1A6VL

B1-8 fv fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B1-8 FV (LIGHT CHAIN)
publication title X-Ray Structures of Fv Fragment and its (4-Hydroxy-3-Nitrophenyl)Acetate Complex of Murine B1-8 Antibody
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 110
sequence length 110
chains with identical sequence M, N
ec nomenclature
pdb deposition date 1998-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6vL00
3MV01 4WIQA 1T4KA 1AHWA 4KUCD 3S6CA 4JFDE 4XCFH 5DEGB 2I9LA 3CJJA 3MOBL 1SYVA 1UQSB 4GAJL 4JHAL 3SN6N 1BF8A 3BAEL 4FQ2H 5CEZL 5T5FH 4HS8H 2CMRH 5K59E 3RWGA 3Q1SH 1JPTL 3OKMB 4LEOB 1MUJB 2P48B 5IEKB 2I60H 1F90L 3ULUF 5JOFB 1NLDH 4NO0B 1FSKC 2C1PA 4MA8H 3QO1A 3VG0H 3NABL 1INEL 2YKLH 1VB9A 4PLOB 1NEUA 4O51A 3V4VL 5J9PB 2BDNH 4WEMB 2PO6D 4WNQA 1UM4L 2VYRE 5F1IB 4I0PA 2YRLA 1IM3B 4BKLA 3KPOB 4EDWL 4Z7VA 1MVFA 4KRNA 3NCCB 4S1SH 4D94A 1LD9B 2VLLA 5AWNL 5DYOA 3DO7A 4BSVB 4JPKL 2J6EA 2DLTA 2WAHA 4CNIA 4GRLA 4NZUH 1CBVL 5F96L 3RX8A 3RWHA 5CEZD 1FNEA 5TDPB 6FABL 1QP1A 3D3VD 5IJKA 4LLUA 2IF7A 1YEIH 3U4EA 1DSFH 1BEYH 1ONQB 5CIPB 1DQDH 5C0CD 1WBZB 2P5EE 2DQUH 1P2CA 5CLTA 1RFDL 3QIUA 5SWSD 2YA0A 3OHXA 5EOTA 1EK3A 2B5IB 3PXHA 2AJZB 1CVRA 2GJJA 3BWUC 5EC2B 1OL0A 4WDIA 5KS9A 1EO8H 4G6AC 2VDPH 5C2BH 1I8LA 5F1KC 1S7XA 2FJFA 3MBEA 1N0XH 2PN5A 3IXTA 1AH1A 5IG7A 2R4SH 5MENE 3UEZA 4F7CA 1JYNA 2R2CA 4P5TC 3LKPB 5T1MB 4JE4B 4NQEE 4X98B 5F9JB 1TDQA 4XVUC 3GSQB 1NCTA 4APQC 3AREB 2N4IA 3CVHH 5T3XE 3H3KA 4V2CB 4KQ3L 1HIMH 3CX2A 4JM2C 5LCVL 3EYOA 1DEEB 3QIWA 4F7PB 4MB3A 5EO1B 1A47A 1TITA 1AD9A 1P6AB 1P7QB 1RQ5A 4FFVD 4WHTA 5JIPA 1JV5B 3S3SA 2V2TB 2ARJB 2M8XA 1K3ZA 1YMMB 2VL4A 1BFSA 2C1OB 4QHLA 4L3CA 3MFFA 4BZYA 1IRAY 1F6AB 5E5MB 3AXLA 4U6VH 4ZOEA 5ICXA 3MLVH 1V3LA 3S8WA 4OKVA 3QUXB 5ABDE 1E28B 2Y5TA 4OF7A 3TJHC 5B3JF 3UZEA 1F11A 5DJ2B 5FGRA 2Q3ZA 3LV3B 1Q94A 1DCLA 4HUVA 4OM1L 5E5UB 4NO5B 4WHYH 3VRLF 1T1WA 4NQEB 3VE0B 1VADA 4U0RC 3ZDYE 3UTTB 3CDGA 5BO1L 3MLRH 5LGJB 1QSZA 4RZCB 5EUOE 1CQKA 4NPYB 1HE7A 3F62A 3FQUB 5ID1B 2E7LA 1HNGA 5I17B 1WFNA 4G8GB 1I9JH 4J4PC 1T2XA 1KJ2H 3VD5A 4OQTH 3CX5K 5JQ6L 3BWAB 4KI1A 3ARDB 4ZTPH 4PP2A 5FYJL 2JB5L 2H9GB 3CFDB 4X6CE 3EO0A 4QRPA 2R23B 3V5DB 5ALCL 4F7MA 1NGXA 1OF2B 4Z7QF 3CPLA 4RMUA 2J6EL 3ULVC 1OTTC 2DQIL 5E9DE 5CGMA 1A3RH 4QT5B 4MXVE 4Y4FA 3O6LL 2M26A 4FFYH 3CX5J 4CJ1A 3BP5A 1OSPL 1U8OB 4LPVA 3ARDC 2F9BT 2DYPB 5ESVA 5JO5A 4YXHL 1UJ3B 1CD1B 1F3RB 3MNVB 4JFDD 1XR9A 2VLJE 4G6AD 4U1SB 1MEXH 4WU5A 4N8VB 2NLJA 2Z31D 2AJSL 4MJ5B 5HGBB 2DLIA 3GMMA 2EDOA 1DTUA 1QSFD 1YN7A 4XAKE 3QWQB 4KROB 5EUOB 5LXGL 2E6QA 2JJTC 5DURB 1L7IH 3ORJA 4ORGA 5E2UH 4X80L 3WXWH 4FG6D 4P5TD 2CLZB 2IQ9L 2XXMB 4OM0L 4RAVB 1QD0A 4QXUH 4X9BA 5FDYA 2HFEB 1BWMA 3D2UA 2GJZB 3P0VH 1QEWB 2OP4L 3KJ4C 1R3IL 1TZHB 3VXME 3LN9A 4O9HH 4HIEB 4PR5A 3BPCA 4RIRB 3IAGC 2WZPD 1DLFL 3P4MB 1I9IH 4JFZL 3MTRA 5C07E 2H3NA 4ZOBA 3REVB 4EI6B 5IBUG 1AJ7L 3RUGE 5IW1A 3VXOB 1KCVL 2FGWL 4K23L 2HKHH 4M43L 1JZ4A 3UJJL 1EAPA 1L7TL 2X7LB 4BQCA 3QXDB 5EORH 2Y4SA 2BVPB 2Q76B 1AXTH 5TFSL 3SE9H 4QRTA 5GRXG 3SJVA 4GUPA 4FMFA 4OLXH 1NBQA 1H3PH 5HJ3B 2VLJB 5D1XC 1S7WA 3TESA 5LBSH 3OKYA 5INDB 4I5BB 4Z8FH 3I6GA 2DQDL 3D6GA 1KLUB 3HE6A 3TJHD 3W0WA 1BWWA 1CXKA 2P5ED 3TCLB 4CVUA 3ARXA 3QZWB 3IT8D 3SQOL 3TA3A 3QJHA 8CGTA 4RQQB 2XRAH 3KG5A 1FHGA 1J1XH 4Z77B 5GRUH 5KVFH 3WUWG 2F5BL 1A14L 2Z92B 3MREA 5EUKA 4XC1H 5IESH 4ELMB 4J4PD 4KQ4L 5LQBL 3OXSB 3EOBB 2DQCL 3INUH 1DVFC 5C07B 1U3JA 3ALPA 4LVNC 5FYLE 5MEND 4LU5L 2L7UA 3SDCB 1BX2A 4U1MB 1IGCH 3HE7C 3GUTA 4G5ZL 2JJVA 4IBLT 2UWEF 3ULVD 1OTTD 3O9WB 5IMLA 4HPOH 5T3XD 4G9FE 4PV9A 4K9EC 1JGLH 1JZ2A 5JOPE 4F7TA 2Q7YB 5HYSB 2FEEI 1QBMH 4JM4L 2AJXL 4OUOA 3RTQB 4KMTL 5F7LB 1A4JB 2VIRB 4TNVK 1YEFH 2HLAB 3C5ZB 2GK2A 4TVSa 3T2NL 1F4AA 3IJHB 2YN3A 2ZSWB 3DSFL 3EBAA 4KVCL 1FO0A 1OAKH 5A40E 1S3KL 1IBGL 1EAJA 5EA0H 3EJJX 3B8YA 4H1LB 5K9OB 5LGHL 4O5LH 3PIQB 4FQLL 4TOYH 5EBGA 5I1AB 2X70A 1I4FB 4EUPH 3DX6A 3LDBC 3PGFL 5SWQB 4Y4HC 4XNYH 1X3DA 3MRCA 4G42B 4K55A 2YMXL 1M7IA 3QP3A 3KPMA 3KPNA 4JCMA 5FM4A 2WV3A 3FRPA 1KB5H 3E3QE 1JF1A 3CFCH 1HHIA 2ICES 3WFBH 4QCIA 2FB4H 4HH9B 3F5WB 1CU4L 1ADQH 1IT9L 2A6KA 4OCXH 3O6FC 3CH1B 4OZIF 2BSRB 3GK8H 4CADA 1I3RB 2E7CA 1KTLA 1J11A 2RHEA 2Y36L 4J12A 2VLKA 3HMXA 3WUWA 1CE6B 1TNNA 2CKBH 2EYTB 2ZNWA 3RRQA 4BM7A 1J86A 1MHHB 2FJHA 3PL6B 3DURB 4MMZC 5E9DD 4KTDH 5D1XD 1JRHH 4LCWA 4XHJD 1K2DB 1Q9KA 1MAML 4TUKL 1CL7L 3NCEB 4GKNA 1EMTL 2VC2L 3IAPA 3MOQA 5EIIA 4YDVB 1FAIL 1MREH 4L3EE 2OL3H 3KPQA 4ZNEA 3L3IA 3U9PH 1E4XI 2DQGL 1HH9B 4AY0A 3PL6C 2YPVL 2XZQH 1I7TB 3OMZA 4JEGB 3STZA 4DKEL 4JHBA 3RA7H 4CMMB 3S37X 4YIQB 3T0BA 3WFDH 2XA3A 1QLRA 2ARWA 1FVCB 3OZ9H 1JHTA 5KOVC 1KBGL 2VH5L 3P11L 2EYRB 1DVFD 2L7JA 3CFEB 1MJ7H 4YUEL 3WUZA 4Q9RH 1F00I 4GJTB 4O2EB 1DUZA 2MOVA 1UVQB 1NMBH 3BEWB 3E0GA 4PJAB 4WFGE 1TZGH 3KXFD 5FXCH 3VRJB 4RMTA 1JNLH 1FGNL 4EOWL 3E3QC 1LDPL 3VXMD 4ZO7A 4HUXB 1Q72L 1UG9A 1U42A 4NKDA 4GFTB 3CSPA 4GW5A 4XNZB 4JN2B 4I3GA 1V3JA 4IRZL 5KN5A 2HP4A 2Z4QA 2OM5A 4X7FC 2NXZB 4NNXB 4RBPH 4JFPA 2AV7A 4PTUA 1BLNA 5FUCE 4UV4H 1KTDA 4JREB 5FCSH 1FO0L 3WJJA 3U48A 1S7TA 3UX9B 3Q6GH 4Y4HD 1EUTA 1ZT1B 1KCLA 3MO1A 1H5BA 2VQ1B 2YPLB 5D8JH 1X5JA 3KPPB 3ZYOA 4G6JL 1CYGA 4PJEB 1T1YB 5TE4H 4LDOB 4RWYH 3BN9C 4Q9CA 1FG2A 3ES6B 3PQYA 1VGKA 2R2EB 4WRLA 4HGWA 1JNHA 5I6XC 3OTTA 4F37F 4Y5XB 1MCFA 3VJ6B 3L3KA 2G9HA 4Z5RB 3SDDC 2OS7A 1LEIA 3FQWB 3GM0A 3IJYA 2HKFL 1MVUA 5CHNB 2W9EH 1FV1A 3IDGB 1YEHH 5A2KH 5EOQL 2BXZA 5IBTL 4W68A 3HMXL 2HLFC 3MV7A 4FTVB 4D9LH 5I16A 5GGVL 3GBLA 2A74A 2FX8H 3BEVA 3DIFA 3RPIB 3KLAA 1LE5A 2QADD 1NBVH 3HAEG 1HI6A 5C9JB 2ADGB 2IBZY 4LHQB 4IRJA 4ZFZB 2DLFL 3OR7A 3MRDB 2J3SA 5FUCC 3QJFB 1UZ6E 4GXVH 5GJTH 5HGDB 2ITDB 4PFEA 5TPWL 4Q9QL 4NKMB 1T0NB 3BH9A 2F53E 2KL6A 3PDDA 4OSUH 2ENSA 1BVLB 2Q6WA 2Y25A 2OBGA 3L3OB 3MLYL 4LLVA 4I48B 5IHLB 3TJEL 3MCLH 3ZKMC 3D0VA 3HCVB 4ZDHB 4XXDB 3T1FA 1M6OB 3MRHB 3TLRA 1LEGA 4M1CC 1KFAH 3VD4A 4R96A 2DI7A 1KCUH 4U4BA 4YDJA 2GQHA 5T3ZL 3DTXA 1NDGA 3SY0A 5IROC 1BECA 4QXGL 4WWKC 3I6LE 4J3OC 3QB7C 1KT2B 1J05A 5HYIA 1LVEA 1Q38A 2G60H 1ND0B 2BJML 3NCJL 4JZJB 1EBPA 5EBMA 1MRFH 4MNQB 3HNSL 2G5BB 4YDIH 5A1AA 4JQVC 1RJLB 2G75A 3UPCA 3PWLB 5E03A 4FQPA 3VXRA 3WKMH 1AGBA 4GBXC 1NBZA 2BNUA 1FFOA 5IMMA 3GKZA 2DTML 4L3ED 4PJ7A 4M7KH 2WANA 2CUMA 2PW1A 2DMCA 3O2VL 3MUY1 3JV6A 4S1QH 4DW2H 2ZUQB 3NZHH 4HLZH 2ADFL 1K6QL 3U4AA 5JORA 4JJHA 1X5XA 4OLZL 3P0YH 5JNYB 3S34L 1WBXA 4XPBL 1I85C 3HAEA 1TJGH 3SDDD 1QLEH 4FABL 1CN4A 2HJLB 4GW4A 4CGTA 5DHVA 2VITB 3WDHA 2ESVB 3T3MF 3NMEA 1G0XA 4FXKA 5HI5C 5GS2H 3MRLB 4K8RL 2V17H 2A9ML 3O45A 4M7LT 4LOUC 1WF5A 5CP7A 2PCPA 5KTEH 1NGQH 1BBJB 4UT7H 1OB1A 2ZKHL 1PG7L 3D39D 3L9RB 3MR9B 3QAZB 4HKXA 4UTBH 4YO0B 1SYSB 4N90E 4LIQL 4LP5A 3BZ4A 1NC2D 3CLFH 4WEBH 2Z91A 4HXBL 5T1LD 3UO1H 2WUBL 5MEQB 5BS0E 5C0EB 1FL5A 1P84J 3RIFF 3W39A 3NPSC 4Z18A 1P6FA 5C92A 3ILPA 1X5AA 2C7UA 1H3TA 3BDYL 3G5XA 4MJIA 4R3SB 1EJOL 5E1AB 4BQ8A 2EC8A 5I1EH 1FGVH 3U0PB 4U1HA 4EQ3A 5I15L 5KVMC 2HWZH 5ICZA 3IFOA 1RJZA 5BV7L 1MWAB 3L5WA 1N0LA 2HTLC 4ZO8A 4BK4A 2BHYA 1F4YL 4HDIB 4WJ5B 4XAWL 3ZTNH 2C26A 4QGTA 5CP3H 5KSBB 5FKPA 2VAAA 2ZUSA 4PJXE 1AD0A 4WWKD 3K2UH 4F57L 2JCCE 4D0BA 5MEOB 1XGYH 4LAQH 2HH0H 2FGZA 3VH8A 3FTGA 1F45A 4LSPH 2EO9A 1UH3A 1CR9L 1LO0L 4PJGA 5FGBA 2EICA 4HD9A 1ZT4A 2VLRA 5D7KD 3RNQB 3OAYK 2P8LA 2X4SA 5DS8A 3ARFA 5BS0B 4K71C 4IM8A 4P2RA 1AXSB 1DBJL 1X5FA 2Y5EA 1CF8H 5FB8A 4CMHB 2VDOL 5FUZH 5IMOB 1RZIB 4Y2DB 1ZHKB 1RURL 5SX4H 4FZ8H 1IGIH 1DDHB 2CLVB 3WFHB 2WINB 5AEAA 4S1DC 3FRUB 4R26L 2MPAH 4BH7B 1XAUA 2IEPA 5EU6A 1K8DB 3X13B 5TE7L 3GNMH 3IFNH 1AQKH 5E5RB 4PJFE 5B4MC 5AYUH 2F53D 5ESQB 2JCCB 4Y2DC 2XG4A 3CGTA 4QHNB 4Z0XA 4M7LH 2XKNA 4OIIH 5D2NB 1JPFA 4NC1C 4ZFGL 5HSFA 4RFNB 1OGAA 2OJEB 3ZE2F 2PETA 3QISA 4L4VA 5EZIH 5J13C 3S36X 2W59A 1AQDB 3VFOB 3ROOB 3I50L 5HI5D 1JGVH 3G6DH 5FYLH 2Y6SC 3MPCA 4LCCB 4LOUD 5AZ2H 3T77A 2BNQD 5C08E 4DK3A 1Z9SA 5IFJB 1NANI 3RZCB 3I6LD 4M62L 3E6FB 4PJIE 3V2AR 1RHHA 3OF6A 1RZFL 4C4KO 2X4UA 4OD3L 1DN2A 1MCKA 1NSNH 2VRAA 4EDXA 1KSRA 4M00A 1BZQK 4DEPB 1M05A 1U3ZA 2X4QA 4AIOA 3MRJA 2NTFA 3T0EE 4XGZB 5CSZB 3L3DA 2CDGA 3HC0A 3SCMC 4P4KB 1RJYA 3NCYS 4JFXB 4L8BA 5C09A 1QBLL 3MNWB 1MCRA 4LHUB 4CW1A 3RGVB 5C8JB 4ISVB 4D3CH 3VWKA 1WITA 2J8OA 4CU8A 3SGEH 4PRDA 1WISA 1KN4H 1OP3H 4UTAL 4YHML 4JQIH 2A6JA 1RMFH 2R15A 1L0XA 3KPRE 5E8DH 1T1XA 4U6YB 2HJFA 5BMFH 4P23B 4WW1B 3ZDZF 1MFCL 3PHOA 3CFBB 4X6EA 2VDRH 4HKZA 1EHAA 3RGVC 2F58H 1R5WA 3FONB 4HUNB 3K46A 4K94L 5BJTB 4NM8H 1G7QA 4W4OA 1ACYL 1AGEB 2HA1A 3GIZL 4C83A 4NWTL 1CLCA 5J7CC 4M1GH 4I3SH 4KXZI 5D72L 2CRMA 2WBJC 1FJ1A 3T0EB 1BJ1H 5D2LA 3NBNA 4G9DA 1X5IA 1ORSA 4YXLL 2EEAA 1DBAH 4P23C 4NQDE 4DKFL 4N90D 5F9WB 1I1FB 5DLMH 5DEFB 4PBXA 3B2UC 1I8MA 3FQRA 2ED8A 5K9KA 4KUZH 2CXGA 3PHSA 1RIVH 3GI9L 3I02A 1MHCA 3HI6H 1CD9B 1H15A 3T0EC 1YYLL 5B4MD 1M1SA 5CJQH 3KPRB 2HT3C 1KCSH 3LCYA 2GTZA 2GIYA 2EIBA 2W60A 3LS4H 2O5XL 2NW3A 4GRWF 4RX4D 3O2WH 5LG1A 4PTTB 4DQOL 2Y6SD 1QLFB 3SKOA 1BBDL 2PKDA 1CT8A 2Z8VC 4M61B 4AH2A 3VCLB 2R4RL 3GM8A 4YHLH 3PWJB 3R0NA 5IW6A 3O41A 5J06A 1OAQL 2GITB 2FATL 3QPXH 3GJFK 2GCYA 4NQDB 5GRZA 1XCQA 5HDBF 3FOMA 2KUTA 3CZJA 3WDJA 3AU1B 3VFVA 2K9UA 5T1DL 3JV4A 4PJHA 1K8IB 4NSKA 4R2GC 3FO2B 3L3HA 5L6YH 4X7DC 2XQBL 2CRYA 2X05A 3FFCD 1RZKL 1U8QB 3HZVA 3SCMD 2DDQH 4RISL 4Q6YA 4XBPB 2CPCA 1PAMA 3WEXA 3D18B 5ECJE 2OQJB 5EU4A 3L5XL 3WE6B 1CFQA 2B0SL 1SMAA 4PRAA 2EE6A 2NY1C 1DZBA 3Q6FB 4ENED 4QHMB 1BGXL 3HUJA 3QG7H 1JP5A 5TDNA 5FA3B 1YMHB 3GEWB 1A9EA 4ZS7H 1PGRB 1IGJB 5MP6L 5D7IA 4DVRH 2UUDH 3MLWL 3QUZB 1ZE3C 3GBML 1YJDC 4EN3A 3BKYL 1J8HE 2IH3A 1UB6B 2K7PA 2SEBB 2W65A 2XPGA 2IANE 2XWTB 1EJ6A 1I1RA 4UDUB 2HT2C 4ZPVA 1UWGH 1ORQB 3WNKA 1S7RA 3A6BH 4YX2H 5JHDA 1RIHH 5GJSH 3IYLW 1G7PA 5D7JA 4XPTL 3TNMA 1JHLL 2WBJD 3BIKB 4FZEL 1W8NA 1A6WL 4LSRH 1EVUA 2P8PA 2FYYA 1Z9MA 1EA9C 5E6IA 1EGJA 3B2UD 4C4KT 5JDSB 1DQJB 1TJIL 5I1GH 4FOMA 1EZVX 3SKMB 4PJDE 3UC0L 4E41A 4ZSOE 5FOJA 2LVCA 5FM5M 2LFGA 1Z5LA 3GMNA 4Y4KB 3BVNA 3B83A 3VMNA 1X9QA 3K2MC 4ZTOH 1MLCB 4X6DB 4OGYL 1F42A 4OZHB 1FLRL 2AEPH 3EAKA 4X0KB 4LVOB 5DJDB 5GRJL 3OKLB 3OG4B 1AXIB 3BUTA 1J8HB 4YBHA 3C60C 4LEXL 2XZCH 2IANB 2B1AL 4HIIA 4LNRB 5J1TC 1OARL 1H3GA 3ARTA 3WJLA 5DRNB 1MF2L 1C7TA 1A7BA 4GKSA 4POUB 1I9EA 3IVKA 4LP4A 2YOCA 2IPTL 3ARYA 3LKRB 1BQLL 1EEUA 3EGSB 4N0CC 4RAUB 3L5HA 4PJBF 1UM6H 5F6HI 1MCJA 3WV0A 3DYPA 3MRMB 5HHOE 1N64H 3PWUB 4OAWB 5FUOL 4LLMB 4OD1H 5CUSH 3U82B 4Q58C 1MPAH 3R1GH 4L8CB 3G5VA 4R2GD 1IQWH 1IAKA 4TQEL 1TTUA 4GKZA 4ONFL 4TPRH 5I1LA 4OF5A 1CVSC 1TVHA 3OKEA 3BKCL 4S2SA 3CUPB 4UQ2A 1MCOL 1MJJA 1CLYL 2IAMC 1QR1B 3U7WL 4O4YL 1KPVB 4OLUH 1R3JB 1MNUL 4HSQA 3QYCA 3LKNB 4XBEH 3QDJE 3VGDA 1FIGH 4OCYL 2NY1D 3SDXF 4NJAL 4M02A 3KYNA 3TPKA 4IDJH 1F3JB 4NM4L 2MQ0A 3I3DA 2V7HA 2P46B 4KI5C 3IRPX 1LO4L 2QQLL 1KIPB 5JHLL 4PB9L 4OZGE 5HHME 4NNYA 3MGOB 2OMBA 4TNVF 4U7MA 2R1WA 4WI6A 1U58A 3JV5A 3H3PH 3V6FB 3OAZK 4NRYB 4OFYA 2NY5H 4X99B 5B21A 4NRZB 3FO0H 2LQRA 2LAGB 3EOAA 3HI5L 1OTUC 4XHQA 3IFLH 3SKUD 3SO5A 1U8KA 1T1ZA 1MRCL 2HT2D 3P0GB 4PBWD 4P2OB 1GZPB 4NN7B 1RZ8A 4MDIB 1RUQL 5FCUL 2QHRL 3ZKSD 4QXWA 3X3FH 3AFLA 3MLZH 4P4RA 1SM3H 3EYSH 4U6XA 4X5LA 4XCEA 5KSAA 3G6JE 5IIEA 3WS3A 1E27B 1FZMA 2ZPKL 1MLBA 5F6HJ 3OAUH 4XPGL 3EHBD 5FYJE 2RBLA 4Z7VE 1A6TA 4EZMA 2YD1A 3MC0A 4P46A 2R56L 3FB8A 3P4OB 1EGJL 3QDGA 4M7JH 5ANMA 3TN0B 4R0LC 3MJ6A 3L3GB 4P2OC 3WD5L 1I1CA 4Y8DC 3QA3A 3WIIH 4KZEH 2DLEA 2HJKB 4G43A 5JXEA 4X9IA 3LN5B 1EEZA 3MRKB 4XMLH 3HR5B 5I73B 4LPCA 1Y0LA 4UAOC 1MCSA 1T4KB 1AHWB 4U0QB 3WSQH 5HHMB 3WLBA 2O5YL 2I9LB 3GMPB 4L8SA 1SYVB 3NIFF 3OB0K 2PTVA 2AK4A 1A6UL 3TC9A 2JJUA 1ZHBB 4F9PC 1IC1A 3BD4A 4QLRA 3RWGB 3LQZB 2R2HA 2R0ZH 1KIQA 1LO3L 3C60D 3HRZA 3NA4A 1UH4A 1B90A 4XP9L 1CFNA 4F8TA 3QO1B 1OTSC 4HW6A 3SE8H 2D31A 1AHWC 4UV7H 4MHHI 3FO1B 2LTQC 4N0CD 1WAAA 3V0VA 4NFDA 3GSWA 4P9MH 5D71L 2Z31B 3DVIA 3HG1D 4R97B 4WNQB 3MLUL 4I0PB 4PUBH 5D6DC 4HWEH 2ZJSL 4JN1H 4Z7VB 4OKDA 5ETUA 2PR4H 2VLLB 2Q20A 5DYOB 3DO7B 4ODTL 5T33H 4KU1A 4FQXA 2ZG2A 4XXCA 1WEJH 4HWBA 5EO0A 4PGEA 2IAMD 4GRLB 1C16A 4HFUH 3RWHB 1XGUA 3L6FA 5EC1B 2V5MA 4LLUB 3QSKB 2DB8A 4L1HA 3LN4A 1OAYL 3OSKA 1A6VL 1PFCA 1MCIA 5CAYB 1DL7H 1ZHLB 1OAXL 4JGMA 2W0PA 1G7MA 4JFFA 4KI5D 1P2CB 4JG0H 3WXVH 1ZLWK 3QIUB 4UMGA 3OHXB 1WZ1H 1CGTA 3QHTC 5IBLC 3OKDA 3PWPA 3ULUE 2G5RA 4WDIB 1WIPA 5KS9B 5IJKC 2D7PA 3BGMB 2IQAB 5I18H 1OTUD 1FE8H 1Q0YH 1MQKH 1ODAA 4LMQI 3QEUA 5CJOL 5DA0B 2BP3A 3VFSA 1S7XB 4DZ8A 2FJFB 4PGDA 2OTWA 3MBEB 1A7PL 2XNAA 4KKAC 1NMAL 4OCWL 5IG7B 1N8ZA 4F7CB 4PJ9A 2P44B 4OLVL 5ITBL 1ERNA 4KDTA 4QOKA 2GUOA 3EYOB 1I8LC 4OI9A 1ZEAL 4X4MA 5HHOD 2NX5D 4JO3L 4NQCD 1AD9B 4WHTB 4HG4K 3MBEC 3P9LB 3V4PL 1TPXC 4QRPE 1BHGA 3NFSH 3QRGL 4QHLB 1Q0XH 4GAYA 4L3CB 3MFFB 3S35X 4CAGA 2AV1A 3AXLB 5ICXB 4LCIH 1JWSA 1GH7A 5DQJA 4OKVB 3QIWC 1RZ7L 4KMLB 1EXUA 2W0FA 3QDJD 4QRSB 1AY1H 1U8JA 3O6ML 1GIGH 4J23A 2EDYA 4M9OA 2D0FA 1F11B 1QSEA 2J1KA 2C4XA 1OTSD 5T5NF 1LO2L 4P9HH 1JGUH 3QEQD 2F19L 4HUVB 3UTSA 2EECA 1ZT7B 2UY6A 4KGLA 1OW0A 3DHJA 5DA4A 3CFKA 2UZIH 1VADB 3ULUC 3CDGB 2EZ0D 5DUPH 3F7YA 3QH3A 1JHKL 1IKFH 1CTOA 4LLWB 1RZGA 3ZHLA 4TVPL 1RUPH 1V7MH 1J8KA 2NY6C 3IU4H 2XA8L 4WUKL 1CE1L 2WSKA 5T5NG 3EO0B 4QRPB 4RFOL 3MXWL 4F7MB 1NGXB 5JXAH 3AGVA 1KUMA 1A5FL 3CPLB 4HWBL 5B38A 1GHFL 2GFBB 4PRPA 1KULA 2AAVA 4Y4FB 4MCZA 2E7LC 3AB0C 3BP5B 5L9DH 2H26B 5EWIH 2E9BA 4PGCA 3ARBA 3SJVE 5DQDH 3QG6A 5ESVB 1A1OA 5IBLD 5LAXB 4WU7B 4XPFL 5JO5B 4ZXBC 5I8OL 1I3GL 1DQLL 3CD4A 1XR9B 3L7EA 1LO5B 3I3BA 4WU5B 2CDEA 2NLJB 5EFIA 2Q8AH 3W0WE 1A7NL 2RB8A 3CSYA 5KJRH 3GMMB 1YN7B 1YJDH 2APVA 3VRLE 4KKAD 3NZ8A 3NTCL 4ORGB 4W81A 5DT1L 3DUSA 3WFZA 5D1QC 1GOFA 3D2UB 1N6QL 2I07A 3WNMA 1DFBL 4NNPL 3TO2B 4K3DL 3PUCA 4PR5B 3BPCB 5TF1L 3O2DH 2H3NB 4BQ9A 5CJXC 4BZ2L 5IW1B 3RVVD 5C0AA 5F6IB 1EAPB 1T2QH 2PYFB 4HQQH 3ARPA 4EI5C 2FEEL 4QRTB 3SJVB 5DD5L 2FX9L 3HNVL 4D0DB 4GUPB 3VGHA 5HD8C 2W0LA 1AI1H 2H8PA 1MRDH 5DD1L 1MQ8A 1RULH 2IMMA 4S0SD 5CKAA 4WI8A 3B3IA 1S7WB 4HAGA 2BY0A 3I6GB 3HE6B 4Y1AD 3GMRB 4JHWH 5J56B 3ZT7A 2AXGA 3GHBL 1MCLA 2E6PA 4EBQL 1W0YT 5C6TH 4PJ8C 2DD8L 3TA3B 2FIKA 3QJHB 3MOBH 4JHAH 2EXYC 3ULUD 3KLHD 4WVRA 3O6KL 4XNXL 3BAEH 5IHUL 4MMXC 2VTFA 5ELIA 4X4XA 3MREB 5EUKB 1JGDA 5E8PA 4YQXL 1F90H 2VKWA 4LASL 3W9DA 1IKNA 2NY6D 1J87A 5D93B 1SJHA 3NABH 1INEH 3KNBA 4OTXL 1BX2B 3QQ9C 5K93A 3V4VH 3GUTB 1UCTA 1J0YA 1WLHA 1R3KA 2MQ3A 2P45B 4NZTL 3MGTA 3VFNA 4M7ZB 3TO4C 1JMZA 1GOHA 4YGVA 4DTGL 4EDWH 3A6CL 3LH2L 5D93C 2XN9A 4F7TB 4XTRC 1VGEH 4OBRA 4M03A 2I5YL 4JPKH 2G2RA 3B2VL 1FO0B 4ZXBD 1JFQL 5F96H 6FABH 3UYRH 1ZLVH 3ZT5A 5M7QA 4LCYA 3ZKXC 1E4XL 2A6IA 2RR3A 2X70B 2VXVL 1KLFA 3DX6B 4NBYB 3B6SA 4J2XA 3N50A 4HIHA 1UCBL 2D4DA 2J2ZA 3MRCB 2PYED 5D1QD 2BY1A 3QNZA 1M7IB 1KPRA 3KPMB 3KPNB 3F7PC 4PB0L 4IIQB 4HX1A 3T4YA 3U46A 2HRLA 3QHZL 1JF1B 3EKCA 4TUOA 3DSNA 4YDLB 1HHIB 4QCIB 1L4IA 5IVXA 3X3GL 5IVOA 2A6KB 3SDYL 3MCKA 3VFPA 5HYJA 5C0IA 2UWEE 4JRXE 5HVHC 5HGAA 3UPAA 1OAUL 4CADB 5SX5H 1KTLB 4EI5D 2C4FT 2BSSA 2VLKB 3WUWB 1LP9A 1FNLA 2EO1A 5C0FA 2EDXA 4N1HB 3RWFA 2FJHB 3VWJA 3EYUH 4KQ3H 5LCVH 1U92A 3KHOA 1Q9WA 4LCWB 5FA4A 4JFEA 2NY4B 4TRPL 4BJLA 4GKNB 2VN4A 1PYWA 3VGAC 1NL0H 5EIVA 4I77H 4NYLA 3VFWA 5EIIB 3QFJD 1KIRA 4HF5H 3V9FA 3AS1A 3WS6A 4PJ8D 3KPQB 4BFIA 2EYSA 3L3IB 2Q1EA 32C2A 3GRWA 4WFFD 2EXYD 3O3AA 1S7SA 1MHEA 5CJ5A 3IU3A 1LK2A 1JZ3A 1QLRB 2XWBB 1JHTB 1PJ9A 1EEYB 3KPLA 3EDJA 1DUZB 1K4DA 1S7QB 2R0WL 3I6KB 4OM1H 4ZD3L 2JK5A 2GY7B 4TTDC 3QQ9D 3OJVC 1IC4H 2MTPA 4ZPTA 4HIXL 3RVWC 3AS0A 1KXTB 3VG9B 4WO4D 4QXTA 4POZC 5BO1H 3TO4D 4HEME 1JN6A 4X7TA 2DBLH 1ZGLP 3RX5A 2EIDA 1AKJB 4NKDB 4UT9L 1KEGL 4GW5B 3SO3C 5KN5B 5FYJH 2JB5H 2Z4QB 2NY2C 2VDQL 4L4TA 5DJCA 3S3JA 5IUSA 4JFPB 2AV7B 4PTUB 3MV7E 1BLNB 2DQIH 2Z8RA 1KTDB 2BNRA 1S7TB 3D39B 2A0LC 3HPLA 1VHPA 1QOKA 3V4UL 5EIQA 3ZE0F 5T1LB 1A2YA 3MO1B 1H5BB 1BVZA 4HPYL 3GMOA 1R6VA 5ISZA 1NPUA 4MJ6A 4YXHH 5E2JA 2AEQH 3PP3K 5F7WC 1FG2B 1YEJH 4M93C 1Z9LA 3PQYB 2D7MA 5DMJB 2DJSA 2AJSH 4OUUB 3E1F1 5I8EA 3SDAA 3TT1L 4RA0C 2GW5A 4X80H 3SKNB 4OM0H 3IJYB 2CO7B 1MIEL 1MVUB 3LZFH 4AEHL 2DM3A 1QFOA 2OP4H 1R3IH 3JZ7A 4QHKJ 5JW3H 3MV7B 4G7VL 5HGGS 5I16B 4P5MA 4KY1H 1MI5A 3BEVB 3DIFB 1AJ7H 1KCVH 4K23H 4Z7WB 1VFAA 3KLAB 5TE6L 3HI1A 4ACPA 1LK3H 2C3HA 4I9WE 1LE5B 5TFSH 5KBNC 1HI6B 4HUMB 4IRJB 2A38A 3RBGA 4P3DA 4Y5YC 5FGSA 3DMMA 3VXRE 3KPSD 3EOTH 3WLWC 4KDWA 3HN3A 3CK0L 4A6YA 3GRWL 1MUJA 5EH1A 2DQDH 3ULUH 3BH9B 4C58B 1F3DH 3BZFB 2B20A 2NXYC 1S5IH 3MV8A 4LLVB 4YAQB 4PJ7E 3V5KA 3RWEA 3HPJB 4TTDD 3D0VB 2VWEE 3RVWD 3T1FB 3AUVA 5GIRB 1LEGB 4FA8A 25C8H 3O3DA 2F5BH 2WK2A 5IB5A 4YDJB 1IQDA 1NDGB 3SY0B 4H8WC 5JW4Q 4JVWA 2NNAA 3HNTL 4KKLD 1WVZA 2DQCH 3I2CL 3LEVL 5BV7C 4JRXD 2NY2D 4LU5H 3G9VA 3THML 2HG5A 1CDJA 4G5ZH 4PG2A 5BRZD 4R7DA 2X89D 3FAXA 4FXGA 3IDXL 4PLJD 3BKML 4UDTA 3QEGL 2G75B 2A0LD 5F9OL 3VXRB 5GPRA 1AGBB 1NBZB 2BNUB 2HFFA 1FFOB 3MACL 4NOBA 5CD5C 4PREA 4NQXA 2Z8WC 2AJXH 5IMMB 3T2NH 4PGJA 5DSCA 2K3TA 3L95A 1FBIH 4MGXA 1U3HA 1S9KC 1ZTXH 4PJ7B 3DVGA 3A6OA 4HWZA 5EC2A 4WI3A 2PW1B 3JVGA 1IBGH 5D70H 1FDLL 3JV6B 2Y06L 4QO1A 5JORB 4O58L 1CTNA 5ALBL 1WBXB 1HKLL 3SBWA 2CLRB 4DN3L 3ZDYF 4XC3L 1ZANL 2R2BA 4NZRL 2YSSA 2YMXH 3M8OH 3N0PB 1PD6A 5EUOF 2Z93A 4GW4B 1GCFA 5DHVB 2VKXA 3C6SB 3GSQA 2EDBA 4U2ZA 4FXKB 4WHCA 1CU4H 3O45B 4UIMA 1XIWC 5CP7B 2PCPB 3OX8A 1OB1B 4HKXB 2EDJA 4P3WA 3GJFA 1A3QA 2V2TA 3C09C 3BZ4B 5C7XL 3V8CA 2Y36H 5DVKA 4PJGE 5J1AA 1P7HL 4WFHE 2DJUA 2YUVA 4LGSB 1FL5B 4P2RE 4YR6A 3W39B 1IE5A 1D9KD 1KF9B 1RSFA 3IXAB 1D7FA 1L0QA 3WLWD 4LK4A 4GS7C 3ILPB 2C7UB 1MAMH 4TUKH 1CL7H 2VQTA 4LF3A 4WW2A 2VC2H 4MJIB 5HDQH 2YD4A 3G6AA 2NXYD 1FAIH 4U1HB 4A6YL 3KS0H 4JDTL 5E2WL 3S5LA 5ICZB 3QDMD 1RJZB 2DQGH 3BX7C 3L5WB 1JPST 5I30H 4YHOH 2Y1VA 1A3LH 4NC0B 4CJ0A 1IGTA 5KZCD 1A02N 5FKPB 2QQQA 2VAAB 5ID1A 5I17A 1AD0B 3IDYC 3DYOA 4D0BB 3P11H 4YUEH 5DVMA 3VH8B 3FTGB 3CFDA 4NCC1 5AD0A 1OGAE 2R23A 1P5VA 4G6KL 2IPKB 4EOWH 1ZT4B 4NP4H 2VLRB 4DVBA 4FQHA 1PBYA 2X4SB 5DS8B 1LDPH 2EDNA 3ARFB 3QZWG 3TT3L 5MHSD 3TV3L 3MUZ1 2XTJB 1IILE 1Q72H 1MFEL 4Z0BL 2C3GA 5BW7C 1X4ZA 5FB8B 5CD5D 3WNNA 3AS3A 4IRZH 3ZZ1A 3UTOA 4L9DA 2V9RA 1IM9D 1GC1L 5CWSA 2ERJC 3CFJA 4U1SA 1QPPA 4RA3A 1RK1B 5K9JL 3FT4B 3LEXA 1FO0H 5EU6B 4E42A 4MXQC 4HULB 4OCLC 3WFCH 4AMKL 5C09E 2L0DA 1VFUA 4NO3A 4Z0XB 2A1WL 4XZUA 2GSGB 2XKNB 4R90H 5HYSG 1OGAB 5IQ7L 2HFEA 4L4VB 5H8DA 4X8JA 4OCNC 5SWZA 1G9NL 3GFUA 3NAAH 3V8OA 3MLTA 4RIRA 1XIWD 1R0AL 3HMWH 3T77B 1HXYA 4Z7UA 4H1LG 1I1AD 2RJMA 4ONGL 4XPAL 2VZUA 3QXDA 2HKFH 1N5YL 4U3CA 2JELL 4QRUA 4QHUB 4TSCL 4LLAA 3FT2A 2DMKA 2X4UB 1XGRA 1SEQL 3FQNA 5EOQH 2BMKA 4M3JA 4S1RL 5IBTH 5CJBA 1M05B 15C8L 2R0LL 2Y72A 5HJ3A 1WCBA 2X4QB 2XXCB 5GGVH 3KWWB 3MRJB 5F72S 2NTFB 5D2LE 1JPSH 3L3DB 2CDGB 3HC0B 1RJYB 4L8BB 5DK0A 3JBG7 3UCRA 3GI8L 3QZWA 4N9GA 3BPNC 2DLFH 2EC9T 4E0RA 5IW3A 2XFXA 3MV9D 4JO1L 3VWKB 3RVTC 4Z77A 4NGHL 4PRDB 4C57C 3L7FB 5TPWH 2A6JB 4ELMA 4KKCC 1HK6A 3HRPA 1PSKL 1KTRL 2R69L 3MLYH 4XNUH 2HJFB 3TJEH 3PHOB 4X6EB 4HKZB 2Q86A 3O4LE 4PJAF 4KRPD 1GGTA 4C83B 1XF4B 1GGCL 4CU7A 1N3NB 1X5ZA 3FOLB 4QXGH 3AM8C 1YQVL 2YPKA 4MX7B 3U30C 5D2LB 2BJMH 3NCJH 3QXWA 1ORSB 2APXA 3ZSTA 1NC4D 4I18A 3P3YA 3HC3H 4KVNL 4MHHG 1I8MB 5FGCB 3FQRB 1CG9B 4DUWA 1CGYA 5K9KB 1DBBL 5D1ZC 2OI9C 3BP4A 4H1LA 5D4QA 2QQKL 4MXQD 1OLLA 3I02B 1MHCB 1CDBA 4F58H 2RCSL 3H9ZA 4Y5VA 1H15B 2JTDA 5ADPH 1KJMA 4H26A 2DTMH 1YZZA 1MIML 2GTZB 2YA2A 4RWHA 2W60B 2NW3B 4OIBA 2NR6C 2X4TB 5DMKB 3RI5F 3MLSL 1W2KT 1H3VA 2ADFH 1GGIL 1K6QH 2CRIA 4PJEF 5HPMA 1QFUL 1DR9A 2BY2A 2HRPL 3MGAA 3LPFA 5E1HB 3ZDZE 4AH2B 2CIKA 4GG8A 3BZEA 3S96B 4XPBH 1LGVA 3TH4T 4MJ4A 4YBLC 3O41B 1J18A 5D7IE 3QI9A 3H42L 4FABH 2R1YB 4XVSL 2GCYB 4HXAL 4U1LA 1XCQB 1F58L 3FOMB 3VFVB 1BQHG 5JHDE 4FQCL 1NGYA 3JV4B 4PJHB 4K8RH 4NSKB 2H45A 3L3HB 2A9MH 4Y89A 3U36A 1T2JA 1K2DA 1CLOL 5D7LA 1E4JA 1AIFA 5LJYH 1T83C 1PG7H 1RU9L 4YWGL 5DQ9B 4F2MB 5I1JL 3ZT6A 3PABA 4LRNL 3WEXB 5AZEL 1EHNA 5EU4B 1VACA 1CFQB 1FVDA 1F6LL 5I1KL 4PRAB 1K85A 4CMMA 4XCNA 1C5BL 5IFAH 3HUJB 2VLME 3BDYH 3BP6A 5ESAA 1EJOH 4KKCD 1HZHL 4GRWE 5TDNB 1UKQA 1A9EB 4H8WH 4XH2A 5EZOL 1UVQA 5D7IB 4YHYB 4PJAA 5CJ8A 3IDNA 4IOFC 5BV7H 3C6LC 5KAQF 4EN3B 2IH3B 2E27L 2W65B 3A67L 2XPGB 4XAWH 1DBKL 4ZPVB 5JHDB 1S7RB 3UMTA 4Q6IA 4FS0A 4F57H 5BVJB 3TNMB 2VXSH 4LLQA 3VXUD 2P8PB 2FYYB 3UTPD 2VXQH 5E6IB 1WFTA 4HZAA 4F3FA 4AEIH 5KAQG 2VNCA 2EDEA 1V7NL 5L2KA 5ACLA 1I7RA 5EO9A 4D9RE 3CSGA 5D1ZD 4E41B 1ED3B 1HHHA 3BO8A 4JRYE 1DBJH 5D7JC 1Z5LB 1C12A 3GMNB 4XWGL 4MS8C 2VDOH 3BVNB 5T1KA 5FM5O 5C0BE 5AG9A 1HXMA 3NFPB 1L9MA 5E99H 2L4OA 1BQHA 1UZ6F 4OIAA 4BSJA 2NR6D 4R26H 3UJTL 4BZ1L 1P1ZB 3KYMA 1C08A 4Y5XA 5I74B 5ACZA 3VJ6A 1EX0A 1IC7L 4HIIB 5FDWA 4W6YB 3FCTB 4OGXL 4Z5RA 5TDOB 1D6VL 4JJ5A 1FNGB 3H9SD 3ARQA 4GKSB 4LQFL 2FO1A 3W82A 3IVKB 3T09A 3HAEH 4ZFGH 1FG9C 2FBJH 1B0WA 4MCYA 5F7YC 2AQ1A 5GGTA 3I50H 4JPWL 2AABL 3QHFL 5CEXB 5DHVH 3G5VB 1IAKB 2J88L 4FTVA 3O4LD 3V6ZA 5C3TA 3VXNA 4IEFB 4GKZB 2PXYA 3AROA 4QRRA 1TVHB 3WJLC 5E24E 3OKEB 4L1DA 4UQ2B 1T7VA 2D7TL 1RZFH 1MJJB 1FLTX 1GVIA 3QBTB 5A2JH 1QBBA 3DUUA 3U0WH 2IFFL 5C9JA 2ADGA 5ANME 3QR2A 1QFWM 1A7RL 3KYNB 5B8CA 4AIZA 1MOEA 2AXHA 2AJUL 3TF7C 4NKMA 2V7HB 3GKWH 3MA7A 4NUJA 3QXTA 3U2SA 1QBLH 3TIEA 5DVNA 4NNYB 5EU7E 2R1WB 5DJ6A 2IJ0C 1U58B 2AK4E 5CBAA 4IOFD 1UWEL 3C6LD 2BK8A 2LV4A 5FIEA 4L9LC 5HHXH 3EOAB 1MFBH 3B5HA 2AK1L 2IMNA 3MRHA 1CLZH 1T1ZB 2ID5A 1F2QA 4LSTL 5E2VL 4GG6B 2X41A 3RDTD 4UTAH 4YHMH 2CKNA 3EO9L 1S9YA 4RDQF 4MNGA 1QUNA 5KSBF 1NLBH 4TVPE 1HN1A 4V1DA 4P4RB 4U6XB 5KSAB 2FX7L 1MAJA 1QFWL 3WS3B 3H7LA 1MLBB 4K94H 3D9AH 4LSQL 2DQFA 1A6TB 4MNQA 4P46B 3FB8B 3QDGB 1XF1A 4HT1L 1D3CA 3BYTA 1QSVA 1FPTL 3QA3B 5D72H 1EEZB 1AO7A 1R5IA 5ACMA 3UDWA 5IR1A 5GS0L 4ZO6A 1F97A 4PYHA 1PLGL 2QKIA 3WLBB 4S0TD 2HT4C 2WWKO 4Y16C 4FQIL 2AK4B 5JW4M 3QDAA 2DOCA 5IVZA 4AIXA 4P46C 4MAYD 2R2HB 4TUJA 3HRZB 4JFFE 4HJGA 1CFNB 1YYLH 4BQBA 1JNJA 3JWNC 3PWPE 4XBGA 3K4DA 4HKJA 1A1NA 2D31B 3DGCR 5JIIA 1ZLUH 3B9KA 2HJLA 5EU7C 4L8SC 3V0VB 3SGDI 3GSWB 2VITA 2O5XH 3GHEL 2JCCF 2B7DT 2XZAL 1UWXK 3U1SL 43CAA 4WWID 2GJ6E 1A6PA 1NAKL 2R4RH 5ETUB 4JHZA 4UI2A 5GGTL 2F54E 3F6LA 3MR9A 4KMQA 2JIXA 4IMKA 1OAQH 4PGEB 4M6OH 5EO0B 1C16B 4QOKE 1WJ3A 1XGUB 4LVHB 1FYTE 3L6FB 3JWOC 1HYSC 4CU6A 1FRGL 4F7EA 1IAOB 3LN4B 4FN0A 4GSDL 1J0KA 4I0KA 4LSUL 2XQBH 2XWJA 4JRYD 1G7MB 4JFFB 4J6RL 4FQXC 4M5ZH 3CNKA 5F89A 3OKDB 5C0BD 3PWPB 4X7EC 2EH7L 5HHPB 3VMOA 3L5XH 3QUYC 3MRPA 2EIZA 2PW2A 5I8KL 4HDIA 4ODSL 3VFSB 2EDRA 4DZ8B 1CGUA 4PGDB 2OTWB 1CICA 4HH8A 3ME0A 1U8LA 5KG9B 2A77L 4XMPL 4PJ9B 4CL7A 1UEYA 5MP6H 3U9UB 4ALAL 1AFVH 3MLWH 4WFEE 4X6BA 2P5WE 5D5MA 4JKMA 1YNLL 3TBTA 3GBMH 5E4EB 4QOKB 2ICWJ 4LHUG 3RNQA 3VI3E 4H25A 2W91A 5J6HA 3MUHL 2Q8BL 4F15C 3HZMA 2BFVL 1PZUB 1AXSA 4XPTH 3UBXI 3QIBC 3ETBF 3EFFB 4FZEH 4WV1B 1A6WH 3RAJH 1PZ5A 3D85A 4GAYB 1ZHKA 1VCAA 3N9GH 2AV1B 4UOW1 1AC0A 2HT4D 4KHXL 3WFHA 4KC3B 3LMJL 4Y16D 1XEDA 1TJIH 4KDTC 1JWSB 3S3PA 5DQJB 1TQCC 2EKSA 1RUML 1UYWL 2CRZA 3UC0H 4KK8C 2V9TA 2W0FB 1KN2L 3S4SB 3VFGL 2ARJQ 3VFTA 4QRQA 5M95B 2BX5A 1QSEB 2A9NL 3MBXH 3JUZA 3UZQA 3UTSB 1ZA3A 4QHNA 5IB3A 4OGYH 1I8IB 5D2NA 3CFKB 1FLRH 4Y0GA 1LMKA 2JE8A 3QXUA 5GRJH 3TZVC 3F7YB 3QH3B 1AQDA 1RZGB 3RVUD 3SPVA 1FIEA 1HOCB 2PYEB 4HCRL 1NMCC 4Y19A 3AY4A 1OARH 4KHTH 4LPUA 4LCUB 5IFJA 5BXFA 4AENA 2WWMD 2IPTH 1BQLH 2DIBA 1SVCP 5B38B 4PRPB 1NFDA 5FUOH 4IRSC 5FF6B 5EZJA 4MCZB 3E8UL 1AR1C 5C0AE 4ONFH 2A2QT 4TSAL 3Q2CA 2OYPA 3MXVL 5J11C 2YZ1A 3BKCH 5D96C 3QG6B 2O93L 1WWWX 3VXSE 1MCOH 4W4NA 1CLYH 2VR5A 2A73B 3BGFC 4LHUA 1WT5A 5DI8A 1T03L 1WFOA 4O4YH 3U7WH 2B39A 2WWKT 1YDPA 3SKJL 4Q0XH 3QUYD 4MA1C 2CDEB 4MD0A 4OCYH 5EFIB 1AP2A 4J3UA 3CSYB 2XOTA 1YY8B 1CFVL 2NY3C 1DANU 2RFXB 3NZ8B 1J0HA 3ARBC 1LO4H 4YHKL 5JHLH 4PB9H 4XCFL 2QLVB 4YK4B 4P2QE 4U6YA 1NAMA 5FYKD 4FQ2L 2I07B 3Q1SL 4DGVL 4XNQA 2MQCA 1ES0B 1QFPA 2XKSA 1AGEA 4FFZH 1CD8A 3VG0L 2YS4A 3EUUA 2GJ6D 2YKLL 3VDAA 1RUQH 3FN3A 5FCUH 2ZZUT 2QHRH 2VXUH 3EDEA 3QIBD 4M8QA 1XGQA 1DUYB 1YYMH 2VXTH 2F54D 1HWHB 2EDFA 1F4XL 2BDNL 2IC2A 2H8PB 2ZPKH 3U7YL 2V7NA 4XPGH 4PRBA 5DO2D 1ZV5A 1FYTD 3OR6A 3ESVF 2R56H 1KENH 2CSPA 4KK8D 3B3IB 3WD5H 1KELH 1UJTA 1JWUA 3BQUC 5C0GA 5CLWA 3TVMA 5C86A 3PDGA 2AXGB 4NZUL 4CVXB 1U0QA 1U93A 4OCSL 1XGPA 3SE4C 2H1PL 2BCKA 1CFTA 5IK3B 1YEIL 2FIKB 3IGAA 4UIKL 5J1SC 3VD3A 1DSFL 4GRWH 4YDKH 2JJSC 3TZVD 4YJZL 5ADOL 1SMOA 4NBXB 1FL6A 5CZVH 1BD2A 1JYVA 2ZUUA 4X4XB 4X6DF 2DWEB 3OBAA 1JGDB 2DQUL 4OZHF 5C0DA 5E8PB 3WHXA 2R8SL 2X9YA 4XP9H 3W9DB 3S98A 2ADJA 1KGCD 3O8XC 1T04A 2HVKA 3KNBB 5FHBH 2GITA 4JB9H 2OR7A 2VDPL 1Q1JL 5IVXE 4WFED 1YY9D 2P5WD 1QVOA 3MGTB 3VFNB 4C56A 4IRSD 1N0XL 3MRQB 4YGVB 5HYJE 1K8IA 2GT9A 4GAFB 1AR1D 2XN9B 2IPUK 5JR1H 2EE3A 3RHWK 1G7HA 3ISWA 1U8QA 3SOBL 1D5IH 2G2RB 2NYYC 4XBPA 1HIML 3IKCA 3UZVB 4RGNE 2FHCA 3D18A 5KVDL 1FL3A 2NY0B 5IQ9B 4F80A 2R39A 4LCYB 2IADB 4JFEE 2A6IB 2PF6A 1A6VH 3B6SB 1OAXH 2NY3D 4MSWA 3LS5L 4X4ZA 4F33B 3L5JA 1CD0A 3QNZB 4IJ3C 2FBOJ 3N1QC 1KPRB 4QTHA 3MLVL 2YK1L 1VEOA 2ZUVA 4HX1B 3LAFA 3U46B 4GMTL 4TUOB 1BFVL 2NW2A 1UB6A 1M7XA 2SEBA 5IVXB 5CJOH 1NAML 2F8XC 3DV4A 4P57A 3MCKB 3VFPB 1A7PH 3DO3A 4OB5L 5C0IB 4XNMA 4OCWH 4ODHL 1JWMA 3T4AB 5HGAB 3J7HA 5E00A 2JKXA 5JUEH 2YC1A 1HHJA 2BSSB 4MAUL 1LP9B 2PO6A 3ZHDA 5C0FB 3PP4H 3RWFB 3VWJB 5CEYA 1DQJA 1NUDA 5HVFB 2APBA 4RGNB 1EPFA 3SKMA 2DN7A 1KJ2L 1Q9WB 4OQTL 4Z7OF 3BPOB 4JO3H 1UZ8B 4JY4A 5FA4B 3NIDF 3BQUD 3OKOA 4ZTPL 1PYWB 3RGHA 3ZTJG 3VFWB 2B4CL 1EO5A 1KIRB 3GSOA 3D3VA 3VXSD 1MLCA 1I9RH 2EYSB 4OZHA 5HTSA 5FYKU 2BNRE 1U8MA 4PRID 3O3AB 4DAGH 1MHEB 1RZ7H 4ZAKC 5C0CA 4HS6A 3BDXA 4OD2A 3IU3B 3O6MH 1II4E 4KZDH 1HILA 2YD6A 5SWSA 4ZOAA 4HBQA 1LO2H 3O8XD 3QDHA 5J4MA 3AC0A 3KPLB 2JK5B 4K7PX 4P2QD 2VDKH 1G9ML 3EGSA 1B6DA 5DRZA 1FVEA 1JN6B 1F4WH 4TVPH 5A3IC 2D7NA 4G3YH 3JWOH 5AG8A 3ARGD 4JGUA 4AJ0A 2XA8H 3DARA 1CE1H 4QXUL 3BH8A 4RFOH 4Z7VF 4L4TB 3P0VL 3WN5A 1T6WA 4PD4K 5DJCB 1Z2KA 4YFDB 2C3WA 4M3KB 2DAVA 3B9VA 3OGOE 4M6ML 3QXAA 4O9HL 3GJEA 1A5FH 4OZIB 3FQXA 5DC9B 4HWBH 1GHFH 1WV7T 1Z6JT 4PYGA 2BNRB 2IH1A 1MI5E 4WTZA 2HKHL 4XB7A 2VOTA 3AS2A 1AXTL 4OCRH 1A2YB 3DOSA 4PRHD 1RZJL 4XCCH 3ZYIA 2KZWA 4ETQA 3GMOB 5ISZB 4XPFH 4MJ6B 1I3GH 1DQLH 3BRGC 1D9KB 1H3PL 2CJUH 4NRYA 3T2PA 3AMKA 4X99A 3VFUA 5I2IB 1OD9A 2MNUA 2ZUWA 5DK3A 5CD3A 1A7NH 4JZOA 5JW4R 5I8EB 3VGGA 5KS9F 3ABZA 2EDQA 3WO4C 1S78D 3MV8E 1RHFA 3NTCH 4ONHA 3ZL4L 2XRAL 4GAGH 5I71C 1J1XL 5KVFL 1CDYA 1G0DA 4NNPH 4K3DH 4D0CA 2IG2L 4NWUL 4NIKB 3SDAC 4BELD 1WSST 3L3GA 3BPLC 3E2HC 4BZ2H 2I24N 4JY5L 4U6HA 3MRKA 1VFAB 3HI1B 3KGRA 1I7UA 5DD5H 3HNVH 2DKUA 1PW3A 4YHNA 2AXFA 4HPOL 1KPUB 3GMPA 4P3DB 5DD1H 3ZE0E 4U1GB 3DMMB 1ZHBA 2YZ8A 1CK0L 1LNUA 4ZAKD 3LQZA 4HUUA 4A6YB 1DLHB 1MFDH 3MRBA 3RJQB 3ZHKA 1G9EA 1YEFL 4POYA 1D5BB 2YD9A 4ZUWB 1HDMA 2ATKA 3M17A 1OAKL 2HTKD 3MV8B 4EBQH 3V5KB 3RWEB 1JI1A 2HMID 2DD8H 4JFDA 2AI0H 3FO1A 5EA0L 5A16A 4XCYA 5IVNA 3PE9A 4TOYL 3RIAK 1ZMYA 2Z31A 5IHUH 3O3DB 1QSFA 5IB5B 4PJ5D 1IQDB 4YQXH 4LASH 4PJCA 1H8NA 2NNAB 1IFHL 4P5TA 5CSBA 1FFRA 3T2QA 3T2OA 4WY7H 1HEZB 3X12A 2M1KA 4OTXH 2HG5B 2ZWLT 4R7DB 3V52H 2FB4L 2CH8A 5F93C 1CZ8L 1FZKA 1PG7W 3NVQA 4FXGB 4NZTH 4N5EC 5EC1A 1NFKA 4UDTB 4NQVA 3CU7A 4DTGH 4OCXL 3FZUC 4B7LA 5CCKL 4AEFA 1I1AB 3GK8L 1ZHLA 2HFFB 4GO6B 4PREB 2I5YH 1YMME 3BDBA 4NQXB 3VXPA 3LQAL 1QFHA 5DSCB 3HTLX 3L95B 4X6FA 3C2AL 3B2VH 3LEYL 1EFXD 1QRND 1U3HB 1ITBB 4U49A 1JFQH 3DVGB 3JTSA 4HWZB 5E8EA 4LARH 3VDBA 3BGMA 2IQAA 1E4XH 1T7YA 3M07A 4LQ1A 2VXVH 3HLAB 2P5EA 1W0WA 3H7BB 5E70A 2R2BB 3DXAD 1T89A 4I4WA 5DXWA 3WNOA 2WUCL 1ZVYA 2YSSB 4BA8A 3KYOB 2OLDA 5H37G 2Z93B 2EEBA 2B5IC 2XZQL 3BGAA 1CGSL 3UTTE 4NZJA 5F7FA 3ZYZA 4NN5B 3WFDL 4U7SA 4J4PA 4LRIC 1LWRA 3X3GH 4G8GE 4UIMB 3SDYH 4Q9RL 1TIUA 4I0CC 1NGPL 3P9LA 3PGDA 3OX8B 2FHFA 3LY6A 3LD8B 5GRVK 5MENA 3BD3A 1T6VN 3GJFB 4XP1H 5I19H 1OAUH 1TZGL 2AQ3A 4UT6L 4PY7A 4AZ8A 3W81A 1JNLL 5J1AB 4KRPB 1OM3L 3AREC 5IEHA 2R9HC 2X5PA 1R3HB 4I1NB 4YR6B 4XRCB 3G9AB 1JZ8A 4P3CL 1X4XA 3REWA 4WCYH 4TRPH 4QRSA 1AGCA 4LF3B 4LLDA 4WW2B 1IARB 3H2WA 4KJWC 2H2PC 3G6AB 4F9LC 4ZUTB 4JDZB 3S5LB 2GI7A 1ZT7A 1BM3H 4MA7L 3MNZA 2PTTA 3CFIC 5KANI 3QUXC 2H6PB 1IGTB 4LLWA 2MCPL 4OF3A 1YPZB 4DCQA 4NO0D 5D8JL 2XV6B 1TTGA 5TE4L 4ZD3H 2R0WH 5J3HC 5AD0B 4RWYL 4PGBA 3CXDL 3O0RL 2EH8H 3UYOD 4HIXH 4DKAA 3KDMA 4HJ0C 4N5ED 4DVBB 4FQHB 4WHDA 4NBZB 4JO2H 2GFBA 3LRGA 4Z6AT 2J8UB 4MZ2A 4Z7UE 3T0VA 4UT9H 5L8KB 1KEGH 5SX5K 2BRRL 5F1OB 2H26A 1R24A 4X6CA 3ARVA 5M94B 2W9EL 2DQJL 2VDQH 1YEHL 3BIAX 3O3BA 5LAXA 4WU7A 5TF0A 2XY1A 5CWSB 3STBA 5E9DA 4D9LL 5D1XA 3CFJB 3QWRD 3RJDA 5BQ7A 2XACC 4KTEH 2UZYB 1LO5A 3LEXB 1EH9A 2BRQA 4TNWF 5DMIH 4E42B 1FFQA 4NC2B 3P77A 1MFAL 4L29A 3V4UH 1TMCB 1NBVL 4RGMB 3TFKC 4NO3B 2W9LA 4XZUB 5L88L 4HPYH 2Y7QA 1UJ3C 3HHRB 4XVUD 3UTZB 2QSCH 4X8JB 4APQD 5SWZB 1A7QL 4DK6A 4JM2D 3TO2A 4ELME 2ILLA 3NIGF 3MLTB 3HS0A 5DJXA 3FN0L 1DVFA 3TT1H 3EZ8A 4N8PA 4KROC 1HXYB 4Z7UB 4YGAB 3MCLL 5ITFA 2PYFA 3KXFA 1F8TH 7FABL 2VERN 1MIEH 12E8L 1ZWIA 4QRUB 1T0PB 4AEHH 4D0DA 2P1YA 3FT2B 3F7RA 1L0YA 3EDFA 5IV2A 1XGRB 3ARED 1F2XK 3FQNB 3VXMA 2BMKB 1OWRM 1TCRA 5IGXH 3ULVL 4G7VH 1WCBB 2YD7A 1G6RH 3IRZA 4GLRI 1P7QD 3FRPG 5T3XL 3VXTA 3VXUB 3RUGA 3GMRA 4OLWH 1G0YR 3BW9B 4KJWD 2H2PD 3QO0B 3Q5YA 1YMMD 1U8NA 5DK0B 4O00A 1MRFL 2FSEA 4N9GB 3FKUS 4YDIL 5DMGC 4E0RB 3QNYA 2XFXB 2FJGA 4LSSH 2D0HA 2DICA 3QUXD 4HAFA 2OK0L 3LKSA 3GRWH 1DP0A 4ODWB 3DRTA 4G6ML 4N8CL 3MYZA 5J3HD 1UXWA 3BISA 4M7KL 3VRIA 3UJIL 4CDHA 2CDFA 2Q86B 4NQED 1NGZB 3UTTD 1YEDA 5GZOC 3Q3GA 1TJGL 4N0FA 4HZLA 4G8GD 1HWGB 3H9SB 2YPKB 1XF5A 3HNTH 2DS4A 3TYFB 3DJ9A 1BZ9A 4HMCA 3ARDD 5F70A 1B4JL 1FZOA 5CMAA 3G04A 5F3HB 3SDCC 4I18B 3THMH 2XY2A 3LVEA 2VZVA 3MROA 2V17L 3IDXH 3O9WC 4JVUA 1N4XL 3BKMH 3DGGB 1TXKA 3BP4B 3OAYH 4N0YL 5D7LE 3QEGH 5F9OH 4PIRF 2QQNH 2P24A 4WEBL 3MACH 4Y5VB 4IMLB 2KBGA 1KJMB 2DYPD 2UVEA 3TFKD 3RTQC 3UO1L 3CVIH 3C5ZC 4H26B 1KTKE 5FECB 4I18C 4OFVA 3GSNA 4IIQA 1CS6A 4NHCH 1FDLH 4XMKL 3C5JA 2Y06H 3EYVA 1XMWA 3OV6A 5HPMB 3D48R 2FLBT 2IALB 5IKCA 5I1EL 5ALBH 2YWYA 2CIKB 4GG8B 1HKLH 4KROD 3BZEB 3ALWA 5I1HL 4Y5VC 5TQ2L 4DN3H 3TH3T 1QTYT 3MX0A 3BYYA 4NZRH 4O2FA 2P49B 4PJAE 3QI9B 4NHUA 5GS2D 4HIJA 4NKIH 4RFEA 4U1LB 1D5ZA 4WI5A 1D6EA 3PWVA 2VDMH 1NKOA 2DIJA 4GRMA 1NGYB 4HUKB 5BZDA 1XGYL 3U36B 3O11A 4K9EL 5D7LB 1AIFB 1TJHL 4YFLI 4EXPX 2FH6A 1X6NA 3PABB 5E2TL 5EBLA 1ZS8A 3B43A 2DWDA 1MHPH 1VACB 5DMGD 1OPGL 1TETL 5DR5L 3RQ3A 4PRNA 1FVDB 2VLJD 4XCNB 1NCWL 3BP6B 5ESAB 5EN2A 4NRXB 2J5LB 2HAZA 4XAKD 2XWBA 2YPLE 4Y7MA 3BSZH 4FZ8L 4L3EA 1EEYA 1IGIL 3UBXG 2CUHA 4PJEE 4JDTH 3TPUB 1S7QA 2BHUA 3I6KA 4XH2B 4LMQE 4UZGA 3OQ3B 3HE7D 3IDNB 2ICWA 4ODXB 3RL2A 2V9QA 5GGQL 2ZUXA 3SGKC 5GZOD 3GGWA 2V2WA 3O4OB 1JE6A 3SDDA 4Q6IB 4TSBH 1AKJA 4K7PH 3Q0HA 3IJSA 1GGBL 1INQA 1FAKT 4D9QE 5DK2A 3P9MB 4LLQB 3GDBA 4OIIL 5C07D 1FYHB 5F7MC 1IGFL 4X4YA 4WUUB 1NANH 1NUGA 3SDCD 2WMPA 4F3FB 2FR4B 3QT2A 3DX8A 2Y9RT 5L2KB 1ZHNA 3G6DL 4G6KH 1I7RB 3LRSA 4R4FL 3O9WD 4FTVE 5EO9B 2VE6A 5AZ2L 3TT3H 4QRRE 4MD5B 3NGBB 1HHHB 4HEPG 3BO8B 3D39A 3I3EA 4Q6IC 1C12B 1X7QA 4XNZC 1NC2A 4PS4H 3GSVA 4ODUA 5T1KB 1P4LA 1HXMB 5T1LA 4KGJA 3RTQD 4DWHA 3C5ZD 5CIPH 2NXZC 1BQHB 2OJZL 2VO5A 1HINL 2AP2A 1GC1H 2X1XR 2LU7A 2DMBA 3BHBA 5K9JH 1DQML 4JREC 3GSNL 3KYMB 1JTTA 1A22B 1C08B 4PJ7F 5ACZB 4OUUA 5FDWB 4AMKH 4ODVL 3O6FD 4JJ5B 4XVJL 4DFHA 4HGMA 3SKNA 4OV5A 4R4NC 2HFTA 4NO2B 5FYLD 2AW2A 4ERSL 4MCYB 4XPHH 1TQBB 4KK5C 3IETA 1RMFL 1G9NH 3T8XA 4WWKA 4Y5XC 3V6ZB 3VXNB 3UBXA 2PXYB 4G9FD 4LPXA 3U7AA 3MJ9A 4QRRB 2FEDC 1G7LA 4BFBD 5JOPD 1JNNH 4V1DE 4Z7WA 1NJ9A 4ONGH 4KXZH 4XPAH 2F58L 2EE2A 3TBWB 3DUUB 1KJ3L 2JELH 1NCBL 4NM8L 4TSCH 3GJFH 4MNQE 1SEQH 4JQVA 1P9MA 3PL6D 3BP7A 5D7SL 3DV6A 4S1RH 3QQ4A 5B8CB 3U4BH 3LOWA 4AIZB 1AO7E 3STLB 1DBAL 3MA7B 3BZFA 4NUJB 3U2SB 2C9AA 3TIEB 1MJUL 1TENA 4PV8B 3GI8H 4YAQA 5DJ6B 3HPJA 1J0IA 5CBAB 4AL8H 3BRFA 4ZUVB 4M9PA 1RIVL 2ZSVA 5GIRA 2GKIA 1MCEA 4NGHH 5F1SA 1VESA 1YEEH 1FFNA 2ZCLL 1S9YB 2F53A 1M4KA 3K81A 5BVPH 2IPUG 4IDLA 4MNGB 1KCSL 4KKBC 2EEDA 2YUXA 1N7MH 1JMXA 3LS4L 4V1DB 2ESVE 2XZZA 1IGMH 2EDHA 5ILTL 4G8EB 4FXLA 1QPXA 2QEJA 4WTWA 2DQFB 1J10A 1FQ9C 3BD5A 2BNQA 4YHLL 4KKNA 4MJ2A 4PJGF 5C2UB 2PUQT 2X4PA 1SHMA 1YQVH 1CIDA 1AO7B 1R5IB 5IR1B 1CXIA 2NXZD 2QKIB 4K3GA 4JZJC 2VDNH 4EXKA 5FK9A 3BN9D 4QY8A 3VH8G 5IVZB 4TUJB 3IF1A 1JTPA 2WLZA 2DDQL 4WGVB 4HJGB 1EDQA 4P59H 4D2NA 2CLRA 3DYMA 4X7SL 3QCVL 2IFGA 3SDXB 4XBGB 4YPJA 4AYFA 4Z78B 4HKJB 1A1NB 2YPLD 3B9KB 4R4ND 1G84A 1KLGA 3C6SA 5E0QA 3BE1H 4WFGD 1VFOA 3MLSH 5KSBE 4LGPB 2ZUQC 1GGIH 2J4WL 3EJZC 3BOVA 3QG7L 2HLFD 3SGJA 3TIDA 43CAB 1QFUH 2HRPH 5EG6C 3ZO0A 2NQCA 2YD3A 5DD3L 1VPOH 2FEDD 3F6IA 1OLZA 4DVRL 2JIXB 3S37L 5I9QB 2C3VA 3H42H 9CGTA 1W8OA 3MJ9L 1FP5A 4HXAH 4U05A 1E4KC 4KRLB 1S7VA 5GGUA 4F7EB 4FQCH 2B1HH 3EW3B 1UC6A 5C0RH 3IXAA 1M71B 4YHIA 1ZGLA 4CRPA 2XWJB 4RGOL 3QAZC 3T65B 4ORZC 4YWGH 4DN4L 1B2WH 4IHOA 5I1JH 4PGZA 5F89B 3PGCA 4AG4L 4NUGL 4UNTA 3ZKMD 3MJ7B 3MRPB 2EIZB 2PW2B 4M1CD 1FH5H 5KVGH 5I1KH 1BAFL 4Z95H 1C5BH 3UAJC 1CICB 1HZHH 1U8LB 2ITCB 2JB6A 3QUKA 4GW1A 4ZTOL 2NY5C 2E3VA 5D2NE 4G6FD 2AEPL 4RX4A 3M1BA 4X6BB 3B9DA 3MFGB 4ZODA 5D5MB 3V7MA 3TBTB 3OAZH 5E08H 4YPGB 1ZSDB 2E27H 2IPKA 3A67H 1RVFL 2XZCL 4H25B 4Q7DA 4EIZC 3TYGH 5J6HB 1DBKH 1YNKL 4NOFA 4JQXA 4PJXA 4Y19E 3HZMB 3G08A 4W6XB 3X11A 4GBXD 1VEMA 2X4RA 4K3JH 1PZ5B 3D85B 1NCNA 3BESR 2AXJA 1UM6L 5ERWA 3GMLA 4JPVL 1V7NH 5CUSL 5D2LF 2EKSB 1OT2A 1RK1A 3FT4A 1NCAL 3FFCA 3SCMA 3VFTB 5DJAA 4QRQB 1BIHA 4JKPL 4H1LH 4CMHC 4XP6H 3KAAA 4LNVA 1ZA3B 4XX1G 5IB3B 2GSGA 5C0NC 4N1EA 1RUAH 1FIGL 1HCFX 2DJ4A 4FQ1L 3IDJA 1ZGLM 3SPVB 2P4AB 4MVBC 1EEQA 1XZ0A 5L8LB 4Y19B 4PJFA 4OGXH 1D6VH 2DQTH 5BXFB 3RWDA 4AENB 4FMKA 3F65A 4LQFH 3L3JA 5D2NC 5IP4A 1JPGA 3IS0X 1ACZA 4J1UB 1NUNB 4RFNC 4QHUA 2ESVD 3RKDC 2YN5A 1UA6L 1MCBA 1NFDB 3LB6C 4JPWH 4N0UA 3T08A 3QHFH 5EZJB 1CDIA 5F88A 2J88H 4LCCC 4FQJL 5I75B 2WBJA 3KWWA 2BOBA 4TULH 1SM3L 4PJHF 4PJIA 3RZCC 2A83A 4KV5F 2D7TH 4HLJA 5EB9A 2DTSA 1ZVSA 2IFFH 5DI8B 4Q97A 4YHZL 3H9HA 1YDPB 2HTLD 4MD0B 2NY7H 4KZEL 1AP2B 4DEPC 4XMLL 3UAJD 4JFOA 3AMLA 1GJIA 1LE9A 2AJUH 3L7FA 2X4NA 2ADIA 3K4ZA 4P4KC 1E0OB 1NAMB 3HUJF 1ETZA 4F37K 3WCYA 4WGWB 2IBZX 1BD2E 4XNQB 2AK1H 4X9FA 1JK8B 5D7IF 3P73A 1XF4A 3P2TA 2DQHL 3DROA 1IAIM 3D69A 1N3NA 3VFMA 3FOLA 4UV7L 4M8QB 1XGQB 4MX7A 1QNZL 2N7AA 1FNSL 3T04D 3MRFA 2FX7H 4C54A 5HYQA 1KJ2B 1J5OL 4HWEL 4PUBL 1ZLSL 4C56E 3JWDL 2V7NB 4S1DD 4PRBB 1YEGH 5IB4A 4JN1L 3OR6B 1CG9A 4HK0A 3NPZB 3ARGB 5BS0D 1FORL 2PR4L 4HT1H 5JW5A 5KOMC 1FPTH 1JWUB 5C0GB 5T33L 2V2XA 4H5SB 3TVMB 1I3UA 3JTTA 4LDLB 1U93B 1XGPB 4Y2DD 4HFUL 5HHQA 4L8DA 2J12B 2R29H 2BCKB 3QFDA 1NFIB 5F9WC 1CFTB 3IGAB 5C0ND 4LSDA 3CXHK 3L1OL 4FQIH 1IAIL 4IS6A 3GIVA 2X4TA 5DMKA 1FL6B 4FFWC 3V79C 1DL7L 1BD2B 2B4CC 4MVBD 5C0DB 2VUYA 4P9HC 1J12A 3WHXB 4JG0L 3WL9A 3MMEA 1QKZH 2ADJB 3P30H 3S96A 3VGEA 1T04B 1SJXA 1EVTC 4ZNCD 2HVKB 5DHYB 5TH2B 3QEHA 1Q9LA 2R1YA 1D5MA 4RNRA 1LHZA 5I18L 3CXHJ 1Q0YL 2KH2B 1MQKL 3T0XA 3RKDD 3GHEH 1QVOB 2XZAH 3MRGA 4QTIH 3LB6D 1C5CL 4C56B 3FT3B 2QJDA 5HHNA 2GT9B 3DETC 1BVKA 1NAKH 1ZXQA 3I9GH 2WBKA 4KJQC 1BFTA 5JA8B 1G7HB 3RZCD 4W6WB 3K4AA 4D8PA 5DQ9A 4F2MA 2JJWA 3IKCB 5FV1L 1FL3B 4QF1A 1FRGH 1YNTA 1PDKA 2XTLA 2ZOKB 2X42A 3VA2C 4GSDH 4OFDA 4MSWB 3QCUH 4G7YL 4GXUN 2ZOLA 4P4KD 5CEZE 1B9ZA 4J6RH 5JIKA 2CGRL 3D3VE 4QTHB 3S97C 1INDL 4X6DE 2WLYA 1U91A 4OZHE 2EH7H 1NCUA 3RGVD 1VKXA 1JIBA 2FZ3A 5DD6B 3C60A 4YC2B 2NW2B 2VISA 4ZO9A 1N26A 3DV4B 5DFTA 1UKTA 1RZJC 4P57B 3RKPA 5SWSE 2GY5A 1JGUL 1ZLUK 1TTFA 3GBNL 3H0TA 2Z0BA 4XNMB 1JWMB 4O02L 4XMPH 5BVJA 5DC4B 2WM0A 5E00B 5H35A 1W0VA 5C08D 4GG6F 2YC1B 1HHJB 4ALAH 4P23D 1MCCA 2FO4A 3D0LA 3QUZC 3HG1A 2PO6B 1IKFL 6CGTA 3DX7A 5CEYB 5JW4N 1N2RA 1M7DA 5I1IL 4U33A 1V7ML 2WIMA 4LBEA 4HC1A 4B41A 1ED3A 4JY4B 5KANG 1E6OL 2Q8BH 1BQUA 3OKOB 3S36L 1IL1B 2BFVH 3DVFA 2IAMA 3T0ED 1IJ9A 2HFGL 2JLLA 5JXAL 2EDTA 3NFPA 2HT3D 3GSOB 1JF6A 3D3VB 2Q3AA 2VJXA 3RIFK 3HZYA 3C87A 3LMJH 1U8MB 2FWOA 4PJDA 1UYWH 4FFWD 3KR3L 4ZSOA 5C0CB 1P1ZA 4HS6B 1KN2H 3DECA 4OD2B 4U7KA 4RMRA 1HILB 3QCTL 2AVGA 4X9GA 3VFGH 5SWSB 4Y4KC 35C8L 1I8KA 3FCTA 2A9NH 5TDOA 1FNGA 1A7OH 3KPRD 4EUPB 3QNXA 5DGQA 1XT5A 3FB5B 2Q8AL 1P4IH 2EDLA 4LVOC 5DRZB 1JCKA 5KJRL 1FVEB 3B5TA 1FFPA 1KXQE 1B88A 3W9EB 1WAAF 5CEXA 2ZG3A 2KKQA 1RIUL 2B8OT 4UILL 2J8HA 4IOSD 3BH8B 1JBJA 2GHWB 1NGWA 1NCDL 4Z7OE 3WN5B 3NIDE 5HXMA 2BVTA 4Y88A 3QXAB 3GJEB 4NQDD 3FQXB 5HHOA 2NX5A 4NQCA 4R0LA 4AT6A 2IH1B 5F44A 1SEBA 3JSSA 2CKBB 5F7UA 4LHJB 1UACL 1CCZA 4TSAH 1T2QL 2W9DL 3MXVH 3B9AA 3PWNA 2VAJA 3WO3B 4ETQB 1MCNA 3KLSA 1HHKA 1NKRA 1RULL 4EQ2A 3QXVA 1HQRA 3WHE1 4F9PA 3ZDXF 3SKJH 3VFUB 1O7VA 3QDJA 5CD3B 5JMOC 4BSWA 4JZOB 3ZMRA 4YXKH 4GG6A 1CFVH 1MWAH 3PXJA 3LPGA 3QEQA 2EIEA 5HGHA 5C6WH 4ONHB 5C6TL 4YHKH 4TN9A 4OZGA 4WENB 3QUZD 5FKAA 4OCMC 5LKNA 5D6DA 4DGVH 4OLYL 1QSFE 4D0CB 4PJCE 1L6XA 5HHVL 2QSVA 1BZ7B 2BERA 4NN7C 4CN1A 4JFYA 4U6HB 4HC1L 5GRVL 1A9BA 3RL1A 1I7UB 1F4XH 2F15A 3G6JA 1OSZA 4YHNB 2AXFB 4K3EH 4XB8A 3U7YH 5DUML 5GHWL 1LNUB 1TFHA 1VGEL 4HUUB 3TN0C 1UFUA 2A6DA 3MRBB 2D9CA 4Y4KD 5IJVA 1HDMB 5I73C 4ZMAT 5H94B 2ATKB 3M17B 4OCSH 4X83A 4ZYKA 2H1PH 4KPHL 4HFWA 4JFDB 5KS9E 3UYRL 1L9NA 4UIKH 1VEPA 3WIFA 5A16B 4XCYB 2CXKA 3BT2L 5ADOH 1IVLA 1QSFB 1J8HD 4QWWC 5GSRA 1MCPL 1TVBA 2R8SH 4PJCB 2IAND 4K07A 1HQ4B 4WI2A 4P5TB 1BF2A 1F13A 2ATPB 3MODH 1QFWI 1PQZA 3VI3F 3X12B 3S4SG 4DOHE 4APQB 3OJDA 1MCWW 3HB3C 4JM2B 1Q1JH 5HBBA 2Z31C 1FZKB 3KHQA 4R97C 4I0PC 1OP5K 4NQVB 5EOCJ 1IAOA 4YFEA 2VDLH 5E8NA 4FG6C 3RPKA 2OX5A 3VXPB 3SOBH 4YFLF 3ULVE 4U2YA 4X6FB 1RY7B 3EYUL 4GRLC 1N6UA 3DX9A 3JTSB 3PG2A 5HHPA 3G5YA 5E8EB 5KVDH 2EE9A 2EDWA 3PJSA 5EBWA 4GMSH 4Y1AA 1Y18A 2DM7A 1NL0L 1WBYB 4I77L 3C9NA 2AEIT 1H3WM 2P5EB 1W0WB 2RIKA 1J88A 1OQXA 5B38G 1RUKH 4BH8B 3LS5H 4HF5L 5KG9A 4I4WB 3QIUC 2FECI 4AK1A 3DBXA 4UOW0 1KCRL 4E9LA 4U0RB 2VZTA 2YK1H 3U9UA 1QQDA 3Q5TA 4JDVB 1UADC 4DOHB 2AGJL 1S8DB 5DJYB 3PP3H 4GMTH 3S88L 1BFVH 2J7LA 1NAMH 2ZCHH 4M5YL 5GISL 4R9HA 4P2OD 3OWEA 3PGDB 3OL2A 4OB5H 4ODHH 5MENB 1T89C 3EFFA 4WV1A 1RK0A 1IC4L 1FC2D 4PY7B 4MAUH 5INCA 2DBLL 5IEHB 2FHBA 3MRIA 2ICEA 4HG4J 3REWB 3TN0D 1QZ1A 3VA6A 4OT1H 1KC5H 1AGCB 4LLDB 3S4SA 1IGYA 1YA5A 3C5SA 1XF2B 2P42B 5IM7A 2B4CH 5H2BA 1A6AB 4ZXBA 2WBWB 4LKCB 5HHMD 1I8IA 3MNZB 3IFPB 5L2JA 2PTTB 4I3RL 4JKWA 4MYWB 4ZUSA 4QWWD 2D7QA 4K2UL 1IC5L 4EVNA 1HOCA 4JG1L 4MQ7B 2PYEA 4L4JA 5D1QA 4DCQB 4ELKB 3ECBB 3MLXL 1WGOA 4LCUA 2AEQL 3IS1X 4LSVH 4PGBB 3KJ4B 1YEJL 2Z35A 3Q48A 5E95B 5C0JA 1DJSA 3HB3D 1Q9OA 2K7QA 1G9MH 2AJ3A 3KDMB 1FZJB 1SVZA 4UINL 4I0PD 2VUOA 5I8CA 4B50A 5FF6A 5FYJD 5CJXA 3WFEL 1S9VA 5EZLA 3KXFE 4EI5A 1R24B 3CZFA 4X6CB 2VZOA 3LZFL 5F7EL 1DE4A 3B4NA 4P49A 4MQXC 2A73A 3O3BB 4GRLD 5FAAA 4M6MH 3I75B 5JW3L 2LE9A 5E9DB 5D1XB 4KY1L 3RU8L 3VD9A 5F9DC 5BQ7B 1WC7A 4O2CB 4Y4FC 2W0KA 1DEDA 2K1MA 3P77B 5E8OA 3RBSA 1YY8A 4L29B 1YN6A 3QFJA 1LK3L 2RFXA 4ETYA 2N56A 5C1MB 5C3LD 4PJ8A 4EKXA 2GSIB 1RZJH 3QIUD 3BMVA 3U0TB 2VL5A 4OGAC 3B8SA 1A4KA 3WDIA 4XT1C 2Y7QB 2R0KL 1Z3GL 5JA9A 3K80A 3EOTL 4NN6B 4XHJC 3KJ6L 3ULUL 1ES0A 3HS0B 1KXVC 2HN7A 5DJXB 1OAZL 2YWZA 1DVFB 3MBED 4LVNB 1S5IL 5IVXF 1F4HA 1NH6A 3ZL4H 5ITFB 1DUYA 3HE7B 1VA9A 3KXFB 1A64A 1YECL 1ZWIB 5IFHH 4WO4A 25C8L 3TO4A 5IV2B 3IDIA 2D2OA 4NN6C 3VXMB 1TCRB 3I85A 2DM4A 2VZ1A 2IG2H 3FL7A 5IT2L 4NWUH 1LP9F 3QIWD 5CILL 4QYOB 4IOIA 3VXTB 3RUGB 4KJPC 3CLEH 5KVEL 1LDSA 4JY5H 1WWCA 5F6IC 1EV2E 1R3LA 3C2SA 1FCCA 1U8NB 2Y07L 4CVXA 2LVEA 5AUMA 2FSEB 4DGYL 2MFNA 4NT6B 5IK3A 3QNYB 4GAJH 4QNPF 3RNKA 2FJGB 4OF6A 5CEZH 3LDBB 2AJYL 1CK0H 4Y4HB 1OWWA 1JPTH 3LKSB 2DWEA 1UB5A 3HE6C 3DRTB 1FBIL 1ZTXL 1UXWB 3NIGE 3ARUA 4LGRB 1A0QL 5K9QI 3VRIB 2LABA 5D70L 3TA3C 4PY8I 2CDFB 3BZDA 5I1DB 5F3BA 1Y6MR 1YEDB 4PLKC 5DDHA 1UM4H 3MRQA 3Q3GB 1LEKA 4U3HA 3O6FB 1G1CA 4N0FB 4HZLB 2HYMA 4C55A 1IFHH 1XF5B 3HZKA 3M8OL 1BZ9B 5AWNH 1FZOB 4CDGC 3SHSA 5CMAB 2VLKE 4QRPD 3G04B 4MQXD 4GH7B 3EFDL 2OR8A 1CBVH 1CZ8H 3MROB 4GOSA 5IQ9A 4OGZA 1WCQA 4G9FB 1WZKA 4M7ZC 4LCWE 4Y4FD 4N5UA 2IADA 5CCKH 5ID0A 5JLZA 2P24B 1QR4A 2E9WA 2X4OA 5K33A 3DUHA 4PLNC 2QADB 3LQAH 1WTLA 4F33A 1WTGT 1RFDH 1BPVA 3H3BC 5J0BA 3C2AH 3LEYH 4ZNEE 4OGAD 3VGBA 1ZVHA 3GSNB 4DUVA 3KPSA 4BQ6A 1F02I 2YBRA 3C5JB 4OFKA 1CXHA 3EYVB 4OZ4A 3S35L 5IKCB 4FHBD 5HDQL 3QQNA 3K74B 5FYJU 4RMWA 1GAFL 2QADC 3T4AA 4P2CG 3ZTJH 4O2FB 2WUCH 1U8IA 4NHUB 3QWOB 5GS3A 2APFA 5AAWA 5I30L 4HIJB 4YHOL 5T3ZE 1CGSH 4IIQC 4PY8J 1D5ZB 1A3LL 4RFEB 5HD8D 3D2UD 1PG7X 1D6EB 4M1DL 3PWVB 4YDLC 4GRMB 4H20L 4KH2A 3GO1L 3B5GA 5BZDB 1UZ8A 3O11B 1NGPH 4KJPD 2UWEA 4JRXA 1NDMA 3CDFA 2KQNA 1E4WL 3QUMA 4UT6H 5BRZA 4I2XA 3SJVD 2X89A 5EBLB 1CDUA 4NP4L 1ZS8B 2DWDB 4XWOC 1OM3H 1J0JA 2C4FU 1X5HA 4PRNB 1S7UB 3D39E 4LDEB 3O3EA 4P3CH 1HH6A 3HC4L