3IDJB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 fab' fragment in complex with gp41 peptide analog eld(orn)was
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
235
structure length
229
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 2F5 Fab light chain
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
total genus 41
structure length 229
sequence length 235
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idjB01
2AJVL 1WFUA 3MACL 3EDEA 4AL8L 1X4XA 3MBXH 2GTWB 4YGVA 3GSWB 1M4KA 3IDUA 5DURB 2WWKO 1CLOH 1MCFA 3D85D 4HIEB 5A2FA 3GDBA 2F19H 4HKXA 1TCMA 1RJYA 2I27N 4POZD 1S7SB 4LPWA 1EDQA 2XWJA 5J9PB 5I75C 1M7DB 4MWFA 1RZJL 4BQ6A 3NIFE 4HW6A 2R1YB 2QTEA 1G7MA 5DVMA 4C56A 4X99A 3G5ZA 1YNLH 2XA3A 1JYNA 4S1DC 3UEZA 2ZNXA 5ALCL 2WLZA 4WI6A 1CCZA 5DC0A 5L6YH 5D7JB 4LSTH 3LDBB 3QUKB 1P5VA 3Q6FA 4MQXC 3HUJB 1G7IB 5D7LE 2DQJL 4JRXD 1FRGL 4YEFA 3VXMD 1EJ6A 2GK0A 3N85L 1YYMH 3C5ZD 3HC4L 5IWLC 3NPSB 3P11L 1MVFA 4KI5E 4F7PB 1KB5H 3MUHL 5DUML 3GBNL 3QZWA 4P5KA 3V5KA 1IZJA 5HD8D 3KWWB 2WUCL 3O8XA 5CGTA 4TRPL 4ZNEE 3S35H 3UDWA 4CW1A 5IGXL 4HG4K 1HN1A 1QBBA 3D0LA 1D6VH 4X98B 3HG1B 1UACH 2IBGA 3QFJB 4K8RH 4XCEB 3RWEB 2P5WB 3FMGH 4MNQB 2UZIL 4PJHE 3DO7B 3SJVA 2YRPA 5FOJA 1VFOA 3DV6A 1OF2A 3K1DA 4M1DH 3MLYH 1A6VL 1CDGA 5GS1C 4Y2DB 1I75A 5DD5L 4L5FH 4TVPE 3A67L 2COQA 4OCWH 4F57L 4QHUB 4XPHL 4XGZA 4JEGB 1BIIB 1NMAL 1WVZA 3QUYA 1T0NB 4LKCB 1KLGA 4KXZI 4TOYL 2DQUH 4K3DH 2A0LD 2B1AL 1EEZA 3WFDL 5A3ID 4JPVH 4AQ1B 3B6SB 3BDBA 4HFUL 3LS5L 3SCMA 2F8OA 3N1FC 1R3JA 4DTGL 3L5XH 2EDBA 2KZWA 4PV8A 4RAUB 3P0VH 3VMOA 1MLBB 4G8GE 1WBXA 3PGCB 3OMZA 3P9WB 2EYRA 1AGDB 5JXEA 5TQ2H 4P5MB 1A4JA 2GEEA 3ULUF 3B9KD 5I1LB 5DI8B 3LEYH 2UZXB 4FG6D 3HUJA 3IJYA 1G7IA 1H15B 5FV1L 3VRLF 3J8F7 4QTHB 4ALAH 4N0YL 5IHUL 2V5RA 4HJ0D 1FH5L 4WFGE 1BQHG 5TDPA 3BJ91 5FO8B 4G8GA 3QEUB 5GQBA 3BWAA 2UZYB 3KWWA 5GZNC 4NNXA 5DMGC 3WS6A 4QOKE 4PRDB 4YAQA 5JIHA 2X4UA 3WDHA 6FABL 4YX2L 1F02I 4X98A 5L88H 2BVQB 3HG1A 3OKLB 2NX5D 5FO7B 5B8CC 2MQCA 1FO0L 4KK8C 3WNNA 4XCEA 3RWEA 2Y6SC 4URTB 3T2QA 5CAYB 2P5WA 4GQ9H 1CF8L 5CHNB 4WO4D 2RFXB 3UROR 2E27H 1WJ3A 3MO1B 1OARH 2BDNH 1T2QL 1BQSA 1M7XA 4HH8A 2MMXA 4QOKA 5D1XC 1ONQB 4PJEB 3RZWA 3WXVH 3QH3B 1BIIA 3DIFB 3FCTA 5EZJB 4ZPTA 4LKCA 4OF0A 1R0AL 5J11B 2FBOJ 1BBDH 2FB4L 1S9YB 3I2CL 3N06B 1RK0B 3SN6N 4O9HL 2HFFA 3LQZB 3DRQA 3PWVB 4KK6D 3H3PH 4OM0H 2B2XL 1OP5K 5HYQB 5I17B 1BFTA 2GSGB 4JFQB 3PGCA 5I0ZA 3PXHA 4JY5H 3WHE0 3GGWA 1AGDA 2Y07H 2Q6WA 2WBKA 3H7BB 1MCCA 4P5MA 5F7EL 2X4OB 3RJQB 1Q72H 3EO0B 4RQQB 5DI8A 2X9WA 3BN3B 1H3UA 1A9BA 4OB5L 1H15A 2AEPH 3C6LB 3FO0L 4QTHA 2GUOA 3MODL 3NPZB 1L7TL 1FGVH 4JG1L 4CNIB 4EUPA 4JFFD 1P7HL 5B21A 4Y5XB 3OR7B 2YA0A 1U3HC 4K7FB 5BO1L 3QEUA 5F3BB 1T03H 1QG3A 3IFPA 1JNHA 4Z5RA 3WHE1 1T66C 1KB5A 4WI9A 4PRDA 4GS7B 4KMTH 3P77B 5F9OL 1C08B 4OF8A 2BVQA 1R5WA 3OKLA 5FO7A 5IMKB 2C9AA 4FQXC 3KS0J 1PAMA 3IU4L 5E5MA 4AM0B 2O5YH 3EZJB 4RGOL 4MJ6B 1A7RH 5D70L 3MJ8B 3MO1A 3KPQB 2NZ9D 1ORSA 1D5ZA 3HI5L 3HUJF 3PWJA 3QPQC 4DN3H 4JGMA 2APFA 1ONQA 4DQOH 3LKSB 4H20L 2PO6C 3QH3A 5C0BE 1E6OL 1YJDC 5IF0B 2EKSB 1RIUL 3NFSL 3GUTA 1CFVL 1S9YA 1RULH 4H88H 4XP4H 3L9RB 5I16A 1RK0A 3LQZA 3PWVA 2C1OA 5ITBH 1DN2A 5HHNB 4NO3B 2GSGA 2Q3ZA 1S78D 4L4VE 5B38G 1CS6A 4G7YH 5K9JH 3H7BA 4HUWB 5T3XD 1ADQH 4F2MB 4BQ8A 3EO0A 2VSCA 3R4DA 4HWBH 5TH2A 3E6HB 1XIWD 3C6LA 2FSEB 4S10A 4LLVA 4YBLB 1I7UB 4CNIA 3UXFA 4H25B 4Y4KC 3DJ9A 4AG4H 4Y5XA 1UXSA 2MPAL 1E4WL 1RMFH 2P5ED 3LMJL 3FB5B 1X5AA 3I02B 4FQ2L 4OZGE 5DUPH 1FORL 4LSUL 2FX7L 1GZPB 4N90E 4Q7DA 2OP4L 3QIWD 4R97B 4NHUA 4PTTB 1I1CA 4XI5D 1DEDA 1XGPA 4GT7A 3EZ8A 1A64A 1UH3A 3TBWA 4DGVL 2CGRL 2ERJC 2ED9A 1N5AB 4XCCL 2K7PA 3WFCL 3WIHL 3H9YA 3EHBC 4MB5A 4MJ6A 5DK0A 5B39G 5KW9H 5GGSB 3T3PF 5F89B 3MV7E 1KSRA 1DLHB 1KCVH 4OZGA 4U7KA 3S34H 4PGZA 5E4IA 2NR6D 1JGLH 2FECI 1AGFA 3LKSA 3JV0A 3BFOA 4YHKL 1QR1B 1X7QB 1MF2L 2YKLL 1HKLL 2DQHH 5TDOB 1I8IB 2QADB 1ETZB 1KJ2A 2P48B 3RBSA 5HHPB 4ENEC 3MJ9L 1BZ7B 1U3ZA 2AV7B 4MAUL 4TUKL 5ID1B 5AZ2L 4U0RC 1KF9B 4P46C 5HHNA 1L6ZA 4NO3A 3KYOB 4GOSA 2AXJA 4K94L 2DWDB 2J4WL 4JRYD 2ZCKL 3UJJH 3PHOA 2GSIB 4NP4H 5HHVH 3RNQB 1AI1H 2EXWD 1KN2L 2P1YA 4EN3A 1I9EA 4NN5C 3OAYK 1I9IH 4HAGA 1L7IL 2D0GA 4RDQF 4RCAA 1OP5H 2B4CH 4NJAL 5E2WL 4ZS7H 4ODUB 2BSSB 4H25A 3TT3L 3IDXH 5D5MB 1NC2B 1FFPB 5CINH 1VFMA 4MX7B 4LVHC 4YK4B 1JE6A 3FT3B 1MCKA 2DLFL 3I02A 4RMWA 2W9LA 4MAYC 2YC1B 2XPGB 4TULL 2E9JA 4UILL 5D7SL 4UTAH 1P7QD 3UYRL 1AR2A 3OKDB 4PS4L 4EDXB 3U4AA 4PTTA 4DKFL 3MFGB 3V4UL 4AENB 2OZ4H 1E6JH 2R2HA 4KRPC 1RJZB 4RZCB 2DTMH 2AVGA 2D0FA 2VE6A 4PJIE 3FN3A 2R0ZL 3CC5B 3UTQB 3ZTNH 3LIZL 3WFBL 5E99H 3SDYL 1MQ8A 5FKAB 1DLHA 3QAZB 2C7UB 4F8QA 5IBTL 2FNBA 1KEGL 1OAKL 3SEPA 1F6FB 4ONFH 1I9JH 3Q1SH 1QR1A 3U79A 1X7QA 3MV8B 4FQ1H 2EXYD 3SE4A 4U3CA 1U8HB 2CRYA 4BZ2L 1LO3L 3OR6B 4WUUB 4PJIA 1FNSL 2AV7A 1H9VA 1J5OH 3KLAA 3L7FB 4M6NH 3KYOA 1T3FA 2DWDA 1ZA3A 3S3JA 4HK3J 3SDAC 2Y06H 1I3UA 3O11B 1MFBL 3VXQB 4ZFGL 1E4JA 2LFGA 2GSIA 3OXRB 4HMCA 4UB0L 2BJMH 2VLJD 1NGYA 2DM3A 2A77H 5TQ0H 1GIGH 3GJFB 4CRPA 4KZEL 4NUGH 3UMTA 1SVCP 1BPVA 1TTFA 4OZGF 1ADQA 4S1SL 3LKPB 1CE6B 2WBJB 4YXHH 3WUZA 5I15L 4ODUA 3VXPB 2BSSA 4K2UL 5D5MA 1ACYH 1DJSA 1XCTB 3CPLA 2GIYA 3MCLL 1U95B 1B6UA 1T4KB 4ZUSB 3FT3A 1F6LL 4JCMA 5J12C 2YC1A 3EYFB 5JW4Q 1A6UH 1IAOA 5CZKA 4HG4J 3OKDA 1LILA 4EDXA 1HWHB 2VZSA 1YY9D 1HQRB 2IAMD 3C5ZC 5HDQH 4LEOA 4S0SD 4AENA 1WIOA 5KG9A 2I9LB 2DQIL 3R1GL 1CICD 3HAEG 2BNQD 5I18L 3C09C 1H0DB 3CC5A 5KOVC 3LKQB 5H94A 4KTEH 2E7BA 1BEYL 4U2YA 2ZPKL 1AXIB 3K81A 3HI1B 1EVUA 2ZUQC 3CSPA 1A5FH 1RD6A 4UTBH 4OV5B 4RX4D 5J6HB 3JVGA 3MV8A 4AEEA 4KVCH 3MLVL 4S0TD 5C0CB 4M02A 5IFHH 5C0AD 5CEYA 1NKRA 1MFAL 3OR6A 2EO1A 2HRLA 1TVBB 3H42H 3QDGB 4DZ8B 5BOZG 4G9DB 2YN3A 3D18B 1GGCH 4D2NA 4P99A 3UAJD 3WFEH 4I9WE 3MJGX 3EFFB 4JGJA 2OCFD 4LCCB 3V6OA 3LEXA 4Z7WB 1IQWH 5J56B 5D96B 4Q58C 2B39A 2NY2B 2VLKE 2R0LH 4PJ9B 2DD8H 3IDYB 4U1LB 3VXQA 3FN9A 4WW2C 2A0LC 2IPKB 3GJFA 5A3IC 4Q9QL 5JXAH 5L8LB 5LXGH 1YECL 4LASL 4YIQA 4G42B 4WJ5B 3V79C 2GJ6E 1QRKA 3SKJH 4Q0XH 1H3PL 2WBJA 3FN0L 4I3SL 3VXPA 4AZ8A 2Z0BA 1BAFH 2X4RB 3TNMB 3T0ED 2R0KH 1AE6H 1T4KA 3LEVL 3O9WA 4NWTL 4LPYA 2NYYD 4YO0A 5D7LD 3T2NL 32C2A 1EMTL 4V1DE 3B9KC 4F58L 2VLKA 3C5SA 3VGAB 1QBLL 4AIZB 1TJHH 3O0RH 3OAYH 4MA1C 4FG6C 4PJIF 5IHZB 5DJXA 2Z93B 1T20B 3P3YA 3PWNB 3PP4H 1QO3B 3ARYA 1E4XL 1E4XI 2I9LA 5IT2L 5JORA 2IG2L 3UJTL 3VXOB 4M62L 4KPHH 3MLZH 2OZ4A 3QIUD 4DUXA 4GXUM 2LAGB 4V1DA 3HI1A 1EBAA 2W91A 4I0PD 2PYFA 3QQ4B 1F4WL 1VA9A 2NY0B 4H8WC 3QUMH 4GBXD 5D5MF 3B2UC 2EDXA 3DSNA 5IV2A 1IVLA 3H3BC 4K3JL 4WO4C 1S7RA 4DZ8A 1IJ9A 3I75A 1MREH 3CU1A 2FGZA 4Z7UE 2Z8WC 3EFFA 3HCVB 4LCCA 4ZQKA 3MR9A 1Z3GL 1INDL 3NTCL 4Z7WA 5EORH 5H2BB 4E42A 4U1LA 4YQXH 4X8XA 5FYLL 3NA4A 2IPKA 2H32H 2HKFH 1HYRC 1X5LA 1F4AA 2D7MA 4G42A 4Q2ZA 5ITFB 1F00I 4JM4L 1FO0B 1L6XA 1KNOB 4LQFH 2HLFD 3FQTB 4LSQH 2ZCLL 4Z7UA 3TNMA 5GS0L 4PLKD 3WUWG 3MNVA 4L8SB 5I66A 1A3RL 3HFML 1R3KB 5KN5A 3RP1A 3MBED 4HS3B 2ADFL 4AIZA 3GMNA 4TUOA 2QSTA 4L3EB 2VDRL 1N6UA 1YMME 3SE9H 5IHZA 1V5JA 5DMYA 1T20A 3RQ3A 1XT5A 4PJDB 2CQVA 4KDTA 3CX5K 1E4KA 3VJ6B 1EBPA 1FJ1A 3IF1A 4HC1L 1RSFA 3VE0B 1JYWA 3QXTA 2YPKB 2G60H 2X70B 5MP6L 4MLIA 1MRFH 3N1GC 4QT5B 4LSPL 5ABDE 2EH8H 3ES6A 4AK1A 4MCZB 5DEFA 3JWNC 1YMMA 4ZO9A 1CN4A 4Y4FB 1FVCB 1YEHH 2XN9E 1X5GA 2ZSWA 2Z9TA 4UUJB 2HT3C 4HV8A 3QDMD 1ROWA 4XBGA 3VGDA 2E6QA 4R4ND 3QXUA 3T2OA 1QUNA 2Y7QB 4YDKL 5ICXB 3LN4A 2AJZB 5MEND 4XNZC 3KXFE 3I6LE 5JZ7D 1CR9L 1YEJL 3D0VA 3K8MA 4GRLD 5EO0B 1U8KB 2DQCL 4D0DB 4P5TC 4QRQA 1TQBC 4NKOA 4NSKA 1LE9B 4YE4L 1MUJB 3MLUL 2XN9A 1JL8A 4RAVA 1F45A 2H9GA 1IMHC 1R3IH 4P23B 3ZMRA 3V6ZA 1MFDH 3OKYA 3ZE0E 5ITFA 3V6BR 1SBSL 1U58B 1FO0A 5L0QC 4M6ML 1G7HB 3CXDH 4P9HL 2A83B 4K71B 4QO1A 1S78C 3PGFH 4QEGA 1AKJA 2FRGP 1RJCA 1A0QH 3KXFA 2DQGL 3NH7L 3GSNL 2R2EA 2Q8BL 1U91B 5GIRB 5TE4H 1AXTH 1IC4H 5KANI 4R96B 4PJFE 1R3KA 3GBLA 3BOVA 3QB7C 1W8NA 3GB7B 3OHXA 1AJ7H 4JO3L 5FGBC 1CLZH 1FNFA 4CMMB 4PTUB 3WD5H 2YBRB 3TYFB 4F9LC 3BMVA 4K8RD 3VJ6A 1NL0H 4U1MB 2P24B 4Z7WF 3VE0A 3G5YB 5F9WB 1WBYA 3FT2B 3ME0A 4P57B 2OL3H 1NCCH 4IMLB 2YPKA 2X70A 5F7MC 2NPLX 4PJFA 2XOTA 4QT5A 3QIWC 1MCWM 2WWMC 5FUOH 4XI5C 1VADB 4U05A 1Q9WA 4Y4FA 4UUJA 1OGAB 4R2GB 1C12B 2JF1A 1DANU 1JIBA 4NGHL 4X6FB 1SM3L 4K9EC 1FNAA 4ODTH 3VRJB 3RX7A 5ICXA 3MTRA 4FQJH 1NEZG 5BW7C 5ILTL 1T5XA 2AJZA 5DHVB 3DXAB 5L9DH 4P2QB 4QHMB 5IG7B 3TN0B 2NR6C 1W0WB 5EO0A 3EYSL 5EC2B 1VB9A 1DLFH 4D0DA 2F58H 1A7QL 2R15A 1R6VA 3NIDE 3HZVA 1OM3H 2XI9A 3Q5YA 1JGUH 2VN4A 5ESQB 4P23A 5C3TA 5I19H 3WFZA 5DD6A 2DKUA 1G7HA 4MHHG 4ZO6A 2XWBA 3BUYB 5GJSH 3S5LB 4H5SB 1FGNL 3MOBL 1I8MA 5GIRA 2E9BA 3DX9B 1U6AH 1P6AB 3NA9L 2EXWC 1IRAY 5EIQA 5EG6C 5J13C 4L8BB 4FMFA 4LAQH 4FMKA 4LCUA 2A9NL 2VLMD 3HE7A 4LNRA 4PTUA 3DUSB 2VWEE 5CJBA 3CFBB 2EO9A 2P24A 3RI5F 1TJGH 3G5VB 3G5YA 3FT2A 1N6VA 4IMLA 1A7NH 4KVNL 3SE8L 3VFVB 4Y7MA 3CU7A 1ZEAL 1D5MA 1GOHA 5IM7A 3TBYB 1QEWB 4TUJB 1ZKAA 1VADA 4KTYA 5DD3H 4YXKL 4R7NB 1JGEA 1KACB 1LDPL 3VRJA 2IAND 5F6HI 4OCSH 4XC1H 1OHQA 3ZTJG 3OJ2C 1C5BL 3SBWC 5DC9B 1J11A 2JK5A 4KKCD 4P2RE 4MJ2A 2GQHA 3VW3H 4P2QA 4QHMA 5IG7A 2HVKB 5TF1L 1W0WA 3MROB 1M71A 3AS1A 1IM9B 3BZFA 2IPUG 2YEZA 3ZE0F 4R4FH 3DMMC 1JHLH 3ROLA 5D4QA 5JR1H 2EXYC 3BP5B 1TVDA 1XR9A 5GRUH 4Y89A 4E41B 5GISL 3ARVA 4HUMB 4NRYA 3D3VD 4Q6IA 2D7TL 1UCBH 4ISVB 1LEGB 5F6IB 1CFBA 5EOQH 1J1OL 2BNRB 5SWQB 3AY4C 3WIHA 4DVRL 3TNNA 4EIZC 1T1WA 3BUYA 2X89D 3BPOC 4A6YB 1QKZH 2B1HL 3WSQL 4NQCE 4H5SA 2VDLH 3U0WL 4YDIL 1AGCB 3REWA 5JW4R 3DX9A 2DB8A 4NQVB 2I60H 4HS8L 4ZOBA 3U7YL 4M7LL 4HKBB 4G8EA 4HLZH 1F13A 1NLBH 4L8BA 2IQ9H 5EBLB 5HDLA 4XP9H 1BVZA 4QTIL 1OT1A 5T1MA 1A02N 2NY7L 3DHMA 2V2XB 3DUSA 3P4NB 4YNYB 2XKSA 4OF3A 5F7DA 3CFBA 1M6OB 2GAZA 4N5UA 3RVWC 4OCYH 5E9DD 2XRAH 3LHPH 4O2CB 3G5VA 2F15A 1JZ4A 3BKML 4NQCA 1FG2B 3V7AE 5DZNA 2BY1A 1ZT1B 4K7PX 1NCBH 1CFSB 4N8CL 3VFVA 1EO5A 2X1OA 3TBYA 1QEWA 4TUJA 1YY9C 3QUXC 2IAMC 1OW0A 3VXRD 3OB0K 5LAXA 5FK9A 3QCVH 4M6OL 2V5MA 1CICC 4X83A 3BT2H 3OSKA 5FCUL 4WGVB 4JE4B 3AREC 3SE3A 2X9YA 3PV7A 3FZUD 4HT1L 1G0XA 3UTSD 3BD5A 5AAWA 1I9RL 2HVKA 2Q87A 3L5WB 3KYMB 3MROA 4FQIH 4G5ZL 2YS4A 4HIXL 3MRNA 1V3KA 3QUZC 5D71L 3CSYB 4LKXB 5BVJB 4WI7A 2ZOLA 1GC1H 5FGSA 4ISVA 1AGBA 1F4YH 4JG0H 5F1OB 4MB3A 5SWQA 1FE8L 2DQDL 2R8SL 1T21A 3T4YB 1CQKA 1UM4L 4XCNB 4GRWE 4LHUD 1TVHB 5EB9A 5FEBA 4NQVA 1U0QA 5EU6D 5B22A 1KULA 2LABA 4PJXB 2NY1B 4HKBA 1WFTA 4W68A 4PB0L 5DT1H 2ATKB 5EBLA 1LK3H 4X8JB 4GG6B 3UTPE 1KPRB 1WCQA 3I84A 4HULB 3TZVB 2V2XA 4D3CH 1O5DT 1EFQA 3P4NA 4QGYA 4XPAL 1NDGA 1M6OA 1OAXH 3T0EC 4I4WA 1PW3A 4O2CA 2NYYC 3L5HA 4N0FB 4NFDA 2NXZB 4Q97A 5BMFL 3CVHH 3EW3B 1MLCB 3KPPA 5IR1B 4LHUG 1XH3A 4IHOB 4X7FC 4DCQB 5I8EA 1JTOA 4KI5C 5L7XL 4WTZA 1AQKL 1FYTD 2XFXA 2EE2A 3OL2A 1S3KH 1NCWH 5E8NB 3QIUC 3IDJB 3FB8B 1NDMA 4PGCB 3KPSE 2E7LC 4I0PC 3L5WA 1AQDA 4EBQH 1ZA6B 3N50A 4N9OB 5ADOL 1JGVH 1VENA 2A6IB 4GBXC 3GSQA 1OAZH 3QNXA 4NN7C 1GXEA 3IJSB 1F8TL 2ICEA 4M93B 3OG6B 3S88L 4D9QD 4OGXL 4NN6B 1XR8B 1NFDE 3QG7H 1DANT 3T4YA 3KPSA 4N0CD 1U8MB 1IKNC 1Q94A 4OZHB 3I6KA 3LV3B 1HI6B 4PGBB 1TVHA 3QQ3B 1HZHL 2P8MB 5IB4A 3RKDD 3BN9C 4PJ7B 2HFTA 4NUJB 4LRNL 4ZAKB 3PJSB 2CJUH 3OJMB 4MD5B 1NBYA 1BQHB 3ET9F 1CFNB 3G08A 4GG6A 3CMOL 4L4TE 1FN4B 3S35X 3VFRB 3J7HA 4PD4J 3BYYA 4LAJH 2A9ML 5CJQL 3VDCA 4K3EH 3ZE2F 3QQNA 4Y16A 2BVPB 4OTXL 2CXGA 4FTVB 4PLKC 3IETA 4XNXH 3NCCB 3MBEC 5F21B 1IC5L 1MLCA 4UDTB 4IHOA 5F7HA 5EBGA 3TYGH 3RVUD 4BM7A 5BRZB 2F5BL 3KLDA 2OBGA 5INDB 4M7LT 4GAYA 1AC6A 1LO5B 2W65A 5L8KB 3IDJA 1J88A 4NT6B 4X6BA 3RZCA 3GHBH 1EFXA 2CDEA 4EJ1C 2I5YH 3MQIA 1ZA6A 3VG9B 5AWNH 1I1AB 3OB0H 5ALBL 4ELME 4J12A 2IH1B 1UJ3B 3ARFD 4AEHH 3O41B 1YUHB 2JLLA 4GRWF 5D93C 4PUBH 1FZJB 1SJEB 3P30H 4TTDD 1Z6JT 4J4PC 4J3TA 1S7QA 1OD9A 4S2SA 3V52L 2Z31B 3INUH 5FM5M 1XR8A 2PTVA 4HCRH 4GRLC 1U8MA 2N56A 1OAUL 3LQAL 4M9PA 4OZHA 4XH2A 3LV3A 1HI6A 2Y36H 4PGBA 1D5IL 3QQ3A 1PKQE 2P8MA 1UM5L 3PHQA 1DVFD 3GSRB 3D6GA 3HPLA 2H8PA 4NUJA 1HNFA 4MD5A 4Z0XA 3PIQA 3HI6L 5FUZH 4JREB 1CFNA 1FN4A 2CUIA 3VFRA 5FYLE 1D5BA 5F7WC 2E5EA 3HZYB 2PCPB 2VC2H 5KVEH 2BVPA 4KJQD 4NQDB 2JELL 2QQLL 2VDPL 3P4MB 1I85A 1IC7H 5ERWA 4CAGA 1PKQA 4QRTA 5C07B 2WNGA 1XGYH 4UDTA 5CJ5A 3VXSB 3DWTA 4A2LA 4NRXB 2O26U 5E7FA 4W4OA 1QFWL 5E5UB 2Y4SA 4D9LH 2VXSL 1R3HA 1TPXC 4K8RC 2R56L 3S4SG 3O6LL 4U1SB 3LZFL 1MCPL 1S7UB 1JBJA 1IGML 1LO5A 1TJIH 1OCWH 1I8LC 2VDKH 3RPKA 4GG6F 3VRIB 4XMPH 1QFUH 3GSNB 4IOFD 4G9FB 4Z95H 4JDTL 1Z9LA 4GAGL 1UH2A 5I0DA 1AO7D 4M8QB 1KXQE 2B8OT 4JQIL 3OKEA 2P4AB 2IH1A 3BD4A 1D6EB 4PJGB 3O41A 4PRNB 1YUHA 3VWKD 1EHLH 1FLTX 4WEBL 1SJEA 4HKJB 3ZKSD 4OLVL 3M45A 4MA7H 1CDBA 5CUSL 3VFOB 1EGJH 1KJVB 4HC1A 2D31B 1D9KB 1HOCB 5BS0D 4XC3L 1ACZA 1B0GB 2HT4D 1NEUA 3EYVB 5C08B 2XA8H 1L4IA 4YHIA 5JW4N 4JKPH 2PXYC 3O6FB 5L2KD 5CP3H 3G9VA 3NOIA 3STBA 1CDYA 1JHKL 4Z78A 3L6FB 2VZ3A 4F7MA 2VIRA 2NY3C 3HZYA 4MDJA 2O5ZL 2PCPA 3LSOB 2YD2A 1N26A 4P9ML 5D72H 2R1XB 2W9DL 1JZ6A 1FIGL 4M00A 4NQDA 4KRNA 3BVNB 1XFPA 4JFPA 1GAFH 3FHQA 4KUCD 4Z7OF 1NJ9A 3P4MA 4IMKA 4HKZA 5IFJA 1CG9A 3SDDB 3BPCB 4F9PC 3BDXA 3JV4A 5J6GB 4RAHA 3AS2A 3TC9A 2VISB 2UYLB 5E2UH 3VXSA 1HXYB 3GK8L 2GK2A 5IVXB 1UQSA 3LS4L 1YQ2A 3MA9H 1DL7H 5B39B 4HWZB 3FFCE 3SGKA 5JIPA 1WBZA 3CMGA 1F4XH 4OZHF 5AG8A 1N6QH 4OBSA 2OS7A 2AP2A 1S7UA 4U6YA 4F7TB 2XKNA 4PJ7F 3I3BA 4WI5A 5CEXB 5KBNC 4LARL 4PV9B 3L3HA 4KY1H 4Y8DC 5HHXL 2VZUA 4OIIH 1CE1H 4JO1H 4Q74A 3VRIA 3GSNA 4Y5YC 1TQCC 3EOAB 5I9QC 4M8QA 5C09B 3V5DB 5T5NF 2QHLA 3UJIL 4NO0D 4LCYB 3TV3L 1FL3A 1D6EA 3BGFC 4PRNA 1KPVB 1X4YA 3PQYB 2WMPA 3TIDA 3IDNB 3FOLB 1JNLH 4HKJA 2VO5A 1MHPL 1BLNB 1U2HA 5JA8B 1EUUA 3SQOL 3L1OL 4RGNB 1J86A 5FDYA 5HHME 3LD8C 2M8XA 1UA6H 2B0SH 4ZFZB 5I30L 2YK1L 1B0GA 4NZUH 2Y5TA 3V6FB 4N1CA 1U93B 4KC3B 1CWVA 1YJDL 2YD4A 3U4BH 2X7LB 3PWPE 3FONB 1OAYL 1E27B 4NCC1 2C3GA 3L6FA 4TSCH 2EDKA 5D6DA 5DWUH 3RTQC 1X5HA 3RAJH 2WM0A 3DURA 4JM2C 2DIJA 5EU4B 4MD4B 5FGRA 2DTSA 4QY8B 2ZKHL 5TFSL 1S5IH 4P4KB 4LLYB 5T5FH 2YMXH 4MJID 3MRKB 5C0DA 5ELIA 5CSBA 3U9PL 1Q9LA 1F3DH 3VGFA 4UINH 4XNYL 5FGCE 5J6GA 4XNMB 1IEBB 2VISA 2ICES 2VDML 3PWPA 3C60C 5KVFH 1HXYA 1SVZA 8FABA 3SDCC 5IVXA 4AH2B 1ZE3C 1Z9SA 4KDVA 3A6BH 3GJEB 4JHWL 4F7TA 4LIQL 3F7QA 5EPMB 5KZCB 4X4XA 5GGUB 4PV9A 3CLEL 3PL6B 5LBSL 1MCQA 4R90L 4GW5B 4FHBD 1AC0A 3BXNA 1LD9B 2K7QA 5SWSD 1N5YL 1KTDB 5DYOB 1IAIL 2P8LB 5HYSB 5DMKB 5JUEL 3VXUD 3EJZD 3O4LE 2GY5A 3CGTA 5D1ZD 2W1NA 3ARBD 1B4JH 4LCYA 4F8TA 4RFNC 2GTZB 1ORQA 5LCVL 3S8WA 5FHBH 4DGYL 1QLEH 4OCMC 4OD3H 3U2SB 1EJOH 1NAKH 3IDNA 3MRQA 3FZUC 1NAML 1MRDH 1R24A 3HE6D 1KBGH 4Y19E 4IRJA 1MWAL 2ZCHH 2XTJB 4ZFOA 1KEML 2WP3T 3V6FA 4XCYA 2CMRL 2W0FB 3ZL4H 3O4LA 1A1NB 2X7LA 1UWEH 1WWBX 1N64H 4OFPA 3FONA 3OKKB 1T2JA 4ZOCA 4TYUA 4FABL 1IM3B 1SYSB 3U46B 1T6WA 1VESA 4MD4A 2CKBH 5BXFB 3ARPA 4LMQI 4QY8A 4NRZB 2DBLH 1XAUA 5SWZB 5I1KH 4JQXC 1F2QA 4BFIB 1YYLH 2LQRA 4KAQL 1I3RB 2EYSA 4WI2A 4IRZL 4L9LB 4QXUL 3GSUA 1IEBA 1HXMB 4EDWL 3HAEB 2JJVA 3IFOB 3HMWL 3P9MA 1OQXA 2HYMA 4ZS6D 2C1PA 4OZFG 4GFTB 3GJEA 1YEFL 1CDCA 1CXFA 3UTTD 4NBYB 1IGIH 1BWWA 4HBQA 5GGUA 4PFEA 4UIKH 1EHXA 3PL6A 3WCYA 2V2TA 2XTJE 3GRWH 3NVQA 1IL1A 4TRPH 1AGEB 1LD9A 3QNYA 1KTDA 3ARQA 2FJHB 2AJYL 5DYOA 3O6KH 1FG9C 5HYSA 4GAJH 5DMKA 4N5ED 2EIZA 4QRRE 1MCLA 2ZUTA 1C5CH 1DBMH 1CL7L 1FDLH 1CL7I 4M48H 2DF3A 3TO4A 2GTZA 4MXVE 1WWAX 5F6HJ 4XPTL 4ZXBB 3X3GH 3NAAL 3K8LA 5HI3D 4WWKB 5FUCE 2CD0A 3U2SA 4OM1L 3EO9L 4W4NA 1OGTB 4X5WB 1OAQL 4X7DC 3MRBA 2EECA 2IQAB 1KGCD 5IVXF 5I1EL 3KDMB 4XPFH 1TITA 5DR5L 3ZLQC 4IOIA 3KJ6L 1FVEA 3ARDB 1S8DA 2BERA 4PRHE 1I4FB 4Y1AB 4QRRA 1A1NA 1RZ7L 4Y4HB 4Y0GA 3ULSA 2NXYC 4GKSB 1IM3A 4IS6A 5H37G 2B4CC 3OX8B 2IPTL 4PR5B 5EFIB 4NRZA 4N0CC 4H1LA 4LPTA 4Y2OA 5SWZA 1C16B 1XEDA 2BVEA 4WHYH 4RFOL 5IESH 3GSXB 1I3RA 4LDLB 3RKDC 1NBVH 4NJ9H 4LCWB 3OJVC 5EN2B 4L9LA 4PRHA 1BZQK 1XGRA 2OM5A 2F74B 2NY4B 1I1FB 3IFOA 3QXVA 2GW5A 3V4PL 3OAZK 4PG9A 4GW4B 2FLRT 1NCDH 4X0KB 4FZ8L 5F1IB 1S5HB 4WFFD 5DZLA 2ZJSH 3IRZA 5GSRB 4P2OA 3MNWB 3W0WE 3IT8D 3RKPA 1R5IB 4LLWB 3QIBA 3KYKH 1YZZA 3GSOB 5E8EA 1WZ1H 1GHFH 4JFDB 1AGEA 4JANB 1DQDL 4LEXH 5FCSH 2FJHA 2E8YA 1JNNL 2OR8A 3X12A 1FV1B 4QHLB 2NY5H 2VXQL 1ZVYA 7FABL 2PN5A 1Q8MA 3LOWA 4DW2L 1J18A 5KSAC 1FCGA 1BQLL 5I75B 4WWKA 3O2WH 1JVKA 1UKTA 4Z0BL 1BWMA 4X5WA 1F11A 4OFIA 3W0WA 4GKNB 1ITCA 4JPWH 2IQAA 4J2XA 1KTLA 3KDMA 5F7KC 1NC4D 4DZBB 2EDNA 3ARFC 3DVGA 5DA4A 3TA3B 1R0AH 2NY6D 4YWGH 2FX9H 1NUFA 3U6RB 5B3NA 4Y4HA 3SJVD 3MRCB 4HXBH 2MOVA 1RI8A 4U6TA 1RUQH 1JPFB 2J5LB 5EFIA 2C4FU 1GGUA 3QZWG 1FZKB 3GSXA 3WKML 2NNAA 3HC0A 1DVFC 4LSSL 1RZIB 2EC9U 4TSAL 5IW6B 1AY1L 5EN2A 1S9WB 2J12B 1N4XL 3PP3K 5DURD 1FFQA 1WIUA 1FL6B 2F74A 1I1FA 15C8H 2HN7B 2CDGB 2DLGA 3GKWH 5IMMA 1BIHA 1FBIH 4OFDA 3HZMB 3D39B 2ICCA 1J8HB 3MJ7B 4UNTA 3T3ME 2VH5L 4FQQA 1WZLA 1S5HA 4P3DA 3RA7H 3QJFA 3C08L 1R5IA 4LLWA 4APQA 2BCKA 5EZIH 4ELKB 5D7JD 1S7VB 4ZTPL 4XCFL 1ZHNA 5DGRA 1NGPL 3FJTA 4JFEE 5JO5A 1JNJA 1J9CT 1FV1A 4NOFA 4PP2B 4QXTB 2LU7A 1X5IA 3MRIA 4Z9KB 1MCHA 1BECA 4N9GB 4QRPB 2RQ8A 2LVEA 1MEXL 4W6WB 2HWZH 4NCDA 1WEJL 5JIKA 2BY3A 1WWWX 4K23H 1IEAA 5ESVB 4GKNA 4IOFC 1U92A 4OGYH 4UAOB 1QVOB 2AK1L 4UU9B 1MPAL 2I07B 1ZGLB 5CJXC 4JFEA 3SOBL 1U8PB 3HG1D 4H8WL 3QFJD 1NKOA 2HT2D 1UH4A 3L3GA 1NCUA 4HGWB 3TCLA 3VWKC 2P5WD 4MNQD 4LL9A 5EBWA 1UZ8A 5E1AB 5IWLA 4L1DA 3TBSA 1JPSL 5J06A 2VDOH 4G6JH 2HT4C 4OSUL 1DBBH 4Y2DD 4AEIL 4OLXH 4OZ4B 3TEUA 3QO0B 4N0UE 1Z9OA 4XBPA 3EOBB 4U33A 5IW6A 4G8IB 1BZ9A 1DE4B 2E3VA 2ZUVA 5HGHA 4Z7NF 4JPIB 5EOTA 4GAFB 2HN7A 1MCOH 1J8HA 5DHVH 5FHAL 3O81A 2DL9A 4G7VH 4DOHE 5HTSA 2IMNA 1OSPH 3WEXB 4RGMC 1MIEH 3QI9B 3O6MH 1YY8A 4JB9L 4N0UA 2AJUH 1QSFE 2NLJB 5GS1A 4ZMAT 2CIIA 5J3HD 5D1XB 2Z91B 3BSZL 3H9SB 3A0OA 5KJRL 5HDBE 4OF7A 1IFHL 3OAZH 2Q76B 4XPBL 2PYEE 4PP2A 4QXTA 4R26H 5HVFB 1NPUA 2HFGL 5HXMA 4QRPA 4KKBC 4HLJA 4X7SL 1HSBB 1QPPA 2FZ3B 3AMKA 4HMEA 5GGVH 3MRRA 3PABB 3MV01 3B2VL 5ESVA 2APBA 1QSFA 3MXWL 3QEGH 4I13B 1QVOA 2MCG1 3THML 5FYJU 1K4DB 5JA9A 4NHCL 3T08A 5CSZA 4UU9A 4I0CC 2I07A 3DVNB 1ZGLA 1QRNE 2BOBB 3QEQE 4POYA 1LO2L 3CLFH 1L0XA 2OR7A 2R29L 4M1CD 2VABB 4TQEH 2FD6H 2H2SD 4RISH 4EUPG 4IM8A 3TPKA 3F6IA 3FKUS 4ODWB 5MERA 1U3HB 1A7OH 2Z92B 4LDEB 1FSKC 4WTWA 4P59H 5JOPD 2YZ8A 4FP8H 4OZ4A 5I1HH 3QO0A 1JF6A 1JWMB 2ZG3A 3V2AR 4OCRL 4G8IA 2QQKL 1DE4A 4N8VB 1UADC 3BIKA 3VWJB 1MI5E 2AK4B 4FNLL 5IROC 2HRPH 3AFLA 4L3CB 1DBJL 5B8CA 5EBMB 1JFQL 3U9UB 4UMGA 3SDXB 5J4MA 1U8JB 4OJFL 4G3YL 1UVQB 3JBG7 5TE6H 3O3BA 1HYSD 4RDQG 4F33B 5DJ8A 5IW3A 3L3KA 3EYUL 2XQYG 2NLJA 5GS2D 3BP4B 5D1XA 3DRTA 3H9HA 3MFFB 2VWEC 3K3QA 3NCJH 4LVNC 3H9SA 1CFTA 2PO6B 2YRZA 2BRRH 2R4RH 3C6LD 1MI5A 5INCA 2X4PB 3VFGH 3HA0A 4OLUH 2E9IA 12E8L 1RFDH 5T1LB 1NFIB 1DQQB 3CZJA 4A6YH 5BJTA 4HUKB 1HSBA 3BP7B 2JB6B 4M43H 1PLGH 2FZ3A 3GNMH 2VXVL 5FYJL 4NM4H 1D3CA 2EC8A 2LU3A 3K4AA 3T04D 3LB6D 1K4DA 4HZLA 3DVNA 1G1YA 2BOBA 4FQHB 4M5ZL 5F93C 3CFIC 2XZQL 2AK4E 1LO3H 3F65A 3S36H 3GMPA 1GYAA 3IVKA 4NM8H 4PJ5D 4X6DE 3HE6C 3BZEB 4E5XB 2FATL 4JAMB 1CGSH 4W81A 1U3HA 2Z92A 4X9FA 3ECBB 2OI9C 5E6IB 5CCKL 4IDJL 2W60A 1LK2B 3RWGA 1JWMA 3OKNB 1R5VB 3JTSA 4N8VA 2A38A 2R4SH 2NW3B 4B53A 4O02L 2AK4A 1BD2E 1WAAA 2ERJB 2YPVL 1JPGA 5EBMA 4FQXA 2FIKA 4X6DA 3SDXA 2ESVE 5HDBF 2AJXL 3BMWA 1NAMB 1Y0LB 4F33A 3EDJA 2C4FT 1LWRA 3OQ3B 3V8OA 5KVDH 4ODVH 3BP4A 2IALA 2VLLA 2PO6A 2A74A 1JPST 4LLDB 3EDFA 1KLUA 4HGKC 1BD2A 5E08H 2EC9T 3BQUD 5IMLB 1MIMH 1NFIA 1DQQA 3AMLA 1HE7A 2ESVA 4X7CC 1IBGL 1AD0A 2VDQL 1JK8B 1UB6A 4XVTH 4PJAE 4IIQC 4P46B 2OTPA 3QXAB 3QDJB 1N0XH 4UT9L 2VN7A 1QSEB 4N5EC 2J6EH 4IRSB 1UENA 1Q38A 5FA4B 1O0VA 2VLRE 2DKSA 3MLVH 3BPLB 2JIXB 4NN5B 4Y19D 1KT2B 5HI3C 1HQ4B 4ZSOB 1YA5A 4JY6A 1J0IA 3BZDA 4Y4KA 4MNGE 1RU9H 3IXAB 4EQ3A 4TPRH 3OZ9H 4LVHB 4G6MH 1MJUH 3U1SL 5HYJB 4HPOH 1IGYB 1LK2A 3G04B 4DKEH 1P84J 5FYKD 5T1KB 1BGXL 2VLRA 5D7KD 5DJ6A 2P7TA 2QADD 2G2RA 2NW3A 1I3GH 1INEL 4LHQB 3CNKA 5F3HB 1R3LB 1X44A 4KRPB 3UC0L 5DSCB 4ETYA 1GGYA 5KSUB 4OZIE 2O61B 4KV5F 2J3SA 2H41A 1SEQL 4PJ8B 1YEKL 1MWAA 4ONHA 3L3IB 4Y5VB 4HUUB 3GMLB 4HSQA 1OWWA 2P43B 4LSRL 3RL1B 4NFCA 1EXUB 4KZDL 4LLDA 2LV4A 1DBAH 4TSBL 4MXWL 1AFVH 5IMLA 1NSNH 1RHFA 1U8NB 3O3UN 5EZOL 1AH1A 4GMTH 1NC2D 2UY7A 4OZIA 2DLTA 1Q0YH 4P46A 3BKJL 4GW1A 5KTEH 4JO2H 3QDJA 4DKAA 1Z5LB 2C3WA 1WAAF 5JQ6L 2H3NB 4L1HA 4PBWD 3SDAB 3MZGB 1QSEA 3QXDA 1OPGL 5IK3B 4X6DF 3SDXF 3MREB 1CD1A 2H1PL 4QHNB 1A1MB 1X6LA 2JIXA 4NWUH 3HZKB 1IKFL 5HY9A 1KT2A 2VR5A 4ZSOA 4FS0A 4H0HB 5DQDH 4G80B 1Q1JL 3KHQA 3FB7B 5DEGB 1INQB 5IB3B 3IXAA 4QWWD 4O5LL 4NQEB 5IJKC 3VMNA 4HX1B 4QGTA 5HYJA 1IGYA 1JRHI 2ZP0T 2ARJB 4MAYA 5J12B 1IE5A 4ZPVA 3G04A 3MV8D 2NY6C 2IGFL 2QLVB 4P3CL 1HHHB 5D1QC 2XG4A 2F54E 5D8JL 3C5ZB 4WUUD 1II4E 5I6XB 1JGDB 1EEQA 5F3HA 5C0IB 1R3LA 1W8OA 5M94B 3O3DB 4C83A 5DSCA 1DP0A 1JMZA 5DJ2B 2JB5H 3C09B 1GPOL 3REVB 1QA9B 5KSUA 1A3LH 3MUGA 5AYUH 2R2BB 5CEZD 3RPIA 2AEQH 4FFZL 3HC3L 3L3IA 3SO5A 4XB7A 4HUUA 1HDMA 2VDRH 4F37K 3QNZA 3U7WH 1GJIA 3V0VB 5E2TL 2F54A 1KCKA 4U1JA 5JDJA 5HYEA 1U8NA 3WLWC 3S97C 3EJYD 5J0BA 2AJSH 5E95B 1P7KB 1RJLA 4ZUWB 1MSPA 2V9QA 4PRIB 1HIMH 3RDTB 3G6AB 5D7JC 3LDBC 2QQNL 1K8IB 1Z5LA 3K2UL 1DQLL 2WIIB 4HS6B 5C2BH 2H3NA 3OPZH 3SDAA 1Q0XL 5IK3A 3MREA 4WW2B 1RHHB 3KPNA 3D85A 5ID0B 1W72H 4JRXE 3NPSC 2MWCA 1A1MA 3ESVF 1BVKB 3VXME 1GC1C 3HZKA 2VDNL 4PJCE 2IFGA 4U6VL 4OLZL 4K7PL 1B6DA 2G75A 4EVNA 1F90L 2UWEB 2VXUH 2HH0H 4I18C 4G80A 5HHOB 1UWGL 1MJ7H 5DEGA 1INQA 2EDWA 5ANME 2UVEA 3VXNB 3AGVA 2HVJB 4KQ4L 1CK0L 1A6AB 2ARJA 3B9KB 5F96L 5EU3B 5GPRA 2HT2C 3CDFA 1HHHA 5I8OL 4JRXA 5C0CD 1G9MH 5J1TC 4OZIF 1T5WB 4YZFE 3VXMA 4PJCA 1P2CA 3C5ZA 1HCVA 3QDGD 1JGDA 4TVPL 1HCFX 5GRJH 5SX4H 2CR6A 2WK2A 3CFKA 1A6WH 4Y2DC 2FWOB 4Q9BA 1DQJA 3I50H 5DHYB 2FH8A 1G6RL 4AJ0A 5ANMA 1ZWIA 1XF5B 2R2BA 3MGOB 3EFDL 4JPKL 2NY2D 4F7CB 4ZYKA 4PJ9D 4JDZB 1OTUC 4HHAA 4PY7B 1KB9J 2DIAA 2G9HA 4X4ZA 3V0VA 2WIMA 4Z77B 3VFWB 2V17H 4I1NB 3SKMB 3ZKNC 4CJ0A 1BFOB 3MA7A 4U0QB 4XRCA 1V7MH 4BSWA 4XBEH 4GMSL 3TBVA 1SJHB 4ZUWA 4PRIA 3EBAA 3G6AA 4GLRH 5DJYA 3CFDB 4JLRB 3W39B 5J3HC 5JHLL 1K8IA 4ZUTA 5FV2A 2OK0H 3CIQA 3P4OB 2AERT 2WZPD 3GSVA 4WW2A 1QYGL 1RHHA 1YNTB 3ROOB 3KYAA 1AHWB 3L95A 2JJUA 4HWNA 3A6CH 2UWEA 3KPRB 5T3XH 3WE6A 3RWJA 3QO1A 5AZEH 1OQOA 2Q8AL 1J05A 5I76A 3VXNA 4MNHB 1JUFB 1MHEA 2HVJA 4KJYB 1QHOA 3SKOB 3MBXL 2QSCH 4CVUA 2J8UB 2NY0D 3B9KA 3DARA 3QEHB 5HDOA 5EU3A 3WBDA 1TETH 1CLOL 1H8NA 2F19L 2PR4H 3O2DH 4RFEB 5GHWH 1ZANH 4M1CC 1KIPA 2NX5E 1HSAB 1S9XA 3RHWK 2H2SC 2RCSH 1BF8A 1YDPB 3W2DH 1AP2B 3H0TA 4H0GA 1YNLL 2X5PA 1T0PB 4NKDB 5DHYA 3HHRB 4XHJD 1XF5A 3RUGE 4F7CA 3ISWA 4PRPB 5JLZA 5L6YL 1K9TA 5MEQB 3QR2A 4LSTL 5D9SA 1FPTH 4K9EH 4P2CG 4PGEA 4TNWK 4DFIA 4PY7A 1SBBA 4FXLA 2OMBA 2NX5A 1YYML 4Z77A 5FKPB 3VFWA 4QRUA 1SJXA 4DAGH 1BFOA 1IGCH 1DSFH 1KB5L 4WO4A 2Z8VC 1HYSC 1ZSDB 3HN3A 1SJHA 2GYSA 1MJJB 1VCAA 3F12A 2DRUA 1DEEB 3RL2A 2PYED 3S35L 3KHOA 4L3ED 1I1RA 4P5TB 3RIAK 1D6VL 1L0QA 3ZYOA 1UACL 1OOAA 2QKIB 5CP7A 1YNTA 4K8RL 3JWDH 3C6SB 3ROOA 4A2MA 4UQ2A 3FMGL 5CSGA 4YDLC 2BVTA 4MMZC 4X5XB 1UXWB 4JFFE 4ETQA 1VEOA 4ODSH 1YQVH 4M1DL 4P3WA 3MLYL 1NGQH 3KPRA 1AR1D 1U41A 1J0KA 3LB6C 4L5FL 2X4TA 4YZFF 4GS7C 4OCWL 4MNHA 1JUFA 4KJYA 3AVEA 1IZKA 2DWEB 4DEPB 1KG0B 2DQUL 4K3DL 4UQ3B 4J1UA 2CLZA 3X3FH 3EOYG 4HEME 2V2WB 4KTDH 4JPVL 1ZHKB 1DN0A 2EZ0C 3I85A 5T3ZH 1HWGB 1LP9E 2VZ1A 4WGWB 3L5XL 1AP2A 3VI4E 3ESUF 4I8DA 1XZ0B 3BJLA 5IMOA 5DFVD 5FO9B 2BVOA 5EOCH 2BC4A 4WW2F 5TQ2L 3B8SA 2EDYA 1DDHB 1P1ZB 5MEQA 4HZAA 3Q48A 3RX8A 3LEYL 4P23D 3IFNH 4ALAL 2UWEF 4QYOA 3CAFA 5FKPA 1CXIA 2BXYA 3CSBA 4L29B 5GRWA 2VQ1A 1CGWA 4XP6H 1ZSDA 2OJEB 3N1MC 3MNZB 1MJJA 1XGTB 2NMSA 3O2VH 3AXLB 5CKGA 4NZTH 4IOSD 2XY1A 3LN5B 3WNKA 4P5TA 5T3XE 4LGRB 4NZJA 3E3QE 1GCFA 1EX0A 4YBLC 5L88L 3BQUC 5MEOB 1BFSA 1V05A 3RY6C 2WQ8A 2VTFA 1QNZH 3GM8A 3KR3H 2E6JA 3GHEH 4GQ9L 4X5XA 2E27L 2YPLB 1OARL 2BDNL 5DVLA 5KVMC 3E8UH 2P5EE 5FDWA 2ZUXA 1LMKA 3NBNA 5JPNB 1H8SA 3D25B 3RIFF 5DS8B 5I74C 3WXVL 3HAEH 3GBMH 2DWEA 4PRAA 4IJ3B 1OGAD 3K8KA 4R2GD 1UB5B 5FGBA 5TDNA 1CVRA 2VL4A 4I48B 2HJKB 5IUSA 3H3PL 4F9LA 2ED7A 4OM0L 4R8WH 5GZOD 4X80H 3DXAD 1XZ0A 4P2QD 3TN0D 3V9FA 2P5EA 3LAFA 5FO9A 4JY5L 1VSCA 2HKHH 2Y07L 4NBZB 2P8PB 3MJ6A 3DLQR 2JJSC 3ALWA 1N59A 1Q72L 3S9DB 3QIWA 2AGJH 2QADC 2MQ3A 3D9AH 2AEPL 1JWSB 2HJLA 3QA3B 5HGDA 5ISZB 1FGVL 3AU1B 5J57B 2OQJB 5F9JB 3N1PC 3X13B 1N2RB 4KMLB 1T03L 3MV9B 5CD5D 1JRHH 1G9NH 5EIIB 4XAWH 1IAMA 2ITCB 2QR0B 3MNZA 5BW7A 2MFNA 4JVPA 4LGSB 3ZSSA 2QL1A 4JRYE 3BD3A 3BKYH 4F3FB 3LN5A 3W11D 1VERA 4KMTL 3S37H 3JV5A 3DMMB 5E94A 5MEOA 3HRZB 3ZDZF 3ZKMD 5D7IE 4JFYB 2O5YL 1CGXA 5A2KH 3IDMA 5DRNB 5LVEA 1A7RL 2K1MA 2DMCA 3ZYZA 2YPLA 5C6WH 2F5AH 4XMKH 1C5DB 4R0LB 1TMCB 3BPOB 4X6CE 2A6DB 1T89C 4DN3L 3D25A 5JPNA 4JRYA 4DQOL 4EI5C 5DS8A 2LVCA 5EH1A 5CBEB 5FUCC 3VI4F 2Q7NA 5GJTH 1UB5A 5K9OA 1VFAB 3GMQB 3DX8B 4I3RH 3QFDB 1RULL 2AKRB 4H88L 1CU4H 4XP4L 1NFKA 5EC1B 2HJKA 4OKVB 5DJDB 4OGXH 5ITBL 3TVMC 3NZ8B 4N0RA 3U36B 4AYFA 3SPVA 4UT7H 3QAZC 1QSVA 3W81A 5DRXB 1F3JB 4BH8A 2E7HA 1P4LA 1XF3B 4QWWC 4X6CA 2XQBH 5DFWH 1IM9D 4G7YL 4KJWD 4KKAD 2EEDA 2P8PA 2IH3A 5K9JL 1CGVA 1A1OA 5IVNA 1P7QA 1ADQL 5F88A 3NCYS 4JFXB 2BNUA 3ZT7A 4HWBL 4E41D 3CMOH 4UV4H 1GL4B 3QUXB 4ONOA 3QA3A 1PEWA 2BNRD 4U7MA 5E0QA 4AG4L 1ZK9A 5C1MB 2OQJA 2DJSA 3KPLB 1RMFL 3AREB 1N2RA 2BZDA 4OD2A 3HRPA 3SBWA 3UX9B 4Z8FH 5DUPL 1U2CA 5EIIA 2ITCA 4YGVB 1YNKH 3IDIA 1V7NH 2AW2A 1HHIA 4HKXB 3BE1H 3BZ4A 4CU6A 5CILH 2XWJB 1PGRB 3S3SA 4MWFB 4Q6YA 3DMMA 2VLJE 5I1GH 3QUZB 3T77A 1VEMA 4XP5H 3HRZA 4JFYA 3BAEH 4HXAH 2WQRA 5DRNA 2ZWLT 4U1KA 5KW9L 3OAUH 2KBGA 3AY4A 4NOBA 4CN1A 3TGXA 1KCVL 3S34L 5GGTH 5EOCJ 1J12A 5C6TH 1JGLL 4XTRD 2IFFH 4WHTB 5I1JH 2OR9H 4KQ3H 2VLJA 2GY7B 2GJZA 2DQHL 2CH8A 3WDIA 1VFAA 5E2VH 3GMQA 3QDAA 1X5KA 3MGAA 4P5KB 3QFDA 4O2FA 4DJMA 4OKVA 3QPXH 5DJDA 4GSDH 1OB1B 4JKWA 1WLHA 3U36A 3NZ8A 3O8XB 2BNQE 2IPUK 2R9HD 1RUAH 5DRXA 4U1NB 1F3JA 1BX2A 2AJ3B 4K3GA 4GXVH 5D7LB 3D0LB 3UJJL 5T33H 4DN4H 2BP3A 4NP4L 5HHVL 1AI1L 4FN0A 4OQTH 1YN7A 4WTZG 4XNUH 3KPMA 1I9IL 2IAMA 2OTUB 1OF2B 2B4CL 4ZS7L 5C0AE 3BUTA 4U3XA 4APQC 1CICA 3IDXL 4O4YH 3I6GA 3Q5OA 4I5BA 5E8DH 3KPLA 1OTTC 2KKQA 3K74B 3AREA 5CINL 5D96C 4XGZB 5I1DA 2NY2C 1VKXB 2EH7H 4PJ9C 3QUYB 1DR9A 3IDYC 1WTLA 2CUMA 1OD7A 4C58B 4UTAL 1KLGB 5DRZA 2NY1D 4OV6F 4I0PB 1J87A 4NPYB 1EEZB 4RX4A 1HHJB 3F7RA 4PJHB 3RNKB 3SCMB 3QUZA 3B3IA 2OZ4L 5CBAA 1E6JL 1R3JB 3TZVD 4PV8B 2EDLA 1WBXB 1PJ9A 5C0AA 2DTML 5ETUA 1EZVX 2EYRB 3ZTNL 1T7YA 1ES0A 5E99L 1A4JB 2NXZD 3T0EE 3VGAC 2HLAB 3IJYB 5E24E 4WHTA 3VI3E 3OB8A 4ONFL 1I9JL 3Q1SL 1IGTB 5DK3A 3MXVH 3W5NA 4FQ1L 1G6VK 1H3TA 25C8H 5TDPB 4G8GB 4OT1H 3WO4C 1LE5B 2LTQB 2YN5A 3BWAB 4JJ5B 4NIKB 4HLZG 5CIPB 3DV4A 1OB1A 4WU7B 1J5OL 1DUYB 3WIFA 4NNXB 5EU7E 4YAQB 5IQ9A 3T0EA 2X4UB 4JR9H 3HPJA 4U1NA 4M6NL 4CU8A 2Q86B 2VERN 3RWHA 2AJ3A 2DM2A 5D7LA 2Y06L 5CZVH 1KCSH 5D2NE 4B50A 2PKDA 4NO5A 1RUMH 2MQ0A 2BJML 2A77L 3JXAA 5TQ0L 4CDHA 1GIGL 2JE8A 1EIBA 4HBCH 4R6UA 4NUGL 3T0VA 4MA3A 1CBVH 3STLA 2OTUA 1WWCA 4YXHL 5M95B 2ICWI 1GVIA 1ACYL 4QOKB 4ZNEA 3FAWA 5FB8A 4XHJC 3QIUA 5CWSB 1VKXA 3FCTB 2BMKA 3LCYA 3C8KA 4ZPTB 2E7LA 2XZCH 4ZAKD 1A6UL 4I0PA 4HPYH 4NPYA 4WENB 2NY5C 1HHJA 1RZKH 3MLTA 3MOAH 2HFFB 4GBXA 3DRQB 4PJHA 3RNKA 4HWEH 5HDQL 2BFVH 4RNRA 4M03A 3RGVC 3WJJC 4D0CB 4ZFFB 2YD6A 5D93B 1PD6A 2GCYB 1BF2A 3GGWB 1TZHA 4FTVD 4UBDC 5C8JA 3D69B 4L8SC 4LSDA 4KTEL 2Q6WB 2P46B 1VHPA 1OLLA 2HLAA 1UJTA 3DUUA 1A5FL 1IKNA 1G6RA 2MHAA 4UTBL 1A9BB 2R0WH 3U30B 1X5JA 4ERSH 2GUOB 5SV3A 1WQVT 5BRZD 1IGTA 2YUZA 5FF6A 4EUPB 4ZUUA 2DS4A 4KVCL 5I1AB 3AB0C 5IFHL 4WUKH 4GQPH 5HYFA 2RJMA 3H42L 1LE5A 3IFPB 4JJ5A 3CFJA 1GGCL 3HNSH 1JNHB 5CIPA 4Z5RB 4WU7A 1AR1C 5T5NG 1DUYA 3WFEL 1KB5B 4YDJA 1U8QB 2Q86A 3H9ZA 1KCUH 1IQWL 4XXDA 4K07A 5A40E 5EUOE 3UPRA 2AABH 1MNUH 2R0LL 4OUOA 1I1AD 2DD8L 1R5WB 3ZTJH 3MBEA 5IBUB 2PUQT 5DD0H 5E5MB 3X11A 1EV2E 3MCKA 5JXAL 3OKMB 5LXGL 3QDME 4JCLA 1RUPH 4FQPA 3SKJL 1TPXB 4C4KT 4Q0XL 5IIEA 5ACLA 1ORSB 1D5ZB 2Z31D 4I2XE 1SY6H 4OQTA 4TNVF 3PWJB 4NC2B 1BAFL 3VFNB 2R0KL 1AE6L 4CADA 5MENE 3CDYA 5CWSA 2EDFA 5EUOA 3NIFF 4PLNC 1TJHL 3O0RL 2ILLA 3GUTB 2Z35B 3F7PC 1H5BC 2YD8A 5I16B 3ARWA 3SGEH 3QDMA 2C1OB 3PP4L 3FQXA 4M7KH 3TFKC 1TZIA 4D0CA 4ZFFA 2I24N 4BZ1H 4KPHL 2GCYA 4FQCH 4NQDD 3MLZL 4J4PA 3D69A 1YPZE 4NZDA 5MENA 5F7NC 5C0BB 5GRXG 5C07D 4KI5F 4YHYB 4GRLA 2CLVA 3QHFH 5TH2B 4XVJH 3VXSD 5ADPH 2XZAH 3VFSA 4LLVB 1SEBB 3VFTA 3QUML 1MCNA 2PXYB 1UXSB 5I1AA 2HTLC 4PYHA 4NZRH 1JTTA 5F9WC 4L4VB 5IVZA 4M1GH 5F71A 1JP5A 5L2JB 2NY3B 4YPGB 2I26N 1YPZA 5I1CH 4JO4H 4M7JH 4Z7QE 3FTGB 1U8QA 4PJHF 4G9FD 4NHUB 4LRIC 3FO9B 5EORL 1XGPB 4PRBA 1KIRB 4XX1E 3TBWB 3WS3B 4YQXL 4R2GC 1PG7H 4BQ9A 4PGJA 2HKFL 3BHBA 4OUUB 2BOCB 3OKMA 4WV1C 2HJFA 5DK0B 4JN1H 1A2YB 2J8HA 2AS5M 35C8H 4XP1H 3BGMB 4LQFL 1JPTL 3MLXH 4ONGH 4OZGB 5GRVK 3ALPA 3TN0C 1D9KD 4LSQL 5HI5D 3V95A 1QBAA 2CO7B 1AGFB 2ADJB 1A6PA 1GGIH 2O5XH 3VFNA 2UUDK 5F7YC 1LQSR 5C08D 2CDFA 1I8LA 5C0JA 3O6FD 5C7XH 1TQCB 5KANG 1KJ2B 3SE9L 2Z35A 4OLWH 5I9QB 3HMWH 4WCYH 3NCBB 1JJUA 3MV7B 3ILQD 4HUXA 3ARGD 4NC1C 2PF6A 1MY7A 5CD5C 4U1IB 5A2LH 2G60L 3PHOB 4LU5H 3S36X 4CMHC 3LD8B 3SDDD 1RZFH 2X4QA 5C0BA 1MRFL 5CJOH 4EN3B 2VB5A 3QHTC 2EH8L 3MOQA 3W11C 1IAKA 3O4OB 1YEHL 1SEBA 3ZKMC 2PXYA 2VLME 3UPCA 4LSVH 4XMLH 3RTQB 1YN6A 1CZ8H 4L4VA 4JM2B 3HNTH 5L2JA 3MLSH 1FFRA 4XWGH 4YPGA 4UNVA 1ZLWK 4YHOH 1MJ8H 2ITDA 3TJEH 3FTGA 4OD1H 3H3KA 2OJZH 4C57C 3QWRD 3WXWH 3FO9A 4U6XA 5BV7H 1KIRA 5EA0H 3WS3A 4C4KO 4UOW0 5C09D 4F9PA 1MVUB 3W9DB 2E7MA 2R2HB 1D7FA 2X4NA 3MYJB 5JOFA 3ZE1E 3ZHDA 3C60B 1FFNB 3JTTB 1R3IL 4YUEH 2VE6B 3BIAX 4OUUA 5BVPH 3SDCB 4AT6A 3PQYD 2BOCA 1QHPA 1B0WA 1MFDL 4O00A 1A2YA 2YHGA 5CMAA 4LPUA 3CXDL 2IANE 3BGMA 4G6FB 3PGFL 1FL5A 1A0QL 1RIVH 2FECL 4OIBA 2ADJA 4KJWC 1YEIH 2Y9RT 3E6FA 5TE4L 4KKAC 1AXTL 1IC4L 3IB4A 1RVFH 4UDUB 1UKQA 4XVUD 4S1QH 4Y5YA 1AJ7L 2VOTA 5IW1B 4UOW1 1CLZL 4PJIB 1N8ZA 1YPZF 3U48A 3WD5L 1TZGH 4H0IA 2PW2A 1J0YA 2DAVA 4RFNB 3KLAB 3MV7A 1NL0L 2IANA 3D3VE 1WTGT 4P4KD 1UEYA 1T3FB 5TE7H 1LO0H 1ZA3B 2AEWA 1EEUA 4U1IA 2OL3L 1NCCL 4TVSa 3EO1B 4JHAH 2FL5B 5FM8A 3WLBB 1DBKH 1NGYB 4JZJC 4JZNB 2PNDA 3VFUA 2DLEA 4WDIA 4C54A 4YLQT 3ZT6A 3N9GH 5FUOL 4FXKB 4Z7VB 3CX2A 1EPFA 2FR4A 3OG4B 4ODTL 3CPLB 3RTQA 5KOMC 5T3ZD 5KZCD 4JM2A 3PWLB 4FQJL 3PL6D 4WU5B 4JZOA 5E9DE 2X89A 3CDCA 5L9DL 1IAOB 3T1FB 3QJHA 2MCPH 1DLFL 2F58L 3JWOH 4LEOB 1OM3L 1MVUA 2Z8SA 3W9DA 5KG9B 3RVTC 3MYJA 3C60A 1JGUL 1FFNA 3JTTA 2GITA 2CK2A 2VZTA 3VXRE 3SDCA 5K9QG 5I19L 2G5BB 5H94B 1ZOXA 4FFVC 4PBXA 3AAZA 4X4ME 1D5XA 4KDWA 2R9HC 5GJSL 4WTXA 4XAKD 5TJWK 1KJ3H 5I71B 4YC2C 3UTSE 3ILPA 4LF3A 1U6AL 4J8RA 5IFAH 3G5XB 3U82B 4UDUA 2A2QT 5E4EB 1DZBA 4LAQL 5CEYB 5D2LE 4Z7VE 1ZLSH 5HYSG 5IW1A 3DECA 4M7ZB 1NLDH 1JZ3A 5DO2D 3ULVH 3CVIH 3GMMB 3PNWB 5SWZD 1TJGL 3LEXB 2UUDH 3EO1A 1A7NL 2FL5A 3UTSA 3WLBA 1EHNA 4POZC 4JZNA 1A22B 3TH4T 4JFOB 4QRSA 2C3VB 3PDOB 4YIQB 1V3MA 4FXKA 5EU6E 4Z7VA 5DD3L 3UBXI 2VMFA 3TZVC 4JKMA 4U49A 4I3GA 4HWBA 3IAGC 3RWFB 2NXYB 3O9WB 4OCSL 4XC1L 3V0WH 4QXWA 5J8OA 3PWLA 4YO0B 32C2B 2NXZC 5KS9E 1KPUB 3FRPA 4BFBD 2VLKB 4WU5A 4H1LG 3C5SB 3VW3L 4JQXA 3T1FA 2XIDA 5DJXB 1CGYA 4R4FL 1JHLL 4JFZH 1EK3A 5CFHA 2GJ6B 5JR1L 5C9JB 5GRUL 5JORB 3HLAA 5K33A 4ZXBD 1FYTE 1UZ6E 2YD1A 2V5TA 4CBPA 4OQ1A 4WWKD 2G5BA 1UCBL 4AMKH 5HD8C 1ZLWH 5EOQL 2KQNA 2NZIA 1WSST 3DI2B 2Q3AA 4V1DB 2XICA 4HK0B 3QSKB 1QKZL 2XWTA 5F8QC 2VDLL 2PYFB 5DVKA 3M8OH 2SEBB 1EA9C 3ARDD 2YD9A 2I60L 3G5XA 2Q20A 4Y1AD 5IV2B 2EIBA 2OTWA 5EO9B 1NLBL 4JM2F 2IQ9L 2YXMA 3NIGE 4XP9L 4Y4HD 1S7RB 1FYTA 3I75B 3GMMA 4NN6C 3GI8H 1P6FA 3PNWA 5KSAB 5T1DH 3C2AH 4WRLA 4OCYL 4ZQKB 3MR9B 1CQYA 2XRAL 3LHPL 4M4PA 4D9QE 3D1MC 1A14H 4PREB 3BRDA 4E42B 4LCWD 4S1RH 1OL0A 4ZAKC 1NCBL 3C9NB 4JFOA 2NY4D 2C3VA 3NN8B 3PDOA 4Q2ZB 5ACZA 3WKNA 2ZSVA 3VXTA 2XNAA 1QFHA 3QCVL 1T22B 5JDSB 4Z7UB 3BT2L 3RWFA 3MNVB 3TJHD 5DC4B 4ZTOH 5I66B 1MCEA 3HNVH 5KN5B 1KPUA 4G6AD 1FZOA 1DFBH 3GMNB 4TUOB 2ZUUA 4JFDD 2R2CA 1JF1A 2I25N 2AQ2A 4QXGH 4FQIL 2QJDA 4HJ0C 3BH8A 5DTFB 2GJ6A 1FJ1B 1F3RB 3IF1B 5C9JA 1YMHA 2CXKA 1LGVA 2BHYA 1F4YL 4JG0L 1T1ZA 2EE3A 5C0GA 1UM6H 4FQLH 4WW1A 4HK0A 5IEKB 3ULVE 3LH2H 3ES6B 4Z7VF 1RUKH 1ZT4A 5H35A 1K6QH 3KJ4C 5DEFB 1YMMB 5ENWA 1I1AC 2SEBA 1MELA 2ZSWB 4HV8B 4XZUB 2YWYA 1UJ3C 5EZLB 1NCAH 3GI9H 3IFLH 3TA3D 4CUCA 4MQXD 4XBGB 5EO9A 5DT1L 3TIEB 1LK3L 4FNLH 3LN4B 1J7VR 4ZO7A 1KELH 1OP9A 2V7NB 4MA8H 2CR3A 4D3CL 2Z31C 3FQUA 4E0RA 4FFYH 5TPWH 5KSAA 1PKOA 1OAXL 3D0VB 4MQ7A 4QRQB 1G0DA 4NKOB 3E2HC 4PREA 3KYNB 4NSKB 1T04B 3CVHL 2XN9B 2IEPA 3IKKA 3C9NA 4RAVB 2H9GB 2E8ZA 4BUHA 4JREC 1F58H 3V6ZB 3NN8A 5AEAA 1PZ5A 4KK6C 3BP6A 4WY7H 3ARFA 4CN4A 3MLWH 3D39D 1T22A 1J8HD 1S3KL 1AKJB 5JDSA 3LKNA 3KXFB 5BZWB 1QBMH 2R2EB 1NCWL 3QWOA 2ICWA 5A16B 5F8RC 3HMXH 1QQDA 3MV11 2FO4B 5FA3A 4HQQH 1WCBA 3H6JA 3OHXB 5FECB 5JHDD 4EBQL 4HD9A 1QOKA 3GIVA 1JGVL 1DVFA 3NFNB 3U7AA 3OTTA 2JCCE 5DTFA 2CK0H 4JKLA 1OAZL 5AD0B 4R7DA 1FNGB 1G9MC 4NQXA 1PSKH 4QRPD 1WBYB 5GGQH 3RJDA 5EU5B 3ZKXC 3QG7L 4PJFB 1CYGA 1KV3A 4OFVA 5IEKA 3NIGF 1K5NB 1NMCB 3EJJX 5GGRA 4JVUA 1C1EH 5IJVB 3WN5C 5LQBH 1C7SA 1Q9WB 4PLOB 4XZUA 4HIJA 5EZLA 1BOGA 5KVGH 2CJUL 1UG9A 2XT1B 1MAMH 4LHJB 1AO7E 5DRWA 4K7PY 3TIEA 1MFCH 3QUMB 4HFWA 5JTWA 3BGAA 3LRSB 2NZ9C 3IRPX 2ICWJ 1M1SA 2V7NA 4KUZH 3NMEA 4K3EL 1T5XB 4RWYH 3OXSB 1D9KC 5HI5C 5DJ0A 5B3JE 3VD9A 2DMBA 2BY2A 2J7LA 5BS0E 3HZVB 3KYNA 4XNXL 5GZND 1T04A 1XF4B 3O6FC 1VPOH 2KPNA 4YHZH 1I8KB 3C8HA 2VUYA 3CFEA 2Z4QA 1AO7A 5CJXA 5L2KE 1KTRL 3S96A 5DD6B 4KGLA 4UZGA 5F1KC 3ILQC 4KK8D 3ARGC 2XWBB 2H32B 3VWKA 1B2WH 1FYHB 1FC1A 4NNYA 4NQSB 1I8MB 5BZWA 4CN6A 1PDKA 1HHGB 5A16A 3SDDC 3QI9D 3E3QC 5BS0A 2FO4A 3GHBL 1CIDA 1NMBH 5D1XD 4OZFH 4DWHA 5EIVA 5FECA 3H9SD 1XIWC 2I5YL 4LCUB 5LWYH 4LNRB 1EVTC 3HE7B 3O45B 1T7ZA 5AWNL 4ODHH 3P2TA 4U1HA 3WNMA 5L2KA 3NFNA 1ERNA 1OLZA 2DDQH 4AEHL 1IT9H 5C0RH 4WFED 5AD0A 5JPMB 5F72S 1FNGA 3DGCR 4GUPA 2APWA 4PUBL 3K1KC 3P30L 5K9KA 4UOJA 3G6JB 4KHTH 3INUL 5EU5A 4HCRL 1E28A 2HA1A 5I73C 1D5MB 1ZTXH 5MHSD 1K5NA 1V8HA 1EHAA 1CXLA 5IM7B 3EOTH 2Y36L 2P45B 5IJVA 2PTUA 5KSBE 4Z7UF 1JGEB 3M07A 4O58H 4EOWH 4LVNB 4YXLH 1P9MC 5FUZL 3JV6B 3DYOA 4MVBD 4AY0A 3QUMA 4K3HA 2JK5B 3LRSA 4DKDC 3UC0H 2VC2L 3OXSA 1NGZA 2WINA 5KVEL 4P4RA 1U3HD 3KG5A 1M71B 2DOCA 3BZFB 4YFLI 2YEZB 1IC7L 2BSRB 4YPJA 3ROLB 5H37H 3FFDB 1XF4A 1XR9B 1XGYL 1I8KA 3VWJD 3CCHA 1KC5H 2VUOA 4XT1C 2N1KA 4NRYB 4Q6IB 3DVIA 1PZUB 1UYWH 4U7SA 5HVGB 4NO0A 4D9LL 1VGEH 4LLQB 3S3PA 3JWDC 4YHLH 3ZDXE 3TNNB 1T1WB 1EO8H 2YUWA 4P4KC 2H32A 4P2RB 4X6EB 3CH8A 1LO4H 4NQSA 1NBQA 3CK0H 3G6JE 1HHGA 1QLRB 3REWB 1TJIL 3HE6B 4MJIE 1OCWL 3T4AA 2VDKL 4G8EB 1BOYA 4XMPL 1QFUL 3CSGA 2VITB 3ULUH 1BM3L 4Z95L 4ZUVA 2PO6D 2NTFA 3HMXA 3O45A 4GJTB 4LFHG 5T1MB 2PW1A 5MEPA 2J1KA 2F53E 4PB9H 4N8VG 5F7DB 1F6AA 2V9TA 5TGBB 5IQ7H 4WI8A 2GAZB 5JPMA 4ZFOL 2J88H 5T1LD 3O3AA 1EHLL 1MAJA 3EYQD 5IROA 4NQCB 3DPBA 4MA7L 3ETBF 3DROB 4LLAA 3G6JA 1EGJL 3B8YA 1CLYH 1X5XA 3QQ9D 4MJIA 1ZS8A 3CFCH 2XA8L 1MFEH 1HEZA 1ND0A 5LAXB 4IDLA 5SWSE 5FK9B 4JKPL 1BMGA 3QCUH 3VXUE 4NNPH 3JV6A 3ARUA 3GIZH 3S37X 1NGXA 2Z8RA 2WWKT 4RIRB 5D72L 3ZT5A 3K0WA 1FAIH 3QRGH 2D03H 5I8CA 5E6ID 1GAFL 3MRNB 2OSLB 2BSRA 4ZOEA 2Y23A 2D2OA 3FFDA 3MRLA 5SWSA 1N7MH 2ORBH 2ZOLB 5E2UL 1GH7A 4LNVA 4ZG1A 3VXUA 5DO2C 1AGBB 4PJFF 5DQJB 3MA9L 1DL7L 4LLQA 1T21B 1F4XL 4X6EA 4P2RA 1N6QL 3VD4A 3L3OA 2XQYK 1QLRA 1RIHH 4PIRF 3HE6A 2CRMA 4KY1L 2YRLA 4OIIL 1IGFH 1CE1L 4JO1L 2EDHA 2VITA 3X14A 4OFYD 4IEFB 4BZYA 1PX3A 1RZ8A 3UYOD 1GZQB 2DYPD 3W9EB 5D6CB 5TGBA 1NDGB 1A47A 5L8JB 4ENED 4I4WB 1O7VA 1U8OB 2VXTH 1JNLL 4MB4A 3L5IA 4GRWB 1A6TB 3DROA 5F9DC 4P46D 3UTTE 3KPPB 3QDJD 2N7BA 1UA6L 1XH3B 2B0SL 4NZUL 1J1XH 5I8EB 2OL3A 1KFAH 2IMMA 3RU8H 1FCCA 1KJMB 1P4IH 5LGHH 1QSED 3LY6A 4ZD3H 3WFHB 2DQTH 1S9VB 2H45A 4IRSD 2EYTB 4OI9A 2X10A 1WZMA 2XFXB 3U4BL 1F2XK 1GGBH 4M5YH 2JIXD 3BH9A 4ZXBC 4TSCL 4P2YA 5DWUL 3BDYH 3RAJL 4O51A 3NIDF 1B88A 1NDMB 4OLYH 3QHZH 4RIRA 3WDJA 2J8OA 1S5IL 3UTTA 5T5FL 1RZGB 4X9HA 2YMXL 1AQDB 1J10A 1T6VN 3FO1A 5DMJB 1G9NC 2P49B 2VR4A 5HYJD 2OSLA 3ARDC 4UINL 3LN9A 3PV6A 4IIQA 3GSQB 1KGCE 3QNXB 5T1KD 4Q9CA 1LEKB 5KVFL 2ICEB 3G6JF 1MHHA 5HPMA 3FT4B 4RA3A 5DQJA 3UAJC 4R3SB 2GT9B 2FLBT 4KRPD 3A6BL 3M1BA 1NCTA 3KPSB 5CGYD 1Q94B 1MRCH 1QD0A 3I6KB 5IB4B 4PJ8D 1VGKB 3WV0A 3P9LA 1G7LA 3WIIH 1NBYB 2FX8H 3O3EA 4L8CA 2QHRH 3G08B 1H3XA 3MLRH 4RMRA 3MGTA 1GZQA 1FQ9C 5AYQA 3W9EA 1B4JL 4M61A 5D6CA 5D1QB 4Y16B 1NFDB 5FHBL 5DMIH 3DGGA 4I77H 2D7QA 3VA2C 1QLEL 2YWZA 4NKIH 3TJHC 1U8OA 3IETB 3NZHH 3QCTH 1EJOL 1NAKL 4OD3L 1OP3H 1X5FA 4YR6B 1A6TA 3JSSA 2FEEI 1YEEH 1FHGA 1MRDL 1KBGL 4WFFE 2D9QB 2J2ZA 2ZCHL 2VYRE 3DX6B 5CD3B 1KJMA 1X5YA 3SDAD 1P4BH 3WFHA 3ZL4L 4L4TB 1S9VA 4H26B 2EYTA 3KS0H 1PFCA 4HF5H 1UWEL 1N64L 1U8LA 5EU7C 3KLHD 4C59B 1HH9A 1CDJA 1PY4A 4GAYB 3UBXA 4UNUA 1EO7A 2W65B 4X6BB 2CKBL 3RZCB 1ZVHA 2DBLL 2JTDA 5D2NC 5I1KL 1BJ8A 3NACH 1RZGA 1EFXB 1YYLL 2CDEB 1FFOA 4PP1D 2W0PA 4XVSH 4NQED 5FXCH 3TA3C 4EUPH 3FRUB 4BUGA 1HHKB 3SGJC 1LEKA 3WO3B 1UFUA 4UV7H 1RK1A 1S7QB 3BESR 3FT4A 4R3SA 4S2SB 3D2UB 4DGIH 2UVFA 2J5LC 2GT9A 3TO2A 1JYVA 3SJVE 1IGIL 4HJGA 4XH2B 3Q3GB 5HGAA 1X6NA 4UIKL 5F1SA 3PHQB 4KHXH 4I18B 3GRWL 3HPLB 5I8KH 2H8PB 1VGKA 4ELMB 1HINH 5DJZB 3PIQB 4Z0XB 5GS3A 2OXGA 5IJKA 1NC4A 3O6KL 4MYWB 4GAJL 3CX5J 3FQNA 1D5BB 4EQ2A 1C5CL 2ZOKB 1DBML 1FDLL 3JUZA 1I7RB 2HLFC 5IOPB 4M48L 2DLIA 5D1QA 1NFDA 3UO1H 2GKIA 3X3GL 3GMOA 4YR6A 1RURH 1HILB 2IBZY 5ERWB 3WNLA 4PRID 3RDTD 1K2DB 1PKQB 4QRTB 1KENH 3VD5A 2D3VA 1T80A 3H2WA 3LQAC 1PQZA 3DX6A 4XPFL 3UYPA 5HHQB 5CD3A 5E00B 1UCTA 3CVHB 3KLSA 2GTWA 1RQ5A 4L4TA 3GSWA 1R3HB 4H26A 4WEUD 3HUJE 1KN4H 4HIEA 1S7SA 4XPGH 3IYLW 5J9PA 1M7DA 2YD3A 3ULVD 4NQTA 4U1GB 2R1YA 4LDOB 3ALXA 5HHOD 1KCRH 5GS2H 4UAOC 5IESL 4OIAA 1NBVL 4NJ9L 2D7NA 3OKEB 1BFVH 5D7JA 3QUKA 3FRUA 3TWCH 1HHKA 4R4NC 5JW4M 1DTUA 3HG1E 2HMID 3QFJE 3KPOB 3UPAA 1MQKH 3D2UA 1CXHA 1NCDL 1T7WA 2P5WE 4MNQE 4F7PA 5JZ7C 5DD1H 2LAAA 2L4OA 2ZJSL 4B0MM 3Q3GA 4YHIB 4HWUA 4I18A 3KYKL 3H7LA 5EULV 4ELMA 1WZ1L 5DF0A 1GHFL 4LEXL 5DJZA 5HPOA 4Z78B 4UT6H 4HJJH 3Q2CA 1JF5A 4F7MB 2VIRB 4NC0B 3BKCH 2NY5L 3QFJA 1AIFB 3B2UD 4MDJB 2ZOKA 1B9ZA 5IOPA 1I7RA 3P0YH 4MNQA 3R0NA 2R69H 3DO7A 4JFPB 3O2WL 1AD9B 1NJ9B 4HKZB 5IFJB 1HILA 1CG9B 3QI9C 3JV4B 1K2DA 2DM4A 4JPWL 4Y2DA 4D8PB 4Q9RH 4LCIH 3IAQA 4XHQA 1KJ2H 4F15C 3QULB 4QHUA 4BQBA 5HHQA 3GJFK 1UQSB 5E00A 4J3XA 3T3PE 5JW3H 3CVHA 2W9EH 1T0NA 1WBZB 4L9DA 2DQEH 4YWGL 4X5LA 2FX9L 4L4JA 3I9GH 4U6YB 2XKNB 3B6SA 4HXBL 3L3HB 1RUQL 4RAUA 1MLBA 3KPRD 4WI3A 2BK8A 2V7HB 5DLMH 2KH2B 3RWDB 1NFDF 5I1LA 4JFHD 4MMXC 1T83C 1FL3B 3FFCB 1T1XB 1JZ5A 2VR9A 1RZKC 3TIDB 4MVBC 3KPOA 15C8L 3OF6D 1CVSC 1PVHA 2D4DA 3GKWL 1FBIL 5FO8A 4YDLB 2Y5TB 3RA7L 4PRPD 5EZIL 4PJEE 2A73B 1MAKA 5JOPE 3VWJC 1A7PH 4AIOA 3DURB 4WFHD 1FC2D 2HT3D 1AIFA 3RVVD 2BHUA 3QXWA 2NQCA 5HHMB 1PG7X 3MMEB 5A2IH 5DQ9B 5C0DB 2ZUSA 5CHNA 2RFXA 1Q9LB 4MJ4A 1AD9A 1MCRA 2HWZL 1F5WA 4PJ5B 4OCXH 1X4ZA 4K23L 5FYKH 4QCIB 3JZ7A 3HKFA 3PWPB 4D8PA 4OGYL 1WFOA 4PJEA 8FABB 3QULA 3SY0B 4P5TD 3P73B 3E1F1 3DIFA 2VRAA 5EZJA 3VG0H 3T0BA 2WUBH 3Q6GH 4OBRA 4ZOAA 3EYQC 5GGRY 3K4DA 3LKRB 5HVHB 4X4XB 1KIUA 4ELMF 5HYQA 5I17A 4JFQA 3QQ9C 5FGCB 5EWIH 3BXNB 3F58H 4OF6A 2VDOL 2V7HA 2NW2B 4G6JL 2FBJH 1DBBL 3K80A 4KK9D 4OLXL 3RWDA 3GO1H 5DZOA 2R23B 2VAJA 2X4OA 3NFPB 2HP4A 2WBWB 4FZEH 4RQQA 1ORQB 3FFCA 1T1XA 1PX4A 2A1WH 3MRQB 3BQUB 4J6RH 4N8PA 4KKCC 4DUVA 4YHMH 1KTKE 1R24B 1MCOL 4IRJB 3OR7A 4ZFOB 4K7FA 4G7VL 4PJ5E 5E6IC 1DCLA 1ZMYA 5F3BA 4XCYB 1OSPL 1DQMH 1MIEL 3O6ML 4HCRA 5FYJD 1YEGH 3FO2B 2AJUL 3O4LB 3TPUB 4XXCC 2A73A 5I74B 1IARB 2JJTC 2WWMD 3V4VH 3P77A 4PJBB 1C08A 5IMKA 1XGQB 4R26L 1KIQB 4AM0A 4Y19B 3RVXD 3MMEA 5DQ9A 2IF7A 2EYSB 3MJ8A 2CLRB 4PJ5A 2FGWH 3KPQA 3RI5K 5GGVL 3X17A 3GSUB 3G6DH 5F7UA 4QCIA 2F53D 4LPVA 3QEGL 3DSFH 4QNPE 1CDIA 2M1KA 3QWQB 3NABH 3SY0A 3P9MB 3P73A 5IF0A 2C1PB 2EKSA 2XXCB 2XYCA 4E9LA 3CLFL 4NBXB 4PLJD 4G6KH 4TQEL 3WJLC 2FD6L 3LKRA 3L9RA 1J1PH 2YPLD 5HVWA 2BSTB 4RISL 3EDDA 5CEZH 1A6ZB 2V2TB 4B41A 1IL1B 2APTA 1IGJB 3OWEA 3TT1L 3L5JA 2NW2A 3QNYB 1A7OL 4ORGB 1B90A 3GJFH 4P59L 4FP8L 5I1HL 4IRSC 2EIZB 2R23A 4XB8A 3BO8B 4HUWA 4F2MA 1U42A 3NFPA 5IB5B 4M3JA 3BPLC 4KROB 3TO4B 3DHJA 4PJBE 3E6HA 1ZV5A 2FSEA 2HRPL 1CTOA 1EUTA 1FLRH 4KI1A 2AI0H 3BQUA 1I7UA 3RY6A 4PJEF 3MRBB 4QF1B 5TE6L 2AJVH 3FB5A 3MACH 4V2CB 4AL8H 4IOIB 5GSVB 1FVEB 1EGJA 3H8NA 1NANI 1S8DB 2EE6A 3NGBB 4QRRB 3FO2A 3TPUA 1GZPA 4EI5B 3NCJL 2RHEA 5EO1B 3ULSB 4PJBA 2BRRL 2R4RL 5FYKE 1T1YB 4IS6B 1RZJH 3VFGL 3F5WB 1I7TB 1ZVSB 4OLUL 5D7KE 5ISZD 1N5AA 2EDOA 1XGQA 5CP3A 2IBBA 1KIQA 4OGAD 4H1LB 4Y19A 5CGYC 1RFDL 4A6YL 5ALCH 1WV7T 2WANA 2X1WL 2CLRA 5GGSA 3MV9D 5F89A 4M43L 1PLGL 4PJ8C 2B20A 3TVMB 3GNML 4Y5VC 4MDIB 4PRHB 4NM4L 4EXPX 1XGR