2MOQA

Solution structure and molecular determinants of hemoglobin binding of the first neat domain of isdb in staphylococcus aureus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
LNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTDSKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSSTHFNNKEEKYDYTLMEFAQPIYNSADKFKTEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Iron-regulated surface determinant protein B
publication title Solution Structure and Molecular Determinants of Hemoglobin Binding of the First NEAT Domain of IsdB in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2moqA00
4MYPA 5D1QE 2MOQA 3QUGA 3QZMA 2K78A 3SZ6A 2ITFA 3VTMA 5D1ZI 2H3KA 3SIKA 2ITEA 3VUAA 4H8PA 2O1AA 3QZNA 4YMPA 4NLAA 2E7DA 2Q7AA 2Z6FA 5D1XE 3QZPA 2O6PA 4FC3E 3RTLA 3QUHA 3QZLA 3QZOA 4WJG3 3OVUB 3SZKC 3S48A 3RURA 4H8QA
chains in the Genus database with same CATH superfamily
3UZVA 4NOBA 2AQPA 2DIAA 3JV6A 4XBEH 5ADPH 3HI5H 5GS0C 5J5EA 4HHWA 2HWZH 1C12A 3B2UC 3SCMB 3IGKA 5F9OH 3IN0A 3KM2A 5I1JH 1CGWA 2H32B 4IEFB 5ILTL 5T33L 1AJ7L 3H4HA 2GUOA 3OKEA 3FSWA 4EZJA 5KS9E 5FHBH 4PW4A 2NW3B 2VN5A 5D55A 1JTPA 2E76C 3NIDF 1QKZL 1KYUA 1VSCA 1W8OA 4C4KO 5I1KL 2ERJC 2FDBP 2R9HC 4MZRA 4BRVA 1G1CA 3MREB 4H8UA 3WJJC 5DRNA 2DQDL 4Y19B 3ZX1A 1PG7L 3FYEB 1MCEA 3NCYS 3BZ4A 4L3FA 3QARA 5D2NB 4DZBA 4R90L 1Y1DA 2OZNA 2XXFA 3ZE1B 3IDXH 3GK8L 1NBYB 3MACL 5CLYA 3D0AA 3AXLB 3SGKA 2M1KA 1RFDH 5DGQA 1XSIA 1PY0A 3RDTB 3UIYA 3HHRB 1LP9A 2L8AA 3AADB 4U4BA 1BQRA 1LO2L 4Z7NE 4Z7WB 1Z0NA 4F37F 1MW1A 5DRZB 1RERA 1AQ8A 1F2XK 4DPBX 3IGUA 5AB1A 2DLTA 3H3BC 2GSGA 4P8QA 4LF3B 3AJ7A 4AY0A 1ADQA 4LQFH 2PTTA 4H1LH 4OQ1A 2NUTB 1TTGA 4Z7QF 2BFGA 3UTPD 4BXSV 5DA4A 3L7FA 5EDSA 1C5DA 1U9KA 2D7NA 3SPIA 1BJ8A 3EFDL 3OKKA 2RR3A 3H54A 5ELIA 4WFHD 3GJFH 4RAVB 3H53A 3R06B 5CHNA 3RPIA 1XMEB 3RWIA 4HIQA 4CKQA 3GBDA 5GZOC 5ID0B 2NNRA 3V79C 3GLZA 4X5LA 1IAKB 2N7SA 4YLQT 2YBRB 3GS0A 4AQ1B 5L4IA 3JWNC 4U6TA 3A0OA 1VRSA 4W68A 5EUOB 1D5BB 2F74B 4S10A 1IMHC 1YG9A 2KLTA 4LPYA 4ONGH 3RUGB 1YYMH 1LGVA 2FO4B 1Y18B 3GXIA 3S2AA 4NPYB 1E2VA 3QXWA 2ZOLA 4QRAA 2VQ1A 5CZXC 3N44F 1SHXA 2PO6B 1PD1A 1HSAA 2B5IC 1KNOA 3LRLA 1IC5H 1LO3H 5DA0B 5FGBC 3ZHDA 3IJ8A 1SFDA 3NZHL 3WNIA 4JQXC 1QNZH 5MENE 2VZOA 2Y5QA 3CAFA 3WMPA 2F1EA 3MV7A 1UKSA 4E0RB 2P5EB 3BGMB 3SDAD 4POUB 5B39G 4D0CA 5I8KH 2X40A 4XC1H 5SWQA 3CDYA 5FFOA 2DLEA 2CR3A 4OD3H 2ED9A 5JDSA 2HG5A 3VH8A 5I2IB 1R1CA 1RMFH 2DB8A 4X9IA 4Z7UB 4ADJA 4EBQH 3V6FA 3G5XA 1IFHH 5FA3A 3SB3A 2NY5H 4I4WA 1CT8A 1DQKA 4OM1H 1E28A 3L13A 2FO8A 5EHFA 4LCUA 4GG8B 3OMIB 5C09B 5C0CE 1OZTG 4M62H 1SEQH 5E6ZA 3H4FA 4Q7DA 3EGDB 4YK4B 5HSFA 5CD5C 1BYOA 4IRJC 1QSFE 4K94L 5FKPB 5CAYB 1V27A 2QQKH 5T3XE 4OD1L 3L3KB 1SVCP 3MA7A 3VRLF 4UINH 1FZJB 3QJFB 3HC0A 3AREA 3K46A 4DSYA 4PRPA 2QQNH 4PPTA 5T1LA 1LILA 1A4CA 1G7LA 4LSQH 3ZVVA 5LBSA 3H9ZA 1IEHA 1H3TA 1KTBA 3RI5F 1BP3B 2IQ9L 2E9WA 2RCSL 1IAMA 4FCHA 1UCBL 1EXUB 4HBQA 1UOKA 2AQNA 1T5XA 3AVEA 3QXAB 2WLJA 4IQHA 3MLXH 3O6FB 2X6AA 5FGRA 3UTTB 4J2QA 1HC1A 4KXAA 2MQGA 5B3NA 3DGGA 4K2UH 3GO1L 4WWKD 2GSIA 4F7EA 1EIBA 4M6NH 5ESQB 4N9GA 4GG6E 5KVFE 4FQ2H 5BW7A 3DSFH 3MJ9L 3HFMH 3HAEH 2BNQE 3B7UX 4GRWE 1XGZA 3C08H 3KXFD 3QIUA 3STLB 5E5UB 3MFFB 4IOFC 5GRUL 2QZ5A 4ODUA 2ZWSA 1KYDA 2IDFA 1DSWA 2VZUA 5AEAA 4AW7A 3HB3C 3G7TA 4XN7A 4WU7A 1KPRB 2R1XA 1L0QA 4AYMC 5L4MA 5I8OL 1IC7H 1UEMA 4MSWA 5JPMA 3TESA 5D1ZA 2AKRB 4XGZA 4D0BB 4EDXA 1E4XL 4ABVA 1YEEH 1QTYT 3UH8A 1EK3A 4U6VL 2X53A 3W9EB 2X2JA 2YK1H 3ES6A 3ERXA 2R56L 4ZQTA 4P2YA 4KITB 4NXKA 4BUGA 4K55A 5E2TL 5ADOL 4PJDA 1HNYA 2MKLC 5I66B 2FRGP 1QFPA 2YRLA 5IB4A 2NDFA 5J13B 1XGTB 2NNFA 4Y4FB 3U1PA 3GHEL 2C34A 5JW5B 1RZJH 1JZ2A 1AZNA 3QDJD 1PKOA 3K7UA 1GGYA 4CDGC 1LO4H 4TSCL 1S9VA 4R2GC 2DOCA 4ENZA 2C8NA 3NAAL 5TDNB 3T1FB 1SHSA 2WTOA 3FNKA 4AYGA 4G5ZL 4I1NB 3IMVA 1KYOJ 3FTZA 5KSVB 4HDIA 2VXSL 3QULA 3UTSE 4FABL 1BHGA 3LSOB 3KGUA 3A4FA 4YXHL 1YEIL 3O41A 3BDYH 1MREH 4RZKA 4U1NA 3S0PA 4PJBE 4JNXA 1WK0A 1JWSB 3OJDB 1JHTB 3CNKA 3BZ5A 3ASOB 2DWDA 3IU4L 3MRCB 3NA9L 4YSUA 4JLRA 1U8PB 3CMOH 4LEXH 1A7PH 2X2UA 4HUWB 1J05B 4OUOA 2KHAA 1UWEH 2RB8A 1BVNT 3CQQA 3P3YA 1IBDA 4WO0A 1PZUB 3MRQA 3X11A 2WUBH 2G2RA 1I4FA 1NM9A 3BAYA 3B3BA 3D2UA 4QRUB 3RJDA 3CFJA 1YN6B 3RX7A 4MCYA 4P4RB 3ESVF 3US1A 2L4OA 4FD0A 3U2IA 2H1PL 3P0VH 3N40F 1NC2D 4HZLB 4U1GB 1HXYB 2IWGA 2IAMB 4G43A 3FSAA 1THCA 4PJ9C 5CBAB 5AVSB 4ZMNA 3MHZA 2J57A 4QLRA 1KEGH 3I3BA 4P46D 3QWNA 3MZTA 4G1EA 1CE6B 2D0HA 3UJTH 4YS4A 4GLRH 5JYLA 1SLWA 2QPUA 4J3OC 1WAEA 1E9PA 1VGEH 1QPXA 1CXLA 3WFCL 1CZ8H 4KTEL 2BFVL 4XPTL 1RUAH 4LSTH 3SYOA 4N2NA 1KTDA 4DKFL 1NL0L 3WKPA 4R8WH 2OJEB 2VMDA 2Q8BL 4QXGL 1BZ7A 1R33A 1I1FB 4PLOB 1X5XA 1OF2A 3D4GA 5DD6B 2V9RA 1DLFH 2I7OA 1OAXH 3D4ZA 1SDDB 3ZRCC 4YHLL 5F89B 1FVCB 1G6RH 4YUEL 4LB8A 4NAJA 4CNIA 1MVUB 3KR3H 4NQCD 1M3IA 4TNWK 4BK8A 1XCXA 2KQMA 3ZYJA 4PRHB 1SN2A 4WFGE 1TNMA 4B9YA 3HKZA 1F3RB 1K85A 5CXPA 4KRPB 2OMYB 5D5MB 4WNJA 4JO1L 4G3YH 4JFOB 3RE0A 3BO8B 4H4NA 1LO0H 3EOBA 4PS4L 1CO1A 1CDYA 1SY6A 1DVFA 2NY7L 2R0KL 1FYTD 1JD9A 5DJ6B 4NRZA 2DQCL 4L2YA 5KYWA 1AHWA 3MRFB 3D50A 4PGBA 3X3GH 2VABB 3ZE1F 5AVXB 1EEZA 5C3LD 2WAQA 3IDJB 3J8F7 5I1HH 3SDDD 3FHEA 3VXUD 1OGTB 3FT9A 3WNJA 5DGRA 1XQ4A 4BELD 5L88H 4AVJA 1CGUA 3IDIA 2EZ0C 5HHXL 5J6GB 1VDGA 1YC7A 3OZ9L 5ANMA 5EN2B 4JJOA 3U30C 4RMVA 1P1ZB 2P5WB 2XN2A 4WTXA 1ZRUA 5IMMB 4NIKB 3ZMRA 3LRKA 3VD0A 1U8HA 1OAZL 1OE1A 3W0WD 4YWGL 2VDRB 3WSQL 2VQ4A 3GDCA 3H9HB 1MHCB 3QNZB 3VRJB 2Y1YA 4O51B 1GJUA 1QHQA 3BT2H 4UQDA 4TUOB 3NABH 1PX4A 2ITDB 2WANA 4PHXA 3D39B 3HRZA 4JDZB 5EIIB 2C7UA 3QDGB 1FNEB 2IMMA 4NZTL 1DQLL 2XZAL 1E3ZA 3F7RA 3HNVH 4IGBC 4LAQH 1FFNA 3EFFA 4AENB 4TOYH 1KG0B 5FS5A 4XXDB 3Q48A 1LMIA 1FNGA 2VN4A 4WGKA 5I8EB 4A6YA 4I2XE 3CLWA 4DKEL 4BSVA 1JZ6A 4PVMA 1U8IB 1LNUA 4BH7B 3MLTA 2YMTA 3LKSB 4W9JC 1IL1A 4Y2DC 4YXLL 4LBEB 2XG5B 5SX5K 5TQ2H 3OAYH 1TQBB 2GT9A 5LGJA 4PRBA 1ZT7A 1ZV2A 1MVYA 2QLYA 1T03L 1AGEB 5F7KC 4MYWB 3EUDA 4AK1A 3Q8CA 4L0ZA 1NPJA 4AVKA 3GQFA 4XNXL 1QO3A 4R84A 4X5XA 1OPOA 1WIUA 5DU7A 2BHYA 4AG4H 1IEAA 1ND0B 2UYLA 1XBRA 5E9DD 1KN4H 1UWGH 4MB3A 4Z7UF 1QBMH 2XBDA 2XFXA 2A6DB 3IRPX 2VJXA 4P2CG 3UACA 1RUKL 5BQ7B 4O4YH 1YZZA 1ZA6B 5DK0A 3MKGA 2VDLL 1U8MB 5I0VA 4E9TA 1B90A 1TZHB 1BXVA 3TVMC 2HJFB 3O4LB 4MB1A 1HOEA 4WGVB 4AJVA 2N59A 2X41A 4QO1A 1XB3A 3MOBH 4GXUM 5B8CB 4ZX3A 4QHMB 5DSCB 4GMTL 3EYVA 5LBVA 1OPGH 1KCRL 1T2XA 4HK0B 5FO7B 5AG8A 5JA8B 1UA6H 1GYCA 1P7BA 4G2AA 4WU5B 4KMTH 1M9WA 1ZHLB 4Q0XL 5T1DL 1ASOA 3QUKB 4M7JH 1J5OH 1MPAH 4QXUH 4CADA 2CR6A 2VLRA 3ARDB 2AZUA 4YHML 1RZGA 3DPBA 3VW3L 1WZ1L 5DC2A 3BUTA 4TRPH 4M48H 1BFVL 1N12A 4HPOL 2HKHH 3FU6A 4JFQA 4X99B 2CIIA 3MLSL 4L8DA 5DHDA 2G2NA 5B21A 3ARZA 2DJMA 4HSQA 3HZYA 5AVQB 3WI9A 3EJTA 2X05A 1BWWA 2WK2A 3L3DA 1OARH 3EH1A 4LSRL 4DVRH 4Q9QH 3FTGA 4AEFA 5A2CA 2D7TL 2ZUQC 1A65A 1QLEB 2ED7A 4OZGE 4HQQL 3NSFA 4KXCA 1XH3A 2Q87A 1J48A 1LK3L 4XBGB 1Q1JH 3OF6A 3QZWA 4Q89A 3I84A 3P4MB 4JRFA 2ZICA 3QFDA 3C6LA 1EVUA 1IM9B 4OLUL 4P2AA 1EEYB 2BVPA 1CLVA 4ZOCA 5BNXD 4R96A 1DO5A 3S3BB 3MRDB 4ODHL 4G6JH 4GBXB 3W81A 4AYDC 3BSGA 5D7EA 1AR1B 3VXSE 5EU5A 3UO1L 1JIBA 3IJEA 2EDBA 3V8CA 4NB7A 4N6RA 3L9EA 5FW6A 3KPSB 4YVUA 2VKXA 1EFXA 1FG2B 3FUJA 5FWRA 4B41A 1FO0L 2VDPL 4O2EB 4DEWA 3WKYA 3O8XA 3OQRA 5I30H 3VD7A 1A6UL 3C60A 3RVUD 1HEZB 3W38A 4UOZA 2BZ7A 4PJCB 4H2CA 1IAOA 3QSKB 4TQHA 3ZTCC 1IAIL 4CUCA 3FT4A 1RI8A 1TSRA 3I02A 2J8UE 4QRPA 1IV8A 3WBDA 3KCPB 3E3QC 5DRWA 5BRZD 2YC1A 4BYHA 3QORB 1IQDB 4PJAE 4ZFZB 2PW2A 3SKJL 2XN9E 2JK5A 1AMXA 4QKXB 1KIPA 1NOLA 4HJIA 5T3ZD 1HINL 3K2KA 3QCUH 1RURH 2B0SL 5CSBA 2CUHA 3GMMA 4JPKH 3O3AB 1ZCRA 1WISA 4QHUB 4GQQA 2Y2YA 5ITFA 5EOTB 2EE2A 2E7LC 2OMVB 4KAQH 1ZTXH 4Z95H 3WTWA 1OGAE 3HG1B 4G6ML 5GRXG 3R1GL 4EIZC 1TETL 3DMMC 2YIHA 3F7YA 5C0BA 3SE8L 1HCVA 4YFLF 1BJMA 3HUJE 1QUPA 4DW2L 5KAQF 1S5HA 1MRCH 4Q8BA 1K2DB 4MQ7B 1U92A 3IF1A 2ARJA 3RAJH 4DP5X 5IHBA 1XL6A 3K2MC 1CGSL 2AQ2A 4J2XA 1P5VB 3MRPA 5DMKA 1PAMA 1X7TA 2BIQA 4B9FA 4W9GC 3C5ZD 2IG2L 4KRNA 1QYGH 5M95B 4DP4X 4ANKA 4HCRH 5T5FA 2VXUH 3OKNB 5BZXA 5F7YC 3HR5A 5HDOA 1OGSA 1KXQA 5ABZA 1U33A 4UNVA 1AC0A 2D03H 1A6WH 1M2OA 2JFCA 1RKRA 3EG9A 4W9FC 2BZCA 4UIKH 2OZ4H 5EA0L 1T2JA 3WFDH 1AS6A 2CNYA 3T8XB 3A67L 5I6MA 2Y7NA 3PP3H 2Z31C 5JNYA 3IMRA 4YBLB 3W39A 5JA9A 4O00A 2NNAB 4B9KC 1RULH 4LCIH 1W2KT 1NKRA 5KYUB 2RFXB 3S36X 4JCMA 3V0EA 5LB1A 1UB5B 3GSQB 1OAUH 1EAPA 1NAKH 4JHWH 1N0XH 2NY4D 1N8OE 1QFWH 2YO3A 4JG0L 1F3JA 4KJQC 4Z7OE 3QI9D 4K5PA 3PL6D 1HI6B 3FQTA 3O3EA 4UV4L 1MLCA 3T8VA 3C9NA 2FBOJ 2OXHB 4LBAA 1QRNB 1RUPL 5GGUB 2A6JB 4AT6B 5CM1A 2YXVA 3W3BA 3BGAA 1ZGLM 4OZIB 2D9QB 4MS6A 2BCKA 2K7QA 4BKLB 4DCQA 1NDTA 5KBMA 4XMPH 3V10A 3H55A 3LNFA 4BA0A 1IM3B 4YX2L 3OSVA 4U7MA 5I6NA 2WBJC 1Z5LA 3O6ML 1BOGB 2J8OA 3GHBH 3QIWB 4APXA 2GTWA 2NY2C 1EO8H 4RDBA 5CSZB 1OP3H 5AKVA 4DTGL 5BUGA 3OB0H 2MCMA 2JCCF 1M9SA 1EDYA 1MRFH 3O3BA 4NC2B 1F58H 1OZUA 1RY7B 4JO3H 5EIQA 1HILA 1AYOA 4R7LA 3OLEA 5CCKH 3TF7C 3WO4B 5GGTL 3S36L 2XWJA 3OJ2C 5C08B 4HLEA 3T9WA 4R9HA 5KJRH 1BVKB 5FKAA 5CZKA 4LSUL 5AZEH 2N7AA 1GA2A 5FUZH 4NGHH 3O11B 2BX5A 3AY4A 4ZYKA 4D9QE 1AE6H 3WUWB 4F37K 1ZSDA 1W0WB 1KENL 2DMGA 5AL0A 1TYEB 2NSQA 4PSPA 1MCRA 2E7CA 1HHIA 4JUSA 1VEMA 4MJ6B 4PJIE 4QRQA 4LHUG 1UWYA 3LN4B 2G2PA 3SDAA 4D2NA 1RQ5A 2X0WA 4KKBC 4XPFH 4OAWB 1H0DB 3QJSB 1XB6A 4ZTPL 2FT7A 1JPSH 4N0CC 3DVGA 4KRLB 5CGTA 2RHEA 3LZFH 2A74B 4WO4C 3ZDYB 2AEPH 3UDWA 3ZE2B 1NEZB 4DN4L 4PTUA 5HHME 1CQYA 4GO9A 1RSFA 2LQRA 2ROXA 1WP6A 5DYOA 3P3UA 1IGML 3BP5B 5EZIH 4JFDD 2YQBA 3D69A 3MX0A 4JQIA 3PGCA 2CRIA 4C59B 3QYMA 2A77H 4HJ0C 1G9NH 2Z7WA 1SGKA 3BKJL 4NZRL 5LCVA 4OGXL 5DZOA 2L7UA 3RWFB 2HB0A 4EOWL 1PKQE 1QVOA 4CC4C 3WGVB 3F65A 2ZWZA 1P7HL 1X9LA 1AIFA 4U1HA 1YUHA 2IWKA 3QEHB 4NOFA 3H7BA 2X70A 2CIKB 4G8FB 2B16A 3VQMA 4NP4L 2WW8A 3MTRA 3PREA 4X5QA 1J9RA 1NOFA 2YMXH 2PWHA 3FRPG 3Q5TA 2B2XH 3MXWH 2BZDA 2F08A 3TH3T 2ICEC 1ZGLA 5HGHB 1YQVH 4OJDH 4KV5F 2IMNA 1UD6A 1R5WA 3C87A 5GGQH 1GAFH 3BUDA 2IALB 4XOEA 5I17A 4WWKA 1B4TA 4L1TA 4KTYA 2WLZA 5AVTB 3T3ME 1UADC 1UJ3C 4PJXA 3NFSH 3B34A 1AKPA 4M5ZL 4XX1E 2R0WH 4OCWH 5KS9B 3BKML 4HCGA 2WZ6A 2EVFA 1F6AA 5D71H 2YD7A 3KXFA 1M6OB 4GQRA 4HHAB 3KS0H 3CVDA 2EC9U 1OLLA 5FDWA 3DXAE 4Y4HB 2ORBL 5EOQH 5EC2B 4UQ3B 1X4YA 1GGCL 5LXGL 4TSAL 3SDCB 5D1QE 5GJSH 3PWVA 3DROA 5DVPA 1DEEA 5DUPH 2EUXA 1PMYA 1A4JA 4JANB 4YZWA 3RBGA 1M1SA 4QHLA 1U36A 3MUUA 2WVVB 4JW3A 1KBGL 3PP4H 4XVUC 4AMKL 2BWIA 2AJUL 2NR6C 5BRQA 3RI5K 2CKBB 4NM8L 3V0VB 5H4YA 2N01B 5DUBA 4ES8A 3S8WA 3QPXH 5MEOB 1AO7A 2IBGA 2C3XA 2VDOL 3MRKA 1QI4A 4PS3A 1A7NL 4HBCL 5ITBL 3SY6A 1DUYA 3A6OA 1H3XA 3POCA 2FK9A 2CA4A 4UNTA 3VGDA 3HNSH 3JBG7 1XGPA 5C0IB 4AOFA 3UZEA 2FATL 2QKIA 3RGVC 3WMQA 3IJYA 5HJGA 4ZNCD 1UYWH 4OI8A 2A73A 4W9KC 2VR7A 3VVVA 4E2OA 4PFEA 4N5UA 4X5WB 5ADPL 5LVEA 3HI5L 4CMHC 1AQDB 5F9OL 1B0RA 4K3JH 2W07B 4Y8DC 5EZPA 5HHOD 1I85C 4Y16D 2Y1AA 4KI1A 4FFZA 2F7PA 2AK4D 5C7ZA 1BBDH 3EYSH 5E5LA 4U2YA 2J21A 2YPLE 1J5DA 3FQWA 4FXGB 2DKMA 1PYWB 1U8CB 4HLJA 3LKQA 3UAFA 3ECBA 3BH8A 3GMQA 4UMSA 5IB2B 2Q3ZA 4KWUA 5MENB 4GB9A 1CGYA 4L3ED 1TZGL 4YDJA 3EJPA 4AXWB 1D5XB 3CE1A 1JGDA 4JFUA 2XWTB 3NH7L 4OV6F 4P2OB 1RFDL 2DMBA 1NC2A 3CX5J 4H25A 5E6IC 1ZHNB 2N3JA 4QPEA 4HCRA 1B4JH 2DLFH 1JPST 2X88A 1ZANL 4MDRA 3BWAB 2X09A 1WFUA 3UTQB 3EJSA 2GBTA 5CN2A 5ID1A 3MUJA 2EEXA 2A4CA 3E9UA 3SJVE 4K4KA 3N06B 4AVHA 3QQDA 2OZ4A 5ACZB 1YN7A 4FXKC 4IS6A 3BUYA 4F15B 3VFGH 2IV8A 2Z4QA 2JQMA 4KZDH 1INQB 5GZNC 3QCVH 5C0CB 1CQKA 3HE6C 2I5YH 1S7SB 1AQHA 1QSFB 2X0UA 2X3CA 3X1BA 4S2SA 5EU3B 3K81A 5A2KH 2VSCA 4P23B 2EUZA 5CGYD 2AJXH 4JFXB 4DEUA 4Y5YC 3KZ8A 3DOHA 3GXDA 4DKDC 3CFUA 4H40A 1A1OB 2V5YA 3EIFA 5FIEA 1V3MA 4ONGL 3LKPB 1YYML 3HMXH 5I5MA 1P2CA 3IM1A 3TOPA 4EKJA 5C97A 2BC4B 3N04A 3BRFA 5IQLA 2HLFC 1VERA 2A83B 4UOQA 3UABA 3N41F 3WXVH 3BISA 5LXVA 2WCPA 2FQDA 4P2RA 3MLYH 1R3JA 1RL1A 2MCPL 2G30A 4WKZA 1BX2B 1IC5L 1N64L 2YD8A 1LO3L 3QG6B 1VESA 3IDMA 3VCLB 5LKNA 3CN0A 3DJTA 1MOEA 1QNZL 3GBNL 4XNBA 5D70L 2ENPA 4A7UA 4F91B 1IFRA 1KT2A 3VACA 4ERSH 4WF7A 4NO0B 4ZW8A 2P1YA 4GG6B 4OJFH 2V7NA 2VQUA 3ME0B 1J1XH 4XC1L 2BNQB 3OAUH 4OQTH 1X7SA 4H1LG 3VGBA 1S5IH 3SDDA 2DWSA 4KNQA 4GRWB 2EC9T 4OD3L 4R3SB 4HOZA 1SJMA 4UF7C 4K71B 1RMFL 2EICA 2J55A 4EBQL 3LD8C 2NY5L 4XVJH 3D33A 1COBA 2XTSA 3GSOA 4JE0A 4OM1L 2FJUB 4Y5XC 3Q3GB 4Z7AA 5FUCC 4PH8A 3CBJB 4K3GA 3B9KC 5D72L 2AGJH 2UV3A 5IOPA 3BW9B 2FT8A 3W0WA 2QQKL 4NN5B 1JXJA 2X1PA 5JMRA 1M71A 4QOKE 4UINL 3RNKB 4BINA 1GYAA 1AS7A 1JFQH 3GLAA 5J06A 3ASWA 3DRQB 2Q76B 3EJJX 1PDKA 2DRUA 3FCUB 1UM4H 3IJHA 2O5XH 4MHHI 4KO5A 2F53E 4WSGA 2EKSB 3T0DA 2QVKA 4NQVA 1P4IL 5E00B 2V5TA 5GS0D 3WEXA 3B2UD 4GUQA 2VR8A 4KNUA 3WIFB 1U91B 2BY2A 4M9OA 2NCEA 4OR1A 1NCIA 5BV7B 1PZCA 2PW1B 1LEKA 3DURB 3T2QA 5ESVB 3IDGB 4OJCA 4HX1A 4QNPE 1P6AB 3PGFL 5EO0A 3VXRA 3MLXL 1KDJA 5I16A 5IVXF 2D7MA 2X42A 4L8SA 4K2UL 4Z1PA 3TA3B 4WK0B 4AQOA 1S7QB 2R2EB 8FABB 5CD3B 1T4KB 4M6NL 4F93B 3S37H 5MEPB 1ZHKB 1I1AC 1A8JH 3DSFL 3HFML 4MCNA 4D8OA 2NXYB 3KVDD 3T0VA 3IGFA 3EXJA 1DBKL 4JL1A 2CBMA 4ZUUA 2XC8A 4R26H 3GJEB 3C08L 4OTXL 1GH7A 1UOVA 2F9BT 4X50A 3VFVA 3ZY7A 4UU9A 4OLZH 3RRQA 2FJGA 1BQUA 2TRYA 1FNAA 1X5YA 5IUCA 4A2MA 1KLGA 1KMGA 2A2QT 2CUAA 2DWEA 2IANA 2I85A 4CN1A 5E1AA 3CZJA 4ZW3A 5DJ2B 3ZE2F 1NGQH 5C0AD 3MCLL 5JHLA 2BVEA 1DQQB 1IB5A 3MBEB 4LLYA 4HF5H 1JV2B 3A6BH 4JG1L 4HK3J 4LVOC 1NMCB 4V1DE 4MAYC 4P5TC 5D96B 3UERA 1ILUA 1YEEL 1HHHB 3WL9B 4BCXA 5E08H 1U8OB 5ALBL 4ZDHA 2VZ1A 4MQSB 4YHOH 3X13B 2ODHA 2FGZA 2ZAHA 2R69H 2CR0A 2ZCHH 1TEYA 3QUGA 3HR6A 2OSXA 3ZRSA 1KLFB 1XO8A 5GZOD 3ZSTA 2MMXA 3FPYA 4MKMA 3BP6A 5IW6A 5T1KB 5K1VA 4GOSA 1VFAB 4UUJA 1RZJL 2NY1B 5HYEA 4I1PA 4JFFD 1R6VA 2ITCA 5DMIH 1EANA 1PZ5A 2P28B 3ARPA 5DJAB 5GGRA 4N90D 3U0WH 2OKMA 2EYSA 5CZXD 3IRZA 3L95B 5DRXA 4TVPD 3L8QA 5JQ6H 2UZPA 1TU2B 3ZZLA 2IWFA 4KK6D 2XPGB 1RK7A 3IXAA 2BSTB 3PAZA 1MREL 5D8JL 5F0LB 1HVXA 3AS0A 4E5XB 3HLAA 3TPKA 4PYHA 1JAEA 2CHXA 1VPOH 1MIML 4IHOA 4JZJB 4ODTH 1I7ZA 1DQML 1EHLL 3SQBB 2BO0A 4CVXB 4FG4A 1A7PL 1EAOA 2ZUXA 4BD4A 3HZKA 2BRQA 3KYNA 1UWEL 2WLLB 4GQ9H 3GMOA 5HI4C 4XCFH 3FS9A 1EUUA 3TO4C 2ZOOA 3O6FD 3P4LA 4KXBA 4OJYA 2K3HA 4MB4A 4PJGA 2XN0A 4WW2F 1SPDA 4PCTA 1JGVH 5C8JB 3F58H 2FIKA 1PEZA 1XIWC 4UBDC 2OMXB 2DDQH 4XH2A 5TK4A 4F8LA 3P0VL 1PZSA 1IGCH 1CYWA 1W91A 2X4OA 3PXJA 4PLKC 1IAIM 1EERB 3DWTA 4WV1C 5F70A 3WAJA 4FG6D 1FVEA 3N43F 4KDTA 4XCYA 1M7DA 2AQQA 1YA5A 5CD5D 5HDBE 5E7FA 1NSNL 2XHNA 4EE2A 5EBMB 4P9HC 2FIRT 2HAZA 3QR0A 1B4LA 4QRRA 2Q6WA 4Z7NF 8CGTA 4Z18A 3JZYA 2DF3A 1JK9B 4E42A 5E2UL 2A9DA 1VGEL 5BRZA 3FU8A 2Y24A 1RZKC 1CZ8L 2AQ1A 3TU6A 3V4PB 5GSVA 3UZQB 1RUAL 5HYFA 4LSTL 1MCKA 5KBDA 1ZS8B 2YZ1A 4K23H 1FZMB 4Y9FA 4BIKA 4NS0A 3LEYH 2CHWA 4LCVA 2XWEA 3FN3A 1H3UA 4RISL 5IBTH 3QUXB 4NKQB 3V0HA 3SKMA 4M8VA 4O2CB 1JNHB 3BGFB 5EMYA 3R7RA 5F6IC 5IJBC 1YMHA 3L3GB 5KEZA 3O9WB 1G6RL 1AACA 5G55A 4LP5A 2APSA 3R0NA 5T5NG 3GZQA 2HJLA 2DQIL 3I6KB 3MRGB 3OHXA 4FADA 1E9OA 4I2XB 4NQSA 4Z78A 4PJ5D 1TPXC 4BQBA 3C5ZA 4IOFD 1M7IA 2R7EB 4G3YL 4OT1H 1KY6A 1MI5D 2WP3T 3HB3D 1HSBB 4K8RD 1GCFA 1KPUA 3DGDA 5L2JA 2Z6FA 3LMJH 1QQDA 1FJ1B 4P06A 3EXLA 3Q43A 4JZOA 2PCFB 2WQ8A 1MHEB 3VWKC 1H8SA 4AV4A 4DFHA 3EDEA 1A6VH 3ULSA 1GZQB 1I7RB 1U95B 5AW5B 4EXKA 4PR5A 1JF6A 4ORGA 5L88L 2XWCA 1LDPL 3HMXA 4FOMA 3RFZA 4U6YA 1WD8A 4G7YL 4M1DL 4AQZA 2B3IA 5C2UB 3CFBB 3FSOA 1ZV5A 2Z1PA 3DO3A 3X1FA 5E5MB 3MO1B 3U79A 4ALAL 1JZ5A 2YAPA 4UZGA 5CJQH 2DMHA 3AWEA 3ILDA 1LWHA 1FA4A 1FO0A 1BEYH 1UXWB 2GIXA 2NYYC 3EJCA 3QI9A 1I9EA 2IAMD 3PL6A 2BS8A 4IOIB 3ZMEA 2VR6A 3PS6A 2E9GA 3BT2L 3X1GA 3CPUA 4R2GD 4AQ8A 2VW6A 3SOBH 2OL3B 1KYAA 2E59A 2ADIB 4WTZG 3MLVH 2GUYA 4OQTA 3TO2B 4M03A 4IBYA 3UTZB 3HNVL 2X44D 1J1PL 1O5DT 3N91A 2JQAA 3OXRA 4G6KL 4LAQL 3KLAA 5SWSD 5KJ7E 4XP6H 4H5SB 1W80A 2I27N 2ICES 3ASNB 3PV6A 4TOYL 5E94A 3GZKA 1FLRH 3NG5A 1CD8A 4F1ZA 5I18H 2W9DH 3KMDA 1JK8A 4AGLA 1U58A 4M5YH 5FF6B 3CN2A 2UXVA 5FFGA 2PYFB 5I0WA 2AJYH 4JPSA 4HSAC 4JHAL 4N8UA 1PCSA 1PZAA 2QQLL 4IBLT 4OZGB 2BS9A 2MOQA 4MXVE 3LXAA 4IRZL 4S1DC 2B4CH 4NENB 1XTLA 1WZMA 3HC4H 3E8VA 4MMZC 4AG4L 2JKJA 5K59E 4PJ9D 3MCKB 1KFAH 3ALPA 3DX3A 2Y1VA 3ZKNC 1NFIB 4R7NA 3LH2H 4KRPD 1T7ZA 3DX8B 4M93C 3VXSB 4O4YL 2MOGA 4WEBH 4LCCC 4X4ME 4XAKD 2ZUTA 3WXWH 4J3OD 3W11C 4I5BA 1A9EB 1C08B 3PDDA 4JS7A 1A2YB 5MP6H 2CO3A 3DX9A 5GS0H 5HPOA 4YVNA 5EIIG 3MOBL 4CN6A 1D6EB 4MXWH 4LRNH 4XRCA 4YFLI 5D7KD 3LEXA 4WUUA 4A2EA 4PB0H 1DR9A 3B2PA 4YSCA 4A2GA 1GR7A 1UA6L 2JKXA 1JN6A 4H8WL 5F7DA 2J8UB 4KMTL 4JQVA 3KPRE 4GI9A 1J5OL 4QXUL 4X98B 2HPOA 4MWFA 2CO7B 4PJAB 1MJ8H 1S9WB 3BC9A 25C8L 3QUHA 1XSOA 2DQ6A 4L3CB 4M48L 4TRPL 1LE5A 5DJZA 3U25A 2HKHL 4XMUA 2ZSWA 1L9PA 5HY9B 2UZIL 2GYSA 3LS4H 3FUKA 2ICWI 3C8KB 5CU9A 5HHPA 1G5AA 3AS2A 3FUEA 3GRGA 4LHUA 1ACYL 1C5CL 1BD2E 4NQEB 4X7FC 4LLUA 4DVRL 4Q9QL 5AYQA 1OGAB 3ZGHA 1INEH 4NXSA 3SBQA 4RMRA 1S3KL 3VI3E 2GEQA 5I1DA 3HUJB 3MCYA 3DOSB 3S34L 5FA4A 1KPVA 2R69A 4PJBF 4XVTH 2EUWA 5C0GA 3DIVA 1HKFA 3K3QA 1A6PA 4GAFB 3QGVA 2WXOA 1Q9WB 5IMOB 4Z77B 3G6JF 4GLRI 1A4KB 2VSMB 4G6JL 2G9KA 3J07A 3LN9A 1JXKA 2W0FB 5CF3A 32C2A 4YZFE 3SDXE 2DZEA 1B2WL 3VUAA 3BHBA 5AOMA 1QEWB 3FBKA 4X8JB 3QWOA 2YEZB 4QCIA 2WLKA 4N20A 3E2HB 5I30L 1SRDA 3S7GA 2CO6A 2K6ZA 2AV1B 5C0NC 3JWNH 3BSZA 4PLJC 3VXQA 1WC7B 4N8CH 3PXLA 5FEBA 1UB6B 4EZLA 4ZPVA 4X4YA 1BVLB 1R75A 3FRPA 3BSHA 1ES0A 1X5ZA 3VM5A 1MWAB 3QB7C 3I9GH 1BMZA 4OLVH 1G87A 1BAWA 5B7EA 4TVPH 3ABLB 1NAMA 5GISH 2B08A 5BO0D 3QCUL 3BMWA 4Z7OB 4HJSA 4IGBD 2DYPB 5TQ0L 1DVXA 4X6EB 3OAYK 4YSSA 4XP5L 2F58H 3THML 1H8OA 3Q01A 5KVGE 4Z95L 2D31A 3MJ8A 3W5NA 5FUOH 3ZDXE 1JZEA 4FZ8H 3L08A 5EBLB 3FMGL 2BDNH 3PV7A 4JG5A 2GHWB 3QEQE 4UT6L 1MRCL 4JPVH 1S9XA 4Y2DD 3FN9A 2R4RL 2VXQH 2JKRM 4QY8A 5K9KB 2Y7QB 3RAJL 3AQDA 2EIMB 3O2VH 3K2UH 3QISA 4F8TA 5DHYA 4HOXA 4MNHB 5L0QC 5A16B 3E6FA 1GTFA 2QADC 5AW1B 3UYRH 2VKWA 4BHUA 2ZX5A 3Q8BA 1JPTH 1M05B 4V2BA 4L48A 4UAOB 3ZTJG 2XX0A 4CBPA 5F3BB 2DQHL 1E0OB 5F9JB 1FL3B 4YHIA 3KJ4C 2CUIA 2CBTA 2D03L 5FAAA 5ACLA 4Y16A 4UIKL 1HL5A 2AK4A 4Q56A 2DIEA 3QZMA 4EUPB 3GIVB 3KDMA 4XBMA 4IKJA 1PD6A 2NX5E 2VNCA 4ZUWB 3TVMD 3QHZL 1DBMH 5FXCH 4OZ4B 5EZOL 5E95B 3AGWA 5I28A 4O02H 3UBFA 4GBXD 1WAAE 2FJHB 4JM0A 3JUYA 1AR1D 4RQQA 1KLUB 2WXLA 4L3EA 4PJIB 4PWIA 1KDIA 4KZCA 1OAUL 1CFVH 4XXWA 1N0XL 3KPSD 3QR1A 1NOAA 4KFZC 4JRXD 2BW5A 2BLFA 1T3FB 2KI6A 5D7IA 3RYMA 3S48A 3I6LE 3TN0C 4HMDA 1K8IB 3MJ6A 1KJ3H 1QWUA 1QBLL 4R6UA 3FFCE 3ARFC 3I74A 3RIFF 4M7KH 2X4TB 3F12A 5MEQB 4KKRA 1BGXL 1M42A 1CU4L 3PWPE 2HFEA 2ZKMX 4QAMB 1L9MA 3ARSA 5CBEA 2CK0H 1QSEE 3QIBB 3QNFA 5TD4A 4F2MA 3HE7A 4RESB 5HHMB 3T65A 2BSRA 4P57A 5DEJA 3GHBL 3PJSA 1F56A 3H7LA 3NEXA 1EO8L 5CIPB 2P8PA 1I9JH 3GXFA 3UGUA 1GY2A 2IPKA 1QR1B 4FJYA 3F7LA 2FZ3B 4YPGA 1MRFL 1D7DA 3T0EE 4DO5A 4JFPA 4NQXB 1F58L 5IZ7A 4NJAH 1B0WA 3WLWD 1PKQB 4OFDA 3B2DC 4HGWA 3VD2A 3EJYC 4PYGA 5IWLA 5HYIA 1EHAA 5CCKL 1BPVA 3FQXB 2YKKA 4W9IC 2F5BH 1AFVL 3CGTA 3NSDA 2WSKA 4YIQB 2V2TA 3FTVA 4QYOB 1A5FL 1FSKB 3D48R 4FEIA 4OD2B 5AZEL 4OCRH 1A6AB 2W0PA 1Q0YL 2OR9L 3SQOH 4HJEA 4NGHL 3HBPA 1HHGB 5LG1A 1A1NB 4E9QA 1WPCA 1D5ZA 1FZKB 1T2QH 4UQ2B 4OKDA 5GRJH 3DTDA 2CGRL 3S4SB 2GJ6E 2ZP8A 3DRTA 5E8DH 5IFAL 5TE7H 3SE3A 5LLIC 1TXKA 3AS3A 5D6DC 3T3MB 3WIHL 3G5VB 3E1ZA 3SCMA 3I9AA 4OI9A 2YEVB 3VWJB 3TZVB 1G4RA 2H32A 4DWHA 5J57B 4XPFL 2HG0A 3TJEH 1E6JH 3GTTA 4BBWA 3MRHB 4MJJA 2WINB 2KERA 1R47A 1MDAA 2F68X 1ZLUH 2NW3A 3BRGC 5DFVC 3LZFL 4MQXC 5GRVK 5C0DB 2AEPL 2V7HB 2ALAA 3DXAB 5FW8A 2WNKA 2F0CA 3JQOB 5D1QB 5GJTL 5D7JB 2F7IA 3F05A 5D2NA 4DGIH 2OX5A 4UYPA 5EZIL 3VD1A 1NBYA 2FUTA 4NWTL 2A77L 3LCYA 2EINB 4PJEB 5ISZD 2A4EA 1MIEH 5HI3C 1MJJA 4I85A 4LLVB 4LU5H 4R5XA 4Z7WA 5DRZA 1QP1A 1E3FA 1OP4A 3HMWH 5IF0B 2DLHA 4YBHA 4A37A 1LWJA 2IQAB 3JV0A 3QJHB 2EP6A 5TE4L 4DKAA 4F20A 5GHWH 2GK0B 4NERA 4LF3A 1OB0A 2GVYA 4XC3H 1ILSA 2KLSA 3PP3K 3O2DA 3QE5A 2KPWA 2NUTA 2Z92B 3JYCA 3RY6A 2E47A 4XNYH 2GIMA 2B2XL 4K0OA 3WUWG 4FCAA 3D7PA 4XPBH 2WZ0A 2CWRA 1H3VA 2GITA 4OZFB 5KN5B 3QUMB 3AWGA 5GGQL 3TBSB 1GAFL 4Y1AD 4J3OH 3W9DB 3R06A 5HYQB 2J5LC 4YH6A 3VFWB 1OAQH 5ID0A 1F3DJ 3AFLA 4CU6A 2GY7B 5EF0A 2R0WL 4UILL 5E1GA 1KGWA 5C08D 3SGKC 3P2BA 5DWUH 3RUGA 4U1SA 2YPLB 2FO4A 4W6WB 3DIFB 1IBFA 4N4YB 4EN2A 1FAKT 1NEZG 2VDKH 4KJQD 1K4CB 3OZKA 4D0DB 2PO6A 2TSAA 1FC1A 5E23A 2K9FB 3RPKA 1E5BA 3MRBB 4XBPB 1OP3K 2FO1A 2I9TB 2DKSA 5CJ5A 5GJSL 2ITEA 2WQAA 2YD5A 4RGOH 3OB0K 2NQ3A 2OTWA 5AW4B 5F1IB 1BDYA 4FL4C 4HGKC 1G7MA 2ZNWA 1JWUB 2X6BA 2VLJB 2X10A 5IB3B 1BF5A 3KGRA 3M07A 3PP4L 4E0RA 5KOMC 3RTQB 3BGMA 4PJAF 4AQEB 1WTLA 3Q13A 2NY2D 4NKDB 3MMEA 2M83A 1K4DB 2H26B 4L4TD 1UG9A 4Y5VA 3L5JA 2KZKA 5IFHH 1TQCC 4I7ZC 1EJ6A 2W95A 3D18A 1D9KB 3SJVB 3HNSL 4RFNC 1G94A 3EBIA 1NBZB 4ONOA 3P3SA 1A6TB 3BD4A 5IFJB 1UYWL 1OE3A 2ID5A 2X89D 4JFFA 4NFDA 4GG8A 4OJEH 2C9QA 3EGDA 5FKPA 4GEJA 4JEGB 3L3KA 3VI4B 2E7MA 4FKEA 4PCSA 1FZJA 4MJIE 1CXEA 4XMXA 1CWVA 4BWUA 3H9SD 4BFIB 2FEDC 1PSKH 1QFWI 1ZK5A 3AITA 3NPZB 4JQXA 2R15A 3RA7H 1E9QA 3ZT6A 3CU1A 1NQBA 5HXMA 2HVJB 4QHKJ 1HHKB 5DZJA 4B27A 5FOBB 3BIKB 2BOCB 4KKBD 4NQDE 1EXUA 1A66A 1DDHB 2NXZC 2B7DT 3ETTA 4AVIA 4KKNA 3O6FA 4ILDA 1I1CA 4I3RH 2FVNA 2Z9TA 4HAKA 1RLBA 4YHZH 1OTSD 4ODXB 2BVQA 2VJ0A 5CJXA 1PZDA 3KYAA 3EO9L 2G3ZA 4TMPA 5KSUA 5INCA 4I8DA 1V7NL 1AKJB 4N0YH 5FECA 1NFDA 1AZUA 1B4JL 2DLFL 1O7DC 1SEBB 3H42H 4AJYV 2WKOA 5CP7B 3GI8H 4AGMA 3AREC 4HJ0D 5DUJA 2YQGA 3MFFA 4CJ0A 3FONB 1D2OA 2H2SC 2JKLA 4Z3JA 5BZWA 3BVTA 3T3PE 1AR2A 1KPRA 1BZ9B 4MDIB 4A68A 2Y36H 3SDCD 5FR3A 2VN3A 3VFGL 3EGSB 4EI5D 4OIBA 1F45A 1HN1A 5KVDE 5A2AA 1LQBC 4JHZA 3G9AB 4Z7VF 4X6CF 1I53A 4EO5A 4B53A 4AGNA 4FXTA 1TOXA 1XAKA 4B9JA 1KTRL 1TTFA 2AKRA 4D0BA 4QOKB 5T3XL 4WFFD 2NY6C 3V5DB 2AF2A 4NN6B 3TBVB 2AJXL 4EIBA 2VXTH 2B14A 1QLFB 3FUIA 3CXFA 3B37A 3ESMA 3W9EA 2QR0A 1NFDF 4MNQD 1JYNA 5TFSL 4YNYA 1ACCA 2Q0ZX 4KKZA 1E43A 2WKOF 5TE6H 4JM2B 1NDGA 1XGTA 3PG2A 3MRIB 3CVHB 4FQXC 5JW5A 2Q5BA 4IU3B 2XFGB 2FAUA 2BOBA 4OF0A 3QIUC 2QGBA 3GPSA 4IBZA 1UEYA 1E4HA 2HKFH 4PJ5A 1WZAA 5TDNA 3T1FA 2Q7NA 3WTSA 1JDCA 4ERSL 1U6AL 4JDTL 1OSYA 5IQ9B 4UQ9A 3Q6GH 3N9GH 3NOIA 4OJFL 2HLAA 5FB8B 4DZ8B 1IGYB 2FCBA 1H9DA 5KVFL 2VLKD 4PJIF 5JPMC 1PD0A 1S5IL 5DR5L 3OJDA 4LEBA 2YBGA 5D1ZC 4KOBA 4XVUD 4LASH 3MRCA 1L7TL 2ZUQB 4XNZC 1U8PA 4LVHC 2NR6D 3QPQC 2YXMA 3DX6B 3OLGA 4XVJL 4HUWA 1DVZA 1J05A 1JDAA 1CG9B 3CSPA 3S37X 3ZIMA 4NC0B 2AP2A 1DBJL 3OZLA 1BF8A 1SXCA 4HWEH 5K1NA 1USQA 1QEXA 3OBAA 3BVUA 1U8NB 3DIDA 4X9YA 1AGDA 2DJSA 2AGJL 2VLMD 5E9AA 4QRUA 5FYKD 3SPVB 1YN6A 3AT0A 3QRLA 4P4RA 4V1DB 3RGVD 3ULUD 1JFQL 1UM5H 1HXYA 1FV1A 1G5GA 2IAMA 4HZLA 4E41E 3H3KA 1FVDA 4PIRF 2H6PA 2FSEB 4POZC 2W59A 2ZJSH 3V8OA 4FI8A 5C2BL 4M7ZC 3G6AB 1U8KB 1CE6A 5IHZB 4S1RL 2F54D 4XN8A 5BV7L 3HRPA 1HEHC 2X9YA 2OMZB 4JY4B 1WFJA 4O5LH 2BP8B 1QSFD 4FFYL 4WQOA 1DJZA 4IIQB 4CRPA 3CZKA 3D4CA 3CPLB 2OJEA 3NZ8B 4P23D 12E8H 1W9XA 2CXGA 3S37L 3K8KA 1NFKA 4R4BB 3U7WH 2NSXA 2Y5TB 5DD6A 1KGCE 4ZAKB 4C83B 3KPOA 4MJ5A 3S35H 3BVWA 1SDDA 2AXFB 5F89A 2WTRB 1FVCA 1QZ1A 4QAWA 4BZ2H 4OLZL 5KSAB 5E6ID 2XLLA 3DMMB 5IVZA 1BBJA 3MGTB 4PJ9A 4E9VA 5F9AC 3PDOA 4GO6B 4PRHA 4TV3A 4G82A 4RNRB 2NTFA 4O58H 2OMYA 3TCLB 3T8MA 1FIGH 1SVZA 2WZ5A 4JFOA 3BE1H 3BO8A 1WG3A 2ROYA 2ZSVA 4ADIA 3NIGE 4HF5L 1L9NA 5AW6B 4ZTOH 5DJ6A 5KTEH 2XA3A 5IJDC 4U0RC 5HDWA 3MRFA 5GZND 5E08L 1ET7A 2VABA 4GSQA 1KB5B 3HE6D 4YHYC 1KTKE 5I19H 3T0WA 4TQEH 1JD7A 5HDBB 3FQRA 5FO8B 4M43H 4A7VA 5D4QA 1WVZA 5FGCE 1F90L 1NBCA 2MCAA 2H0JA 3V4VB 4YE4H 6FABH 5FV2A 4XNQA 3V6OE 5EN2A 2MNJB 2YHGA 3FT2A 1QZNA 5KBNC 1P1ZA 5CEZD 4BUQA 4C47A 5DMIL 4FGMA 1P7KA 4KUZL 4L1LA 5AWNL 3SKOB 3U0WL 5IMMA 4MMXC 5G5DA 4JZNB 1B6UA 1UZGA 5C6WH 4HXBH 1GL4B 2ZQKA 2HLFD 5D4JA 2A6KB 4GS7C 3H9HA 5A3IC 2FECL 5A2FA 2YAHA 1X3DA 3ZR6A 4J3OF 4ZO9A 3V0DA 4DOHE 1EQWA 4O51A 2NLJB 5CLWA 1TVHA 5GS1B 4JKLA 5IJVA 1N7MH 3D39A 4JDZA 1GC1L 1OTTC 5EIIA 1DVFC 3QDGA 2PXYB 2OMTB 4ELME 2J1KA 4HUKB 2XA8H 4I13B 4ODTL 2HUEA 1E50A 5CKGA 4X7EC 2PN5A 4DPCX 1C9SA 4BFRA 1ZVHA 1I8AA 4UZUA 1KG0A 4R97C 1X4XA 3BWUC 4XCFL 3GSRA 5I8EA 5TJWK 3CDFA 2WBJB 5I75C 4PJ6A 3KW8A 3VGAC 4MJ4A 4N2MA 2WGNB 3WN5A 2VAAA 1OL0A 1U8IA 3F58L 4UANA 4UOW1 2WUCH 3OAZK 4BH7A 1CIDA 2DDQL 2MJWA 3VFSB 3ZO0A 3LKSA 4M6OH 3EGXB 1IGCL 2ZPKH 4G8EB 4LBEA 4XP4L 1XGRA 2XG5A 2VDNB 4D7BA 3B9KD 3FN0H 5DT1L 5J9PB 1JNNH 1YY8B 4WHTB 2FHBA 1AGEA 5A1AA 1HNGA 3T71A 5DQJB 4JPIA 2W1NA 4LXFA 4XZUA 1H19A 3TT3H 3U4KA 1ND0A 1LWRA 2IH8A 3HRZC 4Z8FH 3SPHA 3B5HA 1WBYA 4FYTA 4QRBA 3GDBA 4X6BB 2DQUH 3KGTA 5BQ7A 3OMAB 2Q86B 1ZA6A 3MBED 4GH7B 4K23L 3HCVB 4IGBA 3K6OA 3U1SH 1U8MA 1E2WA 4NBYB 3A47A 3LEYL 3LZLA 1ICTA 2HJFA 3O4LA 1AXSB 4FQIH 4E5XG 4ZMTA 3CH1B 4XWOC 2GKIA 1CE1H 2QFPA 5IBTL 4WEEA 1OGPA 4KH9A 3QYCA 3DVNB 3GXMA 1HK6A 5B8CA 4QHMA 1MZZA 3QPKA 5DSCA 4L5FH 4HK0A 1FN4B 1MAJA 1T1XB 3WDJA 3L9RA 4Y2DA 1I1AD 1G9MC 1FFTB 4ZXBB 3FOMA 2NY1D 3QUKA 1F42A 5DD3L 1OSEA 3ARDA 4PBDA 5JIKA 1NWPA 1ZDSA 2EXSA 4OT1L 4X99A 1L3NA 2ADGB 4QR7A 1OAKH 2NNXA 2YPKA 3KE0A 5B38A 2UZYB 3TYFA 4H13C 5CLZA 1H15B 4AJ0A 1JGEB 4UTAH 2Z35B 5CCHE 4EEEA 1JCKA 3IMWA 1L0PA 1U3HB 4XBGA 4PJ7A 1ZLDA 2ZWYA 1G9HA 3P4MA 1IM9A 4X6FB 1EEYA 1G7QB 3BLBA 2I9LB 4WFGD 1QW8A 1CDUA 1XH2A 3MRDA 3H2WA 1EVTC 4GBXA 3I6GB 3UXFA 3FKUS 4I3SL 4AW4A 4U1JB 3ULAB 3B8SA 1U8QB 1KB9K 3KPSA 1A0QL 1BEYL 2YR3A 1RK0A 3IGAB 4JRXA 2GHZA 5AVWB 3K4ZA 4UNIA 3KPNB 2UZXA 1HEZA 3IMUA 4HFWA 3SOBL 1DQIA 4IJTA 4C56D 5L2KD 1DN0B 4DGYH 5E9NA 2Y7OA 3OXSB 5F2FA 3V95A 4GT0A 2G5BA 4XP6L 3CSYB 5SWZE 1WWBX 5EZJB 3KPRB 4OUUB 1YPZB 3QQNA 4OF3A 4BZ1A 1CBVL 4NNPH 5I18L 4ZFZA 1VFMA 2D3LA 1JGLH 3AXHA 2JI2A 1TFPA 1F97A 3C6LC 1EDQA 1EAQA 2AJZB 3H2QA 5I6XB 5FCSH 3R0MA 5KVEH 2MNWA 2HRLA 2WXFA 4L0YA 3LS5H 3O3AA 1GZPB 2AJYL 3L5IA 4QHUA 1W72B 1BD2B 4M5TA 1ZTMA 2ZUVA 5EOTA 5HI4D 5K9JL 4OLWH 3TO4D 1H3PH 2OMVA 5B1CA 4U3SB 1TZ8A 3NN8B 3KPMA 4MFHA 4CMMB 2PWEA 3ABZA 1UA7A 3VI3B 1CJYA 1UQSB 1XIWD 2EEFA 2B4CL 2JLLA 3GZPA 3P4OB 3KBEA 4UBDD 3SOTA 4DFIA 5F0MB 3CHQA 2XY1A 3EF4A 3I3EA 4GP4B 5DJ8B 3O8XC 1K2DA 4MQ7A 3C60C 2A4ZA 4PLKD 2ZNXA 4LARH 2NT0A 3QDMD 1TYJA 1KJ2B 2VC2B 3EZ8A 1D5ZB 2VAJA 4MDJA 2H45A 2VMFA 3BPLC 4LSPH 5FYKH 4BFBD 1P5VA 1R46A 1TO5A 2D3VA 5FYKU 5IEHB 3RIFK 3BVXA 3SDXB 3LVEA 1AD9A 4U6HB 3NTCL 4KI5C 4Z7QE 3F64A 3OKNA 4R7DB 4W9DC 3WTXA 2LTQC 1ZS2A 1FAIH 4KK5C 4J12A 2ATKB 5GS0L 1OCWH 5IBLD 2QMJA 3ROOB 3HI1B 5I26A 2FECI 4JKPH 3R8QA 4JN2B 3MRNA 1YEJL 2CK2A 4LRNL 5F3HB 1BJ1J 1HH9A 1QACA 1R5VB 5CJ8A 3NACH 4PB0L 4WTQA 1NCBH 3T2OA 1XF4B 3T8XA 1TUPA 4Z3FA 2K1MA 1MFCL 4G80B 2FWOB 3OLDA 4HPYH 4X5RA 5KSBA 1IILE 2NNAA 2BY0A 1RIVL 4LFHG 4S1SL 5CN1A 1G6VK 3FSVA 5DJCB 4CJ1A 3NIFF 4QGYA 1HL8A 3GSQA 5ISZA 1EZVX 3FCGA 2ZXQA 7CGTA 1RD6A 1ZKAA 2QGEA 1S3RA 2E3VA 1HI6A 4AIXA 4BK4A 5J7CC 1MUJB 4XPGH 3ZDXB 2OXHA 2E9BA 1QRNA 5GGUA 4XNMB 4OZIA 2NY0D 3DHUA 2CMRH 2XZCH 4WW1B 1QTPA 4BKLA 1U0QA 4GJTB 2NCMA 1M57B 1MAKA 1NCOA 3D4YA 1AG0A 4JDVB 4LPTA 1FNSH 1IM3A 1D5MA 3EYUH 2D0FA 5IK3A 4FQQB 2H4EA 2DIJA 1BQHA 3QIWA 5FCUH 3VWKD 4CDHA 5JORB 5K9QG 3GSNH 3VG0L 5KSBF 5CSZA 4Y1AA 4YSRA 1OXYA 1NCDL 2J20A 3L81A 4Z0XB 2OXGA 1BF2A 3EFOB 1I8IB 1EGJH 2RGSA 4MZIA 4ZUVB 2PR9A 1CGXA 4M4PA 2A9AA 2X1QA 4JPWH 5EUKA 5H37H 3WFEL 1GS7A 3N3EA 1I3GH 2W9LA 2R1WA 2BP5M 4NKOA 4LEOB 3DX7B 5IHLB 5C08A 3FAXA 4Y2LA 3E6HB 5DHVH 5JO5B 5F7LB 1NC4B 4NNXA 2B9BA 2NX5B 1D5IL 2NYYD 2VJ8A 5CEZH 1AXIB 2Z7YA 5KW9L 2JKSA 3O11A 5DQ9B 3NPSC 3I9GL 3KNBB 4WI7A 1MWAL 1F6LL 5AUMB 2RA1A 3CBKB 4F57L 1Q8MA 4OSUH 5FO9A 5GISL 2DQGH 3MRRA 4MJ6A 3L4VA 1O9ZA 1UA3A 3LN4A 2B20A 2V8LA 1MHPH 2HCZX 4OAWA 1XR9B 4FQCL 1H0DA 1AXTH 2IIJA 4B0MB 1MQKH 1CFQB 3FFCB 4UV7H 5FUOL 4L4TA 1WDAA 4JFHD 5SV3A 1TKWB 1TLMA 3PWPB 4PREB 1KXTB 2A74A 5EPMB 5DFTA 3TT1L 4Z5RB 1QSEB 2R23B 3UPRB 1CS6A 4JPVL 1HU8A 3HHSA 2VXQL 3B7SA 5D1XB 4PRPE 1O7SA 2X89A 1NUGA 1CF8L 3O2VL 4HIEB 2QVFB 5EU6E 3K2UL 3BP5A 1HX0A 43C9B 4S1DD 3AB0B 3X14A 5ECJE 5FLUA 1JSYA 1JPTL 3NGBC 4WJG3 2YUWA 3AY4C 3IMSA 3T0EB 4N0UA 3RWFA 4R5TA 5MHSE 4J27A 4UT9L 4GKLA 1J9SA 4J3UA 5FDYA 3ZKND 4ZFGH 4NQED 3L3OB 1DCLA 1DQVA 3QEHA 5DDHA 4W9ZA 2CIKA 4PV8B 3ULVD 5AB9A 1NPUA 3PU7A 4FQ1H 3BAEL 1VGKB 4MZ3A 2WWKT 3NRPA 4X0KB 1AZZC 3C09C 5J6SA 5E51A 4OCXH 2R2BA 1RJLB 5HGHA 1ZAGA 1QA9B 3NCCB 3SE9H 1X5LA 3Q05A 3NCEB 4O02L 2FD6H 4H88L 1Q94B 2AQ3A 2GJ6B 1HWWA 3UDWC 3BT0A 3MLWH 1MFEL 1XF2B 3DX1A 4EAEA 1TJMA 4KNTA 1JWMB 5J1SC 4J6RH 1EWHA 1UT1A 1VEOA 1F41A 1S8DB 3INUL 1FIEA 3MOAH 2W38A 4GAAA 2P24B 5GGVL 3GUTB 1I7TA 1S78C 5KS9A 1KJ3L 1IGIH 2W91A 4XMWA 4JK0D 3NCBB 3Q6FB 2WKLA 3E7JA 3QWRA 5I71C 4UTAA 2EXWC 1M6OA 1NGZB 4HHAA 1S7UB 2VDQH 5CEXB 2EYRB 4Y4HA 3FU9A 4WI2A 5EC2A 4UQ3A 4CC4A 3SDCA 5BXFA 3LKOB 4EI5A 4HW6A 3APFA 1MCBA 2VMCA 4JANA 3OR7B 1GCYA 4ISVA 4YDVB 2ZYSA 2WVVA 3WS3B 1R24B 1W15A 3QAQA 3V6ZA 5CNHA 5C0EB 2QELA 2CKBA 5ALCL 4NJAL 3V0VA 4TTGA 4L8CB 2XWBB 4GKSB 4PJ8C 3AW5A 5E2WL 1CI5A 2J44A 4HALA 3BUQA 4WWKC 1FNFA 4FQJH 2H9GB 1ZT1B 3POHA 4Q52A 1NUNB 4X2UA 1N18A 3QZBA 4ACTA 3A24A 5AVYB 3CXHJ 4LKCB 3D3VE 3ARQA 1T2QL 4FYQA 3X17A 5GRJL 4Z0BL 4TNEA 4X5WA 2TRHA 5C0ND 3RL2B 5TE7L 4PLJD 2ED6A 1BAFH 1JYWA 1AGFB 3GSVB 2HA1A 5B39B 1XSJA 4I18B 5ICXB 2YRZA 2W07A 5J6HA 5HYSB 1E6JL 3KPLB 2VLKA 1Q1PA 1IKFH 3LIZH 3CDGA 3Q44A 1GKOA 2X28A 4FXGA 4K9EL 3MV9E 2G0LA 35C8H 1PYWA 2GFBA 1I75A 4RGNC 3IPFA 3ZGIA 2APXA 3EBAA 1MLBB 1JZHA 1C16B 2DQJH 2XNAB 5IB2A 3OR6B 5MENA 3UZEC 3VXTB 2QKIC 1CLCA 2G0KA 1C7TA 5CP3A 3U46B 1RK1B 2XWTA 4OB5H 1UXSA 3NSYA 2AZAA 2GQHA 4HULB 1F4YH 1ZHNA 2QEJA 2OYMA 4OI7A 3RTLA 4MJ2A 1EH9A 3HMWL 3BWAA 3UTQA 1CFBA 4L9LC 5I0DA 2QADD 3KYMB 1IBGH 4PRDB 3P40A 3ZPDA 5D7LD 5G4NA 3MLUH 2Y4SA 4MX7B 4WK4B 2CDGA 1QHOA 3KD4A 1ZT4B 4U3HA 2K6YA 4HVBA 1G1OA 1T1WB 3ISRA 3VD3A 4ONFL 4P9HH 3ESPA 3S4SG 4HEME 4XPBL 1INQA 2EAEA 2GI0A 4ZOEA 3D0VB 4DUVA 3PJLA 3KWWB 1E4WL 5L8JB 3K74B 1S7SA 3LHPL 3QUML 1QSFA 4JFSA 2EDYA 3R18A 5AG9A 4XX1G 5EU3A 1RZKH 5CMAB 1WCBB 3L1FA 4MJIB 4P23A 4PU2A 2ENQA 5KBLA 1N5YH 2D7PA 4JFXA 5BVJA 1HXMB 1WFIA 1XCQB 4KHXH 4L8BA 1XVSA 3RZCB 3ARYA 3SDXF 1A1OA 3D5OF 3O4OC 3LKPA 3BAWA 2MPAL 1J18A 2OJZL 5E2VH 2A9BA 3TONA 3PXHA 2Z4TA 3L5XL 2A83A 4H0LC 4APQC 1EEUA 2AJ3B 4FTVB 4NQDB 3TN0D 4BFFA 5AENA 4IRSB 1BX2A 1FCCA 1TQSA 2YAQA 3C6EA 2X4PB 3ARFD 3FTSA 3QG6A 3QH3B 5E0QA 5FHAH 2X12A 4XR8C 1JNLH 1CVRA 4N2IA 2OSLB 3B2MA 3WFBH 4N2DA 3FU0A 1A7OH 3ILPB 5DVMA 5IB1B 3F7PC 3TZVD 1AQMA 2R2HA 5D9SB 3LYRA 4YEFA 1SOSA 2C1OB 4XP9L 4FNQA 4GG6A 2XG4A 4R0LB 3VXMD 3MV8D 5ANME 4AM0B 3ME0A 4LOVA 4UWQB 5GZNA 2BNQA 2DM2A 5IGXH 2BNRD 1J0ZA 2DICA 1NCHA 4KXZH 1GTNA 5H37A 4R3SA 1KC5H 1IBHA 1KEMH 2EDEA 4TVUA 3O6KH 1X44A 2VZVA 3GSWB 3ZL2A 3T3PB 1N0LB 3RNQA 5DO8A 3ZDXF 3II3A 4Y5YA 3EJYD 4OKVB 4ZQKB 5D1QD 1TCRB 3PWJA 4JN1H 4B7IA 3TYGL 3BN9C 2FTAA 3TNMB 1T21B 3FZUD 4PRNB 2YN3A 1NJ9A 4I48B 1LD9B 4GW1A 1FCGA 3N1GC 3RNKA 1YJDL 2Q76A 1ZLUK 4P5KB 4PW3A 1PSKL 4YMPA 1KGYE 4HIIB 5E00A 3UC0L 4HHGA 4D3CH 4HC1L 1V7ML 4OIFA 2XVGA 3WIFA 3QWQB 1U91A 3K6SB 3NJKA 3TEYA 1YVLA 2BMKA 2LAAA 1JCVA 3DURA 4JY5H 1CD1B 3IDGA 3SODB 1YNTB 4WFED 3CDZA 4TLKA 3IKKA 5DFVD 4FFYA 3EADA 2C4XA 3MNDA 1NCAH 1CFNB 3WJMB 3BYTA 3WHE0 3PHSA 4MQXD 2FH6A 1S7QA 2R2EA 2K70A 1T4KA 2K0RA 1T6VN 1SLVA 1WEJH 3Q8FA 1IE5A 1ZHKA 2CA3A 4KQ4L 1YNKH 4LCWE 5DQDL 1UWXH 4LPUA 3GI8L 4KUCD 3STZB 4P4KB 2JTYA 5HI3D 1B88A 5F7UA 1JBJA 2EDTA 3U6XA 3ZMNA 1T1ZB 4OLYH 1JMZA 3BIAX 1GHFL 2Y36L 1NEUA 1KULA 3C2AH 5DZVA 1T0PB 4LQ1A 4FHJA 3KBPA 2SODB 1WS8A 3QJUB 3C12A 4X7DC 2VLJD 1DQQA 1EBPA 3MBEA 4ZOBA 5JOPD 4EKXA 4M93B 4JFEB 4PB9H 4JGJA 5IHUH 3DC0A 4E41B 3WL9A 2W0LA 2XETA 2VXTL 4A7GA 3ZKSD 3U83A 4L8SC 4HWBH 3B2VH 2K9UA 3ULVH 3PABB 1NIEA 3X13A 4WHYH 2VLRE 1E2ZA 4BEIA 1KLFA 1D9KD 3D52A 4FQHB 1R9FA 5E99H 3U4EB 2BSCA 1CB4A 2MRYA 2P7TA 4F9PA 3CVHL 5DVOA 1VFAA 4P9ML 2Z8RA 1XL4A 1BA9A 2HKFL 1AI1H 2AXGB 2EIDA 4V33A 4XMKH 1P4BL 3TFKC 2XVBA 2QPFA 1F0LA 2D4DA 3L95A 4MVBC 2NSMA 2Q20A 2AK1L 1OLZA 2WVSA 1CC3A 4K3DH 1OT4A 5TH2A 1LK2B 2CLRB 1I3RB 3W57A 5EDXA 3MZGB 2XPGA 2P5PA 4QGTA 2BSTA 5GGSA 2J73A 3BJLA 3CV5A 4GW4A 4E5XA 4KX7A 2P43B 3SPCA 2CKNA 3GGWB 1PLGH 4LASL 4JZJA 3SQBA 2Q2EB 3FSZA 4CVXA 3GD1C 4KY1L 4YHKL 2WLLA 3VB9A 4PJFF 1MCNA 2C3VB 5E70A 3KYOB 1MW2A 2Q8AH 3PE9A 1MG3C 5C8JA 3L6FA 2VQTA 3NIGB 4NLHA 4PBXA 3DTXB 3T77B 3NA4A 3WAKA 3RVTD 1OK0A 4GUPB 1O6TA 1P1VA 1UKQA 1DFBL 3RIAF 3S3PA 4NZ8A 1FBIH 3IAQA 2OP4H 1PZBA 1WO2A 2E9IA 4XODA 4XMVA 2YA0A 4TULH 5EBMA 5FGCB 2IO5A 4C56A 4QT5B 3HG3A 3L1GA 5C9JB 5IEKB 3LIZA 2YQ2A 3L4TA 1X5AA 4MD4B 2HT3C 2LABA 3Q1SH 2FEDD 5BZDB 2R29L 4FLRA 4PRIE 2H1XA 1Z9MA 2EDOA 3H2PA 3V4PA 1MJUH 2ZXGA 3UZQA 1OM3L 3MV7D 3IPBA 1ZGLP 1ROCA 1XFPA 1NCCH 1ZS8A 1KCSH 4GRMA 4D9RE 1CF1A 2WWNA 1BVOA 1FZMA 4B9PA 2APFA 2GK2A 12E8L 3IDYB 5BOJA 2O6FA 4DOHB 5JUEH 4H0HB 3MYJA 2NXZD 3TO4A 2XUWA 2EYTB 4EUPH 3R7QA 1K8DB 4O2CA 1JNHA 1MCOL 1E27B 3NJIA 6CGTA 1XIWA 3L3GA 1MH5B 4FA6A 2X9ZA 3AU1A 4JM2D 4BZ2L 9CGTA 5I74C 2X1OA 4X4XB 2O6PA 4KDTC 1FNHA 4JMXA 4J6IA 4MA1C 3QDMA 3QQ3B 1KXQE 3I6KA 3MRGA 4N2HA 4O58L 3H85A 4R83A 4HZAA 3ARED 2BWQA 4Y7OC 1JF1B 1CDHA 2R7EA 2H2SD 3OX8B 4XN4A 5T1LD 4ZMYA 2ZYRA 3GSUB 2FYYB 3D30A 4ZTOL 4K5NA 1FPTL 1HSBA 4HKZB 5KTEL 3EH3B 1HH6B 1TJGH 2PCFA 1MHEA 4JO4H 4XCNB 2B39A 2GY5A 2H1LM 2RTTA 5AOZA 1GZQA 1U95A 4H20H 4N2AA 1B3IA 2CGZA 4PUBH 2JCCE 4X9FA 2E6JA 3S5ZA 15C8L 2XIDA 5J1AA 4NZUL 5I76A 2NY6D 3BXNB 4YE4L 6FABL 3CZSA 1ACXA 5BVPH 3QXDB 1AIZA 4RGMC 4X6DF 1K3IA 3ECUA 43CAB 3Q9PA 1MXGA 4AC4A 1FDLL 2DIBA 2UX7A 5F8QC 4HXBL 2YRBA 2CJ3A 4XN2A 4YE0A 5BO1H 4FQXD 1GVIA 1UXWA 3OHXC 1FE8H 4BK5C 4BH8B 3BZDA 3FULA 3UTPE 2XV0A 4IOIA 3LN5B 3RWDB 3DV4B 2DM4A 1I9RH 4B3VA 4UTBH 1F02I 2OFQA 4HWNA 1SMAA 2EIKB 1BZDA 2OL3A 3AU0A 2HTKC 1OSPH 1MCLA 2ADIA 4WFHE 2ATPB 3TO2A 3UTZA 3TC9A 4HUXB 3MNVB 4PD4J 4Z3TA 3GZOA 4LSSH 1ZJAA 4H5SA 1TTRA 4GRLB 1NBVL 2IGTA 1UOWA 5FYJD 2VDLB 3VWKA 5CGMA 5D1ZD 1IEBB 7FABH 2XRAH 3LEVL 1PG7W 5I73B 2D2CC 3RFZC 2AABH 5CEYB 2N4IA 4Q6IA 5FF6A 2A9ML 3VA2C 2PYFA 1QSZA 1N70A 3QK0A 4M6OL 5DLLA 4GAGH 3FCTA 1YAIA 2ZPKL 3NZSA 3CC1A 1B0GB 5DVNA 2H3NA 2BY1A 2RALA 4OZGA 1KYOK 4HD9A 4GP8B 3NSJA 1EZVY 2NY4C 1IVLA 1JNNL 3QI9C 4WJKB 5ABDE 3KWTA 3PL6C 3LQAC 3V0AC 1EPFA 3LRMA 4AQ8C 3IU3B 3GKWH 3TT3L 4P5RA 2G60L 3SPJA 3WENA 4Z8FL 3P30H 1YC8A 3KEDA 3V0FA 3DX8A 3G04B 4RMSA 3RWHA 3VXSA 2QDVA 3T3PF 5IMKB 1W6LA 1WT5A 4QI3A 4HUVB 1KBBA 1X9UA 2HKAA 3JV5A 2KDYA 1QR4A 5KZCB 2J6EH 4FQIL 2ZTBA 1LE9A 1CE1L 2AJVL 5AAMC 5L7XH 2QSQA 3EH4B 5C3TA 1JRHH 5CN3A 2JB5L 3DTUB 1D3CA 2ZXBA 3GM0A 3LV3B 2GB2A 1MCFA 1PCXA 4L5FL 4I0PC 4Q9RH 2WLIB 5SWZB 3K8MA 1U41A 4X98A 3D2UD 2YS4A 5E6RB 1S9WA 1D6VL 1ORSB 2V33A 3OKDB 4J1UB 4HMCA 2VDPB 4L3CA 4TNWF 3UP6A 3MGOB 4F9LA 3ZTDC 4XMLH 4FJZA 2MIZA 3GIZH 4GP5B 1MFDH 1T0NB 3C8KA 2OYPA 4H8HA 3TIEB 3MN8A 1OAKL 1NTDA 2I60H 2FEEL 4IBTA 3EH2A 5D93C 4NQEA 1R3HA 3I50L 1UASA 3L5HA 4PV9B 1TZAA 5JQIB 2EH8H 1PAZA 2PXYD 4HWBA 1Y6KR 3HUJA 3DOSA 2WSPA 4PTTB 5AZ2H 1YHPA 5KUKA 1AY1H 3RB5A 3GXTA 3OQ3B 1SLXA 5IMOA 4Z77A 2XQYG 3I3DA 2EVIA 3D34A 1TLKA 1AAJA 1CLOH 2FB4H 3IFOB 3A3YB 2W0FA 1U2CA 2Z0BA 3KXFE 1Q90A 4Z7QB 4JQVC 4ZW5A 4ZPTB 4NBXB 1MWOA 1QEWA 3KLDA 4X8JA 2YEZA 4NZDA 1WFMA 4R4ND 1Y0LB 1II4E 1URZA 3BZ4B 4JO5A 1ETZA 2AV1A 3WN6A 1S7WB 4DGYL 4PP2B 3PJNA 1TQVA 4DEPC 4WI8A 1BVLA 4UCFA 2WYIA 1DJIA 2ZCKH 1JZGA 3QAZC 2ZXDA 3DUUB 2W9EH 1SBSL 1OTTD 1DVFD 2EO1A 4G7VH 1FWXA 2G9HA 2WJ7A 2A5UA 1N2RB 2RH0A 1QUNB 2YMOA 1B9ZA 2AFNA 3OJMB 3N44B 2XI9A 1IIKA 1NBQA 2PTTB 2XZZA 4GFXA 5KUMA 3LS5L 3P9MB 4X6EA 3WNKA 4CU7A 5JW3H 2KUTA 3L7FB 1W72L 1C5DB 1H3PL 3K6DA 3QDJE 1E65A 3TBTA 2X4NA 5KVMC 5DLML 4DGVL 4UDTA 3CVIH 3L5WB 3RPIB 3WNPA 1OKEA 2C3HA 3RWIB 4DO4A 2QL1A 2NDGA 4HH9B 5ECGA 3ISWA 3OPUA 2Y7QA 5K9KA 3G9VA 3PPEA 5F21B 1H3GA 4OM0H 1RIHH 2YLKA 3BD3A 1KJ2L 2QVIA 2VC2L 4GINA 5FYKL 5A16A 1WE5A 2Z8VC 4TM9A 1PJ9A 2XVKA 4WENB 4WY7H 4L1SA 4G71B 3T5WA 1ZTXE 2EDXA 4LVNB 3LOWA 1SZNA 1YYLL 4RFOH 4ESKA 5F3BA 1GGBL 1O9WA 5F9JA 3CVCA 2BHFA 1FL3A 2FH8A 4N85A 5ENWB 1EAJA 4AIZB 1W16A 3IXTA 1OCWL 3DYPA 4JKPL 4LIQH 3OLIA 4N26A 1O9VA 4JFVA 3HZVB 4EUPA 1UFUA 3NACL 1BZQK 3S9DB 1NCBL 5AOJA 3SYCA 5KG9A 4KO7A 4XWOD 4D0CB 1F5WA 4OZ4A 4OF5A 4OCYH 1T83A 5DXWA 2F8VA 1N67A 3REVA 4D8PB 2BSED 4IDJH 3VGEA 1KLUA 1GPOL 5FM4A 5HBBA 3VFTA 5F7EH 3L16A 4XHJD 4H7VA 3TJPA 3AS1A 5FA3B 1TTBA 3UAEA 3BAKA 1T3FA 2Y2WA 4F33B 2DW5A 2LLNA 1K8IA 1RVFL 3ABGA 3DV6B 1MRDH 4GAYB 5HJ3A 3UMNA 5B1KA 4NN7C 4OIIL 3GRWH 2X4TA 1XH1A 3OKMB 3GMLA 3EH5B 5D7LA 3RHWF 2CMRL 4L29B 1PNCA 4M7LH 3VX1A 1X4ZA 1SNRA 3FB7B 4LNVA 3QIBA 2V2XA 2XV6B 1E8XA 1P5UB 3EYUL 4PRPB 3UADA 3UPAA 5CZVH 4AGPA 3J27A 2XTJD 3MJGX 4ELMF 1CBJA 5CIPA 5EU6B 1T5KA 5TTRA 4KVNL 2ESVE 4AV5A 1QR1A 4LSVH 5LBSH 2FZ3A 2ETWA 4PI2A 4JG9A 3PGDB 1EGJL 5HVHC 1GYUA 2NY3C 1PKQA 2VZTA 3FRUB 3MLZH 2WPGA 4NQCE 3P2DA 3IKCA 3FQXA 1Z5HA 1EHNA 1HZHH 2BVOB 4XXWC 3Q9QA 2IPUK 1RZFH 3ARGD 5BPPA 4UTBA 1ITBB 1TNNA 4RFEB 5EF1A 3K72A 3N50A 4DP2X 4OD2A 2WHVA 1A6AA 5CEZL 4F7EB 3L17A 1FYTE 4HKXA 1HHGA 1MFBH 1UT2A 1A1NA 3APNA 1MG2C 2R0ZH 3EYOA 4N9GB 5A6MA 5AB0A 2DM7A 4XE5B 3KYKH 5HDLA 3BQUC 3GI9H 2GBAA 1EBAA 4RSVA 4CSTA 3S4SA 5L8KB 3VXUE 3OGCB 1FLTX 4MA8H 2DQGL 3QIUB 3HE7C 1ECYA 3G5VA 3F2LA 2J12B 5AVZB 3TZVA 4PMEA 3OKOA 3V0GA 1OTUC 1WA0X 3VXMA 3PWNA 3V0WH 2PR4H 3MV8A 4ZUTA 5EOCJ 1OVZA 1AXTL 3MRHA 3OF6D 1TENA 2NW2B 1MQKL 3ISYA 3C6LD 5IVXE 2JKTM 1YEWA 1OHZA 3BOVA 1A7RL 3W0WE 5C0DA 5FYJH 5IWLC 2V7HA 3DXAA 4EDXB 1UCTA 1ADWA 5FYJU 4F8PA 3CFKA 2NQDA 1KSRA 5D1QA 4TLSA 4XOCA 4I9WD 2Z7ZA 2WO4A 3GPEA 1CURA 3ES6B 2X4RA 1U4FA 1GMEA 3ZHKA 4OFIA 5ICUA 1F1AA 3CDCA 4PJEA 3LNIA 4Y9GA 5IB4B 5MERA 3C60D 2EE3A 1TVDA 4LLVA 4ZFGL 4XPAL 4H8PA 2Y07H 3DUSB 3CCHA 5JHDD 3EAKA 3SE3C 2IQAA 4N8PA 4M3JA 3SCMC 5DS2A 4QRPD 2WLNA 1PS3A 4X8CA 4PG9B 5C1MB 5D6DA 4KI5D 4BGDA 2EDJA 4Q58C 2BVYA 3D3VB 1MCQA 1UFGA 4O9HL 2AAAA 5IV2A 4U1NB 5TF0A 5KN5A 4OZFA 1FL6B 2JIXB 4OZHA 5AOLA 2F1AA 3I75B 2CLVA 1JPGB 1P7QB 3W9DA 2H5UA 4S0HA 1HZKA 2X2IA 3VFWA 3RX8A 4IMLB 2WD0A 3L3JA 1DP0A 4U1MA 5D2NC 3A5VA 5F96L 3MOAL 3MRMB 4TUJB 4KJPC 1T22B 3V4UL 1IGIL 5E9DE 4EDWH 5A40E 3GEFA 2P52A 1NCWH 2YPLA 1X9RA 4IJ3B 3FQ2A 3VX0A 3RDTC 4AL8L 5T1JA 4KQ0A 1C8PA 3MV9B 4F5CE 1YEFL 4BRJA 4D0DA 5AL8A 1M1XA 2ZP9A 4AUJA 1B6DA 1AVAA 2BXYA 3L45A 4HS6A 3MRBA 4XBPA 2DPKA 2I9TA 3GMPB 2WXHA 3BLKA 4FZEH 4U1LB 4OZHF 5F1IA 3RY6C 3FU7A 3DX4A 2VLJA 5IB3A 5IUSA 4PN6A 3QW9A 4O2FA 3RTQA 1JHKH 4J3VA 1QFUH 4L23A 3OTTA 4PY8J 3QRFM 3TWCL 1K4DA 1OANA 2H26A 4M7LT 4N2KA 1EJOH 1M7UA 2CXKA 4KKCC 1CLYL 1D9KA 1AOZA 1NDMB 1G0YR 4AQ1C 1A9VA 1F3DH 2RMNA 1A3ZA 5JW4R 1NBZA 2JJWA 4PGEA 1A6TA 5D1XD 1DVTA 4AEHH 1P4UA 5C07E 3FHAA 3V2AR 2AS5M 2E27H 4WWID 3AZUA 4HFUH 1J7VR 1S7TB 4XP1H 1OAYH 1R3KB 1F4XH 2G75B 2PO6C 4YDMA 4A2DA 2XYCA 3MLRH 4ZS7H 2ILLA 1BAFL 3HPLA 3VI4A 4UT7H 1Z9OA 1D7BA 4U1KA 3MXVL 4BFIA 4X83A 4H1LB 2C7FA 4FTDA 3UL4A 4KVCL 1XGQB 4NUGL 4WEUD 2YPVL 3BQVA 4IBSA 3UBXA 1IKFL 2X4QA 4PI0A 4PJGE 2ZKHL 4WRLA 4DHLA 2HVJA 3EOBB 35C8L 1CLZH 1HHKA 1GW6A 5FOBA 3BIKA 2BOCA 3GJFB 1SY6H 4Y5VC 4ETQA 2DWYA 4B9CA 1AHWB 2DQJL 2JCWA 1EEZB 4NM4H 4R4FL 4XHQA 3HS9A 2WP3O 3EDFA 4LGSB 4ODXA 3KM1A 3BZEB 3M1CA 1ZEAL 5JPNB 3NJGA 4G6AD 4J5VA 1NIFA 1LP9F 1Q0XL 3LVTA 5HHNB 3S5LB 2BNUB 1XT5A 1F4YL 4TKWA 5ANMB 4OW6A 5EORL 4YK4C 2HRPL 4ZNEA 2Q2LA 4YGVB 3SO3B 4YO0B 5CP7A 1TJHH 1AOHA 4FDWA 3CBRA 2Z1KA 3MLUL 1WBXB 4G42B 4KK6C 1SYVA 5I23A 5JOFB 4OCLC 1SYSA 4FLQA 4YSDA 1BZ9A 3FH7A 4XVSL 2V9QA 4CVZB 3EGSA 2LAGB 4QKTA 2EEBA 3QEGH 5CCJA 4OFQA 4M1GH 4AC2A 4HEPG 2AMGA 6PCYA 1U21A 1VKXB 5IBUB 2ZP0T 2O5ZL 1IKOP 1NLDH 4KJYB 1UH2A 1RZKL 4QOKA 5HYSG 4PV1C 3V5DA 3O6FC 3ZZSA 5J0BA 5HTSA 2R8SL 4KHXL 5TF1H 2WQUA 5F1NB 1DQJA 5DD5H 5HDQH 3HVDA 5CJXC 4B5ZA 2L0DA 4A6YH 4BSVB 2Y72A 1FGVH 3QQ4A 4JM2A 5I15L 3GRWA 4CKVX 3CN4A 3CVHA 3MRIA 2F61A 3MLTB 4FG6C 1PY4A 5JZ7D 2XXGA 4KC3B 3TPUB 1IL1B 1X5FA 4IU3A 1S78D 4YBQC 1DTUA 5DMGD 3RIAK 2XPZA 3LRSB 3TF4A 2GT9B 4CA4A 5B3JF 2EXWD 5HI5D 3PQYD 3U0PA 1G9MH 4KFMA 4X7CC 2V2WB 2H6UA 4LLAA 4KX8A 1QO3B 4X5XB 5IQ9A 3QJOA 5FB8A 1O6SB 1RUQH 2H6OA 4Y4KB 4LCWB 4KO9A 2PWGA 5IIEB 2XFXB 2J88L 1KEML 4JRYB 2W60B 2XX1A 3O6KL 4U33A 3PDGA 3ARUA 2EH7H 1O6VA 3DX6A 4G9DA 1RIUL 2CE6A 4PJ8D 5AAWA 5DUMH 1CG9A 3NK3A 2DD8L 4JN1L 3RJQB 4MGXA 1EMTH 1NGYB 3UBHA 5J13C 3QO0B 1J8KA 1U8NA 2XPYA 3AT8A 3DX0A 4Y4FC 5KVDL 4N1CA 5EF3A 3HAEB 4K7PH 5K9OB 4FQXA 2WC7A 1G7JB 4QF1B 4G5AA 4NNYB 1A6ZA 2CM6A 1IGTA 1VZGA 2FSEA 4CADB 5LGYA 3DPBB 2DBLL 4PGCA 5AOKA 2OI9B 3QUYD 4YSPA 1ODUA 2XKNB 5GQBA 1DSFH 4K8RC 4H44C 1IE4A 1U8KA 4HPHA 1YO4A 1U8JA 4L8DB 1UTDA 5IHZA 4RZCB 3HZYB 2PETA 2DKUA 2OMZA 3KPQA 4A55A 3P02A 4BE6A 5HYJD 3B7YA 4GPVA 3GEWB 5CO1A 3U0TB 1NCAL 4X80H 1AP2A 1AO7D 4MZ2A 4IIQA 3U4BL 3CPLA 4RGND 4WSKA 2IFGA 1CICB 1KIUB 3QFDB 1DBBH 4R4BA 1MAML 2GAZB 4XCCL 2WAHA 2ZIDA 1YNKL 3VXPA 2Y5TA 5A2LH 3CQFA 3RZCD 2X9XA 4ZAKA 1KGJA 3WKNA 1RU9H 2F7QA 2ZUSA 1FRGH 4U1GC 5EU5B 2VITA 1DZBA 2WTRA 2IAMC 1E5YA 1I8LA 3IJEB 3P0YH 2A9NH 3PAVA 2P4AB 4HLZH 2ZKWA 4N6RB 5KSAA 1RUML 1DBAH 4FTVD 4NQDD 4OLYL 3ZYIA 3TNNB 4IRSD 1KY7A 3QJRB 5E4EB 4RNRA 2WXKA 4KPHH 4B60A 1HCFX 1AD0B 3TCLA 1IAOB 4KDVA 3N40P