1A6VL

B1-8 fv fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B1-8 FV (LIGHT CHAIN)
publication title X-Ray Structures of Fv Fragment and its (4-Hydroxy-3-Nitrophenyl)Acetate Complex of Murine B1-8 Antibody
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 110
sequence length 110
chains with identical sequence M, N
ec nomenclature
pdb deposition date 1998-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6vL00
4IRJA 3ROOB 1IVLA 1WCBA 1XGPB 2VXTL 1GC1C 4YNYA 1IGYA 2QSTA 1ADQH 5EFIA 4Z95H 4GKSB 3V52L 2YRLA 4RISH 4X4ZA 1EBAA 4XP1L 2WUCH 3U9PH 1U8PB 4JFZH 1GOHA 3BD4A 3FAWA 1WWAX 3TA3D 3HR5A 5IMOA 3H9SE 1QVOA 3MLSH 5T5NG 3EOTH 3VFVA 5TDPB 1DP0A 2DTMH 2DTSA 3G5XA 3UDWA 3G6JB 4L4VA 2APWA 3MLTA 2FX9L 1E28A 1D7FA 3NGBC 1IFHH 2B4CL 4H88H 5F7KC 4MA1C 4HIIB 1DANU 2IBZX 4LLWB 1OGAA 3VDAA 4ZNEE 4OLZH 1WLHA 2IMNA 4S1DC 4QRPA 3MXVL 3B2VL 3TPUB 3D3VB 5E95B 3DV4A 4QRRE 2JELL 1SM3L 4S0TD 4MXWL 3MRJA 3PNWB 2CKNA 3GJFB 1JV5A 2HFTA 4GBXB 3TZVA 1FFOA 1DBJL 1A3LL 4G7VL 4AY0A 2B5IC 1U6AH 3HE7D 4NQCB 1RIVL 3MBED 2VXVL 5IBUG 4N0UE 4XB8A 4P2OB 1KEGH 4M3JA 2P42B 3EFDH 4EJ1C 1MJ8L 2IPKB 3HI5H 4BFBD 5EU6A 3T65B 1FG2B 3WFCH 2IH1A 4WUUA 2ATPB 1OGTA 3HPLA 5HPOA 1WBYB 4AMKL 4NSKA 4Y5YB 3RDTA 4EDXA 1BD2D 2MTPA 2EDHA 2XA3A 3PDOA 4FP8H 8CGTA 1XAUA 3PHQA 4PLKD 1FH5H 4JG1H 1JFQL 2KH2B 4IRSB 4RSVA 4I2XA 4QF1B 3FB6B 3QIWC 3V5DB 1G1YA 5CEXA 3MV7B 1R6VA 2APVA 2FR4A 1NMCC 1JL8A 2LVEA 2HJLB 2VLJD 4IS6B 4S1RH 3RNQA 1UQSB 2HG5B 3LQZB 3UO1L 5ICXB 3FQTB 4MNQE 1PEWA 5ISZD 3BGAA 4KXZH 5TE6H 1VFBA 2DKMA 1BQHB 2WWMD 2Y1VA 4RFNB 3EYUH 1I9EA 2C4XA 4HWBA 3MGAA 3WS3B 1JYVA 3A6BH 3P4NA 4FQLL 3MLZL 4XWOD 1WFOA 3MNWA 2VLRB 5I1CH 2QEJA 4YUEH 1PQZB 4Z7UF 2IGFL 1ZS8A 3BSZL 4NN7C 12E8H 2O26U 3BH8A 1I4FB 4IOSD 3QQ9D 2VZUA 4ODUA 1ZVHA 5D7LB 3IJYB 5AG9A 1N4XL 3C2SA 2CJUL 2NLJA 2GUOB 4NRZB 2YC1A 4MSWB 3I2CL 3V6OA 5C9JB 2OZ4L 5D2NA 1CDJA 2Q20A 2A73B 3H42L 3IETA 4QOKA 1OTUD 4Q97A 1ZHBA 2OZ4A 1S9WB 3EYOB 2AK4D 5GRWA 1AD0B 4JZJA 4IHOB 2R0LL 3BZEA 3D9AH 5EN2B 5GGTH 4Z7QF 3QFDA 4RFOL 4GO6B 4DZ8B 2C3VB 5D1ZB 3BKCH 1N8ZB 4MAYC 1NCDL 4PJFB 5BZWB 1LDPH 1SEQH 3KR3H 4LIQL 3QAZB 1RZJH 4NC2B 4LPWA 1T1WB 3U4EB 1CLOL 2KDGA 5BRZA 2AJUH 3STBA 5TE7H 2W65B 3H3KA 5EBGA 5IF0A 2H2SC 1EEUA 1I1CA 5D1XA 4IDJL 3QIBD 5BXFB 1A7PH 2HRPH 2PXYD 2ZOKA 1SJEA 4L3CB 5DEZA 4RX4A 5GHWH 3SGKA 1JK8B 3GI9L 4EIZC 2D31A 2WAHA 4H1LH 1FSKB 4X6CA 1CD1B 1DDHB 1YUHA 3L5IA 4FQJH 5CHNA 5DFWH 3RPKA 5A3IC 1JYNA 5CP7B 2W9DH 4MA3B 5KS9F 5GZNC 3X12B 3KYKH 1RZKH 4UIKL 2ZUXA 1HOCA 1DBBL 5BZDB 4FQPA 4GAJH 4OCYH 2E7BA 3MROB 3RAJH 4HV8A 1ZEAL 5KW9L 2W0KA 2ESVD 3PJSA 4K71B 3ZL4H 3RY5A 25C8L 5EORH 4H8WH 1XGRA 3T3MF 5IVNA 2D03L 1QRND 1IL1B 1WSST 2X4OA 4J8RA 5EO1A 4E5XB 2D0GA 1DSFL 1WT5C 3U82B 1I7ZB 5ESQB 1Z0MA 2ATKA 5TH2B 1U3HD 2XKUA 5TE4L 3MV11 2Y7QA 1BD2E 1UB6A 2E9BA 4AG4L 1V7ML 4MQXD 4WRLA 5EC2B 4Y1AB 4ENED 3LEXB 1MHPL 3VA2C 3SKNB 4NFBA 4EBQL 3SJVA 1OM3H 1I8LC 3PWLA 1JCKA 1TLKA 2VLJE 1IGYB 3SQOL 3DGGA 1OOAA 1QSEA 4O2FA 5HI3D 4BYHA 4P23A 3T2NL 4M1CD 1CYGA 2VSCA 5LJYH 3EYVA 4ZSOE 5IB4A 4GXUN 5ISZE 1F42A 3MXWH 2H32H 1TJHL 1EA9C 4UBDD 3JWDH 4NZUH 3I50L 3HR5B 5A2IH 3TBVA 1MHHA 1RZJC 1HDMA 4U1LA 4Z7UB 2X1PA 1QVOB 3DUUA 3QDMD 3DETC 4RMWA 5FUZH 3G5XB 2J4WL 3NIFE 4XNUH 3WFBL 3MLTB 5C0BA 1E28B 1WZ1H 5JPMA 2VLKA 3GSOA 1HHGA 5KANG 3UTSB 1F4HA 4QRPB 2VXSL 1N64H 2V7HB 3D85B 2G2RA 3DV4B 3LZFH 1RZKC 3DX8B 3EO9H 2XFXA 3QXAA 5LKNA 1EGJH 3MRCB 1WC7A 4FFZH 1QLEH 3TZVB 4I13B 5HYSA 2LU4A 1CG9A 5DUML 3MGTB 1S7UB 5KJRH 4H8WC 1NLDH 2AK4E 4YFDB 5EU6B 3X14B 3IS0X 3ZE0F 4Y19A 5CKAA 4KHXH 5JHDA 1F00I 2IH1B 4WUUB 2DI9A 1NUGA 5J56B 2EH7L 3UJTH 2FGWH 4NSKB 4URTB 5F88B 3RDTB 3PDOB 2RB8A 4WI6A 4TPRL 2XKSA 3PHQB 4UDTA 2BC4A 4GRWE 3VD3A 1QUNA 3PL6B 5EA0L 1CGWA 5AWNL 4PJ8C 2FR4B 4FFVD 2D2OA 4ZPVA 3BZ4A 1Q9WA 4G42A 4YDJA 4DUVA 4OLEA 5C07A 5KG9B 3C8KA 35C8L 2J3SA 4W4OA 2ZG1A 1NGYB 4HT1L 4GMTL 3ULSB 2B2XL 3B3IA 1CDGA 4HGMA 4LSVH 1VFBB 2D7QA 1Y0LA 3JWDC 5GRJL 2YKLH 4I18B 2FIKA 3P4NB 2NY0B 1TQCC 3UJIL 1FE8L 3RIAF 4F7TA 4OBSA 5LGJB 2H2PD 3I3BA 2LAAA 4J23A 1ZS8B 1D5XB 3BH8B 1B2WL 4KMTL 4LRIC 3VG0H 2ESVE 1XR9A 3WKMH 3HS0A 4ODUB 4EN3D 3C2AH 3LN5A 4I0PD 1IM3B 3NIGE 5KVDH 1WTLA 1L6ZA 2X44D 2YC1B 3F5WA 3BQUA 3LVEA 2A1WH 1J1XH 5I30H 4X9IA 5ANME 2VDLL 5D2NB 4FFYL 3IETB 4NT6B 4ZQKA 2LAGB 4J7RA 3W9EB 5JW3L 5EWIL 5D6CA 3L9RA 1ZHBB 2YD1A 3SE4A 5IM7A 1CTOA 1O7SA 3ROLB 1CZ8L 3H7LA 4M6MH 1NMBH 4M48L 3N1QC 3BZEB 2YD3A 5D7IE 1DVFD 4WI4A 3QFDB 4ORZC 3ZT7A 3IVKB 1RV6X 3QR2A 4DGYL 4Z78A 1GC1L 2YUWA 1TJGL 5I74B 4JFYA 1CXKA 1I3RA 1GH7A 4LHUG 4E41D 3LQAH 1EK3A 4P46A 4KGJA 5L6YL 5TDOA 4WWID 4M6AA 3MREA 2Z8WC 1JWUB 2AQ1A 5DRWA 2OTUA 5E0QA 3I6GA 2Y72A 5BRZB 3ARDD 3QDME 1IAIM 4UMGA 5IF0B 3SDCC 1FNLA 4JKLA 5DVKA 1Q1JL 5D1XB 4MB5A 5LCVH 4PLNC 1QSFA 3VH8B 4XVTH 2QTEA 2JB6A 1SJEB 1YEFH 2XKNA 5CGTA 5CLWA 4HF5L 5C2BL 1T66C 2D31B 5GGSY 1DCLA 4X6CB 1CLYH 4YXLL 1LE5B 1YUHB 1IGMH 2IMMA 5CHNB 2E7CA 3MV8D 3PP4L 4WTZA 3HA0A 1HOCB 3GI8L 1M7IA 4PJAF 5C0GA 3PWJA 4C4KT 4IMLA 4UNTA 5FCSH 4HV8B 4PY8I 3AY4C 1P7QB 1FNGA 3LMJL 3PQYD 1JRHI 1XGRB 2CDGB 3EYQD 5KVFL 1C5CH 2X4OB 5EO1B 3VCLA 4EUPH 4TQEL 4XP9L 2ATKB 3CZFB 2QSCL 2ARJB 5I8KL 1CWVA 1UB6B 1AQKL 3T4AA 2N4IA 4NQVA 2MWCA 3TT1L 4GQPH 5HYJA 2VAAB 1FZJA 4TVPL 3MUGA 3ZLQC 3O2VL 3OKEA 3DROA 1SBBA 2RHEA 1IE5A 3SJVB 3PWLB 1AJ7L 3BMVA 3DGGB 3FB7A 1GZPA 4MS8D 5D7SH 4O2FB 4P4KD 3IGAA 2LTQB 3QIWA 1XGQA 5C09A 4N68A 3QEGH 1ADQL 3OAZH 4LL9A 5IB4B 4R4FL 3L3DA 4Z95L 1MF2H 3LQAC 3D0VB 3U0PA 5DJZA 1D5MA 4RISL 4U1IB 2WUCL 3ULUE 2IQ9H 3U9PL 4X7CC 1KIPA 3TBVB 1MHHB 2VZTA 1ADQA 1HDMB 4U1LB 4JFZL 1LP9E 3UTZA 3MBXH 1MPAH 1MAMH 4O2EB 1M4KA 2O5XL 1ZVSA 3QNYA 5GGVH 5HHMD 2C4FU 1OW0C 5C0BB 1RIHH 3FJTA 3EOTL 5GGRY 3MO1A 5JPMB 3C6LC 2VLKB 2DTML 3KXFD 3B2UD 4E42A 4LF3A 5DD6A 1HHGB 3MJ8A 2VWEE 3O6FA 4Y4HD 2DD8H 5EO9A 2DMCA 3AB0C 1IFHL 4NQED 4H88L 3RZCC 4PGEA 5AG8A 5J9PA 2C5DC 4GXVH 3QXAB 4OLZL 4NBXB 1WC7B 3VXSA 4A2MA 1J7VR 4R4ND 2EDEA 3GMQA 3MRLA 5FCUH 4OI8A 1EZVX 1CG9B 2JTDA 5EBLA 4X5XA 4MD0A 1J8HA 3NAAH 3GSXA 1SJHA 4FQXA 2NX5E 4ZUUA 5EOQH 1U6AL 4Q6YA 1QPXA 4Y19B 1KEGL 5D70H 1Y6KR 4PJ5D 3EFDL 5KSBE 1FGVH 4TSBH 3HI5L 3O2DH 3ARFD 3INUH 4UDTB 3WFCL 2BC4B 5H8DA 3JSSA 1T6WA 4E41E 4HCRA 1BQHG 4FP8L 1C1EL 4HDIA 1FH5L 1MCJA 3NH7H 4JG1L 1QBAA 5J7CC 3TO4D 1Q9WB 4G42B 4YDJB 4N0FA 1OP3K 5C07B 4R97C 3C8KB 4M4PA 1F4YH 3ARUA 4S1RL 3B3IB 4QO1A 4Y5XA 3HUJA 2VOTA 2Z4QA 4G9FA 2IQAA 5GGUA 3VI4F 1Y0LB 3QYCA 4PJAB 2GCYA 1F8TH 1BGXH 5TE6L 1NDMA 1U8HA 4UUJB 1T7YA 2CLVA 3EW3B 1YYMH 4J3WA 3EYUL 3MV8E 4NKQB 2ZP0T 3QNXA 4Y4KD 4F7TB 4HZLB 5EU5B 1R3LB 3A6BL 2VL5A 4DKAA 1CFSA 5H94A 5I1CL 1XR9B 3F7YA 4W70A 4YUEL 3EDKA 3LN5B 1CDCA 2GY7B 4OCXH 12E8L 3VXNA 3D69A 3IFLH 4OLWH 4OAWA 4OFDA 5AD0A 5GS0D 1KC5L 5HI5D 3U36A 1ZWIA 4B7IA 4ZQKB 3G5YA 1ZE3C 3S4SG 2K7PA 4WWKC 5EIQA 1L7IL 2J2ZA 4OCRH 1YA5A 2A6JA 3KWWA 4MJ6A 2UUDH 2AJZA 4L4TA 2V5MA 2D3VA 1G6RA 1DQJB 1HINL 2O61A 3D9AL 1JF1B 4Z78B 1PG7H 4JFYB 5GGTL 5ITBH 1I3RB 5E8EA 1RVFH 4P46B 7FABL 4WI7A 5DMJB 1MCDA 4NQSB 2IBGA 3BKCL 5E9DA 2NMSA 2XY2A 3DI3B 5DRWB 1I1AD 1KIRA 5FOJA 5IW6B 5E8OA 4PTTA 3I6GB 1HZHH 1LDPL 2ITDA 5C0RH 1AR1D 3KR3L 4U49A 3GMPA 3RGVC 5I1LA 1RZJL 1J87A 1K3ZA 3FQWA 1QSFB 2AJUL 1NBYA 3H3PH 3ZE2E 3WJLC 2XKNB 4PGCA 5EB9A 2X05A 4F37F 3NACL 3FFDA 3QXDA 3KXFE 5IW3A 1OHQA 4BQCA 4JKMA 1A7PL 2HRPL 1ES0A 5GHWL 4NQEE 3G9AB 4YDLB 2F8XC 5DD3H 4F33A 1QD0A 1OP9A 1NPUA 2Z0BA 4RFEA 3NGBB 4FQJL 5INCB 1JZ7A 2W9DL 3ZKQD 3MRKB 4MA1B 2VKWA 2CH8A 4KK6D 4H1LA 3VMPA 4XP6H 2EE3A 4W81A 4DJMA 3GJEA 4RGND 2MOVA 1G7PA 4OCYL 1F13A 5C0DA 2X89D 4MVBD 2D7MA 3BIKB 1FL6A 3ZL4L 1YNKL 2I07A 5EORL 3VCLB 4H8WL 4J6RH 4PJBE 4L3EA 4LAQH 1E4JA 2B5IB 1DANT 5HD8C 4F7PA 5FDWA 3T4AB 1F4WH 4C54A 3WDIA 1DN2A 2N56A 2MFNA 3NCJH 5HYJB 3VMNA 1ZLSH 4OCWH 2D4DA 2VKXA 1KTKE 4DFIA 3OKEB 3DROB 4YFLF 3P9WB 1LDSA 1E4KA 1WEJH 4Q0XH 5HGHA 3UZVB 3FB7B 2BRRH 1GZPB 5KSAC 3IGAB 3FZUC 2FBJH 3QIWB 2YRPA 4ZUSB 1OM3L 4BELD 1XGQB 1T04A 1IAII 2NZIA 4HGKC 2PTTB 3OHXB 5FYLD 1NMCB 5CZKA 3H0TA 1I3UA 3U0PB 5DJZB 1D5MB 4UOJA 2A0LD 5D72H 3RVUD 1R5IB 3D39E 1XIWA 5B8CC 3MUY1 2WLYA 4X6DA 2X4TB 3S9DB 1KIPB 2NYYD 2VAJA 2RFXA 3MXWL 4BJLA 3UTZB 4D2NA 3JWDL 1ZVSB 1D5ZA 3HRZA 2G5BA 5DJ2A 1MAKA 2H32A 1F6FB 4ZO9A 3P4MB 2EDNA 3MO1B 3BEVB 4RX4D 5FUZL 3VFSA 4XNUL 3MV9D 4X9FA 4NO0A 1WZ1L 1A14H 4KC3B 4PGEB 5J9PB 4KK5D 2R1WA 3FONB 2HFEA 4NN7B 3QULA 1JHTA 4WU7A 1N5AA 1N64L 4JVPA 3LZFL 2KL6A 3EO9L 4WIQA 3RVXD 3S96A 1EGJL 5ESAA 1NUFA 3OJMB 1QFWH 4FFZL 3T4YA 4KQ4H 4MD0B 2XTJC 1J8HB 3ARTA 4ZUUB 1YNTA 1EGJA 1JPTL 5CWSA 4ORGA 5KJRL 4LSRH 1WTGT 5F7UA 1NLDL 4XPHH 2NY6C 3WE6B 3NABH 5EIVA 2OBGA 1WIOA 5DHYB 4X4YA 4OIAA 1A9EA 1DBAH 2HT4C 2ZNXA 3UJTL 1ZLVK 4YDKH 2GT9A 1B0GA 1R24A 4NNXA 2DQFB 1FJ1A 1T6VN 5MENA 3TN0C 4ZXBA 5C0AD 1RURL 1BZ7A 1QSED 5K9QG 1EO7A 1MCPH 4MAYB 4NC1C 4MXVE 1A3RL 1CD9B 3QSKB 4JHZA 4AL8H 5J1SC 4Z7NF 2YBRA 2Z4QB 2FO1A 2JLLA 5HVWA 4G9FB 3P9MA 2I9TA 4CMHC 3OF6A 2GCYB 3PV7A 2YUXA 2IAMD 1Q8MA 4LSVL 1U8HB 1UB5B 2J8UF 2CLVB 3U2SA 5A43C 2BNUB 3QNXB 5DZNA 3BP5A 4X6DF 2YKLL 5K59F 2VL5B 4JEGB 5CEYB 4LVNB 1QSVA 4I3GA 4JR9H 4K23H 2EKJA 5HGGS 1SBSH 3K2UH 4RGNE 1V5JA 1A6AB 5JW4R 4BK5A 3VXNB 2ZNWA 1HCVA 3D69B 4KTDH 3VG0L 4GW4B 3LEVH 4OAWB 3AREC 3C2AL 5J57B 1G7LA 2YPLA 3AY4A 4KKLC 1ZWIB 3ZT6A 1BAFH 3WLBA 3DYPA 4D8PA 3G5YB 1FL3A 4XMPH 2A1WL 4KH2A 1J1XL 5SX5K 3AS2A 4NHUA 4GH7B 3WJJA 4YC2C 3KWWB 4MJ6B 5IG7A 5TQ2L 3VWJD 2NNAA 5INDA 4M5ZH 4JZNA 2AJZB 3S34H 4M6ML 1NMBL 3L5JA 2O61B 3VH8G 3HLAB 4UT9H 5EUOA 1OAKH 1G7MB 2YXFA 5FYLE 1P7KB 1KJ2H 5TF1L 5I75C 2PKDA 4P2CG 1U8OA 4CBPA 3ZDXF 1T4KB 4D3CH 3C08H 5E8OB 4PTTB 2M8XA 4ODWA 2ITDB 3U9UA 4N5ED 5I1LB 3QDJA 1ORSA 1HWGB 1IQDB 4MCZA 2HTKD 4F57H 2OS7A 3RVVC 3V7MA 4ACPA 3GZKA 4KVNH 2IFFH 5DK0B 4U4BA 1NBYB 2WSKA 4PGCB 5J3HC 4PJIA 5LCVL 3QXDB 4ONFH 2X6MA 1KPVA 3IFOA 4OFVA 3MV9E 4XVTL 2XT1B 1YEFL 1ES0B 2AXFA 1PEZA 2OR9H 4NWTH 5J13C 1V3LA 4F33B 1CLYL 1WQVT 4GKNB 1IGML 1DN0A 1LEGA 3Q5YA 1UFUA 3X3FH 4FMKA 5L8KB 5CZXC 4H1LB 3TBWA 5CILL 3GJEB 2OYPA 1WAAA 4NKDA 4S10A 4KJQD 3F65A 3P11H 5B21A 3HC3H 4POUB 4LCIH 1FL6B 3L3IA 5GRYA 4XVUD 4LASL 3L95A 1FPTL 4L3EB 2HT2D 4BKLA 5HY9B 3KJ6L 3U1SH 5T1DH 3TESA 3L5XH 5FDWB 1YQVL 3RWJA 4G9DA 1F4AA 3I85A 5IEKA 3QNZA 2I60H 4EUPA 3IT8D 4J12A 1GOGA 5MEQB 1UEYA 1OTTD 2X2YA 5DZOA 4S1SH 5HGHB 5CZVH 3UTTA 3IAGC 3S37H 5I6XC 1T04B 5GRVK 4TOYH 4MHHG 4PJ8B 1QOKA 2NY7H 4XPAL 2J8UB 1JWSA 3H0TB 3BXNA 1EMTH 4WI3A 5I17A 2EXWD 2GJ6B 4X6DB 2RFXB 4HK0A 1MF2L 2I5YH 3CU7A 2E7HA 2X9WA 2DQJH 1D5ZB 1TZHA 5DMIH 3GSQA 3QJFB 1ZT4A 1PZ5B 2G5BB 2R2BA 3HRZB 4N9GB 4P3DA 5DJ2B 1JHKH 2H32B 1MPAL 1MAML 4LLDA 3B9KA 5GGVL 4YBQD 5F7FA 2Q6WB 1S78D 4I0KA 3VFSB 1RIHL 4NO0B 1TQCB 2ZSVA 4LSDA 5DD5H 2EDLA 4PJIF 1GSMA 5FK9A 4AEEA 2B20A 2BSTB 3BEWA 1RHHA 2DD8L 2R1WB 2HFEB 3QULB 1JHTB 1TITA 4WU7B 1N5AB 1GHFH 1A6WH 4WHTA 1T0MA 4QGYA 2DS4A 3JTSA 3VW3L 4GXVL 2JCCA 3S96B 5ESAB 5B4MC 2FYYA 5K9OA 3K8LA 3HE6C 2EYRB 4NO2A 2FX7H 5FCUL 1XEDA 1RJCA 4KV5F 5D5ME 5E8NA 3MCG1 3NAAL 4ORGB 4MQTB 5EOCJ 5I8OL 3EO0A 2CUMA 5D70L 1A9EB 3K2MC 1FGVL 4TSBL 1NGPH 4KVCH 2BNRE 1AC0A 3O2DL 4B50A 1B0GB 1R24B 4NNXB 3INUL 5MENB 4ZD3H 1I1FA 1OCWL 1U92A 3AROA 1MJJA 1KN2H 1MFAH 1YPZA 1R0AH 3NH7L 1BZ7B 4PV8B 3AMKA 1WBZA 1IEBA 4X4XA 1TZIA 1PYWA 1D6EA 2JJVA 4NO3B 4UT6L 1F4YL 3P9MB 4NPYA 2I9TB 5ELIA 5GRZA 3ZKMC 4PGJA 3OJDA 3E6HA 3SDCB 4UQ2A 3U7WH 1EEYA 3RA7H 4U33A 1HHIB 5DQJB 3SE8H 1ZGLM 1F8TL 3BP5B 1HHHA 1MUJA 1BGXL 3UPCA 4HUNB 2E8YA 5TQ0H 1X7QA 3EKCA 3LCYA 1YYML 2V17H 1DQMH 5BW7A 3MLVH 3T2OA 4P2QA 3IKKA 3O6FD 5C6TH 2QSVA 4FQHB 3RUGA 2AXJA 3I3DA 1KXVC 4X80H 1KB5H 1SHMA 4RNRB 4OCXL 3DX9A 1ZA3A 3O81A 1KOAA 3I6LD 2V5YA 3WLBB 4U05A 4ZS6D 3CMOH 4E9LA 1FL3B 1FYTD 4IMKC 2VDPH 5E03A 3UYRH 3UPRA 1P4IH 4WFGD 5IVZA 4GKZA 5FO7A 3O6KL 3L1OH 5HHQA 2CRIA 1F6AB 4P57A 1EERB 4HMDA 2DF3A 1UWXK 4JZNB 4UV7L 3VFRA 1JGDA 4OCRL 4ZOEA 5ICZA 1BBJA 2W38A 5FUCE 4ETQA 4PJDA 3MJ7A 5DUPL 3WV0A 1A4JA 5JUEH 3LN9A 3RVWD 2IF7A 1UM4H 4ZS7H 3C5ZD 2M26A 4C83B 3W11C 2GITA 1PG7L 5ITBL 2Y6SC 3QUYD 1U8OB 1RVFL 2R69L 5KSAA 4ODWB 4K94H 4BK4A 4UTBL 4YGVA 4Q7DA 2VXQH 4EDWH 2YD2A 3QDJB 1ORSB 2BSSA 3BO8A 4JRWA 1BVKB 1HZHL 2APXA 3EJYD 5C0RL 4DKDC 5FV2A 5CLTA 4PJIB 1GL4B 4GJTB 3IFOB 4DCQB 5D2LF 4Z7VE 3TP4A 2AXFB 4YGAB 2EEDA 5JDJA 5L9DH 3VXTB 4G6KL 4UOW0 3AU1A 3H3BC 3T8XA 4ZUTB 3C6LB 1R5WA 3CSYB 4H20L 3UTOA 5CIPA 4FG6D 4PJXF 1HYRC 3TBWB 4NQDA 5ICYA 5I66B 3AB0B 4NKDB 3RZCB 3DBXA 3DMMD 4YEFA 4RGMB 1G7IB 4PLOB 4ZUVA 3QUZC 2C4FT 2X4UB 2JKXA 3L3IB 3C60A 2JIXA 2M2DA 2X4NA 4KJPC 4PJGE 4LLUA 4XTRD 1LMKA 1FORL 5E70A 4TN9A 1SVCP 2AXHA 4BKLB 1V7NL 2D7NA 5DK3A 3MOQA 5FM5O 2C3WA 2F58H 2V9RA 4J6RL 4KDWA 4LAQL 3RWJB 4G9DB 3KYMB 4LLMB 5IHZA 3BH9B 5GIRA 5IEKB 1E4WH 2XYCA 4TNVF 3QNZB 1F4WL 1F11A 2F54D 4EUPB 4H26A 4AJ0A 1QNZH 5ADOH 3NCJL 4L4TD 1NGQH 2EICA 1ZLSL 4OCWL 2BK8A 1JTPA 3LPGA 4P2RA 3UTTB 1ED3A 1W72L 5HYFA 2VRAA 1WEJL 4Q0XL 4Z7WF 3O4LD 2BRRL 4BQBA 4X8XA 3O8XC 1MJUH 1JWSB 1MCCA 2FBJL 4YE4H 5CFHA 3TN0A 1N5YH 3LIZH 3RQ3A 5E9DD 5E6ZA 4HK0B 4R97B 4X5WB 5D72L 4K94C 3EGSA 2BJMH 3GSQB 1I9IH 4P3DB 4JRYE 1GOFA 4J3XA 5IB3A 2GK0A 4OI7A 4LLDB 5BO1H 2GSIB 2COQA 4OQTA 2CDFA 4YK4B 2ZSVB 2X4SA 3X11A 2DQTH 1F58H 1FCCA 3IJHA 4X7FC 5FK9B 1K85A 3BEWB 1RHHB 1T03H 3KPNA 1A14L 3LEYH 4WHTB 3I6LE 3JTSB 4PJCE 4YR6A 2JCCB 3V5KA 3MCKA 1FYTE 4WGVB 5CEZL 4JFQA 4NQUA 4PJEA 5K9OB 4WFGE 2BY1A 2WZPD 2W9EH 1AKJD 4ZFFA 3JWOH 3QHTC 2Z8SA 5AUMA 2X4PB 3NFSH 5JOPD 1QFWL 43C9B 5E8NB 3UX9B 4PJ9D 5D7JD 5HPMB 3MRPA 4Z0BH 1V3MA 4WWKB 4G6AC 4K3EH 1VB9A 4LHUD 1ZTXH 2YK1H 1YEEH 3O4OC 4Z9KB 4KK8C 2R9HC 4QRUA 5JIKA 3DXAA 4XPHL 2EIEA 5DD0H 5DURB 1I1FB 1DBAL 2IPUG 2AJVH 4YDKL 5M94B 4XNZC 4WENB 1YPZB 2NY2C 3SDYH 3IKCB 3W39B 1NSNH 1CBVH 1NFDE 2VDOH 4MZ2A 3ZYZA 4JFED 4MXQC 3PXHA 1P6AB 1U3ZA 2X1QA 3G04B 4X4XB 1TZIB 1H3TA 1D6EB 1PYWB 3TNMA 1MCPL 5CMAA 1JWMA 1EEZA 3QEQA 4AL8L 1NAML 3OJDB 3RGVB 4AIOA 4PBWD 4UQ2B 4PJXB 1S8DA 4ELMF 3RY4A 2QQNH 2X7LA 4P5KB 3ZDZE 1MUJB 3KYAA 5JNYB 4RA3A 3PG2A 4U7MA 1X7QB 4YPGA 3HG1D 1JF6A 1ITCA 5DJ8A 3VGAC 3IDXH 5C7XH 5CS7A 5J6GA 2ADGA 2EEBA 1QYGH 4MLIA 4HBQA 2IPTH 4K23L 2NXZC 1SBSL 3RUGB 3K2UL 5I0ZA 1NQBA 1X6LA 2I25N 3IYLW 3DX9B 3KYOB 2AXGA 1ZA3B 3QP3A 4KTDL 5D71H 3I02A 1YEKH 3LEVL 1OAUL 4H25A 2P8PA 2R2HB 1MJ7L 5IVZB 1MLBA 5FO7B 5FGCE 3CX2A 5IR1A 1BAFL 4OZGF 4P57B 4XMPL 3JWOC 4X9HA 2F54E 5KANI 3L3GA 5CCKH 1BQUA 3VFRB 4JG0H 4KDVA 3B5HA 5IB5B 5ICZB 4M5ZL 1BBJB 1MCLA 2FRGP 2V7NA 4ETQB 4PJDB 5I1GL 3MJ7B 3S34L 5DFVC 1A4JB 5I1HH 1IQWH 4H5SA 3O4LE 3QG7H 3IFPB 3VJ6B 3ZTNH 5JQ6L 3FQUA 3SGEI 4UT9L 3CDCA 1OAKL 2IBZY 5ABDE 4ZXBD 5KSAB 2XNAB 3KLSA 1KJ2L 2FD6H 4G6MH 4JM2D 4WNQA 4YGVB 3MJ9H 1DL7H 3SKUD 2BSSB 3BO8B 4NQCD 4D3CL 3C08L 4XWGL 5B8CB 1KJ2A 3CVHA 3BW9B 1EAPA 4U2YA 4F57L 1LO0H 2FLBT 2WBJA 3MV01 3VI3F 4U1GC 2IFFL 2J88H 3ORJA 1CDYA 4GRMA 4C59B 2CIIB 3OG6B 1RHFA 4ONFL 4HFUH 4HXBH 3AU1B 4IRSD 3T8XB 2OR9L 1R5WB 1KUMA 1FNEA 4XP5H 4BZYA 4NQDB 5ICYB 3TJHC 5HVFB 1A7BA 2E6PA 4GFTB 1TMCB 1T2JA 4QKXB 3X3FL 3J7HA 5JOPE 1UKSA 2JIXB 3KHQA 4LLUB 4P5TC 3P11L 2YPLD 4MNGE 4LNVA 2R2CA 3QIUD 1ND0A 2FEDC 4LCIL 1CFNA 3HE6A 2XTJB 5DJ0A 3IRZA 2NQCA 3V7AG 1A7QH 1EJ6A 4JLRB 3U1SL 5IHZB 5GIRB 3L5XL 5EUKA 2DLFH 4PRPE 3WHE0 4NN6C 5DK2B 4H26B 2ZG2A 3ZDYE 1F5WA 4OZFA 2NY6B 3RKDC 4WHCA 2I60L 5C8JA 2EDJA 1RZGA 4S1SL 5CZVL 1MHCA 4JFEE 4DW2H 4Q9BA 3S37L 3VXMA 1QBMH 3Q0HA 3TN0B 4TOYL 3LY6A 4AH2A 2AERT 1U95A 1JTOA 2OMNA 5TPWH 2NY7L 4NKIL 2WIMA 3CFJA 2GSGA 2R2EA 4O5LL 4OZHF 3EGSB 1FDLL 1A6TA 5IB3B 5IVXE 3LS4H 2V5RA 2GK0B 2CK2A 3HG1E 4CMHB 2DJ4A 4MX7A 4I0CC 1MI5D 1JHKL 1CFQA 3MOAL 3QDAA 2BVPA 2RAMA 3DO7B 2CDFB 2HT3C 2X4SB 3X11B 3MRHA 4KKBC 1U2CA 4KGLA 4FXLA 2Z92B 1G84A 4RGOH 2HVKA 5J12C 2D0FA 3KPNB 3V0VA 4OZGB 1CXEA 1Z5LA 3L3JA 4YR6B 4MJIA 3D0LA 3GJFK 4D9QD 4JFQB 4CVWA 1RU9H 1UJTA 5F9JB 1NMAL 1GHFL 1A6WL 5E1HB 4ZFFB 3AREB 5AUMB 2Y23A 3PE9A 2HJKA 2HVJB 4JFDA 2YXMA 3RWGB 4HJ0C 3B43A 2FX7L 4LEXH 3MRPB 4IMKA 1Q9OA 1QLFA 4NJ9L 3HZMB 4PR5B 2Z93A 3RIFK 2FSEA 1DQTA 3MLUH 5A2JH 4YC2B 4QRUB 5ERWB 4OM1L 5JIIA 3DXAB 5FYKD 4JHWH 4HK3J 1TETH 2ZOLA 4FQCH 1ZGLP 4LU5L 4HIXL 1NGPL 4KVCL 4OF3A 5DJAA 1A64A 2Q76A 4GLRH 4MDJA 1KULA 2ICEA 2MKWA 1TENA 1AIFA 1X6NA 5FHBH 4XCEA 4PV9A 2CQVA 1KN2L 1MFAL 1YY8B 4NQCE 5CJQH 5DFTA 3Q6GH 4G6JH 5I75B 1R0AL 2A38A 3TIEB 3VRLE 4B41A 3TNMB 5CMAB 1U58A 2EECA 3E3QC 5SWSD 2H6PA 3QEQB 3PUCA 3R8QA 3BUYA 4KZEH 1YEDA 4G43B 3VGDA 1S8DB 3P3YA 1K8DA 1MVFA 3PHSA 4NP4H 5I19H 2OR7A 3D18B 4TULL 1YMMD 1T21B 5C0ND 3MRQA 5SX4H 1S7WA 2K3TA 5IUSA 4YPGB 4WW1A 3VFMA 1BQLH 1CD0A 2C1PB 3SE8L 1JPGA 4N8VA 4HPYH 1SY6A 5J6GB 2ADGB 1YECL 5TQ0L 5J13B 1NC2A 2V17L 5JW4N 2PR4H 3WLWD 4QHLA 5IK3B 2R1XA 5L8LB 2ARWA 3CXDH 3MLVL 2AXGB 1E4XI 3OZ9H 3QXTA 5C6TL 3I02B 1TJIL 4YHLH 2WNGA 2AEPH 2P8PB 1KB5L 5I2IB 2VDMH 3OKOA 1QFHA 4W6XB 4YHIB 3HMXH 5E00A 3QA3B 1MLBB 5IEHA 5IR1B 3CMOL 2OJEA 4UTAL 5FKPA 2VDPL 3UYRL 2P8LA 1P4IL 3L3GB 3QFJD 5IV2A 3L1OL 4PRIA 4RZCA 5IIEA 1CN4A 3BGFC 3HPJB 1UWEL 3QCVL 2V7NB 2BP3A 4WW2F 4XBEH 4OF7A 5E94B 3KLAA 4U7SA 4H5SB 4MA8H 1UC6A 5AZ2H 4GSDH 2O5YH 4NRXB 3U30C 4YJZL 3MRFA 3GMLA 3D85D 3FQUB 4Q74A 4XAKE 1A7RH 5DMGD 1JN6A 3H8NA 3V79C 1UM4L 3HE7C 4ZS7L 5I6XB 4WNQB 3O3UN 1JPSH 3O8XA 1QR4A 1KJ2B 4JM4L 2VXQL 4EDWL 2PTUA 1EAPB 4MB4A 2R4SH 3TVMD 4YHNB 1MI5E 4OZIA 4GRWH 4PLKC 1R5VA 3KPRA 3TBYA 3KAAA 1U41A 4Z7OF 4O00A 2NY5H 4XI5C 1BOGB 3MNZA 3PL6D 3FQNA 4QWWD 4X7TA 3WIHL 5L9DL 2FJGA 4D9QE 4NIKB 4ZFOA 1HYSD 4P2QD 4YQXH 5E5UB 5TF0A 5DRZA 4AM0B 4OV5A 2E7LA 4JQXC 2WWMC 1Y18A 1LO5A 5FUOH 2ID5A 1CFNB 3HE6B 2HAZA 4KRPD 2APFA 4XWOC 3LKSA 2V9TA 1K5NA 2E27H 1IAOA 1HN1A 1JUFA 4KU1A 3S35H 3B9DA 5FYKE 1YY9D 2F58L 4RRPG 3DX7A 2NY0D 3TV3H 4M00A 5HDQH 3X3GL 4HLZH 4JRXA 3QQ9C 1B3JA 1DEDA 2V2WB 5C8JB 1QNZL 1RZGB 3BD5A 2P7TA 3VA6A 1NGQL 3CFCH 4K3JH 3BP6A 4K3HA 3BWUC 5J8OA 4MJ5A 4X9BA 5JXAH 4LCWA 1QG3A 2JJWA 1DBKL 3VXMB 1DLFH 1CIDA 1O7VA 1BVLA 2ED8A 1OTUC 4AH2B 5SWSE 1U95B 3WHXA 1MJUL 3PGDA 3OPZH 5E2WL 1N5YL 2DYPA 2GSGB 2R2EB 2A2QT 4UQ3A 3LIZL 1XCQB 4D9RD 4KMLB 3HAEG 2GIYA 2WP3T 3MFFB 4KI5C 1HHJA 4FN0A 4PRDA 5JHLH 4E0RA 1A1NA 1A6TB 1YMME 4KQ3H 4FQ1H 1ZHLB 3HCVA 2BJML 3W9DA 2G75A 4B0MM 4Z77A 1CL7I 1IM9A 1F3DH 1CQYA 5I1DB 3N1MC 2BVPB 2Y25A 2DWEA 4XNXH 5BV7H 3ARBD 2CUHA 5FHAH 2NY5C 2HVKB 2DQTL 1FNFA 3V0VB 1YEGH 1T5XA 1S7VA 4N9OB 1T0NA 3D0LB 1EO8L 4OD2B 5BVJA 1T03L 3C9NA 3CLEH 4AT6A 2FH8A 2ZUQC 4G8IA 1CE1H 1GXEA 2XACC 3LEYL 3QI9A 4Z7UE 4ZO7A 2PXYC 3BN9C 1VHPA 4JFDB 2W9EL 3GSVA 3QFJE 4I3RL 3JWOL 3KGRA 3K3QA 1I7TA 1Q9OB 4QHMB 2FSEB 4EI5D 4N8PA 4JY4A 4K3EL 3UTSE 1ZTXL 1BREA 2YK1L 2ZOLB 5T1KD 4HFWA 1C16B 1OB1B 1YEEL 4MDJB 3U46A 5C0FA 3P30H 4P2RD 5C0CB 1AIFB 4HWNA 3HI6H 3B8YA 2AJVL 1S7QA 4XCEB 4PV9B 2DI8A 5GGQL 2DMBA 5J1AA 5KSVB 2N7BA 6FABH 1YN6B 1G1CA 4PS4H 4Z7QE 3SDYL 1NSNL 4D0DA 3GUTA 1U3HC 1U58B 2DWDA 2A9MH 1CFTA 4WVRA 1YEHH 4MQXC 3BUYB 1YEDB 4OD3H 4Y2DD 3BP4A 1B4RA 1VERA 1FO0H 5ALCH 3GSNA 1UXWA 1I85A 2E6JA 3KLHD 1R3JA 3CIQA 3MRQB 1S7WB 1UWGH 1RPQA 4WW1B 3VFMB 1JPGB 2FJHA 4N8VB 1FQ9C 1K8IA 2JJSA 2AI0H 4HJJH 1RD6A 1NC2B 5FM4A 2VDNH 4QHLB 2EC8A 3M17A 5BV7C 4M43L 4UBDC 1QYGL 4ODVH 3RJQB 2IPTL 2DLIA 5KS9E 3GSWA 5DRXB 1LD9B 1OT1A 3CLFH 3OKOB 1A02N 5IEHB 5D71L 2Z9TA 3QUZB 4ZAKC 1YEKL 2OJEB 3JV6A 5FKPB 4F2MA 2EDRA 1PG7X 1KB5B 2P8LB 3H9SA 4KROC 5IV2B 4ODHH 4RZCB 5IIEB 5MI0C 3T3ME 1BVZA 2A74A 2VDRH 1P7HL 3WSQH 4IOIA 1S9YA 2MQ3A 3ZT5A 3KLAB 1MCFA 2YA0A 4HKZB 2VZSA 4YHPA 3MRFB 1OTSC 4M9OA 4PJHF 4ZNEA 5I1HL 1IQWL 2P24A 1A47A 1JN6B 3CVIL 1KLUA 3QG7L 4QT5B 3ZTNL 2AKRB 2WMPA 4QRRA 2G5RA 2VR4A 5C86A 1RUQH 4D9RE 3Q5OA 4HS8L 1T1YB 3L3KA 3DI2B 3O8XB 3EDJA 3BJ91 5KN5B 3V8CA 2FD6L 4G6ML 2P47B 3QUMH 3MJ9L 4WI9A 3IDYC 4OFPA 1DL7L 4PD4J 3IDMA 4HUVA 4EVNA 2JB5H 4N0UA 4OZIB 1R5VB 3H9HB 3MJ9A 3C09C 3D6GA 3KPRB 3TBYB 1J5OH 4PY7A 1NEUA 3SE3A 3BWAA 2JJTC 3MNZB 4OJFH 4FFVC 1AGCA 4BZ2H 3PDGA 2VERN 1MFDL 4AEFA 2A77H 4HFUL 3TNNB 4HXBL 3SDXF 4JAMA 1EHNA 1RJLB 4ZFOB 3QXVA 4PD4K 1VFUA 3V6ZA 5CUSL 2HTLC 4HKJB 4UB0L 3FQRB 3VXRD 2UVFA 5DRZB 4LIQE 4OV5B 4N0YH 4OLXH 1T3FB 2DAVA 4WI2A 1AY1H 4DFHA 1LNUB 3O9WD 4MNQA 2EXYC 3LKSB 1K5NB 1IAOB 4I48A 4K7PY 3LSOA 2H2PC 3PWUA 4YHKH 3MQIA 2Y9RT 4RMRA 5HI4D 1Q9KA 4JRXB 1A7QL 4HUKB 3SN6N 4EN3C 4QNPF 1JI1A 1U91A 2DLFL 4I0PC 3K4AA 3O4OB 2P7TB 2P1YA 3ZE0E 3PWPB 4LCWB 2X40A 4GG8A 3SKJH 1BVLB 4XNZB 2HN7A 1PJ9A 4G8GD 3VWKD 2NY2B 1JZ8A 3RIAK 4DW2L 2XG5A 1T80A 1QBML 2DBLH 3PGDB 3Q6FA 4UQ3B 1QLRB 4FOMA 2WINA 2ORBL 5FO9B 4PG2C 5CJOH 5TPWL 1EFXB 2EZ0D 4PRDB 1AR2A 4E0RB 1A1NB 7CGTA 3DVGA 3HCVB 4PGZA 1EFQA 4O58H 3VGFA 2W91A 4OCSH 1DVFC 4Z77B 3DSFL 1J0YA 2GJZA 1NAKL 1Z9SA 4G80A 3GRWH 3LS4L 5I1KH 3REVA 2DWEB 1NCAH 4M5YH 2HKFH 2N7AA 5D1QA 3T0ED 4XBPA 1WFUA 1NGWA 1L6XA 3VGAB 4Z5RA 5GZOD 3MLWH 1S7VB 1BM3L 2P8MA 3QHFL 2VIRA 4RGOL 1T0NB 1XZ0A 5BVJB 1LEIA 3C9NB 4S11A 3ARDC 4G8IB 3OAUH 2ADFH 2NXZB 3QI9B 3NCYP 2ICWJ 4JB9H 2G9HA 2BOBA 3LRSB 3TA3A 1CXHA 1SMOA 3GSVB 1W0WA 4HXAH 4IRZH 3E1F1 4Z6AT 5C0BE 4OT1L 4HKXA 1LO2H 2XPGB 4G6FD 3OJVC 5E7FA 2VLKE 4LEXL 1GGUA 1ZANL 1AHWC 4JY4B 1D6VL 2FH6A 3VFPB 4NM8H 4WO4D 2Z91A 4HFWB 4NQXB 4BFGA 3MLUL 1XCTA 4IEFB 4XZUA 1II4E 5C0FB 1BJMA 1YJDH 3HI1B 4JHWL 1TETL 4Y5VA 4FQCL 2NZ9D 1PAMA 1S7QB 3EYQC 4UDUA 4QHKJ 4S1DD 1N2RA 5J1AB 5GGRA 3PP3H 1BZQK 4HLJA 5FHBL 4K8RL 3IDIA 4D0DB 2QJDA 3KHOA 3SDDC 3UZEA 3HE7A 2DWDB 4O51A 5CJQL 4ZTOL 3MBEA 1RJZA 1CFTB 3Q6GL 4CDGC 4HWEH 3V4UH 2X1OA 1MCBA 2RR3A 5DZLA 2OQJB 3WO4C 1R3JB 4YX2H 5L2KD 3REWA 1MCKA 4FFWD 1TPXC 1BD2A 4U1GB 5DO2C 4NP4L 5I19L 2FJHB 4MS8C 4FRWA 4P4KC 1BQLL 4TVPD 2D0HA 4QRQB 1K2DA 2FBOJ 3M17B 4HPYL 4OD1L 1X5GA 3RU8H 3SO3C 4PB9H 1MRDH 3KPOA 1MFBL 4N1HB 4OM0L 2VLJA 2PR4L 4C56D 3QCTL 1Q0YH 1IZKA 3CXDL 3OXSA 4ISVA 3GSWB 4MJID 5E2VH 2BVOA 2FNBA 3OZ9L 4PJAE 4ZSOA 5ISZA 2P5WD 4YHLL 5ENWA 3JV6B 5AYQA 4P5TB 4F2MB 2VDML 2IG2H 1BX2A 3HMXL 3HC0A 1KG0B 3H9SB 1JGUH 3ES6A 5LAXB 2I9LA 3MRRA 4Y4HC 2CK0H 2FHCA 2A74B 1NUNB 3R06A 4KAQH 1S9YB 3S88H 3T77B 5GS0H 1X5KA 2DICA 2W92A 3QWOA 4NN6B 3V9FA 3FO0H 4R4NC 3FFCB 4YHPB 3WKNA 1MIML 1NCWH 4G8GE 4MA8L 2P24B 4R96A 3WNPA 5AZ2L 1KLUB 2O5YL 3KPLA 4GSDL 1J11A 1HH6B 1YJDC 4QRRB 5H2BA 1ROWA 4M62L 3SGDI 2YN3A 3L3KB 2OL3H 3GSUB 4XPBH 1ZLUH 3LRGA 5IFJA 2WBKA 4ERSH 5ITFA 4F58H 2NTSP 4MWFA 4XVJH 5IB2A 2LV4A 4ZOAA 3IDMB 3ARFC 4Y7MA 4EVNB 1WZLA 2WANA 3N85L 4KY1H 4CKVX 5BS0B 2PF6A 4LSQH 5DRNA 5DJCA 2AK4A 1KT2B 4WGWB 4PY7B 3T0EE 1CK0H 3BWAB 3GFUA 2PO6A 3AXLA 1UYWH 3FOLA 3GIVB 4QHKI 4A6YA 4IRJC 2NY5L 2YD6A 1MNUH 1JYWA 4JAMB 4G8FA 1ODAA 3GIZH 2DLTA 3V6ZB 3FT4A 3QH3A 5HGBB 4U6YA 4AIZA 2ARJQ 1WIPA 5J12B 4MAYD 1DFBL 1U36A 4YQXL 3ZE1F 2MSPA 2YA2A 1M7DB 4HWBH 3EUUA 4MNQB 5JO5A 3OG4B 1ZLVH 4Y4KC 3QIBA 5A2KH 2PXYA 3S37X 3RNKB 1ZSDA 5LG1A 3PWUB 4AEIL 1IMHC 1G7QA 4QHNA 2E27L 4BFIB 3S35L 1FZKA 3L7FA 1INEH 4OF0A 1U91B 1OAXH 3FCTA 4I5BA 3VDCA 5HDQL 1RZ8A 4K9EH 3VMOA 2QKIA 4UOW1 5ALBH 3TIDA 4LP4A 5GS0C 4M3KB 4JO2H 4PP2A 2ESVA 4GG8B 3ET9F 2C9AA 3CFCL 5GGSB 3R0NA 5CBAB 3TZVC 5JXAL 3QHZL 1H3VA 1DLFL 4GG6F 3U0WH 3ESVF 3L5WA 3BPCA 5LGHL 5DF0A 3FRPA 5B38B 3F7VB 3OPZL 4M9PA 5DMKA 5ANMA 4DEPC 5MERA 5L2KE 1ZV5A 1KEMH 1HH9A 4WI8A 3RY6C 2GJZB 4G80B 4YEEA 1U8QA 3QEHA 4KQ3L 5JHLL 2ZUUA 3NA9H 1I75A 3REVB 4TVPE 2H41A 3CFKA 5FYLH 4S1QL 1BFOA 3BKYH 5IGXH 5E6ID 1MFEH 4XBPB 2ZSWA 3VI4E 3VFGL 3MNVA 1A1OA 1TCRA 2PW1A 4XNXL 3JUZA 2DIJA 4Z5RB 3WUWB 4C56E 5BV7L 1L7TL 4Y8AA 3QO0A 2P8MB 2VIRB 4KI5F 5FHAL 1AR1C 1LEIB 5SX5H 3QWQB 2WK2A 3CZJA 2ITCA 2P5WE 2EDYA 2BOBB 2E9WA 2NW2A 5B39G 1CE1L 4LLQA 1B0RA 2V2TA 4U3HA 3G6DL 1N6VA 5D6DA 4NZRL 3QDMA 1DUYA 5F1IA 2FIRT 2Y5TA 3T2PA 2R0KH 5H35A 1MCWW 3EDDA 1NBZB 2C3HA 1XF5A 1HIMH 1OSZB 4U1NA 3EZJB 1I8KA 1HK6A 5FM5M 1BQSA 1XCTB 4KK6C 3LN4B 3I84A 4XZUB 3BGFB 4RGNC 4U3XA 2DLHA 1KIQB 3OKLA 4HUWB 5ACZA 1G7HA 4MVBC 4K9EC 4UDUB 1EIBA 2NW3A 3P30L 1N2RB 4F37K 3U30B 1CXLA 3I75B 1N7MH 4XB7A 5GGRB 1RIUH 1X5IA 4M8VA 3NMEA 4HUXA 2DLGA 3HE7B 4WEMB 4O51B 1TXKA 1RJZB 5JW4Q 6FABL 4PS4L 5DR5L 3NBNA 2IPUK 3EOYG 1MVUB 1Y6MR 4F9LC 2LABA 1H3GA 5JOFA 2A9ML 4LBEA 3C87A 4JZJC 1HCFX 4OD3L 2J8OA 3W81A 3REWB 4HMEA 2IADA 1FO0L 4PREA 5ALCL 4OI9A 2YR3A 5DJYA 3W5MA 4P3WA 1RK0B 1UWGL 1HILA 1I1RA 5HGAB 1FO0A 2JJTA 3C5JB 2ZCKH 2AI0L 1CGVA 4KHTL 5ECJE 2A0LC 2VLJB 2VDNL 5JORB 4PJ8D 2NYYC 4ALAH 5F3BA 3OXSB 5F1NA 3O45A 2BVOB 4ZSOB 5ISZB 1GPOH 5E8PA 5ENWB 4NDMA 5K9JH 1BX2B 2H9GB 3ES6B 3BPNC 4IOFC 4LKCA 1LP9A 3G5ZA 3LRHA 3SGKC 4APQD 1H3PH 2I9LB 3DECA 1VENA 4ODHL 3R06B 4TUKL 3GBMH 4KK5C 5F97E 3QWOB 4GG6B 2VDRL 3CH1A 4NKMA 3WSQL 5HYIA 4EI6A 4PRBA 1TTUA 4EN3A 1IILE 4R96B 4I0PA 3KPLB 4NZJA 4XHJD 3S8WA 1HSBA 5H2BB 4UT7L 1VFMA 5ID1B 4QXUH 1TVDA 2FJFA 1SEBB 2Q7NA 4MWFB 3TYFA 3RZWA 5DXWA 1MWAH 1K6QH 2QADD 3K8MA 3QUML 2NX5A 1IBGH 2G60H 4PG2A 2AK4B 4LPTA 4LVEA 5FEBA 3KJ4B 4ODXA 2JB5L 5KSBA 3S7GA 3OB8A 3AXLB 1DVFA 3MCLL 3RX7A 1J5OL 4TNWF 4KXZI 4OJFL 4GRWB 2FO4B 5J06A 4BZ2L 4P23C 4E41A 3MRGA 2A77L 5BMFH 3FT4B 4HIHA 4U6YB 3CCHA 3ZYIA 2K7QA 1WICA 5FV1L 1OF2A 1RUMH 4KJWD 1TFHA 1IC1A 2ZUQB 3ARDA 5EPMA 2IAMC 3HNTH 2APTA 3NA4A 5JO5B 1IGFH 4V1DD 2PXYB 1AY1L 5D9SA 5E7BA 4HJGB 3SDCD 4C57C 5CJXC 1G7QB 4N5UA 4XNMA 4QHNB 4XXDA 1V3JA 5F7LB 1FZKB 2CKBH 3TBSA 4YHKL 1FZMA 1Q9LA 3MV8A 3FCTB 3QEUB 4I5BB 4HHAA 3ILQC 1AHWA 3TIDB 4YXHH 2ADIA 1UACH 2XRAH 1K9TA 1P1ZA 3E6FB 1JNNH 4PP2B 3MRMA 4YHMH 3PQYA 3G6JF 4HX1A 3GSRB 1BLNA 3FQXA 4WI5A 1QRNB 3SKJL 2ZCLH 5K93A 3L5WB 3BPCB 5F7EH 4Z76A 4L4JA 1FP5A 2YPKA 3VWJC 2DBLL 1U3HB 1A4KA 4XGZB 5MERB 1I8IB 1M6OB 2ZUWA 5E2JA 1T20A 2NXYD 5CJOL 1U8QB 3QEHB 5FA3A 3X13A 1H0DA 4AENA 4O58L 3GM0A 4L8CB 4Z7NE 1S7SB 4OCSL 1BFOB 1WISA 1OWRM 4ODSH 3WHE1 5JW5B 1NDGA 3GRWL 3MNVB 1A1OB 5DT1H 5I1KL 4R90H 5DA0B 2PW1B 4M5YL 4FZ8H 2HKFL 3FHAA 4P4KA 3RWDA 3V7AE 2J8UE 2HFFA 3GRWA 3LS5L 1U8LA 1D9KD 3OKYA 2GJ6E 3CSGA 4X6DE 4MGXA 3EDEA 1XF4B 3MLWL 4W4OC 5F7DA 5BV7B 5K59E 3WFEH 2NW2B 3OAUL 2ADFL 3HC4H 1GGCL 4LLQB 3TPKA 4P2YA 1B0RB 2V5SA 2V2TB 2AP2A 4POYA 2GTWB 4G8EA 5SWQA 1DUYB 4ZAKB 4HXAL 4IRZL 5H35B 1WBXB 1L0YA 2L4OA 1FNHA 1IKFH 2C3XA 1LO2L 4KROB 4U1NB 1KENL 2XZAL 1I8KB 3KXFA 3OR7A 2AJXH 1GIGH 3BKJH 5MI0B 2P44B 4Y4HA 1NGZA 3O2WH 1A21A 4NQEA 3C6LD 4HH8A 4JPVH 4KJQC 4NM8L 1CGTA 5ACZB 3FN0H 1G9MH 4ZUWA 4D0CA 1G7HB 1BMGA 5F1OB 2VL4A 4PJ7F 1HSAB 4XVUC 1SMAA 3BT2H 2YZ8A 3RZCD 2WUBH 1HKLL 3O6MH 4QXWA 4N1CA 3BQUC 4J4PD 4RDQF 2HT2C 2WWKO 4Y16D 1CTNA 4U6VH 4X7EC 2CDEA 4WU5A 1LWRA 4JZOA 3VD9A 5L7XH 4OTXH 5JOFB 4LBEB 2EIBA 1A1MB 1AGDB 4PJBA 1CQKA 3RTQD 3IDYB 4CN4A 3ZDXE 3PIQA 1OTTC 2F8OA 2IADB 4PREB 3T09A 4LP5A 3HFMH 5DJYB 5FUCC 3C09B 5ETUA 1HILB 4JREC 1FO0B 3MLXL 3JV4B 2VZ3A 3TO4A 5IOPA 4OCMC 5E8DH 1VACA 2EXWC 1J0ZA 3RU8L 2DM3A 1UM6L 5I1IH 5DHXB 5DLMH 32C2B 4PB9L 1MRDL 1R3KA 5F1NB 3O45B 1MELA 1Q0YL 1ACZA 1EH9A 1JPFA 3MX0A 1UM5H 3MMEA 4V1DE 4NDMB 5IJKC 5E2VL 1MREH 3D39A 4WY7H 1FRGH 1RJYA 5FYJU 4YBQC 3EJZC 4LKCB 1LP9B 3G5ZB 4NUGH 1S78C 2ZPKH 1BIIA 2IG2L 4PJFF 1AP2B 3FOMB 2BRQA 4Y4KA 1JGUL 4YDLC 3CFEA 1ACYH 3NCBB 5IT2H 3SGJC 3V95A 2CK0L 4ONHA 3O41A 3CH1B 4EI6B 4L8BA 1R3IH 4OGAC 4KAQL 3GBNH 3JZ7A 4PRBB 3S88L 1QRKA 2R29H 4NNYB 4EN3B 4CN6A 2Y4SA 4I0PB 1QO3A 1PX4A 3M1BA 3CAFA 1HSBB 4N0CD 1NCWL 4OFKA 4NC0B 1G9MC 1B0WA 1KYOJ 4QTIH 1IGTB 5EBMA 4LNRA 2FJFB 4RAVA 5E6YA 1LK3H 2Z31D 2F5AH 3TYFB 1I8MA 4TUOB 4XPBL 3FO1A 4HAFA 4ZO6A 3B6SA 4ERSL 1DUZA 4F58L 3BFOA 3RL1A 4XVJL 2OL3A 1A6VH 1XGYL 2P4AB 4HCRH 1AD9A 5EOTB 3OL2A 4KY1L 1KYOK 3QUMB 2GTZA 4LSQL 1DVFB 3RY6A 1F90H 1JF5A 4W6YB 1CK0L 5DURD 5AAMA 3WXWL 2IBBA 2OXHA 1UYWL 4M7LH 4OGYL 4OFYD 5SV3A 4GQ9H 3GIZL 2F53B 3CCHB 3JTTB 3QDJE 3N9GH 4DUXA 5LBSH 4OGXH 1I1AA 1OF2B 5FO8B 3S97C 5F8RC 4M6NH 1Q0XL 1SYVA 3ARDB 5EPMB 1VFAA 1ZK9A 4PJIE 3RWEA 3STLB 3L5HA 1AGEA 4U6TA 3RGVD 4HWBL 5F7HA 4DGIL 5D9SB 4GRLD 3S5LA 1OQOA 1RI8A 3R1GH 3BE1L 3EOAA 2J5LC 4PJ7B 4U6HA 5F89A 4XXDB 2Q87A 3TBSB 2W60A 1FZMB 1Q9LB 4PBVC 3O6FC 4KV5E 5B38G 3MLYH 1AHWB 4Y88A 3DX6A 4MLSA 2ENSA 4HUUA 1OAXL 1TZGH 2YEZB 4K9EL 4ZO8A 1UCBH 3P4OA 4LLYA 1PKQB 2H8PA 3BX7C 4S2SA 4ZS6C 5ALBL 4JN2A 3PQYB 4HX1B 1BLNB 4JO2L 3FQXB 2X89A 2BMKA 1MOEA 5TGBA 5BQ7B 2DQUH 1AI1H 4FQXC 4Z76B 1EXUA 2DQHL 3WUWG 2VQUA 4Z0XB 3U0WL 1G6VK 3OAZK 3SDDB 4I1NB 4OF8A 1G6RH 3UBXA 3PGCA 1PDKA 1QHOA 1H0DB 4XCYA 3U4BH 1JGVL 4AENB 4F9LA 2QQLL 1KEML 1DZBA 4Q6IC 5A2LH 2ERJC 5F1KC 3WO4B 1DR9A 3C5ZC 3NA9L 4X7DC 1QEWA 1B90A 1S7RA 1TPXB 2PO6D 1FN4A 3TBTA 2DDQH 3S98A 1FFRA 3QUYC 3BKYL 5T3ZL 5IGXL 4P4KB 1MFEL 2CGRH 4LLVB 1JBJA 4EXKA 3A0OA 1U8LB 5D93C 5BOZG 5JOEA 3SO3B 5F6HI 3VGBA 5MEOB 3DV6A 2HJFA 4P5MB 1NANH 4Y5XC 1S5HA 1DQQA 3NCEB 4JDVA 1RUPL 5T1MA 1RUAH 1D5BA 1NFIB 1T83A 5SWQB 3K8KA 1HKFA 5HHMB 3C8HA 3E2HC 4CU7A 3AS1A 3FRUA 3ZYOA 1P6FA 2R0KL 5I1AA 2PETA 3IDJA 3KXFB 3OR7B 4FG6C 4LVNC 3MV9A 5HDOA 3P77A 4Y4HB 1NGZB 1HIML 4K2UL 4K3GA 1AE6H 5KTEH 1UZ8A 3O3AB 4ZUWB 2UWEA 2XZZA 3DMMC 2OSLA 4D0CB 1QFWM 2Z8RA 4LCYA 2WBWB 3NFPA 5DQDH 4DVBB 3U7YL 3HB3C 4JKKA 1PGRB 3LB6D 5DVOA 3KPPA 2QR0B 1KJVA 1N7ML 4JZOB 1AFVH 1RIUL 2O5ZH 2HLFD 1XF3A 3OQ3B 4JO4H 4PJBB 1RUKH 2W59A 1EJOH 4JFOB 4PJ5B 4YHYC 4NRYA 3PIQB 3ARFB 1ETZA 2P5EB 4L29A 5ETUB 2F19H 1VEPA 2EDQA 3LV3A 4RMVA 1CXIA 4FTVD 1KELH 2HT4D 4HIJB 4RCAA 3ZHDA 1KF9B 3MRDB 4PRHD 3TO4B 3CFBA 4IRJB 5IOPB 5C0AA 4D94A 1WCBB 1VACB 5D2LE 4YNYB 4X9GA 3VD4A 5EFIB 5IFHH 1UCTA 1R3KB 4MMXC 3B5TA 1KCRH 1KJ3H 4TNVK 4CU8A 1VGEH 1BEYH 4XH2A 3QPQD 4HSQA 3C5SA 5KSUA 3EYFA 4ALAL 1OAZH 3V4PH 3TYGH 1JZ2A 1NEZA 3HZYA 4PJXE 1RJYB 1GPOL 5HVHC 5IMOB 1OL0A 2IAMA 3BD3A 5F7MC 3FO9A 1BIIB 5K9JL 4Y4KB 3VFVB 3CFEB 3QZWG 1H3PL 1N0LA 5JR1L 4L4VB 5CJXA 5AZEL 3O41B 3ZZ1A 1WIUA 3AAZA 5GRVL 3NZHH 4BH8A 1OGAB 3BRDA 4GOSA 3M1BB 2JE8A 2MHAA 4X6CF 1I7RA 2QL1A 4AIXA 5EIIA 1TTGA 3MRJB 3UC0H 1S5IH 1JV5B 3ARED 4ONGH 4RAVB 4PJ9C 5D7JC 4EOWH 2RJMA 1FFOB 2UWEF 3BYYA 4XCNA 5CEZD 3D1MC 5DJXA 1I8MB 4QXUL 3FO1B 1H3XA 4LSSH 4P4RA 1WF5A 4TTDC 4Z7WE 4OKDA 2FB4H 5D5MA 3RL1B 1D5IH 3VWJA 2OL3B 1XR8A 1AD9B 4DEPB 4PJDE 5HYEA 2GTZB 3KNBA 1OGTB 3HPLB 4JO1H 3GK8L 4EDXB 1E4KC 1QPPA 3G6AA 1MWAA 5FYJL 4R7DA 3CFIC 2BNRA 4I2XB 3FT2A 5CEXB 1Z3GH 4OCLC 4JCLA 4X6FA 3U0TA 5JXEA 3TT3H 4JJ5A 4L5FH 1XMWA 5I71C 3S35X 5IHUH 4CVUA 1QBLH 1I1AB 1XIWC 4LSPH 2BNQD 6CGTA 3RNQB 4JPIA 3D87B 1SYVB 4I3SL 4WCYH 1VFAB 1WZMA 1JIBA 5IBTH 1RUML 3WMSA 4PY8J 2VDQH 3WXVL 4M1GL 3TCLA 1RZ7H 4HLZG 1J12A 3HNTL 4KKNA 4X6EA 3ULUD 1VSCA 2BHUA 1IGFL 3ARYA 3EOAB 4U6HB 5F89B 2AJSH 4AEHL 2W60B 3MNWB 2D7TL 3DX6B 4BSJA 4EXPX 1B6DA 1U8JA 4HUUB 1GGIH 2CIKA 3P4OB 5EBWA 4RMUA 2YPVH 2H8PB 4RGNB 1EUTA 4S2SB 4FA8A 3DWTA 2CKBA 1UACL 2XRAL 1JNNL 3QQNA 1KCVH 2BMKB 1IRAY 2NLJB 5TGBB 2XTJE 4GMSH 1U3YA 3VFTA 4LPVA 1JMZA 4M7JL 4QOKB 3UBXB 1U3JA 2C1OA 1FLTX 3EAKA 1JZ3A 3DRTA 2NX5D 2YMXH 4K7PH 2X70A 4F80A 3RKPA 4FTVE 4JZJB 1UKTA 1ZHKA 4LAJH 4PRHE 4QXTA 4YAQA 2DQDH 1S7RB 1FN4B 4K7FA 1WVZA 4NBZB 4L8DA 3E8UL 1WFNA 4P3CH 4ZXBC 4JM2C 5DT1L 4ELME 4R90L 2N1KA 5I15L 3C8DA 4FZ8L 2BERA 3O3EA 3WO3B 2XY1A 1JGLH 3DV6B 2HJFB 5CGYD 4NC1E 2JJUA 4JDVB 1D5BB 3ARGD 5JZ7D 1NKOA 3N1PC 1M05A 4NBYB 3BVNA 4R9HA 4LKXA 5IJKA 2XIDA 1CDBA 2ZOKB 4YHZH 4JKWA 3O3DA 3I9GH 2HP4A 3BPNB 4U1JA 3IDJB 4Z7VA 1IKFL 3VFUA 4OZGE 1RZIA 1UZ8B 1YZZA 2UWEB 3QB7C 2OSLB 3BKJL 3VG9C 1AXSA 3SGJA 1IEHA 3O2WL 4LCYB 4W68A 4X5LA 3NFPB 1U8IA 4JPVL 2VXUH 4Z8FH 2VN7A 3QIUC 1MCSA 3EYSH 3KPPB 3CU1A 4DN3L 5CEZE 1F4XH 3PJSB 2WUBL 1WUNT 3O6ML 1KJVB 5EO0A 3DUHA 4OUUA 3JUYA 4JDTH 1XF3B 4PJGA 5FYKH 3WNOA 5LWYH 3WJJC 4J8RB 2ZCHH 3HZVA 4XT1C 1W8NA 3DHMA 4NRYB 3T1FA 2QV2A 4LEOA 4OTXL 2Y7QB 1CS6A 5DHVH 5C0IA 3HKFA 3BPLC 1X4XA 2LVCA 5F9AC 1KTLA 3LV3B 2EDKA 4LPXA 4NCC1 3HFML 2Q8AL 2YWZA 3VI3E 3VGHA 3CFBB 5C0AB 3V6FA 2BNQE 1HI6A 3ZTJG 1QSEB 4P23B 3WNKA 3FAXA 2DOCA 3ZHLA 4F7CA 5E8DL 3EYVB 4XH2B 1IC4H 2DBJA 3C5SB 5I1IL 2Y36H 5KSUB 4TSCH 5DLML 4KTEH 3ZO0A 2VDKH 3HZYB 3NN8A 2UZXB 1UM5L 2IAMB 3SHSA 4O4YH 1MREL 4WY7L 1FRGL 3DUUB 5LGKA 1INQA 4NUGL 2KUTA 2ZPKL 1QFWI 3MLSL 3WN5C 1T0PB 2VXTH 3RBGA 3H2WA 1G9NH 1TVBA 3AAZB 1ACYL 3UAJC 5IT2L 3GSOB 4PB0H 2VITA 3MLRH 3PWNA 5EU7E 1J05A 2UYLA 2ZZUT 3JV0A 4R8WH 3GBNL 2R29L 2DQCH 2Y07H 2NY4C 2BZDA 2G2RB 3GMRA 4XMKH 4RGMC 2XFXB 4BQ9A 1I7RB 3ALWA 2OK0H 4PJCA 1FYTA 3TH2T 5HYSB 4XCNB 4QTIL 5DJXB 5F72S 5DQ9A 4P4RB 5MEPA 1LK3L 4UNVA 5C0JA 3OB0K 2AV1A 3DVFA 2F5AL 2FX9H 3VWJB 1XR8B 4HMCA 5JHDB 5GJSH 5F7WC 1A6VL 4HCRL 1EVTC 4CNIA 5IMLA 4OZHE 3G6AB 5H37G 1IGJA 1MWAB 4R7DB 2JELH 1MY5A 2A9NH 1SM3H 3SKOA 3FT2B 4Q6IA 1F90L 1I9RH 1IC7H 2K1MA 5EZLA 1HEZA 3C5ZA 5C0CD 1A5FH 4JJ5B 3TLRA 4M7LL 1BJ1J 3QUYA 4ZPVB 5I1JH 3BZ4B 1LEKA 4RDQG 1HNGA 1GGYA 2IALA 1NFDA 3N9GL 4OGXL 3TF7C 5FECA 4O2CA 2VH5H 2X4RA 1FAIH 3IDUA 3NCMA 1FFPA 4M6NL 4L9LA 4POZD 1EHAA 4U1KA 2CO7B 5C0NC 3D39D 3BAEH 4NCDA 3GGWA 1DEEA 3B9KC 4Y2OA 3G08A 3R1GL 2FIKB 4YK4C 2UZYB 2UY7A 5HHPA 4K55A 4PRNA 1CICD 2J7LA 2VE6A 5IBUB 2CIKB 4R26H 1IT9H 4X99A 3MSPA 3ARXA 1UH3A 1G9NC 2R56H 2GJJA 3HS0B 2CKBB 4LGSB 3KPTA 1TZGL 3DMMA 1UCBL 4JN1H 3BRGC 4NJAH 1ZGLA 2Z35A 4R6UA 3F5WB 4PP1C 3BQUB 4QHUA 2YN5A 3VFTB 3QUZD 4CVXA 5KZCD 2PCPA 3JVGC 2E8ZA 2D7OA 1AI1L 1F02I 3WNLA 1J0IA 4GW1A 5D6CB 3L9RB 4MDIA 4BFEA 1ZT7A 3DRTB 5IM7B 3QQ4A 1G6RL 5IKCA 2F54A 1ZHKB 5MHSE 3U4BL 4YAQB 3ETBF 4K7FB 2XWJA 5E99H 1N4XH 4L8DB 2IFGA 4R7NA 5L2JA 1OSPH 5EZJA 5DC9B 4JREB 2BOCA 3O4LA 3O3EB 2CGRL 2VABA 5TDOB 1J8KA 3MREB 3CX5J 3TVMC 1C5DA 4L9DA 3KDMA 5GS1A 2OTUB 1SEQL 4WHYH 1M05B 3BVNB 4UIMA 4LKXB 3TWCH 1S9XA 2NY3D 4X98A 5TE7L 2GK2A 2JB6B 2FL5A 1M71A 3S3JA 4U1JB 1P2CA 5CIPH 1J9CT 4Z7VB 2IAND 4B7LA 3HUJF 5BW7C 5L0QC 1HYSC 3BJLA 1RZIB 1ZT1A 1ZMYA 1DBMH 2A6DA 1N3NA 4LVOC 1M7IB 4LIQH 1U93A 3LPWA 3PWJB 1GZQA 5C0GB 1U8IB 4IMLB 2RIKA 1W2KT 5IMMA 3KYKL 1RZKL 3OSKA 3KPQA 2D4FA 5FM8A 1FNGB 4GAJL 5DQDL 3UPAA 3RAJL 1C7TA 1AKJA 4IDJH 4KRPC 1T7ZA 4OUUB 5E4EC 5DYOA 4PJGB 2BVQA 1TNNA 1YY9C 4MNGA 3TGXA 3HZVB 1AFVL 2O5ZL 4PJ9A 5D7JA 3ME0A 4LPUA 3MLPA 3GHBH 3T1FB 3VFNA 4PYHA 3WIIH 2BSED 4LHUA 3LKQA 3WBDA 4JO4L 1BBDH 1RUKL 5C0IB 1EJOL 4NQVB 1T5WA 3OWEA 4QRTA 4G6AD 1FZJB 4PRPA 4NWUH 3MUGB 5C0CE 1KPUA 1ZEAH 4KK8D 2R9HD 5EU4A 4JFFD 2F19L 2DKSA 3SCMD 3V6FB 3PWPD 2HH0H 3T3PF 1KELL 4EQ3A 5JIPA 4Z7OE 3P2TA 3T08A 5C09B 4F7CB 3D2UD 4JFEA 2XOTA 5E5MA 5IFHL 3L3DB 4QCIA 1M7XA 1KCRL 1KJ3L 2QQQA 4MXQD 1VGEL 1BEYL 4AG4H 1V7MH 1EFXD 1OAZL 4KKAD 3V4PL 3TYGL 4OQTH 5I1EH 4NZUL 3QNYB 4CUCA 3ARBC 1GGTA 2XWTA 4QEGA 5IVXA 3CD4A 3HG1A 3RVTC 1T22A 3OKKA 2J5LB 1TVBB 2K9UA 4E42B 4LF3B 4FXKA 5DD6B 4MZ3A 1I1YA 2VITB 3MJ8B 3PF2A 1XGPA 3O6FB 3PWNB 1J05B 5EO9B 3VXPA 2UYLB 5HYQA 4GAGH 4FXGA 5IHBA 4GKSA 4RBPK 3GMRB 2ILLA 2QSQA 3IXAA 3VXSB 3C60C 4M1DH 5C08D 1YDPA 1FFNA 3GMQB 4PJCB 1FYTB 1YQ2A 3MRLB 1MRFH 2VISA 3K4DA 5DQ9B 5EBLB 3UC0L 4X5XB 1S5IL 4LRNH 1QLEL 2J4WH 4ONGL 5C0JB 3F58H 4EI5C 3DVIA 3GSXB 3WFBH 1SJHB 4EOWL 5ADPH 4FQXB 2AV1B 4LSSL 3U7AA 3HMWH 2FB4L 2WLZA 4J3UA 2X9YA 1IGJB 3VGGA 1WGOA 3EZ8A 4HIIA 4EIGB 4KHXL 2AVGA 3SKOB 4Q6IB 2MMXA 2ERJB 2FGWL 1KCUH 5EZLB 1HEZB 3C5ZB 4HDIB 1XH3A 5DWUH 3QUYB 2EKSA 3QO1A 1Z3GL 3GJFA 4N0FB 4TRPH 3TT3L 2D9CA 1A2YA 1RMFH 4JM2A 2AAVA 5D93B 3GKZA 1NFDB 4Y2DC 1QBLL 1L9NA 4NQCA 2IC2A 3TFKD 4LSPL 3SDAD 1FFPB 3QDGD 4Y5XB 3HUJB 4L9LB 1UKQA 1CT8A 4WCYL 3KLHC 2IQAB 5GGUB 3GGWB 2VDQL 1FG2A 1DEEB 4J3SA 2IANE 2ATPA 3B9EA 3WNMA 1NDMB 3G08B 4Y5YA 2GHWB 3E2HB 5HHPB 4IRSA 1VKXA 4QF1A 3FB6A 5E56A 2VE6B 3O6LH 4JVWA 1CFSB 2YWYA 4X99B 5H94B 3LKPA 2GY5A 3F7YB 2XQYG 4GMTH 1GGIL 4IS6A 1WITA 3DMMB 1UQSA 2HG5A 3ABZA 3WKML 4DAGH 2Z35B 3HNVH 3ARZA 1X5LA 5AD0B 2P43B 4QHUB 2R15A 3QIUA 5KVDL 1KCVL 4XX1G 1SJXA 3U36B 1BQHA 4H0HB 4MDIB 4YIQA 4L1DA 5I30L 15C8H 3QQ4B 5IKCB 1S3KH 5BOPA 1HNFA 2A6JB 2F54B 4KMTH 4YHYB 3ZSSA 4L4TB 2Y5EA 4JFFE 2CMRH 1PQZA 2YMXL 4K7PL 5E5RB 1G6RB 3PWPE 4KDTA 5L2JB 3AM8C 5EZJB 3RKDD 2DQDL 2RCSH 1FG9C 2APBA 2H1PH 3EJJX 3IJYA 2BOCB 2BNRD 3O4LB 5C3LD 5ID0A 5E8EB 4RIRA 4P3CL 4P48A 3WDJA 3KPSD 2J6EH 2VABB 2VDLH 3CVHH 5JXED 5KVGH 1L0XA 4FFYH 4NRZA 4MSWA 2IH3A 3NTCH 4PYGA 5E9DB 3CUPA 3LQAL 1LE9A 1KIRB 1JGLL 1OLLA 3FN3A 2DIBA 3GMPB 3SE9H 2QHRH 1NFKA 1CZ8H 5HHOD 3FQWB 3RL2A 1MEXH 2A6IA 3EYOA 1IGCH 3LHPH 4X98B 1FVEA 1K4DA 4JDZA 1M71B 5HVHB 1AD0A 5GS2D 1X9QA 2UY6A 1P2CB 1MI5A 1NUDA 3FFDB 3Q5TA 2BY2A 1GC1H 4PPTA 4YHZL 3I9GL 4XCCH 4DZ8A 1ZT1B 2FHFA 2A6DB 1N3NB 2HT3D 5D1ZA 3S4SA 4RFEB 3WN5A 1U93B 2PYED 1EV2E 5IMMB 1KCLA 5C08E 1A6ZA 4NGHH 5C6WH 1G7PB 4Z8FL 1JI2A 1T1WA 3O9WC 1AKJB 1LO3H 3MUHL 4UV4H 3AS0A 2XXCB 5C0DB 3EYSL 4M7LT 5DYOB 2BVQB 1CDIA 1F4XL 1I3GH 2BHZA 4HAGA 2B1AH 4HF5H 4RWHA 2I07B 4MNGB 4PJHE 3FKUS 4PJ9B 1UZ6F 1NLBH 5D7JB 5HI4C 1GJIA 1KFAH 4JDTL 1CFVH 3VFNB 4OZFH 1C5CL 3V0AC 4LHUB 4HJ0D 5IWLA 1JK8A 2ZCHL 2XN9D 4F7PB 1DE4A 1T5WB 3GI8H 5GJTH 1FVCA 4XVSH 1REIA 3X12A 1KPUB 5EU4B 2C26A 1EPFA 5EU3A 4PLJD 1OT2A 3VWKC 5CSGA 3LD8C 5DHVA 2X42A 4BM7A 4W6WB 3QDGE 5D7SL 2EZ0C 4HEPG 5E5MB 5I71B 4QCIB 2GW5A 1IL1A 3UYOD 4Y8DC 3AS3A 1XIWB 5SWSA 3SDXE 3QEGL 1AQKH 1DQLH 5EUOF 4TSCL 4ZOBA 2OJZH 2WBJC 4KTEL 5TH2A 3TT1H 2VDKL 1DTUA 1QZ1A 2IQ9L 2HWZH 3O2VH 5EC2A 1ZAGA 2W1NA 1YMMA 5IVXB 3T0EC 3LEXA 3MBXL 4NUJA 3HG1B 1ULVA 2EEAA 1AJ7H 3CPLA 3OKKB 4LGRB 3RX8A 5HYSG 4QGTA 5DEFA 5GZOC 1E6JH 4KI1A 3QWRD 4LFHG 1I1YB 5HYQB 3VXPB 1CU4H 4FXGB 2HMIC 1G9NL 2BX5A 3PXJA 4R4FH 1KSRA 4PB0L 3IXAB 3MLRL 3V4VH 4R8WL 1YDPB 3DVNA 1FFNB 4QNPE 2DQCL 2Y07L 4XMKL 2O5XH 1KNOA 2VISB 2B7DT 3RX5A 1N6QH 2OK0L 3T4YB 4Z7UA 3EHBC 1YNTB 3QFJA 1WAAF 4WO4C 5CWSB 4LCUA 3JVGA 1UA6H 3DLQR 4AQOA 3OXRA 5HDBF 5EOQL 3FFCE 1WCQA 2NZ9C 4WFHD 4X4YB 2OM5A 5GJSL 4WEBH 3UTSA 2GT9B 4DQOH 3KPSE 1FV1A 2V7HA 1FJ1B 3D85A 1ZKAA 1XH3B 3DX8A 4B5EA 2A9NL 3MRCA 3K4ZA 4P9MH 2EKSB 3QO1B 4ZXBB 1I9RL 1IC7L 2BXZA 1A2YB 1A5FL 4JM2B 4U6XA 3GM8A 4RMTA 1L9MA 5CD3A 5I1JL 2AQ2A 3MA9H 3MGTA 5HHOE 1S7UA 3V2AR 1CT8B 2YBRB 5BS0E 2L7JA 4K8RD 3TVMA 3PGFH 2MCPH 1IGIH 4FFWC 3X14A 2VH5L 3K74B 1FAIL 2RGSA 2YD7A 1SY6H 5KVEH 5CKGA 5C71A 4YFEA 5F88A 3BAEL 3U2SB 1C1EH 1BIHA 4HK3N 1FYHB 4JRYD 1VKXB 5DVNA 2PYEE 3PL6A 1EDQA 4C58B 4DOHB 4XI5D 3LKPB 3FL7A 1P69B 4R26L 1IT9L 3SBWA 3JBG7 3VG9B 4XHQA 3B8SA 5KG9A 2R56L 3ULSA 1NGYA 1NC4D 1G7LB 2YPLB 4YZFF 3QIUB 4JN1L 1QKZH 3IFLL 4OLWL 2Q8BH 4NJAL 5KS9A 3IU3A 4CADA 1P4LA 1U0QA 2BY0A 4D8PB 2BVTA 3AMLA 2XN9E 3QPXH 1SYSA 4YIQB 3SO5A 3SEPA 4NHUB 4I18A 4O9HH 3RI5K 1IAKA 2JCCF 5FGSA 5IG7B 3BGMA 2NNAB 4HULB 5INDB 2JF1A 5IBLD 5LGJA 4Q2ZA 3HR6A 1D5XA 2MJWA 3BPLB 4XPFH 3ULVH 2DJSA 3WDHA 1FNAA 3NOIA 1HQRA 4G3YH 5CJ8A 5E99L 5EUOB 3VE0A 1KC5H 1IM3A 5ID0B 1B4JH 4RIRB 1P5VA 3AVEA 1OSPL 1MCIA 3H6JA 3VXUD 2IH3B 3X17A 1BF2A 3CUPB 5I73C 5I8EA 1S7TA 1LE9B 1N0XH 4WTZG 3U9UB 1L7IH 2GAZA 2FATH 4NT6A 4MQ7A 3E3QE 3W9EA 3DO3A 1T7WA 3W5NA 4MCZB 3RL2B 3Q3GA 3CSPA 2A6IB 2CLZA 3T0WA 3EBAA 5DMYA 1YPZF 3BYTA 1FVEB 1K4DB 1HQ4A 4JDZB 3ROLA 4KI5D 1HINH 3ZKND 1MI5B 1KPVB 3TWCL 2LFGA 4KZDH 4OLUH 4X7SH 3H3PL 43CAA 3IVKA 3DARA 3ARQA 3ARBA 7FABH 4YBLC 3QT2A 3S4SB 3WN5B 1DN0B 3FO2A 1LEGB 4WTXA 5DD3L 1A6ZB 1DBML 4NOBA 4U0QB 4LVHC 3GMMA 1JWUA 2UZIH 3OGCA 2NY4B 4Y4FD 4XP6L 4JGJA 2DKUA 3MOBH 3NACH 3L95B 3VH8A 3BN9D 3LDBB 4Q9RH 3IFNH 3RUGF 3Q2CA 4EI5A 2DLEA 4M93C 1DE4B 4WFHE 1LE5A 3GHBL 1FVCB 3WIIL 4DZBA 1BBDL 2BDNH 1GAFH 5T1KA 4CJ1A 3QUXD 5EU3B 5FGBC 1MAJA 4NWUL 1P7QA 3IAPA 3BP7A 1U9KA 5DHVB 3GDBA 2VC2H 1T2QH 3ULVC 5I18H 3H9ZA 1YNKH 2EIZA 2HH0L 3RHWF 1KPRA 3U83A 4RWYH 2CDGA 3BXNB 1AO7D 1H9VA 1MHEA 5I17B 5SWSB 4PJDF 2EIDA 5BJTA 4Y2DA 4OCNC 5GPRA 2B39A 3CZFA 1MCOH 2ARJA 1NCBH 1TZHB 5GRXG 1ZT4B 2R2BB 4YHOH 1YMMB 5E6IC 2EO1A 2VAAA 4NUJB 4OQTL 3ZE1E 5I1EL 3CPLB 3CDYA 3IDNA 3B9KB 5DEFB 4ZTPH 3NPZB 1JNHA 1KBGH 1I9JH 4H0IA 1X4ZA 1AXTH 4ZODA 1FGNH 4GAGL 2ZG3A 2LE9A 3DVNB 1T0MB 2PYFA 3D0VA 3DURA 3UP1A 2E7LC 4U1IA 4M8QA 3VU2A 1KNOB 3C6SA 2FYYB 4M1DL 5DUBA 4LQFH 3BDBA 3KS0H 4NHCH 4NO2B 4GLRI 4O2EA 1MRFL 3QFJB 4ZAKD 4KQ4L 4LRNL 5T3XD 3CDFA 4LCUB 3F58L 5ADPL 5FGRA 1U8KA 3OXRB 4KROD 4O02H 4GG6E 3EO0B 2MQCA 3HMWL 4C55A 4LSRL 2OP4H 4JE4B 2KQMA 4HKBA 5MP6H 5EULV 2V2XA 3NABL 1FV1B 4PRPD 3Q48A 1OP5K 1U92B 3VXUE 2NR6D 4A2LA 2EC9U 4RMQA 1MJJB 1KCUL 2R4RH 5SX4I 1OTSD 3AM8A 4DTGH 4U6XB 5DWUL 2NY1D 2PN5A 1Q38A 4LMQE 5FA4A 5CD3B 1JPTH 3GSNH 4TRPL 1RMFL 1WBZB 1IEBB 3W0WD 3TVMB 1VDGA 4KI5E 4NPYB 1KCSH 3E6HB 5SWZD 3MODH 1EEYB 3CNKA 1AH1A 4KKCD 1HHHB 2WV3A 5I0DA 2ICWA 4R4BA 4F8QA 1RURH 3MRIA 1F3JA 5T1LD 5L0QB 3O6LL 4P2QB 4HS3A 4X4ME 1A3RH 5JQHC 4LVOB 4JR9L 4KWUA 3VXRA 3QI9C 2DM4A 3P9LA 2HTLD 1NJ9A 1GRWA 1MFNA 5J89A 1HXMA 5KS9B 3IU3B 4APQC 4DAGL 4CADB 3HNVL 1P4LB 1HWHB 1F3DJ 3O9WA 4KRPB 4PJAA 3UPRB 1SYSB 5DGQA 3Q1SH 5E4EB 4GKZB 4LMQI 3QXUA 4UZGA 4UUJA 5HHQB 4YPJA 2EXYD 1IAKB 1OAYH 3BGMB 3NCYS 2W9LA 4HZLA 15C8L 4F9PC 5EU5A 4PJEF 4Q2ZB 1JGDB 1R3LA 1S3KL 2PW2A 3RWCA 3VFWA 4XHJC 2DRUA 1F6LL 2CMRL 5HTSA 3CXHJ 1HQRB 3BZFA 1T7XA 3VE0B 3GHEH 4DGVH 2MCG1 1Z6JT 4MB3A 5C92A 1QRNE 1AO7E 1F2XK 2RCSL 3D3VD