3IDJB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 fab' fragment in complex with gp41 peptide analog eld(orn)was
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
235
structure length
229
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 2F5 Fab light chain
total genus 41
structure length 229
sequence length 235
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idjB01
2J8OA 4P48A 1MY5A 5FCUH 3WJJC 1ZT7B 3KYNB 5T33H 3GMPB 1QSFE 4WU5A 4I0KA 4X7TB 1UM4H 1UB5B 5ITBH 2X70B 2AXFA 4PJDF 4UTAH 3P0YL 3HE7C 2HLFD 1I4FB 3G9VA 3NZ8B 4NUJB 5EBMB 2Q6WB 5B3NA 2R1WB 5BVPL 2DWEA 4KK9C 5EIIB 4M6AA 1CBVH 3QUZA 5I8EB 2XG5A 4MCYA 4G8GB 1GGBH 5FA3B 4QTIL 3VRIB 1P53A 2FDBP 3MLZH 3W0WB 1CTNA 1AJ7H 1N6QL 1JE6A 4Q0XL 3WUZA 3ZHKA 2BMKB 2D0HA 2FD6H 2ESVE 1DQLL 2F8VA 1QFWH 2EEDA 3Q6FA 2IBZY 2HLAB 1MCEA 1ZLSL 2XA3A 4HXAL 4BQCA 5I0DA 3L3GB 3FAWA 5BZDB 4PYHA 4OM0H 4BKLB 3QPQC 5T1DL 1NGWA 1ZHLB 2YPVH 4H1LA 4XPFH 2X4OA 3WO4B 3L6FA 3FOLA 4KV5F 3FOMA 4HIJA 5DDHB 1OCWH 4R3SB 3QEQA 4S1QH 3MGOA 5TQ2L 2XNAA 4HH9B 2V2XA 4HKBA 4K3EH 4M48L 2FBOJ 3BMVA 3FB6B 1F3JB 3P4LA 3LKNA 5F1NB 4QWWC 5EO9A 3S9DB 1NAKL 1G7QB 2Y6SC 4CJ1A 1S7WA 5GS2D 3MV7B 4XPFL 2A9NL 4KUZL 3RTQB 2EYRB 5C0RL 5DHYB 4OZGE 4IIQC 5IFAL 4F8TA 3CDGA 5L2KE 5E94A 4GG6B 1FZJA 2NXYB 1AGCA 1LO5B 1BVKA 4HBCH 3MRCB 2WUBH 4AJ0A 4ZNCD 5I17A 5LJYH 1EO5A 4QRUA 2EEAA 5GGSB 1RULH 4K3GA 2KH2B 4Y19E 5ADOH 2B4CH 1T5XB 4P0DA 3SHSA 2ARJB 2DQJL 2ZPKH 3QULB 3OKOB 2AJSL 5ELIA 4KROC 3RWCA 4JHZA 4JHWL 2C3VA 1BM3L 4AMKH 3MRNA 1T21A 2E7BA 1G7LA 3ELAT 4K9EL 3VD3A 3GO1H 3W5NA 3SCMB 3WXVL 1BBJB 4NO2B 1BLNB 3K4ZA 2DQHL 4OZFB 3K8KA 1Y0LA 3RVVD 1TETL 3BJ91 3OXSB 4FMFA 1U8OB 5GS0C 5KS9A 3T0ED 4YDLC 4OLVL 1LO0L 2J4WH 3W2DH 2X7LA 5I16B 25C8H 1PW3A 4P23D 5F7EL 2QKIA 4AT6B 1WITA 5EORL 1BFTA 1JWMB 3MA7A 1E4XL 2VXVH 4KQ3H 2FR4B 3SKNB 3QFJB 1NBZB 1A1OB 4Y5YB 4F7CA 4Y5VC 4JRYB 3BPNB 3NZ8A 4NUJA 3BKYH 3VMNA 1MJ8H 3UTQB 1BVZA 1J5OL 1IEAA 5IVZB 3RI5K 3U46A 4CMMA 1LK3L 2PTTB 4HGMA 5J1AA 2K7PA 4CMHB 1E4WL 5B38B 5CCKH 3H42L 3RZCD 2QQNL 5IMMA 3FT4B 1E6JH 5EU7C 3ULUF 5B4MC 4HXBL 2JJTC 1W72H 1EVTC 4HGWB 4P3CL 2ORBH 3O8XC 3RUGF 4AYFA 5CEZL 1DVFC 2AI0L 2HWZL 3QUML 4HHAA 3UXFA 4O9HL 2ICEA 1RZJL 1S9VA 1AE6H 1N2RB 4R2GD 5IHUL 2OI9B 5FCSH 3S36X 1CT8B 5F9AC 5IVXE 1RHHB 3L5WB 2VZOA 2IH1A 5F7DB 3SEPA 2K1MA 4LCCB 5JPMB 3BQUB 2J88H 5EZOH 1TZGH 2Z93B 4U6XB 4FP8H 4L1DA 3BN9C 4HJGB 4OQTA 4R97C 4OM1H 3N1PC 4XP5L 1LO3L 3P2TA 1C5CH 1FV1A 1ODAA 1K85A 1QNZH 1MREH 5KG9B 1PBYA 3TBSA 1MWAL 5TQ0H 5I15H 4HK3N 4JM4H 3I6KB 4RRPA 4RWYH 1AO7B 3UPRA 3ET9F 5BVJA 3HC4H 3HC0B 3AREA 4I0PB 5C3LD 4XNZB 3S98A 5I9QB 1FSKC 2BCKB 2B2XH 4RFEB 1RZIA 3M17B 3DVFA 4MA8L 3U6RA 3BW9A 1WCBA 5C6TH 4I8DA 4YHIB 3SE9L 3G6AA 2GJJA 4YDVB 5ESVB 4JPVH 5KW9H 4YPGA 2XQBH 5L2KA 1VADB 1RZFL 2IAMC 3C8KB 1IGFH 3LEXA 3O2DA 4HIHA 4LKXB 1WWCA 1WAAE 4Y4HC 3ZTNL 3LV3B 3FHQA 4PJXE 2NY7H 2XI9A 2VUOA 2R15A 1T2JA 3LRSB 4OJFH 3MC0A 2V17H 4Y2DC 2B1AH 3RWIA 1JFQH 4XPHL 1B0RB 2KZ1B 5C0JB 1JN6A 4M62L 4KGJA 4ONHB 5GJTL 4PGEA 1XF3A 1FZKA 4PJ7F 4CU7A 1JIBA 1G9NL 4PJ5D 1DQDL 5T1MA 4LEXH 2AQ3A 3F5WB 4X8XA 4MAUH 1YN7B 3QIWA 3LKQA 3G9AB 3WL9A 1JTOA 2WWMD 4A6YB 2VR5A 4QGTA 4M6NL 4U7MA 5DRWB 4YXHL 3VG9B 2VXUH 5C0ND 1FYTD 4PJ9A 4XNYL 1T3FB 4PG9B 1ADQL 2X1OA 1MQKH 4PRHE 1U2HA 1G9EA 3KPQB 4JPIA 1VEOA 1EHXA 3ZE2F 1E4XH 1ZHKB 4JFHD 1A6TB 4LIQE 4PJEF 4Z7UF 4DEPC 5D1QB 5CSZB 4W4OC 4D9RE 5DQ9B 4WW2B 4L8CB 3HC3H 5DYOB 1NJ9B 1NLDH 3PWLB 4AEIL 4QRRE 4GW5A 5F9WB 3UTTB 3L5XH 1FVEB 3S37L 3WFDL 4MJ5B 2R39A 2RCSL 4R8WH 3ARZA 4Y4FB 4M8QA 3TBTB 4X6FA 4XPTH 3BXNA 2QQNH 2APTA 4WFFD 4Z7NF 4W4OA 1GGIL 3HE7A 5I19L 1C5DA 5HPMA 2HA1A 4X7CC 4HIXH 4NJAL 2YOCA 4K2UL 2NY0D 4PLKD 4KVNL 3VGGA 4YHKL 3UEZA 3IETA 2DQEH 1QSED 3R06A 2PYFA 3BJLA 4UB0H 2M2DA 4YUEL 2Q86A 5SX4H 2ITDB 3K2UL 3NFNB 2A1WH 4H20L 1Z5LA 1T1ZB 4A2LA 1NGPH 1CGUA 1XR8B 4IBLT 5MENA 1SEQL 4M7KL 2R0LH 3HNTL 4S0TD 2N1KA 3NTCH 3O9WA 1M05B 1U8KB 3EJZD 2VDQH 3B2VL 3RTQA 3CSBA 1CXFA 3QI9A 4JFDE 5CD5D 5KANI 1XCQB 2IANB 3BZFA 1SBSL 4Z8FL 3BP4A 4XVTL 3FQNA 3T65B 4ZUSB 2YUVA 4OGAD 4PJIE 3RQ3A 3UBXG 1WTGT 3EYQD 3BWUC 2GTZA 4NP4H 4EI5B 4OIIL 5CJ8A 3O2WL 3PL6C 4HD9A 4ODXB 5GSRB 2YK1L 3C9NB 4KK5D 2OXGA 4MNGB 3ARUA 4H25A 2Q8AH 1JNNH 3O41B 4TRPL 1BD2A 5T1KA 4HUKB 2DLHA 5GRYA 2AV1A 5EOQL 3ULUH 3ISWA 2DQFB 4QHNA 3RY6C 1D5XA 5EU5B 3MCLL 4E5XB 2H3NA 1I9IL 4UV4H 1RJYA 4IOIA 5CWSB 1F8TL 4P5TB 3TCXA 1RJZB 1AD0A 2YR3A 1GH7A 2ITCA 2VLJD 2KPNA 1VDGA 1X4ZA 2RCSH 3DGCR 4R8WL 1P1ZA 3UYPA 4B7IA 4HCRL 2DWDB 2QV2A 1U8PA 4U1KA 3V7MA 3VXME 3UYOD 2OP4L 3TP4A 3R1GL 3T04D 1IGJA 2DL9A 3O2WH 5E5RB 5BQ7A 4RCAA 2GYSA 2Y5TA 5TQ2H 1HI6A 4Z7QE 1KCRH 4OV6F 4JFEA 5MEOB 4WGVB 1WWAX 4C59B 3D85B 5CUSH 3F7VB 5JORA 2IH3A 4NNXB 5KSBE 3DV6A 3ILQD 4JO2H 1FFNA 4PJBB 5D7IB 3U9PH 3SDXE 5DQ9A 3MRRB 4MD5A 1CGTA 1VA9A 5CJOL 5D9SA 4G6AD 1QFWL 3PWUB 4Y5XA 4M7LT 2QSTA 3INUH 4PRHD 4QYOB 4NO2A 2W9EL 3PQYA 5JLZB 2XZCH 6FABL 1YEGL 5I1AB 4GKSA 1YECL 4WW1B 1DLHB 1GPOH 2OI9C 5GRWA 2VLKB 1KT2B 1PQZB 3BPOB 1RULL 4AQ1B 2UUDK 2PTTA 5IG7A 4OZHB 4ZPVA 4ZYKB 5ESQA 3FQWA 3GI9L 2NW3A 4DUXA 3WIIL 1L0XA 3MBXH 1YEEH 4NKIL 2FGWH 4QOKD 1A6WL 4IIQA 4KK8C 5GRVK 3X14A 4I77L 3MROB 5DT1L 3IFLL 4LOUC 3S3PA 5ANMA 3CSPA 1KLFA 1A1NA 1LILA 4PRIE 4HAGA 1JRHI 3DMMD 1V3LA 2Y6SD 3ULVD 5KSBF 3HUJA 4LCWE 1OAYL 5F1SA 5GGUB 5EZLA 1UXWA 3VGDA 1FG2B 1KPRA 4LKCA 5DMIH 4CGTA 1J1PL 2B8OT 5IBLD 4XI5C 2C1PA 3RKDD 4MDJA 1JWUA 1NDGB 1EDQA 4Z5RB 5IIEB 3DYPA 4DTGH 2CD0A 1Q94B 4HIJB 1CFVH 5FIEA 1I8IA 4JFHE 6CGTA 5ICYB 4OFYD 3OJVC 1KXTB 1J0JA 2RB8A 3MGOB 2MKLC 4LRIA 5IKCB 1FV1B 1I3RB 4H0IA 4M43L 1D5XB 1UZ8B 4LCCA 1KYOJ 4M61B 3KLDA 3DTXA 1OF2A 1LEIA 1NLDL 2X1XR 4Y4KD 2NTFA 1H8OA 3OKEB 1A9BA 3U0PB 1QLFA 2RFXA 5MEQA 1KSRA 4ZTPH 1EUTA 5IT2L 1FVCB 4LPCA 2BMKA 5KVGL 5KS9E 1D5ZB 2ED8A 5HI4C 4I18C 3DV4B 1INQA 2Q7YB 1J10A 2A83B 4X9BA 1G7IA 2BSTB 4GXVH 3MRMA 2GJ6D 4OI9A 3X17A 1G9NC 5C0CB 3BPNC 3GMNA 3MYJB 1NGWB 4H1LB 2F8XC 2EC9U 3DMMC 4K7PL 4HWZA 4X9HA 1P4IL 1WSST 2R1YB 4YPJA 5DK2A 5E2UL 4KK8D 5E4EC 4JVPA 3V4VH 4Q9BA 4I9WD 4X99B 1DFBL 4JZNB 5TH2A 4P99A 3LN9A 3V6FA 5D2NE 2C26A 4PY7A 4J3WA 5JHDB 5JQHC 3IDIB 4L5FL 5FYKD 4JFOB 1IARB 2GUOA 3CIQA 1XF3B 3EOAA 2FJFA 2YPLE 3QUKA 3EYFA 4P23B 1P4IH 4X6CF 5F3HB 4KTEH 4WY7H 4YXKL 3SO3B 4PGJA 1DP0A 3P4OB 3TN0C 2J6EL 5HI3C 2BFVL 3PGDB 1R5WA 1KPVB 4FFVD 5HYQA 3BXNB 1T3FA 5H2BA 1Q1JH 4OZHA 4ACPA 2H26A 3QIBA 2XFXB 3TV3L 1ZGLA 3LEYL 3BISA 4NGHH 3V6ZB 3QIWB 3WL9B 4QHUB 5KSAD 4QRRB 5CSZA 1OTUD 2BHYA 2BSSA 1BD2E 1MF2L 3QNXB 4KU1A 2I60H 2BOBB 4P4KB 1ZANL 1YPZF 3FMGL 2UZYB 4PJ7E 3IDXH 4JFXA 4Y89A 3BEVA 4E41B 1J0IA 3EO0A 1ROWA 4BFIB 3LRHA 9CGTA 5K9KA 1MCDA 5CINH 1UWGL 5TGBB 3T8XB 3RGVD 3AM8A 1MH5B 1J05A 4PRIB 4G8GE 3MV7D 3O81A 4KKAD 3FT2A 1U8LA 3PNWA 5FUZH 4LU5H 2CPCA 5IB3A 1LE9B 4UINL 2CRMA 2CKBA 3BKCH 1KJVB 5IFHL 5CEZE 1F58L 2FATH 3BSZH 1T1WA 3MV11 2HTKC 3OKEA 2Q76B 4CUCA 3LDBB 4OUOA 4XWOC 2UY6A 4OB5L 3WNLA 1QHOA 1T7YA 4QCIB 2A0LC 1DR9A 5EB9A 1U9KA 2K7QA 1ITBB 3SDCC 4NN6C 2OJEA 1ORSA 3ULSA 1JI2A 5I6XB 2G5BB 2XN9D 1DBBL 1N64H 3SOBH 5IFHH 3KPTA 2EDDA 1YJDC 4PS4H 3VCLA 1Q9KA 2BVOB 3BKYL 3RVXD 5FKPB 2DM2A 4MXQD 5E8PB 4R7DB 1WLHA 3E6FA 4AIOA 3IJHA 3QDGB 1M6OA 5A2JH 1H3PL 2BJML 3ZDXF 1DANT 4LASL 4MNHA 4GXUM 1S8DA 3FQXB 1K3ZA 3VWKC 3NA4A 4HKJB 3HI1A 3NACH 4LDOB 1JYWA 3M07A 5E08L 4IRJC 4KDTC 4XVSL 4MZ2A 3MLTA 3WNNA 3WXVH 4PRPA 4PJHE 5HDOA 5KAQF 4QYOA 3RA7L 5EO9B 3WFEH 1NL0L 1WFUA 3D6GA 2FCBA 4I0PA 1CVSC 3SDXB 4PY8I 4MAYD 3A6CL 3HUJF 1K6QL 1XF1A 1EEUA 2GQHA 1ZT1B 4TVPL 1RIVH 3EFDH 2A9ML 1WEJL 2YXMA 5I75C 1FZKB 3LHPL 4UNTA 1KLUB 1G84A 3W39A 5I30H 3TWCL 1QQDB 2OSLB 5BOZG 3RP1A 1G9MH 2Y5TB 4ORGA 3QXAB 4KROB 3GMMA 4Z7WA 1H0DB 1TJGH 3IJSA 3X3GL 3D85A 4U7KA 4IJ3C 1QKZL 1UB6A 4OF0A 5KVEL 2KBGA 3RY6A 1HCVA 1FAIH 1LWRA 1RMFL 1YNLL 1A6AA 2JIXB 4D0BA 2BOCA 3W81A 5EOTB 1LEGA 5FK9B 1T89C 1JWSB 4NQXB 4MA7L 5SWZA 3G5ZB 4TVPE 1DQQA 3LPFA 4P5KB 1MFEL 3Q0HA 4L9LB 1DL7L 4LLDB 3WS3A 5GZOD 1P7KB 2HT3C 1AGEB 1FRGL 5TDOA 4CVUA 4YNYA 1CE6B 4JFQA 3SGJC 5C0DB 4PIRF 1ZEAL 4MNGE 1JV5B 4DZ8B 2PNDA 3BZ4B 5CMAA 1RUMH 2YPLD 2F74B 2IAMD 5HDBE 1B90A 2Z8SA 4PJEB 2W0FB 3QCTH 5BOPA 3S5LB 5CEYA 3TN0B 5DURB 4DN4L 1JTTA 4JKKA 4Q6IC 3KLHD 2F53E 4Z7VB 3VXSA 5EBWB 2W9EH 1FLRH 4KY1H 1CICA 4BZ2H 4POZC 1NCBH 3B43A 1HHHA 1WZKA 3E8UH 5DJCB 4IOSD 4YBQC 3Q3GA 4JPWH 2VZ1A 4OZFG 1IEHA 1OAKH 4MVBC 2J12B 1XIWA 5KBNC 4Y1AD 3PGFH 3VFTB 4UTAL 1FC1A 2BERA 3DYMA 3ULVF 3OWEA 2MFNA 4G6KH 4XC3L 1KENH 1OTSC 3QZWA 3ZT6A 5GZOC 2XWBB 2CK0H 4WEBH 5FYJE 1I9RL 3RJQB 1CFQA 1R24A 2VXSH 2KKQA 4J7RA 5DD1L 2EO9A 3QFDB 4NP4L 4OZIA 3RIFK 1WCQA 4I77H 3P9WB 3O4LD 1C12A 1SJHB 3L3KA 4HC1H 1WIUA 2WBKA 4JDTL 4CVXB 4U1SB 3WO4C 5EU7E 3UJIH 3SKJH 2AJ3A 3P40A 1MCPL 3R4DA 1TNNA 4XTRC 2D9QB 3DX7A 4H0GA 4LSVL 5MI0C 2C7UB 3G08B 2VAJA 3SPVB 4EUPB 4JPWL 5KZCB 3C08L 4PR5A 3T0EE 2AERT 5D7KD 4FFZH 1CDIA 2VB5A 1KLUA 4X4XB 4TTGA 3QWRD 4WVRA 1CF8H 1MCFA 1QSFB 3ZDXE 2IMNA 1SYVA 4M9PA 5I8OL 2E6QA 5C08D 1ZLUK 5CILH 2F54B 3MV8A 4HC1A 4YHKH 1GHFH 4XBGA 4G8IA 3QISA 1XGTB 4MCZA 3WFEL 1FN4B 1ETZA 2WM0A 1RUAH 5DA0B 5F3HA 4QHNB 4X5WB 4XAWH 1A8JH 1VADA 4IJ3B 4NRXA 2VH5L 3MZGB 4P5TA 4YQXL 2VOTA 1AD0B 4YFDB 4HDIB 2IH3B 4NNXA 3VGHA 3FN0L 3O8XA 2NQCA 5DVLA 3C6LB 3TA3C 5IBUG 4G7YH 3OHXB 4GKSB 2B2XL 3HC3L 4RMQA 5C0AB 1IGMH 3HPLA 2W0LA 4LGPB 3A0OA 1P7QB 4N1CA 3MMEB 3MLVL 5ENWA 1F42A 2DM4A 1O5DT 3VI3E 1MAKA 1KCVL 4P5MB 3AMKA 4YJZL 4NKOB 5HGHA 3DECA 1II4E 5AD0B 4KMTL 2A6IB 4Z7UA 2AXJA 4PJEA 3NCYS 1ZLVH 1NFDE 1DVFB 1IFHL 3B9KA 3ULVH 4CAGA 3I50H 4R4BA 3TN0A 4G8GA 4HIXL 1TVDA 4N0CC 4NQUA 4RRPG 5BRZB 2VZVA 3GM8A 1ZHNB 5HHXL 1EO8H 4K07A 1F90L 1O7VA 2YBRA 3MLXH 4JZJC 1NPUA 2Y1VA 3FO1B 3K8LA 2XZZA 4Z95L 4EQ3A 1J05B 4PJFA 3BH8B 4LLWA 3F8UB 5D6DC 4DAGH 2ZUXA 1OM3L 5FKAA 2HJLB 1FFPB 2OJEB 1I1YB 2VR9A 2Q87A 4UIKH 5T1LD 4MXVE 2GAZA 5ESAA 4QHMA 4TYUA 3V9FA 2L4OA 3GSOB 3BESR 2FBJL 5FO7A 4EVNB 4KI5D 4NC2B 1DQMH 2GHWB 3LEYH 3AS3A 1WBXB 1UXWB 5D5MB 4DAGL 1B0GB 1W72L 1BQHG 1DBMH 2V2WB 3MLSH 4QCIA 1D6EB 1DN0A 3FQUA 2P44B 2MPAH 4X8JB 3HZKA 1FH5L 2AK1H 2APBA 2GSGA 1KCSL 4K7FB 3QR2A 4O4YH 1CGXA 4O58L 1T0MA 3OKMB 3S37X 1T04A 4I0CC 1G7QA 3CGTA 1FPTL 2EDFA 3LDBC 4LASH 3I2CL 5DHYA 1F11A 3D25B 5F3BB 3IDXL 4ZFOA 2C4FU 2QQKH 5TF0A 4KWUA 5I1JL 1OQOA 2C7UA 3G08A 5D1XA 4TN9A 2LU3A 4FQ1H 3PHOB 5DF0A 2AKRB 5E56A 3O9WB 4BK5A 1UA6L 5HHVH 5FUCC 4YZFF 3L7EA 3UZVB 4HX1A 1M7IA 1NDGA 1WBYA 4MB5A 5T5FH 1I3UA 2XY2A 4FNLL 1A4KB 1TQBB 3VFVB 5K9JL 1XF4A 5HDQL 1EMTH 3PP4L 3PGCA 5EZOL 1KLGB 5C09E 2LTQC 2GFBA 1U58B 2GJ6A 3O6KH 4RMSA 4HMCA 4ODWB 1A7QL 1TVBB 1BF2A 4G80A 4CN6A 2JCCE 4D0DA 3K3QA 4UDTA 4AM0B 4HV8A 4KKAC 1A6VH 1QR4A 3EOAB 4RBPK 4GAJH 5E1HB 4M8VA 3BZDA 5LQBH 2D31B 3OXSA 4ZXBB 5KSUB 3GBNH 3IT8D 2P8MA 3G6JF 3EFFA 4P3CH 5FOJA 3TLRA 2C4FT 2HRPH 3TM6A 5EO1B 1EAPB 2VZTA 3VWJA 5CINL 3U9UA 1GZQB 1QBLH 3VRLF 4UMGA 1IGYB 5DC4B 1RK1A 2DQUL 2ZCLH 3RUGA 3ALWA 4RBPH 4OGXL 3CZFB 4DEPB 1QPPA 2EDRA 1YNKH 5AWNL 3AXLB 5C8JA 3QCVH 2NY2C 1L9MA 1CGYA 5JIIA 4KTDH 4BQ8A 3IGAA 2FSEB 5ITFB 1A2YA 2P24B 1E28A 3BDYH 3TNNA 3V6FB 3WE6B 2WUCL 1NUNB 1CLZH 4PJ5E 3K2MC 4AG4H 4N0UB 3VXQA 2FH6A 3N9GH 5K9QI 2AJZA 3SDCD 3DV6B 5D70H 2PXYB 1RZ7H 3R8BB 5HHQB 1CIDA 3UJJL 1UVQA 2CDEB 3DRTB 1FFPA 3RNKA 4HPYH 1XGQB 1LP9F 4KZDH 1AFVL 1LDSA 2NYYD 4XCNB 5TGBA 3T8XA 1A6AB 1AGDB 4QGYA 2EXYC 1PDKA 2NX5A 4XRCB 3N1GC 1OAQH 2LV4A 4AENA 2VZ3A 3V5HB 3WIHL 3G6JA 4DQOL 3B8YA 4N5UA 1U8LB 5D1QC 3ARDB 1JV5A 1JF6A 2AXHA 4N0FB 1NBQA 3D18B 4D8PA 3T3PF 3FQUB 5C0FA 5EBLA 5IROC 3B83A 1F4WL 4QRRD 3NCFB 4PP1C 3QEUA 4JREC 5IEKB 2Z31B 3QG6A 4XXCA 5FHAL 4F7EB 4BELD 4IHOA 5EORH 2B0SH 4YGAB 3KPRE 4FTVE 3SKOB 2G60H 1C08A 3Q1SH 1H9VA 3STLB 1YEJL 5BZDA 4O4YL 3QJFB 3PJSA 5HYIA 3HC0A 1MHHB 4KUZH 4K3DL 3MRIA 1OLZA 4PJAF 2JKXA 1DL7H 3TJHD 4YDKH 3STZB 4ZNEA 2I9TB 1NBVL 5LGHL 3AS2A 1LDPH 1OT1A 3CFBA 4QXTA 4G42B 4CVZB 2IEPA 1H5BA 5F8QC 1BAFL 3U7WH 2AJSH 3VJ6A 4NNYA 3BX7C 4G80B 3H3KA 3GSNB 1RIHL 4XC1L 1JZ5A 1S7RA 3HZVA 4NM4L 4WWKC 1UT9A 4GJTB 4PRBA 3T0VA 3S4SG 4Z76B 2NTSP 1D3CA 4PJHF 4I4WB 1KB9K 3B5GA 4PG2C 5DK0A 4LHUG 2F8OA 1PVHA 4KK9D 3GSVA 3DETD 1HHGB 3NABH 2YZ8A 1YUHB 1WFOA 2ZG3A 3SGDI 3TO4C 2ZJSL 5IW6A 3UPCA 3LKPA 3BD5A 2PF6A 1E6OL 5D5MF 3VFNA 1P84K 1WC7B 2Q8AL 4M1GH 5DFWH 2A83A 1K8IB 2EC9T 3V0AC 5BCAA 4P4KC 5E9DD 1V7MH 3O3DB 5C8JB 1XIWD 2EE2A 1M6OB 1KV3A 5E6ZA 2VO5A 2ZG2A 1KC5L 4DKEL 2ZUQB 4LQFH 1GGTA 4NPYB 4WWKB 4F7CB 1ZEAH 5K9QG 4RGNC 4F7TB 3RWDA 2BC4A 3RDTB 5BZWA 4MLIA 5ITBL 4JN1H 4G9FE 1K2DB 1S5IH 1NCAH 3LS4H 3UTTD 5KTEL 2VLRD 4YHZL 1FIEA 3D87B 1CIUA 2G60L 1G7HA 3GI9H 1VACA 5E7BA 5EFIB 3H9HA 3IVKB 3R0NA 4PJ5B 4B5EA 3EYSL 3OXRA 1NFDB 3WUWA 1AC0A 4GBXC 1LD9A 1MI5B 4F7MB 1BJMA 1YYLH 4NQVA 5EBLB 3K4AA 1I1FA 3MRBB 4EVNA 3GGWB 3WO3B 4IRJA 1WBZB 4UT7L 3ZTNH 1TLKA 3P4NA 4G5ZH 3C5JA 5E8NA 1RZFH 5J0BA 1F3DH 5D1ZD 2JK5B 5HGBB 3GFUA 2OBGA 2E27H 3X13A 3HI5H 5ADPH 1P5UA 4F37F 2GY5A 4KKLC 4BZYA 4Y5VB 5T33L 5CHNA 1FO0L 1MFAL 1MAMH 5FAAA 2H2SC 4OLWH 4ONFH 3G5YB 4NKDA 1N0LA 3EDDA 3NMEA 1N4XL 1JGDA 3BYYA 1CR9L 5HVHB 1XCQA 2IANA 3BZFB 3MNVB 1G7PB 2NY6B 3O45A 2R4SH 3EOTH 4D9QE 1MWAH 3O3AA 4GLRH 4PJ9D 3ZDZE 4HCRH 5F7DA 1LEKB 3LKRA 4NN7B 5F7NC 4PUBL 4M7ZC 3B3IA 2W92A 5HXMA 3FCTA 3VFRA 2PW2B 5TDOB 2X70A 2Y07H 4PRHA 3SGDH 2FRGP 4HS8L 5GHWL 1KLGA 2UUDH 4NQCA 2DM3A 4B7LA 3AREC 4TSCL 4F15C 1R3JA 4OZIF 1BOGB 1LP9E 1YY9D 2L0DA 4ZO8A 2FEEI 1I1AA 4HT1H 4YK4B 4JFDB 2XKNB 4KZDL 4MCYB 4Z7UE 2Y7QA 3D0LA 2NY4D 5DVKA 1JVKA 3MLUL 4G9DA 1V5JA 3MRFA 5C0BA 1OD7A 2EDQA 3DX7B 4OCWL 3ZKMC 4YH6A 3RA7H 1NAMB 4FG6D 3KVQA 5AZ2L 1LP9B 1CYGA 4DGYL 3V6OC 4WFHE 1SYSA 3GJEB 4KJQD 3OPZL 3VH8G 1XAUA 4FABH 3CFDA 1HZHL 2H45A 2ADJB 1YMMA 2ZKHH 4ZUVA 3QT2A 1Q9OA 1QA9A 4KK6C 5HVFB 4HIEA 1R0AH 1OTSD 1T1YB 3F62A 4PG9A 1BFVH 1NGPL 3IKCA 4LP5A 4AEHH 1A22B 1RU9H 1C7SA 1G7LB 2FIKA 3KPLA 1BD2D 4P59L 2VDKL 1OGAA 4PGEB 4FQIL 2VL5A 1T1XA 2MQ0A 3SOBL 3VDBA 3GDBA 3F5WA 2C3VB 4RNRA 3W11D 4GG6A 1EAJA 2DD8H 3QAZB 5GGVY 2XA8H 1GGIH 4PJAB 1Q9WB 3CFJA 3O6KL 1QRNE 3RGHA 3DSFL 5M7QA 3SKNA 4S2SA 4K8RH 1DBKH 4KK5C 3VE0A 1T03H 2C9AA 2Y23A 3M8OH 1U8OA 2FO4B 4P2RA 1DQML 4LNVA 3MGAA 5HGDA 3KLAA 2EDHA 1CGVA 5HHNB 1SEBB 5DEZA 1YJDH 3VXPA 3S97C 5CHNB 3TO2A 1E27A 2IBBA 1TJIH 4JY5L 4LLMB 1D7FA 2A6DB 4CRPA 3DSFH 4WI2A 5KVDL 3PWJB 5FYLE 2PCPB 5HHOB 1PG7X 2XN9B 5K33A 1BZ7A 2I27N 2HJLA 3C08H 2DIBA 3GSWA 3STLA 1C5DB 1W72A 4ELKB 4QWWD 4KAQH 5DHVA 4UQ3B 3VFOB 1U0QA 3ULUD 1OP3H 1NGYB 5EOTA 4ZFZB 3QIUB 2NX5B 4KHTH 2AJYL 4XP1H 4X6FB 3RTQD 2Z31A 1ES0B 5D2NA 3LEVH 3P11H 4P2OC 2GTZB 2NLJA 5LBSH 4MQSB 5JZ7C 1G6VK 4RGMB 2BSRA 3QQNA 5C0FB 1UCBL 5E2UH 3DTXB 2VXSL 3MJ8A 3EYVA 3O0RL 2ZZUT 2NTFB 2HJKA 4Q6YA 2HYMA 3LH2H 2P46B 4YR6B 2Q86B 2IH1B 1NSNH 3BP7B 1E0OB 4XAKE 4S1SH 3ZYJA 1OAZL 4E9LA 1FGNH 4NOFA 5AYUH 1MNUH 4FQLL 3HE7D 5SX5H 5BS0E 1PG7H 3ZDYE 1IAKA 1KIQB 4LCUB 4A6YH 5IV2A 4MJIE 1DUYB 4X6DF 2ARWA 4ZUVB 1KXVC 3SY0A 5FV2A 3C2SA 3VFNB 1KJMB 1V3MA 3D69A 4HIEB 4FQ1L 1OWWA 4NN6B 4X99A 3EGSB 3P4MB 4HUNB 1GC1L 5JHLH 5SX5K 3SKUD 4DGIH 2V9RA 3H9SD 3E3QE 3GSRA 3IDNB 2HRLA 3MXWH 2EEBA 1GL4B 5FM5M 3KYOA 4RQQB 5JNYB 4DTGL 4O2EA 2E7LC 4NYLB 2ZUUA 1RV6X 1JZ4A 4D9QD 4KJWC 1QFWM 4XP9H 2AXGA 4K9EH 4Y5YC 4C4KO 2IQAA 4C83B 3ARBD 4AM0A 3QCUL 5MENE 3RWGA 4HK3J 1X44A 4I2XB 2D4FA 2YPKA 5MHSD 2OR7A 1LMKA 1INDH 3AREB 3MJ6A 5LWYH 4KKNA 3Q6GL 3W82A 5C0IA 1B0RA 3HKFA 5KOMC 3RNQB 4EXPX 5DJDB 1H5BC 2XQYG 4ODUA 2FGZA 1YPZA 2AAVA 5HYEA 1D5BA 4QRSA 1I8MB 3ARXA 2JCCB 2XA8L 1XR9B 4XCEB 4XT1C 2PTUA 5D9SB 4X4YB 2IBGA 5F70A 1QUNA 1UQSA 4A6YA 4G5ZL 1OGTB 3PDDA 2NY5C 3OKOA 3QDJE 4TVPH 4R2GB 4C56E 4AY0A 4KUCF 5LWYL 4Q74A 4L8BB 2MWCA 2FYYB 2EDNA 1GOHA 1MCCA 5K9KB 1FORH 2B20A 4DW2L 5C0GA 1IGTA 4DJMA 3ARWA 1A1MA 4P9HC 3V4VL 4OIBA 3SGEI 2VQUA 1AXTL 4M6OL 1KB5H 5D2NB 4LVOC 1LDPL 4WEMB 3PNWB 2X05A 3C2AL 3V6OE 3VDCA 3BO8B 2Y4SA 2XTJC 4Z5RA 4K71C 4U3XA 2ZKHL 2EDBA 4R26H 1LO2H 1MIEL 1HSBA 5ETUB 4APQB 1Q94A 2FB4H 5BXFA 3R0MA 1RVFH 4OF5A 4PJIF 3HE6C 2CR3A 4YQXH 4KQ4L 3B9DA 3DUUA 1ZA6A 4BFBD 3BHBA 5D7JC 2ZCKH 5FYJD 1KJ2H 1MIMH 3WKML 1PZ5B 1C16A 2W0PA 2YPLB 5C71A 3NCJH 3OZ9H 4RAVA 3B9KB 3VWJC 5DRXA 4KI5F 2NY2D 3TJEL 5J1AB 2YD3A 3CDYA 2C1OA 4N8VG 1BX2B 4HMEA 1ZHNA 5ANME 3F58L 5J4MA 3EYSH 1OY3B 3GKZA 2P5EB 3ZZ1A 3U4BL 5EU6B 3U0TA 3V0WH 1OOAA 4M5ZL 2HKHH 3B8SA 3TYFA 5FYKH 2R23B 4X80H 1I7ZB 4RZCB 5EC1B 4ESKA 2BNUB 4HFUH 4IDLA 3QDMA 4EKXA 2NY3D 4JGMA 4AZ8A 4TTDC 4OD1H 1U6AL 3NFPB 4LQFL 2YK1H 4GRWB 4Y16B 4OIIH 5DK0B 1A47A 3SDYH 2ADIB 4AEFA 4PRPB 1FYTE 1T20B 5FUZL 2H32A 3HRPA 4QHLB 1HHGA 4P46C 2CK0L 4WEBL 5C07B 3I3EA 1FAIL 1NCDH 2B1HL 4PRDA 5DRZA 2IFFH 4FQXB 5T1KD 4ETYA 3LKPB 3BZEA 4FQQB 1RUQH 5C0AE 3TPKA 3U0WH 3PGFL 3MXWL 12E8H 3T2NL 3LSOA 3GSVB 1XF5A 2RR3A 5KSBA 4Q2ZB 1BIIA 3MCLH 3OGCB 1OSZB 1V05A 3BI9X 1YMMB 4DVRH 4PY7B 2IPUK 1HILB 1RSFA 4UOJA 4WUKL 1A0QL 2BCKA 1TVHB 3QO0A 4ELME 4XX1G 3PGCB 3BKJH 1NL0H 1EBAA 3I02A 3G6AB 1GIGH 5INCA 3IAPA 4PJ8D 5DHXB 5AYUL 2UWEA 3LVEA 4P46B 1HINL 3QEQD 2M8XA 3NH7L 1JZ7A 2DRUA 5GJSH 3UP1A 5SWQB 1QSVA 3IDMA 3DXAD 4FQXC 4P4RA 1BZ7B 5D6DA 1P1ZB 3QEHB 3MSPA 1H3UA 4RX4D 2FZ3A 3C5SB 4RWHA 5D7JD 3ARBA 3ALPA 1I8KB 3ILPA 5HGDB 4QTHB 4HUXA 2R2BA 3P4NB 5CD3B 1HH6A 3OG6B 2YD9A 4X0KB 5T5NG 2F58H 3QXWA 2VLKE 4H26B 4JFYB 2W9LA 1PY9A 4UB0L 4YUEH 3CK0L 2KUTA 5KZCD 5C2BH 4NFDA 4WNQB 5C9JA 4RMUA 4W6WB 3QUZC 3H3PH 2R1WA 2RQ8A 5HPOA 3DX9B 35C8H 1VB9A 3KYKL 4F37K 4NJAH 1MWAA 2H6PA 3B4NA 3D3VD 3KHQA 3NABL 2EIZB 2V5MA 1QSFD 3KXFD 1N6UA 1OSPH 4OGYL 1BX2A 5GRZA 4OCYL 1BJ1J 2OZ4H 4Q58C 3L3DB 2NW3B 3CXHK 2ZG1A 2CGRH 4LEOB 5D1ZA 4M62H 1RIVL 3P9MB 1JGLL 4JRYE 5A16A 4DFHA 2PXYA 2GJZB 3TZVA 5DS8A 3LH2L 1CDBA 2F5AL 3B5TA 1JI1A 5T1LB 2QHRL 4MLSA 4PREB 2OLDA 1B6UA 5ANMB 4F57L 1Z9LA 3MLUH 3F12B 4YXLL 3TCLA 5C0EB 5DRNA 5IVNA 1ACYH 5EA0L 3QDJD 2PKDA 3AAZB 2LAAA 5HHMD 3MA9H 1A4JA 2IG2H 1AGFB 4XZUA 3IFPB 3MLPA 4GKZA 2Z8RA 4MWFA 4NRZB 4GSDL 4OAWB 3RAJH 3KPMB 3V6OA 1S9WA 3NACL 4RIRB 3W0WD 5L88H 5T3XE 5E8OB 5IJVA 1EJOL 3P77A 4OCLC 1L7IH 4P2CG 2OYPA 4X5XB 1JGUL 3RHWF 1CG9B 5AZEL 2A1WL 4H20H 2R0WH 3U4EA 1LO5A 5FDYA 3LSOB 5L2KD 1AI1L 1S5HA 5JPNA 2B5IB 2OK0H 3QDMD 4Q2ZA 3HMWL 5E9DA 1U91B 2GSIA 3I2CH 5IB4B 2BNRB 3FQXA 4I2XE 4WFGD 3RVUD 3EAKA 3MACL 2BXZA 1TZGL 1MHEB 4XBGB 5CBAB 4F9LC 2EZ0C 4R7DA 5C0CA 3KPSD 3NIDE 2XTJE 3PL6D 5LCVL 1ZHBA 3V4PH 3HA0A 3A67H 1BIHA 4M00A 2J1KA 4JKPH 1HHKA 1KCLA 4O2FB 1D6VL 3JV4B 3WEXB 4HDIA 5D2LA 1ZE3C 4JY4B 3D48R 1RZJH 4LPXA 1QLFB 2RFXB 5MEQB 4FXGA 1P4BH 1Z3GH 4BSJA 3NPSC 4JQVA 5GSVA 3DGGA 5EU3B 3DI3B 2WIIA 4JZJA 1RU9L 1B88A 5C0GB 2X7LB 2AJYH 5JXEC 1A7PL 4EJ1C 2R2EA 1N3NA 2VLLA 2DTMH 4NNPL 5F9JA 3D3VB 5FGCE 4PJHB 2V5TA 4XB7A 2WLYA 4OM1L 4W6XB 2NX5E 4EI5D 5IVXF 1ZGLP 2X40A 1UGNA 4FP8L 4TNWF 2OTWB 3PWVB 4CDGC 4G7VL 1IM3B 1NGXA 3E0GA 4S10A 5C0RH 5ALBH 2IG2L 3SN6N 4LARL 3FTGB 1FFOA 2YEZB 5DJYB 4DZ8A 5J3HD 1KJ2B 3PWNB 5A2FA 5DJ2B 4OCWH 5HHOA 1YQ2A 1CL7I 4M6ML 4NKMA 5KVGH 1ITCA 3BH8A 3EO0B 2ZOLA 1L9NA 2DTSA 5EC2B 4NQDD 2V6HA 1H3GA 3FB7B 1G7HB 4DUVA 5FFLA 3P4OA 4F9LA 3HI5L 1HSBB 1Y6KR 3L3IB 3LOWA 2OMBA 3TZVD 2Q8BH 5HJ3B 3WHE1 5JXED 1PEWA 5HHXH 1UWXH 2QSCH 4JCLA 3GJFK 3HNVL 3L5WA 4M3KB 3ZT5A 1RUAL 1CXKA 2Z91A 4PRAB 2XRAH 3KXFA 5IQ9B 4KK6D 1WT5A 5EIIA 4P57A 1IAIL 1MH5A 4NRZA 4OAWA 2EYSA 4U1HB 1CE6A 4JFQB 1FNGA 4LQ1A 3V5KA 5DJ6A 4IRSC 3TBYA 5I1EH 2R56H 2XNAB 3QWOB 2CLZB 5I1IH 4AEHL 5I0ZA 1KFAL 4L29A 1MRDH 3N85H 4ZOAA 4DKFH 5F7EH 2ZUQC 2WV3A 1OTTC 3MV9E 2PUQT 4JFXB 4N0YL 3HZMB 3RBSA 3OAZK 2R69H 4M5YH 1BGXL 5DRZB 3ZHDA 4QXGH 4NQEB 1U3JA 4ZOBA 4GRLC 2PO6D 4ZOEA 3FO2A 3QUYA 1IMHC 1VEPA 4GKNA 5B3JE 3ARGA 4GXVL 5E4IA 1DBJH 4E41E 3LN4B 4NZRH 32C2A 1BM3H 3RL2A 1OPGL 3FRPA 5HYJB 1ACZA 4OLYL 2IAMA 1S7SA 3F7PC 3VG0L 4AH2A 2F54A 2CK2A 3MV8B 2GK2A 4U31A 1OM3H 5JNYA 5B8CC 2HG5A 2ORBL 1UJ3A 2AABH 4F3FA 1NBYB 3EGSA 3P4MA 3X3GH 2D31A 5KSUA 3G5VB 2VLME 4ZXBA 4HSQA 2NY0B 1C1EL 5EZIH 1S8DB 3MZTA 2ADIA 3MRCA 3V0WL 2L7JA 1J8HB 4S11A 1CFVL 2PETA 4LSPL 2OL3A 4KKCD 4LSTH 4U6VL 2AABL 1S5IL 4IM8A 3BAEL 3GB7A 1M7DA 1D9KD 3FO0H 4FRWA 3LD8C 5CSBA 3U36B 3QULA 1FNEB 1S78C 4PJCB 3EO9H 1JYXA 1MRFL 5EBGA 5E00B 4MVBD 2ADJA 1CLCA 4OCNC 5FOBB 5EU4B 4KQ4H 4LDEB 1KEML 4Y2DA 4WNQA 3O4OB 4YC2C 5DUBB 5DMKB 2NZ9D 1L4IA 1OTTD 1TVHA 2HJFB 3QO0B 1LO2L 1MIEH 4R2GC 1S7VB 3T2PA 4X83A 5E95B 3FT3A 5JO5A 1K4DB 3RU8L 2DQDL 3HPLB 1PKOA 1TZHA 3CSGA 3KJ6L 2Y36H 1IGTB 3NA9L 1JMXA 2FWOA 4JPKL 2E8ZA 4K71B 3EO1B 1RPQA 2XXCB 4U3CA 1HXYA 3IU4H 4WFFE 4PRPD 2VLRE 4PREA 5FYJH 4Q6IA 4GH7B 1A6VL 3B9AA 2RHEA 1KTKE 4Z18A 1YPZB 1OP3K 3IETB 1BVLB 2DMKA 1D6VH 1I4FA 2X4SA 2V5YA 5K59F 5I75B 2B7DT 4P5KA 5IMMB 4P2QB 1Z5LB 5L0QB 3KJ4C 2CXGA 1W8OA 2A6IA 1SEBA 4XNXH 4QRRA 1MCPH 3BGFC 3ECBB 1F5WA 1UB6B 3QH3B 3VXPB 3QNXA 5CEXA 2CMRH 4GG6E 4YX2L 1KIPB 3EDEA 4PD4J 1ORQA 4WJ5B 5IMOA 1IEBA 1B3JA 2FATL 3T4AA 2XICA 2A6JB 4PJXF 1QSEE 3SDAB 5EU6A 4LLVB 1QVOA 1WUNT 4KJWD 5I1EL 4LSRL 4P49A 3CX2A 1H8SA 3VH8B 3T0EA 5ALBL 5JPMA 4UT9H 1JP5A 4PLJC 1GOGA 1T0NB 2DLGA 3FZUD 3BPLC 3G04B 3PWPA 4YHPB 4JR9L 4IS6A 1X6NA 4L9LC 3IDGA 1BBDH 4HXAH 3RWFA 2FHBA 3JV6A 1KBGH 2Z8WC 4YE4L 2JTDA 4PGCB 4IMKA 5LXGH 2OQJB 5CS7A 3EHBC 3K4DA 1AGFA 5C0NC 1AP2B 2RJMA 1T83C 5FB8B 4WI8A 1JNNL 4TRPH 3VFUB 1JNLH 4OJFL 4J8RB 3CFIC 3QFDA 3GSXB 5EH1A 3BP7A 2BY1A 4ZFOB 3QDGD 1IC5H 3QCUH 3WFHA 4LSQL 5JW3L 3FQRA 2JB5H 3OAYK 3O6LL 2UV3A 4QXWA 3K81A 5FECB 4MA1B 5TE7H 5AAWA 1IGJB 1QFHA 2VUYA 4PP1D 4X6EA 3O2VH 3H42H 3UTPD 2VLJE 3SDDD 2R0KH 3ZL4L 3BGMB 4L8DB 3ESVF 1IFHH 2JJSC 3O6FD 3OKKB 4U1IA 3TEUA 1WCBB 35C8L 3GRWH 4LCWB 4X9GA 4WTZA 3NIGE 5FF6A 2HVJA 5KSAA 3AM8C 3V8OA 1T20A 5DMGD 3L3KB 1FBIL 5DJ2A 4NWTL 4CVXA 1TDQA 1BQHA 5DI8B 2X4PB 3VFMB 3D39D 5J6HB 5KVEH 4MQXD 2Z0BA 3GKWH 1A14L 5GQBA 5I8KL 1VHPA 7FABL 4ALAH 2HN7B 1IGCL 2HTKD 4S0SD 1AXSA 1AGCB 5I19H 1VFBA 4KKBD 1I1FB 3HAEH 1RI8A 2CRIA 4CN4A 3PHQB 2P8LA 4J3TA 2QSQA 5T3ZH 1NCCL 2BY3A 3MLSL 2P1YA 1FO0A 3CUPB 1ZA3A 3OKYA 1A21A 4P5MA 5I74B 4Z7OE 4UUJA 1FP5A 1CK0L 1A6TA 1Q8MA 5GGVH 3AY4C 2FBJH 3TH3T 2AJZB 2AGJH 3V0VB 3F7RA 3CNKA 3JWDH 4AT6A 4X0KA 3RNKB 1FG9C 2BNRD 2ITDA 3UTTA 1A02N 4FZ8H 1SVCP 2QQLL 1AGDA 1JZ6A 4N0UA 3VXQB 3EDKA 4WI7A 3JUZA 2J6EH 2WQ8A 3O8XB 1Y0LB 1QFOA 2UZIH 1PX3A 4LLUA 4J1UA 5BRZA 4ZFFB 1CZ8L 4HS3A 1NANI 4N0RA 5DJXA 3O3BB 5B4MD 2XTJB 3IDGB 4F80A 5ABDE 4PGDA 3TBYB 2JCCF 4XAKD 1RIUL 1XGUB 1A3LL 1KB5A 1DFBH 3V52L 2Z92B 2APXA 3GHEL 1P4LB 3BVNA 2GITB 1IL1B 3H7BA 1LVEA 3OG4B 1CDYA 2JELL 3ARPA 4XP4H 3V5KB 4UNVA 3I84A 1EK3A 4PJ8C 1J8KA 4V1DB 1FVCA 4U1LA 4UI2A 4NIKB 4PJFE 2AS5M 2F19H 3L1OL 2D7PA 3EW3B 1WISA 4KMLB 4Z77A 2PR4H 4YZFE 5EUOF 2B5IC 2VLRB 4OFIA 2LVEA 1IGCH 1CFNA 2VITB 4OTXL 3DO7A 4HF5L 2GEEA 2AVGA 2GIYA 3OX8B 3ZT7A 4NO0A 4ELMA 2R2CA 4LLAA 3ARTA 3BKCL 43C9B 5FO7B 1N6QH 5DZNA 3VFVA 2BX5A 2CUHA 2EYTA 3F7YB 4PV9B 1W0VB 3VGBA 2W60B 4PJIB 5JR1L 1JTPA 3VFTA 1J1OH 2NXZD 1RUML 4GLRI 4JZNA 1HIML 1ZHLA 2PN5A 1T6WA 4WHYG 2EE9A 4IOIB 4MAYC 12E8L 2A38A 1CXHA 3CXDH 4CU8A 2EH8H 3O41A 3C60D 1VGKA 4EBQL 3JTTA 1AR1D 1BQSA 3LIZH 1T2QL 2R2HB 2P5WD 4S1RH 2WIIB 4Z7WF 3TT1H 4XVUC 2ZP0T 4P3DB 4GUPA 1S7WB 4G3YL 4LVNC 1H15A 4OT1L 1OCWL 2ICWB 1KG0B 4GAYA 5CJXA 1IJ9A 4F7MA 5GSVB 4UIMB 3T2QA 3FONB 1NEZG 3GGWA 1Q1JL 3FFCD 3EJZC 3AFLA 2XACC 1AKJB 1LNUB 1TQBC 3GBML 4U6YA 5LXGL 1A2YB 2OXHA 1GZQA 5E6IA 3MV9B 1J0KA 4HBCL 2HFGL 1M71A 1QBBA 2A6DA 2EDEA 5B8CA 4NQCD 5DJ0B 4MS8D 2E7LA 4MCZB 4O02L 5JW5B 3VRJB 4KMTH 4XGZB 1YNTA 1WZLA 3PWLA 1EO7A 3X14B 1L6ZA 5J12C 3IJYA 1OAYH 3I6LD 1NKOA 3TBTA 1JF1B 4G3YH 1CR9H 3V5HA 4PRIA 1CICD 2D9CA 5FUOL 4L4VA 1A3QA 2DIAA 4K3HA 2NR6D 1QPXA 2N4IA 3C60C 3UO1L 1I75A 4WUUE 3ARBB 4P2QA 3S3SA 3RWJB 4XCNA 3U79A 4GW5B 4LRNH 3QQ4B 4WO4B 2VN4A 1Y18B 3H6JA 4L4TD 1G9MC 3FRPG 1I8IB 1LE5B 4BSVA 2DKUA 3NH7H 4ODSH 4E42B 3TNNB 1BOGA 3EIFA 4L29B 5CJ5A 4NFCA 4UU9B 1BQLH 1MCQA 3CAFA 5MERB 3VXSE 1YN6B 3ZE1E 2GTWA 5T3XL 4RISL 4GQ9H 1ZOXA 1R5VB 3O3UN 4ZFGL 3CX5K 1VSCA 5GRUL 2N7BA 4NQEA 4LSTL 1D5ZA 3B3IB 4XPBL 5D6CB 3SY0B 2YS4A 3FN3A 3IXAB 3S8WA 1HQRB 4MA1C 3TZVB 3O45B 1G1YA 4WENB 1V7NH 3MCKA 1IZJA 1CD1B 1ND0B 2ZUTA 1RFDH 2HKFH 3GJEA 2PW1A 3H9SB 3ZTJH 4IOFC 3MYJA 2O61B 4Q97A 3VGAB 4LRNL 4OD2A 1HYRC 1X5YA 2NXYD 5IESH 1S7RB 3HZVB 4Q9QH 4U1HA 3FQNB 3T65A 2VDLL 5EPMA 3BE1H 2KZWA 2R4SL 3MNWB 5A43C 3AAZA 1B0GA 1FFRA 2ATPB 5FGBA 5CLTA 1I1AB 2WP3T 3P11L 1ADQA 1FAKT 1X5ZA 3DSNA 4JQVC 3SKOA 4YX2H 1I9RH 2V2TB 3VXMA 2GUOB 1DZBA 1Q9LA 1SJEB 3ARFD 3C5ZA 1BQHB 1B4JH 4XBEL 5SWZD 3KLHC 1MRCL 3KS0J 1J12A 1C8PA 2DQFA 4XCCH 5IFJA 5F96H 3G5VA 4HCRA 4XHQA 4LEXL 5J8OA 3QRFM 4U1IB 2X10A 3UDWA 3V5DB 3GMRA 4KKCC 5FF6B 1A6PA 3C5ZD 2HRPL 5I2IB 5B21A 4WFHD 2LAGB 3C87A 4LMQE 3VXMD 4B50A 2OTPA 3QNYA 2I60L 3MUJA 3VXNA 1TJIL 1AHWB 3TT3L 1MF2H 4X6CA 4WHYH 4U1JA 5GRVL 3U6RB 4L8DA 3D2UB 3SDDA 3OBAA 3NIDF 4MQXC 4I18A 1TITA 4OQTL 3KPOA 2W9DL 3HE6A 1MNUL 5TE4L 1VFBB 3BKML 3QIWD 2WNGA 4PB0L 1TTFA 1F97A 4YO0A 2W1NA 2ITCB 4HH8A 4JO2L 2X4PA 4JN1L 2QSVA 4DOHE 3U7YH 5JZ7D 4BQ9A 2AJUL 1WC7A 2V5SA 3CVHL 1WQVT 5CZKA 1CTOA 2E6PA 4MD0B 5HHMB 3OJDA 2BSSB 4JB9H 4Q7DA 4XCFL 5JIPA 2MSPA 5FYKU 1E27B 3MUZ1 3OF6A 3MJ7A 4K94H 4JM2B 5I1KH 2H26B 4JFFA 2Y72A 1J0ZA 4JHAL 5FHAH 3N06B 5KN5B 3V7AE 3G5XB 5IB5B 2DQEL 3CZFA 1JUFA 3U1SL 5KOVC 3G6JE 1MCRA 4JG0L 3GK8L 5IMKB 4BQ6A 3TIDA 1R6VA 1E4KA 4OGXH 4KJYA 5D93C 3RX8A 2WQRA 4Y4FC 3RAJL 4WW2F 4MD5B 2N7AA 5IOPA 1A9EA 4RDQG 5D6CA 1MPAL 3DX8A 3CD4A 4R7NB 5CJQH 2A73A 3MV8D 1U42A 4NJ9H 1XGRA 3TA3D 2DKMA 1CE1H 3Q6GH 5CJBA 3O6LH 5L7XL 3H3BC 4TNWK 5I1AA 2BZDA 2PO6A 3L9RA 4Z9KB 3BUYB 4POUB 3OAZH 2ZUYA 2JLLA 3ETBF 3IDYB 4LCWD 2L7UA 4O2CB 3U7WL 5C7XL 1PX4A 3T0EC 3N9GL 4M1CD 5GGVL 3O3BA 1R5IB 3RWFB 3O4LB 1S9XB 4WTWA 1CE1L 3MRDB 3NIFE 4JPVL 4M93B 5KW9L 4G8EA 5E7FA 1GGUA 4X4ZA 3N1FC 3OSKA 3WS6A 5J9PA 2GT9B 2CGRL 4XVSH 2DIJA 3PWPD 4R4FH 4Z7OF 5JOPD 1LK2A 4Z0BH 3HI1B 2YHGA 5I18L 5E6ID 3LD8B 1MCJA 3DURB 3WD5H 3C6SB 1A14H 4PY8J 5I8KH 2UZIL 1GVIA 1G9NH 5K9OB 3DUSA 1TTUA 1YEHH 5IM7B 3QNZA 3MBEB 5DUPH 3SKMA 1INQB 1NC2A 2HH0L 1CDJA 4EUPA 5KVFL 5F88B 1XF5B 1A7NL 5I1JH 2XPGA 4R6UA 3GBLA 1BJ1H 4NBXB 3MRFB 4PB9L 1DEEB 1NMCC 4EOWH 2DMBA 5IV2B 5M95B 5BRZE 1RD6A 3K46A 1L0YA 2GJ6E 2Y06L 4HKJA 3RKDC 1BECA 1Q9KB 2BVOA 3NCEB 3FONA 4PJBE 5BJTA 1KPUB 2XWTA 2X89D 3WSQH 4F9PA 4PYGA 4QXUL 3V4UH 3RGVC 1QSZA 3MV9A 3RRQA 5FO9B 1RZGA 3MACH 3FFDB 3RZWA 5DJ0A 3MFFA 1BBJA 5T1KB 4FS0A 5C0BE 4X6DA 4GW1B 5DFVD 4PTTA 1L7TH 3HRZB 5F71A 2FZ3B 4WUKH 2R2HA 3IJYB 2DQIH 4M4RA 3SGKA 2XZCL 2FJHB 1MREL 1T7WA 4X9IA 1F3RB 3QIBB 3IRPX 2IADB 1JWSA 4NQXA 1QQDA 1DVFD 4LLYB 1NFKA 1T80A 4LVHC 3SGEH 4PJ9C 3S36H 4JDVA 4NCC1 2A74A 5C07E 5F1IB 5AEAA 4FHBD 4PJGE 4PJCA 4TOYH 3NCCB 1FH5H 4D3CH 4WFED 1RZKH 5ICXA 2EKSB 1KULA 4U6YB 5I1DB 4OGAC 4LSSL 2OR9H 4JE4B 2FL5A 3UBXI 1KCRL 5F6HI 4F7TA 5CMAB 1NAML 3MLYH 3GBNL 2VXQH 3I3DA 3SDYL 2W0FA 3BDXA 3W9EB 4QRPA 1MAML 3J8F7 5D7SL 2XZQL 2AI0H 2HWZH 3QUMH 3AROA 1GC1C 1AIFB 3BDBA 5I1LA 4Y5XB 1ZVSA 5T1DH 5DD5L 4O00A 2DDQL 4OM0L 1XGYH 3VFPB 1A6ZB 4JFDD 1LE5A 1NFDA 1GCFA 4XX1E 4OCYH 4CMHC 2XFXA 3HZYA 2ID5A 2FX7L 1XGUA 1UM5L 2I5YH 5HYSA 3IXTA 1RY7B 3JWOH 4HBQA 1U92A 4G8GD 1YYLL 3VI4F 5D2NC 4EI6A 4NC1E 2AEQL 1ED3B 2YRZA 4I3RH 5F1KC 3D9AH 1Q0XH 3DYOA 2VJXA 6FABH 3SDAC 1JNHA 3BHBB 2PXYC 3PP3K 3J7HA 3EBAA 4YFEA 2WUBL 3RWHA 4OIAA 3TF7C 1F4XL 1YZZA 3WIFB 1VFAB 5L2JB 3DO7B 3L7EB 1IAKB 1FO0H 4LHJB 5DD6A 5DO2C 1MCSA 4XBPA 1F13A 1YEEL 4NKIH 4ZFOL 1DUYA 2D0FA 3BP5B 2F53B 2B1HH 4FQQA 1YEKH 3EYOA 3MBXL 5SWSE 1QRNB 1NC4B 5FKPA 5GS1A 3HI6L 1MI5D 5JMRA 2XWBA 3CVIH 3Q1SL 2X09A 5EZLB 1MFBL 3KPNB 3F65A 2K3TA 4PV8B 1IC5L 4JRXA 3HAEB 2W91A 1KN4H 3LQAH 3QQ9D 1MRDL 2JF1A 3OKNB 5ACMA 1PJ9A 5D71L 1YNLH 2HFTA 5EG6C 3DRQA 3S96A 3FO0L 2AEQH 2IANE 4X9FA 1F02I 1IAOB 2YPVL 4XXDA 5E94B 1MUJA 4LL9A 2V2XB 5IB1A 2OZ4L 4LCYA 5I66A 3QQ9C 1V7NL 1OF2B 1LEIB 1MJUH 1FZOA 3KJ4B 3BEWB 2P4AB 5F1NA 4MA3B 1KYOK 3GMRB 5F9OL 5FDWB 2DQTH 5DD5H 3QEHA 4ZS7L 2A9NH 4FFWC 4U1GB 4ZG1A 4OZIE 2LVCA 4LGSB 3VXNB 4XMPH 3QSKB 5IHZB 5E5MB 5J11B 1CVRA 2VSDA 4X7DC 2CLRB 4EDXB 1AY1H 4I1NB 2HT2D 2JJTA 2R0ZH 3PF2A 5BS0B 2PTVA 3FTGA 3MLVH 4X6EB 3VXOB 4OBRA 1N5YL 4JRYA 5HDBF 1SJVA 4XVTH 5SWQA 4XMPL 3E6HA 5BMFH 3MLRH 3DVGA 2FIRT 1NEZB 3QCVL 4MHHG 4MGXA 1YNKL 5AWNH 1XGTA 4EUPG 1UEYA 5F9OH 4I48B 1UZ6F 4KJYB 5FYLH 4PD4K 1YEJH 5B38A 5BW7C 3I75B 1U95B 5JXAL 3GMMB 4Z7WB 4MJ5A 2OJZH 2R2BB 3EJYC 1T1XB 1JPST 3G6JB 4HHAB 3UTZA 3ULVE 4RFNB 3RFZC 4U1NA 2W65A 3VXRA 5T3XH 4PJAA 3L3JA 1QLEH 4URTB 2RBLA 3HS0B 3MFGB 1S3KH 3QO1A 3V4UL 3WFCH 3QDJA 4ODTH 1A4JB 1N7ML 3T1WA 3SKJL 3OB0K 2PO6B 1S78D 3L9RB 1ULVA 4QRTB 5JDJA 4XHJC 3GHEH 1ONQA 4PJDE 1IILE 3SE8H 1XGPB 1UCBH 4NBYB 1P7QD 4YHYC 1AQDB 4HS6A 1V7ML 3DJ9A 4QHKI 3ILQC 4XP6L 1NC2D 4I3RL 3BDYL 5D2LE 3O3EB 4KRMB 1ZMYA 4I0PC 4JRYD 4U7SA 5AAMA 4RMRA 2GT9A 1YMME 3IFPA 5MEND 4FG6C 3QXDB 3PABA 4MWFB 2P5EA 2FX8L 3U0TB 4TUOA 4PGDB 1RK0A 1SJXA 4MYWB 1HIMH 2VYRE 5KAQG 2Q8BL 2ADFH 4BZ2L 1UH3A 3UTOA 4NQEE 2DQGH 5DRXB 3MFFB 2H2PC 4MA3A 4YXLH 5J1SC 2X41A 4HX1B 1R24B 5BVJB 1FYTB 3LCYA 4X6BA 5C7XH 3FHAA 1YQVL 2E9IA 5D96C 1GAFL 1TMCB 4QF1A 2DM7A 4MJIA 1MQKL 2FJHA 1TFHA 4G6JH 2H8PA 1NSNL 3CMOH 3FO9B 2IADA 4U6HB 3D3VA 2BRQA 5FA4A 2DB8A 2YXFA 1UADC 4Y1AE 1Q0YL 1CL7H 4M5YL 4YHLL 5IGXL 2CO7B 1CI5A 1CXEA 1WTLA 2O5XH 4IRSD 4ZXBD 5J57B 3RKPA 4U0QB 4FFVC 1BIIB 4JG0H 2XZAL 3VD4A 3N85L 1OGAE 5EIQA 1J11A 1K4DA 3RX7A 4C55A 2QADD 2J8UE 5C2BL 4JPIB 5KVFH 1T83A 1SJHA 2I24N 1GGCH 4NC1C 5CKGA 1NGQL 2V2TA 4K94L 1RUPH 5CP7B 1QTYT 1TJHL 2FJGB 4QNPF 5IBLC 4K9EC 4PJ5A 4QRPD 3FN9A 3MRGA 2WWKO 4MD4B 1IC1A 1CN4A 5INCB 1T4KB 3TFKC 2R0KL 5C86A 2W65B 1JBJA 1CL7L 4NRXB 2D7MA 3IDJB 4C83A 3WIHH 1IM3A 4KI5C 3QUXD 1WBZA 1FVDA 3CMOL 3WSQL 3MA9L 1BFOA 3VWJB 1A1OA 2YEZA 3MJ9A 4OB5H 2XKSA 3QQ3A 5LG1A 4Z7NE 5HYSB 4Z7UB 1TZIB 2DBJA 3PWVA 1DVFA 2OTWA 2VIRB 4JFZL 5DHVH 5FGCB 5HHQA 5IT2H 3OV6A 3V52H 1FN4A 5D8JL 5C08E 2CJUL 5ILTH 3RWEB 3SGKC 5CP3A 2FR4A 5DYOA 5H94A 2B4CL 4AEEA 2P7TB 4Y8DC 1XGPA 2HH0H 1L6XA 1X5GA 2J6EA 1ZLWK 4KRLB 3T0BA 3VFPA 1JGUH 4G7VH 5TJWK 2GCYA 3T2NH 4OQ1A 1XCTA 4P46D 1YPZE 4FZEH 4KXZI 3GIZL 1BP3B 3IB4A 4XCCL 3UROR 2MKWA 4ODHL 1P7QA 1U8NA 1MCOH 3QUXC 3ROOA 2CUIA 2X1WL 4XH2A 5ICZA 2EYSB 3V7AG 1KNOB 1XGRB 1A6UH 5D7LB 1I9EA 4KQ3L 4PG2A 5HPMB 4LGRB 4ONOA 4EIZC 4I3SL 4PRAA 5DD1H 3OKMA 3PV6B 1FNGB 4PJXB 3MREB 3THML 3TPUA 2CLVB 5CIPB 2WP3O 5DWUH 3MRIB 1D6EA 1MUJB 1HQ4B 3QIBD 4WUUA 1ZS8B 2HFFB 3QUYB 3VXRD 2AV7B 3HZKB 3BP4B 4R0LB 3NZHH 1HH9B 1DSFL 1EGJH 4JO4L 1G7MB 3KPNA 2P8PA 2ZNXA 3L5JA 4V1DE 3WBDA 3HG1B 4GRWF 4Y16D 1J5OH 3DXAE 1RIUH 1N2RA 1V3JA 5GGSY 1U8PB 4U1KB 5I15L 5E2JA 5HHVL 5ACZA 3X3FH 4BH7B 4CNIB 5J89A 3EOYG 4K3JL 5GISL 2R0WL 1WV7T 5BS0A 1IC7L 3UPRB 4BZ1H 1MIML 1U91A 3WKMH 1HK6A 4LCYB 5I66B 2R8SL 1KEGH 2M1KA 3RU8H 2WANA 1AXIB 3FB5A 1T22A 1UM4L 5A3IC 1YEFL 1KCUL 2Q3ZA 2VAAB 4FZ8L 5IB1B 1TZHB 2H41A 3EFFB 3TBSB 1QG3A 1F3JA 1YMMD 3S3JA 1Y6MR 5HYQB 3O9WC 5IR1A 1YEIL 5SV4A 3V2AR 4WEUD 4WWKA 1JNLL 4RGOH 1CS6A 2W38A 3MXVL 1R3HB 4RFEA 5LAXB 3UAJD 4OF6A 5JDSA 1OSZA 3VFWB 4FQCL 4F58H 3TVMA 1E4KC 1TVBA 3WE6A 2BOBA 1ZLSH 1UJTA 4OGYH 1QRND 4D0DB 4ERSL 1ZT4A 1CLYH 1QFUL 2Z4QA 3WEXA 3VGAC 3ULVL 1J86A 3LHPH 4MJ2A 5E6IC 2VTFA 3GK8H 5JHDD 3GIVB 3HCVB 3CH1A 1FFNB 4PJBA 4GKOA 3FFCE 4NZUH 5FUCE 4JDZB 4X5WA 5DMIL 1MI5A 2FL5B 2P48B 2LU7A 4P2RE 3MNZB 1P2CA 4AENB 1N4XH 3H9ZA 4EEEA 2BVUA 4CKVX 2O5XL 1JYVA 1MCBA 1TQCC 5C0AA 3HI6H 3QA3A 5HGBA 3LB6C 4ODVH 5HY9A 4U1NB 3KXFB 2X9WA 1U92B 4EI6B 3QDME 1X5HA 5CD3A 5GGTA 4JQXC 3C2AH 4LNRB 4WHTA 1A6ZA 3DLQR 1WGOA 3JTSB 4PB0H 4JFFB 5B3JF 3E3QC 2CSPA 1IKNA 3K1KC 5C09A 4TSAH 4WWID 3T77A 1FORL 4ZTPL 3QHFH 1K4CA 3CDCA 2R56L 1NANH 4KKBC 4UT6L 5DJ6B 4MDJB 5ADOL 3L3HB 4FFYH 4U6VH 1QKZH 4HKZA 3HB3C 1QBML 3ROLA 3VFRB 5GPRA 2ZCKL 4LLWB 3HUJB 4NOBA 2ENYA 3HN3A 5GGUA 2NNAA 1KIRB 4Y4HD 2I07B 4OLEA 3AGVA 5FM8A 4BFEA 4APQC 4NNYB 3LKRB 1MRCH 3NOIA 3L5XL 3S37H 3WFDH 3THMH 1T0NA 3HFMH 1U3ZA 1J1PH 1RIHH 4XC1H 3DHMA 1FNLA 4PJ8A 1OQXA 3U0PA 1TNMA 3QPXL 4G6FD 1N5YH 1JPFB 3AB0B 5EU6E 2YZ1A 2VN7A 4FOMA 2DOCA 1XR8A 2VKXA 3SE8L 3MLYL 1UZ8A 5C3TA 1INEH 3L3OA 4XCYB 2E8YA 3CU7A 1C08B 1IQDA 2JJWA 3D5OF 1KELH 1U93A 2VDQL 3B2VH 3RVTC 3EYOB 1K8DA 2R8SH 4F33A 1MEXL 3I6KA 1NC4D 2BVPA 1NCBL 4BH8A 2A9MH 5FYJL 2BNRA 2W0KA 1RQ5A 1EVUA 3D9AL 4PRNA 3KYAA 4NKQB 4QTIH 1ZXQA 5CP7A 4Q9RH 3LKSB 5FGRA 4HWBH 1B4RA 2C3WA 2EZ0D 2AQ2A 1IAOA 2PYEA 4HF5H 1SY6L 4TSAL 5H37H 3GNML 4TUJA 4XWGL 1X5IA 1PD6A 1U8HA 1MJ7H 3FB8B 3B2UD 4U3HA 2PR4L 4OLZL 4KJPD 5IMLB 1UC6A 4XNMA 1A7QH 1X9QA 4JY4A 5LCVH 1AHWC 3TESA 4OZGA 5H2BB 3K80A 4CL7A 3ZDZF 4GBXB 4DGVH 1LD9B 5F7LB 3PV7A 1P6AB 3HNSH 4WO4D 5C08B 1U95A 3QB7C 3MV7E 4X7TA 5EFIA 3ZO0A 1OAUL 5JW4R 3NFSL 1JF5A 1B9ZA 4OFPA 1IM9D 4ZPVB 3R1GH 3MRJB 4NDMA 4ISVB 2EE6A 4ZSOB 2QLVB 2ZCHH 1EERB 4XTRD 5H94B 1KJ3H 4JRWA 1DQTA 3LKQB 5CJXC 3MV8E 4NZUL 1DLHA 1ZWIA 5MEOA 2CDGA 5AUMA 1T2XA 1NCTA 1QSEA 4NHUB 1IAIH 4XMLL 3AXLA 2XWJA 3MCG1 1YN6A 2BVQB 4NRYA 5EULV 1VPOL 2NY4C 4IIQB 4J1UB 5TE6L 2NW2A 1PGRB 2DQUH 2BY0A 2ZCLL 5D72L 1EEZA 4LFHD 2VDRH 2VWEE 4U1LB 5GS0L 2AEPH 4IEFB 3KNBB 5FGBC 3QIUA 5TE7L 4LRIC 3P0VL 3OR6B 2GK0A 2X6MA 3WKNA 4HUUA 2MJWA 2DLFH 2ESVB 2QADB 2BRRH 4LAQL 1A3RH 4NQSA 4HS3B 2VLKA 3UC0L 2A6JA 1EJ6A 1LGVA 1FQ9C 1NGYA 4HS6B 3D1MC 3QIUC 1DBJL 1JPSL 4I3GA 3E6FB 1UWEH 1N6VA 3OKLB 4ELMF 5HYJE 1EZVX 3S6CA 4M7LL 1OP5H 2JK5A 4S1DD 2HFEA 1YEKL 1BFSA 5IIEA 4LPUA 2VDNL 1XZ0A 1YEDB 3WXWH 5CZXC 2B39A 3D0VA 4XNQB 3RL1B 4MS8C 5IEKA 1X4YA 2H2PD 2PYFB 2X44D 3CXDL 3MJ9H 3N50A 3ULSB 5CEZD 5ICYA 1FNSL 1DQDH 2Q76A 3TH2T 1QBLL 4PUBH 1ZTXL 4N5ED 1KGCE 1WICA 1IEBB 4HEPG 5KSVA 1TJHH 1KFAH 3KYMA 1G7PA 4LP4A 5TQ0L 3MRPA 1GGCL 3NAAL 5EU6D 4R0LA 1FG2A 4U33A 1U8KA 5TPWH 3VW3H 4KRPB 1JHTB 2NY6D 3UDWC 2AGJL 1J88A 3BQUD 1CK0H 1AHWA 1JCKA 4H1LH 3RNQA 1QO3B 1T22B 4NN5C 1HZHH 2BY2A 4U6HA 1P84J 2OSLA 3WFCL 1P5VA 4M61A 4PJGB 5DA4A 1PG7W 1OGTA 1U2CA 1G0XA 3SE4A 3IDMB 5DQDL 3O11B 5FO8A 4PJDB 1WJ3A 4F3FB 4GBXA 1WT5C 1G7JA 2RIKA 5C07D 1EX0A 4JDZA 4N0CD 5HHOE 3S35L 2VRAA 3NAAH 4HUVB 4IOFD 2JIXA 4NJ9L 4D0BB 1T6VN 3BEWA 4JY6B 1R5WB 1YUHA 5FECA 4JPKH 4G6MH 2WBJA 1FZMB 2V7NB 4XVJH 4ODHH 2Q7NA 4JVUA 1ZGLB 43CAA 1CZ8H 4MHHI 1DQQB 1KG0A 5FEBA 3QDAA 2YD5A 1QYGH 5LAXA 4IMLA 3VRJA 3TIDB 5I73C 2LQRA 2QJDA 5E2WL 3CK0H 4OLUL 5HTSA 3VE0B 4MXWL 4WI3A 4POYA 5HI5C 4R0LC 5HYSG 3UTSA 1Z3GL 4UV7L 4PJ7B 3RDTA 4JB9L 1ZT4B 3JWDL 1OAUH 2DWEB 4ONGH 4TULL 3H0TA 3EOBA 4OI8A 3BP6A 5IW1B 4LSUL 1ZSDA 1D5IH 3RJDA 3IFOB 3QG7H 3DXAB 3KPRD 4FTVD 1J18A 4L9LA 1GZPB 5DUMH 4XNXL 3ROLB 1UB5A 1D9KB 1NQBA 3SE9H 3L7FB 1KPVA 2AEPL 2X89A 3BKMH 1CICC 1EMTL 3PP4H 2HKHL 4WV1A 1G6RH 4NM8L 4HS8H 3BIAX 4OZ4B 3BD4A 5TE6H 1I85C 4OD3L 3T77B 1TXKA 2BNUA 2ERJB 2X5PA 5DMJB 3WHXB 1T5WB 5CKAA 3ARRA 3EYVB 3TGXA 4ZFZA 1RUPL 2WIMA 1T04B 1ES0A 2WBJD 1GGBL 2WW8A 3FT2B 4FQ2L 4MZ3A 1SY6A 3REVB 5DJZB 2J8HA 4R90H 2NY6C 5IB3B 5ISZB 1UYWH 5DEFB 2JIXD 1KN4L 3LQAL 3D2UD 4N68A 1MLCA 2XN9A 3AY4A 3DOSA 1IL1A 2J8UB 4DZBB 4U1SA 4L4VD 2I07A 2G5BA 1FHGA 3WXWL 3TPUB 4U2ZA 3ULVC 4U0RC 3D39E 1N0XH 3SDCA 3GO1L 5ISZE 4LOUD 4CNIA 1S3KL 4YEEA 4MB3A 4NCDA 2IPTH 2K9UA 4QRUB 4XAWL 5GGSA 4FXLA 3ARYA 2H32H 4JHWH 3MOAL 1IRAY 2E9BA 4OZIB 1KJVA 3OX8A 5HDLA 1JPTH 3PG2A 3BKJL 3MODL 1JHLH 4XMKH 4HJ0D 1W0WB 4N9GB 1IT9L 5FO9A 4JO3L 1SJEA 3KPPA 1UG9A 3DUHA 3MV7A 4PJXA 3LV3A 5K59E 4K2UH 2UY7A 1CLYL 1QFUH 3VXUD 2HFGH 4YIQA 1OTUC 4O51A 1HH9A 1N59A 3P30L 1NDMA 3V5DA 1LK3H 2VWEC 2X4UA 4HW6A 4GRLB 1N3NB 4YWGH 1F6LL 2APWA 2NCMA 1NKRA 4W81A 5D1XC 3DNKA 2YD2A 5HD8D 43C9A 3UJIL 4H8WC 1I7RA 1I8KA 3O8XD 3MUGA 2O26U 4MNQA 4OT1H 5HHOD 1U8MB 3NCBB 4QRSB 3QDHA 4RAUA 1HKFA 3IGAB 3GUTA 3TT1L 4ORGB 3RZCC 1NMAL 4WI6A 2R1XA 3C6LD 5IB5A 2AP2A 2CDGB 5AUMB 4EQ2A 5E2TH 3GM0A 5DK2B 3OKKA 1T1YA 2YD7A 4G8IB 3LN5B 2BVYA 2EIZA 4X80L 3EHBD 4W70A 4MA7H 1DEDA 3JBG7 4D9RD 3BGAA 5TDPA 3KNBA 1TQCB 3DX8B 2QKIB 1GC1H 4L1HA 1LEGB 1H3XA 3OR6A 4P3WA 1MCHA 4LIQL 1Z6JT 2FJFB 3QUKB 5J6GB 1IQWL 3IKKA 5IW3A 5KN5A 3OHXA 3RWJA 1AXSB 1YC7A 3SJVA 5LQBL 1W0YT 1F6AA 5IMKA 5LGJA 3PGDA 4D9LH 1MFNA 1PYWA 4JG1L 3T0DA 4PJGF 2KDGA 1UACL 4OV5A 2FLRT 2VABA 1DN0B 1RVFL 4Z8FH 2Z4QB 1HWGB 4N8PA 3BPCA 5H35B 3GMLA 1ZLWH 5JW5A 3HZMA 2YSSA 2J3SA 4DZBA 2DS4A 2VC2L 1Z9MA 1BREA 5TDNB 4U1MA 5T1LA 3NTCL 4IRJD 5I1CH 2YBRB 4I3SH 4LEOA 5D1XB 1XF2B 2A73B 4JM4L 5A16B 4OBSA 1MJJA 2WWMC 1JRHL 4YHOL 4FQ2H 2GCYB 1EFXB 1I7ZA 4KI5E 2DJ4A 1TENA 4L8SB 1MFCL 3VXSB 4Z7VA 3BQUA 4TOYL 4XVUD 1FL3B 4K7FA 5EDXA 3GSNA 1MVUB 4N1HB 1CT8A 4X7SL 5E0QA 5IUSA 2ICWI 4OKDA 4DQOH 4F58L 2BXYA 1PY4A 3B5HA 2CKBB 1IC7H 4APQD 3GEWB 5KSVB 1ZV5A 4H88L 4LVNB 3ULUL 2HFEB 4GBXD 1GYAA 2YKLL 2H32B 4YHYB 2GSGB 1HHIA 4E0RA 1YEDA 1WVZA 1X5AA 3HR6A 3FOLB 5A1AA 3B9KC 1AO7A 1JHLL 4HGKC 4XMKL 4FXGB 4GAJL 4JN2A 2R9HC 2ATPA 1TCRB 1M7DB 1U3HB 3NPZB 4WHDA 3L95B 2SEBA 2PXYD 1T2QH 2DJUA 2ZUWA 4K8RL 4Y19D 1T0PB 2YWYA 1ADQH 1KACB 3U9UB 4D3CL 1HKLH 1QSFA 3EDJA 4JFEB 5CGMA 4QRPE 3GHBL 4U1JB 2E6JA 5BZWB 1DUZA 4XVJL 3LN5A 4Y4HA 5D7IA 5ERWA 4DKFL 3QWRA 1J7VR 1UYWL 2YUZA 4Z78A 1DBAL 3S88L 3UX9B 1X5LA 1KJ3L 2FEDC 2ZSVB 1HILA 2NY1D 4QHLA 4UDTB 5CZXD 1XH3B 4F8QA 1GSMA 1BFVL 3IS1X 3GRWL 4O02H 3O11A 3EOBB 4CN1A 4KAQL 3HAEG 4X4ME 5E2VH 3ZKND 3GHBH 2X2YA 5HHPA 4Z0XA 3O2DL 2UWEB 4NBZB 5IGXH 2QSCL 1IGFL 4M7JL 1AIFA 3MRNB 5I1LB 3O2VL 3B6SA 3EJJX 4HUWA 1DN2A 4TPRH 4JQIL 3L3JB 2OM5A 1U3HD 3C6LA 1JPSH 5T1MB 4ZQKA 5C08A 3MQIA 4F15B 2NXYC 3E2HB 1R3HA 3UC0H 4RA0C 4Z7VF 1AKJA 1LNUA 1GHFL 4U1GC 2EKSA 4JVWA 2M26A 1CLZL 1BEYL 3UTSE 5J06A 1OLLA 2G5RA 2VZSA 4NZDA 3KPQA 3ARDD 3WN5A 4HXBH 1OW0A 1DQJB 5IMLA 2MHAA 1KTLB 4TPRL 1YA5A 1AC6A 2NY1C 3OL2A 2Q1EA 3HCVA 3ZKSD 1OAXL 5I8CB 3X12A 3MJ9L 3JV0A 5SWSB 1VPOH 1L0QA 4Y8AA 1JWUB 3KYKH 1H3PH 2BJMH 3GMOA 3F12A 3P9LA 1IM9A 3STZA 4MD0A 4X7FC 3TCLB 2G2RA 3RDTC 1F2QA 5DS8B 4ZO6A 3JVGA 1RK0B 5IP4A 4W68A 4ZOCA 3VXRE 3N1MC 4M48H 4N0FA 4DN3H 1T7VA 4I13B 4LLDA 4ODXA 3QWQB 5FM5O 4NQSB 4Y7MA 4UAOC 3QPXH 1HHIB 4E0RB 1U6AH 3SE3C 3BRGC 1A7RL 3CC5B 7CGTA 3OJ2C 3QEUB 3H9SE 3EZJB 1F11B 5GXBB 3HMXA 3L3DA 3KXFE 5DEFA 3TH4T 2AKRA 1OARL 4O51B 3V79C 3MRMB 3LKOB 3O2DH 3W0WA 3LAFA 2RGSA 3ESUF 2FD6L 1Q72H 4DCQA 3QI9B 2HT3D 4UQ2B 4DVBB 5HI3D 2DQJH 1NC4A 2LABA 3T2OA 1KPUA 2XWTB 4PV8A 1CD9B 2V2WA 4WHCA 3TNMA 2HVJB 5KSAB 4E5XA 1NCWL 3W2DL 2FIKB 3KPLB 4V2BA 5J7CC 3MUHL 1H3TA 4NZTL 5GGRA 2R4RL 3P0YH 1P69B 2OL3B 4J3VA 4R3SA 5SX4I 5FYKE 1CDHA 4I0PD 4BSWA 5IW6B 3D25A 1H3VA 5F3BA 2D2OA 5JOFB 4YLQT 4HC1L 1ACYL 5EA0H 3QRGH 3KWWB 3VXMB 3MOBL 1JN6B 3CPLA 4ONHA 5TE4H 1IQDB 4OQTH 3MRHB 1SY6H 1WAAF 4S2SB 2A77L 1IGYA 3BT2H 1A3RL 3LRSA 4C4KT 1AO7E 2VXTL 3Q5OA 4GRLD 4AIXA 3E6HB 2C3XA 1DANU 2ZJSH 2EDXA 5KSBB 4JKWA 5JMOC 2Z35B 2BVPB 4GW4A 4UZGA 2ADFL 3TA3B 3TO4A 3V8CA 4DKAA 3GUTB 4M7JH 1FNFA 4MDIB 4TTDD 4HV8B 3UJTL 5D1QA 3GBMH 5JLZA 1U8JB 3CXHJ 3PP3H 3BP6B 5IW1A 4LLUB 3GSWB 5I76B 3UTZB 1G7JB 3DXAA 1XCTB 4N0UE 4RGOL 3RWIB 5A2IH 4CDHA 3MROA 1ZKAA 1S7UB 2D0GA 3UTSB 4OLYH 3DVIA 2CIIB 5DJXB 1BAFH 3ORJA 3SDAA 3KS0H 4NQDE 4MB4A 3T3ME 2DI9A 4M7ZB 3CVIL 4LLQB 5FYLL 4OCSL 5CAYB 4G7YL 3AVEA 1AD9A 2ZOKA 1X6LA 5IEHA 1T1WB 4WWKD 2VDPH 5MI0B 3BVNB 3CFEA 3C8HA 3MJ8B 1AQKL 4HEME 2X9YA 4JM2A 4OLZH 1IBGL 1KOAA 4WJ5A 3CSYB 3G5XA 5HVGB 4TUKL 1T1ZA 2R29H 4P2QE 4YHML 5J3HC 3GMLB 3WJLC 4NWUL 5DGRA 4JZOA 2DQGL 3D0LB 4ZAKB 1I7UA 2YRLA 3MX0A 4IMKC 4U1MB 1PLGH 4R9HA 2YKLH 4UBDD 3NFNA 1DBBH 4I5BB 1BQLL 3FO1A 1ZVSB 3P30H 4ENED 4PJFB 2X1QA 4HGWA 1JPGB 1EHAA 4KTYA 4BH7A 5CJOH 2P45B 4X5LA 3O3AB 3O3EA 1QACA 2XKUA 2NMSA 3TYGH 1FCGA 3D18A 4L8SA 3EUUA 3OQ3B 4ZPTB 3MPCA 5IBTL 3WYRA 4JFPB 3BUTA 4YDJB 4XP6H 1RHHA 1TTGA 5B39A 8FABB 5D1ZC 4XZUB 5I1CL 1G0DA 1LK2B 5C6WH 2AXGB 4QF1B 3BE1L 4XP9L 4HJGA 3LZFH 3PE9A 5IBTH 4XBPB 5F97E 1MCOL 1U41A 4RNRB 5EU5A 1TJGL 3IU3B 4MJ6A 4GKNB 1I1RA 1J8HA 2VSCA 1SEQH 5DJDA 5I30L 2DTML 1VERA 5JTWA 2XT1B 4RAUB 4G6ML 4D9LL 4UDUA 2CO6B 3WJLA 1S9YA 3CFKB 4O5LL 3DVNB 5DZOA 4YGVA 3MUGB 3GJFB 5CBAA 1DUZB 4ZNEE 3WMSA 5TF1L 2F5BL 1MOEA 4LBEB 1A7OH 4P23A 5HHPB 4M1CC 3S4SA 2APVA 2YA1A 3GSNH 4QXUH 2VDML 4YHZH 4MXVF 4OUUB 1J0HA 3PHQA 2DYPD 4HIHB 1JF1A 2EO1A 1NCAL 3EO1A 2VL5B 5CIPH 4Y1AA 4L8SC 5BW7A 5MEPB 2D7TL 3M45A 1UH2A 3VXTB 2FLBT 4L4TB 2VQTA 4GRWH 1D5IL 1J8HD 4YDIL 1EPFA 3JV5A 2DWDA 1X7QA 4YBLB 1K8IA 3MRBA 3K0WA 2CLRA 2R0LL 3HNTH 1CD0A 1J1OL 4BZ1L 1FVDB 5E8NB 5A3ID 3K2UH 4BSVB 2OP4H 5DR5L 5FHBL 3UYRL 1AH1A 1UA6H 1UXSA 3JWDC 3MRQA 3QUXA 5D2LF 5I9QC 4PBVC 4HWEH 1MI5E 1YN7A 5BV7H 1E6OH 4LFHG 4WI9A 1QNZL 1WF5A 3V0VA 1EJOH 4OD3H 1EUUA 3O6ML 3SDXF 5I1DA 3TO2B 4ZFFA 4D2NA 1IC4H 4M1DL 3CCHB 4LLMA 4NNPH 1VACB 2F19L 3L1OH 4GOSA 3E1F1 4G6JL 2XY1A 3ALXA 1MJJB 3T3PE 1G7MA 2FECI 3MXVH 4OCMC 1FL5B 2CDEA 3DRTA 3L3GA 3WIHA 4HPYL 2NLJB 3IRZA 5ILTL 1EV2E 3G5YA 4NKDB