3IDJB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 fab' fragment in complex with gp41 peptide analog eld(orn)was
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
235
structure length
229
Chain Sequence
b'RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab light chain
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 229
sequence length 235
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idjB01
4N9GB 4PJCA 3TN0D 4X9IA 4ONFL 5F7HA 5ADPL 2ZCLL 1HHIB 1EEUA 4X8XA 3O4LD 2DQFA 4Y4FC 5BOZG 3O3AB 5DUBB 3TYFA 1AXSB 3WDIA 3MGTA 4IRJC 4LASL 1IT9H 4NQTA 5LWYL 3LSOA 3OXRA 4G8GA 4XMPH 2Q1EA 2BCKA 3CZFA 5GRJH 4GRLB 3GHBH 4OD2B 1KN2L 1T1YB 5BMFL 5E6IB 5DYOA 4EI6B 3MRPB 4FZEH 4PB0H 2X4SB 5GGVH 2QSVA 2F5BL 4G6KH 2P44B 5I1HL 1IEAA 3NIFF 3P0YL 5JW4M 2D7NA 3S88H 4L5FH 4QT5A 5ACZA 5MERA 3OKOB 2JELL 5I1LB 3PWNA 1BAFL 1BZ9B 3FB5B 4ENEC 1P69B 1KFAL 1E28A 3HZYA 4Q9RL 4ALAL 4E41B 1PDKA 2HMID 3O6FD 3QJFA 4UIKL 1R3KB 5E6ID 3CDCA 5AUMA 1TCRA 1F6FB 1UH3A 2FX7H 2VLRA 5MI0C 2RB8A 4PUBL 3EAKA 4X6DE 4K3JH 1CF8L 3MROA 5E8EA 2A6DB 3K2MC 3ZYIA 1BD2B 1S7QA 5I1JL 3D85B 2CIIB 1T66D 4PGEB 4ZPTA 1XEDA 3BIKA 4GAFB 1CR9L 1QQDB 5B4MC 4PJGA 1DBML 4OGXL 3MNZA 5CEZD 4QOKB 5HGHB 1DQLL 4LOUD 3A6CL 4I0PA 1M6OB 4XAWH 2PYEE 2BVQA 4XP1L 2GJJA 2E8ZA 4MA7L 1LGVA 4PJAF 3OAUH 1EUTA 3O6LL 1SM3L 5DD5H 3L5HA 3DROB 1PQZB 4OFYD 4Y5VC 1UCTA 2XG4A 4E41E 2DQDL 2DQJL 1G7IB 3NIDF 2XTJD 4HAFA 3O3EB 1SMOA 4J6RH 1A9BA 4K7FA 4O58L 2V17L 3QXWA 2CLRB 5E1AA 5C71A 3QBTB 1D5IH 4G3YL 1KB5A 1BD2E 3JUZA 5D2LA 1RZIB 2KL6A 2C7UB 1DE4A 4LCUA 5TQ2L 4PGJA 2HT2C 1H8SA 4ZTOL 3BPNC 5L9DL 2X4QB 3EDDA 3PWPA 3TFKC 3DX8A 1MFBH 5EH1A 4YXLH 4QOKE 3VCLA 1FG2B 2O5YH 3RVWC 1YN7B 2OL3H 5DFVD 3JVGA 3BXNB 3PWLB 4JN2A 1GGTA 3OB0K 4NN6B 3GSOB 5EU7E 1CU4H 2QSTA 3UZVB 3ARGD 4OCWH 4NKOB 2AQ1A 4DGYH 1MVUB 3WO3B 3SQBA 3ZE2E 1AD9A 2Y5EA 3SE9H 1DBJL 5IIEB 4X5WA 5HTSA 2CKNA 4WWKB 1OSPH 3FT4B 4QHMB 4UBDC 4CL7A 4MHHI 1YJDH 4YK4C 2VR4A 1Z9SA 3NFSL 3WLWD 4OF6A 3MLSL 4I18A 3L5XH 4ZUWB 4TSBH 1U8HB 5H2BA 5HI5C 4P23D 3DGGB 4WENB 5ITBH 2Y23A 2F58L 2OL3B 4OLXL 2DWDB 3RWEA 2Y6SC 3MNWA 1JVKA 3VXOB 4F7CA 2CGRL 3IT8D 1NDGB 5JW4R 4WWKD 5LCVH 3BQUB 2ZUQB 1YMMD 5D6CB 1D5MB 3G5VB 3OX8B 5J6HB 4MXVE 5I6XC 2V7HA 4XMKL 5HVGB 4NIKB 4NQEE 3VXRB 4JFHE 3GMOB 2EICA 3SOBL 4QXGL 1Z9LA 2EKSB 3HKFA 4D9RD 2J1KA 2FX8H 4YO0A 3IU3A 4YDIL 3ZE0E 3IU4L 4IDJH 3EYOB 1HCVA 2R23A 3DI2B 1NEZG 1UYWL 1WV7T 4IRSB 1GPOL 4MJIA 3BQUD 4CVZA 4BSWA 4EXKA 5I74C 3VE0A 1VFAB 3HC3L 4PS4H 3TPKA 3VXMB 1RZFH 4NQSA 4XC3H 3RDTB 3I50H 3TBVB 1X6LA 2BY1A 3UPRB 1FNSH 2FL5B 5IOPA 1S7SA 2FJHB 4MDJA 2FSEA 2ARJA 3ZDYF 5I75B 1U8LA 3GSXA 2MPAH 4D0BB 1T2JA 1KPVA 4FFZL 3VXRE 5KVFH 2X9WA 3QDJA 2FD6L 4IRSD 4NC0B 1S5IH 3QIBA 2GW5A 2R56L 2W60A 1UT9A 2XWJB 1I8IA 1W0YT 3VH8A 3BH9A 2ZCKH 4LRIA 1S7RB 2GT9A 2HAZA 2NTSP 3B9DA 5GGQL 1E4KC 1WIPA 4U0RC 4OLVL 3QA3B 4R96A 1IC5L 3RDTD 3VXMD 3ESVF 1E6JH 4PG9B 3QXTA 1ZANH 2WBWB 1S3KL 3VWKB 3RIFK 5CP7A 3QPXH 3T0EC 3VFGH 5C0AA 1ZT1B 4K3HA 1BQLL 1OW0C 4G5ZH 4XCNA 2R1WA 5FAAA 2WAHA 4N0CC 3B2VH 1MCQA 1T1ZA 5C0BA 1IM9B 4LLUA 1NCNA 4O9HL 1NFIB 5D70L 3UDWC 1HQRB 1KCUL 3PP3K 3GSVA 5E08H 1DLHB 1SYSB 4HC1H 1MUJA 4XH2A 5IHUL 4NBYB 2DWEA 4RDQG 4XPFL 3BJLA 1JHKL 4R3SA 1EEYA 4Z0XB 4DKFH 4YFEA 1QBAA 2E9WA 4I4WB 3DARA 3U1SL 3EO0A 4PRBA 2F5AH 2DQIL 3EKCA 3VWKD 5D93C 3MJ9H 1NBQA 1SMAA 4MD4B 5E5RB 1WFUA 1X5HA 1GL4B 1U8KB 5IQ7L 3BPLC 5L6YH 3KPLA 1VFOA 1F4YH 1IM9D 1I7UB 2VXSH 2I25N 2XTLA 3SDDA 1JI1A 4UT7L 3Q6FB 5E0QA 2K7QA 3E6FB 3OR6A 1JN6B 1WUNT 4DN4H 5DO2C 4X9HA 1NUFA 4WI2A 4QHKI 4OUUA 5E2WH 5DK3A 2OSLB 1QSEA 3L3OA 1Z0MA 4OI7A 3BWUC 4J4PD 3ZDXF 1PVHA 2YKLH 1MFEL 4NKQB 4UINL 1OP3K 2IBBA 1T1WA 4U49A 4KZDL 2Q3ZA 2WUCL 4U1IA 1MREH 1RK1B 4DJMA 1BBJB 2BJMH 5D7IF 2A74B 4L29A 4RMUA 5DJAB 5ACMA 1S9YB 3FOMA 5BV7C 1H3PL 1I8KB 2XNAB 1S9VB 3QB7C 3ZO0A 5JXEA 1CBVL 4YBLC 1N5YH 1UJTA 3AS2A 5AD0A 4KK5C 3T4AA 4KTDH 1VEOA 3GB7B 2VERN 2VLMD 2V5SA 4P2OB 4RRPA 5F3BB 5AWNL 1JWUB 1HHHB 1S7UA 2UWEA 4NN5B 1ZGLB 2MQCA 2AJYH 4JPWH 5L7XH 1N6UA 1A7BA 4PGCB 3VI4E 3T2PA 4XAKE 4KK9C 3HE6D 1A6ZB 5KS9B 2YK1H 4HS8L 4WW2B 1LHZA 5IGXH 5B21A 2FBOJ 1WIUA 4WIQA 2HVJA 3W2DL 3FB8A 2X10A 4QHNA 2WM0A 2EEDA 2X4UA 4IBLT 1UKSA 5DHVB 2DJSA 5C08A 4KVCH 5DZNA 2FCBA 4LMQI 3KLDA 3TJEL 4IRJA 1UB6B 4RFNC 1N4XH 2YSSA 5B38G 1MLCB 3VXPB 2WK2A 2R9HC 3WHE1 3TYGH 2GAZB 3MLUL 4WHTB 2F74A 1BVKB 5ITFA 5D2NC 4FFYL 4R0LC 2RR3A 1W72H 1GSMA 2VXVL 1LE5A 4TRPH 3V5DA 1QG3A 4YNYB 5JW5A 2VKXA 2XQBH 5FM4A 4NKIL 5KS9E 4PJ8C 5ICXB 3V6OC 2J6EH 3OMZA 1OARL 3HUJF 3WYRA 3TO2B 2QSCL 1V3JA 2BNRE 1I1FA 2FEDC 2CLVA 2HFFA 4KJPC 3O81A 3UYOD 5JNYB 4XC1H 3ZTNL 2W91A 5DWUH 3V4PL 3UTSB 4OFIA 1Q9KA 4F15B 3AAZB 3TWCH 1C5DB 5IESL 1TVHB 2AABH 5LGJB 4XVSL 1C7SA 1Y18B 2AV7A 1WZLA 2XKNA 1R5VB 5C0DA 4JFFE 3TBYA 3UJIH 1CLOL 2PXYC 3TLRA 2HKFH 3Q6GH 5HD8D 3NCYS 3ULVC 1HQ4B 3LB6D 1Y6MR 1VGEL 2AEPH 4XMLH 2Q76B 5ALCL 4ZFFB 1OAQL 1QBLL 1KLUB 2YEZA 2IFGA 4XX1G 5DRZA 4L3AA 4NDMA 2VDPL 3GNMH 3RGHA 1WWCA 4KRPC 1ZHNB 1LD9B 2UYLB 2XWTB 1W72B 3H7BB 1U3HD 4Z7UB 4QCIB 5EIQA 4ZS6D 5FXCH 3MYJA 5EBWA 3UTSD 2OZ4L 3WIIL 4P3WA 4HKZB 4JM4L 3W9DB 4XX1E 2ZNXA 4UZGA 3ZKND 5JIKA 4AQ1B 3SE3C 1MCPL 1ZK9A 4DGVH 5CBEB 3C5ZB 3GSNL 3MRQA 4F3FB 5ESVB 4Y5VA 3VFMB 1GZQA 3K8MA 2ATKA 4I2XE 3E3QE 3F6IA 2BVPB 2DKMA 3W0WE 4GSDH 1OB1B 1Q1JL 5JUEL 4NHCH 4MA1B 2W07A 4HS3A 5IF0B 5SX5K 3BGFB 3WXVL 4MA3B 4TQEL 2LE9A 3BD3A 3HI1A 1AO7A 1JNLH 3BZDA 3KYAA 3BHBA 4XI5D 1F58H 4RIRB 1N6VA 1D5XB 2VDRH 1ULVA 5CJXA 4KKCD 1WF5A 4BQBA 2J2ZA 5I1IL 3DETC 3GMPB 4LARH 4E0RA 3C5ZD 4WFHD 3EFFA 4PJDF 1JZ2A 2D31B 2OR9L 1J5OH 5C1MB 5CHNB 6FABL 1A14L 1XF4B 1BM3L 1V3MA 4M5YL 3I6KB 4L4TB 3JWDL 1X5KA 4UTAH 5DVMA 1D9KB 5ANMB 1HH6B 3QEUA 3IFNH 1P2CB 3OJDA 5DJCA 1V7NH 3QNYB 1DBBH 4K2UL 3ARBA 1N5AA 3C08H 1CGTA 5F9WC 1DLFH 2PUQT 2PN5A 3TO4C 4X8JB 4PGDA 4V1DA 3FONB 1S8DB 3TN0C 1ZMYA 2R69L 1DVFB 1PSKH 4A6YH 2EECA 1HKLH 1TJGL 5I0ZA 5J11C 5IG7B 1M7IB 3UXFA 2OMBA 1MHCB 4MSWB 4N1CA 3GJFA 5I71B 1CGSH 3B9AA 4LCIH 4WI9A 4F7TB 2WANA 3E0GA 5LBSH 2B5IB 1IGFL 1IT9L 3EDFA 1D9KD 1KYOJ 1EJOH 4DN3H 2UVFA 1P7QB 2HA1A 2IQAA 5I15L 3T3PE 3UTZA 4G9DB 4WUUA 5GRJL 4ELME 3GHBL 43C9B 4G9FA 5L2JA 2NLJB 4K7PX 1U8IB 4Q6YA 5ESQA 4L4TE 4W4NA 5GS0H 5GSRB 3QJHB 4UIMB 2R0KH 2NCMA 4FZEL 2WLZA 5KW9H 3PGDB 3V0VB 1L7IH 5JPNA 4X5XB 1CT8B 5HHNA 2ZPKL 2IH3A 1U6AH 2APWA 4JRWA 1ZHKA 1T0MA 1S7VB 4GW5B 3O6FC 4QHUA 1Z9OA 1P7QD 1WBZA 5E6IC 3JV0A 3MRBA 5DJ6A 3CXHK 1P9MC 2OTUB 2JLLA 3B3IA 4EI5C 1NANH 1XCQB 1FE8H 3HRPA 4LSTL 1KTLA 1VACB 3EDEA 3PDDA 4H1LH 1QRKA 2VLKB 1IAKB 4FQ2L 4ONGH 4W70A 3L5WB 1B4JH 5GIRB 5DUMH 4HXAH 3IGAB 2E6QA 3I6LD 3C5JB 2B1HH 4CU8A 1NCDH 4HJ0D 3KPSB 3F5WA 4DQOL 2GSGA 1HHJA 5IMKB 1JF6A 1TVBA 3RKDC 2ATPA 2OTWA 2FO4A 3I6LE 2NX5A 3FB6B 3U4BH 5FGBA 4YZFE 2HKHH 4NUJB 3DNKA 4FMFA 3MUHL 5K9OA 1E4KA 3P9MB 2VLKD 3FQRB 2XTJC 3S3PA 4OZGE 4NQXA 1YN6A 4YPGB 2V6HA 1YPZE 2K7PA 4RWYH 4J6RL 2BMKB 4H1LB 3T0EA 1TZIB 5GS0D 1F13A 1RUKL 3KPSD 2GIYA 1EPFA 1OW0A 1UH4A 4X99A 5IVXB 4RMQA 3BKYH 4OLWH 3X3GL 5I1EL 5I2IA 5LKNA 3W9EA 5DFVC 4P9MH 1MFBL 5J9PA 1CICC 4P9HH 4JRXA 1D5BA 4WHDA 4DW2H 2O5YL 1BF2A 1XZ0B 3ARGC 5IFJA 3SJVA 1FAIL 4ZPVB 3MA7A 1U95A 1KB5L 4RMSA 2H6PA 4LP4A 1CU4L 3EOAB 3L7FA 1K6QH 4EXPX 3QCUH 4DGYL 3WFDL 4YE4L 4OF5A 3SE9L 4KJYA 5EO1A 5FHAH 5IK3B 5SWSE 3TZVA 3V6FA 1OSPL 4LPTA 5DEFA 4IMKC 3V7AE 2VDLH 3WLWC 2B7DT 32C2B 3H9HA 3OJVC 4Y8AA 1JMZA 4NN6C 5TH2B 4HUWA 4DUWA 1LO0L 3C9NB 1GGIL 4P23C 5FA4B 1EEZA 3BT2H 1IKFH 2O61B 5DR5L 3L5XL 3GMQA 4TSBL 4LP5A 5IVZA 4DZ8A 2R4SL 4LLYA 4JM2D 4IRZH 3MYZA 4LVOC 4WWKC 5IW3A 4PJIA 4QRPA 4ETQB 4ZFOA 4GUPB 5ITBL 4NFDA 5IEHB 5INCB 4X6CB 3KWWB 1OSZA 5SV4A 1SVCP 2I26N 5FA3A 3HNVL 5LCVL 5J3HD 3EGSA 4K7PY 2F53A 3SO5A 4LMQE 3G9VA 4GQ9L 4S10A 4HG4K 2EO9A 4OBRA 2AXFA 3T2NL 3TV3H 2VDQH 1Q9OA 1RFDL 1G0YR 4YHIA 4Y7MA 1IGJB 1UQSB 1G6RA 3N06B 3JWOL 4KVNH 1ADQH 4LRNH 4QRSB 1A3RH 2XA3A 4GKNA 4HFWB 1KTKE 5T33H 2G75B 4GG6B 3MV7B 1TVDA 3SDCA 1N3NB 1A7OL 2W0FB 5I1CH 2CUMA 2IMNA 1I1CA 1F45A 2H2PD 4HWBA 1JI2A 1FFPA 3FMGL 2DLTA 3IKCB 1YJDC 4MGXA 3I50L 2NY2B 1F4WL 3T3MF 1FNSL 3RQ3A 3V52L 3QFJA 3KLSA 3G5XB 2MPAL 3QNXA 1KTDA 2AKRB 3GMRB 3MFGB 4PV9A 5C09A 5JIHA 1S5IL 3GEWB 3MV7D 3DV4B 1W0WA 2IPTH 1PYWA 3VW3H 3V2AR 2ZCKL 1TNMA 2DQUH 1PZ5A 2R2HA 4LCWB 4JG1H 3RDTC 3SGDI 4F57H 3IXAA 4WW1A 1H3UA 2AW2A 4L8BB 5CWSB 4HQQL 3P0VH 4KJWD 4LLVA 2WP3O 1CE6A 2FZ3B 2GY7B 3H3BC 3V6OA 1CZ8L 5C07A 1MI5A 3CXHJ 5JQ6H 4LQFH 3VD3A 3AUVA 1MQKH 4LVNC 4MAYA 4ZODA 4JE4B 2J8UF 4HBCH 3P4OB 4G7YH 2PTTA 2X41A 2GITB 4P0DA 4K94H 3CDGB 3B2VL 4GT7A 2YR3A 1XGPB 4LCWD 3X13A 1T04A 1QSFE 2W1NA 2WBJB 2PXYA 3BAEL 4HJGB 5HYJA 4NCDA 4H25B 4Q6IB 3VWKC 3OAYK 1L0XA 1F6AA 1JGDB 3G6AA 4JQIH 5F7NC 1D6VL 1JZ8A 3NFNA 5CCKH 3C5SB 5FK9A 5HGGS 4OD1L 5IFHH 1ZS8B 3TC9A 3CFJA 3BISA 1G7MB 3N1QC 3FTGB 4PLNC 3OJMB 3KS0J 5KSBB 3LN4A 1OTTD 3STLA 1B0RA 1F4YL 1NL0H 3DLQR 2VXSL 1OCWL 3EJYD 3NFPB 3U82B 2DD8L 4JFDA 3SE3A 1VADB 5SWZA 3U9PL 1DUZA 5DHYB 3P3YA 1J12A 1TETL 3JWNC 1C12B 3KHQA 5TE7L 1A6AA 5BW7A 1KG0A 1J8HA 3MLWL 3T1FA 1ORQB 5IQ9A 5ADOL 1DN0B 4JY6A 5E2WL 5TDPA 4NQDD 5E9DB 4XNZB 1AD0B 3QHZH 2EE3A 4ODWB 5CJ5A 4R4BA 2CIKB 4HAGA 1RJLA 3CFBA 3U4AA 2Z92B 5BZWA 5D72L 4K7PH 2BJML 5MENE 1T21A 1KXVC 2X1WL 5HHOD 2RFXB 5B3JE 4O51B 1QSVA 5KSBE 1CG9A 1G7QB 5EU6D 2EZ0D 4XPHH 5ELIA 4HW6A 4OJFL 3V0WH 4JFEA 1PBYA 3RVXD 2A1WH 1R3IH 5C70A 4U1JB 3HE6C 5D2NE 3GIVB 1ES0B 4JPWL 4EDXB 2PCPB 4Q9CA 3BKJH 2FR4A 3LDBB 5E9DE 1IGMH 3P11L 5EPMA 5IGXL 2EC9U 2AGJL 3VD9A 1NUGA 3TN0A 1Q94B 2AJUH 1U58A 4LHQB 3O4LA 5F3HA 4WY7L 2P24A 3SE4A 4KKNA 1OPGH 4OIAA 1LEIA 5LQBL 1RY7B 3PJSA 3DVIA 5BQ7B 3E2HB 1CTNA 3LKPB 3BP7A 2FNBA 4HZLA 5EO9A 5DMKB 1A1OA 3DWTA 2D4DA 2YBRB 4KXZI 4NN7B 3P73A 5BS0B 4HG4J 1WICA 1FVCB 3QDGE 2I5YH 1XF1A 2LAGB 3VD5A 1FP5A 1JWSA 1QYGH 3TYGL 3OR7B 3DO7B 3BRDA 3OB0H 4N9GA 1WQVT 4OI9A 1AQDB 1W72L 1HHIA 2H2SD 4TRPL 3TH2T 1OVZA 1UZ6E 2P8PB 3O3AA 4PJBE 1DTUA 1AXSA 4WFED 5J06A 5KOMC 4AIXA 5FYJU 4OM0H 5BS0D 1NC4B 2YD6A 3CK0H 5HD8C 1BJMA 3ES6B 2JIXB 1T1YA 1UM6L 3HMXH 5E6IA 1U8PB 1P9MA 1EHNA 3WN5B 3O4OB 1U91B 3MRPA 2X4SA 2NY0B 3OHXA 2ITDB 5F8QC 4Q97A 2P7TB 2AEPL 3Q0HA 2D7OA 3CXDH 1Q9WA 2HJKB 1OAXH 5MHSE 5E2UH 2GK2A 3OKOA 5H94A 2LTQB 2NZ9D 5I1LA 1U3HC 2EE6A 4NQVA 4ZS6C 1EK3A 1BZ9A 3FB5A 4NNXB 4UT6H 4F15C 1NLBH 3RGVB 1RU9L 3DSFL 5HI4D 1CXEA 3ZKNC 4I8DA 2IQ9H 1U0QA 3LN9A 1CFVH 2JIXD 1PY4A 1R3KA 3VFNB 3KJ6H 3TBTB 3Q2CA 3DIFB 4DAGH 1AI1L 3HPLB 4OFYA 4DCQA 5C0CB 3I3BA 2NQCA 2GK0B 3CFEB 3MRDB 1BOGB 5L2KE 3C09B 4JO4H 3A0OA 4RGND 3D85A 2CIIA 3GBMH 4OIIH 5HGDB 5A2FA 4UV4H 4PGEA 3BN9C 3K2UH 2RCSL 3O41A 1QQDA 4PTTB 3SGDH 1KUMA 2XY1A 3RI5F 5E95B 4QOKA 5HGHA 2JJWA 1J11A 1M6OA 4XI5C 5IBUG 5CMAA 3SPVB 4OZIA 3D5OF 5CLWA 4OZHF 1UM4H 1MJ8L 4HFUL 1EV2E 5K59E 1INQA 1IZKA 3M45A 3C5ZC 1F58L 1AGEB 4X5LA 2VDRL 1PQZA 1IGYB 5D1ZB 1JGLL 1ORSB 1G6VK 4WCYL 2D7QA 1PKOA 1G7IA 1EGJH 5FOBB 2XZCH 3ARGA 4DFHA 5HDBE 3UTTB 5GS2H 1F90L 3U0TB 3RAJL 2CLRA 5C0CE 1CIDA 1CXLA 4P2QB 5E94B 5JIPA 5F6IC 3TP4A 3NZHH 1QFOA 1MWAH 4NKMA 5C86A 4L3CB 4C57C 2C7UA 4UTAL 2E6PA 2QHLA 2AXHA 5J56B 1V7NL 4OLYL 3G5YB 2X4QA 4R9HA 4PJ5E 3C08L 3OKEB 3RZCB 2JCCF 2XICA 1AXIB 1FG2A 5CS7A 3ZLQC 5D7KD 1YN7A 1UM5H 3IDYB 4EN3B 3BXNA 3PWLA 5D1ZD 3WNMA 1FORL 2BERA 4A6YL 5T1DL 1GVIA 4BYHA 2VWEE 1JP5A 2YC1B 4JHBA 4PV8B 2PW2A 3CLEL 1F2QA 2Z93B 4P23A 4NKOA 1T0PB 4G6JH 3L5IA 1IAII 4G6MH 4P2QD 1P7HL 1YY8B 3GSUB 3V7MA 1W8NA 3FT4A 4WWKA 4QHMA 4F9LC 1EJOL 4E5XB 3UTTE 1YMMA 5EUOE 3WFZA 4WTXA 2WW8A 4K3GA 5DLMH 1BMGA 3RZCD 4OV5B 3B5GA 3TA3B 3UX9B 1MWAB 1YEEL 4EN3D 4XVTL 2EXWD 2VIRB 3CDYA 4FQQB 4ZUWA 5F9AC 2DQTL 5K93A 3UTPD 4TTGA 1TJIL 1L7IL 5H37H 1MVFA 3DGGA 2OL3A 3N0PB 1ZSDB 3SCMD 4MCYB 4HUNB 3VXOA 1NDGA 5FHBH 3DURA 1R3HB 2VL4A 3BQUA 4YUEL 4P49A 1T03H 1I1YB 1L0YA 1NUNB 1MCSA 1D5MA 3OX8A 1T0NA 1ZHLB 5D6CA 5GS2D 5J6HA 2D7TH 4PJXF 3PIQA 1NMAH 5BZDB 3VXRA 1IGCL 3GMOA 5IMMA 1G7LB 5E2VL 3TA3D 4KKAC 3BPOB 4Z7VB 3IETB 4UILL 4ZDHB 4ODVH 1YY9D 4UOW0 5C0FB 2CR3A 1IQWH 4NRZB 3GRWH 1KLFA 1X4YA 4HJ0C 1XF2B 2DQGH 3EYOA 2GJ6B 1OP3H 5C6TH 1NGZB 4IRSA 1NCDL 2H1PL 2ICWJ 2XZQH 4JHAH 1LO5B 1N26A 2NXZC 2YPLE 5MEQB 3V6ZB 1JCKA 4AEHL 5KVMC 3U4BL 3EFDH 1WAAE 2HWZH 4LPUA 4N8CL 2G9HA 4KUCD 2DIBA 3VXMA 1P4IH 3RDTA 1JZ4A 4PP2B 4KXZH 2FL5A 4FZ8H 2FJHA 3BZFB 1J0IA 5A40E 4ZUTB 4D0BA 5EZJB 2GJ6D 3NZ8B 4M03A 3D3VD 4RWYL 4KTEL 4Z7VE 1RUPL 1OP5K 4YXHH 3LZFH 3WNLA 2XWJA 5H37G 3AREB 3HG1E 1S7RA 4PY7B 2YA1A 3TNNA 4POYA 3S36X 3KLAA 3QP3A 1UADC 2EDQA 5CGTA 3D39B 3QA3A 5FYJL 4U6YB 4PG9A 3SE8L 3CAFA 1KCLA 3KG5A 1CDBA 1XGQB 4P57A 3AM8C 4X6DF 1WZ1L 1ZWIB 3VWKA 4LPXA 3B6SB 3QR2A 5I1DA 2HTKD 1ZT1A 1A6UL 1LEGB 1M7DB 1P1ZA 5FIEA 4HIIB 3IXTA 5GGRB 1K6QL 3W11D 2A73A 2Y4SA 4XVJH 1IM9A 5HHQA 3ARED 4JZJC 5EU4B 3V5KA 2CLZA 1NFIA 1QFHA 1ONQB 2ZWLT 1TQCB 4PY8J 4XBGB 1SYSA 5EO0B 3D39D 1A4JB 4UTBH 4Z0XA 1S9WA 1BLNB 1IEHA 2G2RB 4JFQB 4I4WA 2E9BA 3EOBB 1IEBB 3VA6A 3RWDB 3BT2L 4JM2C 5CP3H 5E5UB 5C2BH 4IJ3B 4J4PA 3PGCB 4MD4A 4YHYC 1U8KA 4IRZL 5IHLB 1LDSA 5IMOB 1AKJD 3OPZL 4GQPH 5J3HC 4HJJH 4U1MB 2CSPA 3X3FL 1I7UA 3SN6N 3BVNB 4G8EA 1DCLA 1WZMA 2VAAA 4RBPK 1GH7A 3AXLB 3ALWA 1CL7I 3VXNA 1U8QA 3E6FA 1WWAX 1JN6A 2JB6B 3BKCL 4YDLC 4Y5XB 4C59B 4YX2H 3DOSA 2NTFB 4O5LL 2VDQL 3TNMB 4AEIH 4Z77B 3H9SB 1RUAL 4GAGL 3VWJB 4HHAB 4HC1A 3DRTB 3KYKL 4XHJD 4X4YB 1FZMB 4HMCA 1ZHBA 4NNYB 4JRYE 5JR1H 4DTGL 2BC4B 4KKBD 5KG9A 3HE6A 2H2PC 1INDH 1CDIA 1IGTA 1BBJA 2BY3A 2BSRA 2EH7L 2A74A 3MJ9A 4HT1H 5BV7L 1S9YA 5I1CL 1I8KA 2XNAA 4D94A 1S9VA 4HK0A 3FRUB 5J12B 4PIRF 5IHZA 1BWWA 5T1KB 3KYNB 1R3JA 3DBXB 2R8SL 3PNWB 3GB7A 3H9SD 4P2OA 5F3BA 5SX5H 5TE6L 1UWEH 1G9EA 1JWUA 1HHHA 3BE1H 4YLQT 2XKSA 4KRMB 1JYNA 1BGXH 1ITCA 2QQLH 3QWOA 3GDBA 4MNQB 4EQ2A 1WVZA 5D6DC 3F58L 1A6ZA 2F15A 3FAWA 4WW2A 4M7LH 2NXYC 1QLFB 4W68A 2XWBA 4AK1A 1M71B 2DQUL 4RGOL 5FKPA 1IAIH 1WIOA 4F57L 4KJWC 1N59B 1T1XB 3QIUD 4MA8H 2WP3T 2VMFA 4IOFD 1JPGB 5EA0H 1A64A 5DHVA 3EUUA 1XF3B 3P30L 4NM4L 4ZNEE 2VZUA 3H2WA 3BRGC 4YHKL 4GKOA 2FATH 5A1AA 3OKNA 1UB6A 1FGVH 2C1PB 3ZE0F 4DVRH 2ZZUT 1FL5A 1YDPA 5I19L 2A0LC 1MLCA 3VXPA 4MNQD 1DQML 4G7YL 4Y16B 2GAZA 2BOCB 5IVNA 1HNGA 4S1QH 2COQA 1BVKA 5CJOH 3MRLB 1J8KA 5HGAB 4NO0D 1IAMA 3L3HB 5K9KA 1L0QA 1WZKA 4YEFA 5ICXA 2HRLA 2WWKO 3MLTB 3TO2A 2NW3B 3OKLA 1YC7A 3H9ZA 2NPLX 4X6EB 2KH2B 5JNYA 2XRAH 1KCSH 1R6VA 5CCKL 4K71B 3UTSA 5DRWA 5IFHL 3AAZA 4HS6B 1OTTC 3C8HA 1TVHA 5LGJA 1Y18A 1R5VA 1DFBL 4Y16D 3ULVL 4UMGA 2IADB 2MKLC 4R2GD 2X70B 1HQ4A 4TSCL 1MNUL 1NL0L 3ARDB 4ZFFA 2P5WB 1KLUA 5LGHH 2BDNL 5T1LD 3LKRB 4MS8C 4V2CB 5E1HB 1E0OB 2VUYA 3TBSB 4QGTA 1NAKL 1LO2H 2NY3B 4PLJC 3A6OA 2XWTA 2UYLA 4E42A 3H7BA 4Z7UA 4QCIA 5KAQG 3QHZL 5FYKH 1PKQA 1BZQK 4OCRH 1DDHB 5FV1L 2J6EA 5K9QI 4HKZA 3W9DA 3QEGH 4LIQE 2XY2A 5JOFB 3VD4A 1JHTB 1QSZA 4JVWA 5C0RL 2VUOA 5CBEA 5T3ZH 1J0HA 3C5ZA 4WO4B 2DMBA 4F3FA 2P5WD 5ESVA 3IF1B 1G9NH 1AHWC 5DUPH 1IKNC 4AEFA 4XPHL 4YFLF 3K80A 2BVPA 1FDLH 1I9EA 3EYUH 1OB1A 5GGSA 5IF0A 3D87B 4CRPA 1J10A 1DZBA 3MRNA 3KPPB 1R3IL 4O2EB 5I1AB 1HIMH 5D4QA 5IKCB 4RIRA 4KHXH 1J18A 1Q72L 4RDQF 2HYMA 3KS0H 5GXBB 1IGML 3EO9L 3EYFB 3GMPA 1YZZA 1AJ7L 5D7LD 4GMSH 3QRGH 3FT2B 5DMJB 1QBMH 2Q8BH 3RP1A 2FECI 4P5TD 5C0IB 2AJUL 2D31A 1UFUA 5BO1L 5CHNA 5BRZE 4XNMA 4J3VA 3I6KA 3NIFE 3FO1B 4L4TA 3QDMB 4AENA 4Z5RB 1D9KA 5ANMA 1HH6A 4KQ4H 2X4NA 1P2CA 4PJAB 3QNYA 5HDQL 1GIGL 3D0LB 3FONA 1QYGL 1S8DA 2H3NB 2FH6A 2WIIA 3VRJB 5C0JB 5MEOA 1AY1H 2H2SC 1QR4A 5C2UB 5IB4B 1RJZB 1MCOL 3EJZD 5FYKD 2P8MB 5IG7A 2VKWA 3QUZB 1M7IA 3MJ8A 3E2HC 4LBEB 4BSJA 1MHCA 4MSWA 3MJ6A 4GG8B 4UQ3A 4OLZH 1FNHA 5SV3A 2EC9T 4X7CC 3QDMD 1I9RH 1P7QA 4PGBA 1KT2B 3CCHB 3ZTJH 4G9DA 1A21A 43C9A 1J9CT 2NLJA 4FXLA 1U8IA 5TF1L 3L9RB 5T3ZE 3U46B 4HF5H 1A7QL 2AV1B 4XTRD 3S36H 3L3IB 1J05B 3AS1A 3PGDA 3V0VA 2ICWI 3QUZD 4P2RE 2LFGA 5B8CB 3CXDL 5FYLH 1K4DB 4YHNB 1KJMB 3GM0A 5HI4C 5DQ9B 3UP1A 5FV2A 2X09A 4I77H 3NIDE 3CVIH 4KUZH 1NLBL 1S7VA 4GW5A 4XPBL 1U8JB 5E8OB 3QDHA 5FO9A 2P47B 2UZIL 2OTUA 3WN5C 4OBSA 2IQ9L 5IB5B 1XCQA 1CD0A 3UYRL 2Z31D 5E5MB 4NOFA 1XGTB 1VACA 3KJ6L 1LP9E 5DJ2A 3MREB 2VLKA 4RGNC 1IAKA 3RI5K 3OV6A 3RNQB 4DAGL 5ECJE 3L5WA 1TZHB 4QF1B 4FNLL 5KSAD 3DUSB 5GIRA 1EA9C 3IGAA 3C5JA 3GBML 1MJ7H 3K2UL 1H15B 3KPSA 1T6VN 4NT6A 1HWHB 2L7UA 3R06A 4DVBB 2VR9A 5IMKA 5CSGA 4EVNB 3FB6A 1F3DJ 1RIVL 1LEKB 4NUJA 1OT1A 2NNAB 1WC7A 3S5LG 2EIZB 5T5FH 4FXKB 1FVDA 3QCTH 3ZTJG 3P9MA 5CZXC 3FQRA 4LHUB 1IGIL 3RL1A 2NY4B 2GSIA 4HPOL 3BI9X 2BMKA 4H1LA 3HS0B 3ARPA 4PY8I 1I7RB 1W2KT 5DJXB 3WIFB 5HVHC 3KPRE 4M7JH 4XP9H 5IVXA 1T22B 1JGUH 4FMKA 5IB3A 4AEEA 1SJHB 3SDYL 2BSSB 1XIWB 1K3IA 3VDBA 2R0ZL 3IFLL 5D71H 5ID0B 1TPXC 3RTQC 4LHUD 3KPMB 1YYML 1OAKH 3F7VB 4GXVH 5FYLE 1CYGA 3O2DA 4ZPVA 4NSKA 3DHJA 4Z0BL 1IAOB 2UWEF 4OF8A 2NY4D 2EEAA 4R4FH 3TBWB 3K4DA 2PW1B 4KI5D 5C9KA 4JM2A 4N0RA 3IJYB 4YR6A 3HI6L 1DP0A 5ERWB 3ZKQD 5JIIA 5IK3A 3H8NA 2A6KB 4NZDA 5DQJB 32C2A 5FUZH 2EXWC 4JDVB 4CW1B 5DLML 3OAYH 5HPOA 4ZO6A 4XP5L 3VGFA 4TNVF 5FA4A 1N6QH 1EO7A 2ITCA 1CI5A 1Q0YL 1AR2A 2O61A 4LSPH 3SCMC 4JY5L 4PLOB 5F97E 5HVWA 1AGFB 4ETQA 4P2YA 3ZDYE 2EYSB 4ZG1A 4HH8A 4UDUB 5IEHA 4X6CA 1VPOH 3KWWA 2DM2A 3EZJB 3GKWL 4OD3H 4M02A 3ARTA 1H3TA 4FQCL 3I9GL 1XR9B 1T03L 1AE6H 3TA3C 4MD0A 1ZTXH 2D7TL 1V7ML 1KCKA 4R7DB 1NMAL 1YY9C 4UDTB 1R0AH 3HAEG 2NY5C 1CXIA 1M1SA 1GOGA 1W0VA 1IGJA 1L6ZA 8FABB 4ODVL 4PRHB 3I3DA 4M6NH 3GFUA 4Z7WE 2CMRL 4CMMB 2LU3A 1EMTH 5EN2B 4TVPH 2G75A 1NCBH 4GG6A 3MV7A 1T20A 1N3NA 1RZ8B 2W0FA 4OCSH 3HNSL 5D6DA 1YNTB 4TSAH 3GJEB 2DMCA 4YDJB 3BPOC 4S1RL 5DVLA 4G8FB 3T3PF 4DK3A 3FFCB 4N0YL 3IKCA 4HD9A 5JORB 1P4IL 3QEQE 4OKDA 4Y4HB 4WU7B 4TUJB 3LN5B 5HYFA 3U79A 1K8IB 5J6GB 1WCQA 2AKRA 2YMXH 2P43B 3GMRA 4BFBD 2GCYB 4J3WA 4OF7A 5FO7B 5MEPB 5D7IB 5CZKA 1K2DB 4YXHL 2APTA 2AK4B 4FXGA 4PRHE 4EUPH 1YQVL 1ADQA 4PJ7A 4LCWA 4RNRB 3VXSE 1HSBA 4IHOB 4F7PA 3FFCD 3MNVA 4L8BA 4OLUH 3L3DB 5HHXH 3O3BB 5CWSA 1FGNL 2ICEB 2HTKC 4Y4HD 3LH2H 1MCJA 2IANB 1KB9K 2AJVH 3HNTL 2XN9B 3ORJA 4U0QB 2JK5B 2IGFH 5JHDB 3UMTA 3AREC 5CUSH 3P4OA 5IMLB 1H3WM 5J89A 5KVEL 1ZE3C 1GOFA 4RAUB 3CDGA 3V79C 3BEWB 4Y19B 4KJQD 1QTYT 1XGPA 1CLCA 1IRAY 1R3LB 2DBJA 2XYCA 1RJYA 4OUOA 4RISH 1C5CH 5L88H 4RGMC 4H25A 5D7IE 3RUGE 2KPNA 4Q6IA 1S7XA 3BDYH 4FTVE 1JGDA 2AK4E 1X7QB 2DKSA 3BFOA 2R4RL 1OTUD 2MJWA 3S35X 1WWBX 3DMMB 4NQDA 3C5SA 2XN9D 1VFBA 3IVKB 4OZGF 4TVPE 2ORBH 5JHDD 2UY7A 3MXVL 4AY0A 4URTB 3CVHH 4POZD 1G7MA 4OAWB 3I6GB 4PJ9B 3FTGA 2IANE 4Y19D 1EIBA 1WJ3A 1BQSA 2IEPA 5E4EB 1I1AD 4QRRB 3BW9B 4J3XA 2CXGA 1CLZL 3HZVB 4OCYL 1VADA 3R8BB 5ALBL 5I9QC 5DHYA 4WNQB 1AXTL 1WTLA 4EUPG 3HUJB 1C12A 5D7SL 3ARXA 2ICWB 5DT1L 1IM3B 1ORQA 3OGCB 1DN0A 2YPKB 1MY5A 3IJSB 4XHJC 1F97A 1MHHA 1C1EH 5E8PB 3WLBB 4F2MA 1BIIB 4KKBC 3G6DH 4D2NA 4JFXB 4ODWA 3V9FA 3MQIA 2CIKA 2FHCA 3HE7C 2DL2A 3ILPB 4PRDB 4PGZA 2Z92A 1INDL 4MCZB 3TESA 2P42B 3GSWB 4Y5XC 3BP4B 3VRIB 3CVHB 2RFXA 4JO2H 1JGVL 4CN1A 2BX5A 3CH8A 4XB7A 1G7QA 5DD1L 2DBLH 5ICZB 3WBDA 1DSFL 3MTRA 1S5HB 4QRRE 2OP4H 2BRRH 2WZPD 1UWEL 1QA9B 4K3DH 3T08A 3HUJE 3BE1L 4U1JA 4NWTH 3GIVA 1JNNL 1OT2A 4DOHB 4U7MA 1LVEA 1FYHB 1ES0A 4EDXA 5DDHB 2PCPA 2V5YA 4GS7C 4Z7QE 4MZ3A 5HBBA 5E99H 3GM8A 3QIUC 4QTIH 4LIQL 4WEMB 4H8WC 4IOFC 1CS6A 1Q94A 4XBPA 1UXSB 2R1YB 4MA8L 3TVMB 3BN3B 3BZ4B 1L7TH 5EOCL 7CGTA 5LVEA 3TIEA 4YBQD 4D9LL 1EVTC 3OB8A 1IC4L 3LKPA 4Q9BA 5DMKA 1I8MB 2YBRA 5BS0A 1FGVL 4LHJB 4DVRL 2XFXB 3MODL 3U0PB 4N5UA 1EFXB 5KVGH 3OR7A 5CD5D 1E4WH 3DO7A 4KDWA 1KIQB 4S1QL 2SEBB 2XG5A 4J3OC 4K8RH 1XT5A 5FB8B 2XQYG 4NQCB 4PJDB 4ZO9A 3ZMRA 5IJKA 3DSNA 2Y06H 4ZD3H 3MV11 2P8PA 4EJ1C 3NCJL 1MLBB 2VE6A 1WBYB 3NTCH 2B4CH 3ZZ1A 5E7BA 1KCSL 4JR9L 3PF2A 1B4RA 2X9XA 3MLRH 4Y16C 4Z95L 3N1FC 5DMIH 2NY1D 4YGVA 1NC4A 4R2GC 3ES6A 4WGVB 4XPGH 1U8MB 2JIXA 1LK3H 1U8PA 1T89C 3WN5A 1RZKH 1ZVHA 4M6ML 2CQVA 2B1AH 4LSRH 3ISWA 3BGAA 1BOYA 1T7ZA 5HXMA 3VFOB 3QZWB 1JTPA 1P5VA 1BJ1H 2W9EH 3NIGF 4ORGB 4WHYH 4NNXA 5GRVK 1HWGB 4WVRA 1HK6A 3RGVA 1UG9A 4NQCE 1XF5B 5KVDL 2J8HA 4FQIH 3C60B 1KPUB 2ZKHH 3RNKA 1NCAH 3LKNB 1N8ZB 2ERJC 1TFHA 5GGTA 3CIQA 4OCRL 3FHQA 3UZQA 4MXWH 4LSDA 3VFNA 3MCG1 1FV1B 3QQ9D 3TBTA 1CGWA 3QUMA 3DIFA 4L4VB 5C0CA 2GK0A 3CFEA 2F19L 1BOGA 5E03A 2YD7A 5T3ZL 1QR1B 3C8KA 1KIPA 3NA9H 1ND0B 5BVPL 3OKDB 3PXHA 5HGDA 3V4VH 3HMXA 5IBLD 2OLDA 1G9NL 1UWXH 4PJIF 1A7NL 2CK0L 2HT4D 4ZMAT 4ZFZA 2YXFA 4K8RD 3ZT6A 2C3HA 1VEPA 3C60D 2AEIT 4L9LC 3SPVA 3KYOB 5EIVA 3RVUC 1S9KC 4GJTB 5HGBB 1WFOA 1TQBB 2IFFH 2HFEB 2GHWB 4YHPB 1AGEA 4XWGH 1MCKA 2WMPA 4PD4K 1IGYA 1N0XH 4P5TC 5D1ZA 3REVB 1FZJA 4LNRA 3O8XB 4G80A 4P3CH 3QRGL 2VXUH 4LF3B 3L5JA 3CMOL 1OAZL 3NVQA 4L4VE 2HFGH 2QQKL 1OP5H 3CJJA 3MV9B 1CTOA 2NR6D 4P2QA 5E94A 2OI9B 3G08B 1V3LA 2Z35A 4HV8B 4Z76B 5E00B 5JXED 2OMNA 4WHYG 1CFQB 1EBPA 1HSAA 4PRPD 1YC8A 4WI3A 1LO4H 4F58H 4MWFB 3L3GB 4M1GL 3OKEA 5EBLB 3EJZC 3RZCA 4RMRA 4C4KO 2Q86B 4EN3A 2FO1A 2XZAL 3O8XD 2XOTA 1IBGH 4MMXC 1HEZB 2Z93A 1NMCB 3CSYB 1ED3B 1NBVH 4GW4B 2D9QB 4C56E 1INEL 5B3JF 5HDOA 1EUUA 2YUVA 3INUL 1HH9B 4IOSD 2ADIB 3SCMA 4TOYH 1U2CA 5DJYA 1YY8A 4ONFH 3GSUA 3U7WL 5ADPH 2ZCLH 3X17A 1EGJA 1I9RL 2F54B 1XCTB 3UC0L 4E5XA 5MP6L 1RZ7L 3D2UB 3MV9E 4LASH 1JHLL 4CU7A 5LWYH 3S4SG 3TA3A 1MWAA 3ZYOA 4ODTL 2VIRA 3N1MC 3DVFA 5CIPB 2NY6B 1NAML 4XBEL 1A02N 1KJ2H 1UA6L 3UZEA 1KN2H 1KGCE 5BMFH 3QUYB 3IS1X 3MBEB 5I8KL 4IDLA 1VKXB 5J57B 4JG0L 1ZSDA 4DGIH 2AQ2A 2J12B 3P0YH 4JVUA 1CFBA 1R3HA 2Z31C 1EHXA 2F54D 4RBPH 1I7ZB 2JELH 1I1YA 4L8CB 3D2UD 3PWVA 1ZHLA 3ULVF 1BAFH 5D9SB 5GRWA 3RBGA 3KNBB 4BKLB 5BZDA 1G7LA 3FO9A 4JCLA 5KSAC 3CGTA 4KZEL 4Q9RH 4ALAH 3N85L 3PHQB 4ZDHA 2NY6D 4UIKH 4NRZA 3T8XB 5C0FA 5JW4Q 1XF2A 2DQCL 3QUYD 3MBED 2GJ6A 3S35H 4PUBH 3D3VA 1NGZA 1CF8H 4D3CH 1YMHA 5B39B 2AJSL 3W39B 5GGUB 1T7YA 5I1JH 3FRPG 1KJ2B 1LO5A 3QT2A 5MEQA 2E7CA 1BJ8A 3ULSB 3PV6A 3V6ZA 1F8TL 3Q48A 2VXQH 7FABL 1CR9H 3FQTB 3C2AH 5DVKA 4OGXH 1DQLH 4I13B 3A6CH 4KROB 4PP2A 2E7LC 1BVLB 4XP1H 1KJ3L 4MA7H 4M4RA 3BZFA 3K1KC 3O6LH 3GIZL 4ZUTA 3EYVA 3NZ8A 4O2CB 4D9QD 2IMMA 4Y2DD 3LQAC 2HJFB 2DQJH 1SY6L 3T1WA 3QFDB 4M6AA 4AT6B 1K85A 3AREA 4Y1AE 3GRWA 5D7JB 4Q9QL 2CKBH 4PY7A 4G6FB 4F8QA 1F11B 2V17H 1P6AB 3QXVA 4G3YH 4N8VA 4PJFE 3D39A 2J88L 1T3FB 3LMJL 5TQ2H 4ZTOH 1HCFX 5IUSA 5F96L 4KI5C 1ZWIA 5L9DH 3SHSA 1A6WL 4R90L 1QHOA 3C87A 3B6SA 3JSSA 5KSVB 3EW3B 4LLDB 3P9WB 43CAA 1HNFA 1M7DA 4R4FL 4NPYB 3IKKA 1BEYL 4HIIA 3F12B 4J1UB 2IAMB 1KXTB 4XNXH 1ZT7B 4JB9L 4LU5L 1EH9A 1KC5H 2A9ML 5EU4A 3OKKB 5D7JD 2ZSWB 4HCRH 1NMBH 4G6FD 1MJUL 1OM3L 1ONQA 2LV4A 1DBJH 3O2DL 1F3DH 4AQOA 5EO0A 3W81A 5FUZL 5HYSG 3O45A 1A4JA 4XT1C 1BLNA 3CU7A 2G2RA 5K59F 4JFQA 1PD6A 4U1KB 3EOBA 1N6QL 3RWDA 1BPVA 4KTYA 3K8LA 2ED7A 2J8UB 4I3RH 3T3ME 3MLSH 1KLGB 5IMOA 4LLMB 4WI6A 4U1MA 3QUXD 1QACA 1QD0A 3BPCB 3G6JF 5DTFB 3BVNA 4OD3L 1C16B 3RBSA 3MO1A 3DX7B 2RQ8A 3VFTB 4M1DH 1AE6L 2J5LB 4OLXH 3RWCB 3T0XA 4RAVB 4Y5XA 5AZ2L 2BK8A 2VH5L 1I7TB 2NTFA 3GMLA 3TNMA 4Z77A 1F3RB 3H9SA 4HHAA 4XMKH 3DRTA 3VA2C 3MJGX 1CK0L 4X4YA 4BH7B 1FZMA 4NNYA 2FDBP 3SOBH 4QXGH 2BC4A 3BZEB 4OZ4B 5DURB 1EMTL 1BQHG 3QHFL 5IR1B 4HK3J 5CP3A 1IC7L 3IU4H 2J8UE 3QIWB 4OCSL 1UYWH 3ARUA 2EE9A 4G7VL 1ZLWK 2C3WA 3BJ91 3NCCB 3QIUA 2Y25A 3FRUA 1GPOH 3DTXA 4YC2B 5DRXB 5T1KA 3DBXA 1A47A 3PNWA 3U48A 3KXFB 2QR0B 4LPWA 2X9YA 3MXWL 3RWIB 4OZFG 4X7SL 3LKSB 4MNQA 5DC9B 3WNKA 1QLFA 4Z7OF 3MOBL 3QIWD 4ODHL 4NO0A 4P46B 3S34L 1PEWA 2FD6H 4F9PC 1JWMB 2R56H 1T1XA 15C8L 2GY5A 2W9DL 1GC1C 4Y4HC 4LFHD 3WUWB 1AGDB 5GISL 4OLUL 1MCCA 1QO3B 5I17B 1ZT4B 5GGQH 1JPGA 1GXEA 4XZUB 3KXFD 1XF3A 3QULB 3LH2L 2K3TA 1A1MB 4UV7L 5EC1A 3MCLL 2AJVL 4TPRL 4OLVH 3SDAB 4OZIF 1IC5H 4KJQC 3WO4B 3FCTA 1MAML 2CJUL 1S3KH 2WBKA 4Y16A 3D18B 3LQZB 3LPWA 3MRLA 4P46D 1T89A 4G43B 2DICA 2D3VA 5F7EL 1C5CL 1OTUC 4G42B 4HWEL 2QADD 3OQ3B 4K07A 4MNGB 4O9HH 1B0GB 5T1LA 1JV5B 3DUHA 4HKXA 1EBAA 3O6MH 2NW3A 4I48A 1UB5B 1U3ZA 4X6EA 5IHUH 4POZC 1X9QA 4GXUN 4OQTH 4YXKL 4PG2C 4XPFH 1JHKH 1AH1A 2ORBL 4ZOBA 5I30L 2D0GA 3THMH 3LPGA 1I1AC 4X4ME 3MUJA 3GJFK 3UJTL 4KDVA 2X70A 2OYPA 4OGYH 3VMPA 3ARDA 3NPZB 4TTDD 4RFEB 5IQ7H 2P5WA 4JZNA 3BDXA 2EH8H 4KKLD 2BSTB 3LKRA 3CNKA 3TZVD 4FA8A 3TBSA 4JFPB 3F7YB 5JA8B 3EDKA 1T7WA 3PABA 3ILQD 2B0SH 4NOBA 3U4EB 2ENYA 3AFLA 1R5IB 2BNQB 2QHRL 4MNGE 1RVFH 4X80L 4UNVA 1DDHA 2Z8WC 5E4EC 2RGSA 3O3DA 2ESVB 4QXTB 2OR7A 4L9LA 1F42A 5H8DA 5JOFA 2DJUA 1JHTA 1MSPA 5F89B 1MFEH 1VDGA 3DO3A 1FIGH 4UINH 3VGHA 5D7LA 5D1QB 4PB9L 2WUCH 2CXKA 4FABL 1A4KA 3VG9C 3B8SA 3A67H 2DBLL 3C6LB 1A1NB 3I85A 4ODSL 2EDDA 3PWUB 4AM0A 3DXAB 2BRRL 5I8CB 1PLGH 2ADGB 2ESVD 4P5KB 1KCVL 5IKCA 2QBWA 4OQ1A 5EZIH 5AWNH 1FNFA 5E99L 3EYFA 2BNQE 4QTIL 1I3GL 3NABH 4GKSB 3DV6B 4WWID 1KCRL 4HSQA 2ESVE 3FT2A 2OJEB 4XPAL 1X5JA 2QQNL 3AROA 1LK2A 2VB5A 3IAGC 4HS8H 4YBQC 2VLJB 4JANB 5F1SA 3C6LD 3SDCD 4F7MB 5KTEL 4K55A 4K9EC 1B6UA 1MCNA 3FO1A 3W2DH 3QDMA 4QNPE 4Z5RA 3VXUD 4OFPA 4OZHB 1KPRB 4PJAA 4HDIB 4DEPB 5CD5C 5DJ0A 3ZYJA 3HCVB 4U31A 2DMKA 4P48A 3A6BH 3D0LA 4QLRA 3BO8B 1OF2B 2H3NA 3DXAE 3VRJA 5C0JA 1E4WL 3TJEH 5IB4A 2G5RA 1RJZA 5K33A 4X83A 4M61B 3RVVD 3SKNB 4H88L 3QUZA 1NGPH 5C09D 2HRPL 2VLJD 3WMSA 3UBXG 4O02H 4ZD3L 3MOAH 4FFYH 1EHLL 2DLFH 4MJ5B 4K3EL 1MFCH 4RZCB 2NY1C 2VXVH 3ABZA 3CSBA 4Y4KD 3NTCL 1XMWA 3O2VH 4NKIH 4YIQB 2AJZB 1XGYH 4PRIE 3HI5H 1KT2A 3CCHA 1OARH 1ZLUK 5C0GB 2QSCH 4KFZC 2Z31A 2G60H 3U46A 3ZTNH 2CDGB 1LK3L 5ISZB 3GMMB 2F8OA 4X7EC 5DD0H 5IESH 1J05A 5KSAA 3IDXL 2FIKA 2YPVH 1K4DA 3CFIC 1CLOH 2VITB 2I60L 1OGTB 4HX1B 5DQ9A 1VGEH 2A38A 1MHEA 3MPCA 1CQKA 4YWGL 3R0MA 4MX7B 4GLRI 5DQDH 5FGCB 4LAQH 3QQ9C 1NCAL 5HHME 3KJ4C 4BQ8A 2VDPH 4LDOB 3ETBF 4L8SB 4UAOB 1XGTA 4ACPA 4LSSL 5FM8A 5GRYA 3WUZA 4PJHB 3WL9B 3BP5B 3RNQA 2OZ4H 4M62L 3WIIH 5I76A 1TZHA 4WRLA 4JM4H 4QF1A 2JCCE 4GAYB 2E7LA 1NDMB 2HT4C 3PQYB 3W5MA 3SDDC 5GSVA 3V4VL 1PX3A 1MCPH 5ISZE 1OGAD 3ULUD 3C60C 1H15A 2ZUUA 3MLXL 3GSNH 4ZSOB 4WTWA 3QO0A 2H26B 2ADJB 1JF1B 1IE5A 1FLRL 1DEEB 2AAVA 3FKUS 1LEKA 4PJXB 2B4CC 4JHZA 3BIAX 5JUEH 4NM8L 2EIZA 3EOYG 3O0RL 4FXKA 1UJ3B 3WXVH 4QRTB 3DGCR 3NBNA 4LHUA 4QHKJ 4MZ2A 3GGWB 4XWGL 5FGCE 2R0LH 4YFLI 3GKZA 1AP2A 4YHLL 1EO5A 2NR6C 3M8OL 2KQNA 5AAMA 4DK6A 2VXUL 4NJAL 3HS0A 5EZOL 5I1IH 3K0WA 2DDQL 4R4ND 2HFGL 5JXEC 1C8PA 1I7RA 3ZYZA 3WIFA 1CDCA 2Z0BA 3QXAB 3PQYE 4AIZA 1SJHA 2OR9H 5KZCD 3DJ9A 2BSSA 1A14H 1T80A 2C5DC 1BM3H 4M5YH 1DL7L 4F58L 5ID0A 3GSNB 4NZRL 4XCCH 3O8XC 2ZG1A 4OCNC 3VU2A 5JPMA 3KPMA 5FFLA 3F7VA 4K2UH 4QHLB 2DL9A 4WDIB 5ILTL 1FZKB 2RJMA 4ONHA 1KF9B 3UO1H 3K81A 1IBGL 1IAOA 3BOVA 3TBWA 5EG6C 3WFBL 2PW1A 1CQYA 3RX7A 2OI9C 5KAQF 1JJUA 3IJYA 2G5BA 2DQEH 1A9EA 1TJGH 3R0NA 4WI4A 4TOYL 5ERWA 4NBZB 4KK6D 4KK8D 2A6KA 3S96B 5EOQL 3U7YL 4J23A 2EDXA 4JDVA 1IGFH 1DANU 2ZCHL 3OKMA 4X6DB 2W65B 1NMCC 5I15H 5TDNB 2EDOA 1NGXB 3MCKB 1WGOA 3VFUB 1QLEL 5DZOA 1FO0A 2ILLA 3FQNB 1KJ2L 2CRMA 1ROWA 1RUML 3ECBA 3RA7L 3B9KD 5HI3D 1C08B 4NRXB 5E56A 5IB2B 1AGFA 3MV8B 4NC1E 2EYSA 4UDUA 4EIZC 4DGIL 2DS4A 4BZ1L 3ZHKA 2PYEB 2WINB 1XR9A 2ZPKH 4DKAA 3RL2A 1ACYH 2VO5A 3U30B 4CNIB 5E8NB 2DJ4A 5D5MA 1H5BB 4UDTA 1OAUL 3QUYC 4GRLD 1YEGL 4LSTH 8FABA 2BNUB 4U7SA 3S98A 2X44D 4KRLB 4PRAA 2OK0L 4FQ2H 2OJZL 4CMMA 3S35L 1GGCL 3MV8D 3FQUA 5EN2A 4LKCB 1Q38A 4KWUA 4D3CL 4M8QB 3FO2A 4U6HB 1I3VA 4WV1B 1RZ8A 3L95B 2ZUTA 2P45B 1WBXB 2PYED 1S78D 1YNTA 5HPMB 2VLLB 2GEEA 1F02I 2V2TB 3GJEA 3MV8E 4YDJA 2VXQL 4DQOH 3C2AL 3FFCA 2YRPA 4F9PA 5JORA 3IDNB 3LSOB 4G8GB 4E41D 2D7PA 4Y4HA 4WU7A 4Y2DC 2APFA 2GKIA 3LN5A 4JKWA 4PBXA 1K8IA 4OT1L 1FFNB 2ZOKB 4UB0H 5J6GA 5J1AA 2GCYA 1CD1A 5DYOB 5FO7A 5ICYA 5MEPA 3AB0B 5D7IA 1K2DA 2PR4H 2ZOLB 3BESR 1BD2D 3D85D 2CKBL 3AMLA 4RNRA 3NAAL 4IS6B 4QT5B 4YDVB 1RUKH 2FGWH 4GW1B 2V2WB 3SKOB 4QOKD 3SDXA 3FN3A 3O3BA 4PJCE 1E28B 3HZYB 2ICEA 3X3GH 5DEZA 1LP9F 5I1EH 5CJXC 2HVKB 2XN9A 5IP4A 2JK5A 1SJEB 1E27A 3P4NA 5JHDA 4I3SH 2HLFD 3PHSA 3MSPA 2J7LA 5IMLA 5D7JC 4G8GE 3D69A 1FAIH 4PG2A 4JN1H 4XNXL 4RAUA 1KB5H 2CDEA 3BEWA 4Y19A 1KC5L 1UEYA 2MNUA 3KGRA 3LRHA 1I1AA 4GAJL 3FL7A 3UROR 1S7QB 4MQTB 3ZT7A 4HCRL 1T5XA 1NMBL 3WFDH 1C7TA 1CGUA 1Y0LA 3BIKB 4YE4H 2MSPA 4NQEB 3ARBC 3QQ4B 2AEQL 1DQDH 3MNZB 4GLRH 1X7QA 2R1XB 2CUHA 3HRZB 1EDQA 3TPUB 25C8L 1HILB 1LO0H 4O4YL 3QUXC 1GGIH 2Q8AH 3TCLB 4I3RL 4Q58C 1I4FA 1MCIA 3I6GA 4OAWA 4LGSB 3WIHL 1ETZB 4F37F 5DR5H 2VDKH 3W5NA 2R4SH 4HH9A 1R5WB 5C6PB 2Y1VA 3BW9A 1FBIL 3HZVA 3SBWA 1ZGLP 2VLRE 4WNQA 3MZGB 4M1DL 4UU9B 3HUJA 4MD5B 4NQED 4JFHD 5ID1B 1NEZB 2ICWA 1IM3A 1KB5B 2GTZB 3HNVH 3OGCA 4NZUL 3IDGA 2YPKA 1FHGA 3IJSA 4LVHB 5E8PA 3WLBA 5CKGA 1BIIA 1UCBL 4GQ9H 3PWPB 4PJGE 1XGRB 3T2NH 5F7KC 3FAXA 1RFDH 4JHWL 5JMOC 3NCYP 4JO3H 3QAZB 3ILPA 3JWOH 5F9DC 4MCZA 3STBA 3DUUB 3GSWA 1GGYA 4B5EA 5GJTH 3BP4A 3CVHA 2QSQA 3RIAK 3B9EA 1T5WB 2I24N 4X5WB 2GFBB 1FQ9C 5ICZA 1A7OH 3OF6D 4KAQH 1RURL 3WKML 1UGNA 1S5HA 5A16A 1AGCB 4R26L 3NMEA 2YRZA 1VSCA 2ADFL 3FMGH 2GI7A 4BZYA 4LSQL 4NZJA 3VXRD 5IWLC 4S1DC 3KLHC 1F4WH 1OAYL 5D2LE 3V52H 5DDHA 1O5DT 3QIWC 4MQXC 1NCWL 1BZ7B 2FWOB 4DKEL 4I18B 5GS1C 1RSFA 4XXDB 4I9WE 3PWPE 4YC2C 3T0VA 1HKFA 2BVUA 3RU8L 4XP6H 4OSUH 5EWIL 3RWFA 1UXSA 2R1YA 3TVMA 2DAVA 3BZ4A 5FGBC 3CFKB 2D4FA 2NYYD 1CXKA 1OQXA 4XXCC 1YA5A 4JY4B 4XP4H 4WI5A 4M7KH 2V7HB 1U93B 1GYAA 4HQQH 2X7LA 3MUZ1 2EDNA 4Z7WF 1SYVB 1EFXA 4P46C 1CZ8H 4CADB 3EOTL 4YO0B 1KIQA 2MCPL 5GHWH 2SEBA 1SVZA 1MCRA 2QADC 1G7PB 2UZYB 5FB8A 4PJDA 4M1CD 2R23B 3IRZA 1RV6X 5T1MA 3O6ML 1BHGA 4CMHC 3BAEH 2HT3D 1QRNB 5IVXF 1CFNA 4HEME 4JFOB 2CUIA 1IARB 1NFDA 3D0VB 2E9JA 4OQTL 4M3JA 4BH8A 2UV3A 4Y5YB 1D6VH 1U8MA 3THML 2XV6B 5IOPB 4TTDC 5DF0A 4OD1H 5CSBA 4MDJB 2ARJB 5D1XB 4Q7DA 4JREB 3H42H 4LLAA 4OGYL 4KKLC 2DTML 2BY0A 3TZVC 2C9AA 3QDJB 3VFOA 2YWYA 3QIBB 4JM2F 2HJLB 2W60B 5IVOA 3GUTB 2NW2A 2EH8L 3ILQC 1I8IB 4ORGA 1OCWH 3B9VA 3BH9B 3SKJH 4MQ7A 2QQQA 2DD8H 2P5EB 4KRNA 1XF5A 3GMNA 3U9PH 4S2SB 1RZJL 3C60A 1KPUA 1TETH 2B0SL 5TE7H 2VQ1B 5TF0A 3IAQA 1AGBA 1N8ZA 2VZVA 1L9NA 3MLWH 1RVFL 4R96B 5ADOH 2FYYB 4MJIE 3NOIA 1FV1A 4JLRA 5DGRA 1QRNE 4KDTC 5FUCC 4AG4H 3ARWA 4KMQA 5IV2A 5D1XD 1M05B 1EAPB 1GAFL 3HC4H 5C0AB 1CLYL 1FIGL 1QR1A 3IFOA 5IEKB 3VH8G 3JUYA 4ZFGL 4F8TA 5DMYA 3PDOB 4UUJB 3AS3A 5D72H 3A67L 5C0BB 3RUGF 4LLUB 1BIHA 2DM7A 4L8DA 5AZEH 1FJ1B 1E6OH 4RA3A 5M95B 4IIQC 3QDJE 1MUJB 3KYOA 4BZ2H 1PLGL 5HGBA 4PRPA 4OJFH 4P3DB 4ERSL 2HFEA 1NANI 2OXGA 4XAKD 2P5EE 1JPSL 4PJEF 3EO0B 4PRBB 5HHPB 3S8WA 5EZIL 3BUTA 2N7AA 4OB5L 4HEPG 5J13B 3V95A 3O8XA 3C6LC 1QFUL 3SDCC 3NABL 2BOBB 4R8WL 2JJTC 4N8PA 2H8PB 1HZHL 4LF3A 5TDOA 3FHAA 3CX2A 3P11H 1ZXQA 3BGMB 3LQMA 2AGJH 5B38B 5D96C 3J8F7 4WFGE 1YUHB 2BNRB 5C0AE 3G08A 1NQBA 3D6GA 4OFDA 4HV8A 4WY7H 5EUKB 5E00A 3O11B 4J12A 1MCEA 1CFQA 3HB3D 5LQBH 2DM4A 5C0BE 1A6VL 4JFFB 1JFQL 3A6BL 4P2OD 1OY3B 3RVVC 2Q86A 4CN4A 3M07A 3ARVA 3BWAA 1R24B 4HKJB 1LDPL 3CSYA 4HZAA 1NGPL 1ED3A 4I5BB 4GW4A 1BFOB 4Q2ZB 4Y4KC 4O02L 1FRGL 2ADIA 3MOAL 2BNRD 2EC8A 4FQHB 2DLFL 2X1QA 1MFCL 4GRWF 3ZL4H 4OIBA 4EQ3A 1X5ZA 3JXAA 3RZWA 2F54A 3VI3F 4PJ7F 1XCTA 3O2VL 3QPQC 4D0DB 3FOLB 1XGYL 5T5NF 3HI5L 3D2UA 4MAYC 3T4AB 4JFFD 3K46A 2G60L 3NN8B 3R1GH 3FFDB 4Z7QF 5JDSB 4NYLB 1MFAL 3B83A 5DD0L 5CIPA 1A2YA 1FG9C 2MFNA 5EIIA 1UM6H 3WE6B 3QUYA 5BVJA 2YPVL 3MBEA 4I2XB 1VKXA 1RULL 2O5XL 1QSEE 3W0WB 4LPCA 4NWUL 5KN5A 5CBAB 2HVJB 3J7HA 1JNHB 4H20L 1I7ZA 1KACB 3BH8A 5DQDL 4L8CA 1H8OA 4LAQL 1YEKL 4RRPG 1RU9H 5IJVA 3RPKA 1G9MC 4BKLA 3DSFH 4XRCA 2CDFB 4Y4FB 3PHQA 4P2CG 3LEYL 4IRJB 3T8XA 3ULUC 1FPTL 4PLKD 3WHXB 2NMSA 1AI1H 4Y2DA 4U1GC 3WS3A 3W0WD 2F74B 2HP4A 3W39A 5B39A 5ITFB 2UWEE 5GGUA 5BW7C 2ZUSA 2W0LA 1YNKL 4HGKC 3PGFL 1LE5B 4UAOC 4ZS7L 5JW5B 2RCSH 3V0AC 2XKUA 1ZLWH 3FQTA 3TF7C 3G5ZA 4Y4FD 1I1FB 1K4CB 1BVLA 4GKZB 5F21B 4MDIB 2DOCA 2X4TB 5EU3B 4B7LA 1MJ8H 1Z0NA 2R0LL 4HFUH 4U6VH 3S37L 3MGOA 4R4NC 1NCUA 1QHPA 3SY0B 2XKNB 3LQAL 5C0DB 4O2CA 3MJ7B 2EXYC 2PTVA 2HJFA 5C08E 1JPTL 1JGLH 4EIGB 3QFDA 4BFIB 4AT6A 4WCYH 1CXFA 2R2BB 1GZPB 5D7JA 4Z7NF 1F90H 3GO1L 1F11A 3RAJH 5EORL 4WTZA 4ELMB 5DRZB 3T77B 4JDZA 2OTPA 4NDMB 4X0KA 1T3FA 2ZUYA 4R97C 4U1LB 3FQXB 4XCCL 2UUDK 3NA4A 4OLYH 3WEXA 5EBWB 3QQNA 1EAJA 1UENA 4O2FB 5C8JB 2X42A 3K4ZA 5KSVA 3UO1L 4LLDA 2IPKA 3Q5YA 4NPYA 1FSKC 3F12A 4J1UA 4LPYA 1FORH 4KK6C 4KK8C 5T1DH 1OTSD 1DEDA 2DQEL 1ZT7A 3SE4C 3KPOB 3QUXA 1O0VA 3CLEH 2HLAB 2HN7B 3OKKA 2JB5L 4KU1A 1MIEL 1GZQB 2N56A 4HIXL 3MV01 4L4TD 3RY4A 4QRUA 5CEXA 4U1KA 3B9KC 6CGTA 5HI3C 2J8UA 1H3VA 3SO3C 3BHBB 1DBKH 1YEEH 1DVFD 4XVTH 3SKMB 1KLGA 4KY1L 4NNPL 1RIHL 3GJFH 4LLMA 4NP4H 2DQTH 2PNDA 5LGKA 3E6HB 4HIEB 1TJIH 4HGWB 5IBTH 3QG6B 3MACH 3MA9H 1SJVA 3GBNL 3DX7A 5F1NA 3VFTA 1MIML 1ACYL 3JTSB 3TM6A 3WD5H 4A6YB 4RAVA 3CFCL 4GRLC 4NGHL 1I7TA 2ED9A 4YUEH 2HMIC 3OGOE 1FNLA 1TIUA 5AEAA 3JWDC 3BEVA 4OZGB 4P59H 2AI0L 4BH7A 1IGCH 2D7MA 3GI9L 1YPZB 4N1EA 5E2VH 4PGDB 1DANT 4YK4B 3FT3B 3KPQA 4OZ4A 3VDCA 4KV5F 4UILH 4NCC1 1S78C 1T66C 5IR1A 5IWLA 3OSKA 5FCUH 1AO7E 4TYUA 3RVWD 3QIWA 5AYUL 4LOUC 2H1PH 5GS1A 4F80A 1G7JB 4HXBH 4LLWB 3UYPA 4ELKB 4H26A 3F7PC 3LCYA 4AEHH 4N0UA 4GO6B 1MOEA 3KXFA 4N8CH 2IQAB 5FDWA 4X4XB 2QR0A 1NBZB 3UTZB 2FGZA 2I07B 2XA8L 5L2JB 1BFSA 3RWIA 4XXCA 4UB0L 4WV1C 3LKSA 1V5JA 5I6XB 2LABA 4NO5B 2PR4L 1AIFA 4NQUA 5SWSB 1SQ2N 1TZGL 4P46A 4EBQL 1JWMA 4KTEH 4V1DE 1GC1L 1RUPH 2FGWL 1NLDL 1C5BL 2MHAA 2JTDA 3RJQB 1F2XK 1MCHA 1QO3A 5I17A 2FHFA 1BECA 2HLFC 4XZUA 3QULA 1WBZB 5DEGA 5DJ6B 4Z6AT 2C3GA 1OWRM 3B3IB 2B39A 5FYJH 4MJ2A 5GZND 1A7PH 3SE8H 4I3SL 5I74B 5F44A 1URLA 2C3VA 1EXUA 1WZ1H 3LQZA 2MOVA 4JN1L 5SWSD 1ZLVH 1A6UH 4WUUE 4G9FE 2BHUA 1G1CA 3AMKA 2Y5TB 3MLVL 1KV3A 2VAJA 4MNHB 4DKDC 1K9TA 2FRGP 1HYRC 4JQXA 4G42A 4MNGA 1B0GA 1JV5A 3VG0L 2K1MA 3BD5A 2P49B 4F37K 1DQDL 4HUMB 1KEML 2ATPB 3O9WB 3N1PC 4YHZH 1YECH 2FO4B 1MH5B 4DWHA 5ENWB 2D9CA 5TJWK 3L1OL 5K9OB 1SEBA 2VISB 2VXTL 2Q8AL 1PG7H 2O93L 5JOPE 4U0RB 3MRCA 3I3EA 5DS8A 1IL1A 2VDKL 4NQXB 4OCLC 2Z91B 1JPST 4RFEA 4KDTA 3OPZH 4H0GA 3T0EB 2PKDA 3X3FH 2ZG2A 2V5TA 2A6IB 1OOAA 2BSTA 4PJFF 4TULL 1EO8L 3QQ3B 2FJFA 2E27L 5F7DA 3O9WD 1NC2B 5GRVL 2Z8SA 4NKDB 2C4XA 4HMEA 5EOCJ 1QFPA 5HY9B 3BKCH 2IBGA 3DHMA 3U4EA 4KPHL 2R0WH 4FOMA 2X1XR 4O5LH 4IIQA 4QXTA 2ESVA 2EDFA 4GAGH 1RUAH 3RY6C 4JO3L 5IFJB 1YQ2A 2NX5E 3SJVB 3KYKH 2E9IA 3MA7B 5F89A 1F3JA 4DTGH 2H6PB 5D1QA 1KTRL 2H45A 5GJTL 3BQUC 5DJDA 3ROLB 2ZUQC 5FF6A 4Z8FL 3C6LA 2EH7H 5BV7H 2JJTA 4KAQL 1U42A 5FYJE 3V6FB 2AXGA 4N0CD 1RPQA 3PWUA 4UT9L 3VXUA 3T0EE 1JZ3A 5I8CA 3QAZC 3S7GA 2AJXL 2ADGA 3IRPX 1RUQL 2R8SH 2EDJA 4ZNCD 4KUCF 4P5KA 4FP8L 5TE6H 1LNUB 1EEZB 2HTLD 4YH6A 3GHEL 4CAGA 4IRSC 5IT2L 3EYQD 5IVZB 5FKAB 4GKSA 1QSFB 2NYYC 4JRXE 1NCCL 4XP6L 4HWBH 3F58H 3WS6A 1WEJH 4OSUL 4PJIB 2VLJA 1KIUA 4JANA 3SJVE 2EYRA 4K9EL 4F7MA 1MRFL 3CH1B 4PP1D 4RGOH 3S3JA 3WNPA 5F9JB 2RHEA 4XP4L 4Y4KA 2F53B 4OZHA 1KPRA 3NIGE 1VA9A 4HDIA 4M7KL 1T4KB 3GI8L 3HCVA 5I75C 3ESUF 5BV7B 2NY2D 2AXFB 4NM4H 3P30H 3QEHA 4H5SB 3BO8A 3CX5K 4YHKH 1B2WH 1AQKL 4M1CC 4YBLB 1MRCL 4HBQA 5J0BA 1UVQB 2HH0L 5GHWL 4S1SL 1J7VR 1QSFD 5I19H 5F88B 1DQMH 1UACL 3IDIB 1CGVA 2HT3C 4KI1A 3VMOA 5TGBB 3ZE1F 3Q3GB 5E2JA 4MJ5A 4RZCA 1X5FA 4NJ9L 4W6WB 3JV4B 4PJIE 4QRPE 4YIQA 2AJZA 4EDWL 5C0GA 2A83A 1FAKT 3U36B 4RCAA 4QWWD 2CDGA 3GMMA 4X7TB 2F53E 3ZHLA 3H42L 4ISVB 5MENB 3QNXB 1DFBH 4M7ZB 3U6RA 3ULVH 4XNUL 2LU7A 1G1YA 5CJQL 2XZZA 4TSCH 1MNUH 1OGAA 4JDTH 4RFNB 1CDUA 5FDYA 5DJ8B 1HXMB 3SKJL 2WBJD 3RPIB 2XIDA 4Y5YC 4MX7A 2BDNH 4W4OC 3CLFH 4UNTA 5D2NB 4R0LB 3BUYB 4J4PC 4L8SA 1NAKH 2H9GB 1HINL 4JJHA 1FNAA 4LLVB 1DBAH 4PJHA 1CE6B 5IW1B 4PJ8B 4AG4L 3WJLA 1Q0XL 5MEND 3HC4L 4GAYA 4M6OL 5E8DL 5DA0B 2ZP0T 2FBJH 3ALXA 5C0RH 4WI7A 3QFJE 1YYLL 3PUCA 2ZSVB 4EKXA 1L6XA 4ZSOA 1CDYA 4Q0XL 3MRGB 2H26A 3QUKA 2ADJA 1JF1A 5AZEL 1E6OL 2PXYB 4JPVL 1DEEA 5HYJB 3C6SA 5CZVL 1U2HA 1JYWA 1PZUB 1RZGA 1DUYB 4PJXA 4BZ2L 5JHLH 3QDGB 3ZKMD 2X6MA 1HHKB 3G6AB 4WUKH 1UJ3A 3WCYA 5E9DD 3ROOB 1K5NA 3LS4L 3HR5B 3GGWA 5FK9B 5GRZA 1T7VA 1NKRA 3VGEA 4AYFA 4HULB 5BOPA 5DI8B 4KRPB 4KJPD 2V9TA 3CFJB 1Q72H 3EO9H 3LN4B 4PJBB 3V6OE 2OZ4A 1MI5E 5IB1A 5IM7B 1AJ7H 5C9JA 4JFYA 4M9OA 3HB3C 5JXAH 5I8EB 3MRIA 3QXAA 2BVOB 4JFDB 5BO1H 4P2OC 4GRMB 3QDGD 3DX6B 1J8HB 4NN5C 1RMFH 5IQ9B 1CN4A 3GSNA 4JY6B 3T0DA 3RWJB 5HYJE 3ULVE 5HDQH 4QHLA 4WDIA 4WW2C 1FZKA 3IDMB 1GIGH 3RWHB 3PP4H 3TT1H 3B9KA 1RJLB 3CFBB 1U41A 4WJ5A 1MCOH 2XXCB 5BZWB 1BQUA 5T3XE 4I3GA 1T83A 3MBXL 2YD5A 2WIMA 3ZL4L 4WFFE 3VXTB 3S96A 1CG9B 3F7QA 5DUBA 3V4UL 2HFTA 5I8OH 5DD3H 3LEXB 3BP6B 3R1GL 4X6DA 4JFDE 4Z9KB 4D0CB 5TDNA 5L2KB 3IB4A 1NGXA 4GRLA 3VFUA 4OD2A 5CJBA 5TF1H 3LB6C 1J8HE 2P4AB 1KULA 4M48L 1J88A 1A7QH 1UH2A 5MHSD 2X4RB 1J0YA 4EI6A 2FR4B 1C08A 4NRXA 5IB2A 3MV8A 5F9WB 3TO4B 1TMCB 2X4OB 4L1DA 3T0AA 1U9KA 4N90E 3Q5TA 4QNPF 4S0TD 2PYEA 2WINA 1U58B 3O4LB 2P24B 3U83A 4CNIA 2W0PA 3I75B 2X1PA 4CKVX 1H5BA 4XPBH 1FNGB 3DI3B 2UZIH 4E41A 4FQ1H 5L2KD 1NC4D 2DYPB 3UYRH 3E3QC 1MJJB 2BNUA 2D03H 5IBUB 1MHPL 4OGZA 4FS0A 2XQYK 5B3NA 4JFEE 1PJ9A 3CX5J 5GGRY 4LKCA 3G6JB 5A43C 2A6DA 2NY0D 4M8QA 3TO4D 1ZEAL 4FNLH 1BD2A 4U6HA 5CEZH 1OWWA 4WV1A 3ARYA 3L95A 1HHGB 1NBYB 1WBXA 4ODBD 2V2TA 5HPMA 2VLLA 5TPWH 4BUHA 1CDGA 4PJ5B 1P53A 2J3SA 3RGVD 4YEEA 2R29L 3LV3B 4PYHA 3IDNA 1RIVH 2DQHL 3O4LE 2DYPD 2VZ3A 1BFVL 4KKCC 2RAMA 1VENA 4U6VL 5I1GL 3O6FB 5GJSL 4CJ0A 4NZTL 1FFNA 2ZOKA 4ZYKB 3DROA 1OLLA 5C0CD 4EI5B 2ZOLA 1OHQA 1IGIH 1FNEB 3OHXB 5CLTA 3V8OA 4AZ8A 1N7ML 3O3EA 4HPOH 2IPUK 1Q9WB 1FN4B 5ESAB 4MA1C 5A2IH 4IS6A 3BGFC 4YDVA 3MLPA 5EUOB 1KOAA 4GW1A 3G6JE 4PJ5D 5H94B 1CIUA 1ZLSH 2V2WA 5JLZB 3VJ6B 4NQVB 3SKOA 4OM1L 1RZIA 2VJXA 3UJJL 3SDYH 2HVKA 5DD6B 2R0ZH 1RD6A 3IFLH 5KOVC 5HHVH 1SJEA 1OTSC 1FFQA 3AY4C 5HSFA 1XGUB 1YYMH 3KAAA 4EI5D 2EKJA 4DCQB 4M93B 3GSOA 3CC5B 4Z0BH 5GRUH 3S9DB 4N1HB 3NACL 5EFIB 2XTJB 3UTTD 4AL8L 3HI6H 3MRFB 1MVUA 1D9KC 4ZOCA 4KC3B 5KSUB 5IIEA 4M43L 2Z9TA 3O41B 4M5ZL 5BXFB 4NQEA 1SBBA 3QQ4A 3L7EB 4UQ2B 2IC2A 1F4AA 3PP3H 4UNUA 2R1XA 5CMAB 4OZIB 3HRZA 4XCYB 1DVFC 4RFOH 1RIUL 3V8CA 3TPUA 2O5ZL 1HILA 3RKDD 3VGDA 1INQB 2DIAA 4XP5H 3TCLA 1DBKL 5CEZE 1IQDB 3M1BB 1Q0YH 4LCCB 4AMKL 1ETZA 5K9JL 4NP4L 3GSRB 3U2SB 1CICB 1U8HA 4PREB 1R5WA 2YPLB 1AR1D 4JY5H 5I71C 5IBTL 3RY6A 3OG6B 3MACL 3ARGB 2B5IC 3MA9L 4UU9A 2DWDA 3WD5L 4MD5A 3GKWH 4Z7OE 1EERB 1RQ5A 5ID1A 1NEZA 3OF6A 2GTZA 4FQCH 1P84K 3EO1B 3I9GH 4NKMB 2XTJE 3G5VA 4P59L 1V7MH 1YEIL 3AS0A 1PFCA 1XGRA 1REIA 2EKSA 5CD3B 2YOCA 3TEUA 4OZIE 1IFHL 1CICD 3HG1B 1PEZA 2YPLD 5FCUL 3LEVH 3DUUA 2KDGA 2CMRH 2PW2B 1GHFL 4P23B 1X44A 1NJ9B 4KGLA 2JJUA 1HOCB 4U1SB 3QXUA 2E6JA 1T5WA 4HXBL 4BSVB 2GFBA 2DLHA 3HNSH 4LVOB 1SBSL 1AGCA 1VFAA 4S1RH 2Y07L 4KGJA 1YMMB 4N0YH 2VRAA 3TBVA 1BBDL 1A5FL 2YN5A 1GGUA 3UPRA 3U7AA 4IMLB 1BZ7A 12E8L 3VFVB 2FWOA 2IBZX 5E2TL 3WFCH 3HG1D 5GS0C 4XXDA 4FQLL 4JJ5B 1DQJB 3MRJB 1MRDH 4N0FB 1S7TB 3CFKA 4XNQB 1YQVH 1K3ZA 1S9XB 2Y36L 3DURB 5GZNC 3O6KL 4JY4A 3C8DA 4L3EB 2V7NB 1T0NB 2AQ3A 1U93A 3PIQB 1A7PL 2ZNWA 1FGNH 2EDLA 5IMMB 1G7HB 2IG2L 4QTHB 1J1OL 1SYVA 1VHPA 1LMKA 3I02B 1I9JL 3HNTH 4CADA 2VC2L 2APBA 1YMME 5DVNA 1NGQH 2D0HA 1G7PA 5FCSH 2NY7L 5KVEH 4HUXB 5D8JH 1K8DB 1N64L 2E7HA 3MLYL 4KI5F 5GZOD 4D9RE 1HQRA 3F62A 3MLZL 4L3ED 1QRNA 4X7FC 1S7WB 1DLHA 4YHZL 1YECL 2Y7QB 2YZ8A 3E1F1 4JFOA 3DYOA 3D0VA 2G9HB 4JRYB 4Y5YA 2R4RH 3SGEI 1PG7L 4W4OA 4L3EE 4CN6A 3MXVH 5D1XA 4NHUB 4HWZB 4FG6D 4HK3N 3O9WC 2HJLA 4LVNB 3GUTA 2LAAA 2VDMH 2X2YA 3CUPB 4PJCF 2P5EA 1CLZH 4OCYH 5JTWA 5ALBH 3Q6FA 5EDXA 1AXTH 4S2SA 3TNNB 2VQ1A 5D7SH 1MCDA 3KLAB 5DT1H 2R0WL 4JRYD 4LEXL 1WWWX 5I16B 4U4BA 1FLTX 2FYYA 3IAPA 3MR9B 2OSLA 4P9HC 4ZFOL 2DM3A 4P57B 4YHML 3L6FB 1M05A 1EAPA 3FJTA 5I1DB 1P1ZB 3VXME 5FUOL 3OTTA 5IEKA 3IXTB 2V5MA 2A73B 1RK1A 2AERT 3QO1B 2EDHA 3PDOA 4UUJA 3EYSL 3LHPL 5HHQB 5KJRL 2N4IA 3MRKB 3V5KB 5DJAA 2CLZB 1FJ1A 1JGVH 5GGSY 5DD1H 3WJJA 1G6RL 1DSFH 2HTLC 4P3DA 4OI8A 1S9WB 3EYQC 3CZJA 5JW3H 3HA0A 3VWJD 5D5MF 5DSCB 3HLAB 5HHPA 1DJSA 1ZGLA 3F7RA 3K1DA 1JNNH 1F4XL 1TJHL 3V5HB 3RRQA 4QXUH 2BOBA 4YBHA 2H8PA 1YEFH 4PGCA 1J1XL 4PP1C 4HWBL 1WEJL 5KS9A 3BGMA 4RAHA 5B38A 1JRHL 2KUTA 4LIQH 4G8EB 1YUHA 2BNRA 2VAAB 4ODXB 1CGYA 2NY2C 5EUKA 3OZ9L 5EOCH 2FB4L 3O11A 2YXMA 1BJ1J 5DRNB 1U8QB 3VXNB 4M4PA 3LRGA 5T1KD 2IBZY 2WUBL 5DXWA 4PJGF 1M7XA 4D9LH 1P84J 4IOIB 4JFFA 1IC4H 5DVOA 5M7QA 5C3TA 4OTXL 4BUGA 1B2WL 2UUDH 2X4PB 3STZB 1GOHA 2R2EB 1ZHBB 3MODH 1R24A 3JV6B 4HKJA 2B2XL 3H3PL 4I5BA 4U1NB 1BFOA 4WHTA 1U3JA 5KG9B 3HE6B 4Q2ZA 4B41A 1FIEA 1IGTB 2BSRB 4FQHA 4MJ6B 4L9DA 5DHVH 1KYOK 5C0EB 4YNYA 4QWWC 4HK0B 3SGKA 4NRYB 4D0DA 3FOLA 5FM5M 3NCJH 1A3LH 5IHZB 3NH7H 3QCVL 1R3JB 5D2LF 3SDXF 3NN8A 4P4RB 4JR9H 2A77L 3FFDA 5JDSA 4NYLA 4Z95H 2Q6WB 2YUZA 3O2WL 3QI9B 3R8QA 1C5DA 5EOTB 3WE6A 4YPJA 4I2XA 3EJYC 2WBJC 3QWOB 4TUKL 2VLME 4M6MH 4OKVB 4RMWA 1FCGA 1N2RB 4JDTL 3RWGB 3W0WA 2XWBB 4Q6IC 2Q76A 5CBAA 3U0WH 4KMLB 5FKPB 1JNHA 5J7CC 5F8RC 3BKMH 3CLFL 1LO3L 3LS5L 5T3XL 1G9ML 3RHWF 5EB9A 1Z9MA 3M17B 2KZWA 2R2CA 5KVDH 2CDFA</