1A6VL

B1-8 fv fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of Fv Fragment and its (4-Hydroxy-3-Nitrophenyl)Acetate Complex of Murine B1-8 Antibody
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords B1-8 FV (LIGHT CHAIN)
total genus 21
structure length 110
sequence length 110
chains with identical sequence M, N
ec nomenclature
pdb deposition date 1998-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6vL00
3QA3B 4WY7H 4R3SB 1G7MA 1T0NB 5ACZB 2VAJA 4NOFA 2DF3A 3GO1H 5KTEL 5CJBA 5B39B 2V9RA 3OL2A 3DVGA 4QY8A 1JHKH 4RAHA 3RZCB 4V1DD 3UJTH 1K5NB 2M26A 3DRQA 4GXUN 1HQ4A 4I0KA 3ROLB 3IJHA 2W9EH 4AEFA 3RPIB 1A6VL 2IPKB 3KAAA 4OSUH 2FYYB 1HH6A 4O51A 4XCCL 5DHXB 4OLXH 2V5RA 3E0GA 4NYLA 3K8MA 4JREC 1I1AD 3G9AB 2W91A 1ITBB 4P5TC 1QLFA 3UTTB 3BP5A 4JFQB 1EIBA 2H1PL 3MA7A 1CZ8L 4U1SB 2DQTL 4YO0B 1OVZA 4NN5B 1H3VA 2XKNB 4JVUA 1FNSH 1XIWD 5BRZB 2VB5A 3P11L 5J6HA 1P1ZB 5IHZB 2CKBH 3HC3H 2H9GB 2IPUK 1D6EB 4JFPA 1YNKL 3QXAA 5FYJD 5JDSA 4F57L 3QPQC 2J5LB 3NTCL 4LSUH 4RA0C 1NJ9A 5DD3L 3MNVB 2EDLA 1FNEB 4YBLB 4ONGH 2BY3A 5EU7E 3MACH 3VFWB 3AU1B 4JY4B 1Z5LB 2X4RA 1FVCB 3OF6D 1S7UB 4HG4J 3DGGB 4WU7B 1BQHB 3GBLA 4HWZB 2VLLB 3GB7B 1FPTH 2COQA 3IKKA 3UBXB 3AMKA 4JHAL 4MNGB 4J23A 1S9KC 4XH2A 1KEMH 4GRWH 4XGZA 5MHSD 2EECA 5E9DE 5KVEH 3LQAC 3IJYB 5FCSH 2I9TA 1U6AL 4HF5H 5DK0B 4U6XA 2FSEB 1GC1L 2BOCB 3WUWB 2NYYD 3RL2A 1W72A 3QIWD 1YJDL 4J1UB 1F42A 5FYJH 4JHWL 1S9XB 4QXUH 4OZFA 1S5IH 2NZ9D 2BVUA 2NY5H 5E5MB 1PKQB 4YDVA 1ZLWH 1RJYB 3U0PB 2C3HA 4KK6C 4X6EA 5E9DD 5IF0B 2CJUL 4XCYA 5D2LE 3FO2B 2OXGA 3CSYB 3F6LA 5KVGL 1JPFB 4P2OC 1OW0A 2YRLA 4JZJC 2JJTA 1CXFA 4GRMA 3BAEL 5L2JA 5MEND 2BY0A 3DBXA 1AJ7H 3MRJB 4ZDHB 3N85H 2JJUA 2OQJB 1K2DB 3WNPA 1F8TL 4R4FH 3SOBH 2ARJB 4JRYE 4HEPG 5E4EC 3ROOA 3DV4A 2WQRA 2DQUH 3K4AA 1NFDE 3GRWA 4JKMA 3P0GB 1NCCL 4APQC 2JCCA 3B2VL 3ZL4L 2QJDA 5DHYB 5IROA 4LSPH 4DEPC 5FIEA 4LCWA 4FFZL 4XVUC 1RIUL 5DYOA 2VDKH 1WCBA 5DZLA 1A7QH 1R5WB 4G9FD 3ZKND 4MAYA 4HMEA 5JNYB 3LPGA 4RMTA 1QHPA 5I18L 1ZS8A 2Z9TA 1CS6A 1QA9B 2A74B 5F9OH 5C0JA 1DLFL 1UM5L 2GTZA 3BZDA 4CN1A 4R7DB 3BSZL 2Y06H 3V8CA 4IOIB 4QOKA 1M7IA 3VD3A 3TIEB 5DJ0A 3BP5B 4JFQA 3FHQA 2ZZUT 2AJSL 5CUSH 4AEIH 1U2HA 1F11B 1QD0A 4QRQA 1BIIA 3TBVA 2BSRB 4K94H 1G7IA 5CEZH 2LFGA 3LDBC 3S35H 5AZEH 3KPQB 4X6BB 2Z8VC 4FQXD 3TWCH 1INDH 4NBYB 1XGTB 4MVBD 2AV1A 4GRWB 1S9VA 4G6AC 1YEDB 2DKSA 1OHQA 5C70A 1R3LA 1WC7B 3FQRA 3JWOL 2B8OT 4R26L 1P69B 1INQA 3TBSB 2YD5A 3MYJB 4MDJA 3BRGC 1KBGL 4NJ9H 1YEIH 3L7EB 3MJ6A 1BQHA 3QEQD 4UINH 2CSPA 1RJLB 5L88L 2Y5TA 5ALBH 1M7XA 3NIFF 1AGFB 5ETUA 4AM0B 4N0FA 5I15H 5F6HI 1LO4L 4YGAB 4O4YH 1RQ5A 1U3HC 2R8SH 3QWRD 1CD9B 3QQ3B 5AUMB 1HEZB 3S4SB 2J88L 1AY1H 3L3GB 1U91A 1N8ZB 3SPVB 1MCLA 2DWDA 1HQRB 3C5ZB 3T0WA 2A6DB 4NO3B 4XBGA 3IYLW 3NZ8B 1SQ2N 3MLZL 1KF9B 5EU6A 3NCYS 4PJFF 4PRID 3H7BB 4F58H 5KVGH 2F53D 3SDCB 5F1KC 4TVPD 3VDAA 5C0NC 4X7EC 5BMFL 5TDNA 5IF0A 4ELMB 1E6OL 2ADIA 4JQIH 5BVPH 2HT4C 5FDWB 1FFNB 3CC5A 3BUTA 3I6GA 2VXUL 5DMKB 5DEFB 5L2JB 2XI9A 4NJAL 3V6OA 3VI4E 4ZD3L 4O58H 4AIZB 2LAAA 1CDJA 3L6FA 1FIGH 5HYSG 3TC9A 4HUVB 1H3PL 1UYWH 2H32B 2GFBA 5KW9L 1A47A 4KZDH 1IM9A 1HKLL 4NKOB 5ISZE 3KXFB 4XAWH 1ZA6B 1MJ8H 3RHWK 3O8XA 1AGBB 5HDLA 1DE4A 1V3LA 4KDTA 2VDOL 1EZVX 5T3ZD 2E7LA 1BAFH 4PJ5D 4MX7A 3N1MC 3LEXA 4OGAD 4O02L 5EC1A 4FP8H 2APBA 5DSCB 3H9ZA 3UDWC 4XMLL 3KYMA 3CXHJ 4NZTL 4ZS6C 4FQ1H 2ADGA 3P4MA 2BRQA 2XY1A 3MJGX 4LCYB 2NY5C 2DQGH 2VDPL 4BQ9A 3I75B 1CICC 2F8VA 1MOEA 1TVBB 2NY3B 4QNPF 5JHLH 5FGCE 4HLZG 3NCJH 3U36B 3GRWL 4IRJC 3PWJA 2YD4A 4QKXB 2C4XA 1KFAH 4Y4FB 4LMQI 3MLXL 3S3JA 4JKWA 5I1KH 3QT2A 4RBPK 3LQAH 5FXCH 3FN0H 4Z77A 5D7IA 4LGPB 3MOBH 4LCWD 5FM5O 3C6LA 4G6MH 4LNVA 4FQCL 2V7HA 3OMZA 3HZYA 4NN7B 1G9ML 4M1CD 2L4OA 4WI6A 5GGRB 3VFOB 1ED3B 2Q1EA 1U8HA 1Z3GL 4Q9QL 4M62H 5IMMA 5HVHB 4ZODA 5EU4B 1GGTA 3PHOB 4XP5L 2Z35A 4G43A 4OFDA 1K4CA 4I3SH 3EW3B 1D5XA 4KMQA 3ARDC 4EZMA 2FJFB 3P0YH 2NX5E 2O5YL 43C9B 1KXTB 5TFSL 4JREB 3KPSE 4JO1H 4APQD 2VR9A 2LU3A 4YGVB 4NGHH 1EFXB 4YUEH 4FFYH 5DFVD 4G9FB 2QKIB 5IBUG 3JV5A 3P77A 3SKUD 5EUOE 2B1AH 1EERB 1DJSA 1JRHL 1NUFA 3CFBA 5EIVA 5EU6B 3MRKA 5IHZA 3CFEB 3HRZB 5FKAB 4W4OC 1JPGA 5L8JB 2HG5B 3WNMA 3FONA 2A77H 1SMOA 2EE6A 5CJQL 2AQ3A 4EEEA 1WFTA 1WZMA 1LEKB 3GSRB 2WIIA 3OKEA 4JFHE 4PJXB 3GBML 4C56B 3CFKB 1IGJA 1R24B 1T1XA 3MCLH 3SE4C 3MZGB 3IAGC 3I6GB 3NZHH 3D18B 3Q1SL 1NKRA 3T08A 2DQEH 4KJYA 4HUMB 1G7HB 3BO8A 1IZKA 4LLQA 2YMXL 3BD3A 3VWKD 3EYFB 1AHWC 1RU9H 4R4ND 4PD4K 1W8OA 3P30H 4K23L 3OV6A 3O6KL 2JE8A 4YHMH 3MRNB 5C0RH 1TQCB 1WSST 3TNMB 5GZOD 1X6NA 4GW1B 1M1SA 4DVBA 4YDKL 5DJ8B 3SDXF 5LXGL 3LSOA 1RZIB 2VDQH 4PTUB 1MLCA 3MV7D 4WI9A 5EC1B 2B1AL 3FOLB 1LEIA 1P4LB 2B0SL 4QF1A 1IFHH 4ODXB 5GQBA 2X4OB 4WENB 2FRGP 3OG4B 1T04B 4MA7H 1R3HA 5J89A 4GMSH 1FNLA 4LCYA 1WEJL 5CCKL 1HOCA 3CSYA 2AJ3A 3Q6FB 2CDEA 3RA7H 3PNWA 1GH7A 1HXYA 4QWWC 5BZWA 1RSFA 2VLRE 5JZ7D 1BQHG 1TJHL 5LWYL 1CG9A 2G5BB 3RWIA 3STLA 4NPYB 5JTWA 4WVRA 1P7KB 5HVHC 3TNNB 2OR9H 3CH1B 1KN4H 4WWID 3HI5L 2FD6H 4R90L 4RISH 4Z6AT 2R0LL 2PW2B 4I0PC 2JIXB 3C5SA 4ALAL 5IKCB 4HK0B 1F00I 2ZCKL 2FL5B 3PQYA 4PG2C 1IEHA 1DN0A 5EO0B 2AABH 1IAKA 4O2FB 4QRTA 3C08L 4DEPB 2XIDA 3CJJA 4N0YL 4JM2F 5EZJA 3QO1A 1JZ5A 2HRPL 4D9RE 1AXSB 4GLRI 5D93C 5HPMB 1DANT 1DDHA 1DEDA 3RX8A 1C16A 4UU9A 3FO1A 3NAAH 1OGAE 4ZXBA 3I3BA 2HN7B 3VXUE 2I26N 5GIRA 4MA1B 5CSZB 4LIQL 3VFWA 4PJDF 5M94B 4U1IB 1J0IA 4LSUL 5HGDB 3RNKA 2GAZB 4G9FA 3MA9H 1AQKL 4ONFL 3ARUA 5F88A 3RDTA 4PJEB 1TCMA 1QSED 3EJZD 4PRHD 1FH5L 2AK1H 3PDOA 2FO1A 2DM7A 1SJHB 3IXAA 1NGYB 1S9VB 4PBXA 5MP6H 1PW3A 4G9DB 1GC1H 4RFEB 4X9FA 2VLKB 3OKDA 1E0OB 5CJXC 3L9RB 4K7FA 2DQHL 4Y4HC 4PB9L 5ILTL 5KSAD 1YJDH 4E0RB 3ULUF 4LCUA 4FQIH 1UZ8A 4NO5A 3MLSH 2EDFA 3QDMB 5L2KE 4XP9L 5IB4B 3O6KH 4YHML 1U93A 2BY1A 4HUXB 1JGEA 1I9JL 1PKQA 4YDVB 2NMSA 4RDQF 3RDTC 1D6VH 3EYFA 2WQ8A 1AGFA 5ETUB 2W0FB 4G6KL 3WO4C 4G7YH 3TA3A 5HPOA 4UTAL 3SN6N 4RFNC 4L4TB 4QT5B 1TTGA 5DQDH 3LV3B 5CZXC 1FFPB 4YK4B 5GSRB 5SX4H 1FRGH 4D0CB 2UWEA 4X7SL 2VRAA 4Q2ZA 3IDGA 4HT1L 1CGTA 4CDHA 4Y2DC 1J1OL 2AGJH 3FOLA 2BNUA 4UT7H 1OAUH 4LKXB 1T21A 3DV4B 5K9JL 4WWKA 1QSFD 2DJUA 4JDTL 2DQUL 3WLBA 2CIIA 1QQDB 3SO3B 1PG7H 4D94A 4EOWL 3HE6D 4G8FB 3G08B 2XZZA 3CDFA 4E9LA 4PJ7A 5JOFB 5E94B 5IGXL 2P5WD 1DCLA 3IETA 3K2MC 1LWRA 4EI6A 5ERWA 1UENA 2F54B 1CG9B 2J8UA 3C5ZD 3KPRD 4L4TD 5JNYA 5CMAA 5B8CB 3W11C 4NPYA 4MSWA 2AV7B 2IAMC 4JDVB 3KJ6H 1FGVL 3QUKA 1CE6B 1D5MB 4A6YL 2DDQH 1WBZA 2DIJA 3D0VB 5C8JA 5DS8A 5BXFB 5GGUB 3RQ3A 3V0WH 4QRPB 2EXYD 2CKBA 3E2HC 5F6IC 5C08D 4JG1H 2X89D 4P4RB 1OAXL 1VGEL 1ZEAH 3CFJB 1ZANH 5I16B 3RUGE 2NY6C 3AM8A 3RKDD 5AZEL 2B1HH 3EOTH 4PBVC 5KVDH 1MUJB 3D87B 4ZXBD 3VXUB 4EI5A 3QO1B 4Z7WE 1BQUA 3VXRB 4QHUB 1DDHB 4PIRF 2PR4H 1G9NC 5K9KB 1N7ML 3IB4A 1GZPB 3PHSA 1ZVHA 1XF5A 1PSKL 1I8IA 3NGBB 3VFUA 5CIPB 1TVBA 1WV7T 4J3OC 1V3MA 1VACA 4HWUA 1B0GA 3F6IA 1DR9A 5IUSA 2VYRE 4AM0A 2XYCA 2WUCH 4B7IA 5FYKU 1JTTA 4R96B 4Y4FA 4XRCB 4A2LA 3OKYA 3M07A 4EUPH 1YMMD 4KHXL 2DICA 1MAJA 4MHHI 5I66A 1G7JA 1WUNT 1AIFB 3V7MA 1IGCH 1A14L 1MREL 3PV6B 2XNAA 5HVWA 3C6LB 5BV7C 4YO0A 3VXRD 4MD4A 1OCWH 2EYTB 3F12B 3QUXA 4IJ3B 1HSBA 5CSGA 4GAFB 4X0KA 3OGOE 1REIA 5J6HB 2YD9A 5IOPB 2XTJE 25C8H 4TQEH 3MV8B 4IOSD 5GZND 2JIXD 2R1XA 3MJ9H 2APVA 5E00B 3LCYA 4MCZB 3HFMH 1MJ7L 3PHOA 3SE3C 1R5VB 1ZT7A 4Q6IC 1BBJA 1N6QH 1OF2B 4Y4FC 4EN3A 4MCYB 2AI0L 1FQ9C 1CI5A 3O6FD 1C08B 1C8PA 1Z5LA 1XGRA 3GJEA 3Q5YA 2CIKA 1IAOB 3EGSB 5FHBH 1MCPL 2CR6A 3O3DA 3CIQA 3FL7A 4I3RH 5C0EB 1LO2L 1I3RA 1MAMH 5D6CA 1AKJA 2P5EB 2VZTA 3HR5A 3JWDC 3O45B 4WUUA 4HWNA 2GUOA 4FXGB 1T1ZB 4HAGA 4BZ1H 1PAMA 1NCAH 3S37X 1KIQA 3QIWB 4X4MA 1QVOB 5EZLA 3I9GH 1T5WB 2LAGB 2Y7QA 1H3GA 3TYGL 1NGPH 3F5WA 4C56E 5JW3L 2X4NB 4LPYA 4XMPH 3KYAA 3LRSA 4GXUM 3IVKA 4KPHL 1BZ9A 1KPRA 1Z9OA 2K7PA 3ET9F 25C8L 3HZMB 1QFWH 5B3JE 4DFIA 2ADGB 1U3JA 3IFLL 3U7YL 3FQNA 2J2ZA 1UZ6E 1U8PB 4BH7B 3BEVB 4N8CL 4BH8B 5IHUH 1WITA 4KAQL 3UAJD 3D3VE 2NZ9C 5F1NB 3NN8B 4P3DA 3RX5A 4GRLB 5IW1B 4ZPTA 4JN2A 4UINL 3BQUA 3QCVH 4MZ2A 5DJXB 3X11B 2VXVL 4TSAL 1AGCA 2CO7B 1QSZA 2X09A 1NEZB 5J8OA 2AJZA 5B3JF 1FZMA 2ED9A 4HKXB 5FO9B 4N0UA 4PJCE 4PRNB 1XH3B 4LIQE 3OTTA 3NACL 4U6VH 3FN3A 4O2CA 4ODHL 4HGWA 4Y2DD 3GGWB 5EBMB 2DBLL 5LKNA 1BF2A 5JUEL 4RGMB 4BFIB 3ESUF 4FZ8L 1IGIH 4MAYB 5GGRY 1DUYB 3QUMB 4XCCH 5C2UB 1YEFL 5DJ2B 4Y8AA 1JHLL 1N5YH 1IARB 1DQTA 2GTWA 1JNHB 1AR1C 3NCMA 4XRCA 3QDJD 4HH8A 43C9A 1TZHA 4RNRB 3DARA 1ZXQA 3EJYD 5FK9B 1CGWA 4WGVB 4HBCH 4M8QB 4HDIB 1NUDA 3TIEA 5FGCB 4NWUL 1A6TB 1JN6B 5H94B 2BSRA 5L0QB 5IFAH 3TYFB 4NHCH 4MJ4A 4WDIB 2ATPB 4EUPA 4H25B 4OCYH 4QCIA 1HK6A 3B9AA 3ES6A 4J4PD 4L9LB 2NY1D 4UU9B 3BXNB 3UMTA 5L9DH 3VXSD 5IB1A 3LQMA 1RAMA 4Z7WA 2YWZA 1NGZA 4NUGL 1NEUA 3JWDL 4BELD 3JWOH 1G0DA 1ZSDB 3BFOA 1MCIA 4QRPD 1YNTB 3G6JE 3HE6A 2VDML 3AY4C 2Y5TB 1QFHA 1JPTH 3V9FA 1CD1A 1F3DH 4NFBA 5TH2A 2NY4C 1X4ZA 5D72H 4FQHA 4QTIL 1W72L 1Y6MR 4OKVA 3IKCA 5I8OH 5JMOC 1V7NH 1NCUA 4RBPH 4DW2H 4DJMA 4I1NB 3AUVA 2J8UE 3NCCB 3OJ2C 4FQLL 3T4AA 3EOAB 4XMKL 5ITFB 5T1KD 2A6DA 3PV7A 4K23H 4HJJH 5DGQA 4DTGL 4OLZL 5DRWB 4NQEE 3V5KB 1RMFH 2X10A 3QIUA 1FDLL 1PX3A 2D2OA 1ZWIA 2CH8A 2Y07L 1IGFL 4QF1B 1U42A 4OD3H 2Z31C 3VFMA 1A7OL 2HJLB 4KAQH 1EEZA 3MXWL 1U8KB 2YN3A 3K4DA 4EUPG 3QFDA 4IIQA 3ZKXB 3TA3B 1C5BL 1ZOXA 1I4FA 1U8MB 4OIBA 3VW3H 4QT5A 4P2OA 3KPLB 3VWJC 3P73A 4TULH 5C08A 1U58A 2GJJA 1F3DJ 4LF3A 4Q9RH 4YHYB 3DHJA 4KDVA 5FOBB 3O2WL 4V2BA 4ORGB 3AAZA 4F9LA 3MLTB 4GRLA 1FO0H 3TVMC 4RWYH 4MAYC 5JDJA 3W5MA 1U8LA 3GIVA 1OT2A 4ZQKA 3BPLC 3D25A 3CH1A 5DHVH 3K4ZA 4XP5H 2FATL 4W6XB 4YHPA 2IH1A 3X3GH 1T21B 4ODHH 1MLBA 3GHEH 1JV5A 5HDQH 5IVZA 5HVFB 4RX4D 5JA9A 3C60B 4ZOAA 3WIFA 2B4CH 6FABL 1FNFA 4HJJL 5CBEA 4JFFD 4Z76A 1FZKB 4LAQL 4WWKD 4HC1L 3CDCA 4HJ0C 3QR2A 1D5ZB 3S98A 4F7MA 1GSMA 3RPIA 4NZTH 2X1PA 1RZ8A 4U1KA 3IT8D 1H9VA 5E2VH 5GGUA 1M71A 2VH5L 2XWJA 4HHAB 5EIQA 5F89A 1AFVH 3DUSB 3J8F7 3SDXA 1QLFB 4WI8A 2JELH 4R4BA 1MHHA 5C7XH 1B0WA 5J13C 2PYFA 1KB5A 4NDMB 2VDRL 1FORH 4J8RA 5CLTA 1EK3A 3KDMA 1KV3A 1RPQA 3RWFA 4PREB 3IXAB 4JFPB 2FEDD 4NRXB 3UPAA 4C83A 3X3GL 5ALCH 4PJ9C 2VLKA 1CLZH 2VZ3A 1NGWA 4XVJL 1MCRA 4LCCA 3AS3A 1A7RL 3EFDH 3SDDD 2ADJA 4Y19B 4GKZB 4ONOA 2EYRA 1E28B 1EPFA 1YMHA 2GJ6A 2EIDA 4G3YL 4KRLB 4OUUA 1T4KA 3UYRL 1J8HB 1UWGL 1ACZA 1GZQB 1JZ6A 5DR5H 2VLJB 4I3SL 2R2HA 5I30L 4XC1H 1URLA 2LU7A 2JK5A 1BVZA 1TQBC 2W59A 1MFEL 3AREC 2P8LA 3MUGA 4JPKH 5E08H 2H3NA 2NXYB 4NKDB 2XNAB 3TFKC 4XZUB 4DUWA 1KLFA 1A5FL 3TVMD 3TJHD 5HD8C 4KI5D 1YC8A 1MY5A 3BH8B 4M1CC 5CGTA 3T0EB 4JLRA 3GBNH 5DJYA 3VWJD 4PLNC 2OP4L 1QQDA 5F7NC 4AY0A 5FECB 4LDEB 5IR1B 4JHAH 2OL3B 4G8FA 5TE7L 3VGFA 2DQFA 1RD6A 4PJ7B 4UZGA 4EN3B 1RUMH 2ICWJ 1F97A 3GO1L 4L3CB 5DD1L 4N9GA 1QKZH 2E9JA 1UWXH 2HT2D 3U30C 2XZQL 3P0VH 2ZPKL 3ZLQC 5C0AD 4M5ZL 2ZOKA 5F7YC 4K3GA 2HKHH 1F4YL 2HWZH 3FZUC 2UY7A 2D4DA 3QUKB 2BFVL 2PNDA 5J11C 2BHUA 3G04B 1KB5L 1MCDA 1A8JH 1K8DB 3P4NB 3PDDA 1MI5B 2ESVB 3WNKA 2VUYA 1QVOA 1AO7E 2LE9A 4P9MH 5GGTL 3U7WH 1RJZA 4K9EH 1X5XA 5C0CA 2LU4A 4HKZA 3PUCA 3MV9A 4R7NA 5CINH 1N0XL 3V4PH 4X4YA 3ULVE 1OWWA 4XHJC 1FZKA 1QFUH 5DRXB 4JR9L 1B4JH 3ZSSA 4KKCC 2V2TA 1VFOA 2AEQH 1LE5A 3NFNB 3QXTA 4OZHB 1WT5A 4X6FA 5SWZA 3JVGC 3EAKA 1PSKH 4B53A 2VABA 3SDCD 2VAAB 3HHRB 1QR1B 2IALB 2AJXL 4JPIB 3D85B 5E6IC 1YEGH 5I1KL 4WIQA 1NCCH 3FT2A 4IMLA 2D31A 1B90A 3MLSL 4PJCF 3MLPA 3GSQA 4NQDB 1HHIA 1JNLL 3SE9H 4PUBL 3T3PF 5IWLC 3QUZC 2XT1B 4NRXA 3EZJB 3OB0K 3CMOH 1KJVB 4TN9A 2QTEA 2I60L 2OTUB 1NSNL 1G9NL 5F7FA 1BD2A 1MF2L 5SX5H 5CLWA 4JFYB 3BESR 3HE7D 1AXSA 5HPMA 1F90L 2GJ6B 4UBDD 4UV4H 1HCVA 4XWGL 1C16B 3PP3H 4PJDE 1C1EH 4Z8FH 1PQZB 3WHXB 5BCAA 3IFPA 1GZQA 4JGJA 4MCYA 5BZDB 2FYYA 1HH6B 3JV4A 3JTTB 3TWCL 5GS1B 3RWHB 3LN5A 3PL6C 2OK0L 3NH7H 1NMCB 4M93C 3KPPB 3O3DB 5H94A 7FABH 2UZYB 3BYYA 3KHQA 4HH9A 3RWGB 1HHKB 4EQ3A 1SEQL 1RZ7H 5I8EB 5JXAH 5I8CB 4HUUB 3T0BA 5CP7A 1RUML 3QEGH 4MA3B 3HMXL 5JOEA 4L9LC 5E8NA 4GRLD 4ODTH 3BD4A 4YQXH 3QXAB 5JDSB 4MB3A 4FG6C 2ICES 5F3HA 4IEFB 4Y19D 5HYJB 4U1HA 1PD6A 2GJ6D 4JY5H 3SQBA 3TYGH 3C2AH 4J3UA 5GRUH 2X4NA 4OLYH 4WNQA 1KGCD 1RIUH 4N9GB 4OIIH 2ID5A 1J5OL 1FJ1B 3MNWA 2E27L 3GSXB 3BJLA 1I7RA 1T83A 3H9SE 5MEQA 4PGEB 1H3TA 5KANI 2XQBL 4HUVA 1TNNA 3U2SB 4TSCL 3BEVA 2Z8RA 4JFDA 1J1XH 3GMRB 4Y16B 3B2UC 2EDJA 5ALBL 1XCQB 2JB5L 4TNVK 4YHOL 1FFPA 3VXSB 2F5AL 5DFTA 3FB7A 3MUZ1 5KSUA 3L3HB 4PJGF 3DMMA 1FN4B 3VU2A 1F4XL 2CQVA 4HLJA 4C56D 5IHUL 2WBJC 5T3ZE 1BX2B 2D4FA 3GJFK 1B4RA 2APWA 1MWAA 1QO3A 5DRXA 3DVIA 4ODSH 4Y1AB 4YJZL 2PN5A 4N0UB 2EDWA 5F7LB 1RJYA 1RHHA 1NGQL 1FYTB 1JWUB 4ZO8A 5C86A 1LE9B 4MXWH 1RFDH 1PFCA 4MQXD 4WHDA 1X5LA 5GRUL 4QHMB 3D85A 2W07A 5GZNC 2HT2C 1F02I 3O6LL 3NCEB 4RDQG 4XAWL 3BN9D 4JE4B 2NY0B 1RVFL 5J7CC 1IM9D 2QR0B 4ZFOA 4JRXA 1I1AB 4RWHA 5SWSB 2DQCL 5T3ZL 2DIAA 3P4OB 1NGXB 2EXWD 4YFDB 1EX0A 1N4XL 4MWFA 4CW1B 2XQBH 3KYNA 2Q6WB 4LDLB 3C08H 1M7DA 5DJCA 4M6NL 4D9QD 4R9HA 3BZ4B 1T7XA 1N5YL 1IGMH 2KBGA 3H3PH 3WEXA 2DKMA 5L0QC 1JPSL 3VXMB 2XRAL 2V5MA 3HAEH 3N1QC 1UJ3A 4U1JA 3RBGA 1EAPB 1NLBH 5CWSB 4GT7A 4H26A 2H9GA 3I02B 4PV8B 3PWUB 4PRPA 1UB6A 5IMMB 3OXSB 5LG1A 4E42B 1UEMA 5AG9A 5IB1B 4LRNL 4YIQA 4HIXL 3PWVB 5DVNA 1NDGB 5C0JB 1R5IB 2BJML 4Z78B 2MHAA 2I5YL 3FB5B 5L9DL 5C9JA 4M7JL 3DIFA 2E6QA 4N68A 4OGXH 4WW1B 3TZVA 2C3XA 1Z9MA 4MXQD 5F9JA 4XH2B 1A6UL 2NY6D 2CR3A 1YQ2A 4JFFB 5CP7B 3VXMD 3IKCB 5IFJB 4NQSB 4ZAKC 2GSIB 1EEQA 4C83B 3BPNC 4P57B 3QPQD 4PGDB 3RIAK 3WFZA 5DZOA 2F58H 4ZUWB 4ETYA 3MBED 5CJXA 3N9GH 4P4KA 2RR3A 2OJZH 3BMWA 3S37L 4C56A 4JVWA 3DUUB 5E99L 4HFWA 3DVFA 4AMKH 3H0TA 1J1XL 3QCVL 3LKQA 4U2YA 1CE1H 1CXEA 2EDEA 4IRJB 1KIPA 2ZSWB 2R0KL 3N50A 3PHQB 1RUPH 3QFDB 2OSLB 2YUVA 4OF5A 3V4VL 1X7QA 3EO0B 4G80B 4R0LB 4EDWL 3IDXH 5DZNA 4PJIB 3RP1A 4KKCD 5GS2H 1HQRA 3C5ZA 2P43B 1MCOH 3PWNB 4TUKH 3PGFL 4MJ6B 5EORH 1FN4A 4I48A 4NGHL 4JDTH 5EU3B 4WHTB 1G6RH 4C54A 5SWQA 5DJYB 2APTA 3TF7C 4YHKH 3JZ7A 3GHEL 4TTGA 4CNIA 4PRHB 4RAVA 5KSBB 1NCTA 1FFOA 3OKMA 5IV2B 5TDNB 2ITCA 2BOBB 1GGIH 2EH7L 3INUL 1JFQH 1VENA 4WEMB 3FFDA 2OZ4A 1H3UA 3CU7A 1JMXA 4BFGA 1BFVH 1FFRA 4GOSA 1XF4A 5T5NF 4YDKH 4KPHH 1I1CA 1B2WH 2E9IA 3CX5J 1E6JL 3HMWL 3GSVB 1ADQL 2Z31D 1DANU 4IOIA 4QEGA 3P11H 5DJ0B 3CLFH 5F9DC 1Q72H 1KB5B 1YNKH 4NDMA 3BQUB 4X80H 2G75A 2O5XH 3RUGB 3TESA 3DX7A 3MRDA 5FCUH 3V5DA 1T1WA 1AGCB 2V7NA 5BOZG 4DGYH 2JELL 2M8XA 1KIUA 2VXVH 1NEZA 3A67L 2A77L 5IQ9A 3KPRA 3EYOB 3MLYL 3MRRB 3PWPA 4LNRA 1OTSC 4D0BB 1WC7A 3FQRB 1U3HA 3DSFH 1BVKB 4WFHD 2KZWA 5E1AA 5J11B 1S3KL 1QSEE 2B7DT 1LP9B 4JPVH 5DK2A 3NACH 1A7RH 4U6VL 1ZK9A 1WAAE 2P7TB 4HV8B 1ES0B 3TBTA 5CJ5A 1YMHB 1LQSR 2DYPB 5ICZB 2F54E 3DIFB 3U4BH 3V8OA 3ROLA 1XT5A 4HKBA 3QULB 4B0MM 5F9JB 1CDCA 2ADFL 4NFCA 2R56H 5E7FA 3RWDB 4PLJD 4QXUL 1B2WL 4UNVA 3E6FB 2A38A 4OV5B 3LKOA 1KCSL 4Z77B 4I8DA 1NBQA 1HNGA 5C09B 2DWDB 4BQ6A 1TTUA 1A9EB 3FAWA 1UB5B 4GKOA 4NRYA 2FEEI 2GSGA 2BHYA 2LTQB 2D7OA 4LIQH 2F19H 1UG9A 5SX4I 3V4VH 4HGKC 4L9LA 1CTNA 3PP4H 4LLVA 5JZ7C 3H3BC 2OTWA 1JGEB 3L5JA 4D8PA 3D9AL 3SJVE 4I3GA 1K4CB 1KPVA 4NQVA 3V6OC 3E3QC 3NPSC 5C0BD 3PGFH 5EORL 3JTTA 5GS1A 3TLRA 5TGBB 3NCBB 1BWWA 1DFBL 3WXVL 2Z8WC 2NY2B 1MJJA 3QDME 3LD8B 4OF3A 3OKOA 4B41A 2CGRL 4QYOA 3L3JB 5CFHA 3L3DB 4PJHB 1H0DA 4XT1C 3RIAF 5E8OB 2H8PA 5FYLD 1KJMB 4R97C 2YWYA 4RISL 1VPOH 4OKVB 3GMQB 3NFPA 1Q0YL 2MCPL 1NMBH 1QSVA 4XNYL 4PRHA 4LSRL 3B9VA 5KSBA 3RPKA 4CN4A 1LMKA 4OGYH 4ORZC 4XXDA 4R4NC 3A0OA 3O2DA 3H6JA 1BWMA 3IETB 1A7NH 5EBLB 3TO4A 3MACL 4RRPA 5TQ0H 4RGNB 1T2QH 5EO1A 5CEZL 3S36L 4CMHB 1GPOL 1FL6B 5HI3D 5SWZB 2P8MB 1EMTH 2CK0L 4MAUH 4Y16A 3WXWL 5IG7B 3ARGD 2OR7A 3HCVB 5EH1A 1XGQB 4JPIA 3OR6B 1I8LA 4GW1A 4FQPA 5K59E 3SDAD 1J11A 3SE3A 1U8NB 2VDLH 3REWA 3GIVB 4XNUL 1KJ2B 2YUXA 3MCG1 4X4XB 3L5IA 4EI5B 1TXKA 3T2QA 1OGAA 1Q94B 1ZE3C 3CUPB 1JZ2A 4F3FB 3FT4B 2W9EL 1K9TA 4YDLC 2NY4D 5I1EH 3TJEL 2QEJA 1N26A 3U1SL 4AEHH 5DYOB 1DBBH 3PWLB 4M48L 4XP9H 4G6FB 2VLRB 2YK1H 3O6FC 4YXHH 1VGEH 1ZEAL 3ULVH 4LRIC 1I7ZA 1I85C 1CDHA 3I6LD 5KVDL 1C5DA 1EEYB 1F58L 1HXMB 2BDNH 3VFVB 2SEBB 1OSZA 3OWEA 1QBAA 3RTQC 3KGRA 4PYGA 3ISWA 2IQAB 3LQZA 1NAKH 2PR4L 1OTUD 3MLZH 5D7LA 4EI5D 3HI1B 2GI7A 4P3WA 3A6CL 5KAQF 4TNVF 2LQRA 3KDMB 4IDJH 2LVEA 1A1NA 5F8QC 2ZP0T 3QAZB 4TUJB 3MRLA 3KLDA 5F3HB 1PG7L 3AM8C 4PY7A 5I1CL 35C8H 3EJYC 3VXOA 2AW2A 2ZG3A 3GSRA 5DUPL 1T6VN 1YECH 4G8GB 2NQCA 3WUZA 1WBXB 4WTZA 5MEPB 1CLZL 1MHEB 1KJ3H 4HD9A 5ACLA 4F37K 1WICA 3CSGA 4L5FL 4QO1A 1JGDB 4OUUB 2M2DA 3UPRA 1A6AA 3RY5A 1H15B 3SGKC 4KZDL 4XPBL 4Y4KC 3TZVB 4OGAC 1FLTX 1MIEH 3M8OL 4FTVE 1J5OH 3QFJD 1T0MB 5DD6B 1EUUA 1S5HB 3GEWB 4Z7VF 5KJRH 1PDKA 3P9MA 3NMEA 1INDL 2HA1A 2PTTB 2VOTA 5EFIB 5LAXB 4HXAL 3HS0B 5DJ8A 3HE7C 5I1AA 4D2NA 3EDJA 5L6YH 1U6AH 2YZ1A 1K6QH 4DKFH 4KUCF 1MLCB 3E3QE 3VRJA 2R4RH 5IEKB 1NC2A 2X4QA 5FOJA 3BH8A 3EO1A 2X9YA 1I9RH 2XWTB 5JW4M 3WNNA 3UTZB 1WIPA 4OF0A 3UAJC 2Y25A 5EO1B 1LEGB 3VE0B 1ORSB 4PRIB 3VFRB 1CLOL 5I71B 2YN5A 1BFOA 1EVTC 4ESKA 3WN5B 4ODUB 3C9NA 2UWEE 5IFHL 4P46A 4YE4H 2HLAB 2NW3B 1NKOA 1F90H 4HAFA 4LBEB 5F96H 1R3IH 3DOSA 4ZPVB 3ZTNH 5CEZD 5LGHL 3I50L 2PW2A 1ORQA 1SJVA 4FFVD 4MDIB 3KS0H 2QQQA 5C07D 1KG0B 5EOCH 2XA8H 5EO0A 1U3HD 1AXTL 1YEJH 3BD5A 4NC1C 3FB6B 1S9WA 4U1NA 3RVTD 1RIHL 2FIRT 3UEZA 1QBMH 4Y8DC 2DLEA 1K6QL 2BSTA 2BVPA 4DKFL 1NPUA 1GGBH 3VGBA 4TQEL 4PJ8C 3MRHB 4I18A 1A6ZB 2FWOB 4OCMC 4AIOA 4KFZC 1SM3H 5T3XE 1JE6A 3PIQB 5IVXB 3CVHH 2Z91B 5TPWH 1MHPL 1U2CA 3O9WD 4Y4FD 2MHAB 4P23D 4B50A 3HZVB 2J8HA 3MO1A 4G6AD 1A64A 4WI7A 1SY6L 4MVBC 4NQDD 5FHBL 1OARH 2I07A 4JHZA 1LO0L 4QXGH 3FT2B 3ILPB 1W2KT 2HAZA 3TYFA 4WTWA 1D3CA 2HFEB 4I5BB 2W0KA 3O3EA 1OP5K 1ZAGA 4BFEA 4WUKH 4NN6C 3KPSD 3TH4T 4JY6B 3S5LA 3S35L 2X40A 4QGYA 4E41A 2X4PB 3MXVH 1BVKA 2BVQA 1XF5B 4XPBH 5JIHA 3WS6A 3G6AA 4MD5B 4J3XA 2X4RB 1ED3A 4NQCE 5IK3A 2MOVA 3LZFL 3B5HA 1HDMB 1AGDB 4GW4B 3OXRB 4G43B 3ALWA 3CNKA 4OZ4A 4X5WB 1LDPH 4F33B 2XFXB 3OJMB 4CUCA 1X7QB 2XQYG 4KWUA 4XTRC 1G7JB 3O2DH 4MA7L 5FKPB 5D7KD 4KKBC 2V6HA 3PV6A 3QEUB 2FR4B 3PWNA 3BH9A 4PJXF 3GBNL 3F7VB 1EGJH 4APQA 3OAYH 4QRRE 1AD0A 3E8UL 3TBYA 3HI6H 3QHFL 4PJGB 1DBML 1IKNC 2FJHB 2VISB 32C2B 4HIIA 1FO0A 4K3JL 1FFOB 4D8PB 1JYWA 4X6EB 5EU7C 4U1MA 3B4NA 2OR9L 1DVFC 3QIBA 3IDNA 3R1GL 2NW2A 2R1WA 3TPKA 1IGML 1A3LH 4QTIH 4CU6A 3CFKA 3ARGA 5J6GA 5C0IA 5D71H 1J1PL 3GSOB 4LHUB 3D39B 4NUGH 4I2XB 2EDKA 3HR6A 4CMMA 1BJ1J 2YRZA 2EKJA 4J3WA 1WZLA 2NYYC 1XF3A 4V1DA 3P9LB 2J4WL 3HE6C 1KJ2H 3NFPB 2P8PB 4GRWE 2WBJA 1UADC 1KIQB 3PWPD 3QIWA 4P4RA 4X6DA 1XGPA 1S7WB 1NAML 5I16A 4S0TD 1X3DA 3ZDYE 3F5WB 4Z9KB 4NWTL 4TUOB 4X6DF 2B2XL 4Y2OA 3BVNB 4UNTA 1FYHB 1BX2A 4OCYL 3DVNB 1VKXA 3VD4A 1QO3B 3CDYA 3WV0A 2FHFA 1A6ZA 3GFUA 4KV5F 3N06B 4PJ7F 1RHHB 1ZS8B 3LS4L 1U8PA 4LSVL 4ZOEA 3QUYD 1LP9A 4PPTA 3MLXH 2BMKB 2C7UB 3RJDA 3RDTD 1CFSA 2FATH 3G6DH 4JGMA 1MQ8A 4KMTL 5H35A 3CLEH 4MGXA 5F89B 1Y0LA 3CXDH 4HKBB 3QHZH 4JRXB 5SWSA 3KPSA 3CVIL 5EB9A 1Z2KA 5JHLL 1U8NA 1NGXA 6FABH 12E8H 2Y36L 3ZYIA 5B21A 1KT2A 2QQLL 2XXCB 1H8OA 1I9JH 1WJ3A 4RGND 3G5VA 4HK0A 3S5LB 3WDHA 2PO6B 1ACYH 1BM3L 1UQSA 4JRYB 3VRLE 2G5RA 5E8PA 4FQIL 3CFDA 5D4QA 3UTPD 4GXVH 1HSBB 1MI5D 3EJZC 4W4NA 2D0GA 4EXKA 4MDJB 1TCRB 3DVGB 4HPYL 2FIKB 5L8KB 4HK3J 3PWLA 4OQTA 3UJIH 2IAMA 4Y5XB 3K8LA 3QJHA 1AR2A 4LLAA 1YEEL 2HN7A 2OZ4L 1H5BB 3B9KD 3IU3B 5KOVC 5BOPA 1PYWB 3PP4L 3S96A 3CCHB 1GOGA 3AY4A 4NYLB 3QNYA 3OKKB 4Y5VA 1QHOA 1IGTB 1XGRB 4M8QA 4I4WB 3T1FA 5JPMB 4WEBH 1FVEA 1UXSA 5JW5B 5BS0D 4U1SA 3PG2A 2XN9D 5EUKA 4PJHA 4APQB 4QRRA 4RWYL 5BW7C 1Q9WB 5FGRA 1WTGT 3LEYH 3HNTL 3WJLA 3NBNA 1ZKAA 1S7SA 2W9DL 3QDMD 3PDOB 4PJGA 5D96C 3R1GH 3WFBL 3QSKB 5H37G 1CFNB 1BZQK 4OFIA 5DMYA 3H42H 1KULA 4J4PC 1FORL 4PJFB 5E9DB 3GKZA 3VFNA 4G8GA 5KVFL 4IRJD 4NZJA 1ITCA 3ARBD 3QCTL 4YBQC 5HGHA 4LSRH 3ARVA 4ZO6A 4NQCA 3BP7B 1E4XI 5GS1C 4A6YH 3D39A 4OGZA 5DD5H 3VA6A 4IMKA 1CXIA 2H45A 3IGAA 3BKCL 3MCLL 5C71A 4YHIB 4P59H 4ZTPL 3M1BA 5TQ0L 4K3EH 5HI5C 3O2VL 4E41E 1Q1JL 3DX6A 1TZGH 4OCSH 5TDOB 5DK0A 4HWEH 4AK1A 2Q20A 4R4FL 2H26B 3SOBL 2FB4L 3D0LB 3THMH 3LEXB 1H3WM 1EXUB 4RAUA 3UO1L 4PY8I 5C92A 4MD0B 1F4WH 4NSKA 5T3XH 1OGTB 2UWEF 3Q48A 4PB9H 1G7PA 3WLBB 2FDBP 3AS2A 2ICWI 3WFBH 2RFXA 1FZMB 4KROC 4LLYA 3NFNA 5DVOA 5I2IB 2BOBA 5ESAA 4HFUH 1QACA 4XVSH 3X14A 3WKML 1NQBA 4P9HH 4KTDL 4HCRL 4QY8B 4DN3H 1U58B 4W6WB 4M5YL 2EC9T 4AEEA 1IRAY 1MCFA 3PWJB 2VR5A 1AO7D 5B8CA 3L3KA 5BO1H 1UWGH 3VMNA 1WZ1L 2AV7A 2NR6C 5IP4A 1YY8A 2GHWB 1EHAA 1WBZB 3VG9C 1X6LA 4HQQH 1QG3A 1S8DA 3BKML 2AJSH 3MLWH 3L5XH 2PO6A 4HPYH 3KHOA 2VN4A 4LPXA 4XNMA 3HI5H 2AVGA 3HZYB 4QRUA 4RIRA 1I7UA 4K8RC 4EUPB 4JO2L 4XP1L 3NIFE 3GJFA 5HDOA 3VXRA 3LD8C 4PJCA 5KTEH 5C08E 3BKJL 5DFVC 2Y06L 1ZLSH 5IW3A 3KLAB 4LPUA 2QSCL 2JLLA 4JRWA 4EBQL 2ZUWA 5KG9B 2IG2H 4I9WD 3S96B 1QKZL 1IGYB 1IGTA 3T1FB 4U6YB 2KL6A 4NQTA 3LKPA 4UDUB 5BV7L 4ZNEA 1MHHB 1MEXL 2VXQL 3WHE0 3S36X 4OFYD 5LQBL 2FX8H 2E7CA 4FFZH 3ARDB 1YMME 3MV9E 4AYFA 1JWSB 1HHKA 1X4XA 4PS4H 2ZCLL 2VWEC 4XGZB 4OV6F 3OHXB 4ONFH 1EDQA 5B38G 1MELA 4JKKA 3ECBB 4P5MA 1A0QH 3JWNC 3LS5H 4C59B 2R9HC 3EOAA 4WW2C 1UCBL 4H1LA 3JXAA 4K55A 4N8CH 1INQB 1NFIA 3E6HA 4W68A 4H88H 1NC2B 4N5EC 3FMGH 3TV3H 3N1GC 4WFGD 3CAFA 3JSSA 3MV7A 5ANMB 4GKZA 4XPGH 1EEUA 5D7JA 4Z7UB 2VDLL 4LLVB 4PJ5A 5HJ3B 5HY9B 1J86A 1MI5E 2VKXA 4GRLC 1JI1A 1LO3L 4TVPH 4HWEL 1NFKA 1WCQA 5DA0B 1TJGL 1PY4A 1RUQL 3ZT6A 1G1CA 4XXCA 5JXAL 4PJFE 4J12A 5I6XB 3ULUH 1A4KB 3X13A 1JNNL 5DVLA 3MMEB 3B5GA 43CAA 2E9WA 1T7YA 4U6HB 4LGSB 1BECA 1WLHA 4A6YB 2QHRH 2O61A 3MLTA 4F9PC 2AXHA 5I19L 2A73A 1D5IL 1ND0A 4GQ9H 1JCKA 2H6PA 3EOBB 3RGVC 3H7BA 2ZCLH 4X7CC 3DMMC 2NY6B 2RFXB 1NDMB 3ZTJH 3V0AC 1WQVT 2D3VA 2KQNA 1TETL 1MY7A 1VCAA 4O02H 3V0VB 3B9KB 3MODL 1BFSA 1YN7B 4J6RL 5C0BA 4L3CA 5AYUH 5GRJL 5FDWA 3SDYH 1X5AA 4ZFZB 1II4E 2F53E 3FKUS 4NRZB 4I18B 3RWIB 3FRPG 3ZE1E 2EXYC 2YPLB 3E1F1 4IDJL 4NKMB 1O0VA 5T5FH 2Q86A 4MWFB 2IAMD 4XPAH 5EOTA 3NA9L 4PGCA 1K8DA 4F7EB 3TN0A 1XIWA 1OD9A 1KBGH 4NJ9L 4BSVA 1ZA6A 3SGEH 3HC0A 3QIUC 1FL3B 1RJZB 2IPUG 4QRQB 1KFAL 1U8IA 2D9CA 4MX7B 2QHRL 3LN4B 1UH4A 3FN0L 1XR8B 2F5AH 2PYED 3U82B 2PYEE 5T33L 5L7XL 4F7PB 4YQXL 1GHFL 4LEXL 1LE5B 3HB3D 4NZUH 3GMNB 1BJ1H 3VXPB 1OGAD 5IB5A 5B39A 1A3QA 3BDYH 3Q0HA 2F54D 5CINL 1AQDB 5CZXD 3RAJH 3RZCA 4DFHA 1RURL 2R2BB 4IMLB 2JJWA 1TDQA 1N64L 5TE4H 2GITB 4IMKC 3IDYC 3PABA 3PXJA 2H2SD 4Y5YC 4RNRA 4XMLH 2NY0D 4X4ME 1CXLA 1VERA 2WINA 3FRPA 5IFJA 3ARTA 1OTTD 1JZ8A 4P5MB 3MRFA 1RUKL 5I71C 2FR4A 4DCQB 3KYKH 5C2BH 3MLVH 3MNZA 5I9QB 1CDUA 3RGVA 3QQ4B 4M6NH 1F4XH 1U8OA 1IGCL 3UTSD 1QPPA 1OTUC 2I5YH 4NQCD 3ES6B 2BSSB 4HULB 3TP4A 4YHNB 3T0AA 2Q87A 3FB8B 5B39G 2DQFB 1A6PA 4OTXL 5ACMA 3W0WB 1K8IA 1OAYL 5F7EL 4Y5VB 3U0WH 2P4AB 5DEFA 1JNJA 3DGGA 1RUAL 3TFKD 1R3KA 2X9WA 5EUKB 3ARED 4M7LL 1UT9A 3VFTB 1CD1B 1HNFA 2Q7YA 4PJ8B 4GKNB 1J1PH 4EJ1C 1SBBA 2HG5A 4PLOB 4C4KO 5BW7A 2BOCA 2KUTA 4P2YA 3VFNB 5IM7B 4HC1H 5C0BB 2DBJA 4NQEB 4JRYD 5HHNA 4DQOL 1JF6A 2Q8BL 3MBEB 1NANI 3REVB 1KN2L 4KQ3H 1FVDB 1LK3L 1F4AA 1UVQA 3G5XA 1QEWB 3HNVH 1Z0MA 5CBAB 2GT9A 5GS0H 5IHBA 1NCBH 3LRHA 5HI3C 3RA7L 3MGTA 3C09B 1HKFA 2JF1A 2NR6D 2JB6B 4JDZA 4XXCC 3TH3T 3VFGL 3U9PH 1HI6A 2E6JA 4XVTH 4DGVL 4U1LA 4P46B 3UYOD 2P24A 1HKLH 1IFHL 5I8KH 2ORBL 3BZEA 3CU1A 2I24N 2D31B 3L3HA 5KSUB 4YFLI 5DEGB 3T8XB 4OZGE 1RZGB 3DV6A 2DQJL 1N2RB 5HYIA 2VLKD 3QXUA 4YPGB 3VGAC 1OT1A 1CYGA 3N1FC 1Q0XH 3MRBB 2LABA 3HUJE 1KG0A 2PO6C 1Z9LA 4NN5C 3LHPL 1DQLH 4AEHL 1BD2B 3BRFA 4S2SA 4CDGC 1FYTA 3O0RL 2AJ3B 5IQ7L 2CDFB 2FX9L 3MZTA 3ZYZA 4QHMA 3PXHA 1WIOA 1R5WA 3UTPE 5GZOC 3FFCD 2HMIC 2AK4E 5HI4D 3KNBA 3WE6A 1T7WA 3NCJL 1DBMH 4FXLA 1LK3H 5E08L 2FJFA 2Y6SC 5CGYD 2WM0A 4CN6A 5CZVL 2B0SH 4LCCC 4HS6A 4MAYD 4V2CB 3ZE2E 1GAFL 1MFBL 4BSJA 3QNYB 4Q0XH 2OP4H 4YGVA 1JF1A 4KROB 5JIKA 3T2NL 5GGQH 3VJ6B 3SO3C 4MA8H 1ADQH 5DJ6A 3BGMB 1OP9A 1I7UB 4X6BA 1FL5B 4OLXL 3WIIH 1IKFL 2Q76B 4TPRH 1YEDA 2EO9A 5F6IB 4MQ7B 1EFQA 1N6UA 1GGYA 4PLJC 4HMCA 5AWNL 3MYZA 1EHLH 1IQDB 5FO8A 1R5IA 4LLWA 3BI9X 1QSFA 2EH7H 3MXVL 3W0WA 2ICWB 4OBSA 3DWTA 4GAGL 1I8MA 3GSXA 1RZJL 4GSDL 3E2HB 1P2CB 1KACB 3OXRA 1JWSA 3HR5B 4F33A 4PJAB 2PCPB 3HPLB 1FDLH 1BGXH 4KH2A 4PJ8A 1CVRA 5J3HD 1OSPL 3MRNA 4YFEA 5HGBA 1VADA 1XCQA 2XOTA 2LV4A 2K1MA 1RZKL 3VXSA 2EYSA 3GIZL 3BN3B 3OR7A 1NANH 4ZSOE 4KKLD 1SJXA 4LVNB 2EDHA 3RVUD 4ODVL 3ZE1F 4UT6L 2C1OA 5C0BE 5EUOF 1HINL 3QFJB 2I27N 1OAUL 1ZMYA 4UV7H 3ZDZE 5ANMA 4OM1L 2DQDH 3NIDE 3E8UH 3IVKB 3HG1B 4G7VH 1BHGA 4ALAH 4PV9A 3RWJA 2XXMB 5F7DA 1YPZA 1WFNA 3LAFA 5ESVB 3ZSTA 3U9UB 4M61B 2P5EE 4XCFH 3D9AH 4HCRH 5DVKA 4YDJB 1CVSC 2K9UA 5F1OB 4LGRB 5JW4Q 5FGBC 2NX5A 3TBWA 4WHTA 1TLKA 3P40A 2H32A 3C6LD 1JJUA 1F3JA 1KCLA 2R2CA 5DUMH 4PP1D 1LNUB 1MVUA 4N90E 3WFCH 4AZ8A 3BGAA 2ESVA 2A6JB 1YUHA 1T2QL 5D5MF 3ARWA 5HI4C 2X1OA 5GS0C 1DN0B 4UI2A 2A1WL 4PRBA 3MV8E 2PW1B 4M6OL 4GW5A 3ULVF 1UJ3B 1XZ0B 3FRUA 3HB3C 1BP3B 2NTFA 4KUZH 4ZUTA 1FE8H 3FFDB 1DQQA 4O5LL 3D3VD 5HHOA 2DL2A 3BE1H 2VLRA 3U46A 5TJWK 2OX5A 2D7QA 1XF4B 4FFWD 2A6IB 1S9YA 3V7AG 4JO2H 2GCYB 3BHBB 1SY6H 5DI8A 3D0VA 1A7BA 5HTSA 2SEBA 1YMMA 3RVVC 4U3CA 4QRPA 1IGYA 1IC7H 2CD0A 5HGDA 1PJ9A 5HVGB 4NHUA 3RWCA 3QEQA 5HYQB 2P47B 3GNML 2QSCH 1EH9A 5I18H 2BY2A 4U7KA 5E2VL 1CFQB 3VJ6A 3QEGL 4OLVH 1MCWM 4F57H 3RHWF 4G8IA 3NIGE 5FYKH 1E4KC 2G75B 3RUGA 1FG2B 4X5LA 3T77A 1DZBA 4TUJA 3ZYOA 2QSVA 3VXRE 4Z7WB 3BIBX 1KELL 5KS9E 1RK1B 3FMGL 1UM4L 2ICWA 3CLFL 3ZL4H 3QDGA 4HFWB 4U3HA 5ALCL 1UZ8B 5JPNB 1I8MB 3OQ3B 3T65B 1H15A 1OLLA 2W60B 1JTOA 4LVHC 3UBXA 4GLRH 5SV4A 1GPOH 1W0VA 2BNRE 2GEEA 5HXMA 1P6FA 3VFSB 1KLGA 4P2RE 2RB8A 3FTGA 1BZ7A 4U0QB 5IBUB 3K3QA 4UQ3A 1AIFA 3O3UN 3H3KA 1A3RL 1GOFA 4JFDD 2BVOA 4MJ6A 2EYTA 3F12A 3QUXB 3BWAA 5H2BA 5K33A 4K07A 1JNNH 3EZ8A 1L0XA 4GG8A 2CJUH 4CBPA 4OCWH 3V95A 3LIZL 2Z92A 3GSNL 3A6CH 3QCUL 1ZHBA 3QXWA 4K71C 5D71L 2E5EA 2EXWC 4AT6B 3RI5F 3G08A 1BBJB 2XICA 5TE6L 5SX5K 5ID0A 5I74C 2E7HA 3T2PA 4J7RA 3CX2A 4MS8C 1M05B 1MAML 1HHJA 3MOQA 4M61A 1QLRA 4WW2F 4TOYH 2R9HD 3WN5A 5L2KA 2FO4B 1OCWL 4KJYB 5CEYB 1TVDA 4GUPA 5MEQB 5C0EA 3U0TB 4XNXH 5INCA 3SDYL 4Q7DA 3EBAA 1N0XH 5C09E 1MVUB 1OL0A 4KRPC 5EOCJ 4L3AA 1MRCH 3NCYP 3R0MA 2WBKA 4R6UA 3QAZC 4S10A 4D9RD 1SYSB 2JTDA 2YD2A 3C8DA 4L29A 4Q58C 4XPAL 3QDGE 4YNYA 3LMJL 1Q8MA 4OLUL 4F7CA 2WUCL 3AS0A 2ZKHL 3UYPA 4NSKB 5A2LH 4KVCH 4POZC 4C58B 3U46B 5T3XL 1T04A 3K7UA 4JN1L 1QEWA 1D5ZA 2RHEA 3FO9B 4WCYH 2X4SB 5E8DH 2Z91A 3LEVL 4ZTOH 15C8H 3BJ91 5T33H 3C87A 3K8KA 2HFGL 4K94L 1YMMB 4PJEE 3MGOA 3RKDC 2NNAA 2AS5M 1VFAB 3FFCE 4MNQA 2XKSA 2VXUH 3KPOA 2YOCA 1B0GB 2C3VA 3STLB 5A43C 4DAGH 5IJVA 1IEAB 4JN2B 2DQGL 4LLDA 1ACYL 4NCC1 1WWWX 1RIHH 4J8RB 5HYSB 2HTKC 5E56A 4FG6D 2R4SH 1MVFA 2AI0H 4IRSC 3W9EA 2IH3A 2D7TH 4P2CG 4OUOA 3BZ4A 4W4OA 1KEGH 4N1HB 4PRNA 5AZ2H 1YN6B 1U8QB 5D1ZB 1IT9H 2HJKA 5A3ID 2DTMH 5HDBE 4O2CB 4LHQB 4ENEC 2IMMA 3MROB 1UM6L 3GGWA 1H8NA 3VH8G 3UP1A 4BUGA 5BJTA 4XWOD 1QFOA 5D1XD 1RUKH 4JGUA 3DRTB 4OLEA 5MHSE 3OXSA 1MRDH 3MBXH 4KJQC 3IDJA 4JRXD 3O11A 3NGBC 1NDGA 1NFDF 4YEEA 3ILQC 4HWBA 4OI9A 3ULSB 4EKXA 4NUJB 1E4XL 4O58L 3CDGB 5GS0D 3EYUL 4DVRL 2ZJSL 4FQJH 3UTTA 4KTEH 9CGTA 4WW2B 4QYOB 4ERSL 2BVTA 5C0AA 3QNZB 3BGMA 2FX8L 2Q76A 3BKYL 1OM3H 1UM5H 4JLRB 3AMLA 3VDBA 2FJHA 1JZ4A 2VISA 4HIIB 5FM4A 4N8VA 3ARBC 1J05B 3VH8A 3T2OA 1NFIB 3E6HB 3MV9D 1DBKL 1QNZL 1FV1A 4M9OA 1CXKA 1K3IA 4ZSOA 4HPOL 1FZOA 2EEAA 4UAOC 5DUBA 3UPRB 3HZMA 3VD9A 5D2NC 3RKPA 5FUCE 1P2CA 3MLUL 2FBJH 2ZOKB 4OIIL 1KIPB 2ZSWA 4FQLH 5FCUL 1ZHNA 3WS6C 1LO2H 2MQ3A 4TVPL 5E6IA 1ZVYA 4HW6A 2P8PA 5JUEH 5D96B 1JZ3A 4HS3B 1E4XH 5F7MC 2YA1A 2VJXA 3NN8A 5ITFA 4P3DB 5E2JA 4R2GC 1KXVC 5J3HC 2NY3D 3B9KC 3VRJB 4YHOH 1VEPA 1BBDH 3UJTL 1F45A 3QFJA 5ICXB 1S7TB 1KJ2A 2OS7A 1ZLUK 2MCG1 1ZGLB 5BS0B 3OGCA 4BFBD 3AS1A 3FOMB 4K2UH 4M3JA 4ZG1A 4WWKB 1JWMA 2V2TB 4RAVB 5EPMB 1IBGL 1YEKH 5J1TC 4P9HL 3ZT5A 4XCNA 5IV2A 3GMPB 1G7MB 4IJ3C 5EO9A 3GRWH 4OLWH 4PRDB 1NBYA 1YN7A 2GY5A 2BNQD 1ZLUH 3O3BB 4P2OB 3MGOB 1DBAL 1DBKH 1QNZH 2FLRT 1QUNA 4C4KT 2RIKA 4TTDC 3U36A 3DNKA 1OLZA 3Q1SH 5I1IH 5E4IA 4M43L 4QXTB 5A2IH 1YYMH 3RUGF 3IFOA 1SY6A 5LJYH 3C6SA 5E5RB 3QZWB 2IH3B 4BSVB 2HJFB 4MQSB 1JPST 3U83A 1IC4L 3MRMB 1S9WB 1WWAX 2J1KA 4U33A 4OT1H 5EIIB 2BSTB 2BVPB 1EBAA 1IKFH 3L1OL 4LK4A 4AL8L 1Q9KA 3O4LE 4KKNA 4NKIH 4X6CE 2X7LB 5C07A 2YZ8A 3MRRA 5I73C 1G0YR 4KY1L 1S9YB 4RX4A 3AB0B 3GBMH 5ITBH 5D2LA 5JOPD 2YKLH 3CSPA 2AEWA 1KCRL 2GTZB 2WP3O 4RGOH 3JV4B 2MCPH 1M71B 3ULSA 1OY3B 3VMPA 1DBJL 5CP3H 3SY0B 1DUZB 4HWZA 3VG0L 5E0QA 1A6AB 1TJHH 4CMHC 5LWYH 4PBWD 1CFQA 3HZKA 4LHUG 1CFBA 4K3DH 2A9MH 5T5NG 5DWUH 2HFEA 3F7YA 3LS5L 3D69B 4QXWA 1RZJH 5I8CA 3CFEA 3HRZA 5FKAA 5INDA 3UBXG 5E99H 4URTB 4XVJH 3WLWD 3VWKC 4ZO7A 1YDPA 4K7PL 5HYEA 3FT3B 5E9DA 1B9ZA 1YEEH 4PJIF 1EO5A 2QQLH 2GQHA 3ARPA 4OZFG 4XP4L 5IEKA 3RVXD 2ICEA 2HVJB 1FV1B 2HVKB 4XI5D 3EO1B 4JJ5A 1IGJB 3BPLB 1XIWC 4LP4A 4R2GB 3ARFD 4HWBH 3T0DA 3RZCD 3WKNA 5L2KD 3SJVD 2R1XB 4G7VL 1HDMA 3CFIC 1T4KB 5JA8B 4UOJA 1YY9C 4UOW1 1UACL 3ULUL 4PJAF 4QHLB 1KPVB 5DRNA 4OM1H 4WTZG 3UXFA 3GMRA 1L0YA 4HJ0D 2DQIH 2ZUSA 3QDGD 4PTTB 5TGBA 3QQ3A 3P0VL 5AUMA 4KKBD 5IB2A 1RUPL 3MLRL 3I2CH 3KPNA 5I75B 1SBSH 1VEOA 4XZUA 4DW2L 4HGMA 3HRPA 3AAZB 2F8XC 1ZGLP 2AP2A 4JM2D 4WUUB 1CIDA 2A6KB 4PJBA 1OQOA 4CJ1A 4U4BA 2MJWA 3H9SD 3V52H 3V2AR 2ZPKH 4ISVB 4XXDB 4ELMA 4ONGL 3IDNB 1JGUH 4LCWB 1HHJB 5I1DB 4XP4H 4WI3A 1T89C 2ERJB 2NXZB 4JZJA 2MPAL 1CBVH 4G6JH 4UTBL 5ILTH 2FO4A 4TULL 5KN5B 2A6IA 4LPTA 3GMOB 1I1AA 2GT9B 1XF3B 1S7XB 3FQNB 5KS9A 5H37H 3L3IB 2QSQA 4LCIH 5HDBF 2DS4A 3MO1B 4HS8H 2W65A 5EZIH 2WWMC 1HZHL 5DQDL 4R4BB 4MYWB 4NQDE 3TEUA 1F6FB 4OGYL 4NC2B 4YNYB 2H2SC 4TUOA 3QUYC 4X4YB 1FG9C 1F6AA 3B8SA 4NNXB 3GI9H 2DI8A 1QFWI 2HRLA 4PV8A 4QOKE 3SEPA 4ZS6D 2WLZA 4GAYA 4LAQH 1MIEL 3M8OH 5JR1H 1I8LC 1LK2B 4R3SA 1F3RB 1RV6X 5CJOH 4LCCB 2ADJB 4Y19A 3UJJH 3TN0D 2NNAB 5DQJA 2GY7B 4BFIA 4Z7VE 5L88H 4JZNB 5DD3H 1X44A 3HZKB 1PKOA 2C3VB 4Z7OE 4UTAH 3V4PL 3TA3C 5C7XL 2OL3L 2DN7A 3O41B 2XFXA 4LDOB 3WN5C 1T66C 5CP3A 1QFUL 1AO7B 4QHNB 5GS3A 4GKSA 3MLVL 5IVXE 3EFFB 4M00A 2ESVE 2V2WB 2GSIA 4M7ZB 3L3GA 2YS4A 4LCIL 4X7FC 4FS0A 4YXKH 4NO3A 3BWAB 4F9PA 1AD0B 3OJDB 1GVIA 3HMXH 3V79C 4CRPA 1FAIL 2VL4A 5LCVH 3LB6D 4AG4H 1PZ5A 3V6ZB 3BXNA 1A6WL 5HJ3A 5HY9A 1PX4A 4JQXC 2YC1B 3PHQA 1IQDA 4P9ML 1NGZB 5TE6H 2NXYD 4PGJA 1QSFB 5EBWB 5FGBA 2P5WA 3SKNA 3R8BB 1JL8A 1O7SA 1BQLH 4NZRH 5HHPA 5D93B 4OD2A 3IAPA 3T0ED 3MRGA 3U0TA 3IDGB 4HH9B 3WO4B 4Y7MA 1Q9WA 1S5HA 4FMKA 3IJYA 2CGRH 4Y4KD 1A7NL 2BNUB 5CD3A 4L4VD 2VXTL 3STZB 1NDMA 5TPWL 3ARRA 3OR7B 2YSSB 1CGXA 2A9NH 1LO3H 4O9HL 5F3BB 5KSVA 3LPFA 4KJWC 4MJIA 2OBGA 5JHDA 3V6FA 5I1DA 4J1UA 3OBAA 2I9LA 2EE9A 1T20B 4XB8A 3ARXA 4S1RH 1FZOB 4UV7L 4I0PA 3ARZA 1SYVB 4Y19E 5E5MA 4PV9B 2K3TA 3TT1L 4JFEA 5LGKA 1YNLL 4OLUH 1YPZB 1RFDL 4XHQA 5KS9B 4O4YL 2OR8A 5T1MB 4U7SA 3DURB 4PLKD 1KCUL 3GSVA 3SQOL 3C9NB 4YDJA 1ZA3A 2QADC 2FJGB 3QEHB 1RZIA 1U8IB 1A2YA 4JFZH 5E95B 2KDGA 2YA0A 3DO7A 1MCHA 1KYOK 1A9BA 1F3JB 2R4SL 4QHUA 3H9YA 4YHPB 2CMRL 3MOBL 3FQUB 4Z0BH 3ULUC 3VDCA 3UJJL 5MERB 3VFPB 1X4YA 2NXZD 3IDMA 3FHAA 5CILH 3GMNA 5EO9B 2E7MA 2YD1A 3O9WB 3FB6A 1HOCB 4FFYL 3X14B 2V17H 1FP5A 1OAZH 3NA9H 4OZHF 1G6RA 4LSPL 4M1DH 3N1PC 3VFOA 2AXGA 1KEGL 4S1SL 3OPZH 1WF5A 1K4DB 3B2UD 3WHXA 2QR0A 3MOAL 2EZ0D 2ARWA 4FFVC 5D70H 3QULA 4EN3C 3DXAA 1CGUA 3T2NH 2PTUA 3RI5K 1MNUL 1JPSH 3PF2A 5BMFH 3LN5B 4FA8A 2IPTL 1YEHH 3HAEB 3ARGC 2X41A 3FFCB 3UZVB 4XNMB 3EHBC 1MFDL 3WEXB 1IAKB 1YEFH 2R0ZH 4NQXB 4O2FA 4AENA 4OZGA 2C5DC 1I8KA 3K81A 2VDNH 1U8OB 4DZBA 5I8EA 4NP4L 4X9BA 4CJ0A 4M02A 4MA3A 3I02A 2QSTA 3RJQB 1RIVH 1TQCC 4RSVA 5DHVA 4OZIB 1ERNA 4N8VB 3KLAA 2PYEA 3WDIA 1JGVL 3VH8B 3O8XC 1WBYB 5IJKC 2BVQB 5DXWA 4YAQB 3ARYA 2ILLA 4S1DD 4F15C 3PP3K 1IEBB 3HG1E 4W6YB 1DUZA 3NABH 4L8SC 1W0WB 4PGEA 4CVWA 5JHDE 2IFGA 2CUIA 3ARDA 1Q9OA 1E6OH 3OKLB 1KJMA 4NC0B 4ZFOL 1PY9A 3GMMB 2Y1VA 3GMQA 4KGLA 2DLTA 4H0GA 5CKGA 1NGYA 1MNUH 1HINH 3GK8H 3MPCA 4LLUB 3QWRA 3PGCA 2Y7QB 3OKDB 1BIHA 5E2UH 2HVKA 2HVJA 3RVWD 1P5VA 4RAUB 4X7TA 4JY5L 1A02N 1UA6H 2EIZB 5AYQA 2FBOJ 2ZCHH 4DOHB 2DIBA 1RUAH 5D7KE 1NCDL 4P9HC 2HP4A 3G5XB 3LIZH 1IBGH 1YEKL 4FQXB 4XMKH 5I1JL 1E4KA 3OX8B 1WEJH 3QIBB 2VLMD 3SCMA 1UXWB 1P4IL 3QDJB 4IRSB 2ADIB 3QDAA 1M05A 5TF1L 4BH8A 4DK6A 3C5ZC 5C6WH 1U92B 3MRQB 1KC5H 4G80A 1I9EA 4JQIL 3KR3H 4PJHE 4R0LA 4Y5XC 3C8KB 4PRAB 2P24B 5JIPA 4Z7NE 5K9QG 1E27B 2HH0H 2FJGA 3QRFM 4CVUA 4ZFOB 1AXTH 1YEJL 5KAQG 3VXQB 4KZEL 2P49B 4WGWB 2AJVL 1D9KB 1QLEH 3ARFB 4UIMA 4YPGA 1IM9B 1N3NB 5I0ZA 4H8WL 3KXFA 5IHLB 2AJZB 4P5KB 5D1XA 5K59F 2YXMA 5HHME 5JQHC 4FNLH 5E94A 3VWKA 1BLNA 4L8DB 1AH1A 3KYMB 4HKJB 4NQUA 3QG7H 2DQEL 4XBPB 2ED8A 4BZ1L 2HKFL 4OD3L 4M7KL 3IAQA 5FUOL 2N7BA 5T1LB 1CN4A 3BGFB 2WP3T 4ZUVA 4LQ1A 3VFVA 1TZHB 3NA4A 3UC0L 5CSZA 4P2QB 1SM3L 4FQQA 5E6ZA 2RJMA 2AJUL 1KUMA 2DL9A 3BP4A 3L95B 4F15B 5ITBL 2VZUA 1UGNA 4RGNC 3RDTB 4Y4HD 1NUGA 3ZE2F 1XR9A 3QH3B 1LP9E 4LOUD 1QSEB 3UTSA 3D69A 4J2XA 1MJUL 4QCIB 2ORBH 2G2RA 2H41A 3HNSL 4NT6A 4YUEL 5MP6L 4DTGH 4H8WH 5DD0H 3TPUA 5EA0H 1JYVA 2DLHA 1KSRA 2OMBA 5EC2B 4ZUSA 1DEEB 2EE2A 1OPGL 1AE6H 1HE7A 2ADFH 1TCRA 4NO0A 2HTLC 5CIPA 5EZOL 4TSAH 5D72L 4U0RB 5IMOB 1U8HB 2EKSB 4X6DE 2F53A 4P46C 4PJ5B 3BPCA 3ZE0F 1HH9A 1NBZB 4XAKD 3D48R 1DVFB 1FGNL 5A2KH 1D5XB 1TZGL 1QBLH 3MJ9A 4H8WC 4OCSL 5DRNB 3SGDH 5TH2B 3U4EA 1RZJC 4V1DE 1DFBH 3RWHA 5JQ6L 3P9MB 1NEZG 1SEBA 4I4WA 2PTTA 5EFIA 5LAXA 1UXSB 4LLUA 5JW5A 4D0CA 4POYA 1F4WL 4P49A 4Q2ZB 1P9MA 2AJYL 4X9IA 2GSGB 5I1JH 5CS7A 2A73B 4CGTA 2YUWA 2NY5L 2VC2H 1JPGB 2QL1A 4MJ5B 4I0PD 5TF1H 3DGCR 3V6ZA 4DKEH 3ARFC 4PJFA 4BM7A 2R0LH 1ORSA 4EOWH 1I7TA 4C55A 3WD5H 1KEML 4IRSA 4MNHA 1DVFD 1KCSH 5IBTL 1J87A 2IC2A 1C08A 5DLML 4PJ5E 5GJTL 5KOMC 3W82A 4ZSOB 2VQ1A 3B5TA 4OD1L 2CIKB 4D0DA 4RZCA 2ED7A 1R3KB 2XTJB 2FH8A 4M8VA 5CMAB 4PJIE 2DI7A 4LLQB 3VFTA 3G5YB 2CLZB 2YPKA 1R3JB 3GJFH 1FGVH 5EU6D 5HYFA 4KKAC 5E6IB 5T1KA 2R29L 4TVPE 4MDIA 4JPVL 2O93L 3B83A 4WWKC 1PG7W 4FZEL 2C4FT 3CVHB 4M5ZH 4ODBD 4YHKL 2GW5A 4ZO9A 4IS6B 3EDEA 3NPZB 4WV1B 2H26A 1QYGL 3VXNB 4KXZH 2EIBA 1TJIH 1MUJA 3EYSL 3K2UL 3LN4A 1ZGLA 5EULV 3TO4B 1BLNB 1KB9J 2F8OA 4D9QE 5MI0C 2UUDH 4K2UL 1LK2A 5ABDE 1FL6A 5I2IA 4YDIH 1NLDH 3TZVD 1U8JB 4DZ8A 3VFUB 4P59L 4ZTPH 5D7SL 8FABB 1S78C 4NHUB 5HYQA 1MRFL 3QEQB 4KK5C 1QR4A 1UH3A 4JQXA 4U3XA 1KLUB 4P3CH 2IGFH 2NY1B 4KMTH 1TMCB 2GITA 5CIPH 3REWB 3KPQA 4CW1A 3DO7B 3EHBD 1ZTXL 1NAKL 5F1IA 1O7VA 3EFFA 2JIXA 3VGGA 5ISZA 3KPMA 4MXVE 4PJDA 1DLHA 4X4ZA 3TM6A 2HJFA 2XG4A 3JBG7 5HHOE 2VL5A 4HUWB 4BZYA 3MRCA 1X5KA 1UH2A 5EC2A 4ZUSB 5FDYA 4YXHL 4EN3D 2D0FA 3QQ4A 3I3EA 2RGSA 3OJDA 2YD3A 1QBLL 1ZVSA 3ZZ1A 4R97B 3VXME 1BD2E 4N0YH 2RQ8A 4XC1L 4JFOB 2F53B 1PZ5B 2JJSC 3KS0J 1HQ4B 3KNBB 4X8XA 3WE6B 1XGYH 4UDTA 3IXTB 4KUZL 5F9WC 3QDJE 2BK8A 3OAYK 4NQVB 3I6KB 2A83A 1SVCP 3WFHB 1D9KD 1HILB 5KG9A 1AY1L 1BZ7B 4AG4L 1IAOA 1H8SA 1MFAL 3SCMD 3QEUA 3NFSL 3MODH 4J6RH 1AJ7L 1S7VB 3OB0H 3HI1A 1H0DB 1A7PL 1AKJB 4JCMA 4Z7OF 3HN3A 35C8L 1E4WH 5ADOL 1UJ3C 4F7TA 4ZUUA 1ZT4B 2OJEA 5JXED 3OKNB 2CK0H 4MAUL 3WXWH 1D5BB 3GM8A 1FO0B 4XAKE 3H8NA 3I9GL 4OD1H 3RNQA 7FABL 1MFBH 4KGJA 1I75A 4U1MB 3RY6C 5T1LD 5ID0B 5D9SB 4IHOA 2ESVD 1WBXA 2ZSVA 1ZSDA 1CZ8H 5C0IB 5GXBB 3SGKA 4M03A 4GG6E 4WO4D 5D1ZD 2J6EA 2V9QA 4RZCB 3VXSE 3WL9B 1P53A 1UJTA 3QCTH 5MI0B 4HXAH 4CAGA 2OSLA 1EV2E 1ONQB 1P7HL 2NY2C 4NBXB 4L4TA 1T2XA 1HI6B 4NN6B 3S7GA 5JORB 5D7JC 4RFOH 5GGSA 3Q3GB 3KJ6L 3VXNA 5LGHH 2EDQA 3DETD 4Y88A 3W0WE 1KIRB 4OIAA 3BISA 3S34H 4JHWH 4JCLA 4ZFGL 3QUZA 1DP0A 1T03L 4M3KB 4CNIB 1TQBB 3WNLA 3RWJB 1J10A 1EGJA 1LEGA 1ZANL 4RFNB 4YE4L 2X4SA 3V6BR 3VE0A 4LSTL 2NXYC 4S1DC 2YRPA 1BOGA 1KELH 1UWXK 3FO2A 4XNZC 1IQWL 1U8JA 5T1DL 1JPFA 2BMKA 2C7UA 1T83C 5TE4L 2KPNA 4ODVH 3ZMRA 3DROB 3T0VA 1KLUA 2YHGA 5FOBA 1QBBA 2I60H 3QHTC 2GTWB 3TT3H 3H2WA 5ESQB 2YBRA 2BNQB 4RMWA 4GFTB 2ZUXA 1M6OA 1NFDA 3G5VB 2WANA 4PJDB 2EO1A 4KVNH 5FM5M 4P5KA 2AAVA 2XTJD 4JRYA 3TO4D 3L1OH 4AL8H 1YN6A 3PJSB 3T3PE 1OAXH 2ITDB 3QI9C 1XGYL 4NZRL 2XKNA 3ELAT 2VQTA 4ZD3H 4ONHA 1MHPH 1FNGB 1Z9SA 4I3RL 3VGDA 3BPNB 1AP2A 3EOTL 1GGCL 1P7QA 3KPRB 4YHZL 5F96L 1VFUA 3BUYB 2Z35B 2PYEB 3WS3A 1L9MA 5E1AB 5JR1L 1D9KC 1YPZE 1NCAL 4ZUVB 2A0LD 4LSTH 4D9LH 1RHFA 2A1WH 4UOW0 1P4BH 3CCHA 3B2VH 3LKRB 3VMOA 1LDSA 3DYPA 3HE6B 1RZ7L 1S7UA 5T1DH 1AC0A 2VDMH 3QIBD 5D8JH 3GB7A 2R2EB 4C57C 3QNXB 3ILPA 2DTSA 2R2BA 3TGXA 1HHGB 3QNZA 1QBML 4XCEB 2BJMH 3EYQC 3FZUD 3HPLA 3O3EB 4F7TB 1JHTA 2G2RB 3IFLH 1S7SB 3MXWH 5K9OB 5I17A 3LKOB 1CFNA 1Z3GH 4N9OB 5JHDD 2VDPH 5C09A 2Q8BH 5HYJA 4TRPL 4QRSA 4KVNL 4JAMA 4PLKC 3RGVB 3V5KA 3TVMB 1RMFL 2RBLA 4JHBA 4WNQB 2Y72A 1Y18A 4QGTA 1N6VA 2R15A 2QADB 4LHUD 5IMOA 5DUBB 1NAMA 3WL9A 4RMVA 1NBZA 2X70A 4FQ1L 5C0GB 1QSFE 1SMAA 3MJ9L 4J3TA 1NSNH 1UA6L 5AG8A 2V5SA 3SCMB 1B88A 1UXWA 3ZO0A 2R1YB 4DUVA 1C5CH 3DPBA 3ALXA 4FABH 4KI5E 4LEOA 3SDDA 4B5EA 3S5LG 2BP3A 3GJEB 2B4CL 5J06A 4OJFH 4NKDA 4HS3A 1A1MA 3MRGB 3O6FA 1JIBA 2LTQC 3FB7B 2OQJA 4Z8FL 4ZPVA 1KJ2L 5EUOB 4EDXB 3AROA 3ARFA 4UIMB 1T1ZA 2WSKA 1ORQB 2X4OA 2Z31A 1DL7H 3WFEL 2G60L 5B4MD 5DRZB 1TNMA 4LVNC 2UUDK 3K0WA 5EPMA 2K7QA 1OAKH 3QI9A 4N90D 4UBDC 4P2RA 4WO4A 4NCC2 1RVFH 2BNRA 4GBXB 1NC2D 4NQEA 4Z7QE 1ZHKB 3O4OC 1UC6A 2BX5A 2FEDC 1JRHH 5GGVY 4I2XA 3ZHDA 4BYHA 2RAMA 3BW9B 4GUPB 1IAII 5F70A 4RMUA 5INCB 1TTFA 1QFWL 4KK6D 2IBBA 3QPXH 2X4TA 2JB6A 2XPGB 4XX1E 1M7DB 5DJCB 5BQ7A 3TH2T 1BQSA 1J8HE 3OR6A 3QZWA 2R23B 4QOKB 1L4IA 1TITA 5KSAB 4EDWH 3O8XB 1JYXA 1BD2D 4JPWL 1S7WA 3PJSA 1KENL 4WV1C 3MRMA 3MQIA 4RQQB 1A2YB 4JKPL 1QRKA 4YEFA 4PG2A 1NCNA 1QSEA 3CK0L 4HIXH 1SJEB 1FG2A 4BUHA 4I9WE 1FNGA 3D5OF 4CADB 4HBCL 1MH5A 3T77B 5I76A 1T22B 3PWPE 1FNHA 3RAJL 1YZZA 3TPUB 3G6JF 3FO9A 4YIQB 2V2XA 5DC0A 5AD0B 1OAKL 1TENA 1MRCL 1NGWB 3D2UD 4W81A 2CDFA 5A2FA 1KN4L 2JJVA 4DGYL 4XBEH 1G6RB 1VHPA 5IW6A 12E8L 1C12A 1MPAH 3G5ZB 3GIZH 2MKLC 4L4JA 4TSBL 3KPTA 1XFPA 2ZCKH 4PP1C 4M1DL 1WWBX 5E70A 3IJHB 3GSQB 1IGIL 4LLMA 3SE8L 2FGWH 2VXSH 4X5WA 3ZTJG 1NGQH 3FTGB 5JLZA 4XX1G 4OB5H 3IS0X 4YXKL 4LMQE 4UT6H 1TVHB 4KQ4L 2J5LC 5D7LB 1CL7H 4HUWA 5E1HB 5LXGH 3QQNA 4M1GL 4QRSB 3L9RA 1I8KB 2R56L 2XZQH 3BYTA 1BBDL 1CTOA 3NZ8A 1BF8A 3MROA 1EJOH 3TBYB 1Y18B 4JZOB 2WV3A 1NC4D 2HKHL 4GAJH 1KOAA 2PKDA 4LQFL 4IRZH 3T3MF 3ULUE 1M4KA 3TCLB 1PQZA 3IXTA 3O81A 1NJ9B 1AHWA 4LRIA 3I6KA 5DWUL 4HUNB 2IFFL 3IU3A 4TNWK 4DN4L 1A6VH 3CC5B 2AK1L 3X13B 1FRGL 3PE9A 2ATKA 1EFXD 3DI2B 4Y5YB 3KPNB 3FQTA 1JP5A 4CMMB 3VXUD 4JB9H 3P77B 5C0AB 5F7EH 2AGJL 4Y1AD 2OYPA 1MIML 3QYCA 3BMVA 1GOHA 3RRQA 3OJVC 2DAVA 4MXVF 3K1DA 3HI6L 2OCFD 3G6DL 2CXGA 3CLEL 3RNQB 1DSFH 1B3JA 1UACH 1CLCA 5KVEL 2WIIB 4FTVA 2C1OB 5HHQA 4F7CB 5IMKB 4NIKB 1FJ1A 3MNWB 4JZJB 1G7QB 5DJAB 2Y36H 4HX1B 4CVZA 4NQCB 3U0PA 3QXVA 1NCDH 4MSWB 2DMCA 4HIEB 4MB4A 1CK0L 3ZKQD 2QLVB 2H1PH 4GRMB 2R23A 1X5HA 3O4LB 2W65B 1OPGH 2N7AA 5FV1L 1N6QL 4ZAKD 4BQCA 1DQLL 2D7MA 4LFHG 1UM4H 1AGEA 2MQCA 4YPJA 1IEAA 1HN1A 3DXAD 5FHAL 1EXUA 4NQDA 2HT3C 4NNXA 2OZ4H 2WMPA 2NLJA 1HYSD 3ULVD 3QUZB 4PRPD 1N7MH 3ROOB 1HSAB 2UZIL 1G7PB 1E4JA 3CMOL 1JV5B 4QHKJ 2VSCA 1DQDH 2VL5B 5D1XB 2XZCH 1U3HB 5ECJE 5DO2C 5C6TL 4XP1H 5HDQL 3IDIB 1BOGB 2N4IA 3WIFB 4L3EB 1XZ0A 2J88H 3PNWB 4KJQD 3MOAH 4ZUTB 1CCZA 2DB8A 2AK4A 4I77L 2AKRB 2DYPA 5HHOB 3SKJL 2VWEE 5E8EB 3NIDF 4G5ZL 4OFYA 4ENED 2X9XA 5HHMD 4LLMB 2A83B 1WT5C 5A3IC 3Q5TA 1YEHL 3UBXI 3O8XD 2BNQA 4MHHG 1NMAL 3IFOB 2DQIL 3HUJA 5E5UB 1M6OB 1MCSA 1NFDB 3QCUH 4F8TA 3WD5L 2PXYC 3DUSA 3BP4B 3L95A 4OCWL 5HGGS 5I74B 3Q5OA 4YLQT 4IOFD 5EN2B 5GJSL 2UY6A 4KHTH 5KSBF 4QNPE 1JRHI 1P7QB 3OKNA 3HFML 4JVPA 1D5BA 4MCZA 3WSQL 3AGVA 4O00A 5CHNB 1CDBA 2IANA 4BSWB 1BJ8A 2P5WB 3U7WL 5HBBA 1UCTA 5AWNH 5DEZA 3TJEH 4P2RD 4U1IA 2CKNA 3FQTB 5IK3B 5HHPB 2BNRD 5I6XC 1F8TH 1HH9B 4Y4KA 4MB5A 3SGJC 4PYHA 5I75C 2WBJD 4HIJA 4KVCL 2A0LC 2KQMA 1Z0NA 5INDB 2GJZA 3X3FL 2ZG1A 4NQSA 4WFGE 4UQ3B 1KPUB 5FKPA 5JORA 2H3NB 4I2XE 3D39E 3HE7A 5DC4B 2IF7A 3QXDA 1F4YH 2HWZL 2BVOB 3DMMB 1A21A 3F7PC 4YBHA 1L6ZA 5IMKA 5HHQB 4E0RA 5CD5D 1G7QA 1CDGA 1ZV5A 1I9IH 2YD8A 4ODXA 5DJAA 4KHTL 3REVA 1G7LA 2IBGA 2XTJC 5J9PB 3SDCA 4PUBH 2NY1C 2VE6B 3CX5K 4MS8D 2OL3A 3GMPA 4PJGE 3CXHK 4QHLA 4R8WH 1FZJB 2FZ3B 3ZKMD 2FECL 2H2PD 2XY2A 4N0CC 3RL1B 2WLYA 5IG7A 5D2NB 1VGKB 2XA3A 4QTHA 2IADB 3O4LA 1OTTC 1ZA3B 3OZ9H 4NM4H 4FQCH 4LU5L 2NY0C 4Z7UF 3G5YA 5BRZE 1AGEB 1A3RH 3P4OA 4I48B 1P7KA 1RZGA 5JW3H 1AR1D 1IJ9A 2Z0BA 4KJWD 1A9BB 2A6KA 4PJBB 3HMXA 5FYKE 3P4NA 1DQMH 3H3PL 4HKZB 5IMLB 3SKJH 4WV1A 2O5YH 2PXYB 3IDIA 1V7ML 2EDYA 4GBXA 5IGXH 4S1QH 1CT8A 2AERT 3DETC 2A9NL 5HGAB 1FAIH 5LCVL 4H26B 2F54A 2AXGB 1FSKC 1IC7L 1N5AB 2C1PA 3ZT7A 4ZMAT 3F65A 4FQ2L 4Q9CA 1I7ZB 1A1OA 2G9HA 2IPKA 2ZJSH 4XNXL 1CD0A 2E3VA 4R8WL 2VAAA 4OCNC 1P4BL 2NY7L 2BRRL 1VFAA 1PGRB 4HQQL 3HAEA 1TETH 4XNQA 3QUZD 5F88B 3V4UL 3ZHLA 5D1ZC 3PDGA 5DJ6B 4GBXC