2HT3C

Structure of the escherichia coli clc chloride channel y445l mutant and fab complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3C01
2UY7A 5FECB 5I2IB 1J87A 4MA1C 3TO4B 1NCAL 1L7TH 4ISVA 3ULUD 4AM0A 3WLWD 3HNVL 4M7LT 2ED7A 4HC1A 5DDHA 3MJ7A 4RWYL 3FZUD 4I0KA 5AEAA 1KJMA 4GMTL 1YEKL 3C2AH 1YN6B 1I1YB 1YYMH 5FHBH 2IH1A 4YBQD 3FQWA 3BIKB 1XGQB 3WN5C 1UXWA 4JDZA 4IJ3C 3V0WL 5T5FH 4RMQA 2B5IC 4O2EA 4YFEA 3VFGH 4PGCB 5JQ6L 1DBJH 2FO4B 1QO3A 1QLFA 4NYLA 1KNOA 3V6OA 2C3XA 1W0YT 1GPOL 5I75C 5HBBA 3ZTNL 5J06A 2DLFL 5JXAL 3FN9A 2BDNL 1MCQA 3MRNB 4YGAB 3MRMB 4MJID 1KTKE 1FN4A 1M7DB 1KG0A 3HMXH 2EH7H 3MJ9A 4XNUH 5DJZB 2ZCHH 1K4CB 3HG1B 4ZNEA 1G9MH 2E8YA 4K94C 5DVLA 4J3XA 1T2XA 1S5HA 1PKQB 1XZ0A 4C56D 3VWKC 4NWTL 3TNMB 1G7QB 4EDXA 4JCLA 3MZTA 4TVPL 5A1AA 4LEOA 3ZKND 1NBVL 3ZKMD 4QEGA 3GMLB 3H9SD 4KVNL 4JFFB 5IM7B 4NNXB 4X6DE 3VXUB 1QBLH 5LJYH 1N4XH 1HIMH 3C08H 3VFVB 2WQ8A 1T0MA 2NY2D 4LSTL 4F57L 3NZHH 3IF1A 4CADA 2V7NB 4F7PB 1QFOA 5AUMA 2ICES 2DICA 1JGEA 1JF5A 1NGPL 2X4PB 2X5PA 4RAVB 4WI6A 4TNWF 3S88L 1KT2B 4OGXH 3V52L 3H9ZA 1XGUA 1U91B 3VDCA 3WD5H 2EE9A 2P43B 4U1IA 3I3BA 1P69B 3MCLL 4FTVD 3ARGA 1LWRA 1D5IL 1ND0A 4ODWA 4CKVX 1CI5A 3PGFH 1BM3H 1GOHA 4FG6D 2JJTC 5HVGB 2D31B 3DX9A 3OKOA 4X5LA 3HR5B 2RHEA 2FX7H 3LN4A 5T3XL 4J3UA 2XICA 3C6SA 5I75B 4IMKC 4LRIA 2XFXB 2CXKA 3FONB 5CMAA 2W0KA 1JV5A 1K5NA 3V7AE 1DLFH 3PWUB 4PUBH 5KW9L 3QUYB 1QQDA 4WV1C 3W11D 3UZVB 5JHDD 3BH9A 3EYOB 5EDXA 1FNHA 1IE5A 1IGYA 1FDLH 2W9EL 1QSZA 5KSBA 4TSAH 4JPVH 5DD6B 1V05A 3S98A 1KLGA 5FYLL 1B3JA 3L95B 4P5MB 4V2BA 5J3HD 1YMMA 4JFPB 1J8KA 1RK0A 4AMKL 3GUTA 4HKBA 5CEYA 3L7FB 1CLYL 1U95A 4N0RA 4H26A 1UCTA 3L9RB 4G43A 1I8LC 5JDSA 1NMBH 2ADJA 5HPMB 5IG7B 4DGVL 2X6MA 2B2XL 3OAYK 1NUDA 2VZUA 2I60H 2OTWA 4YZFF 1F4WH 1ORSA 3LEVH 4HEPG 1OTTD 4HUVB 3GB7A 3NMEA 4S0TD 3QPQC 5IVXB 2F53A 1D9KB 2GJ6E 5E5RB 5F3HB 4OB5L 1QTYT 1WCBB 5JXED 2VH5L 1TPXB 2X2YA 3ARBA 5L8JB 4PP1C 3FQTA 3OHXB 3CXHK 4LLUB 4QF1B 4RWHA 3V4PH 4JAMA 1UWEL 1D3CA 2E9WA 1PLGL 3GJFK 1AQDA 1NGQH 3EHBC 1S9WB 2XN9B 5IMOA 3F7VB 2H26B 2R0WL 43CAA 2Q8BH 2Y07L 2F9BT 4WHCA 1RZIA 4WV1B 1I3GL 2DB8A 4UTAL 3EO1B 1TNMA 2Q7NA 3MV9E 3RY6C 1CK0H 4HS6B 4FQCH 3L6FA 3AROA 4AK1A 5DMKB 4Z77A 1S7SA 3STZB 3QBTB 3F6LA 4HXBH 4WEUD 3V5HB 4M62H 3ZLQC 1A1MA 4QRSB 4XNMA 5EO0B 4WO4A 3HS0B 5ITBH 2KZWA 1NAMH 2EC9U 2R23A 1A0QL 3EFDH 3KS0H 1CDCA 1XF5B 4L8CB 2XNAA 4KTEH 3ILPB 3GSWB 3I2CH 3RGVD 3RVWD 1MNUL 3DRQB 1PX3A 2AK1L 2NNAB 3AC0A 5EC2B 2OL3B 1QBAA 3T65A 1EX0A 3GBML 5ADPL 3BD3A 4G9FE 4Q9QH 1G9NH 1N0LA 4RCAA 4YZFE 4H1LA 5MERA 2OZ4L 5E2UH 1FRGL 1JRHL 4JRXA 3GNMH 4NJAH 5E9DD 1CD9B 2E27H 3AREA 3SY0B 5M95B 5FA3B 4YXKL 2EDKA 3S36L 1YPZA 4Y1AA 3SQOH 4OZGB 3L1OH 1S7VA 5FK9A 4XVTH 3DBXA 3FO9B 3VGAC 3HA0A 4DW2L 4XP9L 2FIKA 3TT1H 3LHPL 2XZQH 1RZKL 4MA7H 3MGTB 3VXTB 1SMOA 1MCCA 4YR6B 4LU5L 4JQXA 5GS1B 4JFZL 1ETZA 2KQNA 3RIAK 3EOTL 2UV3A 3U7WL 3VXME 3IXAB 4LLVB 3CZFB 2ZKHH 1SJXA 4P5TB 3SDXF 5E4EC 4KK6C 1BAFL 1EXUB 1HHJA 1YEHL 1P7KA 1KCVL 5KSAA 1GC1L 1RJLA 3MJGX 3QHZH 2WP3T 3LKOA 4UQ3A 5LCVH 5BQ7A 3MRIB 5KVFH 5GGSB 2APFA 1RUML 3TN0B 4TOYH 3MZGB 4OD3H 4F7MB 2HTKD 1WK0A 3PP3H 3B43A 4OCYL 4ELMF 3PXJA 1ZLUH 1SMAA 3CUPA 3MRHA 4M8QB 3ME0A 4PR5B 3TWCL 4H8WL 1DR9A 5FHAL 3TNNA 3NZ8B 4ZFFB 4QCIA 1AQKH 1IGFL 3SDDA 1A6ZB 1DQJA 4Z0BH 4MJ5B 4NQED 1QNZL 5IHUL 1OCWL 1KN2L 1ONQB 5EUKB 4YHPB 5IBUG 5DJXA 1PD6A 4Y4HB 4DZBB 3U0WH 2Y4SA 4ZTPL 5I1AB 5AAMA 4N90E 3OZ9L 2DL9A 4OJFH 3T0DA 5D7KD 2HJKB 3HPJB 3D25A 1DUYB 4CJ1A 3BGFB 4WJ5B 1RU9H 3JWOH 3LRHA 5HVWA 3BPOB 1J0IA 5I73C 1QFWL 1QHOA 3MA9L 4DVBA 3ETBF 5I18L 2WLYA 4G7YH 2B4CC 1HXMA 1LP9B 3NFSH 1CGXA 2HJLA 4PJCA 1AIFB 4I77H 1ZGLM 4ELKA 1R3JB 5E4EB 1XIWA 2BC4A 5I8EB 5J6HB 1PG7L 2P8PB 4R2GD 3RKDC 3SDXE 4DN3L 1U2HA 4K7PH 2VISA 2OI9C 1TJIH 2V5TA 4ZYKA 3V7AG 1RMFH 3VRJB 1I1FA 4H0GA 4LPUA 4XMPH 5T1KA 5EPMA 2LU3A 3DRTB 2Z35A 1T22B 4N0YL 4YHOH 4K8RD 4P2RD 4X7EC 4DUWA 1T0NB 1ED3A 1LEGA 3EOYG 4Q58C 4RMUA 4PJBB 3WN5A 4XXCC 3WO4B 1CDUA 2X70A 3S4SA 1FNSL 1T5XA 2EDLA 3PIQA 4JHAH 5INDA 1LK2B 3EO9L 2DQUH 3K7UA 4ELME 1DVFD 1VADA 1V3JA 1KBGL 2YKLL 3BPNC 5IFHL 2CDFA 4G8IA 3WIHH 1UENA 4LIQH 2C7UA 4OZIB 5L2KB 4GKNA 3QO0A 4R8WL 5EU3B 5HGBA 1CFBA 1P7HL 4TYUA 4G8GD 4UOJA 4M6ML 1DBKL 4HXAL 3SDAC 1RD6A 3SO3C 4NM8H 4NZJA 4ODUB 3Q2CA 3U0PA 4U1MB 3VWKA 1QLEL 3BRGC 3KDMB 3EUUA 1LO4L 1A3QA 3TFKC 3G5ZB 3O3UN 5I73B 3BWUC 1H5BC 3S3JA 1AD9B 4HT1H 4O4YH 5DJ2B 3RBGA 4BFBD 1F97A 2A74B 4LRNH 3ULSB 1NAKH 1S9YA 3HRZA 5TPWL 5L0QB 3NCJL 2W0LA 4YJZL 1A4KB 3KPQA 1JF1A 3GBNL 3RWEA 1KELH 2ITCB 1ZA6A 2R39A 4PJCF 4M3KB 3D18B 4F9LC 2NY4C 3VRIA 3W9EA 4WNQA 1L0XA 5C0NC 1NUFA 2GSGA 4WVRA 3GMNA 1VFBA 4C83B 1FP5A 3LQZA 3IDJB 2ZJSL 4JRYB 4QRTA 4AEEA 4I3SL 1URLA 3BDYL 4FXKA 4Y19B 1GGUA 3NTCL 5I1JL 1GVIA 3MJ6A 3TIEA 4BQ9A 3SE8L 4ZAKB 4DKEL 5HHMD 1YMHA 3EJYC 3BUTA 2XQYG 2IPUG 1FV1A 3ULUL 5E95B 5J1SC 1I3RA 2DTML 5E6IC 3FRPG 3ET9F 3KYAA 3HPLA 4XP1H 5I6XB 5A2IH 3P0GB 5L7XL 3CLEL 1UZ6E 2Z91A 3P0VL 4IHOB 4MMZC 1INDL 2EO9A 4TUKH 2OX5A 4LARL 4WWKD 1RULL 4U6HB 4EI5D 5J9PA 3LRSB 2O26U 1QFUH 3PGCB 2K7PA 4KK8C 3SO3B 3PDOA 4KUZL 2HT2D 2DWDA 1ODAA 4JKPH 4W4NA 4HGMA 3CU7A 5KBNC 1JGUL 1WBZA 4XI5D 4OIAA 1C16A 5I1DA 2DQEL 2IPTL 3SKJL 3BDXA 5JW4R 3HG1E 4OTXH 2HFGL 1WTGT 4JY6B 4XH2B 4APQB 2HMID 3B6SA 1P53A 1PKQE 3UYPA 5I17B 4HUXA 2BNQB 3DSFH 4QHLA 1FNGA 3TBTB 1F4XL 1ZLWK 2PCPA 1DSFH 5GGVL 1LNUA 1CGSH 4NBYB 4DCQB 2F8VA 3B2VH 3RPIB 4DN4H 4N9GB 5AZ2H 5DQJB 4JFFE 4LSUH 3IDGA 3HE6C 4JFYA 1JIBA 3VXPB 3VXUE 3MV8E 3RJQB 3AB0B 2BJML 2H2PC 1DQDL 1QVOB 3HFMH 1UJ3A 5HDBE 3JUZA 3U82B 5ACMA 1RZGB 5CKAA 4WW2C 4UAOC 3QXUA 4KTDH 4EUPB 4MDJB 4RNRA 3CMOL 4QOKE 1BFTA 4KY1L 2Y1VA 1L7TL 4HS8H 1RVFH 3PQYE 5IB3A 2UUDK 3EOBA 3MRQA 3UPRA 3BKJL 1LO0L 3E0GA 3N50A 1U3HC 3RNKB 2WUCL 1HWGB 3MA7A 4YGVB 3CPLB 1MI5D 1ZSDA 3C2AL 5IW1B 4WW1A 1AE6L 4X7TB 3GSRA 1R0AH 5LAXA 5T5FL 2XXCB 5FOBB 5L88H 3HKFA 1DBJL 5EUOF 4X6BB 1H3WM 1OY3B 3UYOD 4B5EA 3C9NB 1G7MA 4R7DB 5EU4A 1HSAA 1JGLL 5DUPH 3I3EA 4X7FC 5CD5C 3EGSA 3TCLB 4HKJB 2MHAB 3P30H 5IJVA 5LXGH 4LK4A 5EBMB 3UTZA 2BNRD 1A1NB 3SDCB 2ZCHL 1ZWIB 3WKNA 5K9QI 1R24A 1QD0A 1UC6A 1N8ZB 2EIBA 5J1AA 3KPNA 4X4YA 2J4WL 1SHMA 1CXLA 4L4VD 1NANI 2XWTB 5IMMA 4NQTA 2B1HH 3EYVB 5IB1B 3HCVB 4WW2B 4DK6A 2UVEA 2Y25A 1I1AB 2VQ1A 1T3FA 5IVXE 1GHFH 4ZSOA 1HEZB 4JG1H 4E41D 1WBXB 1N4XL 3C08L 4ODSH 5B39G 1YEIH 4TTGA 1MAML 5FYJE 2OK0H 1YN7A 5JIIA 4PG9B 3SKNA 3NZHL 4OZGF 5ESVB 1CG9B 3TBWA 1U3HB 4GLRI 4U6YA 4LGSB 3U36A 3U9UB 3W39A 4Z8FH 3WD5L 4R90L 4Z95L 3UTTD 2P5WB 3BP6B 4JFQB 3W2DH 3V4VH 3O41B 4BZ2H 4YEFA 2IFGA 1SY6A 2XN9E 1CQKA 3OKNB 3LB6C 1BM3L 4MB3A 1IQDA 4F15C 1NEZA 2Y5TA 1CZ8H 4YEEA 5EUOE 4R4FL 4W81A 5J4MA 2GY5A 1GCFA 1UACH 4JY5H 4YHZL 2UY6A 4H1LG 3QI9C 1TJGH 2XQYK 4OCNC 4XCYB 3SKMA 2IPUK 2PW1B 1TITA 2VXSL 3MRKB 2J8OA 1GIGL 3TZVD 3BN9C 1YUHA 2J7LA 1U42A 4QRRB 3WUZA 2ZUXA 3ILQD 4M7ZC 3VGFA 5E5UB 2Z92A 3EIFA 5EN2B 3PNWB 1BQUA 3TV3H 4JQIH 4JKWA 1E4XI 3GIZL 3B83A 4FA8A 1A7NL 4K7PY 3K4DA 1A1OA 4NQCA 4UQ2A 4XPGH 3N1FC 1XEDA 5IESH 1YEGL 2C3VA 5C08D 3L3HA 5CJ5A 1JJUA 1U92A 3EDFA 5BZDA 4FQLL 4AYFA 3SOBL 4PG2A 3S7GA 2NW2A 3C5ZD 1DP0A 4KDTC 5EB9A 1EV2E 1Q94A 2M2DA 2QHRL 3MV11 2HH0H 5C9KA 1NMBL 4X5WB 1XR8A 2CK0H 2C1OB 3FOLA 4XMLL 3BZ4B 4NPYB 2I60L 2DLHA 1NBYB 4FFWD 4OZGE 4HFWA 3MV7B 5CJQH 1CDBA 1J18A 3NH7H 2I5YH 4HCRA 5DRWB 3FQUB 1PDKA 2BRQA 3O3EA 1Z5LB 3H9YA 5DO2D 5KVDH 3F6IA 5F3BB 1YY8A 2BRRL 2YUXA 3BESR 5CSBA 1S7RB 1BQHG 1MY5A 2B7DT 2PXYB 5J11C 4PGDB 1WWWX 3GGWB 1FZOA 1W0WA 3GBLA 4U1SB 2NTSP 3QEHA 3P40A 4G8EB 4ZPTA 2BVPB 4KKNA 4YO0B 2XQBH 4DJMA 4FNLH 1CF8H 4R9HA 3QEUA 1J8HA 3VFUA 3X13B 4YDJA 4WCYL 1ACYH 4M7ZB 4XXCA 4ODXB 4HG4J 1JHKH 3ES6A 1W8OA 4G7VL 4P3CL 1FAKT 5KG9A 4I4WB 4PJBF 1HQRA 1SVCP 4Q6IB 2K3TA 4HXBL 5DD1H 5IBLD 2PYEB 2JB5H 3OAYH 5HI4D 5D2LB 4LCIL 3WIFB 1C1EH 3GRWL 4K55A 3TO2B 1NGYA 1VEOA 4Q2ZA 1FO0A 5AG9A 5E2VH 4P46D 4XZUB 5FB8B 4UB0H 4EDWL 1JK8B 2GTZA 3PV6A 3KHQA 2B8OT 3MACH 4BSVB 5D7LA 1I8KA 2ZUWA 3BZFA 4QYOA 4G8FB 1BBDH 3I6GA 4PRPD 5CGMA 4Q9QL 4EIGB 1TTGA 5IJKA 5F9DC 1WSST 2ATPB 3VRLF 1N2RB 2VDRL 3GJFH 1H5BA 1K8IA 4NJAL 3TBSB 1S7UB 4RX4A 5BO1H 1JYWA 3FQNB 2E27L 3EYQD 5EOTA 1QBBA 2A9NL 4Z76A 4LAQH 4Q7DA 2GK0B 2CLVB 2XTLA 4H0HB 4GQ9H 2CIKB 4XPBL 2J2ZA 4N8CH 3GMPB 1R5VA 4OBSA 4LP4A 3KGRA 4X4MA 1LP9E 2QKIB 5HHPB 4XVTL 4YX2H 5J11B 1BOYA 1AJ7H 4U31A 4F9LA 5CIPA 1BFVL 2GCYA 5IVOA 3TT1L 2GITA 5ACLA 3VFRB 3WJJC 1IGTB 2ZG1A 3OX8B 3W0WD 4YHLL 1IMHC 1AFVH 4F7CB 3HI6H 1FNFA 4OZFG 4OFVA 3FHAA 1ZA3A 4MAYB 4P57A 5KANG 1RK1A 1KULA 3VGEA 3U7YH 4HH8A 3MRFA 4WFHD 3HC0A 2NXZC 2FEDC 1DEDA 1MFBH 1KOAA 3TLRA 1HHGB 3S97C 3V0AC 1P84J 4LKXB 1A4JB 3FMGH 3FO0L 4PJBE 4RFNC 4N0CD 3MNVB 3TYGL 5DJAB 4KAQH 5D93C 2VDPH 2BNUA 3G04A 5E6IA 5DSCB 4WEMB 5IMKB 2CKBL 4D9QD 1ZOXA 2F54D 1CU4H 5F93C 1XF4B 1CE6A 2GKIA 3GMRA 2WIIB 4M43L 4P3DB 3IDYC 4K8RL 2ILLA 5K59F 2YUZA 4FZ8H 4LVOC 4OD3L 1SY6H 5EBWA 1PBYA 4A6YL 4MXWH 4OZIE 3FQRA 5L2KE 2UZXB 1XF3A 2A1WH 4HWNA 1UH4A 1YC7A 5C6TL 2G9HA 5F7WC 5K93A 1NLDL 2R1WB 1HI6B 3WFCL 3VRLE 3QIBB 2IH3A 4H88L 3GSQA 1AQKL 3IDIA 4PFEA 1C5BL 1KPUA 2CDEA 2UWEB 3I50H 3TBVB 4ODTL 3PV7A 3BW9B 4PP2B 1U6AL 4LPYA 1OAZL 2FSEB 2P4AB 4RGNC 5F7DB 3A6BL 1OD9A 1IBGL 1G7PB 2WM0A 5DTFB 1ZHLB 3WFBL 2CUMA 3GSUB 4P2OC 3SEPA 3HMWH 3LKPB 1B9ZA 4OJFL 4QXWA 1FIGH 25C8H 4NC0B 3ABZA 2VDOL 4FFVD 1D6EA 4NKQB 1FFOB 1IILE 1RU9L 4HJGA 3QDGA 2H9GA 5BZWB 4NC1C 1NC4B 2Z8WC 3PWLB 1PW3A 5C0GA 3QFJA 2NXZB 1MRDH 3RWIB 2AJUH 2DAVA 3C8KB 2O5YL 1L9MA 4LQFH 1OP5K 4XC3L 1JNLH 4N8PA 2EH8H 2Q8AL 5D1QB 1BREA 1MJ8H 4Y19E 5I1IH 2I24N 2VLRD 5HDQH 2VQUA 1UFUA 3DX8A 3HUJB 5D5MA 4X6FB 1MUJA 2GUOA 4JRWA 1QBMH 3L3IA 1AKJB 4FRWA 3WNLA 4F2MB 1C5DB 1J0KA 5HTSA 3NABH 3QNZA 4YAQB 1ADQA 5D8JL 1AC0A 1TTFA 3REWB 4JHAL 3MXWL 2DQUL 3X12B 3QHFH 3WCYA 1GZQA 4HMCA 1T7ZA 3H3PL 2ICCA 3WIHL 4JJ5A 4Q6YA 4NRXA 3PE9A 3EO0B 2IWGA 4DQOH 1P4BH 3HZMA 4NHCL 2HVKA 4NN6C 3MBED 1WFNA 3LZFH 4G42A 2OTPA 4JGUA 1WFTA 3NPSB 3EOAA 2VXTL 1UYWL 3MFFA 3HE7C 1CD0A 2BNQE 4UU9A 1QSFB 1KIQA 4NM8L 5C0AE 1MFDH 5D7JD 1E28A 4ZUWA 1TQBC 4N0UA 3FCTA 4ETQA 4I48B 1MWAL 1SJEA 2FLRT 4ENED 4HT1L 4O4YL 4FMKA 5DJCA 1DUZB 4GOSA 3QDMD 5CEZE 3DVGA 2VLJD 5HVHB 4MA3A 1NAKL 1QRND 1FBIL 3DECA 4WW2F 5HI3D 2AEQH 3F7YA 4ESKA 2D9QB 3CFCH 4I5BA 2A0LD 3PP4H 3BI9X 4Y5VB 5KVGL 4XPHL 2Z31D 5AZEL 3U4EB 3ARFC 3CXDL 5GGTH 2AABH 3GFUA 4UNVA 1P6FA 4FG6C 2X4RA 4XNQB 4ZO6A 3L3OB 4B0MM 1ZHNB 1PZ5B 4R7NB 2WQRA 3SCMA 1A7BA 2ATKB 2FX8L 4UV7L 4GH7B 5MP6L 5CWSA 4HUWA 5ISZD 2PR4H 4NBXB 3V5DA 3ARDA 4YHYB 5CIPH 2KL6A 3GHBH 1CD8A 5DUMH 3DV6A 4GAJH 1HILA 4HK0B 4MJ6B 5FO7B 3QI9A 3VA6A 3UTOA 4BQBA 4MJIB 3DURB 5KVMC 4ZUVB 4D0CB 4NO5A 4BQ8A 4XP1L 4IMLB 3BH8B 4TUKL 4DVRL 5HYJD 1YDPA 4HX1B 5A2FA 4QTHB 1FVEA 1S7WB 1Q9WB 3HE7B 5JLZA 4U49A 1T5WA 3KVQA 5MEOB 3ZHDA 2WWKT 3LOWA 2D03H 1KIPA 2O93L 3H9SB 2V2TA 1TVBB 4XBEH 1IGJA 1FLTX 2IADA 2IFFH 2KZ1B 3MUZ1 4LVEA 2NY2B 4GT7A 4BUHA 4M93B 1KLUA 1CFQA 1WBYB 4KDTA 4NQUA 2EDEA 3G5YB 4UMGA 4LCWB 3HI1B 5EU5A 1FL6A 4PJDB 4U05A 4U0QB 4GW5A 3B2VL 1NEZG 5ETUA 3UPCA 1FGNL 5T3XE 1X9QA 3L3DA 5AZ2L 3V0VB 4FQ2H 1JWUB 3BIAX 3B5TA 5EOQH 4FTVB 1CDGA 3C60A 4RAUB 1J05B 1FSKB 4J3TA 2Q3ZA 4QXUH 1RHHB 2PUQT 3QUML 4BSJA 3QCVL 2NZ9C 4IS6A 1QSEA 3ZYOA 3ZE0F 5CJOH 2X4OA 2FCBA 2D7MA 2Z4QB 4U6VL 5K9KA 1BX2A 1P4LA 4R4NC 2EYTA 4O2FA 3D85A 5IHZA 1OGAA 5D4QA 2P5WE 1DJSA 4HWZB 4HS8L 5FYLE 1LK3H 4YPGB 2VDKL 3ZKXC 3KJ4B 5JHDB 5EIIB 4ETYA 3BQUC 4LLWA 1CFSA 3RUGB 5BS0A 1JNNL 3CGTA 3I9GH 2IC2A 43C9A 4RGOH 1BHGA 5E4IA 1M1SA 2BFVL 1LO3L 4HJ0D 4U1GB 3KYOB 5ICXA 4JM2A 5C0EB 1R3LB 1A22B 1ZLWH 4Z78A 3TJEL 3V4UL 5IF0A 2J6EA 4ZPVA 5KSVB 3ZE1F 4ZS7H 1F11A 4Q74A 1B0RA 1BEYH 4M6OL 4OT1H 3C09B 4RAHA 3WXWL 3B2UC 5CS7A 1YEDA 5DWUL 4WHYG 1GAFH 5CGTA 4S1RH 3SE9H 4HEME 4E5XB 4OCLC 1RUPH 3B5GA 1BVLB 1A7PH 3CVHA 4KJWC 1BFOB 1KGCE 4QHNA 1EA9C 4P48A 1B2WL 1I7UA 3P73A 1AR1C 4U1HA 2O61A 4JCMA 3QUKB 2UUDH 3B3IB 3T2OA 5JW5B 1GGIL 3L3KA 5HJ3A 2FZ3B 2OR7A 3PABA 2BSTA 1U8OA 4LVNC 5H35A 1P7QD 3MV7E 2PETA 4MS8D 1PSKL 1SBSH 3ZE0E 3QH3B 4MQXC 3PDDA 3B9KA 4F33B 5KN5A 2X9WA 3BWAA 4Y5XB 2GK2A 1YEIL 2P8MB 2ICEB 2HP4A 4MVBC 4POZC 4LSQH 4JGJA 1BMGA 3P9LB 2OJZL 3ZL4L 2R15A 1MHCB 3WFDL 2B39A 3BP4B 3W81A 3NFNB 1I7TA 2PTTA 4R26H 3BQUB 4JANB 1IEAA 2HT3C 5EWIL 3RVXC 4JE4B 4K71C 2VITA 5MENA 2YPLD 1QA9B 1G6RL 2D4DA 2YUWA 3PJSB 4P2QA 4AIZB 2WAHA 3W2DL 1U8LB 3V4VL 2GFBB 4U1NA 2RBLA 2VC2L 4OZHB 5CP3H 2K1MA 4FABL 1XCQB 1FNLA 3RNQA 3EBAA 2J88L 4ODHL 4RFOL 1CZ8L 1T1YB 1EUUA 2MQ3A 4GKSB 2VXQH 2R2HA 3RGVB 1WFOA 1TJGL 2HG5B 2AJYL 3ZE1E 1XT5A 4EQ2A 4RISH 3BP7B 5ICZA 2PYEE 1LGVA 5C0RH 5D2LE 1QYGH 1T2JA 4LHUG 4JFOB 4JN2A 5DRXB 3DMMD 4NOFA 5E9DB 4OCMC 5EZOL 4OBRA 3VFTB 4HGWA 2PKDA 1EAPB 3H2WA 4L3AA 3ROOA 3O6FC 4U1KB 4Y16C 3VWJA 3JTSA 5F7UA 1HH9A 4PRBA 4EQ3A 1IAII 5AD0A 1C12B 4MNQE 1ZANH 1PEZA 2FECL 4EUPG 2Y9RT 4OLVH 3QAZB 1ITCA 3O2DA 4P2OA 3FRUA 3Q6FA 4EI6B 4I0PC 1FE8H 2OYPA 1H8OA 3DO3A 2Y36H 4Z0XB 4TNVF 4JQVC 4CVZA 3BRFA 4FXGA 2DM7A 3CCHA 2N4IA 3G6AA 4D9LL 4GG8A 4J3VA 5CJQL 2XA3A 5D1ZC 2NY1C 2I5YL 1FH5L 4BELD 3ZSSA 5ALBH 1MF2L 3RVTC 1P2CB 4UT7H 3VFWA 4PJIA 5FGCB 5F7YC 2BXYA 3MYJB 1H15B 4CMMB 3OPZH 1CDIA 5EA0H 4KK9D 1YQVL 2B20A 5F70A 3MLTB 2GT9B 3CDGA 4V1DA 3STLB 4H5SB 2UZIH 4IDJL 1K2DB 2A38A 3CC5A 2XTJC 4XVSL 5FECA 5I2IA 1KEGL 4FNLL 3QIUC 5FM4A 5DJ0B 3MR9A 5CBAA 3QQ3A 4MNGA 3HUJF 4FQHA 4PLKC 2XYCA 1ZS8A 4KKLC 4MXVF 1VSCA 3TT3H 1ZGLP 4U6XA 5L6YH 2MPAL 4XXDB 2FR4B 5A3IC 1ZAGA 1IVLA 4PRHB 4XVJL 1I1YA 3BAEH 1O7VA 3BIKA 2ZCLL 3O6FB 4M00A 1OTUC 1JCKA 1U9KA 1MHPH 1CE1H 4PGCA 1OWWA 4JREB 2FO4A 5D6DA 4CVXA 1F6AA 5IFJA 1PVHA 4F3FA 3ROLA 4HUUB 4ZOBA 4MCYB 2A77H 4PJGF 2UWEE 1A6WH 2RFXB 5GJTH 2CH8A 5DMGC 5I19H 2E9JA 3U6RB 3OBAA 3Q6GH 3CK0H 4M8VA 4F7TB 1EDQA 2J6EH 2ZUYA 5CBEB 5J7CC 4GXUN 4KHXH 2HRPH 1XAUA 3QO1A 1HNFA 2EDJA 2W1NA 3PL6C 5DHVB 3QPXH 2VERN 1HYSC 4OF7A 4OFKA 4R2GB 4FS0A 5I8OH 1RIHH 2BVOB 1NKOA 4LLQB 3RQ3A 5GGQH 1C08B 1DQMH 1TZHB 2CKBB 2NLJA 3OJDA 2Z9TA 1G7QA 4GQ9L 1ZT1A 1IKFL 4N8CL 4ZFOL 4J8RB 4PD4K 4G9FD 4P2RB 4YX2L 1CR9H 2EYSB 3GMLA 3U83A 1S5IL 1YJDH 2Q3AA 3ARFA 3CSPA 4A6YB 2WP3O 4NNXA 2XTJB 3VFVA 5CD3A 5HSFA 1NMCB 2MCPH 1UB5B 4HZLB 2EDNA 3QIUB 1S78C 1DN2A 3E6HB 3U7YL 1M6OA 2V7NA 4NO2B 4F7PA 5FCUL 1KB9J 1IC5L 5E7FA 4MLIA 2EDTA 2X4PA 3HUJE 4MXVE 1KT2A 3OKYA 4WI2A 5KS9B 1WZMA 4BFIB 3ARGD 3RZCA 4KMTH 1RUAH 5I9QB 5DZLA 3QQNA 5E6ZA 2VDPL 4I2XB 4DOHE 5CLTA 1N3NB 4PLJC 4G8GB 4X6CB 2D31A 4XPTL 3GMMB 4R0LB 3HR5A 3WS6A 3RU8H 2VMFA 1JWMB 1DBBH 4WUUA 1JHTB 4L8SC 2VZTA 4WTWA 1LDPH 1YZZA 4FZ8L 4GBXD 2FATL 3QWOA 4Y8AA 1I8MB 1DN0A 2XFXA 4OSUH 2A1WL 1UCBH 2AAVA 4PJGE 3GIVB 2XA8H 4RGNE 4RMVA 1BBJA 4OI7A 1DEEB 3PWUA 3VGHA 5TQ2L 1I7RA 1U93B 2E5EA 4FQPA 4L9LC 2ARJQ 4D8PA 3VFPA 3PL6B 3I6LE 4S1QH 4GW4A 5KZCD 1QSFE 5DJ8B 5ID0B 3BEVB 3LEYL 2XPGB 2R4RL 2EE3A 3U2SB 3CSYA 4LL9A 5T3ZH 4DZ8A 3TCXA 3L95A 4KDVA 5JZ7D 3NGBC 3ULUE 3DVNB 3WFEL 3H7LA 4CDHA 3FB8B 3MOQA 2DBLH 4J4PA 5C07E 1DQLL 3GJEA 5TDOA 4Z7VB 3R8QA 4DAGH 1Y0LA 4P9HC 3VH8B 4M7LH 5HHMB 4NKDB 1CXHA 3BGMB 1EHAA 2F53D 1PJ9A 3BEWA 3HC3H 3N85H 2LAGB 5JORB 5IVXA 5BV7H 4ALAL 4D9RE 4UIMA 4N90D 3TH2T 3IAPA 3K8LA 3H6JA 3PF2A 4G6AC 4RQQB 4J7RA 3GO1L 2IAMC 4OQTH 2FBJH 4WWKB 4EI5B 1I4FB 3DUHA 1K3IA 3FOMB 1QPPA 1XGPB 4CBPA 5JW3L 5GS0D 3QUXC 4MJIE 3C6LC 1MCWM 3KPRD 1UXSA 4WUKH 1MWAB 4PB0H 4XCCL 3M1BA 4MJ2A 1BVKB 3JXAA 2OJEB 1NH6A 2RB8A 3F7VA 4TUJA 2H26A 1PG7W 3QHFL 4YFLI 1LEIB 3S34L 1NFDB 4GRMA 2YA0A 3BXNB 5SWSA 4OFDA 3EO1A 5EORH 2BHZA 1GGTA 1B88A 1DZBA 4XPFH 5ID1A 4ONHB 1DE4B 4HS6A 4DQOL 5DS8A 5DMKA 4U33A 3H9SE 1DL7H 2XWBB 5GRUH 4LPWA 3LZFL 2QR0A 4J3OC 3V5HA 5CILL 2VLLA 3LKNA 3L5IA 4QRSA 1CIUA 1R5IA 4B7IA 4M02A 3HS0A 4HULB 3RVVC 3O9WC 4QO1A 1TMCB 4LSRL 3EJZD 4TSCH 4PJHB 1OP5H 1XF5A 4YHIA 1NSNH 1JUFB 2BCKA 4LCWE 4X5XB 3ILPA 4HAFA 5L2JB 3QZWB 4LSSH 4HWUA 3DRQA 1OOAA 4JZNA 4AL8H 2NNAA 4NZTH 2FJFA 5SWZA 4LLAA 3FO1A 3HZVB 1F8TH 4FTVE 1B4JL 3O3BB 4JRXD 3VD9A 5I30H 2F19L 1DANU 4ORGB 3JV6A 3TC9A 1R3KB 2R9HD 1Q9LB 4YHKH 1MI5B 5F96L 2EZ0D 4M7JH 4Y1AD 2WLZA 5F9OH 5FXCH 2E7LC 3S96B 3F7RA 2VDLL 3RA7L 1GL4B 3QUXB 4JEGB 3FO9A 3BPLC 2YD4A 3GHEH 3WV0A 5BRZA 3DTXB 5JHDE 3MGTA 3TEUA 2D0GA 4X4XA 2NY5L 1XH3A 5GS1A 3OJ2C 4Y5YC 4AEHL 3GHBL 2AQ2A 5FKPB 5DUML 5E56A 2ID5A 3AUVA 1RZ8A 1AGEB 2HJFA 3CZFA 4U2YA 1WICA 3TPUB 2R4SL 2AXHA 2BNRB 4P5TA 1KJ2L 5IWLA 5EBGA 3MV01 4NWUH 1T66C 2X4UA 3EYFA 1S9XB 4HBQA 1JPGA 4L4VB 4L29A 2R1XB 1U58B 4U0RB 5EBLB 3QUMB 3O9WB 1MFCH 1OF2A 3I75B 1KN4H 4LPTA 2AQ1A 3TN0A 3HB3D 3VFSA 1Q9KA 2DQFA 4JM4L 3MUGB 4IRJC 4XBEL 1IKNC 6FABH 4HIXH 2EO1A 4Q0XH 4E41B 4ERSH 1LO5B 3T0EC 4KK5D 5INCB 4GUPA 1ZT4B 1RQ5A 1W72L 2OTUB 4C54A 4P5KB 2DD8H 4ZFFA 4OZFH 4I0PA 5JOFB 3TVMC 5I66A 1FNAA 4YQXH 1A6ZA 2EXWC 2JCCF 3QQ9C 4JQVA 4JPIA 2QQKL 4MJ5A 3E2HC 3UTTB 1Y18B 4HUNB 5D1ZA 2IBZX 4DZBA 5IIEA 5GRJL 3MLXL 1JRHI 1CD1A 4FQJH 1KJ3L 2ITDA 2CJUH 3BPLB 2AEPL 2G75A 2XZZA 2HJKA 3HPJA 4KUCD 2HT4C 4G6KL 3LKRA 1HINL 2Z93B 1T89A 5LBSH 5I76A 4LLYA 1EVUA 2G5BB 2H1PH 3TZVB 4YXHH 1L0YA 4JFFD 1SVZA 4Z7UB 3BKCH 1HXYA 3LQAH 3MV8D 4OZHE 5FUZL 3EKCA 1RURL 1DBAH 2C3WA 1XR9B 5I8EA 4K3HA 5DQ9B 1SM3H 2GI7A 3SQBA 4YBLC 3O3AA 3P4NB 2VQTA 1CT8B 2E6JA 4RGOL 4RDQF 2DLGA 3VRJA 1L0QA 3QEQA 4QOKD 1EJOH 5C08B 4XRCB 2YD2A 3HAEB 1T22A 5FYJH 5T1DL 3FTGA 4GMSL 3PQYD 1T21A 4KRLB 1T0NA 3RY4A 2DQJH 1AGCA 2D7NA 1X5IA 5KJRH 2AV1B 4GKZA 2EDBA 3WNMA 2DKMA 4U2ZA 3O2WH 4YC2C 2HLFC 2MKLC 3A0OA 1NGWB 4N5EC 2MKWA 4J23A 4JLRB 4K9EC 3ARWA 4PJ5A 4JFDD 3G9VA 3BSZL 2NXYC 3RL2B 4OZIA 1U8PB 2JELH 2YBRB 4U1JA 4UT6H 1G6RB 2YEZB 3DUSA 2JCCE 1X5XA 1FL3A 3MJ8B 4NJ9L 3ESUF 2V7HB 4NP4H 1RZJH 2X44D 3VWKD 3MC0A 1MVUA 4DUXA 4U1MA 3KDMA 4NM4L 1AXSB 2VXVL 3OJVC 2D9CA 2YRZA 4HKXB 4G9DB 1JYVA 3E1F1 5IROA 3MLWH 3QUZC 1F58H 5E03A 4EJ1C 4UTBL 1LE5B 4KZEL 3ULSA 1ZEAL 1AD0B 2BVUA 4JFEA 5FGCE 4GRLC 2OL3H 3NFPB 4R26L 1W2KT 3ELAT 2SEBA 1NL0H 2AJ3A 2ITCA 3BVNB 3I6KA 4J1UA 5D70H 1G7JB 5HVFB 2PO6C 3N1GC 1C8PA 5BW7C 1UM6H 1QACA 2OM5A 3WYRA 5E08H 4W68A 3TA3C 4ONFH 3MLRH 3P4LA 4C83A 2ZNXA 1MPAH 3IDJA 4JRYA 4P46B 4ZO8A 3QISA 3MGOB 3RWDB 1INQB 1CLOH 2VLKA 3UTSA 1CDJA 3LN5A 4PRHE 4RISL 5DRNB 4Y4FC 3BYTA 3V8CA 4L8SA 4LSVH 4PRPB 2NX5E 4X6CF 1FG2A 1OP3H 4NN7B 5F71A 5GGRB 4V2CB 2DQDH 2VDQH 1UA6H 2VRAA 4L9LA 4JZJC 2YUVA 2X1WL 4U6HA 3SDYH 3HLAB 1L7IH 3H7BB 3C2SA 5CCKH 1CICC 3SGDH 4FXLA 1EO8H 1VERA 3CD4A 1LVEA 5ITFA 1HNGA 2GAZB 4NNPH 3VFMB 1BJ8A 1KEMH 1EGJA 2VSCA 3W0WB 2APXA 4PJAA 3QUZB 4XH2A 4APQA 1AGBA 1IAOB 2Y36L 3E8UH 1I8IB 2I9TB 3MJ9L 1HKLL 5DD3H 1NLBL 4P2RE 5JO5A 4FHBD 5EH1A 1I1CA 3AXLB 3VCLA 3GM0A 3QPQD 4D2NA 3O2VH 2XTJE 1RZFL 3OAUH 2VAAA 4UT7L 4Z7VF 4YWGL 5C0DA 1E6JH 5A2KH 3CZJA 2F54B 3RHWF 3O6KH 5GISL 4PP1D 4R97B 1RZGA 3IU4L 2DBJA 4URTB 2X89A 1CFVL 2IGFL 3IXTA 5BMFL 2IAMA 3CX5K 4NCC2 4LVHB 1J5OL 4GW1B 1ZHBA 5KS9E 5HHNB 3C8HA 4X7CC 2NCMA 4XVUC 4XHJC 3C6LA 3ORJA 5D72H 5SWQA 2W9DL 3EHBD 2R56L 3JWNC 1JWSB 3X3GH 4WWID 4XHQA 3DX6B 4X6CE 2A83A 2C3HA 2EDYA 3LD8C 3GK8L 4LOUC 2FGWH 1G7HB 5L6YL 3UYRL 4B50A 4OLXH 1Z9LA 5CZVL 2NY7L 4AIXA 1FORH 2FWOA 1AI1H 4JN1L 4NDMB 2ESVB 4JZJB 5DZNA 5F88A 5C2UB 5BXFA 3HZKA 2BMKB 4H20H 3NACH 3VG9C 4LLDA 4ZFOB 2ADFH 4LPVA 2G2RB 3MXVH 5C09A 3S37L 1CE1L 3T0WA 1CN4A 2DQTL 2R0ZH 2CGRL 1MHHA 3LDBC 5ILTH 4HH9B 1T7XA 3KYMB 2A77L 3QFDB 3T09A 1F13A 3GSNA 5GJTL 1N59A 2X4NA 4HKJA 1KJVA 1T1XA 4QNPF 3U4BL 4KHXL 3BT2L 3BO8A 5DGQA 4GAYB 4PJAF 3OF6A 1A1NA 4PJHF 3VDAA 4JHBA 4EBQL 5IV2B 4I3RL 2PN5A 4NQVA 1OGTB 1FFNB 1AHWA 3T4YB 5HI3C 1VPOH 1JI1A 1SEQH 5I8OL 5DQDH 5I1KH 4PLOB 1N8ZA 1ZGLA 1NPUA 2UYLA 3CSGA 2IPKA 2VLRB 2J8UB 1TXKA 4Z7VE 1A21A 3GSXA 2I27N 1XCTA 5HHME 3LEXB 1YEFH 2VDNH 3O3DB 1E0OB 1CR9L 2DQCL 4U1LB 1YJDL 4Y4KC 1CFTA 4OCRH 2D7PA 1WBXA 1Q72H 1ZVYA 4UV4L 5JR1L 3CFDB 4X8XA 3BKML 5ESVA 1CG9A 4M7KL 3QXDB 5ELIA 4OLYH 4XBGB 3RIFF 3UBXA 1MSPA 2B4CH 3QIWA 5DMIH 5I16B 1JGDB 4WDIB 4PJ9A 1YEJH 4WHYH 3X17A 3BRDA 4JFQA 4Z7QF 3O41A 3MBEB 2F5BH 4RA0C 4KK6D 3OAZK 3G5VA 5MI0C 3T08A 4YDVB 5DD0L 1NFDE 4NKIL 3QYCA 4YDLB 2YZ1A 5GS0L 1LDPL 5EOCL 2QJDA 3QG6A 4M5ZL 5JUEH 3BHBA 4XCYA 4X9FA 2PW1A 3MRKA 5HDLA 4KC3B 4K3DH 1KC5L 1OAXL 4QRRA 4P4KA 3Q1SL 3QDMB 3OKKB 4EXPX 2VLJB 1XGRA 1FVCB 4IRJA 2YD7A 2AJSL 3FT2B 1QRNB 4R4BA 5EN2A 4S1QL 5HY9B 1BF2A 3WE6B 4PJHE 4ZOAA 3OXRA 2EDQA 2O5ZH 2FLBT 3QA3B 4QXGH 4DEPB 2Z31B 4PRAB 1PKOA 3FFCB 1T7WA 3FFDB 4PY7B 4UIKH 4C59B 2CD0A 2H32H 4KMLB 4U7MA 4GFTB 4PJXF 4OV5B 4L8DA 4ONGH 3CH8A 3ESVF 4OGZA 3F5WB 4WI3A 4RDQG 1MI5E 2W60A 5ISZB 2VDML 1XF2B 2V17H 2APVA 5D6CA 4KTYA 1K85A 3HC3L 4KPHL 1NCAH 4HDIB 1W0VA 4L1DA 5DRWA 5KAQF 5C0BB 4I18B 2WBWB 3HNVH 3OB8A 3MROA 1Z5LA 3OR7B 5DI8A 2R2BB 4RWYH 1IAKA 4MYWB 1OP9A 5HYJB 3RKDD 2P7TB 3R4DA 5E7BA 1NUGA 2BERA 3S5LA 2D4FA 4GMTH 1WFUA 4Z7UF 1YEKH 4CMHC 5JW4Q 4KKCC 1KTDB 2PYFA 4MCZA 1NJ9A 4PGDA 5IB2A 1UEMA 5CEZH 1A47A 3GGWA 4X99A 4U1SA 2KPNA 3OKLB 4NC2B 2BVPA 4IIQC 1NCBL 2IBBA 4HZAA 3DARA 3MMEA 2GY7B 3QNYB 3M07A 1E4WL 1GPOH 3X13A 4FQQB 3OG4B 1G9MC 4EUPH 1KENL 2ARJB 4L4VE 1BWMA 1BGXL 2FHBA 2DLFH 5JXAH 4DGYH 5EORL 2BDNH 4I4WA 3KHOA 3UDWC 4Q6IA 1KCLA 4PRDA 8FABB 1IZKA 3MRDB 1H3GA 4UBDC 5EU7C 3D0VB 4FQXC 2DQHL 3WIFA 1G7IA 2IANB 4W4OC 1JZ7A 4PJXE 3VMOA 2DWEA 5H2BB 2R2EA 4NWTH 2AV7A 5C70A 2A6DB 5D7LD 3SDAD 3RP1A 3NCYS 4MD0B 2HA1A 4TVPH 4AL8L 1CTOA 1WWCA 2D0FA 1NBVH 3WNPA 5J13C 1O5DT 1GGBL 5GRZA 1UADC 5E5MA 3UTTE 4KVNH 2ENSA 2FYYA 4EZMA 3TFKD 1IL1B 4J3SA 4XCEB 5D96C 1KJ2B 4LSTH 1S7UA 2VE6A 3PHQA 3F8UB 4PJFB 2X05A 5C0AD 4HPYL 4LHUD 5IB5A 2CLVA 3W9DA 3VXRA 5HD8C 3HNSL 4GRLA 5E8PB 2XY2A 2OSLB 4ODVH 2A6IA 4CMHB 2NY4D 3GMPA 3S35X 4GSDH 4Z7UE 5CEZD 4C55A 1X5LA 1MREH 1MCEA 1D5IH 1MRFL 5C0ND 4M61A 2NR6C 2R69L 3OX8A 1U3JA 3TA3A 2DS4A 3WFHA 3T77A 1OB1B 2A6JA 5GGSY 5T3XH 1FFPB 1W72B 4WTZA 4GS7B 1RUKL 3IJHB 3B9AA 3U46B 4NKMA 2A6KB 3EJYD 1UZ8B 1HHGA 4OD2A 1PYWA 4Y4FA 4KFZC 1Q1JL 5KW9H 4R3SB 4OCSH 4WGVB 5E6ID 3T3MF 5MHSD 4HJJH 3MCG1 3THMH 3T0EE 5FUOL 5B38B 2W9EH 1XF4A 4P3DA 3VG0L 1KN4L 5IOPB 4NNYB 1EH9A 5FYLH 4ZS6C 1P7QB 3IFPA 4KK8D 1WF5A 4XCNB 1WAAF 5JIPA 1B0GA 3CDCA 6FABL 2FHCA 3KWWB 4MAUL 4LNVA 1MCRA 4AMKH 4E9LA 2VIRB 1MLBA 2E9BA 3VH8G 7CGTA 1CLYH 1VFAB 4S10A 5D1XC 2R1WA 3WLBB 3D3VB 3LMJL 2ADIB 5D96B 4DGVH 2B2XH 1EZVY 2XWJA 5DUBA 4Q9RL 5FO8B 3TBVA 5KVEL 2YPLB 5F7DA 2JTDA 3CH1B 4OB5H 2C1PB 5DTFA 5EIQA 1Q0YL 1AY1L 3HE6D 2CJUL 4UDUB 4K94L 5DMJB 2VH5H 5IBUB 5FYKU 3ZKQD 2X1OA 1VESA 2H2PD 1C7TA 4RRPG 3QDGD 3FT3A 1UWEH 1D5MB 4K3EL 2Q6WB 3QFJD 1PLGH 1DQQB 1NC4A 2VL5B 3PWLA 3REVB 2ZUTA 3KS0J 3L5XL 4P4RA 3MLPA 2AJZB 1DDHB 5BOZG 1DBAL 1T1WA 1U3HD 2R0WH 2Y07H 1CBVL 1BZQK 1I3GH 4UTAH 3IFNL 2ZOLB 5C0CA 4X9IA 3SE4C 3MNWB 1TFHA 1KYOJ 3CFKB 1CTNA 5BVJA 1QEWB 4PRPE 1AKJA 4ZUUA 1C5DA 1G9NC 1MCIA 4YAQA 3FN0L 4YHNB 1NCCL 1WAAE 2ICWB 1ERNA 3RWFA 1A0QH 4U3XA 3MCKB 3REWA 3QWRA 1MNUH 1PQZB 2CIIA 5D1XB 5IW6A 2AK1H 1EERB 3MRCA 4OLUH 4XPAL 4EN3A 1JFQH 5CD5D 3NPZB 5K9OA 3DXAB 3GBMH 5ADPH 2P5EE 1H9VA 1KPRB 3H42L 2OZ4H 3LPGA 1JRHH 2ORBL 1KXVC 3W0WE 2EXYC 1BOGA 2X4QB 4CN1A 2LTQB 4YXKH 3FB5B 1H0DB 4OI8A 3N1PC 4QHKI 1HH6A 4M6NH 4KMQA 3RY5A 1BZ7A 2LQRA 5HGDB 4UUJB 2W0PA 2CRZA 1T1ZA 1A3LH 3SJVE 1RJYA 4JPWL 4AM0B 4DW2H 4XP9H 3MLWL 1DUZA 1RZKH 3WS3A 5C2BL 2J8UF 4Y4KA 3DNKA 2Y6SC 4D9QE 4ZTOL 4LU5H 2F54E 4JFZH 1D5ZA 3EOTH 1KJMB 4KVCL 1M05A 4MD4B 1NL0L 3U7WH 1U8KA 4HWBH 2ED9A 2BHYA 5D70L 4KRPC 1UXWB 4JDZB 3KPSA 3P4OA 3U4EA 4O2EB 1ZLVH 5SX4H 1S8DA 1BAFH 3DI2B 1QLFB 4NYLB 1KNOB 4ONFL 3F12A 4PS4L 4QHKJ 5DK2B 5EC1A 1KCVH 5GRVL 1GC1H 3LB6D 5EO1B 1JZ6A 3JZ7A 1LO2L 4A2MA 3IS0X 2ATKA 4YIQA 4Z9KB 3QI9D 1G0DA 1RSFA 2ESVE 1FN4B 3I84A 1KG0B 3G6JA 3BN9D 4D0CA 3NA9L 3ZKSD 4UDTB 5C3TA 4M6AA 3OXSA 3TWCH 1S5HB 1XZ0B 5D71L 4H8WH 3DX7B 4EDXB 4KGLA 5FHAH 3RFZC 4C56A 2WWMC 4QTHA 2Y7QA 1IGFH 1Q9WA 2HTLD 3JWOC 1L7IL 1S7TA 4LEOB 3MODL 5IHUH 1WCQA 1QNZH 4ORZC 3DROA 1OCWH 3T1FA 5MEOA 3V5KA 4ZFGL 4ZNCD 1IGML 3VJ6A 1FZJA 1A3RL 3H9SA 4NNPL 3QCUL 3UBXG 1KEML 2Z0BA 1T0MB 4XP4L 3RHWK 1OTSC 2YC1A 3OZ9H 5I71B 3CVIH 1WJ3A 3IF1B 1AXTL 3UZEA 4I1NB 5AUMB 5D7SH 1HE7A 2B1AH 2EIZA 2VLRE 2J8UE 3G5YA 1QFWH 3HI1A 3MA9H 4PJDA 1XGUB 1LD9A 2V5YA 5IVZA 1FAIH 4MNQD 4U1IB 4BSWA 3SKOA 2F74A 3ARGB 3K8KA 4G5ZL 1JWUA 3ARBC 5IR1A 5HYEA 5I1HH 1EEZA 1ND0B 1P9MC 3OAUL 5FCSH 4NUJA 4DN3H 1CL7L 3DX9B 3BN3B 1H3UA 1IM3B 3LN4B 4X0KA 3C6SB 4UZGA 5E94B 4GBXB 2YSSA 3D85D 4N0YH 3NOIA 5I8CA 1JV5B 3IRZA 1K5NB 5TE7H 3O4LE 5D72L 3L3GB 4YPGA 1FNSH 3JV5A 4QRQA 4IIQA 4PGBB 3X3GL 3HMXA 3VI4E 5BS0D 1A6AA 4J6RL 1ZLSL 2FGWL 1IGYB 5EIIA 5KZCB 4O9HH 5KSBB 3RUGA 3PHSA 1KBGH 2HKFL 5CZXC 1F3DJ 3EDJA 3ZDYF 5CP7B 4YXLL 3KLHC 2OP4L 4WO4C 1KUMA 1YMMB 4R8WH 5C0EA 1RK0B 3UDWA 4PY8I 4XX1E 5TQ0L 2VLJE 3O6ML 3GUTB 1X44A 1QRNE 4H26B 4QWWC 4G43B 2N7BA 4LCCC 5ILTL 3JVGA 1JPSL 4M6MH 1IFHL 1DBKH 4HXAH 4WY7L 3P11L 2XY1A 4O2CA 1CFNB 2O5XL 1T2QL 2OTWB 4HV8A 1QLEH 2ZUSA 1LO4H 1WC7A 3SGJC 3QB7C 3GB7B 5IBTL 3FFCE 1T6VN 2F53B 4E5XA 2APBA 3AREC 4Y2DC 1BVLA 1SEQL 4LPXA 1BFOA 5TPWH 1TCRA 3ARBB 3NCJH 2MFNA 5DA4A 1MRCL 5I1KL 5BCAA 5IMLA 3FQTB 5JXEA 4D0DA 1PGRB 3GBNH 5E70A 1WV7T 2WIMA 2E7CA 2WBJC 4WU7A 1MHEB 5MEQB 3EYUL 4PY8J 3QEGL 1FJ1B 4RIRA 1AQDB 3KPRB 4OCRL 5F9JB 4KGJA 4PRNA 4JFHE 4G80A 5C0BE 4JO3L 3BE1L 4Z7OF 4JQXC 2PW2A 5IMOB 2ZJSH 3SDXB 5ERWA 4I3SH 4EOWL 1A14H 43CAB 5HYJE 1RZIB 5BVPL 2YMXH 1MHCA 5DEZA 5B39B 1OLZA 1SBBA 4HCRL 4DKEH 4JANA 2B4CL 3ULUH 2NXZD 2FEDD 4Z77B 4IOFC 1S7SB 2DTMH 1IC4L 1ZTXL 4H25B 4C4KT 5H94B 3PJSA 4AIZA 5KSAC 1A1MB 4XNMB 2GFBA 4XCFL 5L7XH 3GMQB 4OZHA 4WO4B 4U7KA 1EHLL 1XCQA 1RUQL 5I0DA 2R23B 1INDH 2I07B 2XNAB 2KBGA 4LARH 1BLNA 3ARYA 4ELMB 1RULH 4K7PX 2P47B 5CGYC 1C5CH 3T65B 4KUZH 4K7FB 5E6YA 1SJHA 1ZVHA 4K3DL 1JGUH 1RV6X 4WFED 4TULL 4UT9L 4H1LB 2DQEH 2IPTH 5MERB 3SKJH 4JRXB 3OKMB 1I3VA 1VFOA 2IANE 1GJIA 4N8VG 2YWZA 5DRXA 2HFGH 2BZDA 5E9DA 2IEPA 3SDDC 2V2XA 1BJ1H 3SGKC 2ZUQC 4K2UH 5IK3A 1EAPA 3MQIA 4Y1AB 5DT1L 4OF0A 1YC8A 4QXGL 2I25N 1S7VB 3EW3B 1VEMA 5FK9B 5FV2A 1TVDA 3DBXB 3KPPB 1TQCB 4RGND 4XB8A 2VZSA 4PGJA 1E27A 4BQCA 2BJMH 2NY6C 4LHQB 4HIIB 5FDWB 4ONGL 1BIIB 4P2OD 1A7RH 3BPCA 1ETZB 1A9BA 5C8JA 4Z7OE 4NFCA 1M4KA 1ZMYA 5EO9B 3MLYH 4BH7A 2NYYC 4CW1A 2AXGA 3C87A 4KY1H 5D7IA 1XIWC 4LBEB 1Y6MR 5E00B 3DUUA 1JZ4A 3F65A 1BECA 2EE2A 3BKJH 1LO0H 2CPCA 3HHRB 1HHJB 4LLMB 3MLSL 2WUCH 3T04D 1RJLB 4UQ3B 3LKOB 3PWVA 4OLWH 1B6UA 5BQ7B 5C07D 1V7NH 3GRWA 4LMQE 1H15A 3IU3A 3RDTC 4CMMA 1WQVT 4X7SL 1NAMA 3VXQA 5FO9A 4CVUA 3MLTA 5CEZL 3STLA 1AE6H 3SE4A 2M26A 1JMZA 5I1LA 1BQHB 4D9RD 3CUPB 2FL5B 2P8LA 5IKCA 1M7XA 2IQAA 1JGLH 4DGYL 1X7QA 5T33L 5GSRB 3MLZH 2IG2L 3SDDB 1A6TA 3NIFE 1DQJB 4XXDA 3IKCB 4JPKH 4HIJA 4NQEA 3VE0B 4XWGL 4X8JA 4N5UA 1FL5B 3IDMB 1D5BA 4QXTB 3D25B 3D3VE 2J4WH 3ECBA 2NY6B 5GZOC 3HE7D 4AH2A 1YNTA 4M1GL 4DVBB 5JNYA 3R06A 2RFXA 3MNZB 4WGWB 1PAMA 4KJYB 2YPLE 4Z7WA 1KSRA 3SHSA 4KKBC 2HJLB 4HWEH 4PJCB 1P6AB 3MV8B 1MAMH 3PWPE 4MA1B 4ELKB 5TF1L 2BC4B 5KOVC 5I0ZA 2VISB 2QSTA 4NO3B 3KNBA 4LCWD 4LLQA 1I1FB 4DFHA 1TZHA 2CLRA 5EPMB 3TIDB 2Z35B 2QSCH 4NQDA 4ODVL 4WIQA 4R90H 4QOKB 4Z95H 4J8RA 4GSDL 1ED3B 4QHMA 1MREL 3ARFD 3PQYB 3WN5B 4IJ3B 3S4SB 2B5IB 4A6YA 5EZIL 1PY4A 1T5XB 3PIQB 1CXEA 5HI5C 5INDB 1U41A 4R4FH 3G08A 4YHZH 1VADB 1EIBA 1IZJA 4XX1G 3Q5YA 4NO2A 1DVFA 2VXSH 1GIGH 4UOW1 2C7UB 5DEFA 1MCJA 3MRRB 4HLZG 4OZFB 1PZUB 1IAIM 4JFDB 4GKNB 3CFBB 3QO0B 1MFNA 1G1CA 5HGBB 4OCSL 5EFIA 2ZOKA 4I2XA 3WJLA 4OIBA 3UC0L 1UM4L 4HJJL 3TESA 3THML 1KLFA 4G8GA 3GIZH 1A7NH 4R0LA 4WUUD 4EXKA 1KFAL 3VWKB 3FT4A 3G9AB 4P23C 1U8HA 3AU1A 1JWMA 1YEGH 1JHTA 4PJEA 1ADQL 3RWCB 1CGWA 3DXAE 3KXFE 2VWEC 2Q20A 2HWZL 4FQLH 3SOBH 1MQ8A 15C8L 3L5JA 2DM4A 5HGAA 2IALB 3V95A 3GIVA 4BH8A 4JVWA 3V2AR 2E8ZA 2DQGH 4YLQT 5I1EH 1DEEA 5KTEL 1EEYB 2QHRH 3KPQB 5IT2H 3RWEB 4RZCA 2BHUA 4XMLH 1H3XA 1ZA6B 5DJ8A 1CDYA 2V9QA 5ID0A 3BEVA 1KCUL 5SV3A 3N1QC 4WNQB 3W9EB 1J1XL 3T3PF 1X6NA 1T7VA 1AO7D 4KV5F 4D3CL 1UJ3C 3GMNB 3VW3L 1VFBB 3LQZB 4IRZL 1MCNA 4QRTB 3WFZA 2YD8A 2BRRH 4FXKB 4DK3A 2XZCL 1P9MA 3FB8A 1RY7B 1FCGA 2XRAL 2NZ9D 5TGBA 5HHXH 3AS1A 1LE9A 3L7EB 1FV1B 5JQHC 2X10A 3RX8A 2FBOJ 4PBVC 1I3RB 5CFHA 4R4ND 3PWNA 5GZNC 3WIHA 2P42B 1JPFA 4MA8L 4NGHH 2CO7B 1HN1A 3V6OE 2Z91B 1IARB 2W0FA 4WCYH 4ZQKA 5ADOH 1CLZL 5EUOB 3EJJX 3CXHJ 5FGSA 1OAKL 4RQQA 4G7VH 4P3CH 3BQUD 1P5UA 4UINH 3FOMA 1LDSA 3PDOB 1JHLL 2ERJC 4JO2L 1WBZB 4KRMB 2A9MH 1C16B 4MDIA 1ULVA 4D94A 5I1DB 4LCIH 3QR2A 1PX4A 3MREA 5KSBF 3GRWH 4QHUA 1MWAA 5C3LD 3B6SB 3IDXL 1BVKA 2WUBL 1ZE3C 4PJEF 2C4FU 4QHLB 4EDWH 3G6DL 5SWSD 1FNGB 4LCCA 2PCPB 2HN7A 2QADC 1LNUB 4OLUL 4HS3A 5E8EA 1JFQL 3B2UD 3BP5A 4GG6A 1BD2A 5JIHA 1QPXA 1U8QB 3SGJA 4JFYB 2VDRH 2WV3A 4QT5A 1UJ3B 4KJWD 4KV5E 4Y2DA 2A9NH 2I26N 1AR1D 4GXUM 1Z6JT 1IJ9A 4M6NL 5BOPA 5ANMA 2VN7A 3QULA 4XPBH 3QZWA 4XNXL 5SWZD 4RNRB 5IHLB 2ZZUT 1A3LL 2WBJA 4RBPK 1F42A 2GSIA 4L3EA 1G0XA 1EMTL 2ADGA 1BFVH 1II4E 4MQXD 5IB3B 1EPFA 3EOBB 3MRQB 4MJ4A 1MFAL 3O3BA 1INEH 3ZO0A 4MVBD 4POZD 4YHLH 1K9TA 3MA7B 4PYHA 5CHNB 5F7FA 1R3KA 1ZSDB 1Q9LA 3RWJA 2EKSA 1VFMA 4K23L 4HWBL 4XWOC 1MI5A 4FFYL 4WW1B 3GSRB 5HGGS 5DHVH 5LAXB 2HT3D 2QQLL 3RVXD 5GGVY 7FABL 5B38G 3S96A 3FO0H 3HC4L 4PJ8C 3TYGH 3LN9A 2ZCKH 5C9JA 3LPFA 5BRZD 2CKBH 1G7MB 1OSZB 3AMLA 3DTXA 1HSAB 5KSBE 4PV8B 4M43H 5DLML 5I1GH 4KU1A 4K8RH 3EGSB 1JP5A 4BFEA 3MBXL 5IJVB 4I0CC 3L3JB 4A6YH 3ZTJH 3BZEB 3UTZB 1YMME 3TPUA 2FJHA 5C6TH 2BNRA 4JB9L 4XP6L 1R24B 4U7SA 1NLDH 3KPNB 4TPRL 2MQ0A 4JVPA 1B4RA 3WFCH 5TJWK 4GG6F 4LCYA 4H88H 5IMMB 1U58A 5D2NA 5ACZA 1C5BH 3OB0K 4PRHD 4ODTH 3SGKA 4PG2C 1U6AH 1OAZH 4IOSD 3O6FD 1UH3A 4RGMC 4Y16D 2VQ1B 3WUWA 3HN3A 1T3FB 4S2SA 3UJIH 2F53E 3A6BH 2NX5D 3N06B 4E42A 1MAKA 3GSOA 1IBGH 4HPOL 3WFBH 5ESAA 3MUGA 1YN7B 5IW3A 1YPZF 2J3SA 4E41A 3SKNB 3CVIL 3VGAB 1AP2A 4HLJA 1MVFA 4PGEA 4GAGL 1ZT4A 3TBWB 5TDPA 4U6YB 2VDOH 1K3ZA 5D7SL 1K4DA 2B1AL 5GRXG 2HRLA 1H3PL 4P5KA 1KTLA 5L8LB 4I0PD 3AAZA 1A7OH 1QLRA 1FAIL 1KF9B 5KOMC 5JOPE 1OW0A 3CVHL 4FZEL 1NMAL 4NKOA 3KPRE 3LS5H 5D1ZD 2NY1D 2FDBP 5I1HL 5FM5O 2O5YH 3UTTA 1Y18A 3BMWA 4XC3H 1IQDB 3JWDL 2Q8AH 1NEZB 1NCDL 3RVTD 2F8OA 4WRLA 4L4TD 5GIRB 5JPNA 3SKMB 4AG4L 3SPVB 1X5AA 1FNEA 1YUHB 3RDTA 1V7MH 1ORQA 3F7PC 5TE7L 1A6VL 5D8JH 2Z92B 3Q3GA 2XTJD 2ZPKL 1S9VB 1VENA 3QIUD 1JNJA 1T04B 3V6ZA 3MXWH 4ZFZA 4DUVA 4O9HL 3NAAH 4PLKD 4KKLD 2AK4A 3P4NA 1A1OB 5EZLA 4NQCB 3H3PH 4UQ2B 3QEQD 2C3VB 3ULVD 5A3ID 1U92B 5BZDB 2AKRA 5C08A 4XRCA 4NHCH 2NW2B 3QWQB 4RGMB 4JRXE 1OTUD 35C8L 4X98B 3C5ZA 3T2NL 3FN3A 2DMKA 4DKDC 2VXTH 1UYWH 4JHWL 2R0LH 2YK1L 5IQ7H 3FOLB 3PGDA 1Z9MA 3VD4A 1NUNB 1HHKB 4Y1AE 3WDHA 1JF6A 1XMWA 5IJKC 4HFWB 5F7KC 1MWAH 4PJ5D 5AG8A 1JPST 4CNIB 5DMGD 3IB4A 1F3DH 3O8XC 2JF1A 2X4TB 2ZNWA 3O3EB 5M7QA 4OGYL 4KUCF 4ZXBC 1FBIH 3PL6D 3MRGA 1HYSD 1YY9C 4O5LL 1UVQA 2KQMA 3LV3A 4AT6A 5LGHH 2OI9B 5GXBB 1BP3B 3D9AL 5KVGH 3MPCA 4XPHH 2D7OA 5AZEH 1FZOB 1MQKL 3CXDH 3QEHB 1JTPA 4NQXB 1AXSA 4HFUL 1BVZA 3QEUB 4NUGL 4G9DA 3VFUB 4YDJB 2MQCA 3MRBA 1A14L 4LKCA 1NGZA 4JFED 5F7EL 3ES6B 1E4JA 2YMXL 2FX8H 5E1HB 4UV7H 5MP6H 1S78D 4ZDHA 3NFPA 3ARPA 4P9HH 1HQRB 1FPTL 4NO0D 3BPNB 3BVNA 3K74B 5FDYA 4RSVA 4P9MH 4BK5A 1G0YR 2XKSA 3K2MC 3G5XB 1FQ9C 2AVGA 2H32B 1NGYB 5E1AA 4Q2ZB 1FO0B 4DVRH 4PLJD 4OCXL 3V6FA 4PTUA 5DFVC 2EDRA 1IGIL 2FRGP 4P46A 2BY3A 3IJSB 5D7LB 1I8KB 3MGOA 3BZFB 1C5CL 4QYOB 3SDAB 3AFLA 2F5AH 3NIGF 1UQSA 3GKWL 1D7FA 1HHHA 4P23A 2GEEA 3Q5OA 1ZVSB 1H5BB 1K8IB 5B3JF 5DEGB 2JLLA 1SYVA 5EOTB 2JK5B 3KPOA 5GGRA 3NCCB 1JNHA 4MB4A 2XKNB 5C0AB 4K2UL 4LHUB 3H0TA 3T0XA 3EDEA 1FGNH 1FYHB 1DFBL 4RFEA 3H7BA 1FGVL 5LQBL 2NY4B 4PJCE 2GCYB 3OGCA 4XNZC 5E8DH 3BJLA 4NT6A 3SE3A 2FH8A 4QRPA 3QUMH 1A7RL 1HSBB 3HI5L 3DVFA 3QCVH 3B5HA 4P57B 5LWYL 4OQ1A 1IGCH 1T4KA 1WITA 1IAOA 5DD5L 3BZDA 3HC0B 2V2WA 3MLYL 5GRYA 4U6VH 2CUIA 4L8BB 1NFIA 5B8CC 5EIVA 2F58L 1OARL 1X5FA 4BZ1H 2VDKH 1GSMA 5HYSA 2EICA 3G04B 5E6IB 1CGTA 5JPMB 4OLZL 4OLWL 3VFOA 1V7NL 1JNNH 1CE6B 2F54A 4G6AD 2OR9L 2IAMD 3L5WB 1CS6A 4OM1L 4OUOA 5DK0A 5F21B 2BFVH 5EBWB 5DJDA 1LO3H 3FQRB 4GW1A 1XF3B 4JFDE 3QUXD 1QR1B 3C6LD 2G60L 4LSPL 3MRPB 3TJEH 1OD7A 4ZUSB 3V4UH 3LVEA 3BDBA 2VZVA 4HBCL 4PJ7A 4C58B 1JWSA 3GJFA 4NIKB 3DX6A 2NTFA 2IH3B 4M6OH 3WIIL 3ARXA 1OSPH 5B3JE 3WXWH 2VB5A 3MLZL 4KQ4L 4YDKL 5DWUH 3WEXB 5LGJA 4HK3N 4K3JL 4JPKL 4NDMA 5FYKE 5C09D 4CUCA 4HAGA 2G2RA 5B4MC 1B2WH 3HE6B 3D69A 1V3MA 4XNZB 1IM9D 4TNWK 1D6EB 4W6YB 2JIXD 1W8NA 3RVVD 4HH9A 4HJGB 1GGIH 3O9WD 3QDGB 4XTRC 3HAEH 1I7ZB 1WEJL 1I9IL 4MXQC 3T0AA 4UAOB 1QFWM 3QFJB 1PSKH 5DVOA 4HWEL 4NN5C 3OF6D 1IC7L 4DWHA 4CL7A 2Q7YB 1OGTA 4NRYA 4P99A 3T4YA 1G7LA 2OJZH 3ZL4H 5HGHA 4MQ7A 3IDNA 1JN6A 3WFDH 1ROWA 5TDNB 2QSCL 1MUJB 2GUOB 2VLME 3L3IB 5EWIH 1JI2A 1G6RH 1K6QL 1UJTA 2VC2H 4U1LA 3SCMC 4FABH 5C6PB 4YNYA 4ODHH 2IQ9L 2J88H 4PJ8A 4RFOH 2DTSA 3QDJA 3ARDC 4MHHG 1UB6A 4N0FA 4LFHD 3CFDA 1ZKAA 5ESQB 3VXOA 3VXSD 3PWJB 5FYJU 2AJYH 4P49A 2RGSA 4NRXB 4XBGA 4HK3J 4PJ9D 4ZD3L 3E6FB 4BFGA 1Y6KR 3HZMB 2HVKB 3TJHC 3LKSB 4G42B 4QRUA 3FB7A 5DJ6A 3EOAB 3O4OC 3MFFB 1T66D 1ZXQA 2D7TL 4OIIL 5EZOH 4UU9B 2HTLC 1KIQB 1E28B 4ZUWB 1RZ7H 2ED8A 3FCTB 5D7JA 1SJEB 4B41A 4OFIA 1N5AB 3JTTA 3DVGB 2EE6A 5HHOA 5JA8B 4MA3B 4IRJD 4JR9L 5I1EL 2DQGL 3QDMA 3OKKA 1VACA 1Q0XH 2B0SL 2YS4A 3KPMA 3T0ED 1M71B 4HIHB 1MEXL 5IT2L 5F1IB 3F7YB 3CDFA 1KCSL 5HY9A 3WE6A 4I5BB 5A16A 3TH3T 1I9JL 3NN8A 4D9LH 2YRPA 3C60C 4EEEA 1FH5H 4YK4C 3TVMD 2Z31A 4PRAA 2X4SA 4PY7A 2EXWD 2CRMA 3QQ9D 1FYTD 2X4RB 4Z18A 1MF2H 4UNUA 2BY2A 2MJWA 1YNKL 3I02B 3A6OA 3QRGL 4F15B 4IRSC 4HUWB 1YQVH 3V5DB 3ARDB 5HHXL 2HT4D 5ISZA 1XF2A 1HILB 1A5FL 4OAWA 1F5WA 3QI9B 4IDJH 4M03A 4P59H 1B6DA 4MD5B 4NO5B 4XVSH 4NGHL 4HDIA 1KEGH 4X9HA 3S6CA 5ADOL 3OR7A 1FZKA 1YDPB 1FVEB 4KWUA 3O4OB 2BOBA 2MPAH 3BX7C 5JLZB 2FD6H 4JM2C 4UINL 3IKKA 1T5WB 2R0KH 4XVJH 1VGKA 1N5YL 5IUSA 3RIAF 2ZCLH 1KIPB 3DV4A 2A9ML 5C0FA 5FM8A 2V2TB 5DYOA 1FVDA 1IGJB 2GQHA 2IADB 2YPVL 3MO1A 3BJ91 1R5WA 4KXZI 5DHYA 3CLFH 1KLUB 5FA4B 1CFQB 5FF6A 3DETC 5EU6A 4NOBA 5EU5B 1FL6B 5LKNA 2EYRB 3U9PL 3MLVL 2BVTA 1KXTB 2HFEA 1GRWA 2HLFD 3MOBL 2CLZA 4N5ED 4ZSOE 4MNQB 4EVNA 3K2UL 3C60B 8FABA 2EC9T 4CGTA 2NXYD 3X14A 3O8XA 3JWDC 5GGTA 4IS6B 3J8F7 1I1RA 4ZXBA 2X4OB 5H2BA 3QJHB 1FZMB 3S4SG 2A6DA 2FX9L 3B9KC 1ZHKA 1EO7A 4JDVA 5K9KB 1IKFH 2EYTB 4O2FB 4KROC 4LEXL 3D85B 3IFOB 4BKLB 3JSSA 1YECL 2P5ED 5IHZB 3QCTL 3VXNA 5J6GB 1S5IH 4JKLA 4LNRB 4NCC1 1ZV5A 2R2CA 1INEL 4HQQH 3D39A 4PREB 2AGJL 3QUZD 2AJXL 2D2OA 4LLWB 1CFSB 4WFFE 5BS0B 3AGVA 2VJXA 4PJFA 3VXRD 3IVKA 43C9B 4Z5RA 5FCUH 4GRLD 1IC5H 2QQNL 3SJVD 5ICXB 1KB5L 4JM2B 1MCPL 3WHXA 4Z78B 1J7VR 2PO6D 1F90H 2ZCKL 4JZOA 3CU1A 1FCCA 4ZPVB 4Y8DC 3OMZA 3TA3D 1Y6NR 3A6CH 1ES0B 2W91A 2XG4A 4XPTH 5I1GL 4NQCE 2JB6B 4TQEL 2OQJA 2X7LB 4NQSB 3LAFA 4WTXA 2FATH 1N0XL 1U3ZA 3IJHA 1IEHA 3K8MA 2R1YA 3DOSA 2NW3B 4AENA 3WL9A 4Y4FD 5B22A 1J1PL 3CVHB 1OPGL 4R3SA 4RBPH 5TQ2H 4GKOA 4M48L 4U1HB 1NFKA 1BZ9A 5IFAL 2O61B 3VWJC 3HZYB 1R6VA 3L3KB 3KG5A 4Y7MA 5HJ3B 3ULVL 1M7IA 3UTQA 3LEYH 2BSTB 1U8OB 3PABB 1V5JA 4WFGD 2ESVD 2R4RH 5IOPA 3UJIL 3DO7B 2LFGA 1CYGA 1P7QA 2J5LC 5KN5B 3U30C 3JV4A 3BWAB 1CICD 4KROB 4KKAC 3KWWA 3WFEH 3GZKA 3RTQC 4MWFA 4B53A 4M4PA 5HHQB 4KJQC 1I7TB 1DQLH 2CRYA 3BISA 2Q76B 1A7OL 2VXUL 4NHUA 1NC2A 4CDGC 2VITB 4NBZB 4P2QB 3LS5L 1DLHB 4U1NB 2VKWA 5B8CA 5F97E 4ALAH 4X6DA 4HLZH 2G5RA 3CH1A 3RNQB 1J8HE 4RFNB 2HYMA 1Z9OA 5D93B 2R2HB 3GO1H 1EUTA 4OF6A 1KIRB 1IEBA 3IYLW 1P4IH 2VABB 5JW3H 2Y23A 3IDYB 3TO4C 5D9SA 5BJTB 2RCSH 1OAYH 5ICZB 5L9DL 1V7ML 3MRJA 4LVOB 1WUNT 3OB0H 3REVA 5K59E 2HFTA 3KYKL 2WZPD 1CLCA 4JN2B 5FOJA 4DOHB 2WMPA 5JW4N 4XVUD 4XCCH 4XHJD 1OHQA 5MEPB 1S3KL 3LH2L 4PV9B 5L8KB 1RIVH 4KHTL 3DMMA 3NAAL 3S34H 1A6UH 3X11B 5D7LE 3VWJB 2A73B 2KH2B 4LOUD 6CGTA 1HH9B 4PRBB 1UM5L 2W59A 1S7XB 4PJGB 4OZ4A 2H8PA 5D6DC 3O4LD 1QEWA 1K8DA 5C0IA 4RGNB 5CILH 1JE6A 1UWGL 1XGTA 2AXFA 1U8NA 3MUHL 4XBPA 4BK4A 4YHNA 1H8NA 3BGAA 2R0LL 9CGTA 4LSRH 3FRUB 3Q6FB 4P2OB 5T1MA 1U8MA 5IQ7L 1N26A 3QWRD 3MCKA 4E0RA 4FXGB 3G6AB 1DBML 4RMWA 4GG8B 3M17A 2CMRL 1WWBX 3CX2A 4X4ME 2NY3D 1B4JH 1CXFA 4HUKB 4U4BA 1KPRA 2F19H 2Q86B 4PJIB 3H3BC 5IEHA 5CP3A 3IETA 5C07B 1EFXA 5LGHL 1CGVA 2HLAA 3AS3A 5F96H 3CDGB 4ODBD 3S3SA 4C4KO 5KANI 1REIA 1BQLH 2H6PA 2HVJA 3FFCD 2VR9A 2KUTA 1EGJL 2VDLH 3RA7H 3WXVH 1TJHL 3UX9B 2GJ6A 3HRPA 3ZT6A 2AQ3A 4AEIL 1C7SA 3MR9B 4Y4KD 2YA1A 4EKXA 5CBAB 3QQ3B 4MNGB 5MHSE 1MELA 4FQHB 1TDQA 5D5MF 1ZS8B 5F89A 1JPTL 4OUUA 2P24A 2DDQH 3MUY1 4U6XB 2NY5H 5CJXC 5I1CL 1MOEA 2VSDA 4P9HL 4AEHH 4MD4A 4JY4B 3RZCC 1MCDA 5E8NA 3KPSD 4M5YL 4P9ML 3ZSTA 3ARQA 2R4SH 3A67L 4NZRL 4JFHD 2E9IA 3WBDA 5C0BD 1KJ2H 3S9DB 5IEKA 2DKUA 4NN6B 4PTTA 4KZDL 4CVXB 5GGRY 3WS6C 3LSOB 1F6AB 3MLUL 5DK2A 5IFJB 3P9MA 1N64L 5EO1A 3ROLB 5GGUA 4F3FB 3QXAB 3MV9A 1HCFX 2F5AL 3ARZA 2FIRT 4PRID 1TQBB 4JM4H 3T8XB 2RIKA 5E8OA 3QO1B 3QUYC 2EDOA 5DVNA 1VKXA 4LASL 1P1ZB 1SYSA 4UDTA 1EO5A 1W72H 2W38A 2N56A 2DM3A 3QDGE 2NLJB 3DX7A 3OJDB 3FRPA 1ZT1B 2BSRA 1YEEL 3QFJE 2QHLA 4R96A 2QQKH 2NY0C 2E3VA 4G9FA 3ARFB 3DJ9A 5E8DL 5GRJH 3MLXH 1D5XA 3LQAC 1KJ3H 4FQ1L 2IAND 1F6FB 4J4PC 4MNHB 5CD3B 2W65A 5J57B 5F6HI 3LS4L 2AEPH 3GSNL 1IGCL 1M6OB 4G6KH 1HINH 2YHGA 4G6JL 4N1EA 4RA3A 4IRSA 5IGXL 5D5ME 1D9KC 2Y06H 4ACPA 3QNXB 4M9PA 3RZCB 4BZ1L 5FUZH 4IOIA 2CDGA 4X80L 4DGIL 1N7ML 1TPXC 3D2UD 4UI2A 1RURH 3QJFA 1MJJB 2BK8A 3BUYA 1I85C 1SEBB 1X6LA 1IM3A 4MX7B 4U6TA 4WUUB 3ARVA 3OL2A 3VXMA 3QWOB 1V3LA 5E94A 1DN0B 4GBXA 4KKCD 5T1DH 3DYOA 5F6HJ 4OF3A 4GMSH 3STBA 1BBJB 3KLAA 3L3GA 1I7RB 2BY1A 4BZYA 1NCTA 1JBJA 4D8PB 4LDEB 3IGAA 3VFPB 2LU7A 4GW4B 2BXZA 4PGBA 1HDMA 1OSPL 3VMPA 4D0BA 1RZJC 1WT5A 1Z2KA 4N0UE 3CSYB 2WANA 2I9LB 4DZ8B 3D48R 5GRVK 5CP7A 1NDMA 2Q1EA 1AO7B 3BSZH 1U8JA 2NY0B 4QGYA 4UBDD 1U8IA 4FQXD 3DSNA 4NJ9H 1F02I 1YYLH 3TBYA 3GSVA 4Y88A 1GZPA 1KPVA 3GJEB 5TDOB 1MFEL 2GIYA 3V8OA 1Y0LB 4OFYA 1CFNA 4HUMB 1OP3K 3WMSA 1ZT7B 4I3GA 5ICYB 3SGDI 3BEWB 4NM4H 5CKGA 4F80A 2VXVH 5F1OB 4OKVA 1E6OH 1NBQA 4UIMB 3T1WA 4YUEL 4UTBH 4KZEH 1ZEAH 3D3VD 3GI9L 3ZKXB 1RJZA 1X4YA 2OLDA 2YPKA 2R8SL 3U79A 3CFIC 2BY0A 3T4AA 1Q9OB 4JKKA 1MHEA 5MEQA 5HD8D 5JIKA 1FJ1A 1MCOL 4MB5A 1UXSB 5I8KL 3KPRA 3PWPD 5F9JA 1E4KC 4KRNA 1TTUA 3M1BB 2ZSVA 1CL7I 3KR3L 5GS1C 2HKHH 4HHAA 4TUJB 3SDXA 2NR6D 2MTPA 1GOGA 4GRMB 4LHJB 4JM2F 5LVEA 5SWSB 2BVEA 4AJ0A 5GSVB 3RAJL 5B39A 5CSZA 5IQ9A 5ID1B 4MMXC 5K33A 4P5TC 5IWLC 1MCFA 5DS8B 5T1LD 4HC1H 1L4IA 2DJSA 3U48A 2F15A 4XP5L 4H25A 2QR0B 2VTFA 3OR6B 5H94A 2VLLB 4JVUA 3LKNB 1T20B 2NMSA 1R5IB 3U7AA 3GMQA 2DYPD 4XC1H 4YHML 1YA5A 5E2WL 2I07A 4YHIB 2BCKB 2X9XA 3O6LL 3TN0C 1KV3A 4ELMA 2X40A 1X5GA 4JZNB 1RZ7L 2FJFB 5SWZB 1X5JA 4LVNB 4K7FA 4ZS6D 1OAQL 3FO1B 4NZUL 1T83C 4GAFB 2JCCB 5FFLA 1Q0XL 3JV6B 4FQIL 3CFEA 1DCLA 3OKMA 1QSEE 4WHTA 1FHGA 3RTQA 2GTWA 5FV1L 5D1XD 3RL1A 3VU2A 3RWHA 3ZMRA 1PFCA 4K9EL 3MJ9H 3KXFD 3DXAD 4Y4HC 1HKLH 1HOCA 1NLBH 1OGAE 4OQTA 4K71B 1HWHB 3ISWA 1TZIA 3QP3A 1LEKB 3KPPA 3ZHKA 4YWGH 1RZFH 3JBG7 1S7QB 3BGFC 5F44A 5BRZB 1F3JA 4HIIA 2X1XR 5FDWA 3RJDA 4X4XB 1T89C 3ZYZA 5BS0E 1BIIA 1EVTC 3BPOC 5GISH 1XH3B 1G6VK 3IU4H 3OG6B 1CFVH 2P46B 2IGFH 5BMFH 4LF3A 4P59L 32C2A 1J5OH 5EO9A 1RZ8B 2HJFB 3NIDF 5JHLL 3TO4A 4LBEA 5E00A 3UJTL 3VGGA 1WTLA 2X4UB 2W9DH 4BJLA 4JJHA 3EYFB 4LLMA 2R56H 1V8HA 1JPGB 4L29B 4GRWF 4TTDC 3R8BB 3GK8H 4CU8A 3NCYP 5CINH 3ULVC 3UYRH 2FD6L 5CZVH 1CXKA 1OF2B 2NY7H 2R0KL 1YN6A 1R3IH 2L7UA 4JN1H 4JO4L 1XGQA 4Y16B 3VFSB 1Q9KB 2DQFB 2NX5B 3WO4C 1EEQA 4OGAC 4WU5B 1BQHA 3S37H 1UKTA 5DR5H 2DQTH 4GUPB 2CGRH 3CLFL 2FL5A 3FO2B 3F7QA 4OCWL 3EYSL 5DJYB 2MNUA 3MOAL 3Q5TA 4I0PB 4XNYH 5I66B 5GSRA 3MRNA 4GO6B 3U4BH 2OMNA 3MRMA 4JPIB 3IKCA 3BT2H 4OFPA 5FGRA 5D1ZB 2NY1B 2FJGB 3VE0A 1M7DA 5IIEB 1CD1B 1KB5B 2YD1A 4EBQH 5DJZA 4I3RH 1FL5A 2ITDB 4OM0L 3IDMA 3INUL 1K4CA 4FP8L 3HG1A 2G75B 3RVUC 3MUJA 4QXTA 2EXYD 1PKQA 3LIZL 3LKRB 5F7LB 3RBSA 3TNMA 5AYUL 3VFNB 4L4TB 3C5SB 1IT9H 5I76B 5MENE 4LLYB 3QXTA 4P2QE 3MNZA 5IROC 1Q38A 4KJYA 2DQCH 3RGHA 3CJJA 4PJIF 1HXYB 4JFFA 5IM7A 1TETH 5L0QC 3VXUA 3MV8A 4HQQL 3DHMA 3NIDE 4UV4H 5JR1H 3O3AB 4LCUB 2P45B 3SO5A 3BKMH 2DMCA 4M7KH 4NO3A 2Y6SD 5DC9B 4JG0L 3AY4C 4NQDD 4RAVA 3QEQB 1J9CT 3TIDA 5CJXA 1JYXA 4GRWE 4PD4J 1U91A 3FTGB 4LPCA 4QOKA 4WFEE 1T21B 4KRPD 3DGGB 3T2PA 1F90L 1AGCB 1PEWA 3PQYA 4FOMA 1TNNA 3OV6A 5T3ZE 4O02H 4GKZB 4KXZH 3A6CL 5DVKA 5DD0H 2DQIL 4X9BA 4NKIH 1FIEA 4ZAKC 3K3QA 2DI9A 5GS0H 3Q0HA 5EOCH 4M5ZH 1JZ5A 5TH2B 4PJ5B 1T7YA 3FONA 1KC5H 1UZ6F 3MRRA 4OZFA 1OAXH 1G84A 5I6XC 4OD1L 4JFDA 4U1JB 3CFBA 4S1SL