2HT3C

Structure of the escherichia coli clc chloride channel y445l mutant and fab complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3C01
1QVOB 1YEIH 5DURD 5BZDA 4Q9QL 1K5NB 3K46A 1CD8A 4NKIL 1XCQB 3VFTB 2MPAL 2X5PA 3ARWA 5DRWB 3GEWB 3JTTA 4IMLA 1U8JA 1IQDB 5JR1L 2CLVB 1YMHA 1JN6B 4OLYL 1M05B 1DN0B 2AJUL 2OX5A 3GBLA 5IESL 2BSRA 3VXMA 3H42L 2DTSA 4P3DB 3WL9A 1E6OH 4GKOA 3MXWL 5HJ3A 5T1KA 1I8IB 1EO8H 4E41B 2P8PA 1JHTB 1ACYL 4AIOA 4I77L 1G0YR 3MOBL 3N1GC 1ZVHA 4LF3B 5E56A 1S7QA 4UU9A 5DUBB 2PYED 3MA9H 3WDHA 3LSOB 2ED8A 3KNBA 4BQ6A 1FH5H 2DD8H 32C2A 3ROLB 5E9DD 1KLFA 2IAND 3I3BA 4TVPD 5K93A 5BV7L 1MCRA 4BH7B 4M1GH 3KPLA 5JPNA 4ZPVB 5DVOA 3OPZL 3KS0H 2PO6D 3NIFF 1IAKA 3VE0B 1AR1D 1IC5L 3ARYA 4WEMB 2Y6SC 1MRFH 3PQYA 1DUYA 2GTZA 4J3WA 1A6ZA 1WVZA 3C6LB 4M6NH 2PXYD 5DJCB 1AC0A 3EFFA 3LN4B 2PYFA 1HZHH 4GW4B 3B9KB 4MD5A 3GBNL 4JN2B 1N5YH 4U1JB 1CGVA 5ISZB 4KJWC 1PQZB 3NPSB 2QL1A 3GMNA 4X7DC 1FC1A 2P5WA 2E7HA 2J7LA 4PYHA 1C8PA 3FQUA 2UY7A 4QCIB 4ZFOA 1H5BA 3LQAL 1WFTA 2AGJH 5DFTA 4PJDF 5MEPA 1FNGB 4ONGL 1Q9OB 1A3RL 4IOIB 3QUZD 2GAZA 4G6FB 1XIWA 1SJXA 2AJSH 5D5MF 4MNQE 3RBSA 1HHIB 2E9JA 2HTKC 3SDXF 3S37L 3AU1A 2H2PC 4HXAH 2GTWB 3DGCR 3C9NA 4OV5B 3EYOA 4OCXH 5EZIH 1FNAA 4K71B 1F8TH 3V5KB 2I24N 5T1LA 1AGCA 4P5MB 1UZ8B 3NGBC 1RULL 3JZ7A 1LO5B 2Y72A 3GGWA 5CGYD 4HWEH 4UUJB 4PJHE 3OAZH 3NIDF 1TMCB 2OTUB 4HZLA 4P23C 5JNYA 4IRSA 2AXHA 3FMGH 1S9YB 4X9GA 1Q72H 3BQUC 1UZ6E 1P4BL 3WUWB 3FTGB 2CR3A 2HTLD 4QRRE 5HVHC 4MA1B 2EKJA 1JK8A 1XR9A 3SKNA 1GYAA 4NNPL 5DO2D 3WFEH 1XMWA 3VXPB 4PLNC 4WEUD 3KXFB 4XVUC 4PJBB 1FN4B 1FDLL 2VWEE 2VJXA 5D8JL 1IKNA 1LE5A 3P73B 2VOTA 4HGWB 1JWSA 4LVOC 2CRZA 5JW4Q 3I3EA 4Y1AB 3WIHA 1FNEB 3VGAB 5IUSA 4BZ1L 1V7NL 2Y36H 1D5BB 3KWWA 3UTQA 1M6OB 4J3UA 2GJ6A 4M6OH 4XPBH 4QHLB 4D9RD 1UH2A 1QFWI 3CC5B 4U1MA 5I0DA 1JYWA 5DD3H 4H0HB 5HDLA 5EU3B 2HLAA 5D72H 3LPGA 5AAWA 1NBYA 1KJ3L 5EIVA 4H1LB 4XPHL 3KS0J 3F5WA 4LBEB 3FN3A 1EFXB 4HUVB 3HS0A 3BFOA 5CJ5A 3U7AA 4PUBH 4AIXA 1HQRA 3KGRA 3EYFA 4WFFD 1MFEL 1L7IH 5KSVA 4L4TA 4JO2L 4HS3B 4Z7QF 4UB0L 4KVNH 3SDAD 3QWRD 1G6RH 3EOYG 1A22B 3ZLQC 5FK9A 1PKOA 3LN5A 2DQUL 3DSNA 3E2HB 4O02L 5TF1H 6FABH 2BRRH 2AK4D 5D1ZD 2CIKB 2BY2A 2IAMD 3NN8A 2QADD 1KJ2L 4L8SC 4IRJA 2WP3T 2V2XB 4NFDA 4PP1C 3U1SL 2J6EL 4LAQH 4X80L 5IHUH 3GZKA 4HK3J 5DVKA 1MHCB 1OAYH 2NCMA 2VDKH 3D85A 3WEXA 4OB5H 3GKWL 2NY1B 3TNNB 1SY6H 3OV6A 4AY0A 1T6VN 4TPRL 3WD5H 5ICZB 1JPFA 5DJAA 1EK3A 3IB4A 5KSAD 1HDMA 4EDWL 2A77H 3V4PL 5IBTH 2DS4A 3PWNB 3FFDA 4FTVA 2X4RB 3PJSA 2VQUA 2BSED 1F4XL 4OZHF 2PO6C 1BREA 1ZA6A 4G6MH 1FFOA 1NGXB 3PP3K 5HYJE 1RZGA 2DI8A 3HPLB 3PV7A 4GO6B 5I18L 4ELMB 3VCLB 4GMTL 2OJZH 1B2WH 4Z7WB 1AE6L 2B2XH 4WI2A 3ARRA 4ODHH 3HMXL 4R90L 2A74B 3UCRA 1UB6A 1PJ9A 3VXSD 4TNVF 2VLRB 3MRBA 1SMAA 3LY6A 3IDIB 3ELAT 2BSSB 2ZOLA 3KYAA 1ZTXL 2VIRA 2DMBA 1Z3GH 2IGFL 1G9NH 3QUZC 1TLKA 2XTJD 2R1XA 1MH5A 4JFDA 1DQDL 2R1YA 5CP7A 5SWSD 1C08B 4PJXA 1FE8L 2EO1A 5DR5L 5MEQB 2H1PH 3V0VB 5DJDB 3MLXH 2ICWA 5CLWA 4YHMH 5ANMB 1KEMH 4MA8L 3TESA 4PY7A 3BZFA 3EO0B 3W9DB 3RNKA 5B8CC 3BKCH 3N85H 3TT3L 2D7OA 1ZVSB 1AGFA 1CD9B 1A7NH 3G6AA 1MCNA 1U8KA 1BVLB 3LEVH 4RA3A 3X3GH 3ZDYE 2VDPL 3DX7B 5I19L 4JY6A 3GMRB 2NTFB 3QO1A 1U8NA 3WO3B 3UTTE 3OKYA 2R0KL 4Z7VB 4ZO6A 2N7BA 1A7OH 3WFDH 1F11A 3M8OL 4GW5B 4JVWA 4X7EC 5BV7C 3JV6A 2HTLC 3TT1L 4HG4J 1CFSA 4ZXBD 1C5CH 4XAKE 3DX9B 4OQTH 5EORH 1IC7H 5DO2C 3I02B 2D7PA 2BVQB 4MSWA 3S36L 2Z31D 4NCC2 5DD0L 1NFIB 2C5DC 3UP1A 2M1KA 5AWNL 4WV1B 4QY8A 4Y19B 4YBQD 3IJSB 3OAUH 1FNFA 1HSBA 1Q9LB 5E8OB 1MJUH 2F54A 4F58L 1IM9B 3LEYH 1RY7B 5DQ9B 3UTPE 1CDHA 4D9LH 1SJHB 3DMMA 3ULUD 1A3LL 2B7DT 3O3BA 4JPVH 5TQ0H 4XP5L 3AAZB 5DMGC 1T0NA 5DYOB 3FB7A 3WKNA 5IIEA 1VFBA 2NY3D 2X4SB 1LEKB 2OZ4L 2QHRH 4ETQA 1V7MH 1OHQA 5TE6L 5C0BB 3RBGA 4ZSOE 5HI5C 4BZ2H 5F93C 3PGDB 1NUNB 5HY9A 3JV4A 2JCCA 3TJEL 1ZA3A 1NEUA 1YC8A 5T3XE 2X42A 4YAQA 1QA9A 5GS1B 3SDAC 4TNVK 4L3EB 5C2BH 3L5IA 4H26B 3H0TA 4NQUA 1J5OL 4JM4L 1RVFH 3GSOA 1QBLH 4LQFH 4BJLA 3V0WL 2D03H 1N64H 4BSVA 3QDJA 2C7UA 5D1ZC 5HHVH 5I1IL 2W65B 5B22A 2IAMC 2QADC 1EO7A 1T20B 1CICB 2J8UB 5C6WH 5SWZE 1M7IB 3ZYZA 4NYLB 2E6JA 3FL7A 2WZPD 4PTTA 3AS1A 1XEDA 3H9SB 43CAA 4IEFB 5ABDE 3P9MB 5JHDD 3KPOA 4PJAB 25C8L 1H3TA 1G9ML 5IWLA 3JTTB 1X5XA 1U8JB 2A1WH 1IAMA 3SO5A 1Z2KA 1MFBH 3VFSA 1WAAF 1A1NA 4OZGA 3QUKA 5KSAC 3QT2A 1A6WL 1I8MB 4OUOA 1QD0A 1KC5H 3KYNB 4TRPH 4KXZI 2D0HA 4OCSL 2B4CH 3EW3B 3WL9B 1U6AL 4D9QD 1B0RB 3TFKD 3MOAH 2AXFA 1XGQA 4U1SA 5HJ3B 5T1KB 2RJMA 2P8PB 1XR8A 1MHPH 2NY6B 1LK3L 4DN4H 5IFHH 1S7QB 4UU9B 3C8KB 3NZ8B 1ADQH 3BE1L 4X6DF 4DEPC 4GRLA 1K8DB 4C54A 1N0XH 3EYSL 1UVQA 1HN1A 32C2B 4D0BB 4DN3L 5KW9H 4Z5RA 1GPOH 3RGVD 5T3ZD 3WV0A 4ODBD 1IAKB 2NW3A 1KIPA 4MNGB 4ZPTB 4OIIH 1NKOA 5C08A 3ZHDA 4PB9H 3ARUA 1F13A 3IAPA 2OL3H 1QFUL 1A6ZB 5T3XH 4I18A 3O3AB 4CADA 2R23B 4MD5B 1UM5L 2CRIA 1E0OB 2VDML 2KUTA 4Q97A 3I2CL 3D18A 3GMNB 2P5WB 4HFUH 3FQUB 2E6PA 4ZFOB 1P7QB 1H5BB 1MJJA 2RGSA 4HC1A 5MEPB 3FB8A 3Q2CA 3IJYB 4S10A 5FYJU 1XIWB 3T04D 4IIQB 3S9DB 3VXOB 2V6HA 1P9MC 2JJVA 5C09E 5TF0A 3S37X 1BEYL 1RU9L 3D0VB 5BVJA 2BSTA 3O41A 1BQHG 2QHLA 3NIGF 3L5XL 4U6VL 4PRPD 4RAVA 2FGZA 3C9NB 1SYVB 3QI9C 4XPFH 2GY5A 4M61A 1AGCB 4Y2OA 3OGOE 3UO1H 1RZ7H 3PXHA 4ZXBC 1BQHA 4ZFFA 2CUIA 1RURH 2GK2A 5IHLB 1AD9A 5BVPL 2ZZUT 5CBAB 3ARZA 2Z31C 3BKYH 4JJHA 5JNYB 1T83A 5E2TL 3BOVA 4N9GA 4NC0B 4HCRL 3S3PA 3N9GL 4YBQC 3S7GA 1HQ4B 2A9NH 2OR7A 3BP7A 1MEXH 2A2QT 4XBEH 1DVFA 4MJ6B 5DJ2A 3QUXD 1HNGA 1Q0XL 1UXWA 1JK8B 1XAUA 3SKNB 4TUKH 4PGBB 4WTWA 3ULUC 2FCBA 5D7LE 3RZCD 4WWKD 4K9EC 3KPRE 5KS9E 3BWAA 2Q7NA 4R3SB 5D7SL 2NY3C 4JFED 2VXVL 1KENL 2FIKA 1X5YA 3GSNH 4RBPK 5HHME 4UNUA 2QQNL 2YS4A 3UMTA 5L8LB 1U8LA 3QDMA 5DMKA 5FIEA 1GGCH 2X05A 3HE7A 2HVKA 1FP5A 4UIKH 4OBSA 3C08H 4G43B 1JGEA 4AH2A 1RIHL 3CH1A 4X4ME 1KFAL 1WT5A 4U1MB 3ORJA 4L8DA 1X5KA 2CDGA 4PJFA 1KPRA 1NUDA 1JNLL 2HLAB 1AJ7L 3K8MA 1OOAA 3PHSA 4QOKD 3C8DA 3KPMA 4TOYL 5F7FA 3BDYL 5FYLE 2GIYA 4PRHA 1MJ7H 3OR7B 4YHIA 2OMBA 1CFNA 5E6YA 1WFNA 4PJBF 3INUH 5KSVB 4L4TB 3THMH 1G6RB 4DCQA 3MRDA 3AXLB 3DTXB 1FSKC 4PJ5A 2P49B 2R2HA 3LN5B 3TIEA 3S34H 2B20A 3NABL 4I9WE 4OBRA 1JUFA 3NFNA 1BBDL 2DLHA 1EVUA 4JRWA 1OGTA 4EVNA 3NN8B 3WYRA 1DJSA 2ZKHL 2Q86A 1Z5LA 1YMMA 2XIDA 4HSQA 2FECL 4KPHL 1U3HD 4G42A 1S7UB 4JKPL 2RFXA 3O6LL 4XBGA 3BSZH 4QRRB 1PFCA 3VMPA 1KGCD 5DGRA 5GZOD 2GT9B 5J7CC 5HHQA 2R4SL 4PJEA 1H8SA 1NC4D 3CPLB 3D85B 3KG5A 1FFNA 1N0LA 4XMLL 2IH3B 1G84A 5TQ2L 1E4WL 2AJ3B 1HHJA 1BF2A 1JPFB 4N8VB 2O5YH 4KI5D 1AXIB 5F88A 1HDMB 5KSBE 1GOFA 1NDMA 3WJLC 3GHBH 4KZEL 2X4NA 4FTVB 3PJSB 3RGVC 3KYOA 1F02I 4YC2C 1ZA6B 3D39D 4RSVA 3HC0B 3VG0L 5F9DC 3GUTB 1DBAH 1RZGB 2A73A 2R69L 4Q9RL 1EHXA 4OCYH 5I71B 5D1QD 2D4DA 2IC2A 3FOLB 5BRZE 3CSYA 4JR9L 1I4FB 4D3CH 1UM4L 5ERWA 3F6LA 1Y6KR 3MRBB 1HILB 1XGPA 2VITA 4O58H 4C56A 4NOFA 3MUGA 3CFIC 4ZDHA 1W0VB 2ZOLB 4WI6A 5GGSY 4GUPA 4K3JL 3C09B 5DC4B 4JFDB 1MUJA 4LCIL 4QF1B 2BNRD 4XCFH 2ICWB 2V7HA 4Z7UB 4O5LH 5JQHC 4ELMF 2W60A 3I9GH 2FWOA 5K59F 2O61A 1HIMH 1Z9OA 4H20L 4KQ4H 2AK1L 1XF3B 1WEJH 4CVUA 3RNKB 7FABL 4Z7WF 3WS6A 1EEUA 4K07A 3U4EA 1UKQA 2GSGA 3T8XA 1AGFB 5FHAH 4UIMA 3C5ZD 1U8KB 2VLKE 1FH5L 2VAAB 2DD8L 3D3VA 1U8MB 5HHOE 1YN6A 4JY6B 4M1GL 2VR5A 4JO3H 3QO1B 5ID0B 1KXVC 4Y5YC 2A83A 2UZXB 3PDGA 4RGNE 1CFSB 2DQCH 3QUXC 1X5ZA 3MGAA 1NUFA 4Z7NF 2I27N 3NBNA 4JHWH 4JFOA 5HYJB 1HZHL 1K9TA 3U6RB 1ZLSL 4HIHB 5CJXA 3T0EA 4WWKC 1I8LC 4LFHG 2DI9A 1WIOA 1MELA 4QY8B 5SV3A 3W39A 4RFOL 1AR2A 2AAVA 3IVKA 1RJYA 4ZFOL 2F54B 5MERB 2AGJL 3IETA 4LLDA 1RUPH 4LCCC 4K3GA 1YQVL 4C83A 4LEOA 2FB4H 1FORL 3DMMB 2AJSL 3UTSE 2VZUA 5FGCB 4F9LA 4CU6A 2EKSB 5C7XH 4I8DA 5LBSL 2C3XA 4ALAH 5D2NE 4XNYH 1T0NB 1QBAA 3EYVA 4KHTL 1A2YA 1KELL 4OCXL 4P2RD 3VWJD 4AT6B 4YDIL 1F8TL 1S8DB 2Z92A 2ERJB 2EDNA 2OR9H 2P5EA 3VXMD 2ADFH 5F9OL 1CN4A 3ALXA 1WBZA 1I9JH 4M9OA 1ZA3B 1J0YA 3DI2B 1FO0H 5HPMA 4YAQB 3CVHH 4ODUB 2QQQA 1CG9A 3H0TB 4X6BB 4WCYH 1L0QA 2R1WB 4KUCF 3VA2C 1MFCL 2XN9D 5E5MB 1SVZA 3VA6A 3QDJB 2C7UB 4YWGL 4Y89A 4GKSB 2EYRA 2G60L 3X14B 1U3HC 4O00A 1MJ8H 2CO7B 4QXWA 3VXUB 4J1UB 4DKEH 4Y2DB 4BQCA 3WFEL 4PTTB 3MRMB 3RU8H 4R2GD 3PQYD 1BX2A 4XNQB 5FUOL 4M6MH 2DJUA 1MCDA 2XZQH 3FN0L 5K9KA 1J0KA 4FABL 5DC0A 2DQDH 1A1NB 4KI5C 1MWAH 4NO3B 5KVFH 4HPOL 1DBBL 5E5UB 5E2UH 3GRWA 3WIHL 1DFBH 1OM3H 2GFBA 4NRYA 4P4RA 3AS2A 5D71H 5DZLA 1DQTA 3QA3B 5B3JF 3VMOA 5I73B 3IXTA 1IRAY 4XPBL 5INDA 1HHHA 1QFWM 4U1SB 3FAXA 2BHYA 2QR0A 4DK3A 1R5VB 3HI5H 5DD3L 3RWIA 1B6DA 5TE4H 3L3HB 4W4OA 5D1QC 5D72L 1MCOL 2J8UF 4GRLB 1KJMB 4X99A 4BM7A 2CUMA 1A4JB 1UVQB 3VXRE 5FGSA 4P9ML 2AV1A 3MV11 4PUBL 4J7RA 4XI5C 1UB5A 4ZSOB 2DQEH 4PJAF 3L5WB 1L7IL 2NW3B 5C0DA 2WWKT 4NZTH 1KIPB 5T1LD 2CDEA 4JZNA 3OZ9H 2XZAH 1PD6A 3GI9L 2Q76A 4NC1C 5JA8B 2OL3B 1VEPA 4IDJH 6FABL 5E08H 3O2VH 3A6BH 5DRXA 1A7PL 4Z95L 4IRSD 4P9HH 4XP6H 1CR9H 3D18B 1CDCA 2FH8A 1T1XB 4PJ7E 3O9WA 4OZIA 4HH9B 5IHUL 4JO1H 1T0PB 4L4VE 5I30H 3JV5A 1MJJB 5HHNA 2DLTA 1I3UA 4JFPB 5BZWA 1QKZL 1PZ5A 1MCLA 3FB8B 3ME0A 1NUGA 4OB5L 5FCUL 3C5ZC 2UY6A 4ODSH 3ECBA 3TBTA 3VFVA 3H2WA 3QUYD 5DVLA 5GS0H 2A77L 5DZNA 1R3HA 3DHJA 5BVJB 1EHAA 1X4XA 5F71A 4JQVA 4M5YH 4JPIA 2DBLL 1YEJL 4TVSa 3MBEB 1NFDB 1H8NA 2CDFA 3U7YH 5L9DL 2AEPH 5HGBB 2KKQA 1AI1H 4X6CE 3ZKMD 5FDWA 4M9PA 4XBPA 1MREH 5T33L 2P44B 1BQHB 2XPGA 3BPCB 1JPSH 1AD9B 3P2TA 4M7ZB 2GJ6D 4ZUTA 2B2XL 3SBWA 5GS2H 2BXZA 4ODHL 2HFGH 3X17A 3RDTD 1EO5A 3IU4H 3F6IA 2ZSWA 4N9GB 3RTQA 3AC0A 3TN0B 2LU7A 5IMMB 1M1SA 4MDIA 5KVGL 5ETUB 2V2WA 1AHWA 1DVFB 4JVUA 4P2OA 1G9NL 1TXKA 5EBMA 2DWDA 3M17A 1YY8B 4L8BA 3RX7A 5GXBB 5CP3H 5IFJB 2ICWI 2FEEI 1IGCH 2ADIA 3CVIL 3MLXL 4IDLA 4C4KO 3J7HA 1EERB 4UQ3A 4LRIA 2FEEL 4LHJB 1MSPA 3VWJC 3GSNB 1DEDA 1HH6B 3CFDB 5L2KA 1T2XA 3I6GA 4RISL 3O81A 4IRJD 3BKCL 2CKNA 5I8OH 4P3CH 3QDMB 4FFWD 1A7NL 3QFJE 3CJJA 3X3GL 2V17H 3D85D 5EOCL 1CTOA 2P47B 4AH2B 2KDGA 4G7YH 4XMPL 4PY8I 2CDGB 1KPRB 2EIZA 3WFDL 1T22B 2VH5H 5E24E 5K9OB 4YR6A 4FP8H 1JTOA 5IHBA 1J18A 5C8JA 1IEAA 1C1EL 1W2KT 5EORL 1IC7L 1JZ4A 2E9IA 1T7YA 5E0QA 1BIHA 1CFNB 1K4CA 4FQHA 4AZ8A 1K3ZA 1AO7A 1R5WB 4R2GC 1FIGH 4DCQB 1HK6A 3I84A 3MZTA 5B38G 1ODAA 3LQZB 4I2XA 5DK0B 2XNAB 5E95B 1GJIA 4YIQA 3OAUL 3VJ6A 1U95A 1JUFB 1MJUL 1VACB 2UZYB 4EVNB 4MA3B 1FCCA 1OGTB 2FZ3A 1R3LA 3VDCA 4ONFH 3VG9C 2YRLA 3GMMB 5B38A 5BS0A 2AXGB 4G7VH 3DVGB 1CE1L 4G42B 3MRJA 3O4LA 1BD2E 2RFXB 3BKMH 2XQBL 4PP2A 5HHQB 3U2SB 4M3JA 1FFNB 3O3DA 3EKCA 5D7LB 5EWIH 4L1DA 4XRCA 3AM8A 2CKBH 2QHRL 3KJ6L 1HHJB 1V7ML 5KS9B 5EU6A 4EUPH 1MLCB 2EZ0D 5J56B 3FO9B 1IARB 3G08A 4J12A 4KUZH 4BZ2L 1P5UA 1TJIL 4AL8H 5C2UB 1NDMB 5J89A 5HHMB 5LG1A 4WU7A 3KLHD 2X4NB 1JP5A 1IAOA 1F5WA 4QT5A 1VADA 4LLQB 3VGBA 4FQXA 4GS7B 3MLPA 4A2LA 5DQJB 4ZTPL 2A73B 5KJRL 2VQTA 4HF5L 4LQFL 1QBLL 2Y5EA 3OHXA 1FG2B 2BVPB 3CGTA 4P4KA 3ET9F 3CSYB 1EJOL 2ESVE 1WUNT 1I7RA 1LILA 4IRSC 1S7TB 2V5YA 5CGTA 1VFAA 5ERWB 1TTFA 1F90H 1XGPB 1MAJA 2VITB 1BJ1H 3ALWA 3MUGB 1J87A 1ERNA 4M7KH 1FFPA 4NQDE 4GUPB 2NXZD 2GQHA 5DJXB 3F58H 4LRNL 1WK0A 2A1WL 2QKIB 3OAZK 2RQ8A 1F6FB 1MFBL 2YKLH 1MUJB 4WTXA 3ARBA 3QUYC 3GHEH 4DKFH 2HT3D 1M7XA 2DBJA 4TRPL 5JOFA 3TBVA 1CDJA 4S2SA 3TBYA 2RIKA 4F7TB 4P46A 2FWOB 4TULH 1FAIH 4LCUA 4LASH 4XCYA 1J0JA 4P2CG 3ZKMC 3P77A 1MHPL 4OFPA 5EOQL 4DN4L 3U4EB 2GSGB 2BVEA 1ADQL 2HKFH 1MCPH 4G3YL 3ZT7A 4OM1H 1N0XL 2DQTL 3P0VL 4AMKL 1UJTA 3MODH 3D3VB 1RK1A 3MNZA 4FQCL 4WFHD 1CD1B 3RDTC 3ZYJA 2VLJA 1YYLH 1NMAH 1YN6B 2WQRA 4JHAH 4JM2B 5GJSH 2HFEA 1AGDA 2EECA 3RI5F 4N8CH 5CEYB 1DTUA 1G7QA 2A83B 3TBSA 4LLUA 2OTWB 2CIIB 4OIIL 5IVOA 5MENE 1EEYA 2AABH 2F58L 4PB9L 2OL3L 1HKLL 2OP4H 3C2SA 5I75B 4UT7L 2V7NA 1AFVH 3UXFA 4Z7UF 3LHPH 1BZQK 3MV9E 3SKOA 5J12C 4HFUL 4UNTA 4R4NC 1N7MH 3QJFA 2J2ZA 1OTUD 4IRJC 1CXFA 4HC1L 4MXQC 1C16A 4K55A 3FHQA 3V6ZB 4LMQE 5C9JA 1PX3A 4HG4K 1ES0A 4F9PC 4ENED 5GGQL 2C3WA 2RB8A 4WUUE 4UV4H 5C0AD 5F70A 4PGJA 3EYVB 4QRSA 4GQPH 2P8LA 4XPFL 1HE7A 3EGSB 4ZUVB 4FHBD 2JLLA 1RZ7L 3ROOA 3UO1L 4H8WC 5LVEA 1RURL 4HIEB 5EU7C 3DO7B 1F4WH 5IV2A 2VZ3A 1FO0B 5HPMB 3QCTH 4HXBL 1RQ5A 1MI5D 3CVHB 4O2EB 1L6XA 1KTLA 1K4DB 4YFEA 5KOMC 3QRGH 4NN6B 3SCMB 3U0WH 4LSDA 2NZIA 4LGSB 4CVWA 3VI4E 2JELL 2F8XC 4IOFC 3V4UH 1P84K 3BKJH 5GGUA 4XP1L 4TUKL 3QP3A 2FX7L 4PJGA 1B0GA 1NKRA 1A8JH 4GRMA 4RGNB 5I76A 4OM0H 4F7MA 1BECA 4JZJA 2JB5H 2IALA 5EDXA 5C08D 1BX2B 4LVNC 4PRID 4BK4A 3ILQD 1CGWA 4MMZC 3GSNL 2E7BA 5DWUH 3WN5A 1MWAB 3ULSA 2EZ0C 5IJKA 3E8UL 4RMVA 1RK0B 3HE6A 3NCEB 4NRZA 2MJWA 3QSKB 3KLHC 1GGCL 2GFBB 4NRYB 4P4RB 4HS8H 1TQBB 4PB0H 4UIKL 3C08L 3DURB 4J3XA 5INDB 2GW5A 5GSVA 4CVZA 2Y5TA 3PGCB 3RI5K 1YA5A 2QR0B 3E6HB 4P5KA 4RIRB 3QNZB 3RWIB 3UJJL 5J6GA 5E7FA 3ZKND 3SEPA 5D2NB 4U1KB 3C5SA 4DGVH 3BAEH 4X99B 3DBXB 3MCKA 1A6TB 1UWEH 2AV1B 4U1LA 4C59B 4U1HB 4LLWA 1MJ7L 3LKSB 4CNIA 1UB5B 2IFGA 3DJ9A 4AJ0A 4XTRC 5C0DB 1JTPA 2CXKA 3QEUB 3KPQA 3PABB 2NY5H 2NXZC 5CZKA 1N5AA 1E4KC 4NJAH 1IL1A 3S34L 3SJVE 3BUYB 3VU2A 1IGML 3O0RH 1D5ZB 2OQJA 1REIA 3IDMA 2IPUG 3PWPA 5DRXB 3E6FB 3RP1A 2HT3C 2NXYD 1CGSH 5CHNA 2EC8A 3WNPA 4CBPA 3MLUH 3O9WB 3DXAB 4OZIB 2I26N 5ADOH 1N2RA 4ZODA 2ENSA 5HHNB 2VO5A 4CAGA 3QNXA 1CIDA 3MYJA 4K7FA 5L2JB 5IT2L 1KCKA 4LSSL 4Y7MA 3KPTA 4XVSH 4XVJH 3TBTB 5DUML 3VFVB 4S0TD 2O5YL 2HP4A 4ORGB 4K23H 4PG2A 4PJCA 1R3HB 3HRZA 1F6LL 3GHBL 2ZNWA 5DC9B 3TWCL 1MRDH 3NTCH 1RZKC 4JPIB 3VFMB 3ARED 4W6WB 1J0HA 1UCBH 2CDFB 1DBAL 2CRYA 1P2CA 5I2IA 3BYTA 4MDJB 3SGDH 4ZD3L 3MJ9A 2XG5A 2XPGB 1KIUA 3HE7D 4GG6A 3QDHA 3PGFL 4HV8A 4ZUTB 5C0EA 2FR4A 4NDMA 2NLJB 5LCVH 4JFQA 1NAMH 2ZSWB 3NFSH 2E27H 1LWRA 3RWCA 1MIML 4WRLA 5BOZG 4WUKH 3JWDH 3RTQB 4O58L 4A6YA 4LPYA 1OTUC 4MDIB 2ZP0T 4GMSH 4KQ3L 4PRHD 3GIVA 4P2OB 1WSST 5TE7H 1RIUH 3WFCL 4L8BB 3GSXA 4KJPC 4DVRL 3R1GL 4M6AA 3PHOA 4ENEC 5JIIA 5SX4H 4PJ5D 1FC2D 1NFDF 5IEKA 2FD6H 5IGXH 2FBJH 1EAPA 3GIZH 4LLVA 4O5LL 5J06A 3I9GL 4KQ4L 1NCDL 2IH1A 1WEJL 5HD8D 5L2KB 2W9LA 1ZGLP 5KTEH 1YMMD 1JGUL 1XCTB 1TCRA 2N4IA 2HLFD 5J3HD 5D2LE 1XT5A 1ZHNB 4HLZG 5IB3B 5FHAL 3DX6B 3LV3A 4PJ8C 3K2MC 3MBXH 1RHHA 3BZ4B 5FV1L 2IQ9L 1YYMH 4LCYA 1TDQA 2H3NA 2M8XA 4Y16B 4JO3L 1FJ1A 1DE4B 1TITA 5DK2A 3IFOA 2EIZB 2PN5A 5CGMA 5GRZA 5I1HH 2XKNB 5EOTB 1X5IA 4H0IA 3H7LA 1JYNA 4BA8A 4W6YB 1IEAB 1YEEH 1FYTA 3A6CL 4DW2L 1NCCH 1HEZA 5F7NC 3T3PE 4FQHB 2QSVA 1DLHA 4CMHB 1AO7B 2DKUA 2JK5A 3VFRA 4QTIL 1CDUA 3X13A 2HT4D 1FL5B 2IG2H 5J13B 4I2XB 5D7IE 3ILQC 2BCKB 4I18C 4YIQB 3MCLH 4JY4A 4XB8A 5I15L 3VJ6B 1HSAB 2ZJSL 1D9KA 2FZ3B 4NQEA 3OKNB 2LAAA 1FL3A 4OCLC 4YPJA 2NMSA 4PR5B 1YUHA 4CVXB 5E4EC 3MRJB 4HWZB 3T0DA 3L3OA 1OB1A 5DEGB 4C56D 2C3GA 3WIIH 5C7XL 1YN7B 4ALAL 4P48A 3NCBB 4XNYL 1NL0H 3O3DB 2Q8AL 2CKBB 2VKXA 1LQSR 5F3HB 3ZKNC 4EUPB 1E27B 2YPLE 5EU6B 4H25A 1L9MA 4CMMA 1KLGB 2DJSA 1Q38A 4ZG1A 2VDRH 4U6TA 3L3DA 1OVZA 3PIQB 4NQXA 2VABA 5BQ7A 3ES6B 2GITA 4HKBB 3WLBA 3OJ2C 3W0WA 4D0CB 4F57H 4FQXB 2JJTC 3CVHL 4JDTL 5IB4B 1PEWA 4LLAA 4X7FC 3ZDXF 1NLBL 4P4KB 2YBRB 4LVHB 3RWHA 4HK3N 1I7RB 2KPNA 1T83C 5AEAA 2NXYC 1MAMH 1AQKL 1HWGB 1MJ8L 3REWA 1NCWH 1VFAB 3GJEB 5HYIA 4O4YH 4GBXC 2WK2A 4MCZA 2V5TA 3ZKXB 3V6FB 2X2YA 4ZAKD 5K9QG 3CFEB 4QNPF 1ZHBA 2GCYB 4HFWB 2ITCA 4PJIE 5KS9F 5LKNA 4NBXB 4QRTB 2R39A 1QLFA 2XZQL 1S5HB 3O6KH 1K6QH 3R0MA 1IGJB 4WW2B 3E3QE 1TPXB 4OD2A 1XGYH 3T0ED 3ARBB 1MWAL 4KK5D 3IRPX 1WFOA 2YD4A 3MLRH 2GJJA 4MJIA 4M43H 4Z78B 3GRWL 2QLVB 4S2SB 4ZO9A 4N0RA 3AROA 4P46B 5I1GH 1U8QA 3AREC 3RWGA 2EDJA 4EOWH 2JJSA 3QCVH 3CCHB 4RGOH 4XCYB 3T2PA 3TBWB 4Z7OE 2P46B 1BD2B 4LFHD 5A2IH 5J11B 1ZEAH 4FRWA 4FFZL 4R9HA 1LNUA 1P6AB 15C8H 4ZYKA 1UT9A 1F4YH 1KG0A 4B41A 1RK1B 1JRHL 3BX7C 5IW6A 2VLJB 1GGIH 2FO4A 1RFDH 1UACH 3GSQA 2HFEB 1OPGL 1P69B 3HC3H 1PG7X 5D7KE 1BJMA 3NZHH 4UT9H 4NZTL 1OSZB 5ESAA 5B39G 4X5WA 3TBSB 5I17A 2P5ED 4LLUB 5I1AA 1YPZB 3OZ9L 1FV1B 3N1PC 3GNML 3CMGA 2VDLH 4PJ9C 3F8UB 1KT2A 2CR6A 2P24B 4IDJL 4RCAA 5E08L 4JRYE 2W9EH 1CGYA 2VE6B 4YPGB 4K94H 3GB7A 3FFCE 3V2AR 1DSFH 3STZB 5B39A 5GRUH 5I1CH 4O2CA 5C0RL 1U91A 4XP6L 1U8PB 3SKOB 2ESVB 3S8WA 4BQ8A 4JO1L 4XX1E 4YHOH 5I30L 1E6JH 4MJ5A 3EOAA 1B4RA 1JGDB 2HLFC 1AKJA 5J3HC 1C16B 5DRNB 2NZ9D 1I1AA 3MRQB 4NQDB 5C9JB 2O93L 3QG6A 4JM2F 4NRXB 3NAAH 2ARJQ 5FHBL 3VD7A 3WE6A 3SKMA 3WFBL 1VB9A 4HHAB 2RBLA 4QHMA 1CFQA 4YK4C 4NBZB 1H15A 1OCWH 4M5YL 4R7DA 2D4FA 4XPAH 2FX8H 1BP3B 3V5HA 5I66A 5J6HA 3U7YL 3T1FB 1QSFE 1AI1L 3ROOB 3CSBA 4WTZG 3VDAA 2SEBB 2XQYG 3BD4A 3RX8A 5CINH 4LSVL 1EV2E 3L3GB 5IV2B 2XRAL 3BPNB 4NN7C 1CF8L 2FHBA 5JW3H 3KJ4B 4RFNB 5T5FL 1A5FL 4F3FA 2DLEA 5J1AA 1KTLB 4HPYH 1WWCA 4L5FH 4WTZA 5J9PA 4YXLH 2FJHA 1S3KH 4WI4A 5KVMC 2YSSA 2UWEE 5I16A 1JCKA 2CGRH 3MRFB 4PGCB 1QRND 5FYKE 1H3XA 3RVTD 4N90E 3HLAA 2Y06H 3MV8B 1ZGLA 4PJGB 4XPGH 5MENB 4RX4A 1B0GB 1QNZH 4G9FE 1P53A 4J3SA 3VFNB 4F7MB 2G2RA 4HJ0D 2IALB 5A2FA 3KPSE 5B21A 4I3SL 1QPPA 1M71A 3R0NA 4N0FB 1JPST 1RUMH 3MUZ1 2ZPKH 2P1YA 1X7QB 3KPRA 3CZFA 4KAQL 3ZE1E 3UTOA 4YQXH 5I8OL 3MRLA 3GJFH 3HE6B 1OTTD 4NRZB 4Z18A 4D0DA 1OLZA 1I8KB 4Q6IC 1T0MA 1U58A 5GSVB 4CVZB 4I48A 4G8GA 4LIQL 3WCYA 4EN3D 4P5KB 2NX5A 1MPAL 2FGWH 3DOSA 5J6GB 4P5TD 4NOBA 3FO1A 1IKFH 4F7EB 3C5SB 4E42A 1Q9WA 4FXGA 3MCKB 3NIFE 2C4FU 3ARGA 5I8EB 4U1LB 1FL6A 5ALBH 4CNIB 1PG7W 2OS7A 4I0CC 4KY1L 4OLVL 3O6FB 4ZAKC 1FIGL 2X6MA 4KV5E 4DWHA 3E0GA 3OJVC 1N5AB 4MA1C 2C1OB 1G9EA 1IL1B 3IDYB 2YRZA 4QRPB 2X1PA 1TZIA 3IDMB 3PWPB 3T0EC 4KK5C 2R2EA 3TJHD 5SX5H 4PD4J 4G7VL 1I9RL 4IS6A 4O9HH 2ZUVA 1J05A 3HG1D 2PTVA 5HHPB 4APQD 2D0FA 5DGQA 5GGSA 2J5LC 1QP1A 2C1PA 5FYKH 3V4VH 2CLZA 3HZMA 4GLRH 4KMQA 5D5ME 3QNXB 3MYJB 1ITCA 2WBJB 3QXDA 4K7FB 3JTSA 4PBWD 2CKBL 2HG5B 4MX7B 1Y0LA 3QZWG 4E9LA 5HBBA 1AQDA 5EUOA 5KANI 4BH8B 5IVNA 4N9OB 1PKQE 3FQNB 1OARL 4WO4B 4AL8L 4PJCB 4FXLA 3T0BA 1KB5A 3BIKA 3T3MF 1E4XL 3JWOC 3DIFA 3QZWA 1Z9MA 2JB6B 5KSBA 3NIDE 2KZWA 3M1BA 1CVRA 1DL7H 4M4RA 4UAOB 1W72A 3MC0A 4HV8B 5EFIA 2ZOKA 4LGPB 4F37F 4NDMB 4OZIF 5FKAA 3QDGE 1DQLL 1NAMB 4LKCA 4DAGH 1FVCB 4I5BB 1F90L 2ZCKH 4JRXA 4GAGH 5HI3D 1P4LB 4DVBB 3LZFH 4ODVH 4LL9A 5CCKH 4M7KL 5F9AC 2VLMD 3GMLA 4TVPE 3ZO0A 1FRGH 5CEZE 1BVZA 3GIVB 1NCUA 1RZJH 1NAKL 1X5LA 4N8PA 2FJFA 2NZ9C 2YKLL 1BOGB 5ID1A 5C0CE 3PHOB 1A6VL 2F9BT 5IVZA 3GHEL 3QIWD 3O2DA 2J4WH 4DKFL 4U0RC 3C87A 3O2DH 3K80A 1HKFA 4OF3A 3CXHK 4LLVB 1EAPB 3HZYB 3PUCA 3FKUS 4OFYA 4TULL 2CUHA 2VKWA 3DECA 4MD0A 5J1TC 3BT2H 3OR6A 5DJ0A 5BS0D 2BNQE 3O4LD 4XAWL 4NJ9H 4YHKL 3ZKSD 2HKFL 3D5OF 3ISWA 4RDQG 3LV3B 2NY2B 3QEGH 4OZFG 3LMJH 3QHFL 4Y5VA 1U0QA 2CMRH 1T03L 2VDNH 3MV01 1SYSA 2WUCL 2H3NB 4FQ1L 4ODWA 5I74B 4W4OC 3TPUA 5F7DA 3FQRA 5I6XB 3SHSA 1BM3H 3HAEH 4OZFA 4EI6A 1VERA 5HHOA 3LPWA 1CLOL 3SOBL 5F9WC 4WGWB 2CQVA 3VD4A 1B90A 4LPUA 1EXUA 4JKWA 2OP4L 4L8SA 1FYTB 1HHKA 2DQIH 4HDIB 1INEH 1AFVL 4FQXD 1DLHB 1S9VA 4P2QE 3VFRB 4HJ0C 2RAMA 3X13B 4W4NA 4JDZA 4X83A 1KTRL 4X5XA 4HK0B 5JMRA 1N7ML 5CUSL 5EZOL 3B9DA 4LARL 3QQ9D 4KDTC 5FKPA 1JBJA 2BRQA 5DD5H 1D9KB 2PYEA 3G5VA 1OTTC 4O2FA 3ARFA 3R4DA 1J1XH 3CFCL 1TVHA 3MUJA 4NUGL 4QO1A 4XNMA 5DJZA 5LWYH 5E9DA 4M02A 2IANA 2YEZA 3TZVB 3WXVL 3L3OB 4TVPH 3DV6B 1SEQL 4XXDB 3SN6N 3SO3B 1NQBA 4EN3C 1I3RB 3VRLF 3WNMA 4P5TC 4PRBA 4MGXA 4OLEA 3DV4B 4CMMB 4U6XB 4OZHE 3KPPA 2IF7A 3OX8B 1LVEA 4FXKA 3IDXL 5F7EH 4TTDD 2E5EA 4JQVC 4F37K 5ESVA 1PYWB 1WQVT 5CJOH 3QCTL 9CGTA 5H37G 3ULVL 1VGKA 1JMZA 3MCG1 3NFPA 3MFFA 4NQCE 3QRGL 1XF1A 3U0WL 3B2VL 3BIAX 1QYGH 4YHPA 1GRWA 4D9RE 2W38A 3V4UL 3TJHC 2F8OA 4Q9QH 1IGYA 1QLEL 2QSCL 2G5BA 4MQSB 1IAIH 3TO4B 3QHTC 4NKIH 5C0GA 2MPAH 4YHLL 4APQC 1J8HA 3PXJA 4OM0L 1QFPA 1MIEH 3CFJA 1LO3H 2JB5L 1AHWC 5LGJA 2VSCA 4L29B 1ZHBB 4UILL 4OFKA 2AJUH 5B8CA 2HVJA 5IESH 5E2VL 4FQ2H 4JKMA 3H42H 4MQ7B 1X5JA 8FABB 4OD2B 5FAAA 2GHWB 4EI5C 2IQAA 3MXWH 4MJIB 4ERSH 4HS8L 2PKDA 5I9QB 3D2UB 1ACYH 3N1MC 4PB0L 4LMQI 4QGTA 3MOBH 4QRQB 1U8QB 1MAKA 3RWGB 5D96B 3MX0A 1D5MA 1I7ZA 2DQGL 4Y8DC 4JJ5B 3RWJB 4UQ2A 1QSEE 1NCBL 1LNUB 5BV7H 4DGVL 4M48L 4ZYKB 2NY4D 1KG0B 4M8QB 5GS1C 5IW6B 1IC5H 3GSQB 3SGJA 4NCC1 4UMGA 3BHBA 4MNQD 1JNNH 5HI3C 1G1YA 3VXRA 5I17B 4X5WB 4HWNA 4HWBA 5I1AB 2NY5L 4HWBH 4WW2F 4DQOL 3QULB 1KT2B 4NJAL 3O4OC 1JVKA 1T1WA 4JGUA 1VEMA 3O0RL 3K8KA 1OT2A 4OLZH 5B3NA 3QIWC 3MRPB 1CGSL 5HGDB 1EHLH 3LQAH 2EIDA 3MLUL 1AIFA 4NSKA 5ADOL 4ONGH 3QEQA 1A3RH 3GSWB 1A1MA 3IF1A 1A6AB 5F97E 3UTZA 4PJ7A 4WU5A 1WZ1H 5HYSG 3T4AA 2IBBA 1I1AB 4XVJL 3GFUA 1CXIA 3QG6B 3S37H 4IOSD 1BFOB 1A1OA 2V9QA 4POUB 3WE6B 3Q6GH 2XZCH 35C8L 4KHXH 2DJ4A 2XTJE 3SE4C 1FFQA 5HYSA 2YMXH 5CD3B 1YPZF 4U7SA 4K8RL 1H15B 4R7DB 3SDAA 3VD9A 2H6PB 4AEHL 3V5HB 5IMOB 5J6HB 3MROA 3T1WA 1MLBA 1WBXB 4AEIL 5HGAA 3IGAA 3RAJL 4YDVA 2AK4A 5D1ZA 1YDPA 5E1AB 5F1IB 2IAMA 3MJ9L 2B0SH 5C07E 2WIMA 3W9EA 2ED9A 1NGQH 3U36A 2EE6A 3NCFB 4JDVB 4M7LT 5CWSA 3MLYH 2NQCA 3X12A 2EDWA 1CI5A 1ZANH 4NO0D 3V6OE 3F12B 3QQ9C 4A6YL 4QHNB 5FOBB 1IGFH 1QQDB 1FZMB 5F9JA 5FUCC 1RIUL 2V9RA 3HLAB 5TDOA 5KSAA 1ZGLB 3L1OL 2MCPL 4WVRA 4JRYB 1FDLH 1EIBA 2G2RB 5D8JH 3H9HA 1WAAE 3EDKA 5IEHB 5ELIA 3FFCB 2BC4B 3P0YH 4PS4L 2FBJL 1M71B 4JFHE 4V1DB 4XNXL 5CJ8A 1I1FB 1Y18B 5EBWA 1T7WA 3ARDD 3CZFB 4BZ1H 1V7NH 4BQ9A 1ZSDB 3GJFB 4NIKB 3MRLB 4QEGA 1BAFL 3DRQA 3CX5K 4TTDC 2LE9A 5HYQA 1HHGB 3D69A 1T0MB 1ACZA 2AP2A 3RWFA 2X1OA 3VXSA 1YYML 4JG0L 4X6DE 1FHGA 3P4OA 4G8GB 1RUKL 4O51A 4XPHH 2XXMB 3FO1B 2PCPB 4FFYL 5I1HL 1SHMA 2YRPA 1R3JA 3RNQA 4PJGF 1FYHB 1MFEH 3BEVB 4HAGA 4JO2H 4UB0H 3BP5A 1RPQA 4NKOA 1U8OB 3OKLA 3HTLX 4KVCL 2DQUH 3SDDB 4O02H 3HR6A 4GKZA 4LPXA 1GZQB 5A3ID 4PRNA 3BDXA 2IG2L 2OYPA 1KJ2H 2R8SL 1BGXL 1QFOA 4HD9A 3VMNA 2V2TA 3U1SH 4E41E 1TZIB 1GHFL 2J6EH 2AV7A 3KHQA 2UWEB 2ZUXA 1BZ9B 1P9MA 4LPTA 1J05B 4DUXA 1OAKL 5GGSB 5A2LH 3GKWH 2VQ1A 5DD6A 5ICYA 1A9EA 3HZMB 3SPVA 2O26U 3QI9A 4TPRH 4UI2A 4L8CA 3CFKA 1V8HA 5EZLA 3QXDB 4LPCA 3HA0A 3JTSB 3QEHB 3IU3A 1Y0LB 3NIGE 5EUOB 3KPSB 1A02N 1MHHA 2CRMA 2NY4C 4P2YA 4Z77A 2Y07L 3MJGX 1BF8A 1I85A 2K3TA 1KB5B 3OMZA 2Z31A 4P23B 3GSRB 3DIFB 3QZWB 5JOPE 4I4WA 4GMTH 4I3RH 1NC2D 3T2OA 5ISZE 3BQUB 1U8IA 3M1BB 3SQOL 5TPWH 2RCSH 2XYCA 4IJ3C 3HMXH 4D9QE 1UCTA 1UKSA 2LQRA 5EFIB 4G6JL 1G7PA 3ULUH 1MAML 4X9HA 1KTDA 1NCWL 1L9NA 4O4YL 4TUJA 2MTPA 4N0UA 1ZTXH 1RZ8A 3I75A 3TH3T 3G6JA 1DUZA 3ZHKA 4OKVA 2JIXB 1TENA 2F5BH 3VGFA 4Y4FD 1DQDH 3UTTD 2Q87A 1FE8H 5IB5B 2EDEA 1K6QL 4LVOB 5K9QI 1L0YA 2FJFB 1T80A 2I07B 5ID1B 1MCJA 1ZT1B 5IVZB 2XWBA 4MHHG 1KIRA 1A4KA 4XAKD 4M43L 2Y7QB 3DWTA 1YJDC 5EUKA 1F3JA 1U2HA 3TT3H 4EOWL 3WN5C 3QIBD 1N6UA 1VFMA 4G6AD 3QCVL 4RGOL 4NQED 4ODXB 3OR6B 4U7MA 1ZEAL 2VWEC 3WKMH 5I19H 4OFVA 2VR4A 1UGNA 3QQNA 1QEWB 5FUZL 1HNFA 3EAKA 3DX8A 3U46B 3UTPD 5DURB 1GGIL 1WIUA 3BPOC 1UACL 5F7DB 5JHDA 3FQRB 3HC3L 1PKQB 5I71C 3TT1H 1BVKB 2AKRA 2D7NA 3NZHL 4EI6B 5DJYB 3MYZA 3RQ3A 1UYWH 5IROA 3KXFE 5LQBH 2L7UA 3R06B 2W9EL 3Q5OA 5DD0H 4L8SB 4FQJL 1MNUH 3W0WD 5C0IA 1I7TA 1HHKB 1DSFL 5I1CL 5AWNH 1SEBA 5GRUL 2DLFL 3S3SA 1JF1A 2ARJB 2WW8A 1S9VB 4JDZB 4F58H 4RWHA 3DGGA 4CRPA 3LOWA 3L9RA 1E6JL 3ARDC 1KPUA 2PYEB 5A16A 4JG1H 1N4XH 5MEOB 2OM5A 3JXAA 2X4UA 3CFBB 1F42A 4F2MA 3BRFA 1XGTA 4MMXC 4X4YA 5E9DB 2IANB 2YEZB 3HZVA 1RJLA 3BH8A 3WJLA 4ZUUA 3C8HA 1T2QL 2OZ4H 5SWZD 2PO6B 5T3ZH 1N3NA 5TE6H 4NWTH 3FCTA 3UX9B 4DZ8A 1OCWL 3Q6FA 2FX8L 2LTQC 1TIUA 5BXFA 1GL4B 4GRWB 2ILLA 5HVGB 4EJ1C 1XF5A 3MMEA 3K81A 1CGUA 1GCFA 2PXYB 5E4IA 3W2DH 5JW5A 3I50H 5CINL 1L0XA 4XGZB 4AENB 1U41A 1GGYA 3OAYH 5F7KC 5ESVB 1I1RA 3C2AL 5JW3L 1Z9LA 4JM4H 3WIFB 2P7TA 3QFDA 2X9XA 5KZCD 5A3IC 4YXLL 5I1IH 3NFPB 3MFFB 5LJYH 2ICES 4KJQD 4F15C 2P48B 3QUZB 4X7TB 4WHYH 1IGYB 1H3VA 3AMKA 1MCSA 5M95B 1KB9K 3FT2A 2Y06L 1NGPH 5C0GB 4JB9H 3FOMA 5F89B 4HAFA 3Q5TA 2BVOA 2WLZA 5LGJB 2FEDC 1X5HA 4LSTL 1JPGA 4XCNB 1EUUA 3P4NA 1A6WH 2ZPKL 2X4TB 4MAYA 3GI8L 4OCSH 2PNDA 4BFEA 5K59E 4QHUB 2ID5A 1JE6A 3LKRA 5F1NA 1IEBA 2EYSA 2IQAB 4R26H 3ZZ1A 5D6CB 4PLOB 2XY1A 1D5MB 3BE1H 3FQTB 1I7ZB 1AKJD 4X7CC 2FGWL 1CT8A 4DN3H 5DS8A 5BV7B 1IKFL 3QUXA 1YECL 3RY6A 5H94B 1P5VA 2L4OA 5IB1A 5MP6H 5FF6B 1JV5A 1TVBB 4FS0A 4YHNA 5ALBL 3QQ3A 4WWKA 1I8LA 3BHBB 5ENWA 4RZCB 3FONA 5C09D 3M07A 1N26A 1QFUH 4KI5E 4JFEA 1XFPA 5GZND 4EXKA 2Y23A 4Y4FC 1EBPA 1BQUA 5ANME 3TEUA 5SWQA 2VDQL 1UM5H 4MXVE 4LCCA 3TV3L 4IHOA 3VRJB 3I2CH 3LDBC 3L95A 2D31A 3KYMB 4O9HL 2WAHA 4PTUA 1H3PL 2X44D 4GLRI 2A9ML 4JZOA 4NSKB 4NZRH 4RNRB 4ELKA 5H35A 1SJVA 2VLLB 3EBAA 2H8PB 3V4VL 3QIBC 4G6AC 1KN2L 2V5MA 4QOKA 4WU5B 4EDXA 5HDOA 1BEYH 1RU9H 4OLXH 3CU7A 4Z7VE 4RX4D 4NT6A 4WHTA 2B4CC 3BPLC 4NQVB 2DLIA 3QPXL 1KYOJ 2IPKB 3L5XH 4WI8A 2R0ZH 4Y4HD 3WNKA 1A1OB 1GGTA 1MQKL 3CUPA 1C5DA 1D6EA 1KB5L 4QXTB 3KDMB 4GKNB 3SDAB 2W1NA 3S3JA 2WIIA 3RUGA 4JKLA 3U30C 3KPRD 5C1MB 1MLBB 4XNZC 5IF0B 5HGAB 4H0GA 1MCWM 3IGAB 4A2MA 2AK4B 5D1ZB 1YDPB 2HFFA 3PE9A 4Y19E 3MV7A 2IAMB 2QADB 1DL7L 3REVB 1VHPA 3W9EB 1RD6A 4G8FA 5FB8A 3CDGB 1U3HA 4P49A 1W72L 3GDBA 3N9GH 1FCGA 3LKOA 4DAGL 2NX5D 1NC4A 2A6IA 1N8ZA 3GM0A 3X12B 4R97C 1Q0XH 3LZFL 4ODVL 3MRRA 5CCKL 1WTGT 3ARGD 1R3KA 5CEXA 1FRGL 4WEBL 3G04A 2R56L 5EBLA 2IWGA 4MZ3A 5KSAB 1ZLWH 4KJWD 4X6FA 5C0BE 1Q9KA 3MRGB 3VWKA 5FYLD 5D7SH 3MR9B 2DMKA 2BMKB 3F7PC 5DUPL 1HXYA 1U93B 1IGTB 3STLA 1GZPB 3O2DL 2VRAA 1F6AA 4U7KA 1F97A 4OAWA 5IQ9B 4G8EA 5HVWA 3BT2L 4L3EE 2DIAA 4Z7OF 3D25A 2XWJA 2HA1A 4DEPB 3EHBD 3DRQB 4NJ9L 1RIHH 3HCVB 2CMRL 3VXSB 1JNLH 2VDNL 2B39A 2J8UE 5D2LA 4O51B 1MHEB 2DM2A 2WSKA 4TOYH 4KJQC 3DNKA 5JDSB 3OKEA 4MXWH 4U49A 2XTJB 4M7ZC 1OF2A 5GGTA 4PJAE 3RNQB 4OFDA 5EZJA 1H3WM 5SWSB 3NA9H 4HKZA 4KH2A 4U3CA 1JFQH 5J1SC 3BP5B 4LOUD 4NKOB 3ZT5A 2F8VA 4HIJA 4OD1H 3VXME 4OUUA 1F00I 3AS3A 2XG4A 2ICEA 2ZKHH 3FN9A 4M1DL 1T04A 3FRUA 3SY0A 2V2TB 1JHKL 4JKPH 4S1QL 3PWVA 3O6LH 1V3KA 5GJTL 2AV7B 2DYPA 5D7IA 4RMUA 5D1XA 2R4SH 5BRZD 4JRXD 4XVUD 4P3WA 4UOJA 4WFGD 3AGVA 5TQ2H 5DD6B 3ARTA 3SPVB 7CGTA 4WI3A 5EZLB 2PUQT 4YBLC 1PSKL 3B3IA 3IU3B 4DGIH 3AS0A 4MNGE 4ZXBB 1CU4L 4KZEH 1YQ2A 2ZWLT 1UEYA 4HS6A 4Z77B 3PQYE 4OKDA 2MNUA 3HUJA 2Z31B 1QSVA 2YPLA 4LSQH 4OFYD 2R69H 1KCVL 5CJOL 1F45A 5GZNC 4F80A 1UKTA 1A21A 2P5WE 5L8JB 4JR9H 5FGBC 4OJFL 5EN2B 4WW1A 1JWUB 2UWEF 1IAII 4BQBA 3SGKA 3OGCB 1IAIL 3QJHA 3RPIB 1OWRM 2DDQH 1UQSB 4JFYA 1AGBB 4N0UB 1RZ8B 4U31A 3G6JB 4K3JH 3K1KC 5HHOD 4PFEA 1MIEL 1E28A 1NMBH 1LO3L 2NY3B 4P2RA 3MGOA 4HUNB 5F6IC 3VWJA 43C9A 5EH1A 4OV6F 4ZFZA 2BOBB 4JREC 3TIDA 4NN5C 1MFNA 3MNWB 3C5JB 4FQ2L 4LCIH 3LKNA 4PP1D 5CIPA 4Y4HC 5CSZA 1PVHA 3ZE1F 4UNVA 3OXSA 2XWBB 1XGRA 4H20H 1A4KB 4ERSL 2AK1H 2XQYK 4Q58C 2Z4QA 7FABH 1RIVH 2AW2A 1S78C 1J88A 4XP9H 1BWWA 2XN9A 3X11A 2WUBL 3QXVA 3HB3D 1ZKAA 2YD7A 1GIGL 3ARFD 2H26B 2R2BA 1EHNA 3P4MA 1KLUB 4BFIA 4I3GA 5K9JH 3MNVB 1A14L 2CXGA 2X70A 3Q3GA 3OXRA 2O5XH 2L0DA 3IFPA 3UTSD 5JHDB 4S1RL 1JNNL 1FSKB 2AKRB 3CLFH 5D4QA 5T5NG 4HWBL 4JCMA 3ARGC 3GJFK 3MRNA 1KBGL 3VD3A 4YHZL 4KV5F 1ZLSH 1LE9A 3RWDB 3LRGA 4U1GC 2ZG1A 5C0IB 1HINH 1I7TB 1SEBB 4OLZL 2YD5A 2G9HA 1NGWB 4L3AA 2ZSVA 4RFOH 2AJYH 1IVLA 1EHLL 2G5RA 5CZXD 1SM3H 1YQVH 4XX1G 4N5UA 2GJ6E 5FA4A 5IKCB 1FORH 3L9RB 1LDPH 3ZSSA 3UPRA 2BHUA 3MACH 1WZ1L 2X4UB 3EHBC 5LBSH 1T89A 4CW1A 2CLRA 2OSLB 1J8HD 4LNRA 4HIIB 1RJLB 1H0DA 3BGMA 4KHTH 1KELH 1XF4B 4ZUUB 4HGKC 4Y0GA 3RGVB 3T09A 4MAUL 3Q6GL 4YDIH 4YC2B 2XZCL 1N3NB 4KHXL 4DZ8B 2YMXL 1OAUL 3Q6FB 1WZMA 1O7SA 5F9OH 4L4TE 3BXNA 4HX1B 1UA6L 5SX5K 2FX9H 4ONOA 2YA1A 3HRPA 1OAXL 5GS0D 2I9TA 1VFUA 5JW5B 4OI9A 3O11A 4CDHA 2B0SL 5L6YL 1AP2B 2W91A 4LOUC 3U48A 1NGQL 3KPNB 3BIBX 3DRTB 1A6UL 3VXQB 2YK1H 1MFCH 2EO9A 2DIBA 3MLYL 4ORZC 4YWGH 3QXUA 4L1HA 1ZANL 1IC4H 2G60H 1K85A 1MRCH 2EDHA 5E94A 5L7XH 3Q0HA 1IGFL 5IP4A 3QXAB 5I1DA 5CSBA 1PDKA 3MRHA 1NBZA 3QUYA 3DLQR 1HCFX 1CQYA 3PDOA 5FUOH 4QGYA 3VXRD 3FOMB 4PRPB 5IBUB 1II4E 2HRLA 3BDBA 1IT9L 3FN0H 2BVOB 4LCWA 4RAUB 3ZDZE 4FABH 5C6TL 3P0YL 4FTVE 1ND0B 1K8IA 5IVXA 2EDRA 5F1OB 3GO1L 3LCYA 3P4NB 4CJ1A 2HWZH 4HPOH 4AYFA 1DBBH 4PGDA 5AG9A 1YEDA 3WIHH 4OF5A 2BY0A 4S1DC 5EC1B 5JPMA 3LKRB 4OLUH 4RMWA 1IEBB 1OAZL 5F1NB 2EYSB 1TQCB 4ODTL 3MFGB 3QISA 5CILH 3RDTA 2YWZA 3VRIA 1Z6JT 5DMGD 1OSPH 3QEQD 4PREA 5T1MA 1I3GL 3H8NA 1Z0NA 4GW1A 1CFVL 1MCOH 4Y5YB 3CLEL 4G5ZL 2EXYD 3ILPB 5IR1B 4YZFF 5HI5D 4G8IA 5JUEH 2BOCA 1CT8B 3KLSA 4JEGB 4ZS6D 3TNMB 4P9MH 4L4VD 3QUXB 4Y5VC 1LP9A 5A2JH 1UH4A 2AI0L 5HGHB 3SDCD 4UDUA 3RIAF 3OJDB 4YHNB 2NW2A 3RZCB 3QQ3B 4CKVX 4JFDE 4WWKB 5DSCB 4NN6C 3GI9H 3SCMC 3FONB 4PJXE 3I6KA 4OCWH 3JWNC 2DB8A 1X44A 4JFEB 4OSUL 3B6SA 4BFBD 4YO0A 2H32A 4Z7UE 2H32H 1A7PH 4Z95H 4LCCB 5FO8B 1ORQB 1IM3A 1K3IA 5FEBA 5EO1B 4RGNC 3T0AA 1WV7T 4LKXA 4FZ8L 2ZUTA 2F53A 4R96B 4F9PA 4GAJL 5DEFA 1GGUA 4Z0XA 1QKZH 5H35B 1FPTH 2Q7YB 3W11C 5FCUH 1S9XA 3HB3C 4QOKB 3ARFC 4EDXB 4PJDA 4LEXH 2D0GA 2HJFA 3B5HA 3BGFB 3UBXG 3CDFA 1QBMH 3CSGA 2MMXA 4WHTB 2MFNA 1BMGA 1TQBC 4H8WH 3L3IA 3FO0L 4Q2ZB 1A3QA 4U4BA 3CUPB 2DBLH 1YEJH 1D6EB 3SDXA 5L9DH 3UBXA 3NMEA 5T33H 5ECJE 3RUGB 3O6ML 5D2NC 5EU5B 4I3RL 1L7TL 4XNUH 1DEEB 6CGTA 3ZE2E 3U0PA 1HXMA 1URLA 3IS0X 2Q3ZA 3C60D 3RA7L 2HFFB 2HH0L 5TPWL 2RCSL 4OD3L 1CDBA 4G9DA 2F74A 2FSEA 4X8JA 2F54E 1B0WA 4I0KA 3MRIA 3HZKB 1OW0A 2NY7H 1U3HB 1OGAA 3I6LE 4HJJL 4KROD 3KYKH 3ULUL 2I9LB 3BD3A 4NKDB 3QFJD 3DUSA 5CZXC 5KVGH 1NC4B 4Y5XC 4K9EL 5FGCE 4LHUG 1QTYT 4HUWB 1OD9A 1I1YA 2F5BL 1NGYA 1R3KB 5CEXB 4HJGA 1MFDL 1XZ0A 4P9HC 5EBLB 3V8OA 5C0JB 3CVIH 4LHUA 1Q9KB 3BO8A 2XWTB 3IYLW 4YHYB 5KSUB 3BH9A 4R4FH 4HLJA 1HXYB 3STLB 1HWHB 3D39B 3VXTB 4LSRL 4RISH 4U1NB 1ORSA 3TVMA 1AH1A 4PV8A 4MHHI 1V5JA 1EGJA 4TNWK 4X7SH 1TZHB 5D1QB 4DZBB 5IMLB 1C12B 4GG8A 2K1MA 2JJUA 2XWJB 5GS0C 3RVVD 4RQQB 3WKML 5EOCH 3QDJE 1KNOA 3U4BL 1MQ8A 3QAZC 4XMPH 1A64A 3RIAK 1XF2A 4KGLA 5DHVA 2P4AB 3QI9D 5DHVH 1R5IA 2DWEA 3MZGB 2YUZA 5F96L 3VXUE 2ADGA 1FLTX 2DM7A 5I1KL 1E4KA 4HIXH 3VGEA 1UYWL 1C1EH 1OF2B 5I1EL 5LQBL 2Y1VA 3WUZA 4F7PA 1UJ3A 1BPVA 3SGJC 4Y4KD 5IQ7L 1MNUL 2DQJH 2ARWA 1J86A 2BNRB 4HIJB 1ZHLB 5F3BA 4MNHB 4OUUB 2FH6A 3RL1A 1KCLA 1W0WA 2ICEB 4KTDH 5FYKU 1DLFL 2QTEA 5F7LB 1T04B 3FRUB 3SY0B 2D9CA 1YEKL 4L9LA 1CE1H 2FYYB 4JG1L 1N4XL 3C5ZB 4N5EC 4JN1L 2XQBH 3FQXB 3L6FA 5DRZB 1IZJA 1CTNA 2ZUQC 3PHQB 3PV6A 3QO0B 1Y6MR 2FNBA 3GK8H 3QQ4A 5EO0A 3T2NH 1P84J 5IK3A 3KJ6H 5T3ZL 3N0PB 1RZKH 2EXYC 4NWTL 3HFML 5GISL 2ZCHL 1N6QL 3B3IB 4ZS6C 3WLWD 3T77B 1TJIH 4R0LC 5B4MC 4HS6B 1VCAA 3W2DL 5C08E 2BJML 2JTDA 3I50L 5EC2B 3SDCC 4OZ4A 5D9SB 3HUJB 4ZTPH 3LB6D 5KJRH 4HF5H 1MCCA 5E8DL 4JFFA 1EJOH 4WI9A 2GUOA 1BBJA 3QXTA 2EYTA 2ZNXA 2OXHA 4WW1B 5CMAA 4HBCL 3BZEA 5IBLD 1VKXA 5DQDL 5BZDB 1R6VA 4FQLL 4YEFA 2HN7A 1NGPL 2DQHH 4J4PD 2APXA 4JB9L 2EDLA 5C0AA 2O5ZL 4IMLB 1B4JL 3HI1A 1YMHB 4LRNH 4P2RB 3VWJB 43C9B 4PGEA 2ICWJ 2HFTA 2BSRB 3VXMB 1LMKA 4KZDH 1FZJA 3LKNB 1NFDE 3F7YA 4PJ8A 1WTLA 4M4PA 1H8OA 1MI5A 2Z4QB 4R26L 1OQOA 5EOQH 3DSFL 5EOCJ 3D9AH 2MQ0A 4LGRB 3MV9D 2XN9B 3LEXA 3X11B 4U1IA 3KNBB 3C60C 4G3YH 1MVUA 4XT1C 2DQTH 3P0VH 4AMKH 3A67L 3QB7C 4FQCH 1LHZA 2R2BB 3ULUF 2K7QA 3FB5A 1JWMA 4K7PL 4PY8J 4BFIB 5F7MC 3KPLB 5JPNB 3LRSA 4KROC 3G5XA 2X70B 3G6JF 1D5IL 3HMWH 5MP6L 2AEQH 2R29L 5F21B 1YNKL 1EX0A 4FG6D 1S7SA 1PG7H 4R2GB 2A0LC 3PQYB 1DUYB 2F58H 5DTFA 4PRIA 2GTZB 4WUUD 1HKLH 4M62H 4BFGA 4UT7H 3EFFB 2PYFB 4U2YA 2R4RL 3BJLA 4MD4A 1T2JA 5DXWA 1ZT4A 2IADA 1LK2A 3QDME 2ZSVB 5C71A 1AD0A 4K3DH 4NZRL 1BFTA 4HC1H 2EE9A 5KVDL 2GAZB 5FA4B 4WW2C 2AJVL 2QQLL 3D48R 2QSTA 3RVVC 4HUXA 4OLXL 5GGQH 1I3VA 4CW1B 2CLRB 3VFOA 3AU1B 1H0DB 2R0ZL 3BW9A 3EYOB 3CZJA 3O8XA 5DJ8A 4DTGL 2JJTA 5T1LB 3JSSA 5J0BA 4E5XA 2CK0L 4OGZA 1JMXA 4KMTL 4MAYD 2VXSH 3BXNB 5J8OA 3GGWB 4NWUL 2I9TB 3UROR 1I85C 1NFKA 4HZLB 4HXBH 3BD5A 1JGLL 1NCNA 4Y4KC 4IRSB 1UXSA 5DI8A 1NBVL 3ZDXE 4GBXA 1YMME 5F1KC 2KQMA 2JELH 3HKFA 1FGVH 3QYCA 4XC1L 1WCBA 3L3KA 3U83A 5JORA 1XR9B 4XP1H 2OLDA 4PJEE 5H2BA 3ARQA 2FX7H 4X8XA 1RSFA 5I1DB 5F6HI 3QUYB 4QNPE 3BVNA 4GXVH 4H88H 1TCMA 3MXVH 3QCUL 1R3IH 3WO4C 2J1KA 1RUAH 1LE5B 3AREA 4AEEA 3IKCA 3HNTH 1JWSB 5IVXB 3E8UH 3WLWC 4X5LA 3LKPA 1Q0YH 1YEDB 1WAAA 3KWWB 3UTQB 4GAYA 3MJ8A 3SJVD 5JPMB 2B1AH 2GJ6B 3F62A 1WIPA 2X4PA 3RDTB 3VRIB 2B8OT 3LB6C 5E03A 4JO4H 3OB0H 3UJJH 1UG9A 4GW1B 2V5RA 1NJ9A 3MLZL 3JVGC 5FM4A 1NBYB 2IBZY 1RV6X 2BOCB 3F5WB 4PJ9A 3HS0B 3HPJA 4MXWL 4X6DA 3BPNC 5IBLC 1LP9B 1HQRB 3EYFB 5GGTL 5DT1L 1QVOA 3B9VA 3NA9L 1OQXA 3RZWA 1W0YT 1EAJA 1JFQL 1KUMA 5E70A 1K5NA 4RMRA 4J4PC 3RVXC 5FK9B 1A9BA 4NP4H 4OD1L 3VFTA 5IROC 5J12B 1PBYA 5DRWA 3ZTJG 1IQDA 1IGMH 2CLVA 1JN6A 2FECI 3K3QA 4DOHB 2MOVA 2H32B 4YO0B 3MV7D 1P7KA 1DN0A 4IRJB 3TLRA 2BZDA 1KPVA 4EBQL 1CWVA 2NY0D 1IM3B 4NZUH 1IJ9A 4P3DA 1OD7A 2E3VA 4LKXB 1UWGH 2F53B 5DEFB 2BVUA 3MUHL 3ABZA 3WEXB 4RMSA 4E41A 3SKUD 1JHTA 4GQ9H 3D3VE 3VDBA 1INDH 5CAYB 5IT2H 1S9XB 4LF3A 4LSSH 5DUBA 5DUMH 3QUMA 2VZ1A 3LSOA 5DJAB 3QUMH 3U4AA 4DGIL 3ROLA 1DBML 3QNYA 3VWKD 5LGHH 3TYGL 3IKKA 3FFDB 3TWCH 2AEIT 1V3JA 1FFOB 3P4LA 4FG6C 3UBXB 3EUUA 4LSQL 2YD2A 5GRJL 3H9ZA 3OG6B 4ZD3H 3M45A 3U0PB 1Q1JH 5DJCA 3PGFH 3LN4A 3OKDA 4X6EA 1JZ2A 4GW4A 3B9KA 5E2WL 4OF0A 1UB6B 4JN2A 4WGVB 4U1JA 1PQZA 4NNXA 4XI5D 3U79A 1MIMH 1OGAB 3HN3A 4R8WL 1NANH 3G9VA 1KYOK 2DDQL 4NM4L 3DUSB 4QCIA 5AZ2L 4KQ3H 1P4IH 2VIRB 4TUOA 1VPOL 1WJ3A 1NMBL 3WDIA 1FNGA 3WFCH 2R1XB 5A2KH 1MH5B 1Q9OA 2Z35A 4IOIA 3S35L 2VYRE 4DVRH 3R1GH 2R1YB 5CP7B 3UEZA 2C9AA 4PJXB 3B8YA 3LD8C 3OAYK 1XZ0B 4OCRL 5E2JA 1HHIA 2V9TA 4LHUB 2P5EE 3BO8B 3EJYD 4PY7B 3BZFB 4Q6IA 2VXTH 1EEZA 2LU3A 4OV5A 2YPVL 1NCDH 1RIVL 1CVSC 2WBJC 4XXCA 1JGUH 1ORSB 3OF6A 4MAYC 4P5MA 4XP9L 1I7UA 3G6AB 4YLQT 1UM6H 2DYPD 1CYGA 2CD0A 5D1XD 4Q7DA 3BN9D 3GMPA 1U36A 2IQ9H 2OTUA 3WUWG 5K9JL 1U8NB 5DHVB 1W8OA 3IFNL 2CK2A 1EJ6A 2O5XL 1F11B 2ADGB 4ZAKA 1BQSA 5KAQG 3JV6B 2D7TH 3CLFL 3WUWA 4GSDL 3RY6C 2NXZB 2JF1A 1IEHA 3CK0H 1CD0A 5D7JD 4KI5F 5KG9A 5CJQH 4WFEE 2EC9T 3A6CH 4DW2H 4MSWB 3F7RA 2MSPA 3HI6L 4MXVF 2YPLD 4QTIH 1ZLVH 1HINL 3JWDC 2DKSA 4PJBA 3U0TA 2AJYL 1HSBB 2BDNL 5I15H 2ZJSH 2PETA 3RY5A 3RL1B 1NSNL 1SM3L 5L88H 2OK0H 3P73A 4HGWA 1JHLH 4Y1AA 1LDPL 3EYQC 5CFHA 5HDBF 1FNEA 3MACL 1JZ8A 3O3BB 3L6FB 1J10A 1M6OA 2MWCA 3PV6B 4Z7VF 4L9DA 1MF2L 2X09A 4H1LG 2Q8AH 3FB7B 3QQ4B 5EO0B 5IIEB 1VFBB 3CC5A 3ZSTA 3P9LA 4ETQB 3JWOH 5EU3A 3GMOA 5IOPA 4N0YH 1ETZA 5H8DA 1LEIA 4H1LA 5HY9B 4ESKA 3JV4B 2JCCB 1EFXA 4LNVA 2FX9L 1PW3A 3T3ME 5GGRY 1QA9B 1JZ6A 4JDTH 5I74C 4EQ3A 1ZT7A 1ZMYA 3GSOB 2YK1L 1NLBH 3ARXA 4BSVB 5FV2A 2GUOB 3DXAE 4JKKA 4OZIE 4PYGA 3SE9L 2IMMA 1IC4L 1B3JA 1A0QH 1AQKH 2NY0C 1MRCL 4GT7A 3MGTA 5L7XL 1VKXB 1HYRC 43CAB 1GSMA 5I8KH 4DFHA 2XTLA 4IMKC 2HN7B 1MHCA 3KPOB 4NHUA 2IMNA 4TSBH 2WM0A 2DICA 5C0AB 1ONQA 3AVEA 3IRZA 1T1YA 1T3FA 4J3TA 4V2CB 3TNNA 5IW1A 3VFSB 2AQ1A 2HAZA 3MA7A 4OZGB 3QUKB 1TETH 1KF9B 3QIUD 2HWZL 1FZJB 3VWKC 5KN5A 3DVNA 3TZVC 2VMFA 3GRWH 1J8KA 4GOSA 4B50A 4OLUL 2AXFB 3U9PL 1XGQB 5CILL 1MI5B 1T4KA 5EB9A 5JXEA 1NGXA 1OSPL 3U7WL 4OCNC 1XR8B 4ELMA 3FHAA 1LEGA 4FFZH 4F7CA 3LEXB 4U1IB 1MVUB 1G7HA 4Z7WA 5JUEL 4K7PX 1ZLWK 3PWLA 1JRHH 1QRNA 4Z5RB 3FB5B 2KL6A 2A74A 5GRXG 1OPGH 4J6RH 4NCDA 3G5XB 2I5YL 2VLRA 3IDIA 2WNGA 2BSSA 3GNMH 3GBMH 5C08B 4OCWL 5T1DL 5DTFB 4PRIB 1JF6A 3WBDA 3WSQL 4I18B 4XHQA 4CADB 4KDTA 3RKPA 1HH9A 3BN3B 3EJJX 5C0RH 5DFWH 1C08A 3FB6A 3IAGC 5ILTH 1QSFD 2Q8BH 5L2KE 4XB7A 3EJYC 3V0VA 4GXUM 1ZT4B 3F7QA 3BZDA 2FLRT 3LPFA 2Z8RA 2AS5M 4UOW1 1AD0B 3EO0A 4LSUL 4ZFGL 3DUUA 4EN3A 1IC1A 1FPTL 5I8CA 4LIQE 1ZVSA 4P5TA 1L6ZA 1D7FA 4LEXL 1BVLA 5D1XC 3BN9C 4HUXB 2VDOL 5FHBH 3ZT6A 1QBML 4LK4A 5DA0B 3WFBH 2BSTB 3DX7A 3O41B 4H8WL 3VRLE 4RAVB 5FYKD 3UBXI 4RMQA 4LCWD 4N90D 4M61B 5F1SA 2AQ3A 4KKNA 1JGVH 5GRYA 4G9FD 1DBJL 4GW5A 4ZFFB 1AO7E 3DYOA 4XNUL 4LSVH 5D7JC 3CMOL 2XRAH 1CF8H 3GSUA 3DX9A 4I2XE 3CXHJ 3I02A 5T5FH 1A5FH 5HVFB 2BVQA 1KXQE 1J1PL 3C6SA 2X1XR 1UXSB 2NXYB 2NY7L 3HG1A 3RVUD 2YN5A 1RMFL 3KYKL 4NO5A 4APQA 4GFTB 5BS0E 4Y19A 4GXUN 3IS1X 3BP7B 1Q9LA 3O4LE 5E8OA 2N56A 1J0ZA 1WCBB 3L3KB 1IM9A 5DJ2B 2YOCA 4X4ZA 4DKAA 1UXWB 4K94C 5JORB 1X4YA 3VFUA 5DQ9A 4CDGC 3SGKC 1A7RL 1SJHA 2DTML 3DETD 1NCAL 3RL2A 2MKWA 4OIAA 5EU6E 4EI5A 3BWAB 3LKQA 1MFAL 4I3SH 1JIBA 4R4ND 4R4FL 2C3VA 4HUUA 1P6FA 2FIKB 2X4SA 4OLWH 3AREB 2LU4A 1LEKA 4M5ZH 4NM8L 4KAQH 3IKCB 5FYJL 2OTPA 1U8LB 1IFHL 3LKPB 4MXQD 5DMKB 4X7SL 3MJ7A 3PGDA 3HE7B 2HVKB 3TC9A 2LVEA 2F53D 2XA8L 4NNYA 4FOMA 5DVMA 1PLGH 5MI0C 1JGEB 2X4PB 3E3QC 2WINA 4LIQH 3CH1B 5GS1A 4MJ4A 4L3EA 4FA8A 4L8DB 1MPAH 2DOCA 2MHAA 4H26A 4PJFB 3CDYA 4XWGL 4MWFA 4X9IA 1FQ9C 2W65A 3KPMB 3UJTH 1NPUA 4PRHB 4HIXL 2J8UA 5AYUL 4KY1H 4NYLA 4YHIB 4OLVH 1KCSL 3LS5H 3H9SA 1MCEA 1LDSA 2DQJL 3MRDB 3QIWA 3P9MA 2EDDA 1G7IA 4PJ5B 4NGHH 2R2HB 4YNYA 5GSRA 1A9BB 3MJ6A 4PJAA 4Q0XL 5IVXF 3TIEB 1HYSC 4LSPL 2X1QA 2E7CA 4PRDA 3NFNB 4IOFD 1QO3A 4KTDL 1P7KB 3QIUC 4MB3A 4YX2L 2Q86B 1Z5LB 1YMMB 1I9RH 1KPVB 1I8MA 1OGAD 5ALCL 4S1SL 4WHDA 3KYNA 4XBGB 4HBQA 1B0RA 4PJEB 2VC2L 1D6VH 3GK8L 3T2NL 2LABA 3ARPA 3SE4A 3QDGD 4YK4B 2XACC 2VLJE 4JFZL 1RZKL 1U3JA 3C8KA 3NZ8A 3QUMB 1LP9F 1T89C 1K8DA 2CJUL 1OARH 1V3MA 5F88B 3ZKQD 4D0BA 4LHUD 3QNYB 3ARVA 1YPZE 1CFTA 3S5LG 5GHWH 1E4XH 3KYOB 5CEZD 3IAQA 4NN7B 5FYJD 1YEFL 4MNGA 5C0CD 3TVMD 4ZPTA 4I1NB 4YFLF 3S5LA 5A40E 1JZ5A 3BRGC 5AAMA 5AZEH 3WNOA 3IJHA 3OKDB 4X6EB 3O3AA 2R23A 3NVQA 3U9UA 1DQLH 1SBSL 4NNXB 2COQA 3SDDC 3TA3D 4XTRD 4C56B 1T5XA 2BNQD 4ZDHB 1PEZA 3ZMRA 2DQHL 5LAXA 1P7QA 3S35X 4HT1L 4PGZA 1XH3A 4TUOB 5E6ID 1NAKH 3IJYA 2Z35B 3PWUA 4LU5H 3ZDZF 4IIQA 4QRUA 5HPOA 1A6VH 4KKBD 3VXOA 1J11A 4KZDL 2H2SC 3TCLA 2V7HB 3D0VA 3VW3H 4B0MM 1DANU 4Q6IB 1EEZB 2W60B 1SYVA 2O61B 2FRGP 4X9FA 4CU7A 4P2QD 3D9AL 3T8XB 3UZQA 5JIHA 3ULVE 4XAWH 1X9QA 4YHKH 1I7UB 4UIMB 2IPTH 1V3LA 2CPCA 3QHFH 3DO3A 1T03H 3GMPB 5CBAA 2WUCH 4FQ1H 1EEQA 1MCKA 5ITBH 1B88A 4LDEB 3RVUC 2PF6A 3HMWL 1U3YA 2AEQL 4KC3B 3RFZC 3MV8E 1SVCP 1HQ4A 1PG7L 4PJGE 1CLOH 4KDWA 2APBA 4ZAKB 3SOBH 4M3KB 4PJXF 1VDGA 4MJ6A 4K3EH 3DVIA 4M62L 4LDLB 4JFOB 5KG9B 4PGBA 1S5IL 4CJ0A 3DETC 5C70A 3T0EB 3NCJH 3EO1A 4RWYH 2Q3AA 4D8PA 5CUSH 3W39B 4R3SA 3IVKB 5EZOH 4JFFD 3U0TB 3EYUH 1RJYB 4ZOAA 4LARH 4K3DL 2J5LB 4KKLC 3IETB 4LLDB 1ED3A 1RZJC 5TFSL 4C83B 4LEOB 3CFCH 4NUGH 3H3KA 4KRPD 4NQCD 4KJPD 3ZTNH 3WXVH 5KVEL 1SEQH 2ZUWA 2OI9C 4G43A 1RUQH 2BVYA 2C4FT 5TDNA 1A2YB 1VGEL 2WWMC 3CX2A 4MNQA 3P9LB 4RGMC 2DAVA 2Z92B 2P8MA 1QFWL 2P5EB 4UBDD 3GMOB 2EE3A 1RI8A 5IOPB 1TZGH 5BMFL 1ETZB 5E6ZA 1LEIB 2AVGA 1WBZB 2VXSL 3UDWA 3IDXH 1CIUA 3ZL4L 3STBA 2LFGA 3ZE2F 3S88H 4PJ8D 2VL5A 3LQMA 3OR7A 3EZ8A 4QRPE 3ULVH 3D6GA 1CG9B 1G6RA 1ZT7B 3PWPE 3AXLA 3DTXA 4PJHA 1IQWH 3B2VH 1F58L 1C7SA 2MKLC 1DQJA 1FGVL 1YEGH 4JPWL 3WXWL 5F44A 3CX5J 1LO4H 3NCYP 1NMCC 1G0XA 2X9YA 1QLEH 2QSCH 1BJ1J 2EYRB 3FT3A 1OW0C 1ZWIA 3EDDA 1S7WA 3MGTB 1S9WA 4YHLH 3VFPA 1QSED 1S7UA 4QRRA 3O2WL 2GT9A 4N8VG 4GXVL 4NHUB 1K2DA 4KU1A 4U0RB 4UILH 3CPLA 4JAMA 4D2NA 5IM7A 3OKKA 2EC9U 4H88L 3MXVL 1ONQB 1R3IL 2IH3A 1ZLUH 1RUAL 1T1YB 1T3FB 4PJCE 3L7FA 5E2VH 4OF7A 2E7LC 4QHKI 1SY6A 1YJDH 5IW1B 5K9KB 2AJ3A 3FT4A 2JCCF 3HNTL 3MA7B 2EXWD 4N8VA 1Q0YL 5KN5B 2QV2A 1WBYA 3DVNB 3NCYS 2ORBL 3IXTB 2B1AL 1YNLH 4UINL 5CSGA 4CN1A 1HHHB 4GG6E 3HC0A 1T4KB 1CLCA 3TVMC 1AR1C 4JO4L 3GUTA 2DQGH 3PL6D 2H45A 3DUHA 1NCBH 1LEGB 1PX4A 4F7CB 4NO0A 2PXYC 4M48H 1G7HB 3FOLA 3HC4H 3PWLB 5F9WB 2W0FA 1I4FA 1QRNB 5MHSE 2YXFA 3TA3C 3O8XD 2MQ3A 1HILA 2CDEB 4JZNB 4YXKL 1W0VA 2Q76B 4DQOH 5IFAL 2X7LA 1X5GA 4NP4L 4OZGF 1KCUL 5E6IC 5D93C 1UJ3C 1CL7H 4W81A 1HH9B 3ARDA 4KKBC 3FB6B 4YEEA 1AY1L 5I1LA 4NZUL 4GBXD 4QF1A 4RFEA 4LAJH 3ZE0F 1UWGL 4Z7UA 1X5FA 5C07D 1PZUB 5BZWB 1XF3A 1PZ5B 3DUUB 4EN3B 5CJBA 4GQ9L 2DL2A 4L9LC 1INDL 5I8CB 3IXAA 4P5TB 3ECBB 3WHE1 1OP5H 3K2UH 5CGYC 3QUML 4LVEA 3CD4A 4K7PY 4PPTA 5ACLA 3AY4C 2VAAA 1F4HA 5LGHL 1U8MA 1U8HA 35C8H 1FNLA 4K8RH 2M2DA 2YD8A 4AEHH 5ID0A 4AEIH 1FYTE 3RAJH 5FDWB 4XBPB 4WNQA 2LAGB 3MJ9H 2P42B 5HDQL 2HT2D 1Q1JL 4OQTA 3BUTA 3GSUB 1GOGA 4JPKL 4JFHD 3TH2T 5HYJA 1U2CA 5EA0H 3UJIL 3FJTA 2F5AH 4I0PD 1EUTA 2WBWB 3U6RA 1NANI 3C6SB 4HIHA 5JXAH 3RWEA 4JANA 5HHXL 3HG1B 4NQEE 1EH9A 4NO5B 3T0VA 4APQB 4A6YH 3OG4B 2V2WB 1AHWB 1CXEA 5MERA 1P4IL 4PJ9D 5EBMB 2DWDB 3K4ZA 3M17B 5HYEA 3VFUB 4KRPC 3L1OH 5L0QC 4HGMA 2MCPH 3V0AC 4P57A 3RL2B 3LQAC 2EKSA 2ADIB 3OQ3B 4EI5B 3LKQB 4UQ3B 4CGTA 4PS4H 4M7JL 2VXTL 4XNXH 2C3VB 4HUUB 1FFRA 1O7VA 4GH7B 4AT6A 3AB0C 3I6GB 4UBDC 1NC2A 1S8DA 2VZTA 3W0WE 1DR9A 4IRZH 3B4NA 1BAFH 2W92A 3QG7L 3MJ7B 4OT1H 1CGTA 1YZZA 1UM6L 1UEMA 4OI7A 2YD3A 4NNYB 1IILE 4JG0H 2WINB 4E41D 1RUKH 4ODUA 1HCVA 5C3TA 4Z0BL 1EZVY 4B7LA 2MHAB 4HLZH 4X6BA 1NEZG 3J8F7 2DM4A 2DMCA 2R1WA 4FFYH 4MWFB 4YDLC 5E5MA 4YR6B 4JQIL 2D7TL 4Y4FA 2WP3O 4YDJA 3UTTA 4GKSA 3CK0L 5C8JB 2ADJA 3O4OB 2VSDA 1NEZA 3WJJA 5JTWA 5CJQL 2E9BA 3X14A 3VXUA 1K4CB 4KVCH 2VXQL 4J1UA 4Y2DA 1WFUA 3K1DA 3AFLA <