2MOQA

Solution structure and molecular determinants of hemoglobin binding of the first neat domain of isdb in staphylococcus aureus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
b'LNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTDSKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSSTHFNNKEEKYDYTLMEFAQPIYNSADKFKTEED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein B
publication title Solution Structure and Molecular Determinants of Hemoglobin Binding of the First NEAT Domain of IsdB in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2moqA00
3QUHA 2Q7AA 3QZPA 2Z6FA 2MOQA 3VTMA 3QZMA 5D1QE 4FC3E 3SIKA 5D1ZI 3OVUB 3QZOA 3QZLA 2O6PA 2E7DA 3RURA 4MYPA 2ITFA 2O1AA 3QUGA 3RTLA 2K78A 4NLAA 4WJG3 4H8PA 3SZ6A 3SZKC 2ITEA 2H3KA 3S48A 4YMPA 3QZNA 4H8QA 3VUAA 5D1XE
chains in the Genus database with same CATH superfamily
3CE1A 2Q86A 4JQVA 2VC2B 1KB5H 1WGVA 2NW2A 2WJ7A 3DXAA 4G6AC 4R4BB 5F96H 1VEOA 3HCVB 1LO2H 3QEUA 1FLRH 3R18A 2WK2A 1CICC 4NQUA 2E8YA 2Y72A 1TYRA 5E1GA 5C0RH 4IRZL 1JVOA 4CJ0A 1NUFA 2IQAB 3LRSB 4MAYC 3HHMA 3X3GH 3TXAA 4G8FB 1DL7H 3GK8H 1U8LB 3KWWB 4XNQB 2QQKL 3PWPA 3BAJA 2GEEA 1T20A 3HNTH 3QR1A 3JVFC 4CNIB 4JFXB 1P5UA 1QHQA 4MMXC 2PYEB 3TN0C 4WO4A 1TKWA 4MCYB 2P47B 3KPQA 4YSDA 1FAIH 3VGFA 4RGNB 4GLRH 4YSRA 1I75A 4S1RH 4FYSA 2IBGA 3FQ2A 4U1IA 4YOKA 1S8DB 5T5NF 1ROCA 1I7TA 1E65A 2PLTA 3B6SA 1CDYA 4QHNA 4GIAA 4DOHB 1MCHA 1S7TB 2LQRA 3QZLA 5DFWH 2JCCF 1T7VA 1PNCA 1PBYA 4KO7A 3ZGHA 3WN5A 2ICEA 1AVAA 4IKJA 1C12B 1Q0XL 3D0VA 3AQXA 4X7TA 1ADQH 5DJXB 3H2QA 2MQ3A 4XPBH 5EU5B 4F93B 3U6RB 1A9VA 3N55A 5TK2A 3GSNA 5E6IC 3DTXA 4C57C 3PNWB 4APQA 1EJOH 1Q9KA 3UOAB 3AGVA 2YGVA 3QWOA 1HYSD 2YD8A 4MJ5B 2JQZA 2VDML 4ZO6A 3RI5F 3HG1D 5FW8A 4JDEA 3FFDA 3LEVL 5K59E 4E41B 4JFFE 1NC2A 2CBMA 3EYUL 3WBDA 4OLUH 4PRBB 4ONFL 3FQWB 3PPSA 1EXUB 4XVUC 1DBBL 2GIMA 4RESB 2XN9A 4BFBD 1CVRA 1BEXA 1CYWA 3GXIA 2YEVB 3EHBC 3FUJA 1OXYA 4P9HC 3IU3B 2XG4B 1BZOA 2QVTA 2H26A 4UBDD 3SCMB 1U2CA 3ABLB 3VXTB 1HQ4B 3DV6B 4APXB 3VI4F 5IFJA 4HWBA 3R8BB 4LU5H 2YMOA 3EFDH 3WXWH 5TQ2H 4PLNC 5ALBL 1IJ9A 1U3YA 4UT7H 1WFNA 1A7QL 4OZIF 3GHEH 4OZHE 4CC1A 2V6HA 2AJYL 3HI6H 4MJJA 3PRZA 5C08A 1C5CH 3VTTA 2HLFC 3MXWH 4NUQA 3VFOA 3M1CA 4PYHA 3CDCA 1MFEH 3G6JA 1A6VL 3PS6A 1NLBL 5IB4A 5FUOH 2F58L 3D7PA 4JR9H 3I6GB 5I28A 3BEVA 1JGUH 1HWGB 4NB7A 5AVUB 2OX5A 3LNIA 3B3IA 4A67A 3AM8C 2BX5A 4UV4H 3CQPA 3M1OA 1QI3A 3N1PC 4GIOA 4RMSA 2YZ1A 4JG1H 1PG7X 3S3PA 2G5BB 2Z7UA 3WJJA 4P2QA 4B5ZA 1PQZA 1ED3A 1EXGA 4X9FA 1B4JH 1IGIL 2Z35B 1N0XH 1OD9A 4IBZA 4HJEA 3OG4B 1R3HB 3QQXA 3T2OA 1JZEA 1L0YA 3SY0A 2DQDL 2BSTB 2VXUH 2YJQA 4HJ1A 4O02B 3TPKA 4UMGA 1L9OA 1NEZG 4R0LB 2XWEA 1IVLA 2J5WA 5GS1B 2GUYA 2WXHA 4JDVA 3TF4A 1NWPA 2IH3A 5TFSH 3WFEH 1A4JA 4WHTA 4GRLC 1TTUA 4H8PA 5JXED 3A6BL 4FMFA 3A4AA 2P1YA 3M8OH 4XCYA 3CBRA 3KYOB 3W39A 2YPLB 4DPAX 4W9KC 1XGPA 1DEEB 1WH0A 2J8UA 4X9IA 2X6CA 3ARBA 4PW4A 5I5JA 3Q5YA 5C07A 3RNQB 1U3HA 5TD4A 3EG9A 2OR9L 1A1OB 2WWMD 3CN2A 1T7ZA 1ZHBA 2ZXEB 4G9FA 4NQSB 1FIGL 1XAKA 2X05A 1U8NA 3EBHA 4KK5D 3U4AA 4MSWA 5KS9B 1E40A 5E03A 1YNTF 4XPTH 2NZIA 5ESAB 1KXHA 2YAQA 3KXFA 1KPUA 5GGUB 3V4PB 1BVNP 4LLDB 5GXBB 4LLAA 1WTLA 4HQQH 3WG7B 4Y4KB 3LS4L 3KWXA 3VGEA 4XX1E 1E4XH 2DL2A 3IS0X 2ZWNA 3UBHA 2AJUL 4KH9A 3ML9A 3MREA 5EU4A 4YHKH 5CHNA 2PWEA 2PW1B 4P4KB 5KVFL 2XWBA 4EOWH 1AZUA 3G3LA 2BM3A 3VMPA 3ROLB 4BK5C 3CU1A 1MFAL 5K39A 4G6KL 5CJXC 1D5MA 2Q3ZA 43CAA 4JJ5A 1X9UA 3D18A 4OT1H 4CSZA 1U8MB 4NZRH 3QHTC 1MY7A 1OEZW 1XIWD 4B9ZA 5F9JB 3VVVA 5JPMC 1KACB 2DBJA 5IGXH 1SM3H 4K94H 2FT6A 2VLLA 1JERA 1KN2L 1OGPA 4B9CA 5KVGL 1BF5A 2APSA 2VXTH 4M93C 5EIIG 1YAIA 3PL6D 5ETUB 1NDGB 1FZJB 2DI8A 4LVHB 4O51A 1BQKA 1P0SE 2HRGA 4OF3A 5AW1B 3HR6A 1NFIA 4XRCB 1L9PA 1JUFB 4Z7OF 3QZWA 3MV9B 1NFDF 1E5YA 2J88H 1URLA 2ZX8A 2XN2A 1SBBA 3L2NA 3RGVD 3HN3A 4JHAH 4AL8H 1KIQB 3HG1E 1WBZA 4G11A 1T83A 1QEWB 5CP3H 3STZA 4F92B 4U6VL 5AW0B 1XZWA 5DCCA 5T3XE 4UIMB 3V6FB 32C2A 1AQHA 4IS6A 4AQEB 2BXYA 3BAEL 2UXFA 5A2BA 4PJ5A 4KX7A 5CEXA 5GGTL 7FABH 5JHAA 4KX9A 3Q6FA 3DO3A 4JK0D 2I9LA 5DUBB 5BXFA 1ZWIB 2ZSVB 2ENJA 3LZQA 3TCTA 1QFWM 3BJ91 1LE5B 1M3JA 3O6ML 2FR4B 2APTA 2FT7A 4Y19B 5DD3H 1CLZH 2KBGA 2EDBA 4HIEB 5FV1L 4F80A 1MLCB 4G8EB 4J3OG 3TL5A 5IUCA 4CSTA 1B88A 3E3QE 1KJ3L 4FI8A 4WI3A 3R06B 3NIFE 3K8LA 1XFPA 1MVUB 1SNRA 2X9YA 4RQQB 2CRYA 3II2A 3L9RA 3MOBL 3EH2A 3N43B 1JRHI 2Q3XA 1DANU 1UG9A 1QBAA 3EZJB 2B39A 2CK0H 1BJ1J 4JS7A 2R51A 2XWCA 5DSCB 1F58H 1SOXA 1P69B 4QOKD 3OR7A 2X9XA 5IW6A 1E5BA 2P8PB 1IEHA 4O2EA 4IIQA 5SWQB 4CVWA 4QRPA 3QUML 5E4AA 2OTPA 3SDCD 1FZMA 1CU4H 4AXWA 1BJMA 3HB3C 5F7MC 3VFPA 3OB8A 4OQTA 4JFED 1LK3L 5C3LD 5KSBE 1KELH 4AYGA 3LKOA 3BGMB 3PAUA 1LK2B 2FL5B 1KCRH 3ZJAA 4RX4A 3BUPA 1QBLH 5BUGA 5F9DC 5DO2D 3VGAB 2IOIA 3BC9A 3ZHFA 1ZCRA 3LZFL 2F53B 1M9WA 3CIQA 4XN4A 3WELA 5A16A 2OJEB 1N4XH 1UKQA 1WS8A 2HKHL 2R8SL 3WEXB 3C2SA 1SOKA 3CZEA 1QZNA 4X5LA 1CWVA 3HAEA 2VNCA 4NXSA 1YNKL 4JHZA 4RBPK 3ZDXE 4YDMA 4PRDA 3WLBB 5KYXB 2WWOA 3HIZA 1AGFB 4UYQA 5DURB 1W8NA 3BN3B 2BOBA 2VQUA 1M57B 4OTXH 5DK2A 4HLZG 4OCMC 2ZXBA 4NAQA 5DR5H 2JIXD 3RUGB 3TZVA 1HIML 2WLJA 4KHXL 2K3HA 3EDFA 3LH2H 4WW2C 5CCHE 4LIQE 4UM9D 4GAJL 3BKMH 1I1YA 3NDYE 1ZHKA 2NY3C 2JNZA 3FXIC 1SY6L 3OR6B 1MHEB 3MRKB 4ORGB 4ZPVA 3WEOA 4HIIB 1D5XB 2WC7A 4JRYB 4M56A 3O4LD 3N6YA 3TYFA 4Z7VE 5CSGA 2Q8BH 1C1EH 3DXAD 2OFQA 4K5OA 3K6IA 4WGWB 4M62H 3BSZA 3GGWB 4YO0B 1R3KB 4Y2NA 4Z7WB 4RMWA 1XGTB 4YSSA 5LGJA 4UU9A 4LRIC 5CINL 4MNQB 4ZS7L 4FF9A 1TITA 1XH2A 4PWJA 5IB5B 3CFCL 1JXJA 3PWPD 4MD0A 5FUCC 2AK1H 4MJ2A 4PGEB 1VFAA 2HT2D 5D9SB 5HVHC 2B0SL 2P49B 1AQ8A 4ZS6C 4KK8D 2H9GA 3NJIA 4L23A 3D05A 4Z0XB 3PIQB 2DWDB 2UY7A 5TE6L 1J1PH 4M61B 3UZEA 3BXNA 4ONGH 3VFUB 4QYOA 2C9XA 3IFOA 3IJ7A 4TOYL 2A6IA 3E6HA 1WTGT 4FQHB 2UZYA 4FNRA 4GOSA 4MA7H 4ZNEE 2OM5A 2IDCA 3HR5B 1UHVA 1CFNA 1T1WA 3FKUS 3WNOA 1NCBL 3UX9B 5B7MA 2BW4A 3VRJB 2F68X 2GBUA 1XD1A 1L0PA 2VZUA 5DUMH 3O0RL 5F89A 3BP7A 5I73B 3N41F 1L5GA 3UERA 5FCUL 3BE1L 4TULL 5F1NA 5JOFB 1DVFB 3U4BL 1SJEB 1P4IL 2LVEA 3BN9D 1NICA 1Z9SA 3V10A 3DPBA 4HS6A 4B41A 4UTCA 4X4YA 5C9JB 3V79C 2A83A 4ANVA 3PP4L 3KNBA 5C09A 4FZEL 3ROOA 2ROXA 3BAWA 5HHVH 3W81A 4G7YH 3CFEB 4NDMB 1NC2D 4N8VG 5FS5A 4PS7A 3TP4A 4TNGA 1MPAH 3REVA 3REWB 3ZSSA 1QPKA 2XN9D 1MJUL 4LARL 2ODIA 3NFSL 3V0VA 3IWUA 3QQNA 3FQNB 4WI7A 1Q1JH 1PZSA 3CSPA 5GGQL 3NSXA 4X7SL 4JE0A 4Z77A 1XO8A 4QHUB 1KCUH 4O4YH 3QWRA 5F7DA 5GSRB 1ORQA 3NCMA 3TEXA 3EDDA 3RY6C 4PRPE 5C08D 5J8OA 1KIPB 4HSAC 4QOKE 4YGVB 1KCVL 3V5DA 1UJ3C 1X6NA 4RAVB 4WWKB 5IHLB 3T3MF 3O2VH 3TBVB 5IQ9A 3UJTL 3O3AB 1JD9A 1CJYA 1ZSDA 2X2UA 3O4LA 1MFVA 2V2XB 2IDQA 4JFEE 4K23L 1UCBH 1KJ2B 3INUL 1IL1A 1PCXA 5EB9A 1OAJA 5TDNB 3UPAA 5J9PB 3SO5A 5L7XL 5AKSA 2YGOA 3Q8CA 4TVUA 1F00I 1HL8A 4P2QD 1MLBB 4YX2H 4NNYB 2CKBL 5ENWA 2A9BA 1KMGA 1NIBA 2IADA 3IE9A 3UZQA 1OD7A 3VFVA 4AQAB 3U30B 4R7DB 1ZXKA 5FYLD 5I76B 2MOGA 5E9DB 1HNGA 5ICZB 3DVIA 2OJZL 3QG6A 2ZYSA 1QTPA 2QELA 3TBBA 4P59L 3UJIH 5AB1A 4W81A 3C8KB 4WENB 3FRPB 4Z7QE 4RDQF 4RMQA 1FE8L 1AXTH 2K4AA 4IU3B 1X44A 3FMGH 3KLLA 3VGGA 5D96B 4E9RA 1FL3B 2WNKA 4GH7B 3HVNA 1BA9A 2GY7B 3ARBD 5I30H 4LK4A 5FYKU 5IHBA 1E9PB 5C07D 1U3HD 2B20A 4KKBC 2AGJH 4NHUB 3BO8A 3LS5H 1RUPH 1PGRB 4G9FD 1E0OB 2YXWA 4RRPM 2EZ0C 2X53A 1OP5H 4DIXA 2VXQA 4NQCB 1W2KT 3O4LE 3VD3A 4L29A 2ZXGA 3HNSH 4IJ3C 1CLOL 3DXAE 2KLTA 4EF3A 4YHPB 4NSKB 1CUOA 3KXFD 3NFNB 5HHPB 3QO1A 1IE4A 1TCRB 2XBTA 2DMGA 4Z9KB 5PCYA 3KPPA 4AUUA 1AR1B 4HEPG 2OMZB 5SWZA 3TA4D 1RI8A 2WP3T 2VAAA 1M05A 3IGAB 1HKLH 2FJHA 2F8VA 4PB9L 4AC2A 4H20H 4WGKA 1T6BX 2WLLA 2RBLA 2WW8A 3GHBL 3F12A 4ZUVB 3V8CA 1DJHA 1CDIA 3KBPA 3GRWH 5SWSB 4HV8A 5F3BB 2UZXB 2YWZA 3WI9A 2XFGB 3ESPA 3QWQB 4YXLH 1I8IB 1H8SA 1I85C 5AENA 3QT2A 5L6YL 4H1LH 5C70A 3MLVL 1H15A 5DRZA 4AYDC 3N40F 3H3PL 3VFRA 2CBOA 3G7TA 5BJTB 2VMEA 3HE7C 3K0YA 3SE8H 3BAYA 3ESOA 4MJIB 3WFBH 1XF4A 3L4ZA 1GZPB 1KCLA 3BWSA 3UO8B 1QFHA 4V1DB 4JZNA 4DKAA 2C9QA 1KBVA 4HKXB 3U46B 3B2XA 3K2KA 4OJAA 3GDBA 4AEEA 4FNSA 4FKKA 3VI3B 2IGTA 2NRDA 3CBJB 1ZLUK 1EHAA 3HPJA 1ZLSH 1CN4A 1U8CB 4XX1G 1G9NC 3G5WA 5ADOH 2IPTL 1CF8L 4XWGL 3L3DA 3V0DA 1E5UI 3BP5B 1CL7H 2XN9E 1L9RA 2Y36L 3D8MA 3UPCA 3CFDB 4DW2H 3GSNH 3BYTA 2D73A 3DNKA 3NSJA 4PJ5D 1NAML 5L4IA 4JVUA 5JW3H 4KITB 1TZIA 1WITA 4XCEB 2DQUH 4W9CC 3L95A 3L4UA 4NZTH 2FECI 3X3FL 4JM4L 1KCKA 4F5CA 2UY6A 1JPSL 1W8OA 2QZ5A 2JJSA 3C6SB 4M7LH 4B96A 3MCG1 1EBAA 2H7WA 1DQLH 4EXKA 3G6JE 3FT4A 5B38G 1PZDA 4QXWA 2CR6A 5EZIL 3BSGA 2NNFA 4DGIL 4R5VA 1OPGL 2X1XR 3D4GA 3MRLA 5HI3D 5AB9A 2UXTA 4NUGH 5B1KA 2R1XB 3OLEA 4HWBH 1UA6H 1UXMA 3KS0J 4C59B 1MWAH 2LU3A 4QRQA 5J3HD 4P2QE 3WN6A 5IVOA 3PAYA 2NY4B 3BQUA 2V7NB 5JDSA 3NH7L 3AG4B 4J3UA 3TVMC 2AANA 4IDLA 4LXFA 3S97C 2GK0B 3CZJA 3S4SG 4DUWA 1A1MA 4JZOA 5EO9B 4X6DA 4JFOA 4AIZA 1KLGB 4QRRA 2O93L 3CD4A 4R8WL 5GGVY 3C6LA 1O7VA 1XV8A 4URTB 4M1GH 5E51A 2XOTA 4EVNB 3N1FC 4DN3H 2A74C 4RX4D 1J7VR 5I8EA 2R39A 2J8UE 2ZKHH 2BFVH 4LSQL 5FYLH 4M8VA 3VDBA 5C07E 2F1AA 2WUCL 5BQ7A 1UZGA 2X0UA 4GG8A 3KPOB 1NMAL 3APDA 1A2YB 1MCIA 3OLIA 4WCYH 4G9FE 4AH2A 2PO6A 1L7TL 5DHVB 5I71B 1N6QL 4EZMA 5TPWL 4ZUTB 1LDPL 2EEDA 5D7IA 2XQYA 2GJZA 1DQDL 1TOXA 3MRGB 5E24E 3HZVA 4TS6A 2CIIA 1G7IA 5IBTH 2FGWL 3KXFE 4Y4FA 3A67H 3VVWA 1MF2H 2BJML 1J8SA 2DWXA 5AFAA 5CEZD 4XE0A 3AITA 3ML8A 1Q38A 5C0AB 4U2YA 5B8CC 5DHDA 4E42A 2CJ3A 2B1OA 2VQTA 5DEFB 3TZVD 3ETSA 3PHSA 5IIEA 5JR1H 4LCYB 4W1TA 3UGUA 3IJHB 1GS6X 2GTZA 3P0VL 1FNAA 3P0YL 2OZ4A 3RBSA 3ZRCC 5FKPA 3SY6A 4I5BA 4DAGH 1Y0LA 2ATPB 2PETA 2EYTB 1V3KA 3GMMA 2QPUA 2VN7A 5MHSD 1P1ZA 4NFBA 1S9YB 2F8XC 2CRMA 2LTQB 4Q2ZB 4XH2A 2HSIA 4B53A 3W9EA 5ITBL 1AHMA 1HYSC 5LN4A 3WLWC 5F3HA 2OSYA 4HMCA 2W81C 4R7LA 4O58L 5CILL 1XGRB 3H9ZA 3HC3L 3M1BA 4LPUA 5BVPH 4PGCB 4PSRA 1D5IH 4OU3A 1JXDA 5J1AA 4P2CG 3BH8A 4QRUB 1SZNA 2ROYA 4R3SB 3TBSA 4NUJA 1M9SA 1C5DB 1NKGA 4PJDA 3T3PE 3T8VA 4Z76B 4FP8L 5BV7L 1UT9A 5D2NA 4YDVA 3CDZA 2IDUA 3OGCB 4AMKH 2EKJA 1UM6H 5BS0B 1S5HB 2AKRA 4EIUA 1NEZB 3IPEA 1TLMA 5GS0H 3C5SB 4YSCA 4RFEA 2X42A 1MFCL 2CDGB 1QTYT 3U82B 3V6ZB 4PVNA 1HILA 2X4UB 4OLZH 3WTWA 3NRPA 1JI2A 3GSXB 4NO3A 2F5BH 3E3QC 3WFZA 4WTWA 3UBFA 4J8RA 3US0A 3ARGB 1OOAA 3NIDB 2BOLA 1S9VB 1BXUA 2NT0A 2PCXA 3CSYB 3QJVB 4D0BB 5F6IB 5JPNB 1HVXA 3PQYB 2NY7H 1OCCB 3V0IA 1A0QH 4FG6C 4YXHH 4K3EH 2NSXA 1WYJA 5C09D 4ZFZA 2UUDH 4X5QA 4DP7X 5AVTB 4M4RB 3HI1B 2XC8A 2PWDA 4HOZA 1KYFA 1EFQA 1QLFA 5T1DL 4LSVL 4ACPA 2AQSA 3TO2A 3LEXB 1HHIA 2VIRA 4Z7UA 5CP7B 4XXDA 2IAMC 4EZLA 3RVXC 3BKYL 3VFSB 4AE0A 2ERJC 5K9KB 1UFGA 5EU7E 4L3EE 3UYOD 1KEML 1KTLB 4K8RD 4MTMA 5LLIC 4DKFH 3QWRD 4UAOC 4LSUH 4MMZB 4Y2OA 1OVZA 1JF1B 1B4TA 4IDJL 2NUTA 1R5IB 4LEOA 5FOBA 3L6FA 5SX5K 1IU1A 1TYEB 3ZT6A 1FFNA 3HMWH 2Q2EB 2QEJA 3BLKA 3EJYD 5KBMA 5I17A 3ZE2B 5D2LE 2VDRL 3BZFA 3KBEA 4QT5B 4OV6F 4PJ9C 1WWCA 3WTTA 3HG2A 3OHXB 5CS7A 5EOCH 3G6AB 3AWGA 2R2CA 4D9QD 4JM2A 1LP9B 3WTXA 4Y7OC 4KKPA 4ADIA 5HVGB 1CZ8H 3QHZH 4RLDA 1T4KA 1QFPA 4KDVA 4P4RA 3WFDL 1FLTX 3NJJA 3EDKA 5EIIB 1UKSA 1IUZA 3GI8L 4MQSB 3WL9A 3JV5A 4OQTH 1JSYA 4F15B 1N26A 4GAGH 2K6WA 2YA1A 2ZX7A 2JXMB 3PWJA 1QWNA 2YXVA 2UVEA 4FXLA 5EEZA 1SJHB 3OKOA 5KOVC 4OLVL 5I1EH 4ZX3A 2NLJA 5ILTL 5CEZE 4LCCB 5D70H 2VDKB 2WP3O 3ESUF 4D8PB 2H2PD 2CM6A 3QUMA 1G5GA 1FL6A 2GYSA 3FU6A 1PFOA 3R0NA 2JQAA 3DA0A 3QPKA 3D34A 4JG0H 5C6TL 4O2FB 4HIQA 5D1XE 2W0FA 3IETA 4JKPL 1G7HB 4JRFA 1KN4H 3ABKB 1EFXB 4JZJB 4XP9L 5DEGA 4R6UA 1ZA3B 2HRPL 2EC9U 2ZCZA 1NGXA 4HJ0C 3IKCA 3V0GA 1MIEL 5CEZH 1B4LA 5MHSE 1FVDA 1FVCA 4X5PA 3D3VA 3KLAA 1BD2B 3UTPD 5ISZA 2YD7A 2V5RA 3Q1SH 2EACA 4U3HA 1LWRA 2AV1B 2HVKB 1G7JB 1HSBA 2AJVL 3E1F1 3NZHH 3PUUA 4L1SA 5B39A 1V7NH 3FT2A 3OM3B 1VHPA 5HYIA 4JE4B 3M6DA 5E8DL 1AD0A 1XT5A 5E6ZA 1QUNA 2VZVA 4R96A 5MENA 4KQ4L 1QLRB 1D5BA 4PJEF 4WI0B 2XHNA 2Q7AA 3A24A 4U1GB 4J4PA 1S5IH 5HGAB 3BD4A 5CSZA 3BSZH 2E8ZA 3Q5OA 1ZAGA 3ZQXA 1JF5A 1TETL 3K80A 1NGYA 2R29L 3PREA 3NN8A 3QJOA 1CGYA 5KSVB 4ODUB 2NUPA 2Y3NA 4PJFB 2ZF8A 3RWJA 3RKPA 5CFHA 1DJSA 1WP6A 2G2RA 3BT2H 1F4YH 1ZGLP 1FBIL 2V7HA 4Z78A 3TIEB 3LNEA 4FQXA 3RZCB 1SDDA 4XCNB 5KYWB 3ETTA 3SJVA 4A55A 5FIEA 3DECA 4LVOC 1BM3H 4L4JA 2RB8A 5GGVL 3L7FA 4GT0A 1QR4A 5HGHA 1OTUD 2YIHA 5HPMA 5IUSA 3HKZA 1U8QB 4OGAD 4MXQC 3NSDA 2AXFA 1WT5C 5E1QA 5C09E 4Q9BA 5E2JA 4N0YH 5AOMA 3S0PA 3TF7C 2XXGA 4H1LG 4PGBB 3SKOA 4LESA 3DOSB 1Z5HA 1Y1DA 2CBPA 1WV7T 4MB1A 4XPFH 1U93A 4WTXA 3SDDC 5DXWA 4NBYB 1G1OA 1BM7A 4D94A 2F61A 3LKNB 6FABL 4LBEB 5DDHA 3SDCC 2DEYX 4ZW3A 1C8PA 2F2HA 4TVPD 3CHPA 4Y4HB 4S1DC 4L5FL 2VABA 4MD4B 4DGVL 4TSAH 2RR3A 1T2QL 4OQ1A 4UZGA 1GC1H 1W72B 1BFOB 3FBQA 5M95B 5DO2C 4HF5L 3QQ3B 2VN4A 1OZUA 4KJPC 2VR9A 1JK9A 3HI5H 4FQCH 1JZ6A 3WTYA 4P5KA 1V7MH 4KPHL 2EILB 3ZMEA 1GGIL 2FB4L 1F1DA 4XNMA 3RZWA 4AJYV 2BY0A 3HRZB 4N8PA 3QORA 3N85H 4K8RH 3GMRB 4D9QE 3BGFC 1VF5C 4DKEH 2B1HH 2XPZA 4F7TA 2X4NB 2FSDA 1IVTA 4FXKC 4LRNL 5TE4H 1REIA 2O6EA 3BQUD 4GP4B 1JHLL 1AQKH 4ZBJA 1PNDA 3U1PA 2O61A 3H54A 4EIBA 4FEIA 4YSEA 4PY8I 3EGXB 3QH3B 5DD1H 2UWEF 1AGBB 3SKJL 3UL4A 2LU5A 4HJGB 1HXYB 3LIZA 4NC1E 1HL9A 4ZFGL 1E28B 1EGJA 4PCYA 1SJVA 5CLXA 2EXWC 1EUTA 4LASH 4QRRD 2OYMA 1UM5L 3GEFA 2E75C 1KB5B 2CDFA 5IEHA 3C6LD 5CBEA 3EJUA 4QO1A 1I1AA 3L5WA 4AK1A 1INDL 2AI0H 3DVGB 1GYAA 5KYUB 3QUYB 2JI3A 4MCMA 4TNVK 2YD2A 2GSIA 1D6VH 4F8NA 2ZUVA 3BP6A 1QSEA 4UQEA 2YGPA 1MAMH 1IC4L 4AKPA 5E94A 3DO4A 2VMFA 3AWEA 2Z31C 3MUGA 3QG7L 2EUXA 4KTDL 2FH8A 2PO6D 5L4MA 1JWSA 1YEKH 4HCRH 5HDWA 5A6MA 1QACA 1NBVL 1N6UA 2HRHA 1P5UC 3BVNA 5JW5A 3QXAB 2A6JA 4KK8C 2PF6A 1I8LA 3UTPE 4Y4FD 3WNIA 3ULVE 4QNPE 3FCTA 5H8DA 2I69A 4N8VB 3BEWA 3PJLA 3MVSA 2G3MA 1ODUA 2F15A 2SODB 4NP9A 4HJSA 3X1NA 4TV3A 3B7UX 3CVHL 5DLMH 3GDCA 2ICEC 1TT6A 1E6OL 2G0KA 3JZ7A 4HKZB 4XN2A 2YUZA 4ELMF 4M6OH 2OW6A 1CK0H 4RH4A 4ZXBB 5ACLA 3ULVH 1AAJA 4FTVA 4HEMA 2J44A 1MNUL 3MACL 4B60A 5IMLB 1J5OL 1FA4A 3DX9B 1E3XA 3ESVF 3OX8B 4Z5RA 1DR9A 3ZBMA 3OTTA 3NSCA 4U1NA 1KGXA 2XIIA 3CLWA 1XZ0A 4YBQC 5JIDA 2VZTA 2F7RA 1KJVA 3VB8A 2H3NA 4HX1A 1PZ3A 1RKRA 2DIAA 1WA2X 2X6MA 4N0UB 4GEIA 4TSCH 4R4ND 4DP9X 1JN6A 1S7UB 5I8OL 4JFPB 2VDNH 1I8KA 2J6EL 2VISB 4HGWA 4MCZA 5DEJA 3QPXL 2K1MA 3WIHH 5KVMC 4BFIA 3ARDC 3VH8G 3MLSH 5DVPA 4EN3B 5KZCD 5DD5H 1P7BA 5LDUA 4KO9A 2ZF9A 1PY9A 4BHUI 3B37A 5FGCE 3OAYH 1OF2B 4YZFF 2EDTA 2HG5A 5F0MB 3L5IA 1MFDL 1S3KH 4W4NA 5GGRA 4Q97A 4F7KA 5LO7A 2EVIA 3GJEB 1RZPA 4OZHB 1DN0B 3GF8A 5JUEL 1CFSB 5HI4C 1OCOB 1PSKL 4KK6D 4KROD 3VG9C 3FH8A 3CSBA 4F5CE 1G84A 3ARWA 1D9KB 3KEHA 3RGBA 4LNVA 3PWLA 2VR4A 2HKFL 2YKLH 3QQDB 3T04D 5I19L 3UJJH 5CF3A 4HPOL 5TH2B 3QGVA 1NCAL 1EHKB 1NPJA 4DEWA 3UBXA 4ZAKA 1A3ZA 3BHBA 3BPOB 3CVIH 4TVPH 2DQTL 4JAMB 3L1OL 3WEBA 4UT9H 1HDMB 2HYMA 2R23B 2G2NA 2PXYA 3QZWG 4X5WA 1MQ8A 2XX1A 4ENZA 3S37H 1A3LH 2ZKWA 4Z7AA 4X8GA 4ZYKB 2CAKA 4MDIB 2MOVA 5D6CA 4PI2A 4QXGL 1LO0L 3ARBC 3EO1B 1A7PH 1MCPH 2GBTA 1CDCA 5JQHC 1YEEL 4QRRE 3GI9H 1P5VA 3IRCA 2MPAH 4JREB 1BLIA 4Y5YB 1PX3A 4WSJA 3OC8A 1LMIA 2JCCA 3KH3A 3APMA 1RZGA 2G9HA 4UQCA 4GQPH 2R4RH 4J3WA 4N1CA 4JM2D 3UCRA 4PAZA 4Q9QL 4AYEC 1UUSA 3GLAA 4JLRB 4JFWA 5GRVK 4B9JA 3H7BB 1AQMA 4K9EL 4MQXD 4GG6B 3QIWD 4JFQB 3ME0A 1IC5L 1KLUB 4YUEH 1UD8A 1S7WA 2GIYA 1THAA 3NA9L 4BH8A 2ENQA 4K71C 1TVDA 2O6PA 1VEPA 3S36X 3LQZA 3OF6A 4TM9A 1LO4H 2XPGB 1SLXA 1RQ5A 4U1HB 2O5YL 1JFHA 3F7RA 5HDBF 3HLAA 1OAZH 3MRQB 4UOJA 3CDGB 1BOGB 1QOKA 4HZLB 4XP6L 3ILPA 1TF4A 1LNUB 1MREL 3FN0L 5E4EC 4CU8A 4BGLA 4FLHA 3VI4A 1BW8A 2MSPA 4B3EA 3NP4A 3QCVL 4P2OA 4FQ2L 3O3BB 2VQ4A 2K9UA 4Y9FA 2G3XA 4OZIA 2XACC 1HSAB 2A4EA 4X9GA 4BQ9A 4BSWB 4K7PX 1FNSL 4YK4C 1PX4A 1IAKA 2DLFH 1QBMH 1TEYA 2ITFA 3VQ2C 1CI3M 1U8JA 3VYOA 3I75B 4ZFFB 4RMUA 1O6TA 4MNHB 4PJHF 1C16A 1O7DE 3UG3A 3MODH 3D3VD 4TNEA 1O5DT 3F7LA 5ISZD 4OFQA 5LGKA 4K5NA 1S7XB 2B2XL 5I1AA 2R2HA 3US1A 1K5NB 1U58A 3HAEG 3OJDA 3EBGA 1KFAH 2B4CC 2BP3A 2OZ4H 2YWYA 3SPCA 5MEND 4WI5A 1MCKA 3N44F 3LX9A 4AIOA 3FB8B 3MRDB 4YVNA 4PJDE 1L0QA 4WJ5B 1N64L 3TU6A 1IBBA 1VGKA 4J4PD 5D2NE 5C0CA 3HG1B 2A6KA 3IBOA 3PU7A 5CLYA 1CGVA 3F6JA 3LOWA 2AHIA 1FIGH 4QXUH 4AEFA 1IC0A 4L8DB 1CFQA 3VRLF 5DGRA 2QL1A 3VM5A 5FR3A 2AW2A 5KOMC 3GTVA 1NLDL 4FX5A 4OLYL 5IJKA 4WEBL 4M48H 2Y7OA 5C0BB 1FAKT 1DQML 2WQXA 5KVFE 1RIHL 1FP5A 3NCJL 3P40A 2FIKB 4FQIL 4Y5VC 1CDBA 4FQXD 4N25A 5IMKB 1A14H 1DQJA 1P4LA 4U0QB 3SJVD 4FNUA 4XMKH 5DRXA 5EEYA 4MLIA 4TKWA 2DDQL 2G75A 2C8NA 3LS4H 5AQ0A 1U30A 1THCA 5I15L 4Y8DC 1QA9A 3GMNA 4PIBA 3VSVA 1RIVH 2VOTA 1Q4NX 5EU7C 1XF1A 1HC1A 1WZLA 4U1KA 4FHJA 2HJLB 3EYOB 4TQ8A 1ROWA 3MYJA 5HGBA 5KVGE 3Q9PA 4IRJA 1WICA 2AEPL 1S7SA 4HU8A 5IB3A 2KPNA 4LQ1A 1QTSA 3KPMA 2X4OA 5I1HH 1A9BB 3ZTNL 5AUMA 3L3KA 4N2EA 3QNXA 2VITA 4UQ3A 4BH7B 1EHLL 5K9OB 3JUZA 4PS4L 5LQBH 2IMNA 3FPXA 3MOAL 3BIKA 1WS7A 2AJZB 4KFZC 1T21A 2JI2A 1JPST 4U1LB 2WZ6A 4ZMTA 4XMZA 1IJNA 1J11A 1TU2B 1DLFH 3BRGC 1T1ZA 2PCPB 1PG7H 4QD2E 4R90H 3IJYB 1TVHB 2AXWA 2WXOA 3EYSH 3GSRB 1ZT4B 2CHNA 4U3SB 4WZ9A 4YFDB 3RIKA 4GW4B 3GMPA 1PZUB 5BRZA 5I1IH 3SE3A 3WHXB 3QORD 2VLKA 1K4CB 4PG9A 2FJFA 4XNXL 5CNHA 2ZOTA 1RL1A 2N59A 1RIUL 4Y2DD 2W95A 3OZLA 3AMLA 1GAFL 4E0RA 3JWDL 3W56A 1A6TB 2GFBB 3MRJB 2ZPKH 3V5HB 3MJ9L 1QI5A 1VADA 3HKFA 2D7OA 1WSST 1EPFA 3V0WH 3JYBA 5HVWA 3ZDXB 1MHCA 5CLTA 3TZVC 1EX0A 1H9VA 1KXTA 5EDXA 4ADGA 3QDAA 5AAWA 9CGTA 2NR6C 5J7CC 5CBAA 4LVNC 1V10A 3L3HA 5D1XC 3TPUA 3MJ7A 1BZQK 1NMCB 1MW0A 1ZT1B 3UROR 1G4RA 3QNZA 1I1AD 3IDYC 5JW4N 3O8XA 2NTSP 2E7MA 3I2CH 5JO5A 3MKGA 4HXBH 2PWGA 4FFVC 3V52L 2ZOLA 3SKMA 5MEPA 3COOA 4GW5B 5ID1A 1TPXC 3CPLA 5GGSY 4AQ8A 3DSNB 4KY2A 3GS4A 2ADJA 3WO4C 1QSED 1XGUB 3BPNC 2HN7B 2BIOA 5L2JA 1W0WB 1YJDC 2RAMA 3LDBB 4Z7VB 3X12B 3LXCA 4GXVH 5DRNB 2Q87A 5DTFA 3VMOA 3P54A 3PGFH 5MERA 1Q9WB 1WBXB 3IDIA 3KCWA 5C2BL 5JA9A 3IDGA 3FCSA 1XIWB 4C54A 4N2IA 1HT6A 3D3VE 2BY2A 2WAQA 4PJ6A 5DZLA 5KW9L 4LPTA 1S7RA 1XVSA 3M45A 5F9OL 1XSIA 4YFEA 3DV4A 4WDIA 3O81A 2VW6A 3LPPA 3RFZB 1FPTL 3PL6B 4N6QA 5GS3A 3CDYA 5L8JB 4KXZI 3OWRA 3AUWB 4MA3B 4U6HB 5MENE 3RWFB 1QNZL 3F6LA 3X14B 4W9ZA 4FFTA 4WTZA 3RGVB 4UUJA 4YEEA 1OAKH 3KPRB 1OARL 2AJXL 1LM8V 1U6AL 1YLBB 5FWRA 2F8OA 2OSLA 1EO8H 5JQ6L 4FTVD 4LSRH 4EDWL 3RTQA 3DK2A 4CVXB 3I6KB 2QGCA 3MJ8B 3ZHNA 1LDSA 1F6AA 5BMFL 1JRHL 2HVJA 3LV3B 1E4KA 1TQWA 1RSYA 4N86A 2W9EH 3KHQA 3WIIH 4JUTA 1QQDA 4JW3A 3DIFB 3GZOA 3AREC 4AT6B 3SJVE 1YEFH 5IK3B 2W07B 5I8CB 1TSRA 4F7EA 5HGDB 4NN5C 5ALCH 1RJZA 5L8KB 4UZUA 4GAJH 1N8ZA 3RIAF 2X1QA 4NLHA 2QR0B 4UM8B 5IHZA 1BJ8A 4BZ2A 3L5HA 2E27L 2JQMA 3M88A 1KTDA 4KGJA 4I0KA 4M8QA 2GT9B 4XP1H 1M4KA 4NFCA 4NT6B 1E50A 1S9KC 2IH8A 5AZ2H 4F2FA 3ZY7A 4W4OA 2C9VA 4K5MA 2D0HA 4P5RA 3FQUB 4XVJH 1VLXA 1XF2A 3OWEA 5AAMA 4HBQA 3TFBA 4HVBA 4TNWK 2RCSL 2R29A 2V9QA 3T77A 3GIVB 3BP4A 2GUOB 4BFJA 2PR9A 1CD8A 1OWWA 1ZV2A 3MGTA 4EI0A 2VDPL 5E5MB 4G8IA 4NPYB 5D1ZB 3N40P 5C0FB 1YCSA 1GW6A 2VT0A 1BOYA 2VXVL 3T8MA 5B3JE 1NCDH 3C60A 1TEFA 3CVDA 2CLVB 4PTUB 1JK8B 2CE6A 3UAJA 2QDVA 3H7LA 1NPUA 5C71A 2NY6B 3KEDA 3QCTH 2PR4H 4RISH 1GS7A 3FQRB 5I6XC 4NC1C 3CMOL 1T3FA 4BBWA 5MP6H 2XVBA 1CB4A 3X13B 5JHDA 1ZOXA 4JFTA 3SOBL 2YKKA 3MC0A 2WXKA 3MNZA 4PGJA 1X5ZA 4X5RA 2PXYD 4A66A 4KUZH 1MFBH 3A4EA 1YNLH 4ERSL 4MLSA 1GGCL 5FCUH 5C8JB 1OAQH 2OW7A 3FT3A 1DUYA 5LG1A 5DJAB 2H2PC 5AG8A 3VYPA 2DJMA 2Y07H 4LVEA 1JYVA 3T2NH 3GSQA 3CNKA 3L5XH 1UA3A 3ARZA 1YMHA 3MLZL 3MR9B 5FO9B 4P2AA 5GRXG 4R7NB 2ZXDA 2AQNA 4FZEH 3TCLB 1U8KA 2JIXB 4HHAA 2UZIL 1HXMA 3MXVH 4UM9B 3V55A 1GJIA 3WE6B 3BZEB 2JK5B 1ZSHA 3LIZH 3HFML 5CGTA 2F5AH 4XO8A 1G0DA 1EGJH 2YSTA 4NHCL 4S1QH 1QSEE 4UMSA 3SKNA 2AXGA 2EEFA 2BMKA 3FSVA 5KVDE 2Q86B 2NW2B 1A5FH 4YDIL 1XDTT 1F3RB 4P2YA 3QEUB 5BOZG 4MD5A 2EDNA 3FYIB 1JNNL 2OKMA 4H8WH 1N2RB 4JY5L 2WLNA 1INEL 3E6FA 3OF6D 2I5YH 1DBKH 4LCVA 1CXIA 4KJYB 1A6WL 2V5SA 4BUGA 4YE4L 1ONQA 4H1LB 4G82A 3MUHL 3PWPB 1WCBB 5FLVA 2WXPA 1DBML 1II4E 3KPLA 1T20B 3NQKA 3OMNB 3QZOA 5KVDH 2YPKA 5LBSA 4WO4B 4PP1D 2ESVA 1B9KA 1TKWB 1M42A 2X0WA 4YZWA 3PP3K 4P2OD 3TT3H 2FX7L 1OCWL 3K0WA 4MS8D 2CUIA 1I7TB 3B6SB 5KVEH 1UXWA 2H0FA 4Q9RL 1J0HA 1FIEA 2W65A 3VFNB 4FTVE 2M1KA 4KMQA 2OMYA 3NUKA 2OJZH 5D4IA 1JGIA 2LLNA 3QW9A 1AXSA 4XNBA 3WN5B 2YD0A 3DI2B 4P3CL 1DVTA 1BXVA 4JO1L 4P59H 5L4JA 1JS4A 2H6PA 2DL9A 3D0VB 3ILDA 4X7TB 5FFLA 4I88A 5HBBA 3J2PA 3GSNB 3NJGA 2IGFH 5DC4B 2EVHA 3DTXB 4HPYH 2FQEA 3ETBJ 3UTOA 4U6XB 4APQB 3F85A 1K5WA 2DMCA 2DM2A 4MKTA 2WCPA 3QWOB 4PJIF 1Z3RA 1SOSA 2SEBA 5C0CD 2G5UA 3FULA 4XCFH 4JDEB 3FFDB 3UAAA 1O9WA 2IMMA 1PEWA 4BDVB 3GMOB 1UFUA 1NC2B 4ODVL 2OR8A 1IZJA 2ZCLL 1VRSA 5A2JH 2ETWA 4PU2A 3QXVA 2XN9B 5DFTA 3VDCA 2Z8RA 5INDB 1X9RA 1ZXQA 4K73A 3WSQL 3VQ1C 4QIRA 5AKVA 2H26B 3N2JA 3NK4A 5DMJB 5IFAL 5IFJB 3H9HB 2RTTA 4JY6A 2WM0A 2C3GA 1MWAB 3AU1A 1PY0A 2LFEA 3BJLA 3WEMA 1GS8A 5C08B 3DSFL 1FN4A 1TJXA 5TQ0H 2XVGA 4LCIL 4YSPA 3RKDC 3SO3B 1AY1H 3P9WB 4TL5A 4Y16A 4NO2B 2YQ3A 4L18A 4L48A 3UEQA 1MCBA 1KXQA 4E9SA 1DTUA 3F7YB 4IRJD 2I9TA 2OX5B 4ZX4A 3GJFK 1XSKA 3J7HA 3DX2A 1XMWA 1ECYA 2H1PL 3E80A 2J6EA 5JW4M 5J57B 4QLWA 4HFWA 2CK2A 4I3RL 4M6ML 1BWMA 1B0RB 2WLHA 4XXCC 1PQZB 4DESA 2GJPA 4K5PA 1EDQA 3QEGH 1IRAY 2EIJB 2L4OA 3C6LC 5LAXB 2MCMA 4X9YA 2A6DA 3SY0B 1R9FA 4C56A 4HD9A 4LBAA 3ATBA 3QDJE 3LSOA 1PZ5A 2DEXX 4PREB 5GJTL 2IH3B 5EC1A 1NUNB 2ALWA 4FL4C 4YDNA 3CC5A 1GOFA 2KZBA 1H0DA 4ZG1A 4XCYB 2IDFA 4LT7A 3UG5A 1Q9OA 4NZUL 3W39B 5I1DB 3RX9A 5BRZD 3ZMRA 2PO6C 4MRCA 2ZYHA 1XCQB 1E30A 2J8UB 2JCCE 4I48B 4JJHA 2VLKD 1U3HB 3KYNB 1VZIA 5C0DB 3L13A 3H85A 3DROB 5I1GL 1T1YA 1R0AH 2FQFA 5K9JH 1ZHBB 3OKMB 4G9FB 4BK8A 3TV8A 3VRIA 1E6JL 1U8NB 4FFZH 4PJ7B 3ETBF 1FYHB 2R0ZH 1ZVYA 4J3BA 3HFFA 4XC3L 2DYPB 2EDKA 4MAUL 4LLYA 4JM4H 5KWYC 1A7RL 2CO1A 5E6UB 1XB6A 2KZKA 3KXFB 1XF5A 4AGNA 3TTYA 3QULA 1DCLA 2Y69B 5ICUA 4BUHA 2ZQKA 3VH8B 3D4CA 5FYJH 3HVDA 1F6FB 1CE1L 2GKIA 3O8XD 5JW4R 2ZWYA 4IRSA 3MLYH 4IMLA 2VLJD 1O7DC 3U1SL 2WMPA 3KGSA 3P9MA 5FGBC 4D0DB 3MREB 4HAKA 3VI4E 4R5TA 3QAZC 2OTWB 4A6YA 4YS4A 2GJ6A 4OZIE 1RZJH 2A7BA 3W11C 1AS6A 1AIFA 1KGWA 1MOEA 3FO1B 3POCA 3CHXA 1VAHA 5K9QG 4AG4L 4H0HB 2FAUA 2EADA 4JG9A 3S5LA 3IPBA 3TA3B 5D2NC 5HY9B 3NCYS 4RGMC 4JCLA 2VLLB 4PW3A 5L8LB 2ED7A 4X8JA 4KKAC 2VSDA 5HHXL 5F7HA 2D3NA 3T3PB 3LEYL 4O51B 3MRMA 1GGYA 1RULL 4L4VA 5C0JA 5IHUL 4LSQH 1EEUA 4QXTB 4FOMA 1TJIH 4XBGA 2M2DA 5JORA 3N9GL 5C0CE 2WQUA 2JF1A 1WBZB 2RGSA 5AL0A 5T8IA 1UATA 3D39B 4LPVA 2FBRA 2Y0SA 3STZB 1JZ7A 5K1JA 4RGOL 1IBYA 4ZRGA 4YSTA 32C2B 5CZKA 4HUKB 1LDPH 1QKZL 1F86A 2BIPA 2G5RA 1HHJA 4PJ5B 1WLHA 1AKPA 4KY1H 2EINB 2YMXH 4HHGA 1S9WB 1U8IA 1M6OA 1DO5A 2I9LB 1DLHA 1TCMA 1M7DA 1UD6A 3MJWA 3QNFA 4V2BA 4XTRD 4HAGA 3PY9A 4K55A 3Q43A 1AI1H 2Z4QA 4U1JA 2ALAA 3GSUA 4OFKA 5D72L 3MMEA 1I1FA 3SQBA 2E3VA 3GXDA 3G5XA 3QIUA 4XOEA 5B39G 3VXPA 2GITA 5KG9A 1CE6A 3NJFA 4WI8A 4U3XA 1AP2B 1KGIA 1IGMH 5F7AA 1BEYH 1GL4B 1NMBL 2CDEA 3GO1H 4FQ1H 5D7SL 3L9RB 4PJ8B 2HJKB 2VDOL 4HU2A 4B97A 4ZQTA 1WAEA 5JHBA 3T0EA 3MRFB 3K91A 4M3JA 5JTWA 2WXNA 1K3ZA 1H5BA 1MQKH 3BH9A 3HJEA 4DSYA 1FORH 5D71H 4HMDA 3GHPA 2J8HA 3KM2A 1F4XL 3LPGA 1GKOA 3OR7B 1YEIL 1IQDA 3B7SA 4KK9D 1MN4A 4JM2C 5E7FA 4O2EB 4IIQB 2DQIL 4ZUWB 4JPVL 4QRPB 3C60D 3LAFA 2OYKA 3TO4C 1FZMB 4AXWB 5F7UA 3DIVA 1JGVL 3UAJD 4I18A 8FABB 4XI5D 2DAVA 3QIWC 5HGGS 3QZNA 1HAUA 3SGKA 4NI6A 3LKOB 4XMPL 4FQLL 5BRZE 2DTMH 3LHAA 1NL0L 5E2UH 1G6RH 2VLKE 1RXLA 3ABGA 1FNLA 4DP0X 2YEQA 4EMZA 5JHDD 1QWHA 3AQYA 4GMTH 4AGQA 4C4KT 4Y8AA 4DTGL 1UZ6F 1GCFA 3B9KB 1FGVL 2QQLL 2R59A 4CN1A 5DQ9A 2GSGA 1RHHA 2F19L 5GSVA 3K1KC 3Q8FA 2P43B 4N2HA 4XO4A 4NI3A 1ND0B 2UV3A 1BFVL 3BWZA 4OJFH 2K6ZA 3L45A 4ZMWA 1Z1WA 2VL5A 2APVA 3E0GA 5C0GA 2XFXA 5GISL 4Z7OE 4FABL 4PRDB 2Q7YB 1NFDE 2H0JA 4OB5L 1CD9B 2Y2TA 3PV7A 4HIXH 3LN4A 3RQ3A 1DUZA 3TBYB 2BOBB 5DK2B 3VTMA 2PNDA 2QJDA 3RP1A 2A1WL 5EBLB 3QFGA 2QV4A 1J1OL 2MIZA 2P44B 4CVZB 4LSVH 1IKOP 3BDYL 1NJ9A 4HJJL 2VLJE 3SD5A 4QDGA 3CG8A 2APFA 2NTFA 4PLKD 6PCYA 1CT8A 4CUCA 1VCBC 3FUDA 4ZI8A 4I3SH 4AQ1B 1BXAA 2NT1A 4P5TA 3S88H 1KEMH 2ADIA 3L7EB 3N43F 1L9QA 4K7FA 4H26A 5LKNA 4LOUD 3HC2A 4OM1L 1BG1A 4BV1A 1HAWA 4NWUL 2XQYK 2XTJE 4UU9B 5F44A 4F57H 3Q9QA 4IKLA 4BZ1H 2IG2L 3NFPA 1NAKH 2R15A 3MLPA 2BCKA 5CGMA 1TNNA 3CZKA 5TF1L 1TO5A 4WKZA 1VFAB 3EJCA 4A2HA 1J1XL 1S9XA 2CNZA 4N2AA 5AZEH 1BYPA 3VD5A 2ESVD 5ADPL 4XPGH 5IBLC 4RZCA 1BMZA 1H3PH 2UY7B 1J8HD 2BDNL 2FBOJ 1R3JA 3BXNB 5J1TC 4QYOB 4JFVA 3IFOB 2NYZA 2ZOWA 3E6HB 4AGMA 4ZMZA 2UZYB 1NBZA 1TJGL 3W38A 1E27A 25C8H 1CFNB 1T1WB 1X7QB 1QLEL 1I3UA 1R47A 2ICES 3GI8H 4A7QA 2F1EA 1OOWA 3GNMH 4G1MB 3MLTA 1FDLH 5F1NB 1KGJA 2Y24A 4TL4A 5EEXA 2Y1VA 1FFPA 1N8OE 1CYXA 3EO9H 2J4WL 1TO4A 3OLDA 2A4ZA 1Z9SB 3QFDA 3DPBB 2W59A 4X4YB 2GB2A 1RK7A 5BW7A 1Z9PA 3OQ3B 3M7OA 3UAFA 2EH7L 4UAHA 3U48A 3ZX1A 4AW7A 3O6LL 2MCPH 5DQDH 2X6BA 1IKFH 2P8LA 2AAAA 2FGZA 3KNBB 4NYLB 5C09B 1LD9B 2EP6A 2MOQA 2P9RA 3MV8B 4XAWH 4KZDL 4XVSL 5C6TH 3L1EA 3IEAA 5D1QA 3RUGF 2DQCH 2XV2A 4CMHB 2ICWI 4XP9H 1EJFA 3CBKB 1N12A 3REVB 5IT2L 1KSRA 2BHZA 2HRPH 1A21A 3ISWA 3JWNE 3MRCA 3Q8EA 3FOMA 1MIEH 2BZDA 2I27N 1JYNA 2Z8WC 1IBZA 2E86A 5ACZA 3WJMA 2WO2B 3EF7A 5F7DB 4AQOA 4UIKL 3DRTB 4PJGB 4PTTA 2D3JA 3QORC 3L3GB 2Z8VC 2BSRA 4XOAA 1USQA 4YPJA 4BZ2H 4Z7WF 5IEKA 4FN0A 1KCSL 3HS9A 4X99A 3V5DB 4KXCA 4Y2DC 3B2UD 1JGLH 3JWNH 3MUZ1 1RZ7H 2CLRB 1HI6A 3N1MC 4GI6A 4Y16D 2BRRL 3QI9A 1F4HA 1I82A 4M5ZL 3SE9L 4F27A 4DCQA 1R1CA 3O2DL 4P2RA 3HZMB 1QR1A 1H19A 3HMXL 2EH8H 5T1KA 3HLKA 4J3XA 1BGXH 3ZE1F 4KTEH 5JHDE 3BKCL 1SF5A 3WJLA 3UGEA 1GIGL 4ELDA 2IADB 3VFVB 1JG9A 2VZ1A 3O9WC 5DJ0A 2EIKB 4FCAA 1FBIH 1FQ9C 2XBDA 2Y5QA 4GO8A 2FSEB 3KLKA 4PJEA 3U36B 3QG6B 4C56D 2PPAA 1LQSR 2AMUA 3SPVB 1VKXA 2WWKO 1ECZA 2WGXA 1NC4A 4UILL 4PMFA 5HI5C 1F3DJ 3RB5A 3Q6GL 4J27A 3ZK0A 4PLJD 1M1XA 2NY0C 3QHFH 5IROA 5FXCH 5HDRA 2AJ3A 1W8EA 4G80A 5K1NA 3AT8A 1BJ1H 3BLBA 3NRFA 1BF8A 3ARRA 1G1KA 3QJUB 2NX5A 4M1DL 4XBPA 3C09C 4IBYA 4AJ0A 2WXIA 5F9WC 5AYUL 2XQBL 3L4XA 2MHAA 1MKFA 3VJ6A 3P4OA 2R4SH 3IWVA 4UQDA 2WCGA 3DETD 2DI9A 2NZ1A 1RMFH 3R7QA 4EQ2A 1QFWL 2WTRA 1WUZA 5GRZA 4JHWH 3PCYA 1YEJL 1XH1A 5T1MA 1BZ9A 5J11B 4GLRI 2Y7QA 1DCEA 1DJGA 5SWZB 5FM4A 4F20A 1CQKA 2VAAB 1M05B 4IRSD 2DY2A 2AXHA 4JPIA 2FJHB 2XKUA 1CD0A 3UPRA 2EVFA 4MAYA 2WLLB 2YJLA 3FUIA 3NCBB 3ULUH 1AHWA 5T5NG 3F12B 1USZA 3AADB 1J8HE 4FMVA 3BCFA 4G6JL 4HV8B 1ZE3H 2VDNB 2GJ6D 1CMOA 5E0FA 2QFRA 3JWOL 4MMXA 5BZDA 2EKSA 4X80H 3T5WA 4AIEA 3SKJH 4N2LA 1NGZB 4A7VA 5IBUG 3LD8B 4K4KA 3BCDA 3T3ME 1H15B 4G7QB 5DRZB 1IEAB 1PLAA 3OD3A 4OKDA 4NNXB 3DHMA 4KJQD 3K72B 1JDDA 4GRWH 2ZYIA 3L3OC 4KJWD 5LBSH 4PG2C 1XF4B 3LVEA 5FGSA 1J8RA 4JZNB 5EO1A 2XNAA 5TF0A 3PJNA 3L3JA 5EBWB 3WKNA 1AGEA 5LCVA 1GYUA 2D31A 4L4VD 2K8MA 4QHPA 2GHZA 3Q7JA 4PV8A 2AEQL 2UWEA 1JYXA 5DS8A 2ZX5A 2GEQA 1E90A 2ZUYA 3HPJB 1CIDA 3MCYA 1DP0A 3SDAA 5I6PA 1OV8A 1N7MH 1MG2C 3L3DB 3K2UL 5F7YC 5F1IA 1GH7A 2V37A 1HL5A 1W0VA 4GEJA 4OD3H 2ZG2A 4KI5F 3CFUA 2WQRA 2NDGA 4KGLA 4XN8A 2BVTA 2V5MA 4TLUA 4W9FC 4MA8H 3W3BA 3MAWA 2UY6B 2DWTA 2NXYB 2O72A 4AMXA 3A6CL 3GB7A 4NPJA 5E2TH 1RUAL 3GLZA 3V7MA 2FYVA 4OIIH 2PXYC 3QIUD 4J3VA 3H2PA 5C92A 4YHML 3ZIYA 1E6OH 2J73A 3KPSD 4HFUH 3UXFA 3EAKA 2E9GA 5F97E 1BQSA 1KXQE 1OB1B 2B77A 4HKBA 5EZLB 4ZTEA 2XVKA 4HXAL 4BM7A 2XI9A 3T6QC 4NRZA 3VTAA 4JPQA 4HG4J 4QRQB 4NN6C 2HXAA 1P6AB 2B9BA 3BQUB 4I2XA 3T0ED 1BBJA 4PJCB 2F18A 3NZSA 5CLWA 4N20A 4WU7B 1NINA 5GZNA 3H3BC 4DK6A 1JWUB 1UWGL 1VPOH 4Q89A 5I9QC 2YD3A 4PSPA 4KKZA 1A1MB 4JZOB 1X7SA 4XNUL 4X6DB 4C56E 4JFHE 5FLUA 2HPTA 4AIZB 2C3WA 4K2UH 5HDQL 5I8OH 4ELMA 1BVOA 2J6EH 2VC2L 5E99L 3TT1L 3MO1A 1NBCA 2E9WA 4FG4A 4PW9A 1HWHB 1LEIA 2RHEA 4QTIL 5EUOA 2CXKA 1LEKA 3AS3A 4G1EA 3FRUB 5IVXF 3EGDB 3QVAA 5IESH 3W9DB 4J39A 4UINL 5BQ7B 1QAWA 4GRLA 3V4UL 4GG8B 1D7CA 5A40E 2VW4A 3RX8A 1M3IA 4U33A 3FB6A 5A2LH 1S78D 5FF6B 1MCWW 2YEZA 1I9JL 1U8HB 4AH2B 4AYID 3T4AC 1GOGA 3DX4A 4YL4A 3B1TA 4NQDA 4JPWL 2C26A 2QQNH 4GAYB 4OJYA 4UCFA 3UACA 5D7IB 4ODHH 2GJZB 4X5XA 3Q8BA 4G5ZL 3HZVB 4PP1C 4GQQA 3S7GA 1AFVH 2CIIB 3LRLA 2R69A 1VESA 2OLDA 4I7ZC 3H42L 4P2OC 4Y4FB 4LDOB 1U8OB 3ATAA 4OGYL 3QEQA 1F90L 1BF2A 2Q8AL 2EIBA 2VJXA 1FFOA 3LNDA 1OP3K 4MS8C 3T4YA 3GFUA 2G60H 2FBJH 4IKKA 3AQZA 4AEIL 5IIEB 3GZQA 1XR9A 3E8UL 3ULSA 4L0PB 3ASOB 5F9AC 4IGBA 3FHEA 4K3JL 3WFCL 1ZS8A 4WY7L 2NCMA 1A1NB 2EE9A 2YBRB 2QVIA 2E7HA 5D2LF 1L9SA 5DK3A 3WNNA 1G7MB 1PX8A 3WY3A 5AW5B 4YDKH 1KJMB 2GJ6E 4AV5A 3GMMB 3QUXB 1L7IL 4NP4H 1KTKE 5FHAL 4WRLA 4QHMA 2FUQA 2B7DT 1LO0H 4OGXH 4JGJA 4XH2B 4ADJA 3W9EB 4D3CL 5FEBA 3U2SB 4QTHA 5F3HB 4BK5A 1O6SA 1SXZA 1GY1A 1QVOB 1B3JA 4KU1A 1RD6A 4ZD3L 4K7PY 1ZA6B 3V9EA 4F7PA 1UB5A 1J9RA 2W9DH 2WB7A 3D25A 4YEFA 3VXMA 1JZJA 5J1AB 3TBSB 4NUJB 4A6YH 4F7MA 2CPCA 1BQHA 1ILSA 1E67A 3VFWA 4D9LL 2IV9A 5A2CA 5A2FA 4X4ZA 5JPMA 1ZTXH 4XMVA 4L4VE 4YDVB 4ZTOH 2EIEA 5IJKC 2R9HD 1COBA 3CDZB 3QPQD 3ZRFC 4PY7A 3NCWA 1XH3B 3T6WA 4X42A 2AKRB 2O5NA 2GVYA 1CFBA 5KSAD 3UZQB 4ZDHA 1E7VA 3N1GC 4XT1C 1DHKA 5DA4A 1G94A 2JV6A 4R7VA 3T0XA 1XD0A 3T0BA 3VW3H 1HILB 2IQ9L 3KL0A 1J0IA 2P5EA 3CHRA 2MKLC 4UTAL 2H3XC 3C5ZC 4FJZA 2ZKMX 2O5YH 3IFNL 4FNPA 3B5HA 4H88H 3E9TA 2H1LM 3MX0A 4IRJC 4KROB 5H94B 3BAXA 2IFFH 2WXJA 3P02A 3D9AL 3N04A 1WEJH 3L16A 3KYAA 5BV7C 1SUJA 4RWYH 3VE0A 3O11B 1MREH 2W60A 2DKUA 4QGYA 3FB7B 3G08A 4O02L 4PR5A 2HT3D 3BPLC 4ZFZB 4N26A 1P7QA 4V11A 4BIKA 3I02A 1BQLH 2WVTA 5D1QD 2K9FB 3KPSE 5DU7A 5AVRB 4BSVA 4DWHA 1ZK9A 3NGBC 4CBPA 2EDLA 1HHIB 3WE1A 1AR2A 3CZFA 4Z7UB 2EXYD 4XXDB 4YBHA 3LPFA 4WTZG 1DEDA 1KPRA 1PKQA 3T0EE 1WCQA 4JRXA 5KJRL 1YRKA 5E1AA 1KZYA 5EHFA 4NC0B 2NY5L 2HCZX 3SB3A 4NO5A 5J5EA 3MDJA 1XBDA 2HWZL 4Y2OB 1EEYA 5EZOL 5FOBB 3B7TA 4TUOA 4N2NA 2EUWA 3OAUL 1FFNB 1PZBA 5IJDC 2DQGL 3PJSB 1MCOH 2UYLA 4QRSA 5I17B 4TUJB 3BZFB 3QI9D 2N1KA 4X6BB 4Z7NB 4IOSA 5T5FL 4PJHA 3KLDA 4WKXA 1MCEA 5EWIL 3V4PL 2NY2C 3LMJH 3HHRB 4ORZC 2VCOA 4P2RD 4M6NL 3US9A 3AS0A 5T1KD 3ZQ9A 1PCSA 4L1DA 1YMMA 4DQOH 5M7QA 4X4XB 2O5ZL 4KI1A 4AITA 4HBCL 3QUKA 1TFPA 2ITDA 5B1AB 1T4KB 5AVXB 3HOGA 5AAWC 1C08A 4OLYH 1M53A 4WEBH 4J7RA 1DQMH 5I74B 2OCCB 3LRHA 3AS2A 1HTYA 1P4UA 15C8L 2CZNA 4YHYB 3WL9B 3JWNG 4FHKA 1WAAF 4HWZA 4P48A 4HD5A 1X5AA 4KZEL 2DDQH 1NDMB 4F58L 4KO6A 4AQ8C 1NC4D 1GMEA 3PWJB 5L88L 3OKOB 3F84A 5H2BA 4PHXA 3NIDF 3ZKMD 3UMNA 2NLJB 3IJSA 4A7SA 1RFDH 1CS6A 1OAYH 3KS0H 4NS0A 2WVUA 1WO2A 4X6FA 4GT7A 4EI5D 4GXUN 5IROD 3PABA 1F97A 2LU4A 1ZY9A 1T5XA 4YN3A 5I6KA 2XTJC 4TQPA 1LO3L 5BOJA 3ZL1A 6PAZA 4F3FB 4TUKH 2OMTA 2W0FB 3WMQA 3EH3B 4JRLA 3LRKA 1KIUA 2NX5D 1WIPA 1U0QA 3SYOA 5DEGB 4JFZH 1BVKA 5D7JB 4G6ML 5IB2A 1QSVA 3RPIA 4F24A 1JGEA 1FVDB 1FVCB 5E70A 3TFKC 2OQJA 3D3VB 3KLAB 2OBGA 4K3DL 5L9DL 5T3ZL 4W6XB 1MJ7L 3S35H 5ISZB 3O6KH 1A7OH 1AZRA 1CF1A 1HSBB 1UWEL 1WWWX 2CBTA 1WBYA 4PFEA 3EJQA 3FT2B 4Q4IA 2XRAH 4N2BA 5B39B 2KC0A 1CG9A 1SYVA 4G6AD 1OALA 4P57A 4GAFB 1AD0B 3EOBB 3DK0A 1QUNB 4R96B 3TA3C 2XA3A 4I77H 5I0ZA 1UOKA 4GY4A 1D5BB 4LRIA 4MAYD 4F1SA 3T1FA 3RX5A 2YFNA 5E8PA 3T2LA 2CD0A 1ACYL 5JIIA 5CSZB 4KVNL 4JFSA 3GSWA 4B95C 1PFCA 1LP9F 1NGYB 4JN1H 3NN8B 2Z7ZA 5E9AA 1IBGL 1JPEA 2NUPB 1UOLA 2G4EA 3RWJB 43C9B 2BP5M 2G2RB 3CC1A 1NGQH 4ZMAT 2V7HB 4Z78B 1CYGA 4FQXB 2Y1AA 4UV7H 1FCGA 1RUML 5ERWB 2VH5H 5DMKA 3NPSC 4AYFB 1A65A 3PYCA 4B3VA 4EDXB 2P4AB 1E4WH 3CVBA 4FKHA 3MLUL 4N9GB 3L7FB 5HGHB 4H40A 2HUHA 5HPMB 4Z8FH 2DN7A 3V52H 4W4OC 3RU8L 3F58H 1L9NA 4ATWA 5CJQL 5AAMC 1NOFA 4ONHA 4M8UA 4XC1H 3X1BA 3SKOB 3SDAD 3JYCA 2E9IA 5D1QE 2ADFL 3J27A 1U93B 4HIJA 4DH2A 4KK9C 4P3DA 1AJ7H 1SF3A 3VGHA 5IV2A 2BXZA 1HJCA 5CD3A 3C60C 3SGDH 3SQOH 2Z92B 5FYKL 3RWEA 4DPBX 4C83B 4N87A 1CGTA 2VXSL 5DMGC 4E36A 4Z95L 5E56A 3UO1L 3NYKA 5KW9H 4RMVA 4WEMB 4XVUD 5DYFA 1ZIAA 1OAXL 5F9OH 4Y88A 5F93C 1Q1PA 1F13A 3EHBD 1QBBA 3KMDA 5DWUH 3S9DB 1FPTH 3GSOA 4J3OF 4MA1B 1JK9B 3AAZA 5FA4B 4AUJA 4XPAL 4WFED 4P5KB 1L4IA 4XNMB 1AYOA 2HFEA 4X0KB 4LHUA 2GTWA 4JB9H 3RY6A 3SBWC 3S36L 1G4MA 4OV5A 3D6GA 4B7LA 3CCHB 4NJAH 3C9NB 2H45A 1OGAA 1UJ3A 3ELQA 1P2CA 4FNTA 4F7TB 4G6FD 1N5YL 1PLCA 5F8QC 2X9WA 4ZODA 4ZUSA 3UFIA 4FNLL 1BBDL 3WKYA 1BAFH 1WE5A 2Y06H 5D7LA 5GJSH 3HZKA 5TTRA 3WKML 2FD6L 5GZND 1V3MA 5MEOA 2ZYRA 3ILQD 2IBZX 3QJFA 4PJEE 3LQAL 4RDQG 5GGSB 1I3GH 3V95A 4ODWA 3SPGA 3CFKA 1KG0A 4K7PL 4XMLL 4H2CA 2CDFB 4PLKC 5IEHB 5CBEB 1I7UA 1I3RB 3W57A 1KTRL 1I1AB 3L5WB 1KEGH 1R34A 2OXHA 5DFVC 3RJQB 3C5XA 1WZAA 4JKMA 2XXCB 1MCJA 2BCMA 3ZDZB 4N0RA 1A4KA 3CXDL 3BLPX 3GSVA 3RGHA 3UTSE 1YY8A 3R19A 4LGSB 3EADA 2GSIB 1CLYL 5JDJA 3FONA 3MA9L 2CO3A 4LOUC 4GRLD 3BP6B 3TWCH 4TLTA 3U0WH 2J57A 5E94B 1MRDH 2L7QA 1YEWA 1Z9MA 3K1DA 1D6EB 3MUGB 3O2DA 5INCA 3W82A 2KDYA 1JWSB 1RLBA 5SX4I 4NQDD 2FQGA 4YXKH 2QSCL 3BVNB 3QRBA 5JW5B 2FJGA 4WV1B 4DEPB 2A6JB 3BRFA 4AZ8A 3QDMB 4NO0A 4LEXL 2PN5A 2VB5A 1Z3GH 3PDOA 2GC4C 4GSXA 3EOAB 3QEQD 2GW5A 3BMWA 4H8HA 4CC4C 3TEYA 3OAWA 3ZLQC 4L2LA 4JGMA 3MFFA 5CD5C 1KFGA 3JTBA 4FXGA 4IGBD 1P9MC 1EBPA 3SOBH 1RPQA 3P4LA 3E1ZA 2YSSA 1DSWA 4Y9CA 1TYJA 2PWHA 2H47C 2CR0A 2HH0H 2V9UA 4I8DA 3CWGA 3EBIA 3HS0C 1ES0B 3FQ4A 4PB0L 1FCCA 4Z5RB 5D55A 4U1NB 3F62A 4HS3B 1IFRA 1GTFA 1KJVB 2H3NB 4OCYL 4Z3FA 2OTUB 1I85A 3QJRB 2BHUA 2P7TA 4XE5B 3KYMA 3VXMD 1JN6B 4WI6A 1VZGA 1PIFA 4XNYH 3U9PH 3MROB 5EN2A 2C9PA 1A02N 2HAZA 4HGWB 3HE7A 5CMAA 1CL7I 3NA4A 1JI1A 2DJUA 2HRLA 2UWEE 4HJTA 5CLZA 3NEXA 3OZ9L 3P4MA 4HC1A 2QTVA 4N0FA 1E5CA 4ZK8A 2LW3A 1IMHC 1IAMA 1OSPL 1I9IH 4FCHA 2A73A 1E3ZA 1OT2A 2R27A 4KRLB 4M43L 4MZRA 4MVBC 1KOAA 3VSQA 4MGXA 3FF8A 1KJ2L 4HS8L 4OM0L 2C34A 3LXAA 2P5ED 3QC5X 1N10A 5LCVH 2EXSA 2XA8L 3NCEB 3VXOA 3MRBA 3APFA 2JJWA 5FHBL 1QSFA 3VWKA 3DVFA 2XWJA 1PS3A 3S3SA 3BUDA 3D0LA 3S5LG 4XNAA 1ZGLB 3NIGB 4PRIE 2GQHA 1HCVA 4R2GC 4WFEE 1P7QD 1OWRM 3OLGA 4LP8A 1YA5A 1CFTA 2NXZD 4ZFQA 1YEDB 4ZAKB 1A66A 5EBMA 4Y1AB 4OZGF 3LH9A 4QCIB 1GHFL 3VD0A 1BIHA 5DQJA 1F4WL 2NDFA 5G5DA 5KJ7E 4YPGB 2D7TL 4Q4EA 5H35A 4X5WB 3ZSTA 4P9HH 3H9SA 1R75A 3G04A 4GXUM 4I2XE 2W94A 4JRXD 3K71A 4U6YB 3L4CA 2FO4A 3GKWH 5IQ7H 4OCRL 3FUFA 4OI7A 5E6YA 2FZ3A 1BQRA 5DWPA 3QRGH 4DVBB 2A38A 3I50H 2BRQA 5HHME 1WZMA 4RNRA 1UVQA 2A9ML 5J13C 2A9NH 5L2KA 3TVMA 4ELME 2D3LA 3WDHA 1Q72H 1HCYA 2HFGH 2KKQA 2QHLA 1N59B 3GTTA 4QAWA 3B2PA 2JCCB 4U7KA 4IOSD 1MCRA 1RZGB 1U95A 2PW2A 3NEOA 5E4IA 1KV3A 5IBUB 4PS8A 1K8DA 2Q76A 4BXVA 1YMMD 1V5JA 4RBPH 3FBKA 1ETZA 1O6VA 3ZPDA 5ICXB 2UX7A 6CGTA 3F01A 1XL4A 4OF7A 3ME0B 3SGJA 2A74A 3QIBD 4BH8B 1S7WB 2HG0A 3NCYP 3K6FA 2HKAA 1IBDA 4PJIA 1JV2A 4DO5A 4NQDE 4KOCA 3Q3GA 5J6GA 3M46A 3HUJF 4G9DA 4LCIH 2IPUG 1LHZA 2JCWA 1ZLVK 1JVLA 1M7IA 2CO7A 3HLAB 2CCLA 3QEQE 4POZC 3QJTB 1DJWA 3VXNA 1QRNA 3WXVH 2GSMB 4LSDA 3Q2NA 3ILPB 3RL1A 3B2MA 2VR6A 1FZOB 2ZD0A 2VGLM 4YZFE 4R4BA 3ISYA 3FK3A 4M6MH 1D5RA 2XG5B 4K9EC 1CGWA 4KJQC 2R56H 2WUBH 3FSOA 4XP4L 3IDJA 3NSFA 5ECJE 4G71B 3HNVL 2BO0A 5DJ2A 5B8CA 5D5ME 1JCKA 3LRSA 2R69H 4PVLA 4M7ZB 1IAKB 3U2IA 2JELH 2A3TA 1YQVH 3FO2A 1U8LA 3GBML 1CFVH 4XNQA 2FATH 3PG2A 1C16B 4G8GB 1HX0A 1BQ5A 3NZ8B 4DO6A 2QBWA 5T1LA 4JFXA 2NY1C 3LKPA 5IW3A 1EDYA 3RDTC 4FLRA 2E6PA 5I1AB 2R2HB 2ODHA 5CSBA 5C6WH 1U58B 1M2VA 1RHFA 2X89A 1LJMA 3NJVA 3VXME 1U9KA 1MXGA 5CO1A 1S46A 4E9YA 5JHLL 1Q94A 3EDJA 4EIZC 1NFKA 1VGKB 4RAUA 3MHZA 4HZAA 4F9PC 2A6KB 5I66B 4GI8A 1NFAA 4UQ9A 1Y07A 1LL1A 5EG6C 1C12A 5KBNC 3LPOA 4MB5A 1IM9B 2DQEH 1CFQB 4LB8A 1Q0YH 1T4WA 3LN5A 4ZS6D 4YQXL 2F08A 5EU5A 5EH1A 2P46B 5I75B 1T5WA 2QSVA 2WYHA 5DS2A 3V4VA 4GG6F 4PMEA 2D03H 1AC0A 4GMSH 3VG0H 5LGHL 1EEZA 2XWXA 1AE6L 4OFDA 3QIUC 2P5EE 4QGTA 4M7JH 4N22A 4EAEA 3CZUB 5EORL 3ULVD 3NABL 1DQJB 4RMBA 1CE1H 2D2CC 1R33A 1A6AA 4MJHA 4E41A 4GAAA 5DVKA 2BSBA 3GMNB 3FQWA 1RP8A 3F7VA 3VNZA 3VSTA 2VLRB 4L9LC 3ZKXC 2FEEI 1TMQA 4YHLH 5DD0L 4P49A 3O45B 3SCMA 3MZTA 1S7SB 3ZE0B 4LLQB 1EHNA 5K33A 3KPMB 2X4OB 4L8SC 2W91A 5AUMB 1PZAA 3L3KB 5LWYH 1AKJA 3HN5A 3QNXB 3S8GB 2VITB 4N4YB 4UQ3B 5EU3B 5HDBE 2F7IA 5CUSH 1HNYA 1KY6A 5F21B 2BFGA 3RWIA 3PFUA 1G6RB 3TJEL 1PKQE 4LLWA 4JRXE 1CGSH 4MCNA 4OD2B 3ZO9A 1TR7A 4FA8A 2Y25A 2IAMA 5DHYA 3AABA 1T1ZB 2Z93B 5D7HA 1NGPL 4N2CA 4ALAC 4ODTH 5IMMB 3CX2A 2FJSA 1XBRA 1I9RL 5IHUH 3TBTA 2BVPB 4YSAA 2YK1H 2P5WB 3DBXA 2PABA 5FA3B 3THML 5BRZB 4LHUD 5D93B 4FEMA 4PJHE 3CN3A 2FJFB 4LAQL 1OGAD 4RGOH 2BSTA 3BFOA 1OQXA 2XX0A 1JXFA 2R2BB 3GBNL 1VFOA 2C9RA 4R4FL 4E0RB 4Z3HA 2PYFA 4PJ9A 3OSKA 5D7LD 3I74A 5DUPL 5HSFA 4NM4H 4RRPA 4QF1A 4ZOCA 5HTSA 1E42A 4TQEH 1NCWL 4YHOL 4Z7OB 3HEIB 1MHCB 4GFXA 3KYOA 1KXTB 1ZVHA 1DEEA 3GLDA 5CBAB 3RNQA 3TPUB 3MJ7B 2ZX9A 5EEUA 4S10A 3CFJB 4WWNA 3TWYA 2KQMA 1A1OA 3GQFA 3QNZB 2L0DA 3O8XB 2FQDA 4KXDA 4Q58C 2AQ3A 4A37A 5JO5B 4WUKH 3D07A 5MEPB 3MLRH 3SKMB 3SN6N 1PD1A 2I60L 3NEEA 5ID1B 3CPLB 4WVRA 3VXSB 2J8OA 2ADJB 3JWDC 5FYJU 4CADA 2WXMA 3IXTA 5T5FA 1ORSA 2AJSH 2J1YA 3IF1A 5KSUB 4GUQA 2YO3A 5GGUA 1G43A 2XQ0A 2QHRL 4LQFH 3S98A 4DP5X 4KKBD 5C3IA 2B5IC 2WSDA 3IDIB 3CLEL 1F4XH 1XXFC 1OGSA 3IDNA 4K3HA 3FCSB 1L3NA 4RSVA 5DZPA 5JNYB 1OHZA 3P11L 1CDJA 1MIML 1RJYA 4NO0D 2DQIH 2EE2A 1HEZB 2AABL 3ES6A 1S7RB 4U1SA 4P9ML 2VERN 3DV4B 2ZP9A 3SGEH 4A7UA 5FB8A 4P4KA 2QADD 4H13C 3WD5H 1PEZA 4XMPH 1OT4A 1VFMA 3RWCA 3PE9A 1A9EB 3UDWC 3MU3A 2OL3A 4HH8A 2WLKA 1HNFA 2FWOA 4UUJB 1WPCA 1U8MA 2RQ8A 1B4RA 2Z0UA 1FGVH 2IF7A 5FUCE 2OSLB 3S3DB 4FQJH 3D1MC 3RTQB 5FFOA 2Q7NA 3SDXF 3R1GL 3KVQA 1JFQH 4QHKI 1F6AB 4JKNA 3WKPA 3N5AA 2HVJB 4H2AA 5G4NA 4FABH 2Y3AA 1NDGA 2FYYB 4LSPH 1ZLUH 4YFLI 2NMSA 1DANT 1JUFA 1KCBA 1AOHA 1QQDB 2RH0A 5LN8A 3GYRA 2IH9A 1RU9L 3EFFA 1KIQA 1LWHA 4F7EB 3EOTH 2NZ9D 3GIZL 3HE7D 1TEGA 4LLVA 5IFHL 1F8TL 4A04A 4UIMA 4AENA 5IHZB 3C5JB 4AQEA 4YNYB 1KTDB 1IAII 3VXRB 1FO0A 4M8QB 3KJ6H 3FYEB 3DX0A 2F1BA 4KBPA 3QUZC 5DUBA 1V27A 1WT5A 3RWDB 5JOPD 4PWEA 4CW1A 3K6DA 4DP2X 2FR4A 1AGDB 3T77B 3KM1A 3BP4B 4YWGL 4ZFOB 3IFPA 3MGTB 3QI9C 4PRPA 2XN0A 1YN7B 3SDDA 4G8IB 1TQTA 1MLCA 1FJ1A 1QSFD 3VWKD 3RILA 2L7UA 4FMKA 3SDCA 3S37X 1IGYA 4QR7A 4JFUA 4RQQA 2B16A 4DP8X 35C8L 4MASA 4ODSH 3CFMA 1W9XA 2VRQA 1KGYE 2B8OT 1RAMA 1FSKB 1T3FB 2OXGB 3W2DH 4HLZH 1I7RA 4JY4B 3WS3A 5CCKH 2HT4C 5JHDB 2PTUA 1RPUA 3EUDA 2KPWA 3MNZB 3NCFB 2KMWA 1Z66A 1IM3A 3CZGA 4KMTH 4JO3H 2P8PA 2VDKL 3H9SD 4LLMB 1ZGLM 1PLGL 1EMTL 4NWTL 2R0LH 3MBEB 3BWUF 5D7LE 1TLKA 2IPUK 4X4KA 4BFRA 4XR8C 1NCJA 4OFYA 2WBJB 3FT3B 3RE0A 3GMQB 3ZDYF 4F2MB 3KR3H 1YEGL 2J4WH 4YH6A 5ITFA 3ATEA 4FXKA 4PUBL 2IH1A 3BGMA 3GSQB 2FL5A 5IROC 4EI5C 1MCFA 5L2KD 3TVMD 1YMHB 1TQBC 5HHOB 1BXXA 2H6OA 3MBWB 1EZLA 5E95B 3QQ4A 2F53A 1HHHA 3TBWB 1IO4C 5GRUL 4HHAB 3TNNA 1S4IA 3D50A 4M5YH 3VD7A 3WEXA 2R1YA 2CHDA 1JD7A 3LB6D 4DN4H 1QO3A 1SOQA 1SYSA 4POYA 2AXGB 2BMKB 3MTXA 5JIKA 5G2NA 3STLB 4I1PA 3UC0L 4DFHA 2CLZB 5HJGA 5BUAA 4I9XA 4MD5B 3H0TA 3D33A 4BFOA 2EDHA 4W9EC 1BZDA 1SHXA 3E6FB 3P4NB 5KN5B 4PBDA 3RUGA 1KCSH 2X12A 3Q48A 4EI6A 2Z31A 1AHWC 1ONQB 5AL8A 4HSQA 3GINA 1A6UL 1DZBA 1M2OA 5ICYA 3ZT5A 1T22B 4IOFD 1QRND 3QRLA 2LLLA 4GRWB 3MCKB 1MHEA 3MRKA 3OR6A 2YPKB 3OKNB 4L2YA 2A77L 1D5XA 2ESVB 1H6UA 3O2DH 1I3VA 1YYMH 4CMMA 3FTVA 3A3YB 4UB0H 2AF2A 4XBMA 5LXGL 2EE3A 4P46C 3GGWA 4EKXA 4YO0A 1IT9L 5I8KH 4Z7WA 2W8CA 4XNDA 3GXMA 3QK0A 3RWGA 2GBAA 1UXWB 1MRCL 1IFHL 2W65B 4TSBL 3RA7L 5AVYB 1RZKC 4D8OA 5MI0C 3O0LA 1UURA 2YHGA 2VYRE 3MYZA 4BFGA 3ARQA 1AXSB 2K6YA 4DZBB 1E5ZA 2DLIA 2RD0A 5D9SA 5T1LD 2H6PB 1HWWA 1G9ML 4UILH 5B21A 4BRJA 3I9GH 4HWEH 2QKSA 1ZANL 1X5KA 4Z0XA 3SDAC 1J10A 1RV6X 3DJTA 2X89D 4W6WB 2DD8L 3DUUA 3VFMA 2YAPA 1UM4H 1VB9A 2DBLL 3WLWD 5AW8B 1NM9A 4KKLC 4EQ3A 4PD4J 3VRJA 2SEBB 1FH5H 3CK0L 4YAQA 1W72L 2XBZA 3L3IA 5T3XD 1NPNA 2BNRB 3U9UA 3BUIA 3W0WE 3G5VB 1Z32X 1NKOA 2J71A 5AYUH 3MV01 3R0MA 5E08L 3IFLH 3M07A 5JOPE 4FRWA 3ARDA 4ELKA 4JY6B 3C08L 3AU1B 1BVLA 5MEQA 3AG1B 4X2UA 5DMIH 2DEWX 2XZQL 1ZLWK 2KZWA 3CFEA 1BZ7B 4HC1H 4NDMA 4E41D 1QSFE 4MB4A 4XN7A 4PGZA 4BA8A 4YLBA 3REWA 3KJ4B 4LNRA 5I1JH 4Y16B 1XGYH 2IV8A 5GZNC 2I9TB 4NQEA 5IB1B 3SCMD 5H37A 1QPXA 1HE7A 3ILQC 4BQCA 1KB5L 5E4OA 4FG6D 5F96L 3IU4H 1G9NH 1BQHG 1LO2L 5GSRA 2AVFA 1FLRL 1AKJD 5SX5H 4IHOB 4NM8H 4AGPA 5C0RL 2OK0H 1U2YA 3OKLA 2CGRL 3X3GL 3BIAX 2A6DB 3H9SE 3V0JA 1DL7L 4R97C 3GK8L 4IM8A 3TBVA 3V0HA 3O3AA 4C56B 4AE1A 3RVWC 2R0WH 4DGYH 4NX0A 3HNTL 5KJ4A 1FYTA 2IAMD 3RVXD 3LSOB 5E2VH 3FDWA 1KJ2A 1PZ5B 5EC1B 5J9PA 3VD9A 2IIJA 4FQQA 3CC5B 5L2KE 4R9HA 1H0DB 3P73A 1MHPH 1F5WA 1FAIL 4F33B 5DI8A 4F2EA 1Q9OB 2VSMB 1JHKH 1QPPA 4S1RL 3L81A 2X1WL 2XYCA 2B9AA 4HJUA 4X6CF 4R7DA 1WISA 2QLYA 2Z1KA 3L1GA 5I76A 4BD4A 4OR1A 1T1YB 5ICZA 3K2UH 1SBSH 2VO8A 1R6VA 3RHWF 3RURA 2EUVA 5AW9B 1ZV9A 3D08A 4PJ9D 1AG0A 1ADQL 1CBJA 3D48R 1EO7A 4XPBL 4NXKA 1DQQA 2H2SC 1UB6A 3DMMC 4PJIE 3CZSA 4X83A 1U92B 4JJOA 2V8LA 4AOFA 1EJOL 2RQEA 5I6NA 3QULB 5EV7A 4JFDB 4IGBC 1E9PA 2JLPA 2DQMA 3DHPA 1URIA 3QZPA 4MMYA 4Q6IB 2Q5BA 5J12C 3TS8A 3GRBA 5ESQA 2WQSA 3CQQA 4YHMH 1AQDA 2L8AA 1B0GA 1VFBB 4GS7C 4IRSB 3X1EA 5HPOA 3QO0A 1QRNE 3LHPH 4WUUE 5F71A 2ZUQB 5J06A 2WMPB 2PCFA 2VR7A 3ZW3A 4NN7C 4NQCA 4U4IA 5FV2A 2QSTA 3EXJA 1GJWA 4YJZL 4LOEA 2AFNA 4A6YB 2GJ6B 2CIKA 3APNA 3FU9A 4FAAB 4KKQA 4NSKA 4C4UA 4L4TA 2CM5A 1AIFB 3NFNA 4LU5L 3WXWL 3EFDL 2X0VA 5TQ2L 5HHPA 3INOA 4UT7L 1HH6A 4NKOA 3GHEL 4PJAF 2VZSA 3QXUA 2XTLA 1TQCC 1C5CL 3PHQB 3F2LA 5EN3A 4HGMA 1MFEL 4FC3E 3ARFC 2C3VA 2FCBA 1RP9A 4JKKA 3CHOA