5IHWA

The crystal structure of sdre from staphylococcus aureus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
314
structure length
314
Chain Sequence
NNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIAKGTFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVTVDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVDIAGSQVDDYGNIKLGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFGDINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of SdrE from staphylococcus aureus
rcsb
source organism Staphylococcus aureus (strain mssa476)
molecule tags Membrane protein
molecule keywords Serine-aspartate repeat-containing protein E
total genus 73
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ihwA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ihwA02
2F68X 2Y7NA 2VR3A 5CFAA 2RALA 4LE8A 3IS1X 4MBRA 4B5ZA 4LEBA 3IRZA 2Y7MA 4BBWA 4FJ6A 4F24A 3ASWA 1N67A 2Z1PA 2Y7LA 4F27A 2Y7OA 4MBOA 4B60A 3V10A 4F1ZA 3AU0A 2F6AA 3IS0X 4LEEA 4Q6KA 5IHWA 1R17A 1R19A 2YLHA 4JDZB 5CF3A 3AT0A 3IRPX 4JE0A 4RMBA 4JDZA 4F20A
chains in the Genus database with same CATH superfamily
5KBLA 4E36A 5FO2A 4EIBA 3EHBC 3IDNB 4F8TA 1GGYA 5D72L 4F7MB 2PNDA 3C5ZD 4OLUH 4FXKB 3ZOAA 1MCFA 2IDTA 3HAEH 3L3DA 4U6TA 3O11B 4AUJA 3VM7A 4EI6B 1ZSDA 2KT6A 2VR5A 1YEIL 4XAWL 1AXTH 4AYMC 3VI4E 2P28B 2F5BL 4HXBH 1I1AC 1LXMA 4KTEL 1O0VA 5KVGL 3VD5A 4KY2A 6PCYA 4AJVA 2Y69B 3U2SA 1S46A 3UEZA 2AEPH 4DN3H 5D7IA 1E4WH 3Q3GA 4XPFL 1KC5L 3KPPA 4UUJA 1G9EA 1CL7I 3LS4H 1IQWL 5T33L 1ZK5A 1FZOB 2EXYD 2G30A 3LIZL 3QUKB 2H1XA 3STBA 1ZHKA 1WCQA 1OT2A 4NFDA 1Q9KB 4JGMA 4M4PA 4PIBA 3B8YA 4CN1A 5F1IA 4UBDC 1PZCA 1CK0H 5L9DL 2NY6B 1J18A 3O6KL 2R23B 3DX7A 2VLJA 4JFPA 4M5YL 4HWUA 5EBGA 5C6TH 5ERWB 1QPKA 2G9KA 4FFVD 2YEVB 4RWYL 3S7GA 1KDJA 3MJGX 4ZO6A 3X13B 1DZ0A 1BQHG 1FC2D 3BSGA 4IMKC 1GY2A 4OM1L 2ITCA 2WZ0A 3BMVA 4Z7WF 5L8KB 1JUFA 2FX9H 1Q9OA 4Q6IA 4UU9B 2OMWA 2JJTA 4L48A 5ID1B 5FUZH 4AOFA 2VE6A 4LIQH 2A9BA 4TVPH 1A0QL 4H8WC 3OKOA 3WELA 3SGEH 2VN5A 2WN2A 4N22A 1K9TA 1H9VA 1QQDA 3MRRB 4QHNA 1UXMA 5A2FA 2VLRE 4ABVA 1OE3A 1QKZH 2V7NB 3LQZA 1UUNA 3I02A 5ANME 2H2SD 1FC1A 2A9ML 4OIIH 4XVJH 3B2UC 4HPOH 3VD2A 2ATKB 3RWGB 1YMMA 2EABA 4OM1H 3L5HA 1KSRA 2XN0A 4ZQKA 1IL1A 1F5WA 1S7RB 2WGXA 2YBRA 2JK5A 3IDXH 1FL3A 1HNFA 3UJJL 3MNMA 4OH2A 4AI7A 4HJ0C 5TF0A 2I9LB 2XPZA 3H3BC 2A74A 1J0HA 4U7KA 4OCWH 4A7TA 3SDCA 5CEYB 2Z31D 5LHDA 1K5WA 3JYCA 3OX8B 3CH8A 3N1GC 4LKCA 5SWQA 4AK2A 2IDFA 4M48H 2ICWA 1NBYA 3LRHA 4WDIB 5C0BA 4ELKB 5BZWB 1E9PB 4WUUA 4X6CA 3UZQB 4LMQE 1OF2B 1PCXA 3MR9B 4OGQC 4YDMA 5EF2A 3QWOB 1QP1A 1UENA 3F62A 1Z7JA 4GRWH 4JY5L 3D34A 5B39A 1Q9WA 5E1HB 3W39B 2NYYD 1LDPH 3R4RA 2NY3C 2CO1A 1YO4A 2R1XA 3ABGA 4MDJA 5G4NA 5CIPA 5HJ3B 1TDQA 3CVHL 5JQHC 2VL5B 4U1HA 4CKQA 4PJ5D 2DZEA 1PTZA 3P4MB 3ZYZA 4Y4KC 5A3ID 1CE1H 1O7DC 4HA1A 5GRJH 3DOSB 3H55A 5T3ZD 4X4YA 2XPGA 4Z3JA 2AERT 3IGAB 3V6FA 2FX9L 1PFOA 1M53A 5CGBA 2YK1H 4YHIA 2X28A 1L0PA 3CDYA 2HFGH 3TA3A 1Q8MA 3V4PL 1T89C 4JG1H 4HAGA 5ETUA 4YHZH 3QUML 1L0XA 1SLVA 3B9KA 2ZX9A 3AQXA 2OTPA 3IFLL 4QT5B 5EFIA 3FCUB 1U8NA 1AANA 5K93A 2VLJD 4UMSA 3JVGC 1U8KA 4JHZA 2EVGA 3VFVB 3WN6A 4HWBA 2AVFA 3IDIB 3HVDA 5F7YC 4RISL 1A7BA 1JWMB 4RNRB 5C08D 4ZMYA 3T2LA 1XH0A 3P2DA 1OM9A 3ATBA 4FFYH 5C9JA 4LPTA 4I3SL 2MQCA 3I50H 3ORJA 1GC1L 4PJFB 1JIBA 1DN0B 4FFYA 5H4YA 1A7OH 2YQ3A 4D3CL 3EJYD 1SLWA 3GGWA 3C12A 5EH1A 2Y36H 2IDQA 2WLYA 1I8IB 1YEFH 2LU4A 5I8OH 3BQVA 1B2YA 4GKSB 3SDYH 2VRKA 2FL5A 1T4KB 1C5DA 4JREB 2H5UA 4ALAH 3TCLB 4PGCB 2A0LD 2EDYA 2XN2A 1KTRL 2ZX6A 5BOPA 2PYFA 2GI0A 1L7IH 4OFYD 4QXTA 1X7TA 1PS3A 35C8L 3APFA 4UM9B 4L1DA 2MNUA 4X9IA 3EO0B 5B8CB 5ICYB 5GISH 5ES4B 3N40P 4YZWA 3RTQA 1LK3L 5G4OA 5IHWA 1R47A 1PZ2A 2R2BA 3M86A 3ZL1A 1CTNA 3FFCB 2BRRL 5I5JA 4XXDB 4K5LA 2VAAA 3KCWA 4ONGH 1BLIA 5L4MA 2UZYB 3PIQB 4YE0A 4AV0A 2DWEB 3ZTCC 4JBSA 5AVTB 4BKSC 1QEXA 4LQFL 1IBDA 4OGZA 3U7WH 4IOIA 4IMLB 3AUWB 3OWRA 1THAA 5DEZA 5DS8A 2GCYA 2NNXA 4M8VA 5CD5D 5K9KB 3VFRA 2Q6WB 3AAZA 4G6KH 4HLJA 1CYXA 4NRZB 3IMUA 2PW1B 1J87A 2V5RA 3W9EA 1ZDSA 4U6VH 3SDDA 2F53B 4YHOH 1HL5A 3EGDA 3K2IA 3O4OC 2EH8L 2YLHA 4OI7A 1ZV2A 1D5ZA 2EDQA 1MCLA 4PJ9D 1MIEL 2FYYB 4YDIL 4N0CD 1Q1PA 5DMJB 4AW7A 3NK3A 4DP8X 2CKBA 2E7BA 2WNXA 2YMXL 4L1BA 5I6XB 3RVWC 4PP2B 2E7CA 5DJZB 3ECQA 4E5XB 3KPTA 2GEQA 1BQHA 3GSOB 3DPBB 1BQSA 1N2RA 3L2NA 5FO7B 5C86A 5KSAA 3TO4C 3B2VL 4ZPVB 2ZX7A 1OCWH 2EYRB 2W92A 4G1EB 5C0RH 4WV1C 5IJDC 2CBOA 3PRZA 1YJDL 2F58L 2HFEB 1BG1A 1GL4B 2LFEA 4R7XA 3MPCA 3MYJB 4X7DC 2MOVA 2OMUA 5AZEL 4FXGB 4QRQB 1FBIH 2Q1EA 2EINB 4XVTL 4KKAD 4X0NA 3O45A 4RX4D 3HB3C 3N44B 1J0JA 2QDVA 5SX4I 2BVPA 4XC1L 5KVFE 1A1NB 4LP8A 5IIEA 2P8PA 4HH9B 1MAMH 5HVFB 2Z9TA 4Y5YC 5DMKB 1KYOK 1U3HA 4Z7QE 3K4AA 3WLWC 2F74B 2WN3A 4B27A 2YPVH 2RCSL 4C83B 4DF9A 2MOQA 2OI9B 1KJ2L 3Q13A 2YPLE 3CFEA 4Y19E 1YNKH 1WD8A 2K8QA 1RAMA 4YBHA 1KN4L 1I3GH 5I28A 3V8OA 2VDPB 3OHXA 5C09E 3FSOA 5FO7A 5C0AD 5ISZA 4PGDB 2IGFL 4JY4B 2LVCA 2ZJSH 3CC5A 4AIZA 1MG2C 2JTYA 3L5XH 5AB9A 5DZVA 2C9AA 4K55A 4NM4H 5HHXL 3QC6X 4NKMA 1AGBB 3ZSSA 4LVNB 1S7TB 1A2YB 4ZMXA 2FJGB 2BJML 5DR5H 1SY6A 3DXAA 3MRQA 4OGXL 1ECYA 5IFJB 4BFBD 3DX0A 4WU5B 2X1OA 1S7SA 5D1XB 4BDVA 4PU2A 2PW1A 3C87A 4KGJA 5BNXD 4LLWB 4WY7L 4TTGA 3LKNB 3FU0A 5GRVK 4NQDA 5IQ7H 1Z9OA 2JI2A 1JPFB 3DBXA 1HOCB 4J4PA 5JOEA 3HR6A 4MQTB 4WO0A 2XBZA 1DCLA 4UT7L 2XQYG 3RI5F 5ADPH 3ZKXB 2VDML 1P7KB 2EE0A 1CGYA 1CFTB 1QPXA 2VOTA 3EF4A 4FG6C 1F86A 4X4ME 4X99B 2EIMB 2OLDA 1G0YR 3S6CA 1S8DA 3P0VL 2EIKB 3NCJL 2P8LA 2LAAA 3LXAA 4OGXH 4TF4A 4A2GA 4WFGE 5AG9A 3VG9B 2ZPKL 1DJZA 1IFRA 2BWIA 4M6AA 4X99A 3FC8A 4N8VA 4G42A 1QRKA 2A99A 2QZ5A 4HUXA 3T0EC 2EDOA 3BWAB 3K8KA 3MMEA 1LEKB 2NPLX 1HEZA 2PR4L 2GT9A 2G60H 2NY4C 2Y1AA 1VADB 4HCGA 4Z3EA 3CHSA 1INDL 4Q58C 2W8CA 5CJOH 5F1OB 3ARBB 3L3HA 3L4YA 4FG0A 3T65A 4DEPB 2G2PA 3UDWC 1P7QA 1XCTA 3VSVA 3KM1A 5FAAA 1SQ2N 4HK3J 4PJBF 4Z6AT 1R3KB 2RCSH 4M6NL 4AWJC 4EZJA 3U6XA 2E8YA 3CFMA 3EUDA 5A16B 2R2HB 4XMPL 3X17A 4XAKD 3SKOB 5IW1B 4FZEL 2EKSB 5GGTL 2A3TA 4FKHA 4TTDD 1HHKB 2GSGB 3LN9A 2C3WA 2WCSA 1DCEA 1U33A 2XFXB 4RGNE 5FHAL 4F7PB 4N1HB 5CGYC 2C34A 2WO4A 2WXFA 4PRPD 1NMCC 5ADOH 3GIVB 2G3XA 4LCCA 5F0PB 3CZUB 5I9QC 1KBVA 3HG2A 2BOCA 3RKDD 4YSAA 3OKLB 3NQIA 4C56E 4TMPA 1FL6B 4Y16A 5GGUB 3DX2A 5HVWA 2ARJQ 4FLHA 4ZFQA 5ADOL 4NHUB 4H8HA 4TSCH 1J11A 4ORGA 3K2UL 1VACA 4F9LA 5IOPB 1UA6L 3CFDA 1P0SE 1F8TL 1I7ZB 1KXQA 1UGNA 4UTAA 4XNQB 3TT3L 1SN0A 4XE5B 5DD6A 1ZA6B 3P2BA 1KELL 3ZW3A 2WKOF 1QATA 3NIDE 1HJBC 4P2OB 1A6UH 4GRMB 4ELDA 1P5UA 4N2IA 3ZYJA 3L16A 3WIIL 4E9RA 1W15A 2OZNA 4PJGA 1SOKA 4F3FA 4JM0A 2FJFB 2DQFB 4BD4A 3I85A 5BVJB 1HOEA 1NJ9B 1U93B 4GKLA 2HN7A 4F57H 3CX5J 1KEGH 1I1CA 3DVGA 5F7DA 5DJAA 1LP9B 1D5ZB 4PLJC 2HWZH 2Z31A 5CZVL 2AJSH 2XA8L 1KELH 2VDQL 1XD0A 4EF3A 2BOCB 3HKZA 3WXWH 1JYVA 2E7LC 1B0RB 1FDLL 1LK3H 4JRYD 1VHPA 2XWZA 5D9SA 1MFMA 3CPLA 4PJXF 2YGVA 1QR1A 1GR7A 1SF3A 4AQEA 1K5NA 1F45A 3PWLA 5G2NA 4UANA 4IMLA 3E8VA 4UTBH 5IJBC 1P4BH 2C9SA 2XWTA 1AC6A 5KYYA 1PAMA 3FL7A 1OT4A 4PV8B 3QIBB 5A16A 2LLNA 1J5OL 2EILB 3UBFA 4G8GE 3WNKA 2XXCB 2G0LA 1IE4A 4JFXA 2HLFD 2VN6A 5CS7A 3T08A 1CXKA 5TGBB 1WBXA 1I7UA 2AJUL 4PYGA 4CSPA 4ZOAA 1SQMA 2R2BB 3ZHFA 5JR1L 2XG5B 4OJYA 2RH0A 4S0SD 3OAWA 1XB6A 3FO9A 3FO2B 2CE6A 5EO1A 4DGIL 1TVBA 4J4PD 3WHE1 4EKJA 1HC1A 2XQBH 3PCYA 1HHGB 3FONA 3RGVA 4XBGA 3RUGB 2NX5E 5EO1B 5HI3D 4ZW7A 3LZPA 1UH2A 3PP3H 2LHAA 1ND0A 2ODHA 4XRCA 3V7AE 3ULUC 2HZHA 2APWA 4QHMA 4J3UA 2FO4A 3X12A 4G7YL 3H9SE 3ULVD 3KWXA 3UPAA 2AKRB 3NCMA 4I2XA 2UXTA 3D39E 1PY4A 2ZP8A 4LHUB 4XZUB 5IG7A 1PCSA 4JHWL 3SDCC 4ETQA 2K9UA 4KKLD 4HD5A 4UB0L 4ISVA 4TNWF 1S7TA 3WCYA 5KSBA 2JKSA 2Z65C 5EDSA 3LNDA 1ZRUA 3HRPA 4FZ8H 3JQOB 4K9EH 2JB5L 3HUJB 5J57B 4XTRD 3G6DH 1URLA 2YAPA 3H9SB 1CGWA 2QVFB 2EDXA 1HHHA 4X5WA 2D31A 1ZANL 5B21A 1U8QA 1BYNA 4K9EC 1EEYB 3DX4A 2XZZA 4U6HA 3ZO9A 2F1EA 1I75A 2JSFA 3MV7B 1NKRA 1O6TA 2DQCH 5TQ2L 4UTBA 2B4CC 4YR6B 5AAWC 5HYSA 2BIHA 2M83A 3K6FA 4AG4L 1A6ZA 2XNAB 1ZANH 2G0KA 3Q1SH 4U6YA 5BVJA 2MCG1 2A6IB 4HSAC 3BEWA 4AH2B 5CJ5A 2GTWA 2VMDA 4LBAA 5E7BA 3PWPB 1U8IA 2DLGA 4S0HA 3C8HA 2VW7A 4L1HA 1KENL 2F1BA 2X6BA 3M1BA 4J7RA 3U1SH 3GMNA 1MHPL 4KITB 2UZXB 2GUYA 4JRXD 4X7EC 1AC0A 4XOBA 2R0LL 3OAZK 2BFGA 4JZOB 4QKXB 1OQOA 2IQAB 4GLRI 2DI8A 4OSUH 3UG4A 3TIDB 5CGYD 3RKPA 3O6FD 3BWZA 5KTEH 1NCAL 5EOCH 2NY2C 4YFLF 2A6IA 3O3BA 5F7HA 4GINA 3RVVD 1AZZC 5T3XE 2O6FA 5JNYA 4F2MB 1V3MA 3M1BB 4FNRA 3AY2A 5C0BE 1PSKL 4MJHA 1AG6A 5LNGA 2D9QB 4QRQA 1CR9H 1EEYA 3FBQA 5I8EA 1DJGA 3SZ6A 1IIIA 4I77L 3GYRA 4NZRL 4RGOH 5IWLA 3GXIA 1CXLA 3H6AA 5SWSA 4TSCL 2UWEA 4G8EA 5HGHB 3O3UN 5MEND 1J05A 4IKLA 1KXTB 4K3EH 1UM5L 4L4TD 2PCXA 1VF5C 3VXMD 1AOZA 2HLAB 3E8UL 1IRAY 1CDYA 3KL0A 3UP1A 4D9RD 1OM3H 3WLWD 2VDLB 3G5VB 2FIKA 5F0LB 1DDTA 4F15B 4PJ5B 3JV4A 1J8HD 1A1OA 4A7GF 1JG9A 1MUJA 2Y6SC 4Y5YA 2NTFA 4OD1L 4JUSA 5ILTL 5J3HC 4NI3A 4PSPA 3C09B 5GS1C 4U6XB 3VXPB 5KSBF 1U2HA 2BNQA 3ZR6A 2B3IA 3OG6B 5BXFB 1P5UC 1AGDA 2WQVA 3AY4C 2G3NA 3S8FB 1F00I 1JHKH 5DQDL 5F7LB 2QHRL 3BGFC 4AVHA 5JIQA 4S1DD 4AE0A 5CCGE 4AGQA 1OAUL 4XMWA 2YAHA 4YNYA 4N8VB 1BP3B 5EA0L 4BQBA 1IAIM 3HB3B 3MUHL 4OCYH 4IGBB 2VZTA 3TO4A 1Z9SA 4H1LH 4X98B 1IM9D 1L9TA 4P5TA 3VVWA 3MA7B 3ARGD 1S78C 5B7EA 4BZ2L 5I1DA 1O9WA 2LLLA 5KYWA 4PJBA 1KPRA 3T9WA 3EYSL 3ESOA 1YLBB 2V3FA 4L9LC 4NQDB 4X7TA 3WD5L 1AO7B 2JJSC 4OZHE 4GB9A 3QVAA 3K46A 2UUDK 2N7SA 4HX1B 4NEHB 1V05A 3WN5B 5C2UB 2GY7B 4HC1A 4PGJA 5GZOD 3B1TA 3DX6B 3B3IB 4LMQI 2CRIA 1S7UA 3O0LA 5IY5B 2Q3ZA 2JXMB 4U2ZA 2GBUA 1YEWA 2XG4A 5I76B 2F15A 4MD4A 4QCIB 4YVUA 2YAMA 1H3XA 2AAAA 3B5GA 4FXLA 3RDTC 4E9LA 1YY9D 2DEWX 2FAUA 3DUSB 2VLMD 4TQPA 4ICXA 3HRZA 2C4FU 2OA9A 3BEVA 5D1ZA 4GY4A 1WWWX 1HWHB 3GI9H 2G4GA 5J7CC 3AU1B 4MJIE 3MOBH 1E50A 3DURA 4KXBA 4KHTL 1HXYA 5I1CH 1T4WA 4FXGA 1KGWA 2H6UA 1YNTB 3TTYA 4BQ6A 3OJMB 2NW2A 5IM7A 3QWRA 2WLMA 4P2OA 1I9JL 3BQUD 2P24A 5I16A 5MENE 2FHCA 4HUWA 4NERA 5IIEB 1I1AD 5I0YA 4FTDA 2J8UE 3FT3B 4XX1G 4Y16B 5GGUA 1QFWM 3X3FL 5ICZB 3T0EB 4M43H 3MUJA 3WY1A 5L2KA 4M6ML 1YNTF 4W4OA 3S4SB 4U49A 2UYLA 2HJFA 3B8SA 4RBPH 4XNBA 4OZFH 1R46A 4QJ4B 4QI3A 4QTHA 4XBEH 2WBXA 1NBZA 3MV7A 5C0BD 2P5WA 5FYLL 1FAKT 1WA0X 3AADB 3VCLB 2W0LA 3G6JB 5J13B 2EYSB 3OJDB 3HNVH 4V11A 1JDAA 1TQSA 2HFGL 1LEIA 4FMKA 4C56A 2PWGA 4U05A 3RIAK 5HYJB 5DHXB 4HULB 5MHSE 3L3KA 3TJEH 1WAAA 5E2TH 1T1WA 4XVSL 3NCEB 2RACA 1TVHB 1BG9A 5DA4A 1HH9B 3I9IA 3VRJB 2W59A 4MVBD 4R8WH 3ZE1E 4WY7H 4JFZL 3LEYH 4MDIB 3TBVA 3PXJA 3SDXB 3HG5A 4PJCE 1Q72L 5AKVA 3WS3B 2ZUQB 1OPGL 3D9AH 5TQ0H 2V0AA 2UVEA 3TA3C 3F5WB 4R7VA 1UTDA 1I8MB 4PBVC 1HZHL 4P9HL 5FM5O 4XCCL 3QAZC 3QI9B 3BWUF 2CKBH 4KVCL 1RUQL 1XGTA 5AYUL 4H8UA 2QSQA 1G1CA 4G8GD 1PD1A 4N8CL 3GBNL 3IS0X 1YAIA 2BVOB 2DKSA 4QXTB 1LDPL 4ZNEA 3WTWA 4WHDA 5GSVA 1T3FB 4U0RB 1JJUA 5I73C 5DLML 2X3AA 5D5MB 3U0PA 2E46A 1KY7A 3KXFA 4DIXA 1F6AB 4K8RD 4ZW5A 4LB8A 5AWNH 2EVJA 3VD3A 4DFHA 1IAKB 1M6OA 2AXJA 1U42A 1YMMB 2WQWA 3MLVL 3ULAB 5TGBA 3ZKQD 5C07D 5GGSA 4HWNA 4C55A 1TENA 5B8CA 1AY1H 4HS6A 5I6OA 4OZFB 2F61A 3VRLF 1F11B 4JAMA 5JHDE 1BAWA 5AAPA 3BP7B 1YZZA 4WNJA 4JPVL 5E2VL 3QDGB 5I0VA 4ACPA 1VAHA 5IGXH 2CNZA 4GKSA 3WJLC 1YN7A 4KI5F 1S7XA 2AEQH 3BISA 4XMXA 5DVPA 4HPOL 4X6CE 2P48B 1A3RL 1QACA 5IVXA 2ATPB 1ZOXA 3I3EA 3FPXA 4GW1B 4DK5A 2PPDA 2NY1C 4LCUA 1UURA 2D03H 4LSTH 1QBML 3HKFA 3Q3GB 4XB7A 3FQWA 1ITBB 3CAFA 3CK0H 2IVFC 1MNUH 3PFUA 4YHMH 4NO0D 4LSVL 4AEFA 3BFOA 4HWEL 3HMWH 4LOFA 4X8XA 3MLZH 4ZO7A 5LVEA 5E6IC 4P46A 2WD0A 5E4AA 4NRXA 3BPNB 1YG9A 3HI1B 3VW3L 4J3OG 1WVZA 2Y0SA 4LOUD 5BS0B 1UA7A 1MCIA 4UUJB 5L2KD 1DBBL 2JJUA 3O2DL 5HI5D 4BZ1L 4BSWB 1HQRB 1OK0A 1T0MA 2H8PA 3ZE0F 4M7JH 2J1WA 2PO6C 1N64L 3QIBC 3U2SB 3IE9A 3IMBA 3V8CA 4JPKL 4MXVE 1G94A 1T1YA 3D39A 2X41A 2CRYA 2IAMC 5HJGA 4NM4L 1UZ6F 4QOKB 4RGND 1LE9B 1E9OA 4KJYA 2A9NL 3LRSB 1QI4A 25C8L 4NNXB 4S2SB 3OVUB 3TM6A 1BYPA 12E8H 4YSRA 1BYOA 1AYOA 5C1MB 1BOYA 3JZ7A 1JK9A 2F54A 3AB0C 4HIQA 3IJ9A 1WFTA 1UJTA 1KJ3H 3C6EA 3T2NL 4N20A 1F02I 4HGWA 4UDUA 2VAJA 4BBWA 2DWDA 1J1XH 2JH2A 5CGMA 4U1LB 3DROB 3EKCA 1HIMH 3KPLB 1UOLA 3S97C 3ZKNC 3DPBA 5I8KL 3FB5B 3EGDB 4GFTB 4O4YH 1XF3B 3ROLA 3QYMA 3OR7B 2XTLA 1P6FA 5LNDA 2WBJC 1F56A 1AGCA 4AIXA 4IGBA 4J3OH 2WP3T 1TUPA 1GXEA 5D6DC 3E6FA 2VM4A 4XPTH 4CC1A 2Y2TA 1W72H 4B9FA 3H56A 4I0PA 3QEQB 4J1UB 4FQHA 1RZKH 3FQUB 2VXUH 4IYKA 4S1RL 2CBPA 3RY6A 3SYQA 5K9OB 3WSQL 3O2VH 4G80B 4J6IA 3EDJA 43CAB 1QLRB 1NGZB 1ZT1B 1WICA 1H3PH 3EG9B 4DERA 3V0HA 3VXQA 3MFFA 4PRPE 2BNQB 4B9GA 4EDXA 1AHWA 3JWOH 3PUCA 1FJ1B 5FYKU 3II2A 2HUHA 3IKKA 4GBXC 1ZA3A 3JV4B 1FV1B 1FFRA 3I02B 4JKPH 4JFTA 4O58L 1N5AB 15C8H 1OCZB 1QWHA 2QSTA 2Q7NA 1S7WA 4XAKE 4JPWH 3ZQWA 2HFFB 1DBMH 1WBYA 2FNWA 4HF5H 4P9MH 1F4YH 2EDMA 1D6VL 1PLGL 3APNA 4CILA 3LKSA 2WQ8A 3BVUA 3KPLA 4RGNB 2CDFA 3KBHE 5HPMB 3BX7C 2OTUB 2A9NH 5MEPA 3OMIB 1LO5B 1T66D 3QUKA 4QUOA 3RIAF 2VMCA 2YSSB 2AQRA 3GMMB 5C7XH 4N1EA 1KIPA 3CVIL 3CGTA 3DYOA 2LABA 2Y1YA 4PRHE 5IFJA 3CSBA 3D0VA 4GG6B 4BA0A 3VUAA 1DUZB 4GQQA 4M7LT 5L2KB 2R23A 2IGLA 3RPBA 4R26L 1Y18B 2AQSA 3BLPX 4U0QB 1MJJB 4L4TE 2Y7QB 4OLEA 3ILDA 2GC4C 4FA7B 4TNVK 4PJXB 4NKOA 4TQIA 3M07A 3IXAA 5DRZA 4KJYB 4XBPA 2J8OA 1R0AL 5E8OB 1ZXKA 2HX9A 2QV2A 3CVHH 3LEXA 3EYQD 3SGJA 5EIQA 2VLLA 1KACB 1XCXA 2W38A 5JOPE 4QKTA 1HXYB 5AUMB 4XP9L 1TZHB 2WMPB 4JDEB 3RVXD 5FK9A 4PY8I 2F8XC 1KCSL 3TNMB 4UZSA 5CN1A 2ZSVB 1EZVY 3V2AR 1LWRA 2H1PH 1BAGA 3CUPA 3MFGB 5GQBA 4ANKA 1U8IB 4YHYC 1N8ZA 5A3IC 2KLTA 1JF1B 4V1DE 5IWLC 4NQCB 5KN5A 3CUPB 1TZOA 3KHQA 5ANHA 1B6DA 2JKLA 2XG4B 5I76A 4HBQA 4KRPD 1E4XH 3H53A 4LFHG 32C2B 2PPEA 3MV01 5CLWA 5BRPA 4NX0A 2R4SL 4N0YH 4XPGL 4AQ1C 4AXWA 1YMMD 1I9JH 4GW1A 3A4AA 4K7PH 1RJYB 2EQDA 2N56A 4FNLL 4QXUL 5KG9B 3V4PB 5IMLA 1A4BA 3TVMD 1MLCA 1NAKL 3QG6B 5INCA 2BHFA 4YFDB 4YMPA 1X5JA 4HK3N 3Q8EA 1XSKA 4Y4KB 5JPMA 3DECA 4B95C 3BH4A 4L05A 5DDHB 5HDBB 4DAGL 2BRRH 2P5EB 1UYWH 5IUSA 4XX5A 5DQJB 1OW0A 3IJEA 3UMNA 3NYKA 3QI9D 3LX9A 4HS6B 4TSBH 1AZUA 4KDWA 4I2XB 1E9QB 2VDRL 1BOGA 4P23D 5IFHH 4WI8A 1P4LA 2VQ1B 3IWVA 4KDTC 3WN5C 2BIOA 3EDFA 5BV7C 1LK2A 3FTWA 5FLUA 4OFKA 4X8JB 3K8LA 1CFSB 1BFVH 1NWPA 5K9KA 1SHWA 4TNVF 2CLRB 5E9DD 2J6EH 1HCYA 3FFCD 1Z3RA 2RHEA 3RDTB 3FUNA 5EZLB 1XAUA 5BO1L 4NJ9L 5EIVA 5FF6B 3K72A 5TFSL 1J9TA 4PTUB 3N55A 1I7UB 1E28A 2R8SL 5DURB 3MV9A 5A6MA 1X5XA 3DA0A 2V4LA 3GKZA 4HVBA 4NO2A 3QFDA 3FF8A 1GA2A 4PJ7F 4Y1TA 1CICC 5GS2H 2XZAH 3EOBA 5K59E 1N59B 2PCPA 3AS3A 3QJFA 3DLQR 1E7VA 1CDGA 1DP0A 3QH3A 2NYKA 4BHUA 2ZWZA 2XIBA 4FJ6A 5T3XL 5F3FA 4HGWB 4L1SA 3CDGA 2ESVA 1S5IH 2FD6H 3G5YA 1NWOA 3LSOA 2VLKA 5SWSE 3IDXL 3HC4H 4JB9H 1W6WA 3WLBB 3H42H 4PRNA 2X09A 5F8RC 4GBXD 4FNUA 2GIYA 1WTLA 3RIKA 4AMKL 1KTLA 2QFPA 1DN0A 4XXWC 3DVGB 3GI8L 5BOJA 2RFXA 4FDWA 3F7YB 3MBXL 2DDQL 4GUPB 1TQCB 1COBA 2UXGA 4OCMC 2KC0A 3ABMB 2V2XA 4C4KO 3HN8A 2OMBA 2KDGA 2J2ZB 3FQ1A 4NS0A 1J8SA 1QEWA 3PV6A 2TAAA 32C2A 1I82A 4JO1H 2ZXBA 1IGFH 2VSKB 5IESL 3UZEC 4CADB 2DTSA 1D5XA 4OFYA 3PHAA 3SDXF 1C5BL 3MROA 4N25A 4WTZA 1GHFL 2MHAB 4GKOA 1UOKA 5DHVB 2XQYA 4WFHE 3H4HA 5TE4H 2YXVA 1LYQA 1B0GA 3WTUA 3GMOA 4MRBA 4N3TA 1WBZA 4S10A 4XO4A 4ZUVA 1J9RA 3RX5A 3V4VH 4OZIE 1BMWA 3N85H 1FSKB 1DVFD 2HVKA 3EH3B 3IDNA 3QAZB 3LB6C 2D7PA 3PP4H 3OKLA 1YEGL 3BW9A 1JGDB 3C5JA 1D5XB 1LO4L 1DVYA 1NAMH 2R39A 5DWUH 3O11A 4ZI8A 1PZSA 4NIYE 3HI1A 2BWDA 5FM4A 1UFGA 5D1QE 5IBLC 1M7DA 5FS5A 3X3FH 1M7UA 1JPSH 1C7SA 3QNYA 3GMRB 3VFSA 1ED3A 3EXJA 2VTFA 3WNLA 3ZKSD 1D6EA 1QTSA 2ISDA 4AYBA 3FTSA 2MQGA 2QMKA 4G8FB 4UOZA 3TP4A 1IX2A 4H26B 3GSWA 2BVUA 2QLVB 1RZKL 5IB5A 3F12A 1RV6X 5D1ZD 4FULA 5E00A 2XTSA 2W0PA 2DLTA 1FG2A 3NIFB 2AJUH 3AMKA 1FH5H 1JPEA 4HJIA 5C2BL 4LBEA 3FUHA 3F58L 2XT1B 1QNIA 4CSTA 1J10A 1QW8A 4DFIA 3UTTE 1BFVL 1OF2A 2CO7A 4J6RL 5J1SC 4BFKA 1DQQA 2HTLC 3C08H 3F85A 3L9RB 1KB9K 2DWTA 3Q6FB 2DIBA 4NQVB 1UM4H 4NDMA 3EGXB 2AK4B 5GGSB 2IV8A 4FYSA 2OI9C 3TO2A 3MMEB 1MHHB 3Q5YA 2LGNA 3Q6GH 3WEXA 4P4RB 5TD4A 2FQFA 1WAEA 3DGCR 4K5PA 1DVSA 1ADQL 1R5WB 3P0YL 4U7SA 3GLDA 5ALCH 5C6TL 3F5WA 2OYMA 1XAKA 2E4TA 1QYGH 4NZUH 2J12B 4UQ3A 1GVIA 6FABH 1ZPLA 4AEEA 3S5LG 4XR8C 2HTKD 1JZ7A 2E27H 1A14L 2DW5A 3DHUA 2QEJA 3D87B 4G80A 3SYCA 4HF5L 4PN6A 3BOVA 4YZFE 1EO7A 1V8HA 4JN1H 4M5ZH 3OQ3B 3OKNB 4ELMA 5BQ7A 5HI5C 2EDKA 1MSPA 3CDCA 4K7FA 3KYKH 2CR6A 1U8MA 4DETA 4B6ZA 1PEZA 4ZS7H 1H5BB 5T1KA 3AWEA 2FLRT 3QK0A 2KH2B 3WL9A 4XH2A 2X1WL 4KXZH 1J8KA 2VXQL 4UBDD 3FT4A 3PG2A 5AALA 4TKWA 3LN4A 5D2LB 3DETD 4UOW1 4BXSV 1U2CA 3TBTB 1MDAA 3VB8A 3EYUL 3W3BA 1HH6B 1JZ5A 2VO5A 2BINA 1FRGL 3VW3H 3F7LA 3K0WA 1ZEAH 4FJYA 2DBJA 5IF0B 3LH2L 3UJTL 1GS8A 3AB0B 3MRNA 3G5ZB 1MZZA 4HUNB 5E94B 3OHXB 1X9UA 2D0HA 3QORB 4I0KA 4TTDC 4XO3A 1S7QB 2EDFA 2DH3A 3BMWA 5JXEA 1HXMA 4ZD3H 3IJ7A 4HIIB 5HVGB 5IQNA 4Y2DB 4H20H 5F97E 3S2CA 3GM0A 3KPRB 4S2SA 1PG7X 3EZ8A 4LGPB 1A3RH 1A6PA 2E9JA 2FCBA 5A2BA 5GS2D 2Z8RA 4HUUA 1P9MA 3IBOA 4NN6B 2W80C 3TEWA 5I19H 3MODL 5JHLL 1L6XA 2DLIA 4PG2A 4MQ7B 4KAQH 2EIDA 2XA8H 4KFMA 4M3HA 3QEHA 3BCFA 3T0EE 1KCUH 1PJWA 3P3SA 5GJTL 4HCRH 1OLLA 1ODUA 3KXFE 5JXAL 4M8QA 5I1KH 1T6BX 3EJRA 2JB5H 5I6KA 3KPRE 1GY1A 4RH4A 4OI8A 2FT6A 1U91B 1QUNB 3MUGA 4X6FB 5I66A 2LW3A 1FIGH 2X2UA 1E65A 5JHBA 4BXVA 4YR6A 1ZDQA 3FXIC 3TV3H 5J9PA 3F01A 3TTSA 5IEHB 1WWCA 4ES9A 5BMFL 3DYMA 3O9WC 3QR2A 5C0JB 1E4XL 3ZQXA 3OZLA 2IF7A 4PGEB 5CU9A 4LCYB 1EERB 4JRLA 5J11C 3C2SA 2CGZA 4KRMB 3DO3A 1CLZL 3KLQA 2AGJL 4PRNB 3MRIA 2NQDA 3QPQC 4JHUA 4PS8A 1EZVX 1UB6A 1WISA 2ZPKH 2EDTA 4LASH 2UY6A 3GSNH 1JWSB 4KK5C 2JLLA 3MBEB 1N6QH 4ZS6D 2HAZA 2QTEA 3S34H 4QRRA 4BFRA 4XP9H 5KVGE 2DLHA 2YEZB 1Z2KA 3W9EB 4F7KA 1T22B 3GPEA 5I75B 4JFZH 2Z4QA 2OZ4A 4QHMB 2NT1A 4C4KT 1MEXH 4OZFA 1S9WA 2VZUA 1PX8A 2ZD0A 4LSTL 2Q5BA 3FFCE 4X6DF 4BUQA 1KIUB 3EJQA 3VYPA 3E8UH 2DMBA 5HGGS 5AYTA 1MRDH 4Z76B 4FQIL 4CC0A 1IGTA 3OKKA 5JOPD 1P4BL 4LLMA 2O5YL 3WFCH 4I8DA 4XXDA 4QEGA 4CVXB 3HR5B 5TDOA 1L6PA 4PV8A 2NTFB 1IV8A 4L2LA 1IQDA 1ULVA 1NCCH 2EDRA 2TRYA 3HZKA 3GS4A 1KIUA 5TDNA 2XICA 3NIFF 1M57B 5IR1B 4GAGL 4HSQA 3EW3B 5F1SA 3BZ5A 3CHRA 5E6IA 2YPLA 1UWGL 4LHUG 3S4SG 1Q94A 3T1FB 4E2OA 5JTWA 3HI6H 1OP5K 2YRPA 2L7UA 3NGBB 1BAFL 3TCLA 5EBMA 5LJYH 1OQXA 1P4LB 2VQ1A 1CIDA 2BO0A 3QXWA 4LSQH 4K2UH 5DK0B 1UC6A 3DK0A 4MA1C 2D7QA 4N3UA 5B39G 4AGOA 4WNQA 5LGHH 4XHQA 4ODXB 3OKDA 3QQNA 1W72A 3SE4C 3VGDA 4CN4A 4JY4A 5MERB 3FQTB 4NCC1 2VDKB 3RGHA 1RJZA 2COQA 1EHXA 1F8TH 3JV6B 2V37A 3IKCB 2IAMD 3HE7A 1U93A 4H88L 4LNVA 5EZIH 2YO3A 3HNTL 1T7XA 3V55A 1BVNP 1SXAA 4GPVA 4FFZL 4NPKA 3GHEL 4XI5C 1PJ9A 4Z7UE 1P84J 4NXSA 1BBDL 5EUOF 5K1JA 1UD2A 4JLRB 4Z7UA 4EO5A 3QJZA 3U25A 4POZD 2UZXA 2E7MA 3K74B 3KYOB 3KDMB 3QQDA 1EAQA 1MFVA 3HHRB 3P4NA 4YXLH 4F2MA 2C3VB 3BUDA 4KRNA 1UD6A 2BMKA 4F2ME 3NJIA 1T1XB 1MCQA 3SDAD 1BJMA 4KKRA 2I85A 3VI3B 1WV7T 4YK4C 1KBPA 3TGXA 2XNAA 2BSED 2YD1A 1PPIA 2EDWA 3BD5A 3NVQA 3QG7H 2VM9A 2VLRB 4ZUTA 5FYJU 5B1CA 3E80A 4JDEA 4LCWA 4G9FA 4HZLA 5DVKA 4NT6A 1J1OH 3QNXB 3KXFD 3KL5A 1RIUH 4GEIA 2EAEA 2V5SA 1GW0A 2LR4A 4GRLC 4Y4HC 4LEOB 4UT9H 3TV3L 2EKSA 3HRZB 2WM0A 1UWXH 1JDDA 2BY0A 2FX7L 2CHXA 4M93C 4XC3H 4F7PA 4JFDE 5H94B 3SPCA 3CVHA 4JFDA 1W6LA 3QW9A 4J28A 4P5KB 4NKIL 3FQYA 1Q0YH 4X5PA 1XZ0A 3U9UA 3B5TA 1H3VA 5F9OL 3QHFH 1SVZA 4Z7VE 1KEMH 1UCTA 2DJSA 2EUVA 4HX1A 2IAND 2C1PA 4EI5D 2RJMA 5DUPL 3H85A 1H5BA 4LEXH 2HJKA 4M29A 3WGUB 4DCQB 3MLPA 1MCKA 5IHZB 3BUQA 3C6LB 2YA2A 5GZNA 3VD1A 4YPJA 2OMZA 4BFFA 1QFWH 2AF2A 4GXFA 4NKQB 1J5DA 3AU0A 5KSVB 2WCGA 4DOHE 5IB2B 3GJFH 2D9CA 3C6LD 4CKVX 1JHLH 4Y9BA 4M6OH 4YL9A 2X88A 3D7PA 5FYKH 4UCFA 2V8MA 4M5SA 1DQDH 4DQOH 1IC5L 4JCMA 5FR3A 5F7WC 1X6LA 3EFFA 4O2CB 1OWRM 3A23A 5FECB 3MSPA 1JBJA 2DI9A 3TIEB 3TYFA 4NDMB 3SQBA 5EDXA 43C9B 4TUKH 4ODTL 3P11L 4XN7A 1VJSA 3A4EA 2ILLA 4HHAB 5DHDA 2QGEA 3SQBB 1JZ6A 1HHJB 1OSZA 3SBPA 1WHPA 3S88L 1DQLH 1JCVA 2DQHL 4NXKA 5C0AB 2CDEA 3KLAA 4JFHE 3O6ML 3QIUA 1Q9OB 3RHWF 1AJ7L 2JIXD 4KMQA 5J56B 4WHTA 8FABA 4WENB 1F90L 2BP8A 4PTTB 1INDH 5CJOL 2X6CA 1NTDA 1ZE3C 4Z7NB 1UADC 2SODB 4L3EB 3ZE2F 3BKCL 4Q4EA 1XL4A 4Y2NA 3VWJD 3GMLB 3NSYA 5D6CB 1RP9A 3QO1A 2H32B 5SWZD 2PXYC 2FO8A 4G1MA 2DLFL 1VGKB 1ZSHA 1XGQB 2FNBA 4IBSA 1G0DA 3V0EA 5MI0C 2NY1D 4PCSA 1KBGH 1XTMA 5D7JC 4UMGA 2X42A 3MV8E 4MJ6B 4U1NB 2PW2A 2WLLA 4KTGA 1MIMH 4Z7NE 1H6TA 3FUFA 4L3EE 2VRQA 4S1DC 4DK6A 3GSRB 4QT5A 2LU3A 1A6TB 4LFHD 2ED8A 1QTPA 2HX7A 2J1KA 1VLXA 1A9EB 2EADA 1ZK9A 2VDNL 3MCLH 3VA2C 2X4PB 4PRBB 4X80L 3H9HA 3QJXA 4Z8FL 4FABH 2ZG2A 1E8XA 1VACB 1XWVA 5J8OA 3FB8B 5M94B 1IARB 3APCA 2CD0A 3PJLA 4L5FH 4LVHC 4TL4A 5DHMC 4CVUA 4LSPH 5C0RL 4OBRA 1HTYA 1OF0A 5B1KA 2Y07H 3ZDYE 3EFOA 2XWJA 5DD0L 1A4CA 5T1JA 5KW9L 1EUUA 4GMTL 3QDHA 1A3ZA 1CL7L 4GG6F 5BS0A 3V0JA 2A2QT 3NQKA 3NP4A 4OVUA 5D7LA 2VR3A 2UY7A 5CMAB 5DC4B 4WFHD 5KOVC 2VL5A 4U1HB 3FDWA 1ETB1 1K85A 2IQ9L 4M6MH 3S3DB 3DVNB 1AR1D 3AITA 4G6MH 4UT9L 2IADA 1T1ZB 2K70A 2H3NB 3MRPA 4IK6A 1HHKA 2E7LA 3UBXA 2P5EE 1WSST 3C5ZA 5E9DE 5C8JA 3N04A 2AJZA 5GZND 2WLNA 1J1OL 1HSBA 3AS2A 2VWEE 3N5AA 1FIGL 5J4MA 3GC3A 5CINL 3QFJB 4L8BA 3HAEA 2IH1A 4P06A 3A0OA 5CM1A 3AG4B 1UM4L 2O6PA 3AXLA 3CFQA 1DBJH 3PNRB 2E56A 4TOYL 4QYAA 4NRZA 1KNOB 1QBLH 2N01B 2JE8A 4LIQL 4Y4FD 4WEUD 2WJ5A 3GBLA 3JWNH 5SWSD 5JDJA 1XBRA 4UV4H 1OHZA 4PJAE 3OKDB 1KWGA 2GK0B 3VJ6A 5ABAA 4OV5B 1E8YA 4LCWD 2K1MA 1M6OB 1TEFA 5IVNA 1WS7A 2KERA 1P5VA 3RUGE 4IRJC 1QWUA 4U1JB 3ZU8A 1YMME 3TFKD 3WXWL 2R1WB 4Y16C 4TULL 3U0PB 3AREB 2KZBA 4GSXA 1N9PA 3L4TA 4GQ9L 1U92B 4XMVA 4Z76A 2N7BA 3EJTA 3IRZA 4JFEB 1JTPA 3RTQB 4LCCC 2WVVB 1SMDA 4IBTA 4OZGE 4POUB 5F93C 2VR6A 1ZPUA 4MS8D 3VFUB 4V1DD 1BOGB 5INDA 4GRWE 1VZHA 2ITEA 3ZMEA 4U6VL 1DQLL 2CDGB 1EO5A 1T4KA 3P73A 3S3SA 1XGZA 4PJFA 1OAKL 2BX5A 1JWSA 4Y2LA 4UQIM 5G4MA 2VLJB 2EDHA 3BT2L 1RMFL 1MWOA 3VYNA 4L8CA 2AW2A 5K1VA 5GHWL 3WBDA 1G43A 1JWMA 1MCOH 4YHLL 3OR6B 2OR7A 4IHOB 4Z95L 4BFEA 1TQVA 5I1IL 4WTXA 1KCUL 3O9WD 5DZJA 3FRPB 3IYLW 4K8RH 1FZOA 5C09B 2P44B 3VXSD 6FABL 5CJBA 1AI1L 3ZSTA 2CGRH 4AXWB 2EVFA 4R7LA 4ZNCD 5EEWA 5J11B 3L1OH 5CILL 4NT6B 1KT2A 1GZHA 2XTJC 4PJ8B 1GPOH 4MXQD 5IV2B 3KEDA 3D0AA 2XTJE 1H6EA 2XFGB 4ZAKD 4PRHA 1U91A 3MUGB 2IJ0C 1KOAA 3X2QB 5F44A 2WLHA 4U0RC 1PD6A 5I73B 1I3VA 1A9BB 2RQ8A 5DUPH 1QVOB 4LNRB 4ZPTA 2BIPA 4DGVH 2FWOB 3WTVA 2C3VA 2A5UA 2AJVH 1FAIH 3MJ9A 1MREL 1XMEB 5C0JA 1FL5B 3O3BB 1HAUA 3PLYA 3D85A 1ZA6A 4H2AA 2N59A 7FABH 4ZQTA 2ZKHL 4JZJA 4GUQA 5DJ2B 4ZAKA 3LIZH 2GK2A 4EDWL 2VDOL 1UB5A 2BMKB 3OSKA 4LLYA 5FYJH 1PLAA 1T80A 4RMBA 1TEYA 5B3JF 1E4WL 2BXZA 2ZOWA 2WWKO 1A1NA 3AG3B 1HWGB 1MY7A 2BNRA 2IPTL 3KM2A 4OCXH 4ZPVA 3V52H 3CIQA 4JHBA 1RIUL 4R7DB 5F1NB 5F7MC 2CR3A 1PZAA 3JVFC 3CG8A 5C0CB 4L29B 3WTYA 1K8IB 4B3EA 5BRZB 3GDBA 3R0NA 4JFYA 3MYJA 2R1XB 3WAKA 2DQEL 4LLDB 1NCAH 4G9DB 3T8XB 4P3DB 4V2BA 5TE6H 3IMSA 4PJDF 2EECA 4WJ5B 5I0ZA 1RPKA 4MAYC 3W37A 1TKWB 2BZ7A 3FUDA 2VDPL 4G1EA 1OP5H 1A3QA 4KY1L 4M6OL 5ESAA 3RX8A 4E9TA 3EOBB 5T3XD 3B56A 2OJEB 4YSQA 4PQXA 4O5LH 2X6MA 4F2EA 3BRDA 1UWEL 5E56A 3V4VA 2HRPH 1CN4A 4TUJB 2R2HA 4LSPL 2WXKA 3U46A 4F7EA 5BRZE 4AV5A 4WWKB 2QMJA 4GSDL 4YDLC 2BS8A 3UL4A 3SGJC 1J1PL 3ASWA 3VFGH 5KUKA 1FE8H 4UI2A 3UTSB 1S3KL 3ULUF 2EEDA 2WLJA 4JRXE 3V4LA 3TESA 2OW6A 1CFQB 5CEZH 1JZEA 2I07B 4YIQA 5GGTA 1E0OB 2ZT9C 1XCTB 2X05A 5ID0B 1MAJA 1MCEA 4N8VG 4BK8A 3FUJA 2DD8H 5C0ND 2Z1KA 4TOYH 3EJPA 5T1KB 4TRPH 1HQ4A 4PI0A 1ZLDA 4XMPH 3I74A 2ZWNA 1L7TH 4KNTA 1MPAL 1AQKH 3FTGB 1NAKH 3G6DL 4M7LH 2XRAH 5BQ7B 2VE6B 5DT1L 3Q8FA 5D7HA 3SO5A 1CVRA 4MXWH 2O6CA 5AVYB 1V7MH 4PRIA 3ZTEA 5CWSB 3O6FC 4ZMAT 2OMYA 4JCLA 2BSRA 3A47A 4UM9D 2XV6B 3QS2A 5KBMA 4MMYA 5HXMA 2NSMA 4ZS7L 2Y2YA 3FCTB 1TJXA 3FO1B 4I5BA 2DJUA 1WP6A 3QUYB 4F1SA 5JMRA 3MGOA 4ATTA 4HIPA 1NCGA 2FIKB 3I2CH 4TQEL 2EICA 1HOCA 4YSTA 5MEOB 4QHLB 5GS0D 1PZDA 3D18A 2WSPA 1S7VB 1MQKH 4OCWL 1BX2A 2XACC 5D7IE 1P7HL 1BXUA 2FSEA 4MB4A 1RZ7L 2BIIA 3CLEH 3SBWC 4UINL 4HCRA 3U30C 2FL5B 4PG9A 1NC4A 1ADQH 3P0YH 4GG8B 3RZCD 1ECZA 1RSYA 3LHPL 2OMXA 2I5YL 4L5FL 5J9PB 3X14B 2B16A 2I27N 4BWUA 3L3OB 1QSEA 3K2UH 5FO9B 6TAAA 1WAAE 1VKXA 4PVBA 5EG6C 5C0FA 2R29A 4RSYA 4JFUA 1OK8A 4H88H 3WTSA 4H8WL 4M1DL 3ARDC 5DJ0A 2GBAA 1FI8C 2BDNL 1X7QA 3UDWA 3TNMA 5DFTA 1F41A 3FHQA 2DQFA 1BQLL 4HV8B 5DMGD 3FUMA 4N26A 4QXGL 4GBXB 3C6LC 4GQRA 3JZYA 4TVSa 3NA4A 3ASOB 1G9NH 2X9XA 3L13A 4NQED 4X5LA 4A6YL 1KWKA 3EYFA 5HYIA 1P7QD 2CU9A 1FNSH 1IGML 4L8DA 1RIHL 5KWYC 5GXBB 4DESA 1MCPH 1ADWA 1MJ8H 1NC2B 5CZVH 5D7EA 1NDTA 2V2XB 5IOPA 5TH2B 1YPZF 3FQXB 5EC1A 25C8H 5C0GB 2WV3A 1QFPA 4JFQA 2KPWA 2G9HA 2B4CL 2OR9H 2WQUA 3RHWK 4L3CA 3X14A 3OJ2C 1ZTMA 5DMYA 3DRQA 1YEDA 3W39A 5FGSA 1T6WA 4MLIA 2ZUSA 4HPHA 1Z9MA 5JHDA 4NO0A 2C3GA 4YXKH 4MX7B 1EEZA 3H9SD 3ULVE 3ABZA 5E94A 3CDGB 5IB3B 3NEXA 2VXUL 3QDGA 4GO9A 1WD9A 5BW7A 1CG9B 1U8MB 1ADQA 1GHFH 1RK0A 1ZLSH 1SVCP 4HXAL 1EJFA 3HZVB 3QSKB 2ZWYA 4DKAA 1PIFA 1E3FA 1PKOA 2A4ZA 4FQXA 5CEXB 3ZX1A 1MLBA 4QXVA 1BV8A 1T5XA 1SRDA 4P2QB 1G6RA 4GW5A 3TC9A 3MLWH 3BRGC 2J8HA 2XIDA 3FO0L 1XF5B 3U9PH 5E08H 5D1QC 1A8JH 1BEYL 3GHEH 5JIIA 1S9VA 1OOWA 2OPCA 1GYAA 1TVDA 5TTRA 1AR1C 2JKWA 4JZNB 1LHZA 3SE6A 3T4YA 5DO2C 2X7LB 4P04A 5DSCA 3TWCL 5HD8D 3QRGL 1MI5A 4LSUH 3FSVA 2VAAB 2WZPA 1U8JA 3TPUB 2HTKC 3OXSB 2ZICA 5HHVH 2GAZA 1WZAA 4P4KB 2D8KA 4MKTA 1AY1L 4X83A 3U36B 3KYMA 3P3YA 5EN2A 2IANE 4G7VH 5B1BB 3BN9D 5I0XA 2F6AA 3BP4A 1XR9A 2BVQA 3GUTB 1E67A 2CAKA 3BESR 3IETA 4LCVA 4R96B 1D6VH 5EC2A 3UYRL 1ESOA 4TUJA 2BH0A 2X4UA 3BP6B 1NLDH 1PW3A 2P1YA 4HJJL 1NMBL 5DRWB 2FDBP 3MRDB 4U4BA 5C0NC 1XL6A 3KW7A 3LEVL 4ABQA 4AIOA 3PWNB 3LS5L 4QTFA 5TFSH 1T7VA 1G1KA 3LRKA 4PY7A 5I19L 2WAQA 1ZHKB 3TYGL 5JIPA 1AQHA 3KLDA 3V4PA 4JM2A 5FCUH 5F96L 2HX8A 3HG1E 3O2WL 5BV7B 2WVTA 5HDQL 3U4AA 2E9BA 5HDOA 2ZF8A 5DJYA 3O41B 5H4ZA 4CRPA 1XZWA 2B77A 2JQAA 4L29A 4HWEH 3SEPA 5DDHA 4Z7AA 4ONHA 4F92B 1SLXA 1B0GB 3RVTC 4JQIL 4PVNA 5ISZB 2AEOA 3CZLA 3RFZC 3C6SB 4A55A 1SDYA 1KLFA 4O2EA 1RXLA 1ZCRA 4G43A 4WW2A 1JGDA 1YJDH 3L45A 2ZUYA 1XIWD 2BP0B 2N3JA 2Y9RT 1HINH 3D3VA 3PWUA 3WHXA 4OD2B 2ENPA 3CPUA 4F7MA 1K3IA 5EIIA 5IQ9B 3US0A 2NYZA 3EYOA 5GJSL 4AZ8A 4UT6A 2APSA 5L6YL 1JTOA 3VGEA 3O3DB 4TNFA 5T1MA 3VNYA 5D1QA 1UEYA 5F6HI 4QLWA 3MCKB 4NUPA 4IMKA 4YDKL 4MNGE 3MJ8B 2EH8H 2BVPB 4MQ7A 4U1IB 3RDJA 4O2FA 3TN0A 3WGVB 4FXKA 5IV2A 4DO4A 2CKNA 4JLRA 3NFPA 4E41D 1A7PH 3LV3A 4PJ8D 3MHZA 3ZUNC 1FG9C 2WO2B 3L81A 4OD3H 3M6DA 4NHCH 4ADGA 4YHPA 3AACA 4G7VL 2PABA 3J07A 4IU3A 4MBOA 2IXQB 3GSUA 3PGCB 1X5HA 4N8CH 1A7RH 3HEIB 1TQCC 3AG1B 2XV0A 3RKDC 2JI1A 2FGWL 1QRNB 4BUGA 4RCAA 3TJHD 3L9YA 4BWTA 5ITFB 4ESKA 2MNWA 4NB7A 3ARZA 1PBYA 2ITDA 5E4IA 2LE9A 3MGOB 3PV7A 3HS9A 1OAJA 2GB2A 3D52A 2YPLD 1V54B 1QSVA 4EKXA 5J1TC 5HGBB 2X70A 4EN3A 1EJ8A 2N0MA 3C9NA 1LWHA 1W72L 2XC8A 2OSXA 1T2XA 4POYA 1HWWA 4YSEA 2VR7A 3FT2A 3RA7H 4J2QA 4DP0X 1CLOH 3V0WL 3T3PF 4DK3A 3QWQB 4K3DH 3HC0A 3Q2CA 5HHQB 1NSNH 4P5TD 5AOKA 2XVGA 2AQTA 3E0GA 3UPRA 1G9MH 4CBZA 5AAMA 2W60B 4WKZA 1MQKL 4URTB 3BWAA 1P5VB 1D5BA 1MIEH 3P2TA 3NOIA 4R4FL 3WNMA 2Q87A 2Y5TB 1JNNH 4HKXA 4LL9A 4M43L 4YLCA 4IIQC 4J8RB 1NMBH 1VA9A 4G6FD 4KXDA 3ROLB 3MX0A 4HGKC 4C57C 1RZFH 1CLYH 1P1ZA 1QAWA 2AITA 2YD4A 1R5IB 2J71A 3E6FB 3RFRA 3NDZE 3GSVA 4UTAH 5ECJE 4GOSA 4AQ8A 4LZKA 4XP5L 5EO0A 4A2EA 3SYAA 5EBWA 3PDDA 4WU5A 1QFOA 5F9JA 2HJFB 4Z3IA 2OSLB 2WNKA 3CFTA 3ETSA 3OQRA 3VX1A 1N12A 1P4IH 4N2EA 1A6AA 1UB6B 1AGBA 4MA7L 2CJUL 2PP7A 4PUBH 2KS0A 2NY5H 4D8PB 1IM3A 1U8HA 5GRXG 3W38A 2P24B 4NGHH 4UAOB 5I16B 5TH2A 4FYQA 1N68A 5F3BB 5D7LB 1XBDA 3RL2B 1JNLL 5B1AB 1C12A 1J9QA 3TEXA 4RWYH 4RVBA 3WO4C 4MQXC 3LV3B 4K23H 4BE6A 1O6SA 2X53A 5AUMA 4WUUD 4RGMC 2WUCL 3UC2A 1P4IL 2TSBA 4WWKC 3TZVC 2P5ED 2VJXA 5F7FA 2WO3B 1UOWA 4YSPA 1L0YA 2EDBA 1QVOA 4W9LC 4X4MA 4ZPTB 4PJCB 3DUSA 3FNKA 1QSFB 1RJCA 2VKWA 4LLUA 2XBTA 2QPDB 1QASA 2EEXA 4JO5A 4OZGA 3H9HB 2FZ3B 1G84A 3CQFA 4LHJB 4HUVB 1B6UA 5IB1B 1Y07A 1A6TA 1ORQA 2ARJB 1NFKA 3VI3F 5KJ7E 5FYJL 2Z91A 3GD1C 2W0FB 5D5ME 5FGCE 5HYQB 2H26B 1U30A 2YD8A 4WW1A 3ULSA 2WQRA 1YEEH 2R7EA 4FL4C 4KGLA 4NQCD 1XGQA 4D8PA 4ANVA 2AEIT 4NQSA 4W9FC 4PJBB 3SQOH 1EBPA 3P4MA 3Q5TA 3QNFA 2ESVE 1WE5A 1R1CA 3FTXA 3K3QA 4JKKA 4N0RA 3TT1H 1S5HA 3GHBL 2HG5B 3BP7A 5DJYB 2H9GB 3QDAA 4L3ED 4DGWC 2VO8A 2DJMA 2FYYA 1XR9B 1MWAB 2BVQB 3HE6A 4Y2DC 1GGUA 2YK1L 3MACL 5ILTH 4WHTB 4ECNA 4JDZB 3EO1A 1L7TL 2VDQB 1U2YA 4HUKB 4GW4B 4CC4C 1R3LB 1AD9B 4NO5A 3KJ4B 5BW7C 3W81A 1GOFA 4X0KB 5B3SB 3MLZL 1KTBA 1K72A 5IROC 4N0CC 1G7MB 2HKAA 1CYGA 2ESVB 2DM2A 4RFEB 3EBIA 4MA7H 4ATWA 5LGYA 2LAGB 4LLQA 4G7QB 3VFGL 3X1BA 3LDBC 1EAJA 1T5WB 2ADIB 4KV5F 4A7GA 1L6ZA 4JZJC 1XR8B 4MD5B 2D3LA 5FW8A 3D39D 3V6BR 3IAPA 4A7VA 1EZUA 1PKQE 1RJLA 2V3EA 4WUKL 5CJQL 3WDIA 1XF4B 1KCBA 2YZ1A 4M7KH 4AMKH 1XB8A 3BCDA 1A1OB 1AHWB 3ARDD 2R51A 2IDSA 2PETA 3W9DA 1EEUA 4MVBC 4JY5H 3E6HA 4KOCA 5E2VH 1RZ7H 1AS7A 1EGJL 2QDWA 2R15A 2F19L 2P80D 2JKXA 2YJLA 4G6FB 4JW3A 3HZMB 1QLFB 4K94C 4BZ2H 4JFOB 5FW7A 1RK0B 5ECGA 2WXHA 1EANA 2DQJH 1JF6A 1Q4NX 1O5DT 4KQ3H 4Z0BH 1B0RA 5KUMA 3ARDA 1RUAH 3EUUA 4FA8A 2RGSA 1BLNB 4WVRA 1JK9B 4ZMWA 2CZNA 1Y1UA 5DT1H 4QDGA 1T1ZA 2IADB 3MRPB 2OYKA 4YJZL 3LRSA 2NXYC 3KLLA 3ETTA 3MLYL 4ODWB 4PRAB 3RWEB 5C9JB 2K4WA 3AQYA 4CA4A 3V0IA 4F93B 1HYSC 1ED3B 1QI3A 4LESA 1W91A 5JPNA 2NQ3A 1ZHNA 4W9KC 1ZGLM 1A9VA 2GC7C 4UNIA 1J1PH 1QNZL 2DMKA 2W0FA 3GMNB 1TLKA 4JFQB 1SGKA 4MNQB 5KANI 5SV3A 4OZIB 2V7HA 3WKQA 2D4FA 4A2HA 4RAVB 4DZBA 3K0YA 4BH7B 4IRSA 4ZXBB 4AZ8B 4Y5XC 4GQPH 1CD0A 3LMJH 1Z66A 2GYSA 2FR4A 2Y7LA 4NQCA 5F2FA 2HJLA 5D1QB 2OTWB 3FULA 1XXFC 3M8OH 3IFPA 3FCBA 4XBEL 5TE6L 4E42B 2R9HD 1KCRL 5CUSL 3EYSH 4H0IA 3O8XC 4H13C 2VW4A 3D48R 5AD0B 3DSNB 3VXOA 2VXSL 4KKCC 1GYUA 1MHEB 4LCIH 3WFBL 5GZOC 3S96A 5CCHE 3SKNB 2CH8A 2BP0A 2V9TA 4PLKD 1SXSA 4DN3L 1J0IA 3PHOA 4JANB 1JFQL 1FFPA 4HW6A 3E9UA 1KFAL 3DGGB 5GPRA 1KLFB 2X1QA 1K4CB 4IK7A 4KROD 2LT9A 2BSSB 3IDUA 2RFXB 1TPXC 4GUPA 4Q9QH 2BP8B 1MCRA 3CZFB 4C56D 4ETQB 3MLTB 2GQHA 1DQDL 3CH1B 2GJ6B 4MD4B 4OUUB 4QCIA 4DQOL 2UX6A 4XPTL 4BE5A 5GGQH 3PP3K 1LDSA 1K6QL 4DKFL 3LIZA 3HFMH 3L7EA 5B39B 2WXRA 2AV1A 3IVKB 4LVOB 2R56H 2FBJH 2E7HA 4B9CA 3TA4D 4FFVC 5IROA 2ICWB 3DIDA 1GIGH 4I85A 4MFHA 4M8UA 3W56A 1DEDA 4NZJA 3RE0A 5D1ZI 3ARFC 1BQUA 2ZF9A 2WYTA 3J27A 5T5FA 2FEJA 2IH3A 2KUTA 5BV7L 3EFFB 4O2CA 3GLEA 1HAWA 3BI9X 3NJNA 5C3TA 1KGXA 2FLMA 1GOHA 3SE8L 4WEBL 2YR3A 4DP1X 3FRPG 1CGXA 4GRLB 2OX5B 4PD4J 5J3HD 1MH5A 4AKPA 5JA9A 3SDXA 2OMVB 1NLDL 1OANA 4MDIA 3UBHA 9CGTA 1JTTA 1BZ9B 3RFZB 4XP5H 4P23A 4PPTA 4Z3TA 3LRMA 4M6NH 2YUZA 5GHWH 3QI9A 5E5UB 4A2DA 43CAA 2QPSA 4DVBA 5IQMA 5D2NB 4PCTA 5JW5A 3WS6A 1OGPA 4PBDA 4H8VA 4JCWA 1FYTB 3HHSB 3OJDA 4IDLA 4QRRB 1N64H 4N6RB 4F37K 5CR1A 1SBSH 5GGRA 2ZKXA 1MJ7L 1JYWA 4HG4K 1BD2E 1JNNL 1NC4D 3HHMA 3M17A 3MRLA 4UIMB 4UF7C 4WFED 5CP3H 4M1CD 3DOIA 3WNNA 3T8XA 1PYWB 4WWKA 4M00A 2ROYA 5FX3A 4W4NA 4UM8B 5I15H 5IT2L 2FHBA 4BH8A 2IDCA 4MASA 1DN2A 2CMRH 4TUOB 1AE6L 1P53A 1T0NB 2DLEA 1BD2B 1ZV9A 2KBGA 2Y1ZA 4KXZI 5KBPA 4HKJB 3ARGA 3BFWA 4HYTB 2ZWKA 3QIWB 4JN2A 3HZYB 3SGDI 4YHNA 1NKGA 1B2WL 3MRJA 4D0CA 5DC9B 2ZUTA 3DBSA 1UHVA 4PW3A 1SMAA 4HQQH 5J6SA 3KG5A 3QULB 2GHZA 4JG0H 4QGTA 5DRNA 1QSFA 4LLUB 4NN7B 3KH3A 4N6QA 4TNWK 4ENEC 1UGKA 3GS7A 3BJ91 1ZWIA 4NN5C 3BGMB 4GXUN 3REWA 4JJ5B 3CD4A 3ZDZE 4ZUWB 2FX7H 2KZKA 2J43A 1YA5A 4LDOB 4RMUA 2CUAA 3HE6C 4Y2DA 4PJ8A 1MFBH 1JCKA 3QJHB 3B6SB 3NJHA 3FF7A 1DJYA 4X7FC 3NJMA 2HRGA 1J8HA 4F7TB 2WP3O 3DX8A 4G6ML 4RX4A 2PLTA 3U0WL 4LNRA 4MAUL 5DRZB 4LSDA 2ZCHH 2ZYIA 3WEOA 4FG4A 1LEGA 2F18A 1DLHB 1GGBL 2J72A 3ARVA 3BHBA 5GGVL 3JSSA 2R1YB 1EXUA 2HA1A 5DS1A 4OVVA 3RWJB 2IPKA 1R3KA 3C75A 3CWGA 2XDHA 4CSSA 3HG1A 1H19A 5BVPL 4N2CA 3P0VH 4J12A 4LO9A 4IBQA 1NC4B 1I7RB 4WHYG 1KIPB 2F53E 1DVTA 3NCWA 4A2MA 3NRFA 1KUMA 1SMOA 1VEOA 3LZOA 4F9PA 2A73B 3L3JB 5I71C 2VC2B 2BNRD 3OKMB 3N43B 1ES0A 3MZTA 1LEKA 4KHXH 3HMXL 3FONB 4ZW6A 3QC5X 3N91A 4LSRH 3QXDB 4K3EL 5DUMH 3S34L 4WZ9A 1KLGB 4QRUA 5FKPA 1OPOA 2GSIA 1A4KA 3I6GB 5FO8B 1E5CA 1XF1A 2DIEA 4Q8BA 3L5WA 1RPUA 1TTCA 5DFWH 3KJ6H 5D96B 4AENA 4F15C 1F3DJ 4PJ7B 4I1NB 3HNSH 4M3KB 1TSHA 4MJIA 3N40F 3U2IA 4Z7WB 5D5MA 1YEJL 2GJZA 3VQMA 3TBSB 4HS8H 1DFBH 4P9HC 4IS6A 4QIRA 1TZGL 2EDLA 3NTCL 2LU5A 1XCQA 3QDME 4HPYH 4XZ4A 2YAEA 5E7FA 3PS6A 2Q2EB 2Y06L 3FOMB 3H3PL 1D5IH 5I30L 1MXDA 4JQVA 5KTEL 2WXQA 2YA0A 5L7XL 3UGXA 4JFXB 2W9LA 3ARFD 1KIQA 1T5KA 5DQDH 2YD3A 4GQZA 5HVHC 1F13A 2F8OA 3WXVL 1SYSB 3FU8A 4TRPL 4CUCA 5CEXA 1KPUA 1XO8A 2WUBH 3U82B 2EEFA 5D7JA 3IM1A 5IHBA 5LUMA 4NRYB 1RVFL 1MKFA 4ZJ9A 1XQ4A 4GKNA 4DP6X 1F6FB 2E3VA 1R5VB 4FL4B 3ECWA 1LEIB 1OSPH 1SJXA 1HZHH 4P9HH 1M2OA 5FDWA 3ZL4L 2AMGA 2ZYSA 3I9AA 4ZW3A 4DQAA 3HC3L 3HMWL 5C0CA 1OCWL 4QRSB 5TQ2H 2L4OA 1AP2B 2HVKB 1XGPB 4K7PX 1Q1JL 3AT9A 3NSXA 3QEGH 4DP4X 1RZIA 3HFML 4NWTH 5D1XC 1ZEAL 5HP5A 1ZT4B 1OB1B 2DL9A 4BH7A 2HB0A 3W0WB 1ZGLB 1NCWL 2WWKT 4JE0A 4AH2A 4A67A 1RVFH 1H0DA 3OC5A 3BC9A 4ZYKB 3KMDA 5D55A 3UJIL 4WEEA 1A3LL 3QUGA 3GSNB 4HHGA 3PQYD 4N24A 1PVHA 4JY6B 3DDFA 3HNVL 1CZ8L 4JQXC 4XP6H 5AL8A 3QUHA 4AMWA 4OJAA 3LDBB 5JPNB 3HG1D 3IMWA 4JZJB 2EJ1A 1AH1A 4WHCA 2X3BA 2EEAA 3PWPA 5KSAB 3TCTA 3EDDA 3AZUA 5K9QG 1GCFA 2EKJA 1NCIA 4XNZB 2HMIC 3WENA 4LAJH 1VGKA 3ZZ1A 3TPKA 2XY1A 4KPHH 4OSUL 4MSWB 4MA8L 1JHTA 3EJZD 1A6UL 1SJVA 1FO0H 2B5IC 3SY0B 3UYPA 2APVA 1FH2A 5T1LD 1WO2A 2XN9B 5T3ZE 3LNEA 3ARBC 1OTTC 3NACH 3SE9L 3PGFL 4LAQH 1YNLH 4ZUSA 3JTBA 4KZEL 3U6RA 3V79C 1X5MA 1T83A 1S9YA 3QUXA 3X3GL 3WNPA 5FYJD 1NBYB 3ZTJH 1ZMYA 1JRHI 1S7XB 2B1AL 4K7FB 2QPUA 6CGTA 4LSSL 5DK2B 1LILA 1PNCA 3D5OF 1D3CA 3EJYC 2BFVL 2CA4A 5EU3B 4PTTA 3SGDH 1BIIB 3Q44A 4LARL 1RU9L 5MEOA 4GP5B 3R7QA 4XPHH 3IFNH 5L8LB 2GT9B 2CLVB 4G8GA 4LSSH 1C7TA 1S9KC 1IL1B 2A7BA 4XVSH 3ULVC 2P5PA 2VXTH 1KY6A 3G6AA 1CURA 2UZIH 3VI4A 4R0LC 4MD0B 4HJEA 4RWHA 5I9QB 2D73A 1UWEH 4RQQA 5J6GB 1YY9C 4GS7C 5ALBL 1ONQB 3F7KA 4Q6KA 3EAKA 5IP4A 1KFAH 4UB0H 3L9RA 4UINH 3ZZSA 1IU1A 1P9MC 5EU3A 1HSAA 1N4XL 4FQXD 4LVEA 4IIZA 5MHSD 1QA9B 1I7TA 2MJWA 4I7ZC 1IEHA 2E7DA 4U3SB 3ZLQC 1GGIL 4MJ5A 4JM2C 4FQCH 1SBSL 2V9UA 2ADGB 4GSUA 4R97C 2GJ6A 5DD1L 2P8LB 4PJHF 2C7UB 3D8MA 1R3HA 5AW6B 1VZGA 3BD3A 4KMTL 4H26A 1TCRA 1WPCA 3L7EB 4KTYA 5EMYA 2P5EA 4P2OC 3JWNG 1HL4A 1E4KC 2W07B 3MDJA 4MMXB 3CVBA 1X5FA 4TQ8A 5ALBH 1URIA 4FS0A 4QLRA 3SCMD 5A7EA 2PWHA 2HKFL 3MV8B 2QKIC 3HIZA 1JSYA 2HN7B 4WSGA 3SOBL 5HYJA 3V6ZB 1TJGH 2ZXAA 4RIRB 3RL1A 4OIIL 1VERA 2OL3H 4FFTA 4PRDA 1ZTXL 3QFJA 4L8BB 4JG0L 1IGFL 1ZLUH 1ORSA 3HBGA 2AXHA 5TK4A 3PABA 1U6AL 1AR2A 2AJZB 1G7QB 4NPYB 4OF8A 3SGEI 1SBBA 4IBVA 3JUYA 4LLDA 5I1EL 2EIEA 5ETUB 5F7DB 1EXUB 5AZEH 4OQ1A 5GS0H 5H94A 5DFVD 3S9DB 2JELH 2NLJA 1T04A 2W5PA 4JQVC 4JS7A 2XA3A 1HYRC 2WWMC 3S35X 4M4RB 3VH8B 1T2QL 4TL5A 4OB5L 1J0ZA 3VGFA 4G3YL 3GMQA 1CBVL 3RJQB 3B9VA 3QHFL 3QFJD 3UG5A 1YYLH 3EFOB 2GTZB 2VZVA 3N42F 2WZ6A 3O8XD 5T5NG 3BSZL 3MRJB 4D0CB 3NPZB 4C59B 3HZ3A 2YMXH 3V0AC 3Q06A 3PV6B 1ILSA 4JGNA 4OZIA 1M9WA 3OG4B 1E27B 2IQ9H 1QSED 4HBCL 1U41A 7PAZA 3STLA 5HDLA 3RZWA 4EOWH 3DPDA 3KGUA 1BD2A 1BZQK 4XPFH 3RZCA 2VYRE 4MDJB 4XNXL 1UT2A 3QORA 4OF6A 2RA1A 3K6DA 3BAIA 3A3YB 2J6EA 2W88A 5GRVL 4PRBA 5EA0H 3STZA 3L3OC 5LCVL 3KZ8A 1KCRH 1KJMB 3ESUF 1TMCB 5D7SL 4HKJA 3GSRA 4JHAL 5DK0A 3RWFA 2B20A 3AY4A 4NRYA 1M71B 5MEPB 4ZFOL 4P5SA 1NFIB 1TETL 3SDDB 3GK8H 4Y1AB 3UO1H 1DBKH 1MG3C 1SEBA 3F6IA 1WZMA 2UWEE 3LNIA 1A4JB 4X7TB 3FU5A 2F7IA 3QEUB 1J8RA 3GLZA 4OW6A 4PRHD 3HZKB 2PCFA 2FVNA 3VX0A 5SX4H 5DVOA 1QPPA 1YECL 3QA3A 4ELMF 1LNUA 2P3YA 2Y3NA 3RBSA 2LTQB 4BZ2A 5ABDE 1R3HB 4GXUM 5FO8A 4KQ0A 1NL0L 4H4NA 1OIOA 4PJEE 3VGAB 1UM5H 4EEEA 3W9DB 2IANB 3O9WA 2BNQD 4WI5A 5INDB 2RAMA 1NANH 2AXFA 2EUWA 2G5RA 4U1GC 1XGUA 5LLIC 4WTZG 1IKNC 4BIKA 3QIWC 2OJZH 4P3CH 5JIHA 4D9RE 3NAAH 1AKJD 1I9EA 3OKMA 2AQ2A 2IFFH 4XE0A 5C08B 3DTDA 4WJKB 4Z9KB 3ESVF 2JCCF 4QY8A 1EZLA 1KULA 4HALA 3II1A 1TZIA 1WWAX 3QXDA 1JPGB 4U1MA 3HE7D 3PF2A 4NN7C 1OSYA 3BVXA 1DSFH 2EH7H 3HG1B 4V1DA 4ZSOB 3Q8AA 1AAJA 2W81C 3MRIB 4EZLA 1X5KA 1QR4A 3S2AA 4EOWL 5EU7C 2DJ4A 3HE6B 2NY2B 3DI3B 1KNOA 1A14H 3AMLA 5B22A 4ODBD 1IE5A 5G5DA 5KG9A 3SDAB 4DPBX 3LNHA 5TE7H 1CFNA 5D4HA 2J20A 1TKWA 3M88A 4NP4L 5FGBC 3ALPA 4P2RD 2MCMA 4JFFA 3AM8C 1SVBA 1DLFL 2IGTA 3TN0B 1N0LA 3NFSH 5BRZA 2R0KL 1MDTA 4Q9RH 5T5NF 1KBKA 5A2CA 4JO1L 5IW3A 4E41B 3U4BH 1NCBL 4AK1A 4I0CC 4JRXA 3GWJA 4XBMA 1T1YB 4AQOA 5E4EC 5IFAL 4LLYB 1N6QL 3AWGA 2X2HA 1R3JA 2QKIA 1EH9A 3L2MA 3I75B 3BDYH 1JAEA 3S35H 4K9EL 3PXHA 1GC1H 3OGCA 1JWUB 5F21B 5HHNA 3K1KC 5DRXA 3PGFH 4LAQL 4X6BA 1OP3H 3C09C 5DRNB 1FORH 4GH7B 4DGYH 4L3AA 4Y89A 1RUPL 4QF1A 4UQEA 4MMZA 3ARTA 2WXIA 2D7TL 1T1XA 3OD3A 3BEWB 3U79A 5HYEA 5KS9F 2CR0A 1KGCD 4PP1D 2YQ2A 5D96C 5T33H 1NFAA 1CGSH 3WNOA 4ICWA 2N1TE 2A4EA 2FTAA 5IVXB 2YC1A 1TJMA 2YOAA 3GJEA 3WJJA 1BXAA 2K3HA 2NW3B 3VQLA 4FI8A 2DQTH 2E9GA 3IK2A 2VXVL 4KH9A 5KVGH 2VH5L 4QRBA 4M7KL 2WIMA 3FQTA 3PFQA 2KHAA 3PWVB 1NGQL 4RAUA 3QISA 2VSDA 3SKOA 5D2LE 3CN4A 1OP9A 1D5BB 1SHXA 4ACTA 2EE6A 1MFNA 4TVPL 5DJ8A 3K6SB 3VFMA 2JK5B 1VRSA 1TMQA 2PPFA 3VXUD 3R0MA 4LASL 4YEFA 3MOQA 4JO4L 1AQ8A 1T83C 3TA3D 3V5DB 4OUOA 4KX7A 3L5XL 1NGWB 5CP3A 2Q3AA 2D0FA 3FT2B 4QJ3B 3DIFA 3T2NH 4LLQB 4LEEA 3C60B 4Y4FA 1OGAA 4PCYA 4X42A 1G1YA 1IFGA 4HUCA 2ZX8A 1PKQA 2Q9OA 1TYJA 3OKKB 1N26A 4GEJA 4PS4L 5I18L 4H1LA 4P2QD 4JRYE 1JUFB 2IOIA 3BIBX 4WNSA 4QRPA 4BCXA 4UT6L 4HZ1A 3IDYC 2X12A 3MLTA 3U7WL 3HZVA 3JWOL 4UOW0 2XYBA 4HSCX 1K8DB 2I69A 4GI8A 4PGCA 4TPRL 5KS9A 2Y7OA 4R5TA 4AITA 4GMSH 2AV1B 3KPSD 3IVKA 4CNIB 1IAIL 3V95A 3MNZA 4WEBH 3UABA 4R4FH 4MB3A 3AABA 3CFNA 3PGCA 2WSKA 1HE7A 1TO5A 3T8VA 3KPSB 3TX4A 5CF3A 2QZQA 1ILUA 3CV5A 4BK5C 2B5IB 2JTDA 1YSOA 2ERJB 2MPAL 3ATEA 5KVFH 4ZFZA 4AIEA 2NZ9D 4X9HA 2ZCKH 3D1MC 4MMZB 1CE1L 4W9DC 3WMQA 4HFWB 4X9GA 3RTLA 3ZL4H 2R83A 1R0AH 3HMXA 1X5LA 4PWGA 4MWFA 3SDCD 4D0DB 2XOTA 5C6WH 4FFWD 1G9MC 4AQAA 1TNNA 4XO8A 2C4XA 3WUWA 3GJFK 1G4RA 3GDCA 4ERSL 4X4YB 4M8QB 4Q9QL 4BFGA 5FEBA 3QCUL 4ZMLA 4D8OA 3VB9A 5I66B 4QNPE 1YQVL 3ZDXE 4QRTB 2MSPA 3CFIC 2F7PA 3TA3B 4YAQA 4LPCA 3OKYA 1CGSL 4RAVA 2QADC 1JGVH 1QSZA 1RZJC 3V0DA 5DGQA 2P7TB 3IJSB 1RFDH 5SWZE 2YARA 2FT7A 3DVIA 3Q9QA 4QHUA 4HPYL 4K9JA 3KH4A 2V6HA 3VTAA 2JCCE 3T2OA 1U4EA 3S5YA 1ROCA 3GMPA 1W8EA 3W2DH 5LKNA 3WEMA 3DX6A 4IJTA 3PDOA 4NBXB 4J3BA 3ZL2A 3V4PH 1FNGB 2UX7A 3SDAA 1EHAA 1G9NL 4YOKA 1PIGA 3ETBJ 2V17H 3IFOB 1I1FB 4U31A 5MEQB 1TG8A 4AT6A 3BKYH 3PWNA 1VEPA 1G9ML 4FQQB 3S36X 4GRLD 1X7SA 3WO4B 5CJXC 4BH8B 4PJEF 3U9PL 3S8GB 4WGKA 3DSFH 3VXUB 2X2YA 3BSHA 4R2GB 3KWTA 4RGMB 1DFXA 1PKQB 3GTVA 3O3EB 3HMXH 1FNHA 4UQCA 3MLUH 4TNGA 3RA7L 2OP4L 3UROR 2W94A 5GSVB 3QUZB 3WIFB 4UOQA 4WFGD 3NIGF 2GAZB 1OCRB 5IQ7L 1OAYH 4PP1C 4Y1SA 3P4LA 3ZDWA 3EOAB 1EJOL 4FNQA 5JA8B 3QDMB 3E6HB 1AGDB 3Q43A 5TDNB 5BVPH 3RNKB 3QWNA 5D70H 4ZZKA 4GW5B 3BZFB 4NM8H 1TTBA 2OMTB 1PX4A 3IN0A 4YSDA 4UT6H 2I60L 3VD7A 1MW1A 5DD3H 2AJ3A 1WIPA 4KROB 4M62H 3PWPE 3K7UA 4FEMA 3UTQB 4PS4H 3LKPB 4LPUA 2PYEE 4KK9C 3H3KA 1PL3A 1L9MA 2IH3B 4MJID 4DNLA 3VD0A 4OGYL 2AHIA 3CZSA 4L4TB 2R8SH 4TVPE 5K9JL 1NEZB 3V5HB 4HOWA 5CEZD 3UCRA 4L8SA 1BJ8A 4UDUB 5KZCD 4WW1B 1NDGA 1RUQH 2NNFA 5I17A 4C58B 1S7SB 1QG3A 3QE5A 4YHPB 2KL6A 5D1XA 3SPVA 3CHXA 4BRVA 1F0LA 2HVJB 2PYEB 2XTJD 2X2IA 2WTOA 3ZKXC 5BRZD 3NFPB 3MUY1 3KEHA 1SFDA 4JFDB 3HN5A 1NCBH 5F1NA 3HE6D 3PNWB 1XF2B 1HVXA 4QTIL 2WINA 3VMOA 4DEUA 1SXBA 4OFPA 1RL1A 1VGEL 2X4RB 1EX0A 2XZQH 3QJUB 2WBKA 4P5RA 4WV1A 2ZXCA 1IC4H 1ZAGA 2F0CA 3BZ4B 4NQXA 1C5CH 4WWID 5DFAA 1LP9F 2JF1A 4PJDA 5KVFL 3WHXB 2B08A 3L1GA 1Z0MA 3O6KH 2XVLA 2J6WA 4UTCA 4KWUA 3QAQA 5IBTL 3WD5H 5F96H 4JRXB 2QR0A 3K5SA 1E5UI 3T4AB 1GAFL 4O2EB 1SY6L 2Z0UA 4AMXA 5KSUA 2MHAA 2LTQC 3IGKA 2NY4D 2QR0B 5DUJA 1ETZB 1OAZL 1Z0NA 2GUOA 4E5XG 2R4SH 4N0YL 1MCDA 4OT1H 3HG4A 2R0ZH 3KVQA 4PJHE 4ONHB 2GJ6E 4MQSB 2AEPL 3CXDH 3D3VB 2BLFA 2K3TA 3LQAC 2HVJA 1RFDL 3BYYA 3NJKA 3MV7D 3B83A 4PSRA 4LK4A 1CE6B 3KPQA 4ODSH 3GXUB 4XN5A 1IBFA 2X4QB 5E5MB 5C09D 2ZOKA 1EDQA 3HUJA 1NMCB 4L5FE 3MNZB 3ROOB 1RZPA 5JXAH 4WWOA 1MFDH 2YWYA 3BKJH 3FOLA 4Y4HA 4B50A 2KQMA 4TNEA 4F37F 1MW0A 2R59A 1WS8A 3MX0B 1NL0H 3BKMH 1V27A 3V9EA 1TCRB 4JFSA 1HH6A 3MA9H 4RGNC 1YVLA 5LWYL 2VDLL 3NZUA 4HLZH 4F9PC 3S36H 3U7YH 3ETBF 1CU4H 2P47B 1E2WA 4GKZA 3MRGB 1M3IA 4QD2E 1IFHL 3CCHB 2A6JB 2FBJL 4ODHL 4WO4B 4U2YA 2BHYA 1NIEA 3O8XB 4KK9D 1NGWA 4OQTH 3TN0C 5CP7A 3G08A 3RTQD 2EO7A 5IHLB 2ARWA 1P6WA 5HDWA 3DTXB 4L4VA 3D12B 3QZPA 3BN9C 4QXUH 5CP7B 2AAVA 3DWTA 2OX5A 4RZKA 4Q0XH 5E8PA 5KBKA 3L3GB 1RHHB 3MJ6A 2FWLB 5GZOA 4YE4L 3TVMA 5TF1H 4LPXA 2X4SB 5IKCA 3JWDC 3JVGA 2UUDH 4PJFE 3WFBH 4FQHB 3GBEA 4IRJD 1Y7VA 1SDDA 2HXAA 2HH0L 3WY2A 5E5LA 1GZPA 4DVRL 2DQGH 3ARRA 4LVOC 2GIXA 1OV8A 4MYPA 5TF1L 4U3HA 3WKPA 4MJ4A 3MBEA 4Z7OF 1E43A 1A7QH 1OD9A 1ZIBA 1ZVSA 1A25A 4A6YH 1MWAH 4EN3D 3VDAA 3HG0A 2VLJE 3MV8D 3Q6GL 1UG9A 4OJFL 1ZD6A 4R9HA 1EFXA 1U8LA 3QQ4B 4BFNA 1CE6A 3KPQB 3SD5A 5I74B 1DYZA 3T2PA 2ZCLL 1G6VK 4Z7QB 2FJSA 1SOSA 3KR3L 1RURH 4LEBA 3CFCL 3I6KB 3VD4A 1M2VB 1XTLA 2YUXA 2Z93B 1JGIA 1GMEA 3B9AA 2GTZA 2NXZB 1NGXB 3G7TA 2NW2B 5IM7B 1PZ3A 2Y72A 2K7PA 4Z7IA 3A6OA 1AIFA 1DLFH 5AB1A 2ARJA 2Y24A 2ZOTA 1AGFA 1IMHC 2VH5H 4KO6A 2LQRA 4K7PL 2NLJB 4ORGB 4RA3A 3VRIB 2YFOA 4NOBA 4NI6A 2A77L 4UOJA 3RY4A 2YD5A 3QUMA 4QHKI 1HYSD 1AD0A 3V6OE 1UACL 2EDJA 1YUHA 2Q8BL 3NIGE 3PGDA 5KYUB 4N9GA 1ZHLA