JHWH 1OAXL 4OTXL 4TOYH 1N6QH 3H6JA 3IJHA 3OB0H 2QHRH 2J4WL 3NCFB 3OHXA 4HKXB 5D1ZC 3SY0B 3PWVB 3QB7C 2AGJH 5SWQB 2A74B 1D9KB 2WIIB 5ANMA 5E7FA 3MQIA 1U8OB 3LPWA 4YHPB 2IQAB 5ESAB 3RZWA 4AM0A 5C0CA 2I24N 1NPUA 3VGAB 2G75A 2ZCKH 4LP4A 2Z91A 2Y23A 2VZVA 3TZVD 5HDBE 4UIMA 1UGNA 4XRCA 2HJFB 4PGBB 5C9JB 3TNNB 4F7PA 5ISZD 4W6YB 5I8EA 3PGFH 1HKLL 3SJVE 1K4CA 1D5ZB 3MJ8A 4JRYA 1YC7A 3VFRA 1BVKA 3NPSB 5JXAH 5IR1B 2QADC 2A73B 1KB9K 2HWZL 3GM0A 4X9FA 4XGZA 3SGEH 1RHFA 3Q6GL 4JFXB 1M05A 2BNQB 4HUVA 3G6JF 5FHBH 5HVWA 5L2KE 3I50L 1I9RL 4NT6A 1LO3L 1WQVT 3HPLB 5CEZL 5B3NA 4XB7A 1RUKL 4WGVB 3FN3A 4K3DL 2J88L 4DGVH 4UDTB 3LEXB 4K7PL 3SDXF 2CXGA 5DGRA 1GPOL 3MV7A 5MEOA 5E6YA 3O8XB 5T1KB 3PGCB 5C3TA 4H25B 3X3FH 4X0KA 4D0DB 4JO2H 1ETZA 4PR5A 5IIEB 3FO9B 4P5TC 4NQTA 1V3JA 1T1YB 1I3GH 3PE9A 1JGLL 1F2QA 4LCCA 4N5UA 1ZA6A 3QT2A 5CJBA 5DFTA 5E24E 1QBBA 2UYLA 3RWGB 5EBWA 1FNLA 5C09A 1YEJH 4GKOA 3QUYA 1N0XL 5GJTL 1BZ7B 3O0RL 4XPBH 2A6IB 4JQXC 1JTPA 4MA8H 3F8UB 4G8EA 5FOBA 1J1PL 5IKCB 1E6JL 4JO4L 3ZE1F 1MJ8L 2GSIB 3O45B 1KTDB 4K7FB 5HHOD 1KTDA 4XCFH 5B8CC 1FAIH 5TDNA 3JWDL 3UJJL 2FJGA 4U1SB 1YQVH 3WHXA 2I60L 4BZ2H 4EXPX 3HNSH 4KTEH 1MFBH 2A6IA 4HZAA 1IEBA 2GT9A 2X89D 3BX7C 5GS0D 1TJHL 3FAXA 3G6DL 4HXBH 1UKTA 2CKBA 3V2AR 4OF3A 5C6TL 2UYLB 2W0LA 1JNHB 3RWGA 2NY3D 3HI5H 4OIBA 2P5ED 1ZWIB 1IGCH 4JHAL 2QBWA 3C9NB 5FM5O 4GG6E 5ACMA 2Q8AL 3TNNA 4F7PB 5ITBL 5GGSB 5B38G 2Q87A 1H0DA 3FRPA 1LDPH 4X5XA 5FGCB 4EKXA 1X5FA 5HHXH 3VI3F 1PZ5B 4M4PA 3GSNH 4MXWH 1Z9SA 2BSRB 4JQVA 4UT6H 3LN4B 4M5YH 3IFNL 1HINH 2GAZB 3BFOA 1AO7D 3LKOB 2XQYG 4RWYL 2ADIB 1UH4A 2PTUA 3I6LE 1A4KA 2IBGA 2V9QA 4LLQA 4Z0XB 3CFKB 3ULVH 3PGDB 3RDTD 5CJQH 1KPVB 4M9OA 4Z9KB 2CQVA 3OAUH 2JCCF 4NCDA 1OQOA 1S3KL 3ZTNL 5C2BL 3GMRB 2PCPB 5J6GB 2OS7A 1A3RL 4Q97A 3BVNB 4PY8I 4E5XA 3PDOB 4J6RL 1T03H 4PB0H 1I1YB 1DLHB 3HFMH 4JRXD 3TT3L 4ZUWB 1EO8H 3MNWB 4PTTA 3V52L 4EN3B 2E7HA 4PJDE 5BO1H 4PGDB 5IFAH 3VXME 3BQUD 2M8XA 1EAJA 5E8EA 4Q6IB 1RUQL 1QBLH 1I3RA 2H9GB 5IFJB 4KQ3H 4S1SH 3DURA 3EW3B 4OF5A 1WBXB 5DMKA 4C54A 2YOCA 4GKZA 4EI5D 5DD0L 1A1NA 1FVEA 4YHPA 1KIRB 2E6PA 4OZHE 4PJCA 3WKNA 5C0JB 1U93A 4XNQA 2DWEB 3RNKA 4CGTA 4I0KA 4S11A 5E99L 4F8QA 2DD8H 4KZDH 1MLBB 5IB5B 4KJWC 5HYEA 3PWLB 1T83C 2ERJB 3KPRE 1OTTC 3CXHK 4UI2A 5JORB 5B4MD 4JKPL 4L4VE 5IBTH 1QRKA 4ODVH 2Q3ZA 3T65B 4OKVB 1OY3B 3LKNA 1M1SA 4GAJL 4LRNL 3WIHA 3N1GC 3ES6A 1F4HA 1NCNA 1HH6A 3EO9H 1OAQH 3CVIH 3IDIA 2NY6B 3MXWH 5GSVA 2CKNA 3VG9B 1FO0A 4XPTH 2DBLL 3EZ8A 4WFGD 5J57B 2VZTA 4XMLH 1QSED 1DUYA 5FKAA 3O6LL 4P9HC 7CGTA 1LO5A 3OAYK 4MD0B 4YQXL 5J1TC 1KJ2H 3VFMA 5SX5K 4EBQL 4IRSC 4HHAA 2AP2A 2DYPB 1AGFB 4GKSB 1I75A 1JCKA 4YIQB 5F88B 4Z76A 3SGKA 1UCTA 4F80A 1EPFA 3VRJA 4Y1AA 3U6RB 2ITDA 3VI4E 4BH7A 4QTHA 3C6LB 1I9IL 3VJ6B 4RFEB 5KJRL 4TUJA 4MDJA 2IEPA 3A0OA 2B8OT 3B83A 4APQC 1AI1H 1AKJB 3E3QE 2AK1L 3NTCL 4MA8L 1IGCL 4JHAH 4YHNA 1UQSA 3TESA 5C0DA 1IKFL 3G6AA 1XF5A 3KWWA 3RX8A 4UTBH 1KXQE 4OIAA 4P2OC 3B4NA 3K8KA 4C56B 1K85A 2IH3A 2Z31B 1MFBL 1BD2E 3P0GB 4XCYB 4XPFL 5EBGA 2VZ1A 5KSAC 5EIIB 3D3VB 4U6YA 5LJYH 2FL5A 2UVEA 2R69H 1MPAH 2B0SH 3W39A 5F71A 5HGDA 1MRCL 5F96L 2J4WH 3GB7A 1T66D 5DDHB 2OI9C 4K8RC 4ZNCD 1HXYA 2P43B 4MAYA 3FFCD 3BISA 3B2UC 2C4FT 5DRZA 1KXTB 5IHBA 4KJQC 2WP3O 4UILH 3VFPA 3VXQB 5F9AC 2VLKB 4Y2OA 3ULSA 1YN7A 4LLWA 4MAUH 1BGXL 2RJMA 2IF7A 2YN5A 1CE6A 3R8BB 1R3LB 2V7HA 1AGEB 5CFHA 4JGJA 3IVKB 3LS4H 5C8JB 3SGJA 1KFAH 1NGWA 3O4LD 4P2RA 4OCYH 1UM6L 3RI5F 1FV1B 2HWZH 2DQTH 4LSUH 4XBPB 1WBZA 4JRYD 3IS0X 5IBUG 3O3DA 2R2HB 2DQUL 4WWKD 5T33H 5CINL 5HGHA 1K6QL 3MBEA 1LP9E 1KULA 1FG9C 2HFEB 1I3GL 1S7XA 1YEFH 1ZLUK 2MHAA 4P57B 1D6VL 4OLEA 2J8UF 2B5IB 4MNGB 4GKNA 1OPGL 3EIFA 4LCCC 4B5EA 3OF6D 4R0LB 4TPRH 4QOKD 4DGIL 4DVRL 2B39A 1H5BB 2RFXA 5J12B 3IJSA 5I17B 1UEMA 2CRMA 2ZKHH 1CIDA 4HC1L 3H7LA 2HJKB 5D93C 5KG9B 4CN6A 5GGTL 4ELMB 1MLCA 4BQ8A 4NO0A 4U6HA 3NGBB 2JJVA 4LL9A 1LO2L 5F1IB 5C0BA 4EVNB 1NCTA 4HGWA 1ES0A 4ZXBA 5I1AB 4NUJB 5BV7H 4JKLA 4WHDA 3L3IB 3VXOB 2VAJA 1VFUA 1FYHB 5EA0L 3E6FB 4NDMA 3KPPA 4ODWB 1SJHA 2ICWJ 1MVUA 3U46B 4MS8D 1UWEL 2VMFA 1OM3H 4L9LB 5KAQF 5F7KC 3I6GB 1P84J 4JFFB 3X11B 1I7UB 1BJ1J 3GBNL 3IS1X 4GG6F 1BQLH 1A5FH 4B0MM 3EJZD 1SBBA 2X4TB 2C4XA 4BSWB 2X4TA 2O5ZH 1C12A 3QUKB 5JW4N 1MFAH 4G7YL 4XVTH 5D7IA 1JPGB 3I75A 4X6CE 5KSVA 3SDCD 1HI6B 2BNRB 5IK3B 4X4MA 2BVPB 1A7PL 5GPRA 3IFOA 3RBGA 4KXZI 3KYMB 5CHNB 3ZTNH 1P7KA 5I8CA 2Z8SA 1HHIB 1XR8A 1U8MA 2M26A 3O2WL 2Q3AA 1CD0A 2H32B 2F54E 2AJUH 1DE4A 4FQJH 4UBDC 2ZOLA 1SJXA 1R3IH 2GJJA 3DV6B 3SDYL 1KN2H 4JY6B 2VSCA 4YDJA 5HYJE 4HV8B 1FYTD 1G6RH 4XCEB 1EJOH 4KKAC 4X7SH 5GIRA 4L3CA 2BX5A 1F11A 2A6KB 1G7HA 1CBVL 4ZPTB 3P9LA 4JM2B 2FLRT 4NCC2 4OLVL 5KS9F 3WN5A 2E9IA 4K94H 4XNMB 3VG0L 1MRFH 3ALPA 1NC4A 1FG2A 3GSXA 4BUHA 5EUKA 2LQRA 3IU3A 3CFJB 3WFEL 3GHBL 5AUMB 3UTSE 4XPFH 3HNVH 1S7XB 4HMCA 1RUQH 3RWDA 1GXEA 3RJDA 4Q6YA 1LP9A 4JY5L 4MCYA 4TNVK 1Q1JL 2NCMA 1MIML 1UB6A 3JTTB 3FAWA 1Q8MA 3BDYH 1ZVYA 3KYKL 4KZDL 2XTJB 4YWGH 3DV4A 4ZYKA 1QFOA 5D96C 2AK4E 4JG0H 1OGTA 4DTGL 4KK6D 4HBQA 3KPSE 1RZ8A 4ISVB 1HK6A 1U8NB 1EO5A 4J12A 3MRRA 5BVPH 1R5WB 5EO9A 1Z0MA 4N0RA 5IVZB 4BZ1L 1Q38A 1DVFB 2AJZB 3BH9A 3CLEL 3PWUB 3BH8A 1E4XL 2ORBL 4G9DB 4YDKH 5JOPE 2V2TB 1MWAA 1ITCA 3OPZH 1J88A 2DLEA 5J13B 3EDDA 2K3TA 1H8SA 4N8VB 1OD7A 4PTUA 4R8WL 4KJQD 3P2TA 4LNRB 2HVKB 7FABH 5FF6A 1W8NA 3OAZK 4CVZB 4YPGA 4YUEL 4PJHB 1BQHA 2G5RA 1GZQB 5ERWA 4YHKL 2RCSH 4NPYA 1RZKL 2OTPA 3DX9A 3PP3H 4QNPF 1N6VA 3O81A 4Q74A 4F15B 2R8SH 1CGXA 1QFWH 5EO0B 5HBBA 3QDME 2QKIB 3EDJA 4PJHA 1NGZB 5FYKU 5C6TH 3BP7A 3TIEB 5DC0A 3LV3B 2VLLB 3BP6B 3PWNB 3D0VA 4PFEA 3KWWB 4M1DH 3KPNB 4BFBD 5JHDB 2KQMA 4I9WE 1A6UL 4I13B 4Z7VA 3ULVC 2XXMB 2CPCA 2AI0L 1F00I 3UBXA 2DTMH 2YKLH 4YLQT 1VFOA 1EH9A 2P24B 12E8H 5SWSE 5HHME 4H8WL 1CZ8L 2HFGL 1OGAA 4S10A 3QA3B 4KK8D 2VDRH 4RDQF 1LEKB 2R56L 1INDH 3BESR 3OXRB 4OF6A 1EBAA 5FO9A 1EMTH 4RBPK 1FPTL 2VLJE 5F6HI 5GRWA 3U4EA 4NM4H 4EI5C 3QFDA 4NHUA 2ZUSA 2AEQL 3OKNB 4XPAH 3MLSH 1W2KT 4OF0A 2JIXB 3M1BB 4N1CA 1AC6A 4OCRH 2X4OA 5IWLC 2NW2B 3S34L 3N1FC 4OZFB 3QCVH 2C1PA 1J8HE 1RIHH 4JFDA 1I1AC 5CCKH 2ZNWA 5D6DC 2ZUYA 4PY7B 3OGOE 3QHTC 4CVZA 5CIPB 5C6PB 4KMTL 4PJAF 4D8PA 2A9MH 4LLVA 5I8CB 3IGAB 1UB5B 3F65A 4ZFZB 5B38B 4NGHL 1JWMA 1N7MH 5T5NG 4ZNEE 2X4NB 3B2VL 1A14H 5FXCH 1DBJH 2EECA 2HT4C 5HYSA 3S88L 1VSCA 3TJEH 4ONGL 4YDJB 4B41A 1KTLA 1OD9A 1YYML 5JIHA 2YD9A 3R06A 3S4SG 3NZHH 4OZ4B 3CPLA 1T89A 2NLJA 2AK4A 3AFLA 1QFHA 3U83A 5C07A 5BRZB 3GGWA 4HKJB 3IDYB 2NZIA 1DBMH 1T1XA 4Y4HC 5EU3A 4M6NH 3ALWA 4LSPL 4LSVL 1KC5H 2NXYD 4HK3N 4PJ5A 3INUH 5D1XB 5HYFA 4G8FA 1HSBB 5IESH 2DQHH 4PGEB 3MV8E 5EZLB 4PJEE 4Z7NF 4UNTA 3CFJA 1U3YA 2HVJB 3LQZB 4MHHI 4XP5H 4EEEA 4OGAC 5K9JH 3HZMA 4EVNA 4YH6A 1IGYB 2RGSA 4OFYA 3REWA 3U0WH 4HC1H 4P9HL 2J8UB 3OB8A 1JN6A 2VDLL 3ZDXE 2ZP0T 1SVZA 1LO3H 1PKOA 4JQXA 1A1OA 4R3SA 2CSPA 1A1OB 4UV7H 1G7MA 3DSFH 3OQ3B 3LS5L 5LCVL 4M6AA 3LEVL 3QDMB 1KG0B 4JFQB 1JN6B 1GPOH 1UXSA 2X7LB 2VQ1A 1NEZA 1AQDB 1GVIA 1B4JH 2OXGA 3VDCA 4F7TA 1I8LA 3HZVA 3QHFL 4JDTL 4EQ2A 1BZ9A 5C0BB 4OZFA 3MCKA 3BWUC 3QIWC 3MR9B 4LLQB 1DFBL 2X4OB 1VB9A 4N90E 2UZYB 5I6XC 3DETC 3QNYB 4BZ1H 2JIXA 2R8SL 4G9FD 1SEQL 2VXTL 5BXFB 2WLYA 1IARB 3NOIA 1UXWB 1TTFA 4YAQB 1AXTL 1E4XI 5MP6L 5DR5H 3HE6B 4QXTA 4KK6C 4GRWB 4WFFE 1DL7H 4QOKE 4RGMC 4R90H 1NANH 3UTSD 4DN3L 3Q1SH 2EDRA 3FO2B 5GQBA 1P7HL 3IVKA 3SCMD 4QF1A 3EFDH 3O0RH 1FE8L 3KPSB 4X6CF 5JPMB 5KVEH 1SEBB 3MRNA 4RFOL 3JV6B 5HYSB 5EU6D 1X6LA 3QUZB 2IALB 4MAYC 3HR5B 4ZFFA 2ADGA 3BRFA 3QUMB 3P4LA 4JZOA 3KPNA 4ENED 1KN2L 4ODWA 1Q9OA 5FAAA 5JIKA 3FCTB 3ZSSA 1MWAL 2QSQA 3LB6D 5D8JH 3L3OA 3BQUA 43C9B 4OZIE 1Y0LA 5ESQA 3WDJA 4W70A 1X5XA 2GSIA 3O45A 3STZB 4CU7A 3MREB 4HQQL 1I1RA 1ZGLA 4L5FH 5HGDB 4QO1A 5A2LH 2K7QA 1NUGA 3DARA 2ZUUA 1LMKA 3RVUC 4WFGE 5ITBH 4YX2H 4KK9D 5CBAB 2IAMA 3VRIA 5I1GH 4MJIB 4NNYB 1S7QB 4C4KT 2OZ4L 1A7NL 4N8VA 1ACYL 3KPLA 3QUXA 3ZE2E 1E27A 3MC0A 2XN9E 3HMWH 5JA9A 3RY4A 1KB5H 3MLWL 4HZLB 1CU4L 4PLJD 4X6FA 5HY9B 1D5MB 4M93B 1DP0A 3LMJH 4OJFH 4JFFE 2DAVA 2LU3A 1CT8B 1XGQB 4S0SD 2SEBB 3D5OF 2KQNA 3MRRB 3J7HA 4ONGH 5JMOC 2O26U 2IH1A 3O8XA 4AL8H 2H1PL 4U1HA 3AMKA 3C08H 1CXLA 1G7QB 3BP6A 1N6UA 3RTQB 3OG6B 3RTQA 3JWOC 5C08A 4BSVA 2FB4L 1U6AL 4QHLB 2X2YA 3GJEB 1PX4A 3M07A 4JO1L 3FONB 1LP9B 4JHZA 5CJOL 1E4JA 1JF1A 4KPHL 4M6NL 1YECL 3NACH 3UBXI 1ZLWH 4UIKH 5HY9A 1H3WM 1BVKB 5GGQH 4JO2L 3WUWA 1CFSA 4M43H 4QXWA 2HVKA 4HLZG 4XP5L 5T3XD 3S36X 4PGBA 5C9JA 5MEPA 5GS2H 5DEZA 1QNZH 1VEMA 1XGRA 1H3XA 2EDJA 3V52H 3RVXC 1AY1L 4AEHH 3DVGB 2J3SA 2V5TA 2Z31C 4LSPH 4HCRH 2N7BA 1IAIH 4PJBF 5FKAB 4E41D 3GZKA 3RPIA 1G84A 3BP5A 5FYJH 2WIIA 1IE5A 3IFLH 1P7QA 3GO1L 4K9EH 4RGOH 2IH3B 4XVJL 2CRYA 2DWDA 2AJYL 2EE2A 5GSVB 2EH7H 1VACB 1CDGA 4QWWC 4PRPB 3EO1B 5DD0H 4N0FB 2VH5L 5CAYB 5TE7L 5JW4Q 3ZE2F 2ZJSH 3LD8B 5BJTB 3TEUA 4HUUA 5IT2H 4XBGA 3FN0L 4CBPA 2E7CA 4NZUH 5DMKB 2F9BT 3T08A 3QEUB 2NNAA 4F57H 2JJSC 4MDJB 3WIHL 1T21A 5K9OB 4ERSL 3DTXA 2X89A 5E9DB 1FG2B 3GSUA 1X7QA 3SHSA 4R4FH 4P9MH 2CIKB 4QRTA 5EBMB 4HUNB 3AS2A 4RAUB 3HG1B 1HCFX 1OP3H 3HA0A 1NDMA 2H41A 2EDQA 5D70L 4UAOC 1A1NB 1FVEB 4FNLH 4XP4L 3UTSB 4TOYL 3BYTA 2J8HA 3U0TB 5GGTA 3U9PL 5F9OL 2XIDA 1FSKB 1RY7B 4LLDB 2VSDA 3DMMD 3MLXH 4M9PA 3KJ6L 3ZDYF 4U0RC 3H0TB 2BXYA 3BIKA 4I0PC 4PJAE 3QJHB 5TFSL 1BD2D 1YMME 1GGIH 4P46C 4LCWA 5IHUL 1MRFL 1KLGA 4PGZA 1CIUA 3FQWA 4IMLB 1QRNE 3LN5B 2AJSH 5T1LD 4OKVA 3EDFA 5EZOH 3RGVA 2GJZB 4LRIA 1A9EA 1A9BB 4J1UB 4HGMA 3ILQD 3V5KA 3L3JB 5F8QC 1HYRC 1ACYH 4LCYA 3WLWC 2JJTC 2FIKB 2IGFL 5C09E 4NQCB 3MUGA 3RJQB 1KPVA 4J2XA 1BECA 1MJ7L 3CFKA 4JM4L 3B3IB 1MHCB 4DUVA 1A7QH 1HSBA 5IFHH 3G5XB 1X5AA 3MRMA 3MV9E 4M7ZC 1AR1C 5A40E 2Y07H 5E8NB 4X9HA 5BVPL 4M8QA 3F7PC 3MGTB 1NCWL 3JWOH 5KW9H 1U8HA 1T03L 4HKJA 3BWAA 4L9LC 2FBOJ 5C1MB 1UEYA 4WFHD 3VGBA 3GI9L 5D1XD 5EUOA 4UT9H 1FH5H 4HGWB 1FBIH 4O9HL 3U7AA 5D4QA 1KTLB 4PYGA 2QSTA 3U0PB 4PGDA 1P5VA 1NFDB 3B9EA 2YPVL 4G8GA 1ZVHA 4NBZB 4K3EL 4TQEH 2VLRE 5DURB 5JXEA 3AAZB 1NGXA 3IJSB 4AH2B 2DBJA 5KSAD 1U8QA 4H20H 3MLVL 1JYNA 4D9QE 4KY1L 3ARFA 4K7FA 1PLGL 2OR9L 1T1YA 4XNZB 2PW1A 1INEH 4JFDB 3FO9A 1DANT 2ZOKA 4NN6C 5INCA 2ZZUT 3TBVB 4J4PC 1FQ9C 4DCQB 1FLTX 4MDIA 4NSKB 1A7OL 1JYXA 5DFVD 2FGWH 5J11C 2JF1A 5F6IB 4Z7OF 1A21A 1EUUA 4ONOA 2H6PA 4J4PA 1IGIL 2WWKO 4C56A 3QHFH 4FQPA 3QR2A 4JM2D 1FE8H 1J9CT 1BJMA 1A3QA 2X1OA 3MJGX 4K2UL 2DQDL 3VFGL 2O5XL 4NKMA 4DVBA 5LKNA 1M6OB 1CLOL 1VPOH 5EOQH 3EO9L 5MENA 3OXSB 4KVCH 4NOBA 4GUPB 4OD3H 1T04A 3K2MC 4KKNA 1RIVL 4BQCA 2H26B 4HPOH 4PBXA 4QRPA 1CGSL 4XI5D 1GJIA 4EUPA 1CL7I 1S3KH 5DJDB 3BHBA 3UP1A 1EEYA 2E7LA 1S9YB 4RIRB 2BC4A 3O8XD 5EUOB 1A2YB 3VDAA 5IVXF 1KYOK 3CDFA 2W92A 2YA2A 3KXFD 1FNAA 2EXYC 4LEOA 2J8OA 4OZFH 4QRSB 4Z7VF 2ICWI 5D70H 3DYMA 1N2RA 2FL5B 1MI5E 1QRNA 4Y16C 3RKDD 4M8QB 1A6ZA 3MACL 4MJ6B 5CD3B 1TVHA 1UA6L 4NZRL 4EJ1C 1F5WA 3I02A 1Z9MA 4DOHE 5DD5L 4MZ3A 4YPGB 4FMKA 3NA9L 4KQ3L 2D7OA 2NY7H 4PRPE 3B9VA 3MUGB 4BQBA 5D71L 3BZ4A 5E03A 4CMHC 1CWVA 1RURH 1S7RB 4LLYA 3TPKA 3GNMH 3RQ3A 1AH1A 4N0YL 15C8H 1C16A 1A9BA 4J1UA 1OTTD 1HDMA 4PR5B 4R6UA 2NX5A 1WITA 1T1ZB 3H7BB 3ZYZA 2OJZH 3MROB 4P2YA 3FB6B 5DUBB 4FTVB 3KPQB 5T5FL 2GIYA 1BGXH 4HWZB 4YDLB 1U2CA 4X7TA 5EU4A 3CVHA 3WDHA 1KLGB 3OHXB 2AVGA 2FH8A 3DETD 3WFZA 1N6QL 4FZ8H 5DD6A 4FQCH 2ADJB 4PJGF 3H0TA 5E5MB 4AIOA 1MJ7H 4HFUL 1M7XA 2OTWA 3JWDC 2YD3A 3TNMB 5CSGA 1AGFA 3C08L 4TSCH 1EO7A 1W8OA 4OCLC 2WBKA 5GRJL 1K5NB 3VFMB 3DIFB 3MBXL 4Z7WA 4Y4KC 3CH1B 3V7AE 5HGBB 2PO6D 3IRPX 4DGYL 2Q76B 5C0IB 4G6ML 2MKWA 3FTGB 3T0VA 3VXSD 2XI9A 3Q5OA 1Z0NA 1R5IA 4XTRD 5IB2B 4HXAH 1U95B 4KRLB 3DTXB 3C8KB 1PYWA 4M03A 2EXYD 1I85C 4ODHL 4PJIA 3CX5K 3OR7B 5DD1H 3ZKXC 1C1EH 3UCRA 5T1LB 5JORA 3S6CA 2H3NA 2E27L 1MCOH 2QLVB 4QRQB 3PWVA 4MZ2A 2KBGA 3WLBA 5C0JA 1DL7L 3R0NA 4R90L 5LXGH 1WWAX 3ZKMC 3P30L 5IMMA 3BP5B 4M1GL 2MCG1 1KT2A 1LNUA 1RUML 3U4BL 1KIQA 4KRPB 4NQVB 4MHHG 4UV4L 4XVJH 2NX5B 1RK0B 4OD1L 5DK2B 4PRAB 2ATPB 4NBXB 3MLYH 1XGRB 3X3GL 3NCJH 1DQLL 1TJIL 4RMRA 1FIEA 1H0DB 1MIEH 1KB5B 4XNYL 2Q86B 5JXED 2ZJSL 4ZDHB 1RUAL 4HF5L 3T0BA 4MX7B 5I30L 3MXVL 4PJ8D 4X5LA 3SKJH 1AI1L 1DLHA 2DKMA 2CDGB 5F3HB 4J3SA 4LVHC 1IKNC 5EU6E 1YY9C 1P2CA 1RZJC 1RULH 4IMKA 3N9GH 4FQQB 3VXUA 4K55A 3QG7H 3PHOB 4X99B 3U30B 4FFVC 1YNTB 3K81A 1I8IA 3TBYA 4PBVC 2EZ0D 2VZUA 4YXLH 4QXGH 4EDXB 4K3HA 4O2CA 4MVBC 2COQA 1B2WL 2BDNH 4X6EB 1T3FA 1FFOB 3MA9H 4WEBH 2FWOB 3Q5YA 1D5BB 4CJ1A 2AQ2A 2QEJA 5EWIH 3H9SD 5EBWB 3MROA 4FXLA 1FNGA 5D7KE 1YEEH 1JWSA 3MGOB 5INDB 3L5WB 1D5MA 4LCCB 5C09D 1Q9WA 2ED8A 4X5XB 5MHSD 2Q20A 3U36B 4YDIH 4YHLL 3BKCH 3GEWB 3PXHA 1HHHB 5B22A 1S7RA 2HMID 1OTSC 2DTML 2YKLL 3C6SA 2OTUA 1FAKT 4HX1A 5A16A 1LDPL 3ARGD 5SWZA 1CDJA 1D5XB 1LQSR 3CU7A 4M62L 3DRTA 5H2BA 3BMVA 1QYGH 1H3VA 1QO3A 4UB0L 4BFEA 4HUKB 5DK0B 3VRIB 3EYOA 2YPLA 4GXVH 4NWTH 3T4AA 3PQYE 2WIMA 4MDIB 5L9DL 3LEXA 2OMBA 3MREA 1Q9KA 1CFTA 1YNTA 3GSWB 3BN9C 5ID0B 2W9EH 5C0FA 4LPVA 2NPLX 4YC2C 2I27N 3QQNA 4PJEB 1U58A 3QCVL 4OZHF 3KS0J 5GS1B 1BF2A 3MTRA 2R29L 5F3HA 1J0HA 3SOBH 1VENA 5BS0A 2NY0B 3GMNA 3MJ8B 5IG7B 1IM9B 4WI6A 1Q1JH 4QHMB 5CLTA 1N7ML 3V7AG 3O2VH 1RFDL 5LWYH 4YE4H 4CDHA 3V4VL 2W9DL 1UWEH 4KJYA 4MMXC 4YUEH 1KIQB 5C0CB 1DQDL 1HHGB 2HJLB 1BM3H 4LEXH 2F54A 3QDHA 3QIWA 1D9KA 2D7PA 5J12C 3SBWC 1OCWL 4KQ4H 4EZMA 3CSPA 4WI7A 3L7FB 4KI5C 5DTFB 3CFEB 4R26L 3TV3L 5ACLA 3REVB 5D93B 1NDGA 3D87B 3MUZ1 2EIDA 1DCLA 2CDFA 2ENYA 5DHVA 3DSFL 2H3NB 1XF1A 2FX8L 2UZXB 4HKZA 1J12A 1TTGA 2ESVD 5I15H 4NJ9H 1B4JL 5MENE 3AAZA 4P5TA 3KPOA 5EOCL 3PWPE 1L0XA 3JV4A 2OK0L 4PJFA 4ZSOB 1HZHL 5JLZA 2MTPA 3A6BH 4O2CB 5SWZE 1KJVA 1S7SB 2VLJD 2X05A 5H37H 4FQ2H 2NXZB 1AO7B 2MCPL 4DW2H 5I1JH 2XWTA 4JANA 4HHAB 3SGKC 5GGVY 2WQ8A 5KSBF 5K9KA 2W0KA 1MELA 4IRSA 1LNUB 5D5ME 3VFOB 3T77B 4YXKL 2EDTA 1RULL 1UKSA 4JM2F 4ALAL 1YEGH 3E8UH 2YMXL 4KUZL 4U1KA 1TNNA 5J3HC 5IW6B 1DBKH 5E2TL 3ES6B 4E42A 5F3BB 5K9OA 4FP8H 4I3SL 4LVNB 2XV6B 4H1LG 1T1ZA 3H7BA 3V5KB 4YXHH 2NY2D 1MUJA 2WP3T 1MUJB 4OM1H 3K8MA 4LLMA 2GTWB 2VWEE 3BGMB 3EYQC 4IRJA 4C56D 4EXKA 4M4RA 2XN9D 1U8KB 1F58H 4GG8B 3TT1L 2WINA 3NCMA 4CMHB 3LSOA 4PJGE 1HXMB 2BY3A 4XAWH 3QPXL 4KGLA 5D72H 3TA3D 1UKQA 4U7KA 2VJXA 4WU7A 4JM2C 4WVRA 4XMPH 4Z7UF 5HI5D 1OP5H 3RPIB 2R4SL 3C5ZA 4MJ4A 3BEWA 3RUGB 2J6EA 1RJCA 3QPQC 3TNMA 4DQOL 3BD3A 1PY4A 4YK4C 3QI9C 1JNLH 4LIQH 1KENL 2A6JB 3EKCA 5GISH 5L2JB 4YHML 4PJ5D 2J7LA 2DS4A 2P8MB 1FC1A 1ZSDA 4WV1C 4BFGA 1EVTC 2H26A 2R1XA 5HJ3B 1XIWC 4FTVA 1LILA 4PRNB 2JLLA 2CLZA 2LAGB 1G7JB 5HHOE 5I74C 5DEGA 3TVMD 1F4AA 4PJIE 5CSBA 2BVOA 1QSEA 4D9LL 2UY6A 3H2WA 2B5IC 1B88A 3DXAB 2VLLA 4XCCL 3M8OL 4LSQH 4O51A 1VACA 1B3JA 4G5ZL 2XRAL 1OWRM 3CVHB 1HH9B 4PD4J 2EDWA 4QT5B 5E70A 5CJXA 1YQVL 4KVCL 3ZMRA 4JLRA 4GLRH 4W68A 4AY0A 1KEMH 1RVFL 1AGDB 3H9HB 2CMRH 5ERWB 3MXWL 5I0DA 1TCRA 3BDXA 2X1WL 3UZEA 4PJFE 3MNVA 1JPST 4ODXA 1AY1H 4JPWH 5D2LF 1PAMA 4AEHL 4BELD 4ZNEA 3FOMA 1NBVH 4LPUA 1G7LB 1UM4H 5LGKA 1BFOA 4WU5A 3TO2B 3ZYIA 4WW2F 4EUPB 5IBTL 5BS0B 3MRCB 3RY6A 3C2AH 2KDGA 4S1DD 4WTZG 2WK2A 5L8JB 1DDHB 1L7IH 2HN7B 5IVZA 3U0PA 2R56H 4IS6A 2R1YA 3D25A 4TULL 1T7ZA 3QPQD 4Z77B 3EBAA 3WHXB 2F5BH 4OZHA 4LEOB 5JHDD 4PJAB 1M6OA 1OAZL 5EU6A 1LWRA 4DUWA 5JPNA 3DRQA 1WZKA 4BA8A 4GRWE 2BNQD 3T0EC 1CLYH 1P4BL 4KGJA 3SDAB 3GK8H 5KANG 4Y4HD 1S7UA 1HEZB 1TMCB 1KNOB 3G5XA 5FO7A 5ETUA 4QXGL 5E6IA 1WSST 3QUYC 1MJUL 4DCQA 2AABH 3IDXH 5JPMA 3BPCB 5JW5B 2WUBL 1HN1A 1QYGL 5IJVA 3GSVB 3MLPA 1DBKL 3WN5C 3Q5TA 5T1MA 4P5TD 4QKXB 4MQTB 4ZOCA 3RDTB 4NO0D 4JFED 1Q0XL 1FNHA 5IQ9B 4Y88A 5E00B 1JK8B 5HHMB 4KKCD 4XNZC 3PV6B 3RX5A 4P4RB 3BE1H 3H9SA 1QOKA 1C5CL 4LVEA 4UUJB 5K9JL 5IW3A 1NMAH 2Y6SC 5I1GL 2ZOKB 5INCB 3OAYH 1QSFD 4KUCF 5FHAL 2HAZA 3L3KA 5E2WL 3RVTD 1MH5B 5D7KD 2C5DC 4GAGH 2VL5B 5DA4A 3O6FA 3UMTA 2HLAA 4JFYB 1M71A 1HE7A 4DK3A 2BNQE 5KVGL 5B39A 3VFRB 2X4RB 3S96B 4HWBH 1YDPA 3BJ91 5ADPL 1B4RA 2VLKE 3P4OA 4ZDHA 2QQQA 4LCYB 2X4PA 3HZYB 4GRMB 5GS1C 5BZWB 5E4IA 2BHYA 1OCWH 3BSZL 4XMPL 4LLUB 3NFPB 3SE3C 3C5ZD 2PR4L 2BY0A 2JTDA 4F3FA 5I1EH 1R3JB 4L9LA 1KPUB 2HKFH 3FB5A 3MJ9A 4PJ5B 2ZPKH 2ZSVA 1D6EB 2FR4A 5J6HB 3SY0A 1VGEH 5GHWH 1F4YH 2P46B 4ZXBC 2AK4B 4C83B 1QP1A 5AZ2H 4FOMA 5E6ZA 1A6VL 5EZIH 2DQFA 4APQD 4LLDA 4IIQA 1UXSB 3FRUA 1LO4H 3ZHLA 3FRPG 3VFVB 2R0ZL 4CUCA 3OKEB 1FNSL 1WFUA 4HD9A 4H5SA 4XWGH 1L7TH 4R3SB 1E28B 2DI8A 2GFBB 1N5AA 3RWFB 1YA5A 5IB2A 4L4TB 3IGAA 5D6CB 5DJ6A 4JQIH 1NAMH 1U92B 5CIPA 4HS8H 4P5MB 5E9DA 4NJ9L 4NO5A 4A6YB 5I16A 4IMKC 4AMKL 3HE6C 3UYRL 2VXQL 5GS3A 3ARED 3DYOA 5ILTH 3E8UL 3CUPB 1DBBL 1OAYL 2HFEA 3D0LA 3HCVB 3O4LB 2DLTA 3SO3C 1ZHBA 4U6TA 2H2PC 3MUHL 1IMHC 1E4WL 1U42A 4TTDC 1L4IA 1PX3A 2BVTA 1JNNL 3UTPD 4RNRA 2NTFA 2DWDB 4N8CH 5FO9B 3SKMA 4ONFH 4PREA 2VDQH 3GBMH 4OLZH 5KZCD 2IQ9L 3U9UA 4O00A 1R3HA 4F7MB 1WISA 4HT1L 4AIXA 3ZL4L 2JJSA 4K2UH 3VFGH 4XT1C 2R15A 3W0WA 1V5JA 3ZKXB 1CXEA 4L8DB 5JNYB 5HI4C 4MAUL 1ZS8A 1MFAL 1X5LA 4O5LH 1I4FB 1X5HA 1O0VA 5IB1B 3KJ6H 4NQCE 3ROLA 2DQCH 2QKIA 1MCJA 4Z6AT 4BQ9A 2D4DA 4RGNB 1J8HD 3NCYS 5GGQL 4BH8A 2N7AA 4ONHB 3QPXH 4HUXB 3MRPB 3QO0B 3BPNB 2A9NH 4JZJB 4LKXB 3GJEA 1N64L 4R7DB 3SCMB 4GS7C 43C9A 2WNGA 4A6YH 5IMKB 9CGTA 4XI5C 5E2WH 3X14B 5GRVL 1MHPL 3B9KA 1G7QA 5ENWB 3QEQB 3G6AB 4UNUA 1WT5C 3QEQD 4Y4KA 1G9EA 1EJ6A 3HR5A 5D1QD 3W0WB 1MWAB 1SY6L 2DLFL 1S9VB 3DMMA 4M1CC 4X6CA 5F1SA 4KK5C 5DZOA 2AJZA 3V5HB 1ZVSB 5LGJA 4HK3J 1UZ8A 3LHPL 4WV1A 1T22B 1CFQA 1WZMA 3CVHL 4P99A 5D96B 4GAYA 3TIDB 3V4UH 4YFLF 3NZHL 5JOFB 4Y1AB 4OI7A 1TZIA 4YAQA 5DC4B 4Z18A 1CFVL 2VZOA 5EO1A 4NZUL 4R2GB 3CC5B 1R3KA 2F74B 2QQLH 5J3HD 4JPWL 1YQ2A 3S5LG 3ZKND 3MUY1 4P23D 1R5VA 3WHE1 1JZ5A 1FZOB 2QR0B 4LQ1A 2NY2C 5HI4D 1TVDA 3BMWA 2NY6C 1HZHH 2RCSL 3MRJB 5I1IL 3WN5B 3V0WH 3Q0HA 1LE9B 5DWUH 2EDOA 3VD9A 2R1WA 4R7NB 1I9JL 3VFTA 1NFDA 3HRZA 2V2XB 1FP5A 3CFBB 3SDDB 3SDDD 2DB8A 4PJXA 2GEEA 1MCPH 5HI5C 1P53A 4NN7C 1V3KA 2G2RB 3BEVB 3HC4H 3IAPA 4CL7A 2WW8A 1ZANH 1BEYH 1JGUH 3FB8A 2E7LC 2NY1B 3MZTA 3RWEB 5L88L 3CFDB 1BQUA 3EOYG 4GSDH 5F7DA 3LZFH 4JE4B 5E56A 2XZQL 4WTWA 3ZDZE 3D85B 3S3SA 4I3RL 4L29B 2EE9A 3BQUC 3WJLC 2UWEE 1ZAGA 2P8LB 2FR4B 12E8L 2D0HA 2NY3B 3EFFA 4XP9H 4ZTOH 3GMMB 1K8DB 5DEFB 2BRRL 4KK5D 3VFWB 3TJHD 4G7YH 3T1FB 1C7TA 3QUZC 1H15A 35C8H 1OAXH 1CYGA 3UAJD 1YEJL 1XIWD 2GSGB 4I2XE 1P4LA 1JBJA 2ILLA 2XTLA 2CRIA 3NA9H 1RUMH 4G8GE 2VQ1B 3U4BH 4LDLB 1BOGA 4KKBD 4CW1A 1U92A 1C5CH 3RGHA 4YHOH 3HE7C 5DUPH 2GJZA 4WJ5B 1AHWA 3W11C 5DRNB 4P23B 1DQLH 1TJIH 1U8LB 1E28A 4HG4J 3ZL4H 1UH3A 3HNSL 4OZIA 1XF2A 4QRRA 3QNYA 1EXUB 3TM6A 1VKXA 3E6FA 4NDMB 4OTXH 2VXVL 4U1NB 4U1GB 1QQDA 3VXTA 3D48R 4KROD 3NGBC 3AREC 4F7EB 1A4JB 4JM4H 4LHUD 4U31A 4F7EA 4QHNB 2P48B 2XZCL 2Y7QA 5I6XB 5M94B 3QJFB 1B90A 3WEXA 1RURL 5JQHC 1WICA 4NM8L 5DA0B 2RAMA 4HWUA 4NRYA 1NCUA 4PLNC 4PUBL 2W59A 1S7VA 3W9DA 4JQVC 3FB5B 3EYUH 3GHBH 1SYSB 4OZGB 3W0WD 3SKUD 5E00A 2NY0D 5BRZA 2YEZB 4U33A 2HTLD 5I1EL 1N26A 2KL6A 4YHYC 1WC7B 1GAFH 2FH6A 1JPTH 2EH8H 3RIAF 4R96A 3EJZC 4S1RL 2UUDH 2V5MA 4XAKE 3QFJD 3ARYA 1KJMA 2X41A 3MRFB 1K8DA 1FL3A 3TFKD 1YMHA 4JRWA 3VXUD 2ZUQC 3WSQL 1C1EL 1MVUB 4Q9QH 3MBXH 2R2HA 3QXTA 1YPZB 4IRZL 2BVEA 4KC3B 4AL8L 5CEZH 3D85A 3S7GA 1J8HA 4TN9A 3ARRA 3TPUB 2AQ1A 2VR9A 4JG1L 2YPKB 3VGDA 2V17H 1CGVA 3ARSA 1LVEA 5JR1L 1X5GA 4OZ4A 1DSFL 4AEEA 1N3NB 1A4JA 1CGUA 2AJVH 3I2CH 1T89C 3HE7D 4JO1H 2I9TA 4RGNE 3W11D 2EKSA 3MX0A 4NQED 3ULSB 1V3LA 2V2XA 1VKXB 2YRPA 1K4DB 3FT4B 3B6SA 4I18C 3VFPB 5F9JB 5E94B 4OZIB 2CUIA 1TETL 1MCWW 3LPGA 2PN5A 1K9TA 5IV2A 5F6IC 4YGVB 1IEAA 4I48B 4X4YA 2V9RA 2A77L 4ODXB 1GZPA 4LSRH 3JTSA 4KXZH 4EUPG 2YUXA 5T1MB 4APQA 4M7LT 3IFPB 3VXRA 5DHVH 3VRLE 1G7PB 3S35X 4I1NB 3KLDA 1AD9A 3WCYA 1FJ1B 4LDEB 1KCUL 3MBEB 2YD8A 4UQ2A 3SO5A 2X70A 6FABH 2AI0H 2FX8H 3UEZA 2EDLA 2J6EL 2JB6B 3QQ3B 2HTLC 3HHRB 1A22B 4KVNH 1ZHNB 2NR6D 1BQSA 4RFOH 1UB6B 2DQJH 4R7DA 4XAKD 2HT4D 1L9NA 1XF3A 3P11L 2MPAL 4OB5L 2V9TA 2XQBH 3E3QC 3VXMB 5IEHA 5FA4B 1OGAB 2DQIL 2YWZA 4FS0A 2XKSA 1DR9A 1RMFH 2ADFH 2JIXD 4RMSA 1Q72H 5D8JL 3SEPA 4Y4KD 4O58H 4KAQL 4W4NA 3RL2B 1CLZH 1B9ZA 4Y1AD 4YBQD 1E27B 3MNZB 1KLUA 3S3JA 4BH7B 5ENWA 5JDSB 2PXYD 4LPTA 5FHAH 2VO5A 2VISA 1M4KA 1NGZA 4W6WB 2XNAA 4V1DA 3NH7L 2IFGA 4NC1C 5IQ7H 2G75B 2J8UE 5IOPA 1S5IL 1CD8A 4HWNA 4M7LH 3C5ZB 3G9AB 4JLRB 4C58B 1FDLH 1PSKL 1ZGLB 3PIQA 4PB9L 1N3NA 1TVBA 4PREB 4AEFA 2YD5A 1TZIB 1HH6B 3BGAA 2XKNB 1JF5A 2YRZA 2BVPA 1HWHB 4IRJB 4Y7MA 1IAMA 2BNRA 1AO7E 5IK3A 3RP1A 4P9HH 2XWJA 3BSZH 4HS6B 4X98A 5IEKA 1RUKH 3PWUA 1BQHG 4CNIA 1RV6X 4M8VA 4JFPA 4PRNA 1R3HB 3PP3K 4OGZA 5JTWA 4JFZL 5J1AB 1VGEL 3MPCA 5DJAA 5LCVH 1ZSDB 1QFWI 5JIIA 4XNQB 3GJFA 3LEYH 3U6RA 1MEXL 5AWNH 3BW9B 4OZGA 3CJJA 1EV2E 3QNXB 2OMNA 4JZJA 1IC4H 3EYFA 2E7MA 5DJ8B 4L9DA 5FGCE 4JO3L 2NY3C 3MRGA 4ONHA 3DMMC 5JHLH 3S4SB 4UTAH 4R4BB 4IIQB 4XWGL 4JY6A 1JL8A 4ZS6C 3IU4L 1U6AH 1VDGA 4Z0BL 5EUKB 5DJCB 4XP6L 2F54D 1I1AD 2H32A 2ZSWA 4M6ML 5FGBC 4M1GH 1JPTL 4IDJH 3T0DA 4XNMA 4NKOB 4XMLL 2PXYC 5JZ7D 4GG8A 5IMOA 4RMQA