2MOQA

Solution structure and molecular determinants of hemoglobin binding of the first neat domain of isdb in staphylococcus aureus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
LNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTDSKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSSTHFNNKEEKYDYTLMEFAQPIYNSADKFKTEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein B
publication title Solution Structure and Molecular Determinants of Hemoglobin Binding of the First NEAT Domain of IsdB in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2moqA00
3RTLA 5D1ZI 4H8QA 5D1XE 2O1AA 3SZKC 3QZLA 2K78A 3VTMA 4FC3E 3VUAA 4YMPA 3RURA 3QZMA 3SZ6A 3QZPA 3QZNA 3OVUB 2E7DA 5D1QE 4H8PA 2MOQA 2Q7AA 3S48A 3QUHA 2ITEA 2ITFA 3SIKA 2O6PA 4WJG3 3QZOA 3QUGA 4MYPA 4NLAA 2Z6FA 2H3KA
chains in the Genus database with same CATH superfamily
1L6XA 3QZWB 4BK5C 3IETA 1IVTA 4UTAA 2JJUA 1K6QH 1WFTA 4L9DA 2X1XR 3FU7A 4PWEA 4Z7QF 4X0KB 1N68A 2QV2A 3CGTA 4H26B 2NW3B 1NA8A 1AXTL 2XXCB 2D7QA 2EDTA 5KTEH 4WU7B 4O5LH 5HVFB 1UD4A 4GEJA 1AZRA 4KJYA 2W0KA 1R3JB 5IQNA 4LLYA 2H26B 4MLSA 4IRSC 2DKSA 3CZGA 3LSOA 4POYA 5L7XL 4QRUB 2YKKA 3HC4H 5EZJB 4YAQA 1A66A 1KIRA 1YEHL 1TJHL 2JKIS 3NACH 4I1RA 4NRZB 2BSRB 1W0VA 4TUKL 4G9DA 4JKKA 3TBCA 2X4RB 3UOAB 4LHUG 1NL0H 3PGCA 4NRYB 3O4LE 1FH2A 3D0VB 5E2WL 2ZUTA 1GR7A 4J3UA 4PJBE 5JW4M 1RPKA 2DM2A 3RDTA 2BW5A 1PFCA 3W81A 5D2NA 5EZLA 4PJ9C 1SQ2N 4IBUA 2OMVB 5L2JB 3FCTB 1Q9KA 1UJ3B 4Z3GA 5I6PA 5ADPL 2M1KA 4I5BA 2R69H 5K9OA 4YVUA 3IDGB 4YXLH 3KXFD 1J9RA 5T3XD 3ZJAA 1F6AA 1H6TA 1Q0EA 3FSVA 1AH1A 1IM9B 5E7BA 3M1BB 4OB5H 2AK4A 1RIUH 1UCBH 3IT8D 3CLWA 4P2OA 4QRRD 4R9HA 3BOVA 4X6DF 2FHBA 5HGAB 3K7UA 4GBXD 1QSFB 3TCTA 4U0QB 2UX6A 1WHPA 1KPVA 2W88A 3RP1A 3SDCC 5L9DL 2HP4A 1UACH 2R0LL 3UADA 1YNLH 3WNKA 5FKPA 3TEWA 3BFWA 3DOSB 5I28A 4KNQA 5I5JA 1G1KA 2ZP0T 4MX7B 5ADOH 3CZNA 4NQDD 4U0RC 5I1CH 1BJ1H 3JTTB 4X5WB 5D7JB 1FNGA 1VACB 1I9JH 4ENZA 2NUTB 3B2UC 4ZMTA 3U6XS 1AIZA 3OJVC 3ZU8A 5E99L 4MAUL 1ITBB 2E86A 3MV7D 5BPPA 2EILB 4BKLB 3O6MH 4N2CA 4N28A 4TVPH 3VQLA 5C0IB 2BSSB 2I7OA 4HJSA 5E1IA 5TF1H 4ODTH 3BYTA 3RIFF 3A21A 2VWEE 5FWQA 2BVQB 1Y0LA 3NCCB 5DMJB 1OAZL 4HGKC 1J5IA 3NA9H 3QI9A 4G6MH 4AG4H 3CPLA 2ZWNA 1W0WA 4N8VA 3B56A 1N0LB 2ZXDA 3PGFH 3BAJA 4HGMA 4IIZA 3WAJA 1C5BL 4Q14A 3FH8A 5EF2A 5KVMC 3PPEA 3GXIA 3QXAA 2P3YA 1DJXA 2HRHA 1E5ZA 4HC1L 5CLTA 5T1KD 4OZGF 1QSEE 4GAAA 2X4QA 4PIBA 3H9SA 4AVHA 4PJHA 3G6JF 5KBNC 3IJYA 1W80A 4KJQD 4UBDD 4LLWA 3UROR 2VJXA 4WUKH 3QJOA 5DJXA 2QDWA 4ZD3H 2F7PA 4LDOB 4XAWH 1MJ8H 25C8H 3KPPB 3VXUE 3T4YA 3WTSA 1I7TA 3MRNB 4TQEH 3F5WA 1KIPA 4ABUA 3GNMH 4UDUB 4PS8A 2VLME 4IU2A 5EEXA 3HE7C 2PXYB 2HVJB 2VR6A 1AS7A 2VNCA 3BCDA 3A4DA 3TO2A 2ZOWA 3IKKA 3IRZA 4ZFOL 1UATA 2BXZA 2RJMA 4I7ZC 2ITCA 5IT2H 3HZKB 4HKXB 2RCSL 4BA8A 3DHPA 1IC7L 1TVBB 4G8IB 1RZ7H 1E7VA 3HMXH 3FUMA 5IBLC 1NEZB 4G6FB 3I3DA 3O6FD 5B1KA 5IM7B 5IMKB 1FGNH 4GMTH 3OBAA 5C0FB 5JR1L 2WXIA 5MEOA 2VB5A 1UA6L 1JWUB 3IDNA 4L8DB 1REIA 5GS2D 3SPVB 3ZVVA 3Q2NA 4DGVH 3OAYK 3EO0B 3QIWD 3CFEB 3DX3A 4GQ9H 5F9JB 3QIUA 2XG4A 2NY4C 1XT5A 3QCVH 2FZ3B 3WUWA 1BZDA 1ZLSH 2I26N 3G08A 2NUPA 2CDEA 3QWOB 2VLKD 3RNQB 5KSAD 3QJSB 1ZXQA 2IG2L 4HA1A 4MA7H 3E2HB 4ZPVA 3S4SG 4DEWA 4BFFA 1J9CT 4BK5A 4KK9D 2EKSB 2WNKA 5FECA 3P3RA 2X2JA 1WD8A 5K9KB 5F44A 1T5XA 1B3IA 1VFAA 3GBEA 3G5VA 3LIUA 3FJTA 3WTWA 1SHXA 4NXSA 1BOGA 2EH7H 5JIKA 2X41A 2J6EL 4ENED 4F8TA 4IRSA 4PRBB 1A2YA 2L7UA 4PTTB 4R7VA 4XNZB 4GRMB 1E9PB 1YNKL 4JJHA 2XBDA 4MJHA 2EUZA 4DGWC 1XVSA 3DO4A 1HH6A 4NYLA 4NERA 4OSUH 5B3NA 5I0ZA 3HUJE 2BXYA 4NLAA 4F1ZA 4AJVA 3QNFA 3EO1A 2V0AA 3RWJB 2WBKA 3IMWA 3K74B 4HCRA 3RVXC 1TXKA 5AOJA 2BINA 4KUCD 3CCHB 2VXQA 1CGVA 1M7DA 3MX0A 4S2SB 4AW4A 1NFDA 2GJPA 1J1OL 1XWVA 2DBJA 3NZ8A 5D7IE 2Z92B 1URIA 4MCZA 2BIPA 4PJ9A 3CHQA 1D5ZA 4ZUVA 2E8YA 2FD6H 1TVDA 4FG2A 1NPJA 4XBEH 1EV2E 5KBDA 1NKRA 3A6CL 1JPGB 5F71A 5DHYB 1AY1L 1PEWA 5JLZA 2FVNA 3GXDA 1VDGA 4KKNA 1NC4A 1J87A 3S98A 2DYPD 3EJYD 1IO4C 1ZA3A 3TBSA 1KV3A 5J6SA 1HOEA 4QHLB 3SDCA 3STBA 3F83A 5D6CB 1CI3M 1W16A 5BQ7B 5L8KB 4GSXA 2EICA 4BZ2A 2Z8VC 4DETA 1CXKA 3A6BH 3S5LB 4K71C 5BS0A 5DFAA 4ABQA 2OK0L 4PGZA 5E6SB 3SYPA 1QBLH 3FBKA 3INOA 5I16B 1QAWA 4G6JH 2KH2B 1LNUB 1JYVA 1KG0B 4LSPH 3WMPA 1VEMA 4ZX3A 3WIHA 1A1MB 2A4CA 1T21B 1TTRA 4NO2A 2AQ2A 4YO0B 2A38A 4KMQA 4TKWA 3LKPA 4MNGB 3L45A 4YDJA 4OIIH 4BIKA 1MXGA 5F7FA 5HD8C 5FGCE 1MJUL 2GTWA 1KJ2B 1OQXA 4AQAA 3MRQB 1WBXB 2W9EH 1JWMB 1KFAL 2D7MA 2DH3A 3B5GA 4KKCC 3GGWB 4Y1TA 1Z0MA 1S4IA 4ILDA 3JWNH 3F7VB 1BAFH 3GMOA 1B6DA 3H55A 2ZF9A 4K7PY 3V79C 3BSHA 2RB8A 1CXFA 4R0LA 2F5BL 1M9SA 1G9MC 3C6LC 3S34H 3FQYA 2I9TA 2QTVA 5HJBA 5GGTH 1II4E 3CHRA 4QO1B 2WCSA 1KOAA 1ZLWK 4JUTA 1ZSDB 3MRRA 4KPHL 5LXGL 1H0DB 2WLKA 1NC2B 4W9GC 3Q8AA 1RIVL 2XHNA 3L3DB 4Z3HA 4XCCH 2BCKA 4EI5C 3RGHA 4LEXL 3V0EA 1FE8H 2N1KA 4OU3A 1JVOA 1S7RA 1XIWD 2CDGA 4KI5D 3S8FB 4OGXL 5ENWA 1ID2A 3HZVB 3V6OC 5DJZB 4ZTEA 1KTJA 5DQ9A 1GSMA 1M6UA 2R4RH 3U9PL 2AEIT 3MRMA 4PLKD 4XP6L 3X12B 1MN4A 3P4LA 3LCYA 5H4YA 4JRXD 4HIHB 4AZUA 2EIKB 1VEPA 3QRGL 3CLFH 5INCA 4DW2L 4JY5L 3HE7A 4AKQA 3LHPH 1LLAA 2KKQA 5E9AA 3P4MB 2MWCA 3P77B 4FQ2L 4UOJA 3BT2L 1IKFL 1S7SA 4X2UA 4CC0A 4E68A 3KS0H 4H8WH 2IWEA 3C5XA 1BZOA 3Q3GA 3VXRD 2FO8A 3QJZA 2H6PB 4JFFA 4QRTB 5CP7A 1IGFH 4IBZA 1RULL 3D85A 5FKAB 3PJSB 3D51A 1SQMA 4PS4H 3N40F 1SBBA 2A6JB 3ES6B 3HMWL 3RL1A 1CICD 4X50A 1YHPA 3MVSA 2ISDA 1RK0A 3GTNA 4P5KA 1EXUB 2PP7A 2WOBA 3O9WC 2X7LA 2VN4A 3TJHD 4PJEB 1JF1B 4XAKD 2A6DA 3EJSA 1H3UA 3Q6GH 1F56A 1KT2A 4OF0A 1P0SE 3MRGB 4IHOB 4LLVA 1LO0L 2VZVA 3PL6D 5HYJB 4NO5B 3EXJA 1NCAH 2GTQA 3APFA 1GC1H 4D9LL 1BX2B 3L3HA 5GRJL 5I76B 4NB7A 4TPRL 5IMMB 2PLTA 5IMLA 5HJGA 2VUOA 1MCWW 1ZVSB 2GJ6D 2E0PA 3O3BB 1ZV9A 1S9VB 1FSKC 1TQWA 4OY9A 5SWSE 2WYTA 1L9MA 1NUDA 2NXZC 1F3RB 4GUQA 5HHME 1XF5B 2Q8AL 3LKNA 3BE1L 4ODHL 4K7PX 5LBSH 1E5YA 3RA7H 1XSJA 2DICA 4P5TD 4XXDA 5GXBB 4X83A 3DXAE 2W38A 1KJ2L 4MMYB 4D0CB 1JWSB 1PAZA 1VADA 3DGCR 2LW3A 4Q0XH 1JZ7A 3RYMA 3UBXI 3TBTB 1GA2A 2FT6A 4Y88A 1G9NH 5H2BB 3RKDC 5H8DA 2O6EA 3QFJE 4OLVL 4MAYB 1R0AH 1OWRM 3SE4A 4HS8L 2EP6A 4OM0H 5AVYB 2XX1A 1Z9SB 3JV0A 2AXGB 1B0GA 5EPMA 4AGLA 3NK3A 3BHBA 4U3CA 1LYQA 1TSRA 1SY6H 3U1QA 5FOBA 4AGNA 2VISA 4J23A 3RFZC 3S6CA 5E9DA 1G1OA 2E6PA 5DEFB 4HIXL 3ECBA 5D7IF 2NY7H 2J44A 1FVDA 1TZHA 4W70A 4XBMA 4YDKH 1H8OA 2J25A 2UZYA 5FR3A 1E9QA 5TK2A 2B9BA 3PHQB 4MGXA 3HE6B 4Y4KB 1C8QA 1D9KB 3RWEA 2HT2C 4W4NA 1NBZA 4GOSA 1HZHL 1TEYA 4PFEA 5I1AB 5IHLB 1OK8A 2H1XA 3NCFB 1O6SA 2K4AA 2QT6A 1UXMA 2WQVA 4MVBD 5C6TH 5TE4L 1ZLDA 4OD3L 1BLNA 1OHZA 1P4UA 5T1LD 2AQ3A 2B1HH 3POCA 1SFHA 4M4PA 3IGKA 3EO9L 5E0FA 4FQXA 2OI9B 2W65B 3DK2A 4HJJH 5IK3A 4F92B 1TETH 5GIRB 1Z5LA 1MREH 3Q6FA 1LEKA 1FC1A 3KLAB 1ZTXL 2FAUA 3KLSA 2UX7A 2CBTA 1A14H 1J05A 4AYSA 1JUFA 1MY7A 5AYQA 1TU2B 4EN3D 3K6SB 1HHKA 3CN2A 2D7TH 5CHNB 1ZKAA 2G2RB 3GLZA 2PR4L 4Z77A 4ZFGL 4N5UA 1CXEA 4ZMZA 1O7SA 3FC8A 1QO3A 3QUYC 3AABA 4W9JC 2GITB 5EU5B 3HS8A 3VTMA 2IPUG 2X1QA 1OCCB 5MEQA 4J4PC 1W72B 4BQ9A 4ZMWA 3NPSC 3C6LA 1JXFA 3ARZA 3H2PA 1LO2L 3AB0B 3S3JA 4DT2A 5IVXA 3QIBC 1WWAX 1XMWA 3GF8A 1RK1B 2ZJSH 4C54A 3HTLX 1A7RL 4TOYH 3I75A 5F21B 2EXYD 2GAZB 1AR2A 4Y19E 2IPKA 1ONQB 1RKRA 1E28A 1QWNA 3V8CA 3U0TA 2VDKB 4YZFE 3DUUB 5EORH 1CFVL 3U4AA 4BH8B 2CLRA 3V6OA 4P9ML 5GZNC 4YSQA 5T3ZD 4Y2OA 2LLGA 2OSXA 2AQTA 5DYOB 3VFUB 2GC4C 1W8OA 4IKNA 4N8UA 1CE1H 3FRUB 4NSKB 5JDSA 4MSWA 3B34A 2H32B 1GOFA 4XN1A 5AKVA 4PLJD 4G7VL 4A6YA 1AFVL 3EFOB 1BREA 1LO5B 1PZ2A 1WPCA 4XXWC 2PCPB 1KULA 3MUHL 1VB9A 5EO1B 1U95B 3DBXA 1WQVT 1EFXD 1D6VL 3T9WA 2C7UB 4JDTH 3L9BA 5GGRY 1DVTA 2FWOB 2BZDA 3HPJB 3JZYA 3L7EA 3JYCA 1PLBA 4MD5B 1AD0A 3CC1A 2WHVA 5D7LE 3H2WA 4HULB 3II3A 2DQFA 4PY7B 3K3QA 5C71A 1PGRB 1TLKA 2DQTH 3WNPA 3OKEA 3QQ4A 1BJMA 5KYXB 4H25A 4OJDH 2IQAA 2XWRA 4OZIF 3KGRA 1LMIA 2OMYA 1ZGLA 4KKBC 1YRKA 2JIXD 3HI1A 3HIZA 4NM8L 3ZE2E 5C97A 1S7UB 2Z31C 5CR8A 2E4TA 3G6DH 1OCRB 2NYKA 3FUIA 2B7DT 3SKJH 3WHXA 4QF1A 5F0MB 4F37K 5I6XC 1V54B 2YPLA 3VG9B 3QRFM 1HQ4B 3COOA 5E2UL 4I13B 1J5OL 1ANUA 1TMCB 5KBLA 1HSAA 1HX0A 5L2KE 3JYBA 5HHOE 4XNYH 1N5YL 4HIIA 5F1NB 3WSQL 2FJFA 1YEIL 3JVFC 3L3JB 3IMSA 1FG2A 3GJFH 3KW8A 2Y7MA 4DIXA 3QNYB 4ONHB 1N2RB 4J3VA 2DQDH 2WLNA 4M5TA 3OKOA 1M53A 4U6XB 2XTJC 1YMMA 5IB1A 3ZHDA 5HGDA 3SHSA 3VWJA 3P9LB 4GW5B 4QT5B 5F3HA 3E9UA 4JBSA 3V5DB 5KW9H 3RGVB 1YECL 1YEJH 5CJOH 1I7RB 5FLUA 3LEVL 4U1SB 3HLKA 3BWUF 4M7ZC 3UZVB 2GFBB 3MHZA 1PL3A 1ZHLA 2AW2A 4EKJA 1IV8A 3CXDL 2DM7A 1WC7B 1KN2L 2ICWA 3B4NA 5CS7A 2BSCA 3C5ZC 3H7LA 2AVFA 1X7QB 3OR7A 3TL5A 3WUWG 4F7PA 4WI3A 4M7KL 4JO4H 2D0FA 7FABH 2VDKL 4O2CA 1A9BB 5AB1A 1NMAH 3RFZA 1JZ5A 2RD0A 3PFQA 3GSWA 4WW1A 1UD3A 3HFML 4YGAB 1HQRB 2VDRB 4IQHA 1XGYH 2ZWYA 3EH4B 4NENB 5ABZA 1SYSB 1WBZB 4UYPA 4W9ZA 1RLBA 3M88A 5T3XH 2Q6WB 5B21A 4Y2NA 3U1SH 4KKZA 3A67L 2F61A 3EIFA 4WTQA 1T0NA 2JTYA 1E40A 3FTYA 4IS6B 5GRUH 3P4NA 3RWFA 3UTSA 4J3BA 3MA7A 2F8OA 3C2AH 2IWGA 1T2QL 4NKDB 1E2VA 3LKSB 1JN6B 1IC1A 5CBEB 1AKJB 3T65B 1E8XA 1FRGL 2X4NA 1L7IL 3GBNL 4XMZA 4PJ8C 2IGFL 4K55A 1HAWA 4LLMA 3WYRA 5JPNB 2WUBL 4XODA 3EJUA 4HUNB 4X4ZA 2NNRA 4LVEA 4D8OA 3VXMA 1UYWL 3GJFK 2WBJA 3F00A 3I6SA 3MLZL 3SGEI 3NG5A 4NQEA 1S9YA 2P5WD 3O2DL 5JOFA 1F02I 5KVFH 2Y1YA 3BP5B 4GUOA 4UZSA 1ADQH 5ID0B 2HMID 4DP1X 1NCBH 3UP6A 5JW3L 4OQTH 2D7OA 4WFGE 2FBRA 1DLFH 4UAOB 1MHEB 3QUYA 4F7EB 1LEGB 4ANUA 1PX8A 1QLRB 4UOZA 1BFVL 4J4PA 1MCEA 3LEXB 1NLBL 2CCLA 4PCKA 3KM1A 4A39A 3RTQD 4X6CE 1I8MA 3ZTNH 4G1EB 2Y7NA 3ZOAA 4M5ZL 2V8MA 4NWTH 3TA3C 5HGHB 1BVKA 3MRBB 3ZXAC 2VXUH 1XZWA 1BQHG 4WW2F 5JDJA 2AQRA 2IJ0C 1W15A 3CC5A 3QDGE 4PJ5B 3L1OH 3VB8A 4H8VA 1H8SA 4N2AA 4O5LL 3MGOB 5KTEL 4OAWB 1PG7H 3QEGL 2ZXBA 3PWJB 3IAPA 4AJWA 5CUSL 4UT9A 2X70B 3FW6A 4M48H 5GZNA 1VEOA 1MFBH 4XPHH 4JB9H 4UOW0 3V95A 2BRRH 1HXYB 3NJLA 2ID5A 2ZTBA 4YXHL 1G6VK 3KVPA 5J9PB 1LD9B 5E6ID 3UEQA 3U9UB 4JM2B 1PZ3A 2QQKH 5DVMA 5I9QB 4ELMB 1MPAL 4WNQB 3NACL 4KNTA 4NLHA 5I82A 4KXDA 2I5YH 4XXWA 2IH1A 4YZFF 1BM3L 1K4CB 1NL0L 5DT1H 2PWDA 2X42A 3AG1B 1ACXA 2AERT 5CR1A 3ZDZE 1LL1A 5E8NA 1FIGL 3MBED 1YDPB 3VFMB 4UQDA 1JZ4A 2CPUA 3SE9H 3SDXB 5D1ZD 3V4VA 1WAAF 5MENB 2LVCA 4GEIA 3Q8FA 1G7QB 1MEXL 2EDJA 4KRLB 3NQKA 4JQIA 1MIEH 4U49A 3ZKNC 4J5VA 2PMZA 4NCC2 3L4XA 1A4KA 4L4TE 4WUUA 2VDRL 4GT7A 5AL0A 2P5EA 4U33A 1RIUL 3K71B 5B1AB 3FO0L 3SDAC 4K5OA 1DBBL 2QFPA 4G9FA 1KB5A 4KRNA 2ZX5A 4DQOL 6PCYA 3GO1L 1S7XB 1UACL 1MFNA 4NAJA 1T7YA 1RZJL 2BHZA 3BKJH 4IKKA 5GRYA 3B8YA 4A7SA 5I6OA 3D07A 3QEHB 4R4NC 1W91A 3LZFL 5BV7L 1R24B 1KGCD 3H9SD 4C55A 2PTTA 5GS2H 1E2WA 3RPBA 3IFPA 4P3CL 1QRNB 2VJ8A 4X8GA 3N44F 4RSVA 5IG7B 3BISA 3FQWA 2ZZUT 5DSCA 4Y8AA 4YDZA 2B2XH 3UBXB 1UCTA 1U93B 3LNGA 1F4XL 2DWEB 5BO1L 1DUZB 1SXZA 2BMKA 5FCSH 5ISZA 1I1YA 3O6ML 1F97A 5GGUA 2XV0A 1QPKA 1BJ1J 1QRKA 1CXIA 1KTLB 4JKMA 3OMIB 1A02N 3U46A 5C09B 3U0WL 2VKXA 3FZUC 1BFTA 1E6JH 1SEQL 5E1HB 3UX9B 2WLIB 3NA9L 3V0IA 4XVSH 1AC0A 5DJ6B 5FF6B 3MUJA 1OP3H 5IP4A 2K9UA 3A4EA 3IMRA 4CBPA 3QUXA 1MRCH 2UZIH 5JHLL 4WHYH 3PGFL 4P2QB 4HK0B 2YLHA 1J5HA 3OAZH 4GAGH 1LK2B 2LFEA 4AMKH 2H0JA 3D4YA 3T0XA 3F84A 1PLGH 2EXTA 1B2YA 1CJYA 1BGXH 4N8PA 3TBVB 3W11C 5C0AE 5JO5A 4HG4K 3A5VA 1WIPA 1FZOB 2P49B 1CD1A 5LGYA 3C5ZA 3QDJB 3F7YB 4IOSA 5DMKB 4GXVH 1CMOA 3REWB 4NQXB 4LEEA 3DMMA 3FU3A 3EJZC 3W1ZA 4X6DA 3VGAB 1EAQA 1HHHB 1R5WA 1GZHC 4LVOB 1I82A 3AREB 4C56D 2FWLB 4WUKL 4IDLA 3VRJB 4IRJB 4ZD3L 4A2MA 1XGQA 1F11B 25C8L 3OX8B 5DEZA 3BYYA 4AJ0A 2ZWSA 4Y5XC 2ITEA 4W9IC 2HFFA 4XO3A 5CBAA 2ZYHA 1CS6A 4NHCH 3T6VA 3N85L 2ZCHL 5DCCA 1X6LA 1FFOA 4EUPG 4LKCA 4HUUB 2BNQA 2ZD0A 1IQWH 2FNWA 3WFDH 3KLLA 3WHE1 1A5FH 2JXMB 1VFBB 2YD1A 2JELL 4R84A 4IW4C 3ZTEA 3T0VA 4L18A 1I1CA 2OZ4H 5C8JA 5IT2L 5D8JH 3KYKH 3ETBF 2P45B 5DJAB 4MMZB 4RBPH 1RZ7L 2AEPH 3HMXL 4PB0L 3RWIB 3X3FL 2OULB 3BP4A 3UL4A 1NOLA 1U8KA 4A2LA 4ZNCD 2R8SH 3LEYL 1HNYA 3HPLB 5T1JA 4NT6B 5IMOB 1FFPA 4XE5B 1AI1L 3TZVD 4EF3A 4DUVA 5DC9B 1DLHB 3EHBB 4DGVL 1TYRA 4M6AA 4UINH 3SD5A 1LM8V 4HV8A 2WTRA 3RUGB 1HILB 2F74B 3MAWA 4OM1H 2Q7NA 4GQ9L 5F7NC 2IOMA 4TRPH 4OR1A 3WD5H 2VWEC 4B60A 4Y4FB 1ZOXA 4OZGA 4OD1H 5IWLC 4HQQL 4N2FA 4W9KC 2O5ZL 3SPHA 4TNWK 4MA7L 5I30H 3AXLA 5JIDA 1E8WA 1N4XH 3TA3A 5JPMB 4Q9QH 1QUPA 1QSZA 3L9RB 1YJDC 2YXVA 3WDJA 4KRPD 3MKGA 4Y9GA 1OGTB 1KPRB 3VFWA 3ZYIA 1NZRA 3NIGB 2MEJB 2MCPL 1VZGA 4FHKA 4AENB 4XNMA 4QRPB 5BS0D 4YX2L 3LN5A 4X6CF 3EJCA 4Q58C 1BZ7B 1IRAY 1BIHA 4OSUL 4PIRF 2BIHA 4DP5X 4LNRA 5EC1A 2R1YB 3C60A 1A6PA 3LZRA 4NKMA 2OMTB 2K9FB 3DVGB 2EC8A 4I0PA 3P2TA 5DD0H 2OJZH 4KX7A 2MJWA 3CFCL 2Z8RA 2VL5A 4U1LA 2JJVA 3A47A 5IJKC 4N6QA 4LRIC 3ZHFA 3DRQA 1CLZL 2FD6L 5JORB 1H19A 3DX7A 4GH7B 3E6HB 5DUBB 3EDJA 1X4XA 4K8RL 4KKAC 1ZK5A 3QHZH 5DTFB 3WN5B 1ZVNA 1NAMH 4AT6B 3ZDZF 3ME0B 4ONOA 4OUUB 4A55A 4CW1A 4Y4HD 4YWGH 1G6RA 3FPYA 3SDAA 3TN0D 4G8FB 1QW8A 4PGEB 4PW3A 3AS3A 4J28A 4HOXA 3ML8A 2IDCA 3HCVB 2HJLA 4WO4B 3PQYB 4AQEB 2QQQA 4IKLA 4JDVB 5E8OB 1PNDA 5GJTL 4AX3A 1NGPL 5GS1B 3FOMA 1IQDA 2BSBA 1ZV5A 1M7XA 1ET7A 1WGOA 3OLEA 1QA9B 5JXEC 1P5VA 2Q7YA 3BRGC 4PRHD 2WB7A 1BVLA 3ZZQA 1RSFA 3FTVA 5C0DB 1ECZA 1MLBB 5FYLD 3NN8B 4FRWA 4JFPB 4PGBA 3EOBA 4W9EC 4J3SA 3BESR 4WI4A 4F7KA 3WN6A 3M1OA 5TDPA 3BZ4A 43C9A 2Q8BL 3VGHA 5A6LA 4A2DA 4BGDA 3DHMA 5SX4H 1AO7B 1KCUL 3IJHB 4OV6F 5AALA 1DQTA 4CBZA 5GHWH 3WO4C 5IV2A 1IM3A 3WNLA 1JPTH 1NBVL 2ADFL 4MWFB 1QLEH 2DQIH 3TEUA 5J11C 3LS5H 4JFFD 1AQDB 2KL6A 4P4RA 3TT1H 5E94A 3DROA 5IJDC 1WRFA 3A24A 5GGTL 4AYID 1OZTG 2DWDB 5FUOL 5E1QA 3O4LA 4PJBA 1NJ9A 2LT9A 3KPQB 1JDAA 4BHUA 4XCCL 1UWEH 5I1LA 4ZT1A 1GZHA 1KGYE 1FE8L 2QR0B 4WFFE 2BCMA 4R5TA 4IDJH 1A7BA 3PWNA 4XCFH 4MQSB 2WXGA 1HHJB 4XI5C 5D4IA 4QOKB 3T2NL 4Y5XA 1PD1A 2R1WA 2ZUQC 5IR1A 4KK8D 4G82A 3AITA 5DWPA 1F18A 4LEOA 5KVEL 4YHIB 4ODXA 5EA0H 5KBMA 4LT7A 2BP3A 2FEJA 3APDA 5J0BA 2C4FT 5LGHL 2JK5B 1GOHA 2DD8H 1W6WA 3MREA 4ZMOA 4H8WL 4ETQB 1A4AA 3MC0A 3RZCC 2XKNA 5DDHB 5DFTA 3TYFA 5FO8A 3APMA 1GMEA 1V3MA 3MROB 5KBKA 3GRGA 2IAMB 4JS7A 2D7PA 3PNWA 5FUZH 1VPOL 5F7EH 4URTB 1X5GA 1R34A 4MJIB 1XGZA 3WE6B 3BW9B 4QXVA 2E6JA 1DQLL 3KS0J 1AGCA 4YEFA 2FGZA 2ZXCA 4GJTB 4NP4L 4XT1C 3VGEA 3L3KA 4LCUA 5CD5C 3BVTA 4GKSA 1JFHA 1EZLA 1ASOA 1XSKA 5J89A 1KLFB 2YRPA 4KHTL 2E7LC 1HWHB 1F45A 3G6AA 3RWGB 1CFNA 1T7XA 5I1JH 3C6SB 2P43B 2ROXA 3KPSB 5IWLA 4NJ9H 1NCAL 3ESVF 4RMQA 5E5MB 1OAXH 4QIRA 5E9DD 3IE4A 4KJWC 3FQNA 3BLKA 4Q9CA 5AVRB 5EZPA 4YGVA 1EGJL 3IGUA 4IMKC 4L29A 5AAWC 3WXVH 3ULVD 1U8JB 2JKLA 4FG6C 3GS7A 2DMKA 4NZTH 4ONGL 4E9VA 5BVPL 5IFAH 3AQXA 2HUEA 1HKFA 2P28B 1OGAE 1QEWA 1SJHB 4HFWA 4LPYA 3TCLB 2H6UA 3V4PH 5ICYB 1SM3H 2H2SC 4HJTA 2WVVA 4FEMA 1QSEA 3HNSL 3RVVD 2P8MA 4U3HA 2IAAC 4EIUA 5MI0B 1WTGT 3RA7L 3V7AE 3TX4A 3OXSB 1XGTB 3U30B 5A16A 1MJ7H 1A4BA 1O75A 4KUZH 2BLFA 4PP2A 5F0PB 1TKWB 4J1UB 5HY9A 4ZG1A 3QUZA 4Q0XL 1G9NL 4HWBH 2BOBA 4HJ1A 4RQQA 4FQXD 3CSGA 3VXUA 5T3ZH 2N1TE 4TQHA 4OLUH 3FRPB 5DZ9A 4OM0L 3AZUA 2O1AA 1HT6A 4KHXH 4M6NH 5I0VA 3QSKB 1CURA 1QI3A 4G1MB 2WGXA 1T20B 3LY6A 4GRLD 4YDIH 2WINA 5C07E 4I3GA 3ZKMC 1FDLL 3WFBL 3O0RL 2Z35A 5LHDA 4UM9A 1MW1A 2NR6D 4QHUA 4Y5VB 3SCMA 2GT9A 1S8DB 2ZOKB 4NBZB 2VR9A 3GMRA 2WXRA 4KY1L 4XX1G 4DN4L 1CFQA 4N87A 4FA7B 1I8IA 2W60A 4Y1AB 1HC1A 1KGWA 4YDKL 4F2MB 1XCQA 2OX5B 4R7DB 4JG9A 4O58H 2I27N 3T1WA 5AWNL 2X28A 4JPKH 2R2BB 2FRGP 3L4WA 1FYTE 2VABB 4HJ0D 4M5YL 5DI8B 1P1ZA 2AABH 2UXGA 3BPLC 3MBWA 4XE0A 4ZUWB 2XRAL 5JXEA 4O4YH 5LGJA 2E7BA 5C6TL 3NEEA 4N90E 3VXOA 5D1XB 1ZT1A 2B1HL 2ZXAA 3TJEH 1I4FB 3DJZA 3T08A 4G7RB 1KELH 2V17H 3AS0A 3IBEA 4MHHG 5FO2A 3MU3A 3PABB 2A4ZA 4Y89A 4YPJA 4XNAA 5C2BH 3H7BA 5ECGA 4B9IA 3GJFB 2O4EA 1A14L 3GMNA 1YZZA 4IRZL 3ZHKA 2YRBA 1GYVA 3JV4B 3UABA 1KXVC 1D7FA 1MF2H 3OXRB 4BSWA 1NCUA 1X9RA 3VI3A 3LRKA 1MIMH 1VGEL 5A3ID 5I2IB 3HUJA 3OKDB 4R7NA 3L2NA 3X3GL 4PV9A 3WKYA 1ZLUK 3D06A 2APTA 3T3MB 1YUHB 1MSPA 4TOYL 1DBKH 1U8HB 4KJPD 2VMJA 4G8GD 2XN9D 4P23A 3EYQC 2F0CA 4UYQA 5D4JA 3PP3H 5SX4I 3MACH 2EC9T 2FJGB 4ZTOH 4QYOB 1CYXA 1DR9A 4IGBC 3A22A 5D7IA 5MEPA 5EEUA 4FTVD 1NGQH 1RPQA 5CO1A 5ANMB 3ZE1B 4XN5A 1QUNA 4GS7C 1CD8A 4NQCE 3R7RA 5CEZL 5DVPA 1UB5A 4OGYL 3P9MA 3IVKA 3KPRB 1FO0L 4XMTA 5CEZE 3CFBB 2V37A 1AXIB 1DEEA 1DO6A 2FE0A 4P3WA 2P80D 5EU3B 3KXFB 3R18A 5E4EC 4TF4A 2WANA 4A66A 3QWRA 1CE1L 1IFRA 1O5PA 5AOZA 1YMHB 5AQ0A 3KH3A 3OR6B 5G5DB 4Z7WB 2P24B 3L2MA 4IBLT 4KZCA 2NX5B 2OMWA 1MFEL 3DVFA 4QRRB 5IBUB 2RBLA 4GI8A 2EADA 4WWKD 1JNHA 4YC2C 2C9SA 3AU1B 1URLA 2C1OB 3LNDA 5E8PB 4UTAH 2ITDA 3L3OB 4QXGL 3CQFA 5IESL 1AGBB 5DZJA 3RZCA 2C1PA 1TJMA 3OQ3B 3CFKA 4MS6A 4OZ4A 1ZLVH 4BWWA 3JWOC 4ATTA 3ISWA 1U41A 3D3VE 4PI0A 5HI3C 2OJ1A 3TNMA 3V6FA 1ID5I 5I6LA 4NQDB 1UM6H 3CN0A 5I26A 2BSTA 2FH8A 3VWJD 5FUCC 3RKDD 5I1DA 3N1MC 3MMEB 3APNA 1HYSC 3EUUA 3IXAB 2CGYA 5IJVA 4I0CC 4K73A 3REVA 5TE6L 3MV7B 4N0FB 3ULSA 5TQ2H 3L95A 4NKOB 3VSTA 1XH0A 2E7LA 1PBYA 1ES0B 1SLUA 2B77A 9PCYA 2O5XL 2YS4A 1FH5L 3FB8B 3VXTB 2BWDA 1QQDA 3SKJL 2F08A 2A83A 4YXKL 3GFUA 1TUPA 1SVZA 4WHCA 4I48A 4RGNC 4WW2C 43CAB 4GRWE 3QC5X 1K8DB 1UM5H 2DIJA 4KZ0A 3QQNA 4IMKA 3F58L 1JNNH 1Z5HA 1CYWA 3W3BA 1ZEAH 1KCLA 1U8OB 3LNFA 4GQRA 1ND0B 5J1SC 3QQDB 2XWXA 4PBXA 3HB3D 5I1HL 3FQTB 4K5MA 4PJ7B 5IJCC 4R4FL 2ADIA 1ED3A 3UG4A 3LPPA 4JFDB 4FQLH 4KDTA 2CHZA 4ALAH 5IQ7L 1OIOA 1M3IA 4M6OH 4Y2DD 1I85C 5DEGA 1YY8B 5I75C 3X11B 3NVQA 2H4EA 1F86A 4EI6B 1MCWM 3CVHH 3HFFA 3DSFH 3BPOC 2N56A 8FABB 4YVNA 2H9GB 4MCYA 1AMYA 3RB7A 4NPYA 1XGUB 4BFGA 2ZCKH 5KW9L 3QJVB 5CJOL 3RWDA 2ZP9A 2CG9X 4NFDA 1T5WA 1JTTA 2WBJD 4QKXB 5EF1A 1DTUA 4M1CC 1TYJA 2X6VA 1MH5B 4CN4A 1FNSL 4J8QA 3C9NA 1HK6A 3A23A 4NC0B 2O26U 4Y5YA 5B3SB 2B16A 1H3GA 2E7DA 1NLDL 5I8EB 1AIFB 4JO4L 1NWPA 1F8TH 7FABL 3TGXA 1QFWM 1NMAL 4N2GA 4KZDL 1DQDH 1N3NB 2DRUA 4L3EE 3BVDB 5C0CE 3QUYD 5I5RA 4QD2E 2F1BA 3LPGA 1YVLA 2ZE0A 1XGYL 5I0YA 1A1OA 3JWDL 5D7EA 3Q9PA 4PVBA 2NW2B 5T3XL 1WS8A 1YEGH 3U1SL 1A3QA 1TO4A 1SDDA 1CFBA 3O6FB 1MQKH 4U6YB 2ARJQ 1KBKA 4YHZH 3NUKA 5KUKA 3FN0H 4N9GB 1GZQA 3N91A 3DC0A 4JFEA 3CH1A 2AQQA 3G5XB 1OALA 4XNQA 1OCOB 4P48A 4C8XA 3VRLE 3MOBH 2YQ2A 3PXJA 4ANWA 2HRGA 2DDQL 3EDFA 4B9ZA 2VIRA 4XPBL 1CB4A 3N9GL 1NDTA 1K5NA 1XCTA 5HBBA 2VLKB 4JFYA 5KSAB 2IPUK 4LB8A 1RUKL 1FHNA 1MZZA 4U1GB 1HI6A 1OT2A 4R83A 3DGGB 2UVFA 5SWSA 1DN0B 4X4XA 4YBQC 4AM0Q 3ULUD 3SKNA 2NY3C 4DWHA 1A9VA 2V3EA 2YHGA 3GZQA 4BQBA 3MV9D 4XZUA 2ZT9C 3TBYA 1U3JA 1ZS2A 1EO8L 4H1LG 1LEIB 1IGYB 3DXAA 4LMQE 1L9SA 4OJEH 2V7HB 2OJEA 3S96B 3HN5A 2Z1PA 3QB7C 4N86A 2Z1KA 3HOGA 4ODUB 5BZWA 1QKZH 2XIDA 2VERN 3ZTNL 1A4JB 4L1TA 4NWTL 4HAGA 4J3OD 3UTPD 3TNNA 3VXPB 2XG5A 3QFJA 2NDGA 3MOAL 4NQVB 4PCTA 1YEKH 4XMPL 3TURA 3VGFA 3BGAA 4IGBA 3K4ZA 1UT2A 1ORSB 2WO3B 3L1OL 3F7LA 4PJCF 4E42B 3DX9B 4H8PA 4E41E 1MHCA 1E2ZA 5I19H 4PJFE 3MXWH 2QADC 1HL5A 4HETA 3HAEH 1U8IB 2DIAA 4LHUB 2OXGA 4M48L 4JFZL 3P4OB 4R3SB 4MD4B 1CL7H 3BVNB 3MLTB 2J5WA 4N24A 3IJSA 2EYSB 1IEHA 4B5ZA 2GBTA 4F37F 5GSVA 1FJ1B 4HKBA 2Z8SA 4WVRA 1TZAA 2P7TB 3GI8H 2QQKL 5BZZA 3DO7A 1KDIA 3TJPA 2WKLA 2JWYA 3QO1B 5DT1L 4YHYC 4OF3A 3CFJB 1XH1A 4ZOBA 4G72B 3CFDB 2NYZA 2X4SB 3EZ8A 4RESB 3LZPA 4YDLC 4UUJA 2MPVA 3TH4T 2DQGH 3BKCL 1CFTB 1ACYH 3V4UH 1VGKB 3BLPX 3AWGA 1WEJH 1WAEA 2Y5TB 3PGDB 4EVNB 5AB0A 2FR4A 3GKZA 3BPNB 4LLAA 1IKOP 1C08A 4JFOA 1MIEL 3JTBA 1N7MH 3QUXD 1P69B 1S7WA 4ISVB 2FYYB 1T1ZA 4U6VL 5FM5O 4F15B 3F85A 1MHHA 3FO9B 1YN7B 2UWEB 4HDIA 4X7TB 4Y9FA 3T1FA 4BQCA 1U8PB 2VLJB 4OF7A 4TNEA 1PMYA 3T2OA 2V2XB 5J1TC 5FYJD 5IBTH 1JMXA 2W9DH 4MZIA 1Y6NR 4JFHE 4BRVA 5DD6A 4N1CA 1MI5D 4HCRH 5JW5B 2FHFA 3QORC 1J1XL 4IOSD 4CMMB 4OLYH 4QTIH 4Y16A 1SLXA 3DMMD 2IADB 4K94H 3K6OA 5FW6A 4WW2A 4X8JB 2ICES 2GUOA 3KGTA 1C5DB 3ZK0A 2D73A 1BZ9A 3NFPA 4MNQD 1S78C 4GFTB 2R4SH 3IWUA 5DO8A 4S1QH 4HAFA 3QDMB 3JV6B 1CVRA 1GS6X 4M4RB 4KAQH 1U8NA 1TCMA 1OM3H 3X13B 3DRTB 1SJEA 4KKLC 4YHNA 1ZS8B 2OTPA 3H3BC 4NEHB 2V2WA 4X6BA 1YC7A 3FCBA 4Y19A 3U7AA 2GJJA 4GRWF 4FXKB 1I85A 1DDHB 2VDMH 3H6JA 5C08A 4K3JL 1QNZH 1E6JL 1WF5A 2BNQD 3TVMD 2VR4A 1EHNA 3U4KA 1BQSA 1GYUA 1HSBA 3MCG1 1OTTC 4GAGL 4Y9EA 5KYYB 1J0KA 1XR8B 2Y6SD 4PRNA 3IDJB 4KNSA 3NQIA 5FHAL 5CGYC 3BUBA 3MYJB 2F58H 3T77B 2FUTA 3WIHH 4X9HA 5ABDE 1FZJB 3V6ZB 1EEUA 2ESVD 3CUPA 3V4LA 4JRXB 1DQQB 4GXVL 4K3EL 4JPWL 3P1VA 2FNBA 4JPIA 1IAKA 2VERA 1OARH 1NUNB 4PJDB 2Y23A 1KWGA 2CPCA 4OZFA 3AMLA 1NAMB 5A2LH 5D7LA 4G6KH 5IVOA 5I1KL 4X9IA 2Y2YA 3KAAA 1KTBA 4JDZA 4Z7VB 4DZ8B 2FB4H 2XPYA 3ATAA 2JFCA 2WIIA 4UIKL 3BAYA 2RHEA 1SMAA 2AJ3B 4J2QA 3I2CL 2WLLB 2HJFA 4X7CC 3W0WD 2XFXB 3K8MA 2VYRE 4TN9A 5K9JH 4KDVA 3SDYH 4NHCL 3MLWH 2NRDA 5KS9E 2CK2A 5JHAA 1CXHA 2J1YA 1TNNA 2A4EA 1CICB 1QR4A 5F3FA 3KLQA 3QUML 5DZAA 5FK9B 2CIIB 1TVHA 2EDLA 3VFOA 1IQWL 3P0GB 1R9FA 1A5FL 4DSYA 4YPGA 4ZSOE 2VR7A 3M17A 1OSZB 3ROOA 3EYVB 3F6IA 5D1ZI 3H42L 5I8OH 3B6SB 4MXQC 3Q06A 1PKQB 1GGBH 3ZE0F 4AZ8A 4QRSA 4RISH 4OFQA 1FZKB 5I8KL 2R8SL 3C60D 2X5PA 3UC0L 4XBGB 2OTUA 1MCHA 1KIUB 1CDCA 1PEZA 1VSCA 3GHBL 4KTEH 5TQ0H 4I0PD 5HHOA 3RX7A 3WS3A 5FYLH 2AF2A 5L2KA 4ODWA 2GJ6B 4PBDA 4UINL 1FFNA 3S4SB 1NSNH 1YYLH 4P5RA 3S5ZA 1DL7H 2R9HD 2WZAA 4TRPL 4R2GC 3ROLA 3UTOA 4LSDA 1KJMA 2DQHL 5ELIA 1UOLA 3UJIH 3VYNA 4P5TB 3U36A 3JBG7 1TJXA 2FIRT 2EE3A 2JKNA 1YQVH 3IJ8A 4FXLA 5I30L 2LGNA 1MFUA 3BEVA 2AEQH 5EC2B 2OYPA 5C6WH 2VCOA 4GB9A 3D9AL 2QLVB 1D5RA 3N0AA 3VW3H 1BZ8A 4MDIB 5CWSB 3U79A 2BK8A 4AEIL 3S8GB 4F27A 1QYGL 1EO7A 3G5ZA 4GQZA 3FB5A 1Q9OB 4BSVA 5A2IH 3VYPA 3S37X 4CL7A 1UOVA 3SKMA 3GUTB 1PIFA 4AIEA 1T66D 2BNRB 1SLWA 1Q0YH 3GM8A 2HT3C 4LASH 3T0EC 1JZ8A 2J88H 2DWSA 3I6LE 3CBRA 3ARDA 1D5XA 4P2RB 1XH3A 4JM4H 1BFSA 1PCSA 1MNNA 1CDIA 2VDLH 3QJQB 1D6EB 1MAKA 5IB4A 1EEQA 1PW3A 1ZDSA 3FSAA 3PDOB 2QQLH 4X6EA 2EUVA 1NKOA 2IXQA 2BP0A 1UWXK 4XVJL 1UXWA 4K7PL 1INEL 5F2FA 4PJFF 2W0LA 5ERWA 2J1ZA 3BQUA 4M02A 1UVQA 2OJZL 1BIIA 4K9EL 1OPGH 3IU3A 4U1IA 3T6QC 2VQTA 1EPFA 4XTRD 2IGLA 3D25A 3O6KH 5E00B 3BDYH 4JGJA 3STLB 1M7IA 2BVTA 4XNXH 4CJ1A 2IMMA 3P30H 1AC6A 3IFNH 2GSMB 5D1QD 1CL7I 5DS8A 4U1JB 1AP2B 4UTBA 1U92A 5TK4A 1LE5B 3EKCA 1NAML 2A6KA 2WZ0A 1G4MA 5T1LB 4JY4B 4CMHB 3PWUA 4AL8C 3NIFB 3WL9B 4LOEA 1I1RA 4YWGL 1P4BH 4XO4A 4N3TA 2CLVB 2V7NA 4O51A 4N0CD 5JOEA 4H40A 1K2DB 1PU0A 4F7TA 3PP4H 1JRHH 2EECA 3QORA 2HT4D 1ZMYA 4HS3B 4W6WB 5C2UB 2E74C 1DQJB 3O2DA 5AVUB 5I8CB 1X9QA 1GYAA 4AVIA 4TNVK 4NN6C 3ZYJA 5JNYB 3GMMA 4WI5A 1JGEA 3FB7A 2N4IA 5J13C 4EN3B 4Q6YA 3QBTB 1LQSR 1H3PH 2I60L 1FN4B 3FMGH 5IB5B 1UZ8B 4FXTA 1D5MB 5E51A 5D7HA 5D9SB 4A2HA 3IE9A 1OAJA 3RURA 1A6VL 1ESOA 4LPCA 4NUGL 4X6CA 5D96C 4FTDA 4KO6A 1S7VA 2WKGA 4ODSH 5EDXA 3V4PB 4F24A 2FX9H 2HCZX 3SBPA 3GJEB 1JFQH 3ULVH 4XP4L 1U8QA 3HC0B 4LEBA 3QDGA 1I1AC 1PY4A 1CWVA 3H85A 2YD2A 4FNQA 5GHWL 2EABA 3KGUA 3CDGB 1SGKA 1KCWA 1QASA 2DLEA 2I7SA 3VI4B 2DQIL 2OSLA 1Z7JA 3LS5L 4EIBA 3VCLA 2ED8A 3AXHA 2WJ5A 3R4RA 3OGCB 4P9HC 1RPUA 3P0VL 3LVEA 3TT1L 2BNUA 3EOTH 1KCSL 1UURA 3KYOB 4I9WE 1IBZA 4HT1H 3G04A 3N41F 4MJ5B 2GVYA 2G5BB 2OQJA 3IN0A 3DV4B 1UM4H 1YAZA 3ATFA 4NS0A 2HLFD 4E2OA 3ESUF 2VXSL 4DUXA 3ZKSD 3GSNA 5CD3A 3IGFA 1XSOA 2CRMA 3ARBC 3AG3B 3K72A 4JDEB 2B4CC 3D69B 2R2HB 3ECVA 4BZ1L 4OI8A 1P9MC 4UQIM 5H4ZA 1FQ9C 3KJ6H 3MJWA 4PJAF 5D72H 4L4TA 5CN1A 5BUGA 4XWOD 4TNWF 1OP5K 3QQXA 3GMLA 4I4WB 2GTZA 3JVGC 1JXGA 4X7SH 3LKOA 3IMTA 5F7LB 5TPWL 4Y9BA 2PPAA 2WLHA 1NUGA 3JUZA 3OKKA 3MJ8A 4JRYB 4QJ3B 3FQXA 3NJVA 5F7AA 4Z7UA 4YE4L 1J1PL 3UEZA 4PRDA 4QWWC 3FAXA 5CJQL 5AOLA 5T33H 5CKGA 2PYFB 3W2DH 4FX5A 5KS9F 3HBPA 3O3EB 4LL4A 3QUZD 1D7BA 2ZG3A 2LE9A 2MNJB 1KUMA 3IGAA 1JHTB 3TPUB 2R2EB 2X4UB 3BO8B 4OI9A 1FCGA 2NPLX 1S9WA 3HAEG 4QHMA 4BZYA 3K46A 3UTTD 5E5UB 2ZKHH 3DURA 3ATDA 5EBMB 1DE4B 3QGVA 4A6YH 1T22B 5HXMA 2YAQA 2VLMD 3UTQA 3ZR5A 2J2ZA 4QXUH 5GJSH 4UM9D 3LD8C 3R19A 4H8QA 2GQHA 2MHAB 4JFXB 4NJ9L 5EU6E 2EUXA 4Q9BA 3SCMD 5JW4Q 2ZF8A 1V7NH 4PWHA 4ZOEA 3H0TB 4JVWA 1GSKA 3ZKXC 3IF1B 4L5FE 2AJUH 4FNLL 4P59L 5GQBA 4BFJA 5B3JE 3GZOA 3HG1D 5IFAL 1ZE3C 3TV3H 5C0AA 3DX6A 4QAWA 1MG3C 4X98A 3V4PL 3POHA 1IM9D 1L6ZA 4HPYH 2H45A 4Z7NE 5F6HJ 3T0EA 3IXTA 4AYFA 2RIKA 3FFDB 4KUZL 3CSYA 5DC0A 3RPKA 5J6GA 4IJTA 1GIGH 3HI5L 3DVNA 5TGBB 4APXB 3GSXB 4Z7OB 3DUSB 3V5HA 1A9EB 2W81C 4IU3A 3FK3A 5IGXH 4GAJL 2G0LA 4Z5RB 4HWBL 5AZEH 1H15B 4H20L 1QG3A 3MXVL 4FULA 1DQML 1K3IA 5F1IA 4EXKA 2QL1A 1HS6A 5DJ8A 5KVDE 5D7JD 4KHXL 4ELKB 2CLZA 1C12A 4OJFH 1AQKH 2X9YA 4L3CA 3IETB 5CIPA 3FU7B 4MYPA 1VHPA 1GAFH 1EEYA 3PNRB 3V10A 2F6AA 2ZX6A 4L3AA 3AACA 3NZUA 4KJYB 3BPCA 1JZ3A 4LLYB 3ILQD 1RUAH 3F01A 3K0WA 4PP1C 3B9KC 1S3KL 2F7QA 2PR9A 1NFIA 3UJTH 1FYHB 4S0HA 1I3RA 1SN2A 2V5TA 4LU5L 4RMTA 1RH8A 4YAQB 3QRBA 1KIRB 5DQJB 2V3FA 1ZAGA 4KQ3L 4P23D 3Q1SH 1W0VB 5FM8A 4G9DB 2P5WB 3FUJA 4I3SH 3HI6H 2GSGB 3PGCB 1BFOB 3FB6A 3PY9A 4PUBH 5BZXA 3T8XA 4GG6F 3RDTB 4KVNL 4O4YL 2WNXA 3HRZC 4QTHA 5I17B 1MCDA 5D2NB 3QE5A 3M45A 5CILL 5EZLB 5KANG 5AOKA 3ZUCA 3S3DB 1Q9KB 4JGUA 3TJEL 4F7MA 4I5BB 1JYWA 4XMLH 5K9OB 4A2FA 3DPBB 4X9GA 4BV1A 2CHWA 1F6AB 4D94A 1X9UA 2PW2A 3CMGA 1R5VA 1WV7T 3RHWK 3UGXA 1JRHI 4HIJA 2AK4B 1J11A 4P2OB 5ESQA 3QVAA 1BVOA 1I1AA 2LTQC 2O6PA 3CFIC 1XF4B 1X5MA 3JTSA 4PS3A 3NMEA 4XMKL 3C09C 4ZO9A 1MCIA 3I3EA 5FKPB 2Y7SA 4J6RL 5IFJB 3LVTA 1T5KA 4V33A 4P4KD 3VFGL 2GB2A 5I24A 5K9QG 4U7KA 4ZMAT 1JK8A 2J56A 5C9KA 4GINA 4L9LA 2D31A 4EPSA 1Y18A 1UQSA 5LNEA 3TH3T 2IALB 5DFWH 2NOYA 5IW3A 2NY5H 2N01B 1FNGB 2Z65C 4RGOL 5F9OH 4FQCL 4XRCA 2CR3A 4WEEA 1OWWA 5IF0A 1EAOA 2HWZH 4G6FD 1NGQL 1ASPA 3FT4A 5CF3A 1TTCA 2XPGA 1J9QA 1NDMA 3MBEB 4OIAA 1G5GA 3VM5A 1SUJA 3VFVB 1T80A 3T71A 1OOAA 1NCCH 1Y0LB 1I9EA 3LRHA 5D1ZB 2R23B 4JHUA 2X4PA 4ZUTA 1OAUL 3BKMH 3CPLB 4PJXE 5D2LE 4N8VB 4BE5A 2J43A 1TCRB 4WKZB 2CJUL 5B22A 1NAKL 2IDUA 1KLUA 3NPZB 1MFAH 3GM0A 5CM1A 1WWCA 3GS0A 1CTNA 3KG5A 3QXAB 1U3ZA 2H2SD 4K2UH 5HVHC 3WFZA 4M8QA 4QDGA 1CE6A 4UTAL 2ENJA 4TVPE 1JD9A 4E9TA 1T7WA 3OJDA 2IF7A 1A7QH 4GPVA 1B9KA 2G75B 5F96L 3H9SB 5EBWA 4PJHB 2ATAA 5MP6L 2NXYD 2YXFA 3NRQA 4O00A 1E90A 3IJYB 3UYRH 3Q13A 2ZAIA 4FKKA 2OCFD 4KH9A 4DCQA 4LFHG 4LLWB 1UOKA 4XGZA 3FT0A 5DJXB 1MJJA 1R4XA 4QJ5B 3UYPA 4BE6A 4CGUB 3IKCB 2XTSA 1OT4A 1I7TB 2RQEA 3FU0A 3T4YB 1IGMH 3LXAA 3LN4A 4GXUN 1YY9C 3FUKA 4NIKB 2A9BA 1MNUH 4BWTA 3GK8H 2R7EA 3B9DA 4BWUA 3QQ9C 4HOZA 1KIPB 3LX9A 4YSDA 1EZVY 4IU2B 4UV7H 5KVGL 3ULUH 3CFUA 1KEGL 3TO2B 2CR0A 1RQ5A 4PPTA 2WQAA 1HHIA 1I7ZB 1BBJB 3L08A 1TPXB 3NA4A 1IAIM 4YDVA 1UM5L 3NEOA 3VXSE 5I1EH 5LWYL 1JNNL 2WLJA 4FFWC 1ZEAL 2ITCB 3IPBA 2DQJL 4JVPA 2QZ5A 2D3VA 3L5IA 3KYNA 3TO4C 2EE9A 3VMOA 4JHWH 1QR1A 3EF4A 3TIEB 3N55A 3FU5A 3O4OC 3LAFA 1OCWH 3HJEA 5MEOB 2EVGA 4J3OH 3P73A 2MTAA 2ZWZA 4ELME 2G3XA 2X0VA 3IDNB 4HBQA 4E5XA 1KB5H 2AGJH 5B3JF 5AG9A 1G1CA 2XG4B 3QIUB 4S11A 4WSJA 4ZMPA 3EG9A 3LIZH 1FV1A 3G08B 5GS0L 3SE3A 2CDEB 1NBYA 2VM4A 3VD1A 2ZNWA 1AHMA 3SDXE 5GZOC 5ES4B 4BA0A 1JHKH 4ZPVB 5LQBH 3ZT7A 32C2A 3SKOB 4PJIF 3L6FA 4PRPE 4M9PA 1BQLH 3L4YA 2BIIA 4C59B 1VFAB 2WXMA 1RY7B 5HHMD 3G5VB 1XXDC 3VNZA 1F4YH 1TTFA 1BOGB 4H7VA 4X5RA 2OYLA 1DQDL 3RFRA 4A38A 3V5KA 1KV7A 3QXUA 1G7IB 3DXAD 1A2YB 1EZUA 2DJSA 1XGRB 1HHGA 3B9KA 4GSDH 2AV7A 1WZKA 2J1KA 4PRIE 1IBHA 4NYLB 4B9GA 5AW2B 4D9RD 1ZIAA 3B7SA 1YEGL 3J2PA 1F42A 2NNXA 1QRNE 4GFXA 4MCNA 2KPNA 2J1XA 3K8LA 1FCCA 2YXWA 3VQMA 5FYJH 3RTLA 3EGXA 3TZVB 1ZXKA 1NFDB 4MS8C 2A0LC 1P5UC 2DB8A 5C0BA 3NZ8B 5DJDB 3ARPA 4MCZB 5DD5H 3MOBL 1D5ZB 4XPGL 4WWPA 4ZUVB 3FQ2A 3QFDB 1WCQA 4POZD 3P11H 1NC2D 4Q4IA 4YOKA 5K1VA 1EVTC 2B5IC 4WWID 4RNRB 2DLIA 2Y69B 4LIQH 2P47B 5C09E 5JLZB 1THAA 3QCTL 5EUKA 1CTOA 2XY2A 1RZKC 3V8OA 5INDA 4CSTA 1EZVX 1MCPH 2OR7A 1RFDH 2R0KL 3E9TA 4KMTH 4KRPB 4LP4A 3UJJL 4N0UA 1OGAA 4YSUA 3WIIH 5C0GB 2VDMB 3BUTA 2FHCA 5JZ7C 2XA8H 3FTZA 4DKFL 4JMXA 2AJYL 3EFFB 1WA2X 5BS0B 2ICWI 2GY5A 1DBMH 3BKYH 4AGPA 1ECYA 3CZUB 2BC4A 3ZY7A 3WTTA 4M7LT 4AOFA 1Q0XL 4ZNEE 5IHUH 3BFOA 1YEKL 1ZANH 3NABH 5CSGA 2K7PA 2K1MA 2QGDA 1CLVA 1NIBA 1NANI 1NCHA 3VWKC 5ESAA 1BAGA 4HFUH 1H9VA 5E6YA 5SWZE 3QR2A 5C07A 1NICA 5I19L 1ZDQA 5B39B 1C7SA 3MRJB 4NGHL 4Y16D 5I5IA 2FSEA 1RMFH 4XBPA 5D5MF 1D3CA 4K3DH 5T1DH 2GTWB 4B9CA 4AQAB 2PO6C 2AMGA 1AG0A 1JV5B 3B7YA 4OCWH 2XJLA 4NWUL 2DY2A 3C5JA 3GMOB 1RVFL 3T6XA 1HVXA 1OGPA 3GBML 5HYJD 4Y4HB 1E6OH 2P8LA 4O02H 4R0LB 3TN0B 2CNZA 2ED6A 2K8QA 2AJZB 5DD1H 1E4XL 1LDPL 3GB7A 2HKFH 3CX5K 1U8MA 4MNHB 1IC4H 1A6UH 2C9AA 1MCQA 2DQGL 1FYTA 3KLHD 4Y19D 1WEJL 4PJXF 5D2LF 3BZFA 3MRRB 4GT0A 1KJ3H 5IEHA 1NGYA 4LVNB 1ROWA 4R90L 3K2IA 4DP6X 5LG6A 2DMCA 3BP7A 1E5BA 2NYYC 1S7RB 2CDGB 3CHSA 5HHNA 1XF2B 1P7HL 1AQ8A 4PRHB 4V2BA 2N3JA 1LHZA 2HX7A 2KZKA 1T6BX 3V0WH 4DO4A 4HHAB 3OZ9L 5EN3A 4TMPA 4UQ2A 5DQ9B 1XGPA 4M1CD 4HWZB 2QSTA 3OPZH 1WCBA 1UG9A 3MRMB 3OPUA 3R06A 2MKWA 1F90H 5EO0A 4F2EA 4OLYL 2VXQL 4RFOH 1ZIBA 5B38A 2PPCA 4KWUA 5INCB 3SJVE 4G6AC 4UZGA 1A21A 3QNXA 2AXFA 2PCFA 3FO1B 4L3FA 1AXSB 5F72S 4BGLA 4IBVA 2YD5A 5EEYA 1X5ZA 4XCEA 3FYEB 2N0MA 3R1GL 1HXKA 3TO4A 1WFUA 5CGMA 4EOWH 3DO3A 2IH3B 4JFFB 1EWHA 4XVUC 1EMTL 1IJNA 1UB6A 2K3TA 3DDFA 3VJ6A 3QPQC 1I8AA 5CMAA 2Z0UA 2WTOA 3NJFA 4Q74A 3WMSA 5CINL 3ERXA 1G6RH 4FLQA 1ZHKA 1Y07A 5T5FA 1TZOA 1HH9A 1RK0B 2VDML 1FORH 1JTPA 1TZIA 1QNZL 4FC3E 2IPTH 4P5KB 4XB7A 4BZ2L 1NCDH 2VDLB 3Q7JA 3W39A 2A6DB 4KQ0A 4JW3A 4NQCA 4Y4KD 1L0YA 1HTYA 3TIDB 4L0ZA 4HWEH 5EN2A 5FAAA 1DFXA 3LH2H 1RZQA 4LLVB 2NNAB 1V05A 5DRWA 4BQ6A 4OF5A 4OLZH 3FHEA 5IOKA 5FYKH 2PXYC 2AQSA 5GPRA 3I9AA 4IBSA 3GTTA 5LB1A 3WIHL 5I0DA 5IMLB 1B4RA 4V1DE 4X5LA 4RMVA 1DQKA 4HLEA 2VUKA 3KR3H 4L1HA 5FV1L 5AW9B 2AI0L 3W57A 5M95B 4JO8A 1OARL 3NSFA 6PAZA 1GGIH 2IQ9L 1FPTL 3EXLA 2HTKD 4G6KL 2PN5A 2FQEA 1HOCA 3PQYE 4XXDB 3D3VA 1BEYH 3QEUA 3ZIMA 2VC2H 4NAMA 1O9ZA 2W94A 1A3LL 3HKFA 1WGVA 3R8QA 3RVUC 4NO3A 3HBGA 1UD5A 1VADB 3DX8B 2ZOTA 4QY8A 2L3BA 5C08E 1PY9A 4G80A 5HYSB 2WYZA 1RUPH 5L7XH 3WELA 3TYGH 1SXSA 3VAEA 4IOFD 3U7YH 1PX3A 3QZWA 1B0GB 5KJ7E 4TUKH 4PG9A 3ARDD 4H26A 2HH0H 1JXKA 2O5YL 3MUGA 5CSZA 4KO9A 5E2WH 2NW3A 3U2IA 3WY3A 1GGBL 3BMWA 5I8OL 4FJ6A 1U3HD 4F2FA 2BZ7A 3LQMA 5E9DB 4WO0A 4HX1A 2H26A 5IROC 2XICA 4DN3L 3V0VB 5TQ0L 5DHEA 4YLCA 5ADPH 3BQUD 4NNPL 1TZHB 3RX5A 4ZX4A 2R56H 1JGVL 1Z3GL 1E9QB 3VFSB 1WD9A 3UGUA 4K71B 3RWEB 4DK6A 2X4TA 5IFHL 1KYOJ 3SB3A 1UTDA 4IEFA 1PLCA 4H88H 1KXQA 4E9WA 1I8LC 2WTPA 5AG8A 3HW7A 2R0LH 3GRBA 1BLNB 4J3XA 1YCSA 4WJG3 2OMVA 5L2JA 4BFEA 4YS4A 5KG9A 4JX0A 4FQXB 3IDGA 3FXIC 3VWKA 1U30A 4AJYV 5JW4N 4GO8A 5IK3B 1LEKB 1Z5LB 3D39D 2XU9A 3E0GA 1UUNA 4HOWA 2L0DA 3M1BA 4X99A 4NNXA 4OCRL 1TQCB 3DOIA 1J05B 3OKLB 4JM4L 4MAUH 1T2JA 3D30A 1CGXA 4L3EA 4NP9A 1UADC 3PWVB 2PO6A 4HWNA 2NTFB 1A6AA 5GS3A 4MDJB 3S88L 1HHKB 3NH7L 4PMEA 3SDDD 3ZSTA 2ZAGA 1QO3B 1P53A 2JJWA 4U05A 2DQCL 2XT1B 3FONA 4MX7A 1JZDC 5H35B 5HI4D 5MEQB 1OAZH 1ZT7A 3US1A 3WJJA 1R5IA 1Z1WA 4R8WL 3L1GA 4WEUD 5IVXB 2EEDA 4GUPA 1VACA 3QDGD 3TM6A 3TV8A 1JZIA 1MFDH 1SJVA 4XNXL 3HHSB 2XYCA 1MCFA 3IFNL 4OGAC 1EEZB 3ILDA 3MRPB 2EXWD 1UGKA 2ZWKA 3BGFC 1PAMA 1DVFC 2CLRB 2C9VA 5DUML 1J0ZA 1XH2A 1EXHA 2E8ZA 1P4BL 3WLWD 4AH2B 5ETUA 3CN4A 4FEIA 1JRHL 5JDSB 1N0LA 4A6YB 1T1XB 4PU2A 8PAZA 5IB3B 3G5WA 3RGVD 2OCCB 3GKWL 1CU4L 3DBXB 4UV4L 5HHVL 3BUYA 5E56A 5DU7A 3DYMA 4HSCX 3ULAB 3CMOL 1AD0B 3NCJH 5LO7A 1NGZA 2DQFB 4L4TD 1WUZA 5LLIC 2F54E 2V5SA 4AV0A 3FFCE 2YA0A 3QQ4B 5EIIG 1NEUA 2FX9L 4GP8B 1WWBX 4H25B 2B14A 1UXSA 1YEEL 3OF6D 4G8GB 2RCSH 5C70A 1KXTA 2CM5A 2OMYB 1DANU 1IC7H 4E41A 1ZGLB 4FQPA 4YBHA 1ERNA 3NJKA 4PJFA 2E46A 3HI1B 4JUSA 2GCYB 3TBWA 5JR1H 2DBLH 4JO3L 1BXUA 4DGUA 1UA6H 1NIEA 1UEYA 4L2LA 3UH8A 4UDUA 3WHXB 1FVCA 3CSTA 3FF8A 4QF1B 1E5CA 3OJ2C 2RA1A 3NAAH 5AKRA 1E27B 4LRNL 1F6FB 5FW8A 2Z64C 1ILSA 2H0PA 4HT1L 2C3WA 2X0WA 4K23L 3OAUL 1LO3H 1UM4L 4PHZA 1HSAB 1FSKB 1GS7A 4O9HL 3KD4A 1TVBA 2EDYA 3DIDA 4JO2L 1CK0L 3N1QC 2E59A 3L4ZA 5ILTL 1PS3A 2ZUWA 1FG2B 1RIHH 1AR1C 1JWUA 2WSDA 4NUPA 3GLAA 3EO0A 3KJ6L 3LQAC 3OKOB 4FERA 4LGRB 3CFEA 2VAAA 2J6EH 2PP8A 4HP5A 5EZIL 2B0SL 5IB1B 1CGSL 5HGDB 3VWJB 1CTMA 2EVIA 3FO2B 4X7SL 3IU4H 1YNKH 2X6AA 1OTUD 4HGWB 1G9ML 5F89A 2JSFA 1JMZA 3RNQA 1Z6JT 4M43H 1F2XK 4NXKA 4CNIA 2WLZA 3S3BB 2XC8A 4AVKA 4D8PB 2YGQA 2J7LA 3T0BA 5BRZE 2ICWB 3IK2A 1ZV2A 5T33L 4PVNA 4F7PB 2UXTA 4XP1H 3W2DL 4ZFFA 1LWJA 1B90A 1J1OH 1DJGA 4O2CB 3QJFA 3GSWB 1SNRA 4WW1B 3RI5K 3UTZA 5IROA 2QKSA 4DGYL 3GRWA 4PTTA 2PYEE 4DOHE 4GRMA 1E9PA 4F7CB 3NJNA 3TESA 3P0YH 1WP6A 4HIQA 1J5CA 2BJMH 1OW0C 1QHPA 1SOQA 1AY1H 1SN0A 5HDBE 3CG8A 3HB3B 4JM2D 4JPQA 4QHPA 4A6YL 1QMUA 1F41A 4Z95L 3AW5A 4ZS7H 3T3ME 2Y5EA 3RWFB 4W9DC 3UTSB 3ML9A 1R3LB 5SWQA 3SODB 4MAYC 3ELQA 4MBOA 4OFPA 4BHUI 3J07A 1QWHA 1BF5A 1OCZB 1M05A 4KX8A 1UXLA 2BVPB 2X4NB 3RB5A 2OLDA 1KGXA 4B95C 3V6BR 1L5GA 3MRIB 5MEND 4LLMB 2OK0H 3NIDE 4PLNC 5CKAA 5DJ0B 1BBDL 2QKIA 3D7PA 2A9DA 4WGKA 3EH1A 3HN3A 3UAJD 1M2OA 1Y1UA 2WBJB 3GEWB 5C0ND 2J5LC 2A9NL 1S9YB 1E3ZA 4H2AA 5JOFB 3L1FA 4XMWA 8CGTA 4HH9A 3SOBL 2JH2A 3MR9A 4TNVF 4QRRE 2FATL 5BQ7A 3SGDH 1KTDB 3DETC 1GIGL 3Q2CA 3S48A 4RSYA 3FOLB 4WLCA 3N42B 4JN1L 1TFPA 3HE6C 3QUYB 1A65A 4EZMA 1PZ5B 2ALAA 1B88A 3NPSB 1EANA 3CAFA 5I16A 1MJUH 3G5YB 3QR0A 4ZMLA 4L48A 2YPLE 3TWYA 2A77L 1I8MB 1KFAH 5KS9A 4NOBA 4ONFL 1A1MA 1IB5A 4APQD 1BVKB 2YIHA 3V7AG 3CU1A 3VFNA 1CZ8L 1OTSD 3CC5B 5FA4B 2F5BH 3DNKA 5KVFE 3QUMA 1FL5A 4R97B 1DVFA 2DIEA 4CUCA 1DN2A 1MUJA 2GK2A 2OZNA 3DBSA 1TQBB 1MRDH 4KPHH 4BFIA 5LXGH 4WJ5A 2H3NA 3UJTL 3CK0H 4MA3A 1RIVH 4J2XA 4X9BA 4U2ZA 6CGTA 3CD4A 3DDGA 1GRWA 2DZEA 35C8H 4LEXH 5FS5A 1ETJA 4P2QD 4XMVA 3AQDA 5AW5B 2PWGA 4OGXH 4OLWL 2IH1B 1HFUA 5E2TL 3O2VL 4YBLC 1B0WA 3HI6L 4PUBL 4M3JA 3II1A 2CXGA 1IFHL 1RJCA 3AB0C 4NPJA 4XZ4A 5E8NB 2A73A 2APSA 4QO1A 5GSRB 4XP6H 3MV9B 5DRNB 3PFUA 1KYFA 3QDJD 4BBWA 1QI4A 4WTXA 1ZSDA 5HYFA 3QRGH 4DW2H 1M7UA 3Q0HA 3L3DA 3MJ9A 4K8RD 1CFSB 2J8HA 4E9YA 5HJ3B 1A4KB 4WUUB 5E23A 1IKFH 4RCAA 3AG2B 2P5EB 2IEPA 3X1EA 3Q2LA 2GEQA 2OMBA 3E3QE 4GLRH 5DS1A 4HLZH 1GTNA 1JV2A 1KB5B 1JS4A 1SOKA 1JXDA 2EE6A 1RULH 4OCLC 3MRHB 3QAQA 3WFCL 1FGVL 1VA9A 1A3ZA 3HMWH 1AZCA 1SZNA 1BP3B 2HFGH 4GIAA 4MCMA 3IFPB 4IOIA 1U0QA 4Z7QB 2Z7UA 1F1AA 2OMUA 3ZQ9A 2GC7C 3P77A 1WT5A 2FLMA 2NDFA 3IJ9A 3PXHA 5ICXA 4K0OA 4LLQA 1HIMH 5F9OL 3BX7C 3VO0A 2PWEA 4WK4B 2IBZY 3MRLB 1LO0H 3VU2A 1H6FA 5ISZB 2H6PA 5AUMA 4D9LH 1N10A 2N7BA 2GABA 5GGUB 1Z66A 5GRJH 5FKAA 3VXME 4ZMYA 5DHVA 4LVHB 2IBBA 3ES6A 3U46B 3LS4H 2EDKA 2UV3A 2AS5M 1JD7A 3UC2A 1N0XL 3ZT5A 2VQUA 5MHSE 4PREB 2XTJB 3O3DB 2F19L 1JF1A 3QUXB 3A0OA 2YFOA 2NY0D 2Q8AH 1E30A 4ODHH 3BEWA 4F9LC 3B8SA 1S7TA 3MRGA 1ZGLP 4IHOA 1MFAL 4M7ZB 4MRCA 3VG9C 3S9DB 4B9KC 1UA7A 2FQGA 3QQ3A 5JO5B 1DBAL 5DMGD 1MI5B 2WSKA 1CD1B 2GJZA 4ZQKA 1PLAA 4JKLA 4MQXC 4XX1E 5SX5K 3SPCA 3VFRA 5T5NG 1A7QL 2NZ9D 4CU7A 1PZUB 1ZVSA 3DMMB 4XVTL 4BDVA 2WPGA 4HS8H 3SO3B 4X6DB 4FFVC 1R5WB 4JVUA 3UYRL 1B4LA 3IPEA 4L2YA 4UT9L 1XF5A 2IAND 1E5UI 1X5FA 4MNQB 2Y36L 1DVSA 3ZRSA 5IVXF 3THML 2Y3AA 1N70A 1OW0A 2QMKA 3ETTA 4LCIH 1PZBA 4Z3JA 1BQKA 2YAOA 2HTLC 2HFFB 2WXNA 1MNUL 5CBAB 1XCXA 3GK8L 4HIXH 3PDGA 4C4BA 1RSYA 2P42B 1U33A 4MAYA 1FFOB 1XV8A 4Z23A 2H2PC 2Y1AA 4LKCB 4QAMB 4X7DC 2BNQB 2ZOLA 2HB0A 3AXIA 5I1EL 4RETB 5HDBF 2IMNA 5EBGA 3V4VL 5FX3A 3GWJA 1ZSHA 4NQSA 1HZHH 4WFED 1PNCA 1TJGH 4JQIL 5GGQL 4JHWL 2Q10A 5C9JA 2BIMA 2GBUA 5TE4H 3CVIH 1U8KB 5DEFA 4S1RL 3QZWG 4GAFB 5DK0B 3EO9H 3RX9A 1G7LA 4P46A 2WXPA 2G3NA 2AJSL 2WTRB 3CWGA 3VD7A 3NIDF 4G9FE 5CLWA 2WLMA 3QH3A 5CZVH 2YGPA 3HE6A 3WY1A 1ZTXH 2W0FA 4NZRL 4FG0A 5I1AA 4OZGB 4WTZG 3DTXA 1S9XA 5FDWA 4PW9A 4O02B 4TS6A 1EHLL 3ESPA 4P0DA 4DAGH 2GHWB 3AJ7A 1KB9K 1ACCA 3AXLB 3TA3B 2KLSA 4ZMQA 2PCXA 4WSKA 2J73A 1OAYL 3G6JB 3K5SA 3RHWF 4JGMA 2A74C 2OCJA 4JN2A 1HEZA 4IKIA 4B97A 5EUOE 1FBIL 3MLVL 3NFNA 5PCYA 1LO2H 3VFWB 1F4YL 5LAXA 3SGDI 3ABLB 5HHPB 1OP9A 1A7RH 3KLAA 1AMXA 1XBDA 3LN5B 4WSGA 1AO7D 4LQ1A 1YPZE 4ZO7A 2DEYX 2QGCA 4KNUA 4W9CC 4P05A 4EDXB 1E5AA 4G8AC 4LNRB 5EC1B 1CFVH 5FOJA 4E9RA 1J10A 2BZCA 3C60B 2HVKA 2K4WA 4P9MH 3NSCA 3GMPA 2GITA 4X9FA 5E4IA 5CEXA 4I0PB 2J20A 2H0FA 2KZWA 1W72A 3CZKA 4MZ3A 5FHBH 4U1LB 1D2PA 4ACTA 3FT3A 2VDOL 3DRQB 3GD1C 1RK1A 4G7VH 1AFVH 4X4ME 5A2CA 2Y3NA 5B1JC 4LARL 3EAKA 1JPFA 4LIQL 2NSXA 5FDYA 1D6VH 3EBGA 4HUWA 4KROD 4B9PA 4U31A 2TSAA 2XZZA 2MOGA 1CCZA 4LSTH 4UANA 4BH8A 1MCPL 1RFDL 1W0YT 4KMTL 5HDOA 1G6RB 4CW1B 4L05A 3SDAB 3G9AB 3L5XL 1JVLA 3WIIL 3NCWA 1T3FA 1DJIA 1WWWX 4JKNA 4QOKD 4TSBH 5BVJA 3W82A 3VFUA 2XA8L 2WCGA 3B43A 4NSKA 3FRUA 4HUXB 4L4VE 5E6ZA 5BOPA 5I9QC 2DTML 5HVGB 1DBML 4RFEA 1CXLA 1IQDB 3FOMB 2PCPA 5CLXA 3GI9L 4N90D 4U4IA 4TQ8A 4A2GA 1P5VB 1TO5A 2CMRL 2DL2A 2FJUB 2MTPA 1YEWA 2BIQA 2Q7YB 3IB4A 1IEBB 1QFHA 1OOWA 1BVLB 5IHUL 3QXVA 3HPJA 1G9EA 4MD5A 1NCOA 3EOBB 4QXWA 3MTRA 1WFIA 5BNXD 1KENL 4IJ3C 5JUEL 4MJID 3VXRE 5TDPB 3BZ4B 1P7QA 2ZSVB 4KFMA 43C9B 5LBGA 1RJYA 4XC1H 1G7MB 5E2UH 3FN9A 4ZYKA 1J5OH 1SJXA 1F13A 2VC2B 4OCSL 5HYQA 1N5YH 2IWFA 5IV2B 1IM3B 3S37L 3WSQH 1YEIH 1S7UA 2V3DA 3UPAA 2DWXA 1B0RA 4Z76A 4F9LA 2QVFB 3QULA 5ESVA 3KPSD 4B0MB 1E6OL 1HCFX 4FFZA 4QNPE 4P4RB 4FAAB 5E94B 3VDBA 3DROB 4EEEA 2J57A 4FADA 1A6UL 2EAEA 3Q2VA 1ZT4A 4UNTA 1FFRA 3O4LB 3PRZA 4UB0H 5F93C 4X42A 2MPAH 1NJ9B 1MZYA 3LEVH 4XHJD 2FQDA 2Z0BA 4NQCD 4WRLA 5I1LB 2ADGA 1ETA1 2X12A 1FF5A 3BIKA 3NCYP 2A7BA 3O2WH 5GGRA 4RRPA 5CEZD 3CXDH 1U42A 3CQPA 3PWNB 2VE6B 1B9ZA 2VO8A 1AJ7L 1AS6A 2WXOA 3V0WL 1WE5A 4G42A 3KL0A 4G5ZL 4LP8A 2ZSWA 5SV3A 2R1WB 1DP0A 3HFMH 3P69A 1NEZG 4JE4B 2M26A 1GPOL 4NDMA 4PGCB 4HW6A 4QT5A 1J0JA 2IBGA 1S3RA 3V5DA 4ODXB 1I7RA 4QRBA 3KM2A 2YK1L 4NHUB 4ADGA 4XC3L 2B59B 4L1BA 5CZXC 3MREB 1WC7A 5J3HD 1SMDA 2XKNB 2G2NA 3TYFB 5FO8B 4E9XA 1L0PA 5I15L 1VENA 4JR9H 4M62L 1T2QH 1GGUA 5BUPA 3PNWB 2O5NA 3ELAT 3VGAC 5KANI 2IV9A 4LVOC 3V0HA 1AGCB 2C7FA 1L7IH 1G6RL 2IGFH 3PUUA 3L3KB 4MS8D 1XD1A 2BS71 4LCUB 4F3FB 1FORL 2YLKA 3EJPA 4QHKI 2IPTL 4IRJC 4LOUC 2EDOA 4LPXA 1KYDA 2Q6WA 1UYWH 2XZCL 2PW1A 5D6DC 3MLZH 1MCKA 4HPHA 4HWEL 3G6AB 3O2DH 3JZ7A 3VXQA 1FLTX 5FV2A 4PJXA 3NDYE 2F8VA 5D2LA 3EZJB 3ORJA 1HDMB 2LU5A 3S0PA 4HMCA 2Y7QA 2O6FA 5FYKL 5JW3H 3LKSA 3OVUB 3FQNB 4NO0A 1IAMA 2A74A 4YGVB 3TFKC 1HL4A 4L29B 2ORBH 2B20A 1NMBL 5HI5D 2IDQA 1BFVH 2K8MA 3FUDA 3B3IB 4FD0A 3T8VA 5HDQL 2VRKA 1J9TA 1QEWB 1EAJA 1L9RA 2GIMA 3P2BA 2XWBA 4H2CA 4XP9L 5I0XA 3VD0A 1T03L 4ETYA 1RZGA 3GSOA 4HXAL 4M5ZH 1J8SA 2O6DA 2P8MB 3V0GA 2C4XA 1OB1A 3P54A 3VD4A 4S1DC 1UD2A 1SXAA 3QAZB 3CXHK 1BEYL 1PPIA 2NT1A 5A16B 2P48B 2VC2L 3EDKA 3EHBC 4QTFA 3MV11 5FO9A 4PWKA 1OAQL 5EUOF 3QUZB 5I74B 3QEGH 4R5VA 5CUSH 3P3SA 3EH3B 3WOVA 1MHEA 2CSPA 1RZFH 4F7EA 4JGNA 4RQQB 2BOBB 3JWNC 2DIBA 1QLRA 1G43A 1RUPL 3GIZL 3LEXA 4Y4FC 3VX1A 2GIYA 2EIMB 3LXCA 4KO7A 3N43F 4YXHH 3CN3A 3TYGL 3UTTB 1YPZF 3Q2WA 1J0IA 2I07B 2WXLA 1G1YA 4G1EA 3U7YL 2RALA 5JPMC 1MPAH 2V2TA 4JPSA 2Z4TA 3Q01A 3S5LG 2Y1VA 2Z35B 1BM3H 3CSPA 4UM9B 2VR8A 1HAUA 2HH0L 2K78A 4PCYA 5ACZB 5C0CD 5ICUA 4ZI8A 3AM8A 3VXSA 1I3GL 4YK4C 1V55B 2GT9B 3SCMB 3US0A 1FIGH 4WI2A 3GMRB 2X70A 1XX9C 1G0DA 1UOWA 4ZFOB 1F2QA 3KPRD 3OC5A 3PU7A 1GW0A 4QGTA 4RX4A 5AOMA 4I1PA 1I8IB 2FLBT 1IFGA 4A1RA 1HXYA 2W60B 1MEXH 3HG1B 3LQZA 5LKNA 2R56L 5GRVK 5T3ZE 4ELMA 2VDRH 2EDMA 2DLGA 1PTZA 2NX5D 5TJWK 5K59E 4CILA 4OV5A 4ANVA 1P1ZB 5FPIA 3FO0H 3U9WA 4JFUA 4WFHE 4H88L 1DBBH 2BM3A 2GPZA 4DQOH 5C3LD 4LSSL 1BF8A 3GO1H 3QT2A 3AGWA 3VXOB 3CJJA 1RZJH 1ZT1B 2WD0A 2YN3A 3LZFH 4ZAKA 5BV7H 5I6KA 3FCGA 3SDXA 3RU8H 5F9DC 2PUQT 3EFDL 4P3CH 4G7SB 3D2UA 4DFIA 2QPUA 4PRPA 3U1PA 3H7BB 4R4BA 3WN5C 4ECNA 2WWOA 2EIBA 1WS7A 1F4XH 4DO6A 3I84A 4I88A 5BO1H 1NCTA 3GMNB 4Z8FH 2JKXA 3T3PE 2X9ZA 4NNYB 1XFPA 3FTXA 3OKNB 1RJLB 4LLUA 4BSWB 4WO4C 2XNAA 4PRIA 5ALCH 3R4DA 1WUNT 3O8XC 4EO5A 3B2DC 1KC5L 3U0WH 3HUJB 3KNBA 1JP5A 1SEQH 3BIAX 3HJ0A 4G7QB 4R7NB 4PV9B 1QRNA 6FABH 5F7DA 4PN6A 4ZXBD 1M6OB 1GC1C 1YJDL 3OAYH 3BIBX 3KPOB 5JHLH 5F7BA 3WV0A 4FQ1H 4OKVA 4P23B 1KBVA 1U93A 2D3JA 1MFDL 4X7FC 4E41D 1KB3A 5D7IB 3BD5A 1UD8A 4CC4C 3P3TA 4DESA 3FQUB 4QNPF 3BC9A 4JFDD 1DVQA 1KTLA 5B8CC 1UB5B 3H3PH 3WAKA 3P9MB 1FWXA 2ZCZA 4ZS6C 3IVKB 3LB6C 3CZLA 5C09A 2VZSA 2ICEA 2VZ3A 2WLIA 4HCGA 4LOVA 2B9AA 4DVBB 1NDGA 2XIIA 5GGVY 3VDCA 4F58L 3CQQA 2OMWB 3LDBB 1LK2A 5F9WC 5JHDD 1G9NC 1JNHB 3EJRA 4WHTB 4TL4A 3B37A 2LVEA 5CIPH 2ITDB 5J57B 1FZOA 1ZA6B 4N5EC 3N85H 2ZCHH 3F7YA 3RZCB 3NCJL 4BFBD 1NBQA 2Z91B 3ZX1A 1WBYA 3CFKB 4OZ4B 4P4KB 5CZKA 3NJJA 1S7QA 2JQZA 4RIRB 2ATPA 2VLRE 2UUDK 4OZHE 2OYKA 4ZNEA 5J8OA 3V6FB 4U1HA 4KQ4L 2BSTB 2QVTA 2ZOUA 5I1DB 4HJEA 2JELH 1OKEA 2ATKA 3QEQD 1MWAL 2E3VA 1WDAA 5EU4A 3T8MA 3SPJA 4GUCA 3ZPDA 2MQ3A 2LLNA 1S5HA 3V0FA 4EQ2A 4IRJA 1JAEA 1IBGH 3REVB 1F11A 4N2BA 5SWZA 3UZQA 4KXZI 4HHGA 3ULSB 4PY8J 4PB0H 4H0HB 5KSVB 3X3FH 5LDUA 5LCVL 2DBLL 3QRLA 5G4MA 2CDFA 3HNVL 3LEYH 1FVEA 4O2EB 2C26A 1AI1H 3BH9B 3L81A 4OGQC 4W4OA 1SEBA 2A83B 3NAAL 1L9TA 2BVYA 4I48B 3KHOA 3VSUA 1AAJA 2R39A 5E2VH 4MTMA 1LO3L 4JREC 4L4JA 4AUJA 1L9QA 1LWHA 4HQQH 1J18A 1HCYA 2O5ZH 5C3IA 3KPTA 4FMFA 2BSED 2IAMC 4PR5B 5AZ2L 1XO8A 2A1WL 2ZNXA 1FC2D 1FAIL 3D0LA 5DC4B 3RWIA 2ADIB 1ED3B 4OJAA 4M1GL 4S1SH 1RIHL 3EYOA 3K2UL 1QD0A 4YFDB 3AT8A 4NT6A 4YSEA 3RIAK 1X5AA 1HXMB 3MCYA 4KGLA 2NY1D 5DEGB 1DLHA 2P5WE 2WWMD 3CXFA 3IMVA 4QI3A 2EEBA 4NM4L 4RMSA 2NXYB 2WVUA 2P46B 4R26L