5IHWA

The crystal structure of sdre from staphylococcus aureus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
314
structure length
314
Chain Sequence
b'NNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIAKGTFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVTVDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVDIAGSQVDDYGNIKLGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFGDINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine-aspartate repeat-containing protein E
molecule tags Membrane protein
source organism Staphylococcus aureus (strain mssa476)
publication title The crystal structure of SdrE from staphylococcus aureus
rcsb
total genus 73
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ihwA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ihwA02
4B60A 4F27A 4LEEA 3IS0X 2F68X 4RMBA 4MBRA 4JE0A 4FJ6A 2Z1PA 3IS1X 3AU0A 2Y7OA 3IRZA 3IRPX 4B5ZA 1R17A 4LE8A 4MBOA 3ASWA 1N67A 3V10A 2VR3A 4F20A 1R19A 4JDZB 5CFAA 2Y7NA 4Q6KA 4BBWA 2F6AA 2Y7MA 2YLHA 2RALA 2Y7LA 4F1ZA 4F24A 5IHWA 3AT0A 4LEBA 4JDZA 5CF3A
chains in the Genus database with same CATH superfamily
3IM1A 3ZJAA 3QYCA 1AGDB 2BMKA 5E56A 2K4AA 1NINA 1K4DB 2CLVB 2H3XC 4HS8L 2JKLA 1J1PH 5I1KH 3DGGB 1U91A 3SE9H 5ICUA 1S8DA 5GIRA 5FC9A 4AMKL 2OA9A 3Q9PA 2G0LA 5HHOA 4S1DC 1MLBB 3HBZA 2A9AA 5EF2A 2ZWNA 2YQ3A 4EPSA 3ASNB 2X9ZA 3WXWH 3AACA 2OR9H 3QFGA 5AW9B 3GRWH 4QRRB 2J73A 2WV3A 3GK8H 3N3EA 4X5XA 4HX1B 1BF2A 1SM3L 1UWXK 3X13A 3MV9E 2GEQA 5A2CA 4XN7A 3WDJA 1CDIA 4QTHA 3MLYL 3BP7B 3NSCA 2AZAA 1A64A 4LSUL 4PP2A 4V1DB 3W9DA 3I6LE 1UWEL 4LE8A 4GPVA 4X6DF 1F58L 3FJTA 1ZIBA 5JDSB 5DVLA 4GO6B 1FN4A 3MBED 1K4DA 5EU6D 1GR7A 2RFXA 1UACH 4HGWB 5FW7A 2X4SA 5A40E 5T1KB 4ACPA 4AEIH 2GITA 1CXFA 1OARH 1SDDA 3EF4A 3GM0A 2BIHA 1E27A 1MHHB 1T80A 2WXRA 3B7YA 5F9WB 4P5SA 3IMWA 4D2NA 2N7AA 5CJQH 4MXQC 2E46A 4FEMA 2NX5E 2D2OA 3CSTA 3KH4A 4WSJA 4NPKA 1IC4L 5JPNC 5IBTH 4XAKD 3LXCA 3TWCL 4LF3A 1L6ZA 1U30A 1G6RH 2F15A 1Q1PA 1Q0XH 4ZS7H 3CLWA 4KUCF 1E27B 4FA8A 4JGUA 3BPCA 1ZVYA 1EFXD 1HEHC 2XQYG 3QR1A 5EO0B 5HGAA 4YDLC 4PGZA 3TP4A 5LXVA 3BKMH 2DLGA 2ZUQC 4JUTA 1U33A 3L3HA 3FU5A 3GSUB 4WY7L 3GK8L 3VXSA 3TASA 4DKAA 1WHPA 4NI3A 3BSZL 5DD5L 1GL4B 1B2YA 1GKOA 1L9SA 4XHJC 4HBQA 5T5FL 2IAMC 5KUKA 1DYZA 4Z78A 4PJ9D 3WIFA 3IKCA 4OZIA 3IMRA 12E8L 1PLGH 2IOMA 3HJEA 4K3DL 5FM4A 2VE6A 2WJ5A 4N25A 4HAKA 3J27A 3GSNA 5B8CC 1CGUA 3QZPA 3KLLA 2B0SH 3QAQA 2QSQA 1LEGB 3B83A 3ZBMA 2J8UB 4X6FB 5CUSH 2AJ3A 3Q01A 2DIEA 3IDUA 2BP0A 2CRIA 3L4TA 1HNYA 3QIBC 3QXAB 1MVUA 3GHEH 1A6AA 1WSST 1XR8B 4FQLH 2HN7B 4UT6H 1U91B 3MLUH 4YHZL 2WVSA 3GSUA 3ULUH 2F53E 1JHKL 3E6FA 1FNLA 3NMEA 4LNRA 1WK0A 2BW4A 3OKOB 4FFWC 4FE9A 4CDHA 3LN4B 1ZPLA 5C07E 1ZE3H 1KB5A 5J13B 5AD0B 4G1EA 4F58H 3WTUA 1AGDA 3DJ9A 2O5ZH 3QHTC 4N6RB 1M05B 2NNAB 4F33A 1ONQB 3X2QB 1DUYB 3CLFH 2B08A 1ZWIA 5GRYA 2WNGA 1N64H 1QFWL 5IKCA 1JE6A 3HC3L 2OTWA 1NDTA 3QT2A 4YNYB 3B34A 3LNEA 1M71B 4NB7A 2QL1A 4ELKA 1P53A 4FLQA 5FAAA 1E43A 4J3SA 2NPLX 2DY2A 4LVNB 4M5SA 3O3EA 4HFWA 4ANKA 2ADFH 3QRFM 4P5TD 3DRTA 5K39B 1R5WB 2UYLA 3CZNA 1T83A 2ADGB 2XJKA 2X4PA 1RVFL 4OJEH 4I2XB 1U8HB 3FFOA 1LO2L 3DX9B 1CFSA 3P3SA 3MBEB 4UQBA 2TAAA 4X5RA 3IVKB 3D5OF 3GJFK 5EUOF 1V3JA 3KYNB 1U8IA 5F3BB 2C3HA 2GAZA 4JFZH 1QFHA 1KJ2B 2IBGA 5BRQA 2EH8L 3GTVA 2YMTA 3NCJL 2YN5A 2ZUUA 1JNLL 3HCVA 2H32H 4L9LA 5KW9L 5ID1A 2AI0L 1CO1A 2QT6A 3WS6C 3JUZA 6FABL 1E3FA 3F12B 2DLIA 3IE9A 1MCLA 4LSTH 5DJ8B 2BS71 4TM9A 2C4FU 1MF2H 1N26A 5F8QC 5I8KH 1PYWB 2CR6A 4XP4H 4YFEA 3X1NA 4Z7VE 4L3ED 4NQVA 1HCZA 3QI9C 1P7KA 4UUJA 3EH1A 2FNWA 4NC2B 1D6VH 2BSED 1QQDA 2MEJB 3Q06A 1G6RL 2X4TA 1HH6A 1UOWA 5AVXB 4UAOC 4L9DA 3MUGA 4LVOC 1U8LB 3FOLA 2DDQH 2LVCA 5LQBH 3SD5A 1PG7H 4B6ZA 2ZP0T 5IB3A 1R4XA 3D9AH 2VDKH 1FO0H 1YEJL 4NZUL 3GSOA 2IADA 2Z93A 4OCSH 1QLEL 2WB7A 4GUQA 2OI9C 3EYFA 4OCLC 2JJUA 4F80A 4N87A 1W0VA 3FS9A 4JFYB 4RA0C 3FQ1A 4NUMA 1ZTXE 5JDJA 4G6KL 1K72A 4MS8D 3AQDA 3J8F7 3QUMA 1QKZH 1C08A 2DTML 4N68A 1OTSC 3NSDA 2JTYA 2DJSA 1EBPA 4ISVA 3G5VB 5DHVH 2VLRB 3S5LG 2XBZA 2BJML 2X1QA 3T77A 4M4PA 4Z76A 3ARSA 2VL5A 3CHXA 2WWKT 2Q2LA 2HH0L 2CGYA 2ENJA 2O5YH 1GOHA 4JFFE 4U7KA 4PRID 1G9NL 2YRZA 3X12A 5EHFA 1CDYA 2F5AH 2DN7A 4S1QL 3GXIA 1G9NH 2H5UA 1IT9L 4XO9A 5EF3A 5I8CB 5D1XD 3BKML 4P5KB 4B60A 1UOLA 3NK3A 1FSKC 1QNZH 3BQVA 2DLTA 3KBEA 5ECGA 4IU2B 5EU5B 3VTAA 5KSAB 4D9LH 3BRFA 2AXGA 1UT9A 1Z5LB 4Q2ZB 3VGGA 4F33B 4D7PA 1TYJA 2VH5H 5ALCL 5L4MA 1SY6L 4X0KA 4L1SA 5I71B 4G1EB 5B4MC 1ES0A 4ONGL 4P2QA 5TDPA 3FO2B 1E8ZA 4YHKH 3LEXB 2YSTA 4J8RB 2J8OA 3GXUB 3C5ZC 4PG2A 3EGXB 1JN6A 3S34H 4Y19E 4F2FA 1VFAA 3EH5B 3LIZH 4Z3TA 2D03L 3P11H 1W2KT 5J4MA 3KYNA 1XGRB 1U21A 2CIKB 2ENQA 4GYBA 4JRYB 3WTSA 1LDPL 1S9WA 1XGUA 2CA4A 1CFSB 1QSEE 2W0FB 5D1QE 5L7XH 1MFVA 1F58H 2CBPA 1L9MA 1BZEA 1MXDA 2JCWA 2R1YA 2R27A 2E6QA 1QWUA 2A74B 3MRIB 2C9AA 2IO5A 4P23D 5C3TA 4PRIB 4XNUL 3I3EA 4PUBH 2JQZA 5C0BA 1CL7L 4OD1L 3GMRB 3BD4A 2R0WH 3LHPL 3KJ6H 4HH9B 3UBXB 2OMTB 1F90H 1HHKA 1A1OB 3WFCL 4X6EB 3UPRA 4TYUA 4WV1B 3GF8A 4W9CC 2OL3H 2KHAA 4NQCE 4AMKH 3NACH 4OFQA 3BAJA 1E4XL 1FRGL 5FOBB 3FF8A 2RAMA 3EYQC 1XGRA 4LMQI 3KWTA 1IAIH 2QKIC 2W0FA 2IGFH 1AHWB 2EE9A 9PCYA 2MOVA 1SZNA 4DGWC 3H2QA 2XTSA 3KWUA 1SMOA 2VLJB 4O51B 1OWRM 1PSKH 5HVGB 5I9QB 1FLRH 2D4FA 2LTQC 3OKDB 4FQ2H 4J7RA 1XF5A 5K9QG 1NWPA 3TNMB 3DSFH 3K6DA 4AJVA 4MCZA 4LU5L 3ULSB 3WAKA 4NIYE 3CUPA 1D7CA 1L9QA 1OANA 4WNQA 5ILTL 3UBXG 3W81A 3TT1L 2OCJA 2YEVB 4JAMB 1BFTA 1QR4A 4WFGD 3D18A 4OLXL 4X7SH 5D7KD 3V8OA 5CP3H 4U1JB 4QXVA 3WIIL 4GW4A 2J5WA 1XTMA 5F7LB 1OT4A 1X6NA 3K2MC 2R1XB 3FRPA 1P7QA 4MAYC 2C3WA 5C8JA 4Z76B 4UM9B 5EPMB 5LB1A 1DN0A 3FUKA 5I0XA 3FB7B 3IDNB 2AJSL 2H45A 3BP6A 4IBTA 4XMUA 2FYVA 5KUMA 1OT2A 1IBGL 4H13C 2GIYA 4QRPE 1JZ7A 2WXNA 2Y06H 2WBXA 3U9UB 4XVUD 3STBA 4WI4A 3SD2A 2ZWLT 4R4BA 4K5MA 5E2UL 2JKJA 3M7FB 2X28A 4KO5A 1A14H 1MFCL 3PWLA 3GHEL 3O0LA 4CSPA 1INQA 4A2HA 5H4ZA 5DVNA 3OB0K 5HGDA 3OLDA 3DMMD 4P9HC 4H25B 4JKMA 2PWHA 2EINB 3GBMH 4WJ5B 5MEPB 5FFOA 3BAXA 5AVZB 2HJFA 2BCMA 2WIIB 3HS0A 3L3DA 4I3RL 1J9RA 5DF0A 2H2PC 5F6HI 1H8SA 2DLFL 2DWTA 3EG9A 1BAFL 2A99A 1ZXKA 2CBOA 3ILQD 2IH3B 4XVOA 2KQNA 1AQDB 4WK2B 3T08A 4AXWA 3NCYP 1F02I 2CHDA 3JYBA 4PRHE 2CXKA 4TSCL 4ZW7A 1GYAA 1NIDA 3QPQC 3N43B 5IP4A 4UNIA 4H0LC 3SGEH 1NCDH 4WAFA 1KTLA 2WINB 4HJ1A 5K9JL 1EHNA 2YD3A 1NFIB 4PJFB 5A2JH 2BNUA 4N0CD 4LLMA 1DQJA 4OKVB 3MRCB 4PLOB 1IGYB 3LEVH 3ZKXB 4JZNB 4BFFA 1QZNA 3C08L 1KCVL 3VXOB 3ZZ1A 1INDL 1ZV2A 5D7KE 5E1IA 3D8MA 2BOCB 3TEUA 4Z3IA 5DYFA 2CO6B 3VFRA 1HHKB 1IARB 2J6EA 2NXYC 2WNWA 4HEPA 3TEZA 5KS9B 1MRFH 4CDGC 2HT2D 4JFPB 3FONA 3KPQA 3ZDZB 2R2HB 3GZPA 4JKKA 2YR3A 4XP6H 4JFTA 5IVXF 5FA4A 2UZXA 5IMOA 5D7JC 4XMPH 4X6BA 1PY9A 1W0YT 3KH3A 4HFWB 5E95B 5FUZL 2FEEI 2GJJA 1FPTL 5DURD 1OT1A 3TIEA 2EDTA 1U8CA 4N6QA 4G72B 5E2WH 3UAEA 1NWOA 5I1JL 5L9DH 2PW2B 4A7TA 3R06A 5T1MA 2HRPL 5DJDA 3EYUH 2F1EA 1RP9A 3EUDA 3C8KA 3ASOB 5E8OB 1U8OB 1E4HA 2MSPA 5DZLA 3F7PC 1U3HC 4BUHA 1U3HD 4L1TA 1OZTG 3IRCA 3QJVB 4AMXA 2FX8H 3HG4A 4KVNH 4MJID 2IBZX 3BPOC 4XO8A 4ZFFA 1VAHA 4XN2A 5HYQB 3PJLA 3SE6A 1HAUA 2GKIA 4A67A 4L18A 1KTKE 3HI1B 2WKOF 4KJYB 3QA3A 5ES4B 4WFFD 3BVWA 3MOAL 2OQJB 4N3UA 1AXSA 5E8OA 3KPNA 5FGSA 1PKOA 1S78D 4BDVA 4GBXC 3V6FA 1JZDC 3D39A 3BDBA 3R0NA 4KAQH 2EDMA 4KK5C 4FFTA 3V4VA 2E9WA 3FXIC 4PJXA 4OCYL 1AZZC 3QNXA 3LY6A 4WUUB 3MJ8A 3P2DA 1ILUA 3FQTA 3ARBA 3HC4H 4U6HB 4JBSA 4LIQL 4JRXB 5DURB 5JIQA 2A9NL 3ZX1A 2J43A 4BSVB 3MV9D 4AQ8A 1S7XA 4N2NA 2P8LB 4LHQB 2QEJA 2YGOA 2CDFA 1MIMH 2KZKA 2AJYL 2DYRB 2NXYD 4PJEF 3H1ZA 5CHNB 4F37K 1RU9H 4YOKA 5BV7H 2H32B 2SEBA 4MMZC 4UB0L 3TOPA 2HSIA 3ABZA 3LZPA 4YDIL 1YAZA 3RWJA 1FFRA 3H9SD 4UOW1 5DC2A 1ACYL 3OAUL 3O45A 3IFOB 4AE0A 4O58H 1ZS2A 3RZCD 1LE9B 4NN7B 3CDCA 5F7HA 2LU3A 2VZSA 3FN0H 3V0HA 5BCAA 1Y6MR 3P69A 2Z92B 5SX5H 2IH3A 4JZNA 1HHHA 1MWAL 3WGUB 2E7CA 4RSVA 3IE4A 1JPSL 2XPGA 4GY4A 5ANMA 4DGYH 2FX9H 5HPMA 1I9RL 1JPGA 4PJFA 2HVKA 2FEDC 1RZQA 1XH3A 4I18A 5BVPH 4P4KC 3SYOA 5F9AC 1P69B 1T89A 4FAAB 3QZMA 1K8IA 2F58L 1GPOH 4PSPA 4PB9L 5IHWA 5BUPA 2ZXDA 5LCVA 4PBWD 1I75A 3VO0A 3THMH 5CZVL 1QYGL 3VXSE 5J0BA 2IG2H 4JFDB 3I9GL 3EJJX 3RWJB 4PJIF 5F1SA 5IVNA 2WUCH 3GMNA 4QO1A 1JD9A 1RJYB 4OH2A 3FMGL 5E8PB 1R24A 5KJ7E 2DKMA 2YA0A 4JFFB 3ZDWA 5JPMA 2V37A 4FRWA 3ECBB 4OQTH 4DEUA 3HZVB 1RZ7H 4C4KO 2YPLB 5MERB 4FXKA 1U8MB 2WKLA 3K6IA 4D3CH 5IR1A 1NGPL 3RYMA 2P45B 4JM2D 3WUZA 5I1GH 2R9HD 5D1ZC 4P06A 4U1IA 3X13B 3QWRA 5AOLA 3IB4A 4YPJA 5E4EB 4M93C 5DQ9A 3P30H 4UTBL 2AC0A 5IROC 2BIIA 4MJJA 1D5IH 1HN1A 1O6TA 4JGNA 1FUNA 3A67H 3BAYA 4NUJB 4PJ5E 3IJYB 1EZVY 4F8PA 1DJYA 1KBPA 1OIOA 4HQQH 3T9WA 4F1SA 1AXSB 1J5IA 1ZANH 2PCXA 1JGEA 3AC0A 5LNGA 1JHLH 4O9HL 1PDKA 3V6ZB 1H8NA 4MAYB 4XVJL 3VI3F 1XMWA 5D72H 4KY2A 4PJFE 4UNTA 3VDBA 1OAKH 3EJCA 4ZUWA 1WG3A 5EWIH 2C7UB 3I9IA 4DOHE 2A6IA 5TFSH 4H8UA 4AENA 1AAJA 1KPVB 3O2WL 1J10A 4Y89A 1NMAH 3QUYC 4CADA 3SHSA 4JG1H 2XWBA 4MD4B 2WXFA 3U9WA 2BSEA 1J8SA 4FP8L 1K9TA 3LDBC 4KPHL 5F0LB 3LDBB 1S9KC 4N2AA 5JXEA 1I1AB 2DQ6A 1R3LA 1SOQA 1ZIAA 4H2AA 3GGWB 2DB8A 1WC7A 2BIPA 4L2YA 5GS0D 3LZFH 3MJGX 3U7AA 1KPUA 2X4NB 4P2QE 5CEXA 3B9AA 3BRDA 3MMEB 2M1KA 4P23A 1UTDA 1ACYH 1YECH 2N56A 1CI3M 1UOVA 5DMKA 5DT1H 3KNBB 3GBNH 4PM1A 2F74A 2CD0A 3EDJA 4PREB 4FLHA 4G8IB 2DD8L 5I6PA 3HN3A 3N0PB 5A3IC 1QFUH 2CDFB 3MR9B 3QIWB 4PJGF 3ARZA 1JFQL 3P0GB 2DYPD 1A66A 3BAIA 4DTGL 2AQ2A 4DP6X 2QADC 3GXDA 1NLBL 2HFFB 1VFMA 5HVHB 2A9NH 1Q72L 2BOLA 1XCWA 1EO8H 4Z7WA 3GMLB 4MA7H 3KNBA 1NEUA 4KX7A 3G04A 4DJMA 1A6VH 3FYIB 2ED8A 3PDOA 3PF2A 2HKHH 4WLCA 1NKGA 3EGXA 1XSOA 5FWQA 3F3HA 1V7NH 3VM5A 3DHMA 3AU1B 4CU8A 2YHGA 2PN5A 4G8EB 5ABAA 1BCIA 4OBRA 4L05A 2GW5A 3VJ6B 4LCYB 3HE6B 4OIBA 1ES0B 2ZE0A 3VGAC 1LO3L 1OCWH 5T3XE 4DGYL 1HQRB 4HKZB 1FVDB 4TQEH 2W60B 3DECA 3GHBL 3RIFF 3VD3A 5IQMA 1YG9A 3ARFA 3OGCA 4M4RB 2GT9B 3VWJA 2Z31C 5DA4A 5BS0A 1OE2A 2QQNL 3IDMA 3L3OA 3AQXA 4UYQA 4JG0L 2NNAA 1MNUH 1PX4A 3E6HA 2RR3A 2F8IA 1CDUA 4NCC1 1KWKA 1B4JL 2JB6A 2ICEC 1UKQA 2HVJA 3VFOA 2YPKB 2P8PA 3T77B 4BQ9A 4EXKA 2L04A 5FO9B 2R69L 3AG1B 5ESAA 3FQUB 2P9RA 3O3UN 4PR5B 4FQJL 2A9BA 2BVUA 2P52A 3KE0A 5E1AB 4LBEA 1KJMA 2VQ1B 2DLEA 1FSKB 4F57L 4PJ9B 3BMVA 4KMLB 5CZKA 3VDAA 3APCA 1OSZB 4NO2B 4A6YB 3TF7C 2Z8WC 5CIPB 4YHPA 4P46C 1TJIH 2N3JA 5K5YA 1OB1A 3US0A 4IIZA 4E0RB 3AUWB 2E4FA 3ZE1E 2VDQH 3GSNB 2CO6A 3QRBA 4YDLB 3IDMB 4BA8A 2AJXH 4G59C 3RVXD 5I1AB 2R23A 1NJ9B 4E9SA 4I0PD 1SY6H 2FECI 4U2ZA 2VSKB 2XCMC 4QJ5B 4RDBA 2X88A 4PG9B 2YPVA 4PGJA 3DTXA 4PWFA 2AXFB 1RZ8B 3H9HB 3FHEA 2KBGA 3QORD 4XX1G 3NPSC 1XF5B 5CNHA 4JRYD 1MELA 1HHGA 4PV1C 4S1QH 1MCOH 5LG6A 2OZ4L 4MVBD 2IALB 1FORL 5AEAA 2XZCL 5A3ID 1ZA6A 4YHML 4X6DE 4L8CA 1DQTA 4WU5A 1U8CB 1Z9SA 3QHFH 4R2GB 5LGYA 1FC2D 5DRNA 1YNLL 3MGAA 3GMLA 3HMWL 3FCSB 3WKMH 2Z65C 1IEBA 4KPHH 5HYFA 3FT0A 2FYYA 2MQ3A 4I3RH 2HFFA 4QWWD 4KC3B 4ZT1A 4XCEA 2H6PB 1CURA 3BIAX 4S0TD 1J1OL 1KJ2L 5L0QB 1OZUA 4XXWC 1JGDB 4GEJA 4FKKA 4NKDB 5J6HA 5GJTH 4RISL 1JI1A 4QJ4B 1TITA 4WFEE 3JWDC 3WIHH 4MASA 1T7YA 1EAPB 2YQBA 1CG9A 1CT8A 2IDQA 2ARJA 4ZDHB 3RTQC 3O2DH 4K9EH 4N8VG 4PS4L 4IMKA 4L1HA 1D6EA 2MQCA 1OLLA 4K3EL 4NQDD 1XH1A 4NQEA 4GLRH 3MRFA 4UTBH 5IHLB 1JWUA 4A39A 4U7MA 2FO8A 4AIOA 2WZPA 2W9EH 2CHZA 1MCDA 1P2CB 4Z1PA 2HG5B 4NRYA 4QOKE 1VGKA 1KB5L 1L3WA 3MX0B 1JN6B 5E5MA 3NOIA 4HK0B 2GBTA 4MCYA 2AQ3A 5EBLB 3ULVL 1I1FB 3TBSB 4C55A 4H5SA 1GS6X 1CD8A 4P2QB 5GRXG 4NLHA 3EADA 2F53A 4OFYA 4YIQB 3QO0A 3VG9C 5A43C 4DO6A 4HLZG 3CC5A 4X5LA 4JY5L 3F05A 5DJ6A 2OK0L 1AIZA 3DUSA 4X9YA 4NC1C 1OTUC 4E0RA 4AQOA 4CA4A 3SYCA 2UXTA 3K5SA 1MFCH 2IGFL 1DANT 3X3GH 3WO4C 2W81C 3AS1A 1KDJA 4XPTL 3CZUB 5FXCH 1OP5K 4PJ9A 2XFXA 3OWRA 1XWVA 3MNMA 5DWUH 4CUCA 4OU3A 3SKOA 1KYUA 3WJJA 4QCIA 1Q9LA 1QWNA 5IB1B 3CD4A 3SE4A 3U6XA 1QFWH 2VISA 3CMOH 4RMUA 4R5TA 3Q1SL 1YUKB 4I0CC 2P48B 3BCFA 4IKNA 4HIXL 3W5NA 1UZ8B 3ROOA 3N9GL 1TG8A 3TZVA 3GIZL 3RWDA 4PUBL 3VRIA 4F91B 1MJJA 4OLXH 3CZSA 2JI1A 1MJUH 1IM3D 2QELA 3IS1X 2CGRL 3DXAD 4JHWL 4MCNA 3RY6A 3FN3A 3KXFE 5EFIA 4TSBL 2OFQA 4LCCC 4WU5B 4YZFE 4IDJH 5JPNA 3U48A 4PJ7B 1GSKA 3I2CH 2IALA 4Q58C 2J5LB 1H19A 3QWNA 4KTYA 5AW2B 5SWQB 4UT6L 5PCYA 5JOFA 3K74B 3QH3A 4R7LA 4G5ZH 2RB8A 1UB6A 1A7PH 4FGMA 5KVFL 2YPVL 4EDWL 3TA3A 1LEIB 2Y7SA 5IHZB 5ID1B 1MRCL 1EEYB 5D7HA 2R15A 4CN1A 2EYTB 1RZKC 1NGZA 3QBTB 2FGWL 3L4UA 3S9DB 2CCVA 3IJ7A 3BIKA 4A63A 4AITA 4KXBA 1U93A 3B2VL 4JREB 1JNNL 5I9QC 4N8UA 1R46A 4HHAB 4RAUA 6CGTA 1JCKA 3RNKA 1SVCP 1QNZL 4LLVA 4H1LA 1TEFA 2JB5H 3MVSA 1ZKAA 4U6HA 3FUHA 4Y1TA 2ZPKH 3WUWG 3FBKA 5I15H 4JO3H 5DMKB 3PWUA 2VW4A 4FADA 3DMMB 1D3CA 4P2RB 3QYNA 4YUEH 5KSAC 3UG5A 3TT3L 1D9KC 4Q52A 2X4NA 4GO9A 4U7SA 2YAOA 1KTJA 2GEEA 2J88H 1KLUA 4JFHE 4M1GH 5CZRA 2DQGH 4J28A 4HJGB 1GCYA 3JWOL 4KXAA 1BVKA 3WI9A 2IV9A 2VZVA 1XGUB 3D05A 5F7KC 1CD0A 2DMHA 1SHSA 1CU4L 3M17B 5EC2B 1ONQA 2B59A 1OGAE 1ZA3A 1D5MB 1CU4H 2ITDA 5JR1L 2HWZL 2FBJL 1R75A 4ZMTA 4R3SA 3RVUD 4E9TA 5C7XL 4MBRA 1WFOA 3SOBH 1ACZA 1IGIL 1AR1D 2CKBB 1PVHA 2VDOH 3UJTL 1UURA 3VXME 1RIHH 2F53B 4BFGA 1RAMA 3FO0L 2GSGA 2O6CA 5T1LA 5TE4L 2XWJA 3RUGB 5T3ZH 3BRGC 4QXGH 5J7CC 2UV3A 4LCYA 4I4WB 2ZYSA 2MPAH 3ZDXE 3H6AA 4GW1A 2X41A 4NNYB 2VDPL 3VFUA 4BCYA 3NIGF 3DROB 1KF9B 3BE1H 3WXWL 4AIXA 2JXMB 4EAEA 4IRJB 2P80D 2WBKA 1XGTA 4NQEE 4J3OH 4ATWA 3CFEB 1ZLWK 4R7VA 3WDHA 3V52H 3X14A 2QPSA 1HEZB 1JYWA 2GJ6D 1EEZA 5A2LH 4M29A 1W8NA 2ZX9A 3ECVA 1VGEL 3Q6GL 1MJ8L 3CVHL 4GI8A 2A4ZA 2E59A 4H4NA 4JDVA 4X2UA 4EKJA 2K70A 4Y2DB 1QLEH 2ZIDA 2YBRB 1WBXB 4KK5D 2APWA 3QCUH 4EIZC 4GG8A 4ZUVA 4ETQB 4HIEA 2PCYA 3QJFA 2YS4A 2X4OA 2RQ8A 1IAII 4R7NB 1X9QA 4RRPA 5IB3B 1GSMA 4TUOB 3VU2A 4X4MA 1WC7B 3ET9F 2WP3O 3VFUB 1CF8L 1HHIA 4RMWA 3RVVD 1A7OH 5E08L 1SY6A 4YGVA 4F8QA 4JDTL 4YZFF 1HE7A 1OAUL 1PAZA 3OKKB 4LVNC 1ZLWH 2X5PA 4M3KB 3D85A 3CU1A 4XVSL 3OAYH 2BNQD 3NJVA 5KJRL 3BGFC 2EP6A 5J11C 2BP8B 3MREA 5I8KL 1QRNA 2XX1A 1UM4L 2X4SB 4ZO6A 4HF5L 5B1KA 3PHQA 4WK4B 4AEHL 3K80A 4GMSH 1XBDA 3IMTA 2MCG1 1FFTB 4TTDC 1I3RA 2WQSA 4QRPA 1TQUA 2P5ED 4N26A 5AAMC 3P2BA 2Q1EA 4FQCH 3V6OC 3STLA 4I5BB 1OLZA 4P2OC 4BXVA 2ITCA 2V5RA 3KYMB 4NJ9H 1KIRA 5CWSB 3INOA 1H3GA 3L3DB 4LCIL 5EU7E 4K3JH 4U1LB 4UT9A 3U0PB 2P28B 4LARL 4A38A 4BEIA 3GJFA 5D5ME 2VCOA 2R0LL 1RVFH 4E9YA 2V5TA 5DMGD 1HDMA 3G6JB 3QNXB 4WUUA 3BLPX 5D7LD 5GGVL 4HJEA 2ICWA 3IDYB 3W3BA 4CMMB 1RPQA 3HKFA 1DVFC 3JWDL 4FN0A 4JPVL 1RK0B 3CX2A 1GZPB 4F7TA 4V2BA 5GIRB 1NMCB 2ZXEB 4JK0D 4UT7L 1D5XB 5B39G 1EAPA 2H1PH 4YHYB 3HE7D 3ZTNH 1AS6A 3RTQA 3PHQB 1WRFA 3BWZA 4JHZA 3RIAK 3MV7D 4PJ5D 3ULVH 1I3RB 4QRPB 4UWQB 1YNKL 4HWBL 2DH2A 4GBXD 1FL3A 1UYWH 1S78C 4IBSA 4X6DB 3WNMA 3CHOA 4GT7A 3IDYC 1NBQA 4R7XA 2JSFA 1QI4A 3J2PA 4LGPB 1FVDA 4PVLA 3SYAA 2ZAIA 5DRWA 1LK2B 4ONFL 1VZIA 2AK4E 4QLRA 2J2ZA 4KJQC 3ARFB 1IM3B 4KV5F 3STZB 5CP7A 4DP5X 3IGAB 1RH8A 4NQCA 1RV6X 1JPGB 4QR7A 2ZT9C 3LEYH 2DJUA 4PVMA 2BFVL 3VE0B 1RUMH 3O8XB 1E7UA 2O5NA 5CJBA 2D3JA 4YIQA 3MGOA 3SDAC 3KLAB 3BWSA 3QIWC 4LL1A 3BQUD 5D71H 4PGBA 5F7EL 4X6EA 3UPRB 4M61B 3ARDD 4DP2X 1SYSA 5L2KE 1CCZA 2JIXB 4KQ3H 5IJKA 2RD0A 3SE3C 1FAKT 2IXQB 4L3EB 2EIKB 4S1RL 2KC0A 4FMFA 3UBXA 2YJLA 1EO5A 1FZKB 4NKQB 4PRPE 5C0AD 1ZRUA 4QHNA 4WHDA 3BVNA 3CBKB 3DC0A 2RIKA 2J6EL 1ULVA 3HEIB 1NBVL 1IRAY 2XICA 3WSQL 4QF1A 1F6LL 3FRPG 3MRRA 1J0YA 4PN6A 3OX8A 3SCMC 3FQTB 5JIDA 2OMZB 5D8JH 1G7MB 5D8JL 1ZHNB 2QGEA 4D0BA 2YC1A 4WO4B 2ZCLH 3NA9L 5F21B 2NUPA 4Y4HD 3ZMRA 2BJMH 5GRVK 1G9HA 4WSKA 3HE7C 3D87B 4Q56A 1BBJA 3L3JB 3QR2A 5J6GB 1KGYE 4MRCA 1CYGA 1DCLA 2QGCA 1UASA 2XHNA 3ECQA 3UJTH 1UD6A 3KLHC 5ITBL 3A6CL 3DHJA 1VERA 3D3VE 5IFHH 5JHMA 3S3BB 1TJIL 3HPJA 5D1XA 3R4RA 4HU2A 5E03A 1F4YL 5F7EH 4JZJB 2X12A 1A4CA 1I8MB 3VGBA 3ZGIA 1KG0B 4PRPA 3BH9A 3OKOA 4V1DD 2NTFA 2KZWA 2VZUA 2WVVB 3UO1L 1ID5I 4LAQH 2BFVH 4PTTB 2VUOA 5IJBC 1PBYA 3S8WA 1AY1H 2PP8A 3MA7B 3BGFB 3HW7A 4FYSA 1DDTA 2W5PA 5CR1A 3L1OL 5LKNA 4JG9A 2CRMA 3H9ZA 1OCOB 4LCWD 2AQSA 3MUUA 3F84A 1CGYA 2C1OB 1YEFL 4YUEL 1KGIA 1E5AA 2G5RA 3WFHB 4ABQA 4CVXA 1WA0X 3BCDA 4HXAH 1PF3A 1A02N 3KYKL 2WYHA 3CSFA 1A22B 5EOCJ 5K1NA 4Y4FA 4YEFA 3KXFB 1WAPA 4Y0GA 3B56A 2L7EA 1N5AA 5C0CD 3OR6A 1JV5B 2Y1YA 3IK2A 2BNRE 4WFHD 4X8GA 1J5OH 1CTNA 1ZHBA 1VKXA 2QMJA 5SV3A 5JLZB 3BKJH 3V4PL 1H0DB 2VRAA 3U6RB 3SJVD 3WKQA 4LKCB 2EVFA 3T0AA 2Q7YA 3H53A 1FWXA 1ACCA 4WK0B 4ZRGA 3UDWA 4W9KC 1RK1B 4ELMA 3EO1B 4JO2H 3NN8B 1V05A 4L3EA 3IBEA 5MHSE 3T0BA 3ROLB 1V7NL 2BNUB 3IGLA 5AKTA 3NIDB 4MYWB 2F7RA 3S35X 3HI5H 4N9OB 5DRNB 4UANA 2NY2D 3NRQA 4PYHA 1DVUA 5HJ3B 1BZDA 4WI8A 2D7PA 4OV5B 1BFVL 1EO8L 4P2CG 4BGLA 3VGFA 4WRLA 1NLBH 2ZOTA 4O4YH 4L9LC 5ANME 1NZRA 1HCVA 5HJDA 3RWGB 3OGCB 4M48L 1G7QB 3FSOA 5DQJA 4E5XA 3OL2A 3HB3D 5E9DA 1D5MA 2ITDB 5I0ZA 2EC9U 1UZ8A 1MOEA 4HV8B 4N2MA 4XC3H 3ZE0E 3IVKA 3FCBA 1HL5A 3BPNB 1DR9A 5AVTB 1T4WA 4MNGB 4HHWA 4V1DE 1NAKL 4Z5RA 5FV1L 3SKOB 4YC2C 3P4MA 2Q20A 3TO4D 5ALBL 2GITB 2JKNA 1GS7A 4XWGL 3WV0A 5E1AA 1ZVSB 3GHPA 3PJNA 2XIBA 3QCTH 2JLPA 1FN4B 1D2PA 4YBQC 3C6SA 3H7BB 1IAKA 3C60D 2L7QA 3MFFA 3MLUL 3L3KB 2Z0BA 4UIMB 4PJIA 5FYJL 1G4RA 3QPKA 1S7SB 4XPAL 5EZJA 2CHNA 1OAXL 3CV5A 5F93C 1IGMH 3AY4C 1KY6A 4PJXE 2EE0A 4ZTOH 2WXIA 3ORJA 3ECBA 3AT9A 4ZMQA 2FDBP 3HPJB 2QLVB 2DJMA 1IKOP 3BEVB 5C08B 4IJTA 1NCTA 5GRVL 2Y07H 3UZEA 3RWCB 1EUUA 2GJZA 4HW6A 5KVMC 1NBYA 4MD0A 1NAMA 4NM4L 3WKML 3D33A 1E5BA 4MA3A 4JRLA 2DQTL 1TQBB 3TH4T 1G9EA 4FYQA 4PTTA 4WHTB 1WA2X 3LNFA 2YKKA 4R5VA 2E3VA 3MJ9H 4A66A 4K7PY 1AG0A 3TA3B 1E2WA 2FWSA 5T1LD 2VAAA 3BUIA 4OGQC 5TK2A 1ZGLB 4KTDH 1A3RH 1SLVA 4JQXA 5DD5H 4YSDA 5IB5A 4LHJB 2L7JA 3FQNA 4DAGL 4MD4A 4WDIB 1FZMA 2AFNA 4RFEA 3D2UB 1MVUB 4PJEA 5IQOA 1XIWA 3BSZA 4KBPA 3EO9L 2EDDA 4C83B 3OJDB 3AFLA 1TQSA 5EUKA 3VJ6A 2DJ4A 1P4LA 3A22A 4RGNC 1LO5A 2C9UA 3CVIL 3IFOA 5C70A 3TZVB 1EGJL 1E9QA 3GRGA 3T1WA 3GYRA 4PCTA 1QYGH 3WBDA 3PXLA 1EJOL 2VMFA 5I1LB 3ES6A 1JPTH 4KMTL 4YL4A 4K3HA 5IOPB 5EN2B 3N1GC 1A1NA 1P4LB 1CGVA 4JHUA 3IXTB 1V3KA 4G43B 2HYMA 3WKYA 3QI9D 2KT6A 2YXVA 5BRZB 5HD8C 1EERB 4PCKA 4Z7UA 2D7NA 3WJLA 4FQJH 4F8NA 2WBJD 1CPUA 4U1KA 1U95A 5FGRA 1NFDB 2WZ6A 2ZF9A 2Z3FA 5DU7A 1EAOA 2QVTA 3BO8A 5HYJB 1LD9A 3VTTA 3FSZA 3NIFB 4NNYA 1JFHA 4OZFB 4GFTB 5B39A 4TQ8A 2BVYA 2R0ZL 4JM2C 4PMFA 2FB4L 2JB5L 2GSGB 5I73B 1MW0A 2HRLA 3L3GA 5TDOB 4OT1L 3PS6A 4WTQA 1EV2E 4FCHA 5EN3A 1A7QH 3FYEB 5A6IA 5D5MB 2VLLA 1WAEA 3POCA 4FMVA 1I7TA 5EEZA 1U3YA 4XXDB 3JV4B 1A8JH 5JORB 3HS0B 2DS4A 5I8CA 1JV2A 2EKJA 1B4LA 1GOGA 4BWWA 2K8MA 1ORQB 1HINL 2BIOA 5EU5A 3U1SL 3EJYC 2Z31D 4I2XA 1A6WH 1CLYL 4YX2H 4S1SL 1HJBC 4LLWB 4O2EB 1O0VA 3PXJA 2I60L 1H3XA 4XOBA 5JIKA 5T33H 3SKJH 4E42A 4QRRA 5GZNC 3ROOB 3PL6B 3MBWB 2XU9A 5CO1A 5CEZD 3GIVB 4IRSD 4IDJL 1RJZB 1ORSB 1T3FA 4JB9H 3AS2A 4PJAF 2A6JA 1Q9LB 5KVDH 1S7VB 5DMJB 1S5HA 3CFCH 2IFFL 4ORZC 5GPRA 1OF0A 3D39D 1KCUH 1HL4A 2BOBA 3RA7L 1HQ4B 3FTSA 4EQ3A 4U3SA 2ZONA 2KZBA 5GSRB 4NKOA 2Y5TB 5DEGA 3KCWA 4KKLC 1VPOL 3E1ZA 3PWVA 3CMOL 1JV2B 3U4BL 4F27A 1XCXA 1RUAL 2QGBA 3O6FB 4N5UA 2FJHA 1LE5B 1DQQB 1L9RA 4KK9D 4TS6A 3TBVB 3EFDL 4KKAD 4GNKB 4N85A 4HUMB 4UM8A 5DWUL 3GO1L 3SZKC 1U8LA 3FOLB 4IK7A 1KELH 1ZPUA 1F00I 4NT6A 1X3DA 3O2VH 3ZRFC 4A2FA 4X6CB 2Q7AA 1QEWA 2UZPA 1CXLA 3LX9A 4JG1L 3VXMD 2A6KB 3QH3B 5HI4D 2IBBA 4EUPA 1Q4NX 1MJ7L 2XYCA 1WICA 4N0RA 2X2UA 1WEJL 3T6QC 1JZFA 1NBCA 3HKZA 3QPXH 4P3CH 2VDKB 4NQSA 3BPLC 3CXHJ 3ULUF 4U2YA 1BM3L 1BOGB 3VG9B 5E2TH 2XC8A 4Z7UB 1X44A 4NRXA 5FOJA 4NZFA 2Q8AL 3G04B 1GYUA 4NI6A 4G43A 3RG1C 2DWEB 1VLXA 1MCEA 2FATL 2VQUA 1ZGLM 4JGMA 2OW6A 3UTSA 4LPUA 4DVBA 5CJOL 3ES6B 3GSNL 4QHUA 1UWGH 3DRQA 3HUJE 3SKUD 2AP2A 4P8QA 1ZEAH 3PP3K 1NM4A 4MNQD 4X6CF 4XB7A 5J56B 2GJ6E 3FTVA 1IC0A 4YMPA 4JM4L 3D4CA 3WHE0 2ZWZA 1FDLL 4KTDL 5CEZH 3UZVA 5HHPA 4G42B 1MFEH 4FQXD 1TJGH 4TSCH 1IIKA 1RZFH 1JOIA 1HXMB 1YUHA 3MRJB 4NX0A 3FFCD 4YDJB 3VYNA 3KDMA 3N06B 2GHZA 3ARBB 4GAAA 4XODA 2LU5A 5H37H 1MCCA 1P9MC 1XQ4A 5HVHC 1BD2D 2ZUXA 5F88B 2QTVA 4FFYA 4F3FA 2X1WL 5D1QA 1QSEA 1WWAX 1BGXL 4FQQA 4Z9KB 5FHBH 4TQHA 2R9HC 5I28A 1CFQB 5TFSL 5L0QC 1UATA 3VWJB 5F7MC 1J0HA 3MRNA 1ODAA 5E8NA 3SJVB 1MJ7H 2VLLB 2B59B 4WGVB 4MB1A 5SWSA 1YN7B 5GRZA 4YHOL 3CFQA 5D2NB 5E9NA 5E1QA 3BQUB 2OZ4A 2I9LA 2B8OT 2WQ8A 4O9HH 2ZP9A 5BV7C 4R2GC 1ASQA 1Y6KR 4WI3A 3BPOB 4Q97A 1A6UL 3GB7A 5TJWK 4WZ9A 3MX0A 3RQ3A 3WFDL 4Z3EA 1HNGA 4R4ND 2R2HA 3HC0B 4ABUA 3R06B 5T1MB 5J3HD 3BFOA 2OMVA 1LWJA 1UM6H 5FYJU 4DZ8B 1UD4A 1T1WB 4IU3A 1OP3H 1MCOL 5I1AA 2CM5A 4X5XB 1KEGH 4E2OA 3GUTA 3NYKA 4UNVA 2VSMB 3NRPA 1C8PA 3F6JA 4JFFA 1D9KA 5D7LE 1CYXA 1CDHA 4QF1B 4YBHA 3H8NA 5AG9A 4P5TB 3IN2A 1MY7A 1O7SA 3QDME 5DS1A 1DO5A 2D7TL 1R24B 1Q0YH 1GCFA 3HC4L 2XN9A 4WVRA 2G4GA 1NGZB 3C6SB 3L2LA 3GMNB 2G0KA 3CBJB 4R4NC 3OLIA 3O6FD 2Q86A 3GB7B 1GZQB 2P8MA 3SYPA 4L37B 4L29A 5E24E 5IY5B 3EXJA 2X2YA 3R8BB 4M7LH 4I1NB 4EVNA 2DM4A 1F13A 2JJSA 1KG0A 4N0CC 2DM7A 1HINH 1ZV9A 2BOCA 2A73B 2FBRA 3NCCB 3MZTA 2YEQA 4PY8I 1WBZB 4ZOAA 5AAMA 1BD2E 4UM8B 3LS5H 4BK5A 2ZYRA 4ZJ9A 1V8HA 1M3IA 2XN9D 3RJDA 2XQBH 2Q3ZA 4NQDA 1QA9B 5IZ7A 2CMRL 2FX8L 4KVNL 4J3XA 4XAWL 4OT1H 4XCCH 4G7VL 5ICYB 2BHYA 5GZOC 1FFOB 1N7MH 1BBDL 2J1YA 4PI0A 4CN6A 3V6ZA 4AUYA 2IAMD 1BMZA 4RIRA 3VB8A 5I6MA 4NKIL 2RJMA 3FL7A 3FQ4A 1LMIA 3CIAA 3WY3A 4XXCA 1H0DA 4F7TB 5DD0L 4CU7A 3OX8B 3FB7A 2OPCA 2H1XA 1COBA 4N2BA 5C0AE 1ZT4B 3VFGL 2R4SL 4M56A 1E5CA 1BLIA 3RX9A 1DEEA 3IFPA 1KLFB 4X83A 2H2SC 3DROA 1A8ZA 1OAQL 3SDCD 4CMMA 2VIRB 1R33A 3JTSB 4NO0B 3Q8AA 2L3BA 2F1BA 1TTCA 2OBGA 3N50A 4QUOA 4APXA 4XHQA 1XH0A 3APMA 3QQ4B 2VXVH 1MI5A 4R2GD 4S1DD 1KCVH 4CMHB 5EEUA 4NCDA 4GQRA 3CPLA 3QO1B 3QI9B 4HC1L 3QCVH 1I8MA 5IJKC 2HT4D 4BYHA 3VRLE 4QHKJ 4AQAB 4N3TA 1Q9KB 3A0OA 4LSRH 3S5LA 3WE6A 3V0VA 5D2NA 1NA8A 2XZQH 1I9EA 2AAAA 5BZDA 1M3JA 3WSQH 2D4DA 5LCVH 5GJSL 3PQYA 4ZFOB 4TNWF 3S3SA 3WFDH 2P5PA 2Y22A 1WZ1H 2ICWI 4B9FA 1OPGH 1YEIL 4HOZA 4UOW0 5F6HJ 3IMSA 1HQRA 1YEHH 3V9CA 3OMNB 1CD9B 4OCRH 4E41A 2VR3A 1C5CL 4KJPD 4G6KH 4UAHA 4XBPA 1AZCA 4L37A 3BQUC 2BIQA 1R1CA 1WAAE 1P4BL 5FKAA 3U0WL 4PPTA 3WNKA 3SE4C 4MHHG 2EKSA 4NYLA 3C5JA 4ZTOL 4LQFH 2DMGA 2OMZA 5D5MF 4HJ0C 4OM0H 4XPAH 2CJTA 4OVVA 1JPFA 1BWMA 1I3GL 3EYSH 4G3YL 3Q2WA 3GDBA 3T0DA 5DUPH 2ZXWB 4TNFA 3O0RH 3QDJD 4GSDH 3HE7A 3UADA 5IEHA 1Z1WA 3L4ZA 2IWEA 4ENZA 1RSYA 3HHSB 4ONHA 1ED3B 4ZX5A 4APQB 2WGXA 4Y1SA 4AEFA 4OZIE 5GS1A 4ZOCA 4KWUA 1E42A 5CR8A 4DERA 1VZHA 4KI5E 3JQOB 1ANUA 3V6FB 2F74B 4PREA 4R8WH 1F2XK 5AKVA 1ZE3C 1CLZH 4BFBD 4LVHC 3QDGD 2A74C 1BJ8A 4PJBF 2IOIA 3RTQD 1XGPB 2Y4SA 4XMLL 4YHLL 2FVNA 2K6WA 2DQEL 4WHYG 3UJJH 2CR0A 2X2HA 4B0MM 2ZOWA 4ZMWA 3BD3A 4KFMA 4OLEA 2GI0A 2YK1H 4JZJA 5JHBA 2ZG2A 1T0NA 2BSRA 4PMEA 2A77L 4IRSA 2IG2L 4NOBA 4RFNB 4P07A 3ZKXC 3RWIB 4R90H 3R18A 1HS6A 1O6VA 4TUOA 1QBML 2ZX5A 4KRPC 3ZRSA 3VNYA 2BNQA 5CP7B 3X11A 4AYFB 2CO7A 4HAGA 1FGNH 3PE9A 2HTLD 4TUUA 1UT1A 1EHXA 1CBVH 5DD6B 1AHWC 1Y07A 5E0QA 5KSAA 4I7ZC 5F9JB 4YHIB 1EHLH 2YGVA 2P8LA 1KELL 2ITFA 3VI3A 4LT7A 3REVB 4EN3B 4Z7OB 1P7QB 4PJBA 5ACZA 1L9PA 1Z9MA 1RUAH 4ZW5A 4CVZA 2AERT 2Y72A 4NO3A 3BW9B 2AJ3B 5EA0H 3WTXA 4B96A 5J11B 4IHOA 2EICA 2ZAGA 2WLIA 1NUGA 3CBRA 4YSEA 4D9QE 1TZGH 2JTDA 4FKHA 4N8CH 1HCFX 1HZHH 1TJHL 2JKTM 2OSXA 2F18A 3B9KC 4Z7VF 5DXWA 4ENEC 2XKNB 3PFUA 4NBXB 5E8PA 3D09A 5FYKE 3L95A 4LAQL 5DD6A 2HX7A 3WU1A 3V4VH 2X05A 5JIIA 4ZOEA 1N0XL 3PGCA 3WN5C 1SJEA 1QHQA 5CN2A 4PJ8B 1SXCA 3U1SH 3NP3A 2E9IA 4G7YL 4A68A 5SWZA 1BYPA 3P02A 3PJSB 1OQXA 5JQHC 1DUYA 3D7PA 3MOBL 4GH7B 2GTQA 3RWEA 4GAGH 2XTJD 5D70H 3V4PH 5E70A 1ZTXH 3HHSA 4QAWA 2YBRA 4Q6IC 5EIVA 1IBDA 1WV7T 3GMRA 1A1NB 1WT5C 1F90L 4KH9A 3ZO9A 4YJZL 2QQKH 4OJYA 3DRTB 1JP5A 4W70A 5K39A 4F24A 1TZHA 4ETQA 4IRZA 3QZWA 1A4KB 3S3DB 5B1BB 5KS9A 2EUXA 1AGEB 5AVYB 3UTOA 1LEKB 4EDXA 2APVA 1NBVH 4IYKA 4RA3A 4XVTL 1E8WA 1HXYB 2OMYA 2YD6A 1N8ZB 3F7YA 3WE1A 3O9WB 2EIJB 3IFNH 1ET7A 1JZ6A 4LP5A 1N2RA 5GISH 4UDUA 2YAPA 2NT1A 1U8KA 4LCVA 4Q0XL 2XKUA 2OS7A 3HI6L 3T8XB 1ZGLA 3QZBA 1GY2A 5TF0A 5E0FA 3FFCB 5FCUH 1F4WH 3FQNB 2VDKL 3LD8C 1E4KC 3RNQA 1PZDA 2FECL 1B2WL 4NWUH 3SDXE 3K71B 3KXFD 1WWCA 2JJSC 2NXZD 4XX1E 5EMYA 1NBYB 4JE0A 5SV4A 3GSRB 3T4YB 4AVIA 2WLKA 5C08A 1I7UA 4ELMB 5ALCH 2DQGL 3PIQB 5E9DD 3KPOA 4W9IC 5BXFB 1OD7A 3AXLA 2XV2A 1WO2A 2VXUH 3Q2VA 4RX4A 2V5MA 3UAAA 3I6KA 1WFIA 3K5RA 3WFEL 4GP5B 1IT9H 1C16A 5IIEB 4LQ1A 2APTA 4X4XB 4DAGH 1LK3L 5SX4H 2GIMA 5LHDA 1IQWL 1JAEA 1F3DJ 4ZMZA 2O5XH 4H25A 4KXDA 2NY1C 2HG0A 1XF3A 1FNSH 1S5HB 3WJLC 4J12A 4A1RA 5TDNA 1EFXB 4JLRA 3QUMB 4LFHD 4XMWA 1ZT7B 2H6UA 5IHHA 5EORL 1MHCA 4R6UA 1AMXA 1X5MA 1OF2B 3PV6B 4PRAB 4NUGL 1C08B 2EXTA 2J3SA 3GSXB 4QRFA 3MV8E 2BY1A 4ODSL 3MA7A 2F7OA 5FYKU 1E9QB 1PFCA 1BSIA 1PLAA 3NZHL 3QORC 1ZVSA 1ROCA 5BZWA 1DBAL 3NTCH 5CGYC 1KN2H 4AUJA 4M3HA 3JWNG 3JXAA 1NEZG 3WO3B 3CJJA 3FCSA 1ZT4A 4HKJA 1C16B 5IIEA 4K0OA 5LDUA 4BZ2A 2XY1A 3LQZA 1H3TA 1IGYA 2FQGA 3R4DA 1IM3A 3STZA 2Y7QB 1TO5A 4KOCA 3NFPA 1LDSA 3RWEB 4DCQB 1FCGA 5F70A 3S96A 2AV7B 5IB4B 3ROLA 2GFBB 2PLTA 3SPCA 2Z92A 5DJ8A 3LNHA 4LL4A 2AMUA 2BWQA 1UM4H 1BX2B 2V2WB 2VR9A 3VG0L 5LVEA 3LEXA 5F7FA 1BQHB 4JVUA 4OZHF 1QUNB 2AKRA 2X53A 4R26H 4ZAKD 4LOUD 5EOQH 3BUDA 3P4OA 5GGVY 1IM9B 2AI0H 3K46A 3DURA 3N1PC 4M5TA 2OTPA 4PJAE 4ES8A 4PFEA 5IB2A 1GA2A 3TN0A 43C9A 5JPNB 1XDTT 3DPBB 1YHPA 1K5NB 4QTHB 4YBLC 3FTZA 1EHLL 4YSOA 4U6XA 4X7FC 3O9WA 4WW2F 4J4PD 5JHLA 1AO7D 4YHPB 5J57B 2MCAA 1KN2L 3V0GA 1CQKA 2JFCA 4WV1A 3TYFA 3TYGH 1HQ4A 4MNQE 1WS8A 1UADC 4GSXA 3QZWB 2AJVL 2IIJA 4O5LL 3WGVB 1TQVA 3W38A 4X9HA 1GYCA 3WNOA 1BQKA 2HRHA 5EC1A 1F3JA 4NJ9L 1NMCC 3BFWA 4G6MH 3VXPB 1EFQA 3DXAA 4JPIB 1IUZA 1BZ7A 1T7WA 4FQCL 3V5KB 4F5CE 3FCUB 1G7IB 3L7FB 4DPRA 3UJJL 4F15C 1M7UA 5IG7B 3I3DA 5GS0L 5T5FH 2AMGA 3LKNB 3GSQB 4PAZA 1KBKA 1SMAA 4B27A 1W0WB 1XF1A 1LK3H 2BHFA 3GEFA 3SDYL 4H0HB 1ZA6B 1EZLA 2VZ1A 1HKLL 4HXAL 3D18B 4OIIH 1GGBH 2XWCA 3G6JF 1KBGH 3IJEB 3MLRL 3QZLA 3Q13A 3SOBL 3L5WA 4HXBH 2EYSA 1SLUA 2WZ0A 4MD0B 4NP4H 1ADQA 3GINA 3NTCL 2WOBA 2PPAA 5CN1A 2NDFA 1F56A 1JWUB 4ERSH 1VGEH 4L5FE 2DI9A 1OB0A 4NNPH 2XXCB 2WO2B 3S3PA 3K4ZA 3OG6B 3VW3L 4HGMA 3IFNL 1WCBB 2B5IC 2P5EB 4TLUA 3MV7A 4ZDHA 1TT6A 2DMBA 3KLSA 2F5BL 5BUGA 4TMPA 5DFVD 4NQCD 3FSWA 1A6PA 5DO2C 2XZQL 5EN2A 2MQ0A 1U8JB 5H4YA 3N1QC 1P4UA 4QHKI 5FDWA 4LSRL 3U79A 1KEMH 2F5AL 1KV7A 4MXQD 3S5YA 1RZJL 2ADYA 4L3AA 2EE2A 4WJG3 1IM9A 3F7VB 2LOEA 4JPWH 5D9SB 4ZW3A 5M94B 2GBAA 3H3PH 4MDJB 5E8EB 5T1LB 4R0LA 4FJZA 5C0FA 3DX1A 4XZ4A 4APQD 4AYBA 3MRIA 1BVNP 1DSFH 2G2RB 3HR5A 4QY8A 3VQ2C 1PZ2A 4HV8A 5B1JA 4Q9RH 4U31A 5CAYB 4U6XB 4I9WE 5BPPA 1RZKH 1DJWA 3MOBH 1Q9KA 1K5NA 3ZK0A 4CGUB 4P9HH 5CZXD 2WLZA 1XGQB 3V5HA 4ERSL 1DQJB 5KANG 2V2XA 3O6FA 5GS2H 2BO0A 1SRDA 4MWFB 3WN6A 3U30C 4OB5L 5JHDD 2ENPA 5KVEL 1HOCA 3DVFA 2HMIC 2N4IA 4AOFA 1ML0A 1UM5H 3TO4B 2A1WH 2WZ5A 2B16A 4JDEB 4WUUD 4PHXA 1A9VA 4WWKA 5AB1A 3VXPA 1YPZE 4IMLA 5LQBL 3NT0A 1E5ZA 4RMSA 1KBGL 3DYMA 5HDBE 5D7JD 3FRUB 3DYOA 1JZ8A 4B9CA 4OJDH 4G8GD 4KRLB 2FJHB 2J57A 5IUSA 1HH9A 3WEAA 3K2KA 5EF1A 4XPGH 4DSYA 2FEDD 3BJLA 3QJQB 3TLRA 1ZMYA 1AQHA 2FSEA 3FB6A 5J12C 1JI2A 3SDYH 5F96L 1S7TA 4OM1H 3UAJA 3C5ZD 2FAUA 2K7PA 1WP6A 5CILL 3NJNA 5H94A 3ARDA 1LVEA 3IYLW 3O41A 4QNPF 4CSZA 1HH9B 2WQVA 1IBZA 4JFXB 4XTRD 4GKZA 2JQAA 4LSQH 2FGWH 4U1LA 1B0IA 1XEUA 3QARA 1YLBB 1LYQA 4HUVA 4M62H 3FRPB 1T1YA 1OM3H 4FA7B 2AXWA 5F0PB 4R9HA 2Z8VC 4ZPVB 3KL0A 4NQDB 4HCFA 1JPEA 3GSOB 4CADB 1G87A 2XWRA 3FU7A 2NY5L 3SE8L 2P49B 1YEKH 2IAMB 1DVFD 4KDVA 3QIUD 2CALA 4HZLA 3RNQB 1QSEB 3GC3A 3T0ED 4B9ZA 4N24A 1UQSA 4JPSA 3U7YH 4QRTA 1NCWH 1FH5L 2BVEA 2FO1A 4BFOA 4PBDA 1DFBH 3LZNA 3MRDB 4MSWA 4PJDA 3CZKA 5L2JB 2DWXA 4OLZH 5GS2D 2OYLA 5IHUL 4YDJA 5FYJE 4K5NA 4MJIB 4BQBA 1F8TH 4U3CA 2BLFA 5I5JA 3FU3A 4HF5H 3Q6FB 2WMPB 4OQ1A 1CLZL 1ZD6A 3U82B 4HIXH 4NZJA 4CSTA 3DIFB 1TYRA 5IM7A 3BUYA 5D2LA 4QHUB 1T22B 5C0EA 5CHNA 3LKQB 2FT6A 3H85A 1X7SA 1E8YA 1A0QH 1C1EL 3AG3B 3MJ8B 3M45A 3ULUL 4OW6A 3BZEA 4J1UB 3QC6X 3BESR 4YAQA 5SX5K 1KXTB 1NSNH 1PEZA 2AQQA 1C9SA 4NIKB 3ATFA 3WHXB 3GMOB 4NBYB 4CGTA 1IKFH 2B1HL 3HFMH 4Z3JA 4HCRL 1X7QA 4O02A 3MCLH 2OMVB 3I75A 3UJIH 4ETYA 2XPYA 4A7GA 5C09B 2F61A 2A77H 2GIXA 1S8DB 4XTRC 2IQ9H 3I50H 3ARYA 3RUGE 2YD8A 5DEZA 1XR9A 3PQYB 4XP5H 5BO1H 1LM8V 3DJTA 4K15A 1XAUA 2VERA 5E5MB 4FERA 1JDCA 3WUWA 3DUHA 4UU9A 5DJDB 3IKKA 3EDFA 4YE4L 1HHHB 2ETWA 2P7TA 2FJGB 5HDOA 3FPYA 5HVFB 3L9RA 4JM4H 3VA6A 4GAJH 3A4AA 2ADJB 3WENA 1I53A 2WXPA 4WW2B 3TO4C 1RP8A 5F8RC 4PLNC 4ODTL 2V17H 3IGFA 4OVUA 1AJ7H 1DVXA 3KW8A 4CVZB 5KVGE 5DGRA 4MMXC 4ZBJA 1NOAA 1TZHB 5TPWL 1CB4A 1UXSA 1F18A 2Y2WA 4GP4B 1KCRH 1T4KA 3VMNA 1TMCB 4L4TE 4GBXB 4O02H 3N42B 5E2TL 3P4MB 3VD0A 5JR1H 1E6JH 4MMZA 3RVTC 3W39A 1GMEA 2PPEA 5GGQH 5DMGC 1AZVA 1JNHB 4TUJA 3CFBB 4Y9BA 3S97C 5EOTA 3X1GA 3H7BA 2E8ZA 5JXED 4OCRL 3REWB 4G6JL 4Z78B 4K7PX 4MJ6B 3U1QA 2VM4A 3HG1D 2GUOA 1WHOA 1D5ZA 2BZ7A 1J5CA 2DW5A 2PABA 1HNFA 3ZDYF 5CINH 4LEXL 1BYNA 1MPAH 1TDQA 1UXWA 2NY1B 3L3HB 2VLMD 2DQUL 1T7XA 3DPDA 2YQ2A 5FYKD 1R6VA 1CR9L 2Y3AA 1S7QA 2YUZA 4HJTA 2LW3A 2XTLA 4YFDB 4CC1A 5JXAL 4WWNA 3KJ4C 15C8L 1F4HA 3ZL1A 4AYFA 4A2DA 3CFJB 1T20B 2YWZA 1RU9L 2XVBA 5BV7L 3DDFA 2GTWB 2RGSA 3RI5K 5JQ6H 2WQXA 1OGAB 1N8OE 3U6RA 5ICYA 3FH8A 5FFLA 2JCCE 5HYSG 2VXVL 3QNYB 1TJXA 1A3LH 4QWWC 4Y1AA 2NX5B 4X4ZA 1J1PL 2YAFA 4RDQG 2R39A 2W0LA 4ODVL 35C8L 3ZQ9A 1INQB 4IGBD 1HU8A 1N5AB 3DVNB 1QTPA 1RIUH 3V7AE 4IGBA 2C8NA 2PYFA 3BISA 2EIZB 1BF5A 1X5FA 2VM9A 4OD3H 3UZVB 3BP4B 4NO5A 1N0XH 3KBPA 4MHHI 4MVBC 4DKEH 4E9XA 1NC4D 1E67A 1QTYT 4LKCA 5AQ0A 5F9JA 4HWUA 3ZUNC 4ELMF 2R4SH 3ZDXB 5EOCH 1EXUA 4ZQKA 4JFDE 2FD6L 4XOEA 3O6MH 4M1CC 4OZFG 4LLDB 4IIQC 5F97E 2CQVA 1V54B 3KLHD 1P9MA 1YYML 3I6LD 2NQ3A 1S7UB 3PWPA 5LBSH 3MRGB 5AZEH 2BY0A 3VWJC 2IPKA 4QRBA 4E9VA 4FLRA 3MRCA 1CR9H 4JM2B 5D7IB 1ID2A 4TN9A 5CJXA 5L9DL 3ZE2F 4TVUA 3GI8H 2A9MH 3RFRA 4DIXA 1GKEA 2NLJB 4Y2DD 3AU0A 2WM0A 5C07D 2CLVA 4ODHL 3VD5A 5IROD 3I6KB 2NX5D 3SGEI 3FQWB 4EEEA 4UINL 3RAJL 2ZCKL 3ATEA 4ZAKB 3CC5B 5FIEA 1A7NH 3C6LA 2WWOA 1A65A 2G75B 4NZTH 1OOAA 1CMOA 2ADJA 2XKNA 3HZKA 5KJ4A 3HRZA 4OR1A 5D7IA 3EYOA 4XP6L 5CFAA 2B77A 2FBOJ 1RK7A 3O2WH 1TLMA 1J0JA 4XCFH 5C7ZA 4C56A 4MWFA 2K6ZA 2APXA 5KANI 2IDCA 4LPYA 5DZOA 1JTTA 3VACA 2R29H 3UYPB 1AHKA 3DARA 4X6BB 2EDWA 5J1TC 5BW7A 4DKFL 4M6ML 1AD0B 4KX9A 1ZLDA 2OMYB 3PAYA 4JQVA 4ZNEA 1TVBA 3QFJD 2ZKHL 1C7TA 4JO4L 5B3NA 2VJ0A 3U2SB 1HXYA 2DD8H 4GKOA 1HKFA 4P4KD 4K9EC 4PJHB 3SGJA 1RMFL 4UYPA 4FQHA 4HPYH 5IQ9A 1IFGA 1KGCD 2ERJC 2H0JA 2NMSA 1RMFH 2Z93B 3UAJC 3T3PE 1WFTA 3MLXH 3S4SB 1JMZA 3T71A 1MCSA 2MTAA 5HYSB 1IB5A 3WCYA 4ONOA 4PS4H 4FQPA 1UKTA 4I85A 1WFJA 5DO2D 3BIKB 3V10A 3PUCA 3BN9D 3QNYA 3WKPA 4PJEB 1OEZW 3L6FB 4B0MB 3B1UA 4RISH 3B8SA 4QXTA 5AYUL 4PG9A 3VXSB 1WEJH 1NDMB 3FO9B 4WNJA 4PS7A 5JNYB 5EO0A 5HGAB 3SBWA 1RZ8A 1PJWA 3H9HA 4MJ2A 4PJGB 4JCLA 4Z7OF 2KI6A 1VEMA 4YDNA 1EXHA 5E6ZA 1G6VK 5KN5A 3CSYA 4YWGH 1A0QL 1C1EH 5C0RH 2GSIB 3FB8B 4Q4EA 3A67L 2OV0A 4IOSA 2NY3C 3OR6B 2PXYD 1IGTA 4X5WA 5I8EB 4UZUA 4BBWA 3SDDC 4J3WA 4PLKC 1KLGA 4P46D 1G4MA 1JERA 1LILA 1ZHKA 1XF4B 4GP8B 1JF6A 3UTTD 2B3RA 1TR7A 1JF1B 4P59H 1U3JA 2JKXA 3SBPA 1IE4A 1RLBA 3RURA 3C5XA 3OM3B 5I74C 4XN8A 2G2PA 5BNXD 5KVDL 3U6XS 4WSGA 2XRAL 4KKBC 4L8DB 5ANHA 5TDNB 2Y23A 3QQNA 1LNUB 2ZUTA 3AG4B 4EZJA 1RK0A 4MNHB 2WXMA 1MQKH 3K8MA 4YDKH 4OZHE 3U4EB 1GZHC 1KXVA 2P8PB 1UD3A 2WK2A 3KW7A 1BZ9B 4M3JA 3C09C 4ADJA 1OTUD 2G9KA 2VLRE 2JF1A 1JMXA 4U1SB 3L81A 4OI9A 3HNSH 4XXDA 4AQZA 3MTRA 4R4FL 4Q7DA 2ZUYA 2IGTA 3EYOB 5FO8B 3TN0B 43C9B 1I1AC 1EVUA 3T65A 3PYCA 2VABA 3EXLA 3HS9A 4PJCE 3MA9L 1EBAA 4QTFA 4TRPH 1J8KA 3BQUA 4N2KA 1IJ9A 3UC2A 4OM1L 5JHDA 1MNUL 3WTTA 4Z77A 4CBPA 4MD5B 3BZFA 4YLQT 3TZVC 3B2XA 3MA9H 3TZVD 1J88A 3S88H 4GFXA 3W0WD 4LEXH 1ZAGA 4LHUB 4XR8C 5EB9A 1WPCA 3C75A 1JG9A 1HEZA 3S4SA 5JMRA 1K5WA 1AGBB 32C2B 2RMNA 3M46A 4C54A 2FD6H 2IANB 4G6JH 4BZ1A 2XZAL 3L9BA 3APFA 3SKJL 4JHAL 2IWGA 1NCAL 2DQJL 3NABL 5KAQG 2VMEA 5DHXB 3HNSL 3RWDB 1T66D 5J6HB 4G8FB 1B3IA 1JYNA 1O75A 4GG6A 2D73A 3CGTA 1T6VN 1RIVL 5IFHL 5KG9A 1B0RA 1DZ0A 1MRFL 1TF4A 3WFHA 4PRIE 2F7QA 3B7TA 3TA3C 3OKNA 3A6CH 5E5UB 5D7EA 4E41E 5J1SC 2UUDH 4HUXA 5EIQA 4PJDB 4FG2A 4UM9A 3PNWB 3PGFL 3U4AA 1UCBL 3BAEL 4JM2F 4EUPB 4HC1A 3DHPA 2DQDH 4FG6C 1KPUB 4ZMVA 1Q94A 3G5YA 2YAQA 3MRLA 5JQ6L 3UXFA 2W94A 4Z3GA 3MUGB 4U0QB 3FU7B 1QFUL 3VXTA 5FYKL 1VFBB 3N91A 1MCRA 2X4TB 3P4LA 4LKXB 1KENH 1B6UA 2VM3A 1NGWB 1AKJD 1I8AA 3MRHA 5HI5D 4AG4H 4QTIL 2WCSA 3C8DA 1XIWB 3APDA 5JHDE 4EI5C 1FZMB 3LYRA 3ZDXF 3ZKMC 1TNNA 4XNYH 3PP4L 3H2PA 2LR4A 3SCMB 3LV3B 4WFGE 2EDBA 2GK2A 4BH8A 3VH8G 1EUTA 8FABA 5L2KA 3GLEA 1KFAH 1OW0A 4K71B 4MA8L 3Q48A 5GQBA 2CDGB 1MHPH 2CM6A 3FN9A 3I50L 3MYZA 4K5LA 4OSUL 2VDLL 2GC7C 1LE5A 5F2FA 2B1HH 2E9BA 1Z5LA 4Q2ZA 2VLRA 1OAXH 5EZIH 3MACH 2PPFA 4LLVB 2AEWA 2ARJQ 1BVKB 3ZHFA 1J5DA 3DV4A 4QRPD 1H8OA 3TCLA 5CCKH 1IGCL 1BEYH 2A7BA 1PG7W 5HSFA 3NFSH 2WC7A 1LNUA 2OMWA 4I1RA 4JS7A 1M56B 3E0GA 2GCYA 4FULA 4GQZA 4F7MA 4OCWL 5K9KA 4JR9L 1OVZA 4P2RA 3F5WB 1D6VL 5HYIA 3CSPA 5L6YH 4LLYA 4ONFH 2PETA 3I3BA 4PJCA 4P23C 2D9CA 4ODTH 1AANA 3B3IA 1R3JA 1IC5L 2VDNH 3KVQA 3ARED 4E9WA 2EC9T 4U1GB 3H7LA 1FCCA 2OSLB 5D1ZB 2HVJB 2MTPA 4J4PA 4JO1H 2BSSA 1DBKL 1Z7JA 3L3GB 5TDOA 2V8MA 5HJBA 3AAZB 4KHTL 1GXEA 5IVXB 3DVIA 5DYOA 3MJ9L 4XBEL 2CIKA 3FTXA 4PD4J 4OLZL 5EBMA 3ZDZF 1WZLA 3FU9A 4HWBA 1M05A 3JV4A 4QY8B 3IEAA 3BPLB 5DMIH 5E2VH 1BD2A 4AT6B 5D5MA 2P1YA 1IU1A 1QUNA 2AKRB 3RDTC 3R19A 4M9PA 4XCYB 4LL9A 5C1MB 3QJZA 2DICA 1BM3H 5FYJD 2NCMA 1HXMA 5E6UB 3OC5A 1AO7A 5DVKA 1SQ2N 4P3WA 4QRSA 2QZQA 3IBOA 1RZJC 4ECNA 4Z7AA 1OM3L 5DK3A 4P3DB 2X70A 2VLKD 4PJ7A 1IE5A 4JJ5B 2EDYA 3TVMA 1AR1B 2Y06L 4RWHA 3S0PA 4GKZB 3RAJH 3RRQA 4OZGB 2OR7A 1XGTB 1IBFA 1NJ9A 3QCTL 3E38A 4JCMA 5DFTA 1FYTD 4U1HA 3DDGA 3N43F 4ZXBC 4PWHA 2B39A 3SDAB 3L3IB 1IAOB 1S7TB 3CFEA 4BDVB 3SY0A 4NZRH 5CMAA 3GMMA 4W81A 3BLKA 3QXDA 4J3OC 4R7DA 4FQHB 1AOHA 3OKMB 2QFRA 4WNQB 5IBUB 1OGAD 4ZFFB 5DD1H 3O3BB 3U2SA 2QR0B 3E2HB 3ZRCC 2C9QA 2OLDA 5DK0B 1X5GA 3SGKA 2EDEA 4LU5H 1QEWB 4EIGB 4BZYA 3V6OA 1H9VA 1IO4C 5JIMA 4CVWA 3BSGA 4Y1AD 4QRTB 1X5YA 5CBEB 5AW1B 4DKEL 3MRHB 1F4YH 3OKKA 5LG1A 3FDWA 4QRUA 1CLYH 4GRLC 3ZDYE 5AVQB 3DLQR 1DBAH 3FO1A 3CQPA 3MRKB 4Q9QH 1SXBA 4J3BA 4WWKC 1GAFL 4Y16D 4EXPX 5IG7A 1T2QH 4TVSa 3GSWA 1VIWA 5EU4B 4WEBH 1INEL 3CHSA 1HTYA 2Z91B 4S2SB 5DLML 1MI5B 3WDIA 5T1DL 5C08D 3DX2A 1I8LC 1YYLL 3KDPB 5DZPA 3TN0D 4AWJC 2FT8A 1LLAA 3H9YA 2L7UA 3O6LH 3M8OL 3OKMA 3PDDA 5JW3H 1YUHB 3MRJA 3V5DA 1FNSL 3K6OA 3O3BA 1DDHA 1NCNA 1PKQE 4KGLA 4KUZH 4MDRA 4MXVF 1Z66A 3SDXA 3C09B 4OUUA 4K7PH 5HHPB 2AXHA 1V7ML 4DFHA 3TXAA 1XF4A 1EDQA 2HH0H 2ICWB 2R1YB 3DO3A 1ASPA 1YEWA 2ZJSH 4ZFZA 4M03A 1MPAL 2R51A 3BKYL 1AOZA 2YEZA 4BKSC 1Q0XL 4WI0A 3N1FC 4QI3A 5HI3D 3X14B 4XBMA 1T22A 2FWOB 1ZOXA 4H1LB 5E6ID 5EO1A 1QSFB 4FABH 3QEQA 4Z0XA 4GW1B 4LVOB 3DSNB 2HZHA 3S98A 4E5XB 4DZBB 1KCSL 3KWWB 1VCBC 3ATBA 3MODL 1FNEB 4HUWB 4OKVA 1N18A 1TVDA 1BQHG 5BRZD 2XWXA 3P73A 4CC4A 4D9QD 2IPTH 5HHXH 3NK4A 5EUOB 2WINA 5TE6H 2Y6SD 3KPPA 1GRWA 3G9AB 3RKDD 2ZAHA 3IU4L 3QQ9D 5FM5O 3VE0A 1EGJH 3OPZH 1XGQA 2YJQA 1UFUA 4H0IA 3V5HB 3JWOH 4FFZA 4WKXA 2F19L 3L4VA 4Y1AE 2BINA 4WCYL 4ZO8A 4G6FD 1LK2A 4M00A 2YD0A 1TENA 4P2OA 2BY3A 5AOJA 3IGAA 3ARQA 3MCKA 2F54D 2QHRL 4H20L 1M4KA 4GKNB 4JRXE 5AVWB 4OKDA 1S2EA 4GLRI 4X6CE 3PAZA 1UYWL 1I4FB 1QLFA 4PRDB 3SIKA 4ZPTB 1BVLB 2PCFA 2DBJA 4J2XA 2GABA 1GZQA 2P8MB 2QKIB 4IRJC 1MREH 4QGYA 4QRQB 1JNNH 3P73B 1QFWI 3M8OH 3ALPA 4X98A 4HLZH 1IEAB 1UXSB 3SE9L 3F7RA 1OM9A 5I66A 1Z2KA 2XKSA 3CK0L 4R7DB 2ZXAA 3IETB 4U1NB 1F41A 5HDQH 2OMXB 3W0WB 5IWLA 3I9AA 4RDQF 5CMAB 3VFOB 1TTFA 1CVRA 4YR6A 3ZR6A 3O41B 2CO7B 3U30B 2J8HA 4TUJB 4F1ZA 2YFOA 1J86A 1YEJH 2JJTA 3C5ZA 4L3FA 4LMQE 4PG2C 1T04B 3H2WA 4WKZB 3ZL4L 2HVBA 1YJDL 2ITCB 3BWUC 1QACA 1KACB 2VQ1A 2BSRB 4NENA 4NKMB 1AC6A 1L9OA 4PVBA 3HRZB 4DQOH 3GJFB 5BMFH 4PJBE 3SQOL 4QD2E 3GWJA 2KKQA 4Y5YB 1OSEA 3A4DA 5TDPB 2WLHA 3HI1A 1NDMA 3FO9A 3UTQA 2UZIH 1KJVB 4GT0A 3EH3B 5TE7L 1R0AL 5E94A 3ARWA 1VFBA 1G5GA 3VDCA 4E36A 1HX0A 1FI8C 4HULB 4LSTL 1CYWA 1UA7A 1SFHA 4UDUB 2NSQA 3GZOA 1KYOK 2E6JA 1RURH 1N5YH 2PO6A 4Z23A 1JTPA 2NYKA 4NCC2 4HFUL 1JYVA 2YXMA 4IIQA 1FG9C 5I8OL 2NDGA 3IF1B 3SGDH 1P1ZA 3C60A 3II3A 4P2QD 4ZK8A 1BAGA 1N70A 5LNEA 2F54E 2DBLL 4HJUA 3UROR 4AK1A 2DWDB 4HJGA 3T2OA 4L4TA 4Y2OA 4JM0A 1T5WA 2A4EA 5FDWB 3RI5F 1MFAL 5ABDE 1PSKL 3G9VA 3NESA 2ZKYA 5C0EB 3EH4B 1NTDA 3S5ZA 4PLJD 1F97A 1FJ1A 5IMKA 1Z9LA 3FPXA 2X4UA 2NZ9D 4KZCA 5ICZB 4FA6A 5EO1B 2PYFB 4IKKA 1MJ8H 3CVHH 1FG2B 1E4WL 2WQUA 3NGBC 5HDQL 2UWEE 4WI0B 4LCIH 1ZJAA 3PHOB 3PXHA 3BZEB 1MUJB 3FC8A 2P43B 4ZUUA 3DOSB 3TCLB 2WSPA 3D48R 2AV1B 4KNTA 1U42A 3L5XL 4XBEH 3N44F 4KKCC 1NCJA 4XMKH 1X4YA 4Q9BA 2ZUWA 4XMLH 4JFUA 4U1MB 3BE1L 4YHLH 4CU6A 4NFDA 4X9GA 1E65A 5AWNL 5JHDB 1JXGA 3K2IA 4Z77B 1QHPA 3S8GB 3D34A 4HKXA 3Q05A 4GRMB 4R8WL 4KO7A 4OD1H 1R0AH 5T3XD 2W9EL 1PW3A 5AW5B 3D3VD 4XVSH 1JZGA 3NN8A 1A7OL 2WWMC 3RHWK 1OGSA 2WVUA 1YDPA 2QSCL 2W1NA 3D25B 4ZW6A 1JGLL 4YBQD 4UAOB 3VQ1C 3EYVA 3PQYE 3OB8A 1BD2B 3JV5A 3LQZB 1VA9A 1JXDA 4DHLA 2ORBH 3G6JE 4PS3A 5BS0D 3B7SA 3QUZD 5BVJA 1GHFH 4UV4H 5F1NB 3ARFD 3C5ZB 4Z7NB 2QKSA 1Z32X 2C9PA 5H94B 1P7QD 2X6CA 4QPEA 2NY4D 4AJYV 3EOAB 5I1HL 3IJHB 3UTTE 1MI5D 1ORSA 1T3FB 2OMXA 3W0WA 2YD4A 3BT2H 2VJ8A 4OZIB 1HAWA 4POUB 1OTSD 4ZZKA 3VB9A 5I66B 2BFGA 3F6IA 1RPKA 4HIJB 4N2EA 5DQ9B 5BRPA 1TJMA 3TT3H 2R0KL 4H26A 4LOFA 5KVEE 4YSAA 3T09A 3ULUE 3BZDA 1RZGB 2H6PA 3EOYG 3UDWC 3A24A 2CKNA 4X9FA 3Q1EA 1DBBH 3HNTH 4WW1B 2WCPA 5B1CA 4E68A 3LXBA 2MMXA 2OX5A 2YPLE 3HZYB 1KULA 1AD9A 1QRNB 4OF0A 4AKQA 1Z9SB 2J55A 3BVVA 1SLWA 4CSSA 3WTWA 5F1NA 1NANI 2BNRB 2EDOA 2ZCZA 5FWRA 2JJVA 5GGTH 3WY1A 1MH5A 5T1DH 4F9LA 4RGNB 1IGIH 1WBZA 3ZHNA 1N6QL 2APBA 1INEH 3R7RA 1FA4A 3QORA 1L9NA 4L8SB 1ZVNA 3BUBA 1GGUA 4AQ1A 1B2WH 5HGGS 3EO0B 1J1XL 4Q9QL 4L3EE 1C5DB 2B1OA 2A3TA 4GRLA 3RX8A 4HT1H 3TJHC 3VD7A 3QXVA 3ZOAA 2Y2TA 3B9EA 4KKLD 3MLVH 1LMKA 4I0PA 2ZTBA 5ADPH 3DVGA 3MLRH 2OMWB 4ZNEE 4L4JA 3WAJA 4M8UA 4WF7A 5HD8D 3CDGA 4N4YB 3PDOB 5IB4A 1K4CA 4M5YH 2J8UE 5DD0H 4R84A 4F37F 4HOWA 5BS0E 3ZW3A 4F92B 4XNZB 1U92A 4D0CB 1OQOA 5C9JA 3MR9A 3QIWA 2JCCB 3T04D 4PSRA 5E4OA 5B7MA 3B2UD 3ULVF 3IXTA 1V7MH 2YRPA 3JVGA 3FUMA 1MUJA 4J6IA 2I85A 3GRWL 1N7ML 5I1LA 2JMRA 3Q1SH 4OUUB 3OZ9L 1NCCL 5IV2B 1FL5A 2X4PB 1FNGA 2C3XA 4XX5A 4NYLB 4L8DA 3SKNA 4AV5A 1HILA 3GHBH 3T2PA 2XFXB 3ZTNL 3VQLA 4G6AD 2XDHA 1VJSA 1WCBA 3ULUD 1LO3H 1OCWL 4GOSA 1Y0LB 3FBQA 3CX5J 5BVJB 1OE1A 4NQXA 4TULL 2CK0L 1M53A 1X5XA 1U3NA 4BKLB 1MRCH 5JW5B 2YPLD 4M4RA 1E8XA 4JN2A 4OV5A 3AGVA 2ZCHL 1U8OA 3HRPA 3QEUB 4BRJA 2J1WA 4UT9H 4WW2A 5L88H 1A9EB 2WSKA 3EUUA 2VQ4A 4FNRA 3QO1A 1MFAH 3VU1A 3RGVD 3O6KL 4XXCC 4ZAKA 2MQGA 4QXUL 1I7TB 3NCWA 1ZS8B 5F44A 5HYQA 4UM9D 4IJ3C 3UBGA 3SPIA 4DP8X 1Z3RA 1GYWA 2IH1A 3GLDA 5E99H 2MFNA 3R7QA 4DGIH 2OSYA 3KD4A 4HIIB 1TTAA 1U3ZA 3BEVA 3RPBA 1ACXA 2EVGA 5EC1B 3HUJF 2P26A 3DETC 4ZS6C 3AB0B 5DS2A 4Q6IB 1QSFE 3T8XA 3LRSB 5IHBA 1R9FA 2XQYA 1AGBA 1GMIA 32C2A 1GC1H 1MQ8A 2WSDA 1LEKA 4EDXB 3RU8L 5KSBB 4NWTH 4UILH 2Y69B 1M6OA 5HJGA 4RGND 3VXUB 4AJ0A 4Z5RB 1KOAA 1HWHB 2X6UA 2Y3NA 4L1LA 2C9RA 4WHYH 1H5BB 1G0YR 4TVPH 4Y1AB 5EZLA 1ZHKB 2EXYD 1JVLA 3HUJA 1YEHL 3IWVA 1OW0C 2GTWA 5DMIL 5E2VL 1KFAL 4MA8H 2IV8A 5LGJA 1KB9K 5FYLH 5HHOD 1U8QB 3P0VL 1QZ1A 4BFJA 3WY4A 3LRGA 3WNIA 4X4YA 3MLPA 5IW6B 1FORH 1K8DA 1RULH 3QHZH 4HZLB 2YOAA 3UEQA 4J8RA 4AG4L 3NCMA 3MLZL 1Z9OA 5E94B 3U4EA 2V3DA 3HFFA 5E4AA 2HAZA 1N6UA 1VRSA 3NAAL 3L4XA 4GO8A 5KYUA 4O2CA 2F8XC 1QAWA 3ABGA 4F2MA 4NHCL 3QEQB 4Z0XB 2PO6C 4P2OD 3UZQB 3VSUA 3K6SB 1VKXB 1OF2A 3PV6A 4D8PA 2V5YA 1OE3A 3LMJH 3BDXA 3HLAA 5JLZA 5LGHL 2B3IA 1Z9PA 6PCYA 2WGNB 4M7LT 2VXTL 4ZFZB 2E8YA 3BYTA 2FHBA 1E5YA 1FYTE 3HBPA 5HBBA 4P2AA 1QPXA 3B43A 5KOMC 2F58H 1HOEA 3PWNB 5I8EA 2ZOUA 4D8PB 3F00A 1BZOA 3LKOB 1UG9A 3OQ3B 3R1GH 2VDOB 4KK9C 1UACL 3KYMA 2O6PA 4NO3B 1J0ZA 2NR6D 4P4RA 2EYSB 4JPQA 4PRNA 4RGNE 1ERNA 1AI1H 3RVXC 1CDBA 5LLIC 1M71A 1SMDA 2J44A 3RUGA 3KMDA 4L5FH 1N0LB 5IW1B 3RDJA 1AIFA 1HE8A 1JZ2A 2O6DA 2OTWB 4YNYA 2B2XL 5KVGL 3CVDA 4O2CB 1EQWA 5DHYB 5J3HC 3VXRA 1PS3A 2G5UA 2Z35B 1I4FA 4ZTPL 1CFQA 5F0JB 3BXNB 3D50A 3FZUD 1GGIH 1KPVA 3QXUA 3QG7H 4Y5YC 4CJ0A 3P9WB 3QIBA 2KMWA 5A16B 4AMWA 1UD2A 2F68X 5EDSA 3DOHA 3X17A 3QEHB 1UEYA 4U1KB 3B2VH 4JKLA 2JI3A 4OV6F 3VXTB 2HFTA 4ZD3L 3O6LL 5E6YA 5FOBA 3ZE1F 3VXRB 1DBML 2MHAA 5TD4A 3KVDD 5GGUB 3I75B 3V4UH 3V5KA 2R59A 1HHIB 4M43L 3T4YA 4HJJL 4XNBA 1NC2D 1CI5A 3CZJA 5IGXH 3RL1A 3FSAA 2YAEA 4E9QA 1QW9A 4QCIB 4GG8B 4ZUVB 3FUNA 3GMMB 3X3FL 4KAQL 1P5UA 3RUGF 1T0OA 2ENSA 2QV2A 1IV8A 4FZEL 2FIRT 4MX7B 3V4VL 5ICXB 3VFRB 4CN4A 4KVCL 3VXUA 3JUYA 3M07A 2EXWC 2DEXX 4X4KA 5ECJE 2W07B 1UHVA 4L4TD 2VC2L 2H2PD 4TSBH 4C56E 3ZHDA 2F9BT 3FFCE 4Z7WB 3CVBA 4GMTH 1MJUL 4LCWB 3FTYA 2D7QA 4RESB 1H15B 1HI6A 3UOAB 4F2EA 2KPWA 3KBHE 3CFUA 2IANE 1G0XA 2I5YH 2QFPA 5AOKA 4GAFB 1B4JH 4J4PC 1GGIL 4ODWA 4I1PA 4Y16A 5J6SA 4XPFL 4XNZC 4JMXA 5K9OB 3WD5H 3QJSB 1JCVA 2ZKWA 3MJ7B 3ULVD 4OF3A 4MJIA 2YD1A 2IDFA 5CGMA 2Z91A 2CNZA 3QZOA 4LSVH 5E6SB 2ESVB 5GGSB 2G3MA 3NIGE 1T7ZA 2OJEB 3GLAA 2FGZA 3QZWG 4M8QB 3RDTA 4NRYB 4XPTH 5ACLA 3LHAA 2DIJA 1A7RL 1X5IA 2CHXA 3PWPE 2Y7NA 4QRUB 1EZVX 2IPUK 3S8FB 4PJEE 1AXTH 2YARA 3NVQA 5DYOB 3UTTB 4DGVL