2MOQA

Solution structure and molecular determinants of hemoglobin binding of the first neat domain of isdb in staphylococcus aureus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
LNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTDSKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSSTHFNNKEEKYDYTLMEFAQPIYNSADKFKTEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Molecular Determinants of Hemoglobin Binding of the First NEAT Domain of IsdB in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Iron-regulated surface determinant protein B
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2moqA00
4H8QA 2E7DA 2ITEA 3QZLA 2O1AA 2Z6FA 3RTLA 2Q7AA 3QZOA 4YMPA 3QZMA 3QUHA 4NLAA 3SZKC 3VTMA 3QZPA 3SIKA 4MYPA 4WJG3 5D1XE 3VUAA 5D1QE 2ITFA 2K78A 3QUGA 3QZNA 5D1ZI 2MOQA 3SZ6A 3RURA 2H3KA 3OVUB 3S48A 2O6PA 4FC3E 4H8PA
chains in the Genus database with same CATH superfamily
3VI4E 4JPWH 4QRPE 1IEBB 4YBHA 5D2LA 3PJSB 4XPBH 4DGYL 2HP4A 4OZHB 4ZMXA 2IQAB 5FAAA 1K4DB 2XWBB 1A6AA 3H1ZA 4LU5L 2GHWB 3HZKB 2IAMB 4YXKH 4YSOA 4NWUH 4XPAH 1IC0A 4JKLA 4AZ8B 1Y7VA 3LKSA 3V0WL 2YJLA 3BXNB 2H45A 2WHVA 4JY6B 1UXWA 4OV5A 4KK9C 4QRPB 2NR6A 4X99A 5FYLL 1KB3A 3EF4A 2DH3A 2PXYA 5FKAA 2HX9A 4KJYA 2XSKA 3EFOA 1AD0A 1LQSR 2KL6A 4QT5B 1EAJA 1PNDA 1S3KH 4N24A 5FLVA 3KXFE 3VGBA 1LWRA 1XWVA 3I6LE 1QYGL 3K8MA 3MRNB 4PPTA 5HY9A 3ZHFA 2W91A 4Z3GA 5HI3D 3HZVA 4HHAB 3EJRA 3QUXA 2XX0A 2X4NA 4WW1B 5F8QC 3ZDXF 2AGJL 3NJGA 3SPJA 5AAPA 1VGEL 5CFHA 1I82A 3GSVB 4HJSA 4P9ML 3RL1A 5KBLA 1ZLEA 4IRJB 1BG1A 1A9BB 3U1QA 1L7IL 1YMMA 5EUKB 2PWEA 4X83A 3VI3E 1VF5C 2W94A 3F7KA 4WSKA 1ET7A 3SO3B 3RA7H 1E30A 3MJ9L 1P2CA 1AR2A 4YVNA 2VLLB 3U9UA 4AEHH 4BCZA 3EGSA 2OR9L 1DZBA 2OMZB 3HR5B 3VUAA 3SBPA 4XCCL 4X0NA 5E56A 4A55A 1CBJA 5C0JB 4MAUH 2GVYA 3MV8D 2FHBA 4I3RL 3CK0H 1I4FA 2ZSWB 3AU1B 3LB6C 1U3HD 2APSA 4GXUN 5JOPE 2R8SL 3V0DA 1HKFA 3WMSA 3X1BA 3G5XA 4ORGA 2A6DA 5DTFA 1M05A 4JN2B 4ZMZA 4JRLA 1QSEA 3LZNA 3IBOA 4HWUA 5I1CL 3Q44A 4RVBA 5AZ2L 3PGDB 4PHXA 4L4JA 4LLDB 1ZV9A 4X9FA 2KKQA 4P3DB 3DXAA 4QXGL 4F7CA 5C0AB 1RHHA 2VXUL 2A38A 2WBJB 5EC1A 1SXBA 5EB9A 5EPMA 4HKJB 3GSNB 4WFFD 3QP3A 4N2OA 2H32H 3MYJA 3PFQA 1TCRA 2FO8A 2F5AH 4IYKA 4M5TA 2WINA 2PCPA 2FH8A 1OTTD 2J6WA 3KS0J 4AK1A 3GSNH 5FB8B 1CD9B 3VQ2C 4IU3A 3DV6B 1MCWM 4ORZC 2P26A 1T1XB 3FHAA 3CFCH 3RJQB 3QIUA 4LF3A 5T5FL 3RGVD 4OV5B 3UO1L 4OFYD 2Y69B 2BCKB 2QV4A 3NYKA 3HN5A 4ZW3A 1MWOA 4X6CA 3RVWC 3UTTA 2VDML 3IDGA 3WGVB 4H8WL 4F8OA 4OLYH 5FYKH 3RWDB 3CHXA 3K46A 4M62L 4NNXA 4R26L 5D7JA 4BCXA 3FB6A 5LO7A 4ETYA 5F70A 1JGDA 2APBA 4YLBA 2X6UA 4Z3TA 3CFUA 2CDGB 3GBMH 4H20L 4O51A 2VDLL 1IKOP 2G30A 1A4KB 1NGYA 2RFXB 4WDIA 4PWGA 4ZPTA 2D4FA 2IGLA 3QNXA 4TSCH 5BS0A 2FGWH 2YGQA 5ICXA 1ZK5A 3ULAB 3HE7C 1WZLA 2NY4C 4B95C 2CUAA 3V4VL 1K6QL 3OSVA 2OP4L 5KAQG 4LLUA 3UTQB 1PLAA 4RZCA 1BEXA 3DBSA 4PWKA 4N2NA 3SJVE 3VXRE 3ZIYA 3TIEA 4AUUA 2B1HL 3I02A 4JFVA 1SZNA 3K71B 1J8RA 1P7QA 3C6LC 4HQQH 3IJSA 4Y2OB 4K23L 1BVZA 1ROCA 2R23B 3QHZH 3OJDA 4KHTL 3FCTA 3NIDF 1KENH 3UTTD 2O93L 3QZBA 2WVTA 1IZJA 32C2A 1MWAH 4S0HA 1MXGA 4ONGL 3MJ7A 3MRFB 4NN5C 2DI8A 4NQXA 2FT7A 2D3LA 1HH6A 4YIQB 4UDUA 2FBOJ 4EI5A 2LVCA 4GG8B 2X1XR 3SE3C 4XCYB 3LRKA 5E08H 2YD5A 3IN0A 4ELMF 3GBLA 4Y4HA 4ZX4A 1OGTA 2XN0A 4JFHD 4LSTH 3V0GA 1N5YH 3GFUA 4PJGE 3TEXA 4HUKB 3AWEA 1YHPA 3QCTH 4AW4A 2EE0A 4ADGA 4HF5L 2EVGA 4NRXA 2Z92B 5GJSL 4NM8H 2UZIL 2CAKA 2DQUL 3TOPA 3VFTB 4TRPH 3TEYA 1BA9A 4MJ4A 5LXGH 4HPYH 5IBLC 1HC1A 3QXAB 4WUUB 1K2DA 4WV1B 4X4KA 2CGZA 4J3XA 2PTTB 5EU6E 3HUJE 2G3MA 1OB0A 1R33A 1YRKA 1CLCA 3FO0H 3TVMC 1MH5B 3EDFA 1PU0A 3FQXB 3LIZH 5BZXA 3S96B 3SQBA 3VD1A 1PJ9A 3T0EE 3UPRB 4BDVB 3SO3C 1EXUA 4I85A 3QPKA 1KFGA 3HPLA 4N86A 1ES0B 4OCWL 4L0ZA 3ZZ1A 3IXAA 1JGEB 1N0XL 1H0DB 4XP1L 2X2JA 4B0MB 1R5IB 3SKNB 1UATA 1WRFA 1XO8A 3MFFA 4GKLA 2GW5A 4OKVA 1MVUB 5HHOE 4JZNB 4PJ8D 3EZ8A 4E2OA 1P7HL 2TSBA 3EH3B 2AK1H 2VH5L 2WXFA 4P05A 4X5QA 3WBDA 3WFZA 3HI1B 4AYEC 4B9ZA 4XBPB 4MJ6B 4JKMA 1TQBC 1S7QB 5HHNA 1ML0A 3BKYH 4RDQF 3RVUC 1YN6B 5GZND 4MCYA 5DR5H 4OIIH 1S7UB 2RIKA 4DAGH 1HL5A 4JVUA 4Q8BA 5IB2B 1KLUA 1ETA1 5DZ9A 4Q97A 3N42F 5E94B 1TR7A 2X4NB 2R1XA 3A67H 2IDFA 3DX8B 1JF1A 3GIZL 3PV7A 1USZA 4ALAH 2NY3D 4BFOA 4P57A 3KLAA 4J1UA 4FFYL 4Q6YA 1MCQA 2VDKH 4Y4KB 3OLDA 5JHDE 1A9BA 4Y5YB 5L8KB 2ZWSA 3D25A 1UT9A 2XV2A 2NY1C 3I9IA 5BQ7B 3FN0H 5EBLA 3L4CA 3ELQA 2OZ4L 35C8L 1E7UA 4FQQB 1KGXA 3FT3B 1QNZL 3P02A 5GRXG 2HLFD 1XZ0A 3ZE1B 3N43F 3WEBA 1EGJL 5MERA 4NZTL 4X4ME 3D87B 4FQPA 4JPKL 1M7DB 2BOBA 3ASWA 3LKNB 4X4XA 2NYYC 4DGVH 4DQAA 2P5EA 3CFIC 4JAMA 4DTGL 1I8AA 4M7JL 1NCNA 2F5BH 3ESUF 1KIUB 2CE6A 5GRUL 4AQ8C 3ZQXA 1I3RA 4JM2A 4NKDA 2WUBH 4QRPA 5F72S 3V0VB 3IFNL 3UZEA 1JZ6A 4J8QA 2IWEA 2V9TA 3NJHA 2DH2A 3AWGA 1SJEA 4AM0A 5I0WA 4XVTL 3VFNB 3BP6A 4AYFA 2P5WE 4LFHG 1S7TB 3NG5A 4Y9CA 5B39A 2WLIB 4LARH 4LHUD 4Y1AB 4LPYA 5D1QC 3BC9A 3QUYA 1OM3H 4JFUA 4N9OB 4YPJA 3PWNB 2I26N 4G11A 3PWVA 3OL2A 1D5XB 4UT9H 4AKQA 5ACLA 2GSGB 2XNAB 2XICA 2I07A 2Y7NA 4OGAC 4A04A 2HSIA 1A9EB 2FX7L 3D4ZA 1NIAA 4UWQB 3FUFA 4ZYKA 5GS1B 3L4ZA 5EORH 4ZBJA 3VWJD 3ALPA 3ECQA 2R4SL 5T1DH 1HSAA 2AEPL 5FCUL 3BLKA 4K9JA 3V5KB 3K81A 4PJAF 1GS8A 3QIBC 1RPQA 2CNYA 5C07A 3X11B 1M3JA 3MNVA 4HFUL 3H42L 4W9GC 5K39B 3UYOD 4AQ1B 4FNRA 4K73A 3I9AA 3FC8A 3UAAA 1XHHA 4NDMA 1Z9LA 1HIML 1RV6X 5KVEH 2BNRB 4OB5H 5E5MB 3OWEA 1DL7L 4IRZH 2BSEA 3RDTD 1QO3A 5IVXB 2BVOA 1RULH 3BZEA 2AJZB 2OBGA 4JFDE 2F53E 1HJBC 1F97A 3BN3B 3T6QC 1IC4H 3N42B 4G6JH 4GKZB 4C56E 3LJ3A 4EE2A 1UM6H 1TF4A 3NACH 3NRPA 4I89A 3TEUA 5BV7H 4U1IB 1WG3A 1ZGLB 1CWVA 3BP5B 5D1ZA 4OM1L 4KITB 1RHHB 2NDGA 2X89A 3R8BB 4GAJL 1A14H 5ICXB 3GJFH 5EIIG 5GS1C 1RZGB 2VQ1B 5DD1H 1KEGL 1T89C 5HGBA 1DEEA 2GUYA 2A9MH 3QIWC 1IB5A 2NSQA 2FHCA 1NIDA 5L4JA 1R3IH 3MO1A 1J8HD 2A6KA 3BP7A 5ITFA 1Q9LB 2AERT 3P0YH 4N0UA 5MP6H 1E9OA 4XAWL 2HTLC 4L3FA 4K2UH 3OF6D 4F9LA 3MV8A 1FH2A 3MV9E 2NY6D 1PG7L 4YHOL 5D2LF 1JF5A 3MRRA 4NOFA 3VFRA 1DVYA 1I7TB 2YWZA 4HEPA 5LB1A 4CVUA 3R4RA 1TTCA 1AGDA 4R83A 4YC2C 2X0UA 3OAUH 2D31A 3CDZA 3HCVA 3UAJC 4NPJA 4GS7C 2YD6A 4RGND 2XKUA 1JI2A 2BXYA 3PGFL 4OZHE 4URTB 1ORQB 1THCA 4U7MA 3VG0H 4F7PA 3QJXA 1F3DH 3ULUC 2EEBA 3CZEA 3OD3A 3RB5A 3MLWL 4F8NA 1NUDA 3ZYJA 2VQ4A 4Z5RB 3R4DA 1WBXA 1OP5K 5TPWH 2PN5A 1BF5A 2IPUK 3F01A 5BOPA 4H40A 2R69L 4KFZC 1TLKA 5GRJL 3WL9B 3KLHC 4FYSA 1S7XA 2JB6B 3QRBA 2YR3A 1DQDL 3QJSB 2Y5TA 4JPIB 1QVOA 3KPSD 4HJ0C 4Q58C 5BO1L 4AC4A 3V6OE 3DPBA 2Z35A 2XKNB 3R19A 5TE7L 3QZWB 2AAVA 2LLNA 3WHXB 4K7PX 1NCGA 1CE6A 2HFEA 4ZOAA 3WMPA 4KJWD 4KUCD 4M93C 3EYFA 1OB1B 4KKNA 2UYLB 2JCWA 4BWWA 2I9TB 1WFJA 1P7BA 4BFGA 4ANWA 4Z1PA 4YEFA 3SQOL 2YWYA 1XGPB 3IU4L 1IV8A 1P7KB 3C5ZC 4JZOB 3MA7A 2FATL 1P5UA 3P30H 4LOFA 2ZXCA 4H0LC 1QOKA 4Y2NA 5H35A 5L7XL 2HRHA 3DIVA 4G2AA 2DJSA 3PP3H 2XTJE 1MIMH 1YUHB 2IAMD 4XGZA 2ADJA 4Z95L 5DA0B 4JZJA 3V6ZA 4I3RH 5AW5B 3CC5B 4MQSB 4XZ4A 1UWGH 4MA3B 4IRSD 4PTTB 2R8SH 4G9DB 5A2KH 4BZ2L 3SDXE 3TJEL 4UTAA 1CTOA 4S1QH 4V2CB 3TN0D 3BVTA 4MZIA 2VDKB 3P4MB 4M6OL 3UG3A 3S8WA 3CFQA 3MRBA 5D72L 1RZIA 3BAWA 3BVNA 3GRGA 3O2VL 1B2WH 3MV7E 3NEEA 2C3XA 4IKIA 4M9PA 4W9IC 1F4HA 2B14A 1NMAL 4AI7A 5C0CA 2LLGA 4YSRA 5HHQA 3QUZB 3U48A 4HKXA 2VJ8A 2A73B 4XVSL 5C08D 4FFTA 5IUCA 1WS7A 4XNZB 4PW3A 1SDYA 3MOQA 1XF4B 1SVZA 2PPFA 5KANI 1MG3C 4WI2A 4WUUE 1AGDB 4KMQA 4UQEA 2E6JA 3N9GL 5EU6B 5LBSL 3FCBA 4U1GB 2CO7A 2VISA 2XPYA 4GKNB 2Z3FA 1XXDC 3TBTB 3ELAT 3P9WB 3LRSA 3ILPA 4JHAH 5A2LH 1JTTA 4DCQA 4B9KC 3ESVF 5E9DA 2OV0A 2FAUA 4K3JH 3ZTJH 1CXLA 1AKJD 4ADIA 4HD9A 4NM4L 1I7RA 3UO1H 4PUBH 1D5MB 3EDEA 2D7PA 3CVBA 4MB4A 4L3AA 4PGDA 1NCUA 1QFWL 2HPTA 3WEMA 1U8LA 4UQ3A 1YN6A 2R0ZH 5GGRB 2XWRA 3BPOC 4BKTC 3P4OA 1IGFH 1TPXB 4BEIA 3A5VA 5CR8A 2ARWA 4V1DA 2X7LA 1BAFH 4D3CL 2XQYG 3G5ZB 2WTRB 3GJFB 5DCCA 5FC9A 5LNGA 1J5CA 3TJHC 5E6UB 2FCBA 2I60H 2ICWJ 3OHXA 3VSQA 3TCLB 4Y5XC 2WC7A 1ZHLB 4QJ3B 4KRPC 4N0FB 3ATBA 1TMCB 3NJFA 4NKMA 4OZIA 4OLUL 5GSVB 1B4LA 4XN5A 2NY3C 4FQCH 2XJKA 1CGUA 4LVNB 2OP4H 3BAXA 3BGAA 2Z65C 3NJLA 4XXCC 5G55A 5AQ0A 4OZ4A 4KTYA 3SGDH 1LP9A 3ULVE 1NFDA 4JREC 2B1HH 3VRIB 5D1ZD 5EO0A 5MENB 4P2CG 2NXZD 1W16A 3JWDC 1N59B 2AXFB 2IO5A 4JDTH 2Q8BH 3SGJC 4E41E 5K9JL 4TVSa 1HFUA 4G9FE 4Z0BH 5FHBL 5I5RA 1Z66A 3VFSA 4E5XB 1WCBA 4CDHA 5TQ2L 5HJDA 1Y18A 5I1AA 5FDYA 4L29A 1IEAB 1OAUL 2EIJB 1MFCL 2IAMC 4KY1L 2BXZA 3CLFH 5D7IA 2Z4QB 1U2CA 4ZFOL 4D94A 4LHQB 2PXYC 1LO3L 5KVDL 1CXKA 1S5IH 3S4SB 4NQCA 3LPOA 3DOSB 3ULSA 4JG0L 1ACYL 5A6MA 2WXHA 3F7VB 1IBYA 3NCWA 3WELA 4LSTL 1Y0LB 3MBWB 1A6PA 4Y8DC 4DF9A 2ESVA 3DUSB 2ZKMX 2IG2H 3WTXA 3FU7B 3HG5A 1WBZA 3VXSE 1JNHB 4DSYA 3ZDZB 4Y4HD 4HJEA 4N5EC 1V55B 2LU4A 2WXKA 4WU5A 2J1ZA 2ROYA 4CA4A 3F7YB 2GSIA 4FTVA 4JDVB 3LZOA 3RL1B 1KN2H 1YEFL 5DJ0B 3ULVC 4DK6A 4N2KA 1ND0B 3BPOB 3OGCB 2AW2A 4M61A 4U1SA 1O5PA 2X4QB 3JTTB 4HPHA 1B0GB 5BRPA 1Q1JL 3QDGD 4C8XA 5C3TA 5HI3C 2GJ6A 5L88L 4UUJB 3EGSB 4TUUA 1NOFA 4YPGA 1YEDB 3BYYA 3I9GL 1DVUA 3ISRA 3MMEA 2X42A 4ONFH 3MC0A 5E8DL 3DGGB 1A8ZA 2APTA 5IQ9B 1QLEB 4NT6A 1FHGA 3DMMC 3EO9H 5CKAA 3TA3B 3II1A 2PP8A 1E5BA 2B59A 4QCIA 2NQCA 4HSCX 4JKNA 4NO2A 1NGZA 4NZUL 2DQGL 2N0KA 3EO1B 2RD0A 2EC9U 4GLRI 1QSEB 5HVHC 2F54E 3A0OA 1I9IH 1L5GA 4FULA 1GOFA 4WI5A 4N0YH 1T1WA 3V52H 1B0WA 3R0MA 2Q8AL 3ZTEA 3PQYA 5I18L 2YMTA 1DUYB 1FCCA 3AY2A 4YH6A 3SOBH 4M4RA 3GLDA 4NQED 2VERA 2J21A 3IMVA 1MXDA 3ZLQC 5FV2A 4WF7A 4IKKA 2ZYSA 3UZVA 4P2OB 4D0CB 3FQTB 2V3DA 3B7YA 5AW3B 3UJTL 2OR7A 2WINB 3HOGA 3QPQC 2FO4A 1R3HB 3NIFB 5ADPH 2NY0C 1NANH 1IQDB 1BIHA 2XZQH 5JPMA 4ENED 3QDJD 3RZCC 1QW8A 3DMMB 3PDGA 4XNAA 1QUNB 2H41A 3C6EA 4GRLC 1WHOA 2QKSA 1HINH 3KLKA 4X6DE 4M7JH 3VVWA 1TENA 5DMJB 9CGTA 1KYOK 2XQYA 1XQ4A 3K1KC 4EVNB 4K8RL 2OSWA 2WUBL 4JB9H 4YDVA 2ZUVA 2EYTA 1A6UH 2CUHA 2CD0A 2E6QA 3P0VL 2WBJA 3F62A 3MRKB 4WKZB 4QAWA 4N5UA 3WD5H 5JHLH 5BRZA 3UJJL 4W9FC 3Q5TA 3GEWB 4P9HC 1XX9C 3DUUA 5F88B 1LGVA 3ME0A 4N8VG 5EUOA 1ZE3C 2J72A 1JWSA 5AWNL 1TZIA 2BVUA 1JHKH 2AEOA 3MZTA 4WDIB 4YC2B 4LSPL 2YD9A 4L8SC 3BQUD 3GMNA 3ARBB 3ARDB 1L0YA 1RUAH 5E2TL 3PP4L 1YNLL 5EU4B 4OJAA 5I6KA 1DANT 2BK8A 2ICEA 3I6KB 3TNNB 3W0WA 3ZSSA 1SM3H 5DQJA 4P9HL 4B9GA 4GRLB 2OMWA 2YMOA 3U4BH 3ZRCC 2FT8A 1NOLA 1RSFA 3ATFA 1RZ7H 4L5FE 3DVIA 2BHUA 1IAMA 2R4SH 3BEWA 4HT1L 1ADQH 2CZNA 1A4BA 4FADA 5MEQA 3FMGL 5H8DA 5C3LD 2L7QA 4MZRA 3TA3A 1R19A 2WKLA 5IW1B 1QRKA 2W0PA 3AFLA 2EDRA 1O9ZA 1JHTB 1ODAA 3L45A 5DUML 2EE2A 1G7PA 3LB6D 3OKOA 4PCYA 3WO4C 4F8QA 3BYTA 1XGRB 2X1OA 5TF1L 2WUCL 1AXTL 1HHKA 2CCWA 3VXNA 2AJXL 2ETWA 5BS0B 1BQKA 4WUUD 3T1WA 2BCMA 4KAQH 1X5ZA 5FV1L 5LBSA 1KWKA 4AXWA 2CDEB 1IC4L 4G6JL 4K71C 1MREL 3WEOA 3MBXL 3L3OA 5EULV 3IDJB 4YFLI 1IE5A 4HC1A 2FX8L 2ZX5A 1T66C 2NY1D 1EHAA 1MFVA 4U3CA 2BVPB 3BUDA 3DVGA 3LKPB 4GAGL 4G1MA 4L1LA 5HTSA 4V33A 3X17A 5DFWH 4B9YA 4OJEH 4WEUD 3X14A 1QP1A 2Y1VA 3CSGA 5D7IE 3VXUB 1AIFB 2GJRA 1EEYA 3MV7B 4KI5C 3THML 2QMKA 3IDNB 4V2BA 1USQA 1JVOA 4BZ1L 1E27A 5ADOH 2H0EA 1NUNB 1PSKH 3QQXA 3O6FD 3CDGA 3TA3D 1A4CA 5I8OH 1A6VH 3MLRL 4KMLB 4WO4A 4APXA 4ODUA 2ZSVA 1VFUA 4PMFA 3S2CA 4X42A 3VXOB 4XMPH 2QSCH 2EXTA 1IGYB 1UD6A 4Y4HB 5DJXB 2QZ5A 1GAFL 3I2CL 2CO3A 2JKSA 3ZW3A 4OLVL 4BRVA 5D7IB 2XQBL 4Q14A 2EDHA 3RURA 2NYYD 1DLHA 2AVGA 2YZ8A 2EIZB 5A16B 2NNRA 2YD3A 2QTEA 3CSBA 3HKFA 2ATAA 3VG0L 2O4EA 2FLMA 1FYTB 3EJUA 4LLVB 3VRJA 2AJSL 5CEZH 5INCA 2XXMB 4KWUA 2PTVA 2VR7A 3T3MF 3MOBL 3QWOB 4R2GD 4ONOA 4Y5XA 1X5HA 3T09A 3VGDA 3T0AA 4ZFOA 1C8PA 3K2MC 3C08L 4JBSA 3T0EC 4OZGB 1NGWA 1HWGB 4HCFA 4WGKA 4S1SH 2EDOA 2AXWA 4JY4A 4LK4A 5CN2A 3A23A 2E86A 3C5ZA 3RNQB 2FSEA 2ZPKH 3NSYA 1RZPA 1JTOA 5E8OB 5F7LB 3MFFB 3BHBB 4MAYD 3DVNB 1UCBH 4RRPG 5HXMA 1NSNL 4V1DE 1V27A 4AE1A 2W60B 1T2QL 3L3HB 4NJAH 5BMFH 1NBZA 2EDFA 4BQCA 8FABB 4X8GA 1GA2A 3D09A 1HXYA 4OGZA 2HTKC 4P4KD 2IJ0C 2AV1B 3L2LA 1JAEA 4PRHB 4AW7A 4AIOA 2Y36L 5ISZE 1M1SA 2W81C 2DIBA 1GYWA 5GGQL 4YHKL 3GSQA 4NERA 4FQHB 3HB3B 2W07B 4IJTA 4IMLB 4UM8A 3HA0A 3G5XB 1TZ8A 5TE4H 4XO8A 3R1GH 4UOQA 1SDAB 4NQCB 1T5XA 3KBHE 5E5RB 1C08B 2ITCA 1WZ1L 4FXKC 3ZL1A 2AQPA 2PW2A 3PHQB 1JD7A 2N7BA 5AOZA 2IPKB 4G82A 1BJ8A 1NCTA 3PV6A 2GPZA 3BLPX 1OT2A 5CEZD 2IWGA 5J6HB 1IFRA 4RAHA 3B6SB 3PPEA 1FFQA 2QQQA 5LGJA 1S9XB 4NUQA 3W1ZA 4QAMB 4PLOB 1XBDA 4OCRL 4JO1H 2BS8A 4OZFB 2Y07H 3Q43A 4FL4B 2FIRT 3C2AL 2ZG2A 4NQCE 3VFOB 3S48A 4BBWA 1NEPA 1UXLA 4JFYA 1W15A 1TYEB 4OM0H 4FXKA 1DDHB 4PJEE 2HTKD 1D5IL 3OLIA 4P4KC 4BFEA 2ORBL 2Y7QA 4EI6B 3DX3A 4IBYA 4BGLA 2QPEB 3QUHA 4KTEL 5F1SA 2VLKE 3UAEA 1DJYA 2H1LM 4NIYE 3WE6B 4WV1C 2GJ6D 4QRSA 5EUOE 4HX1A 3LN5B 2EYRA 2L7UA 3MRJB 1RIHH 2HMID 2KT6A 2O5YL 3GJEA 4NQEE 3KPOB 5F9WC 1HEZB 2NR6D 2Y6SD 2WXQA 4N3TA 4AGLA 3EFDL 3WLBB 4NCC1 3AXHA 3SY6A 5BUAA 4XNZC 3W56A 2DWEB 2W38A 4PCTA 3IN2A 2YPLD 1T22B 1PDKB 3EOTH 1RUPH 5IY5B 3EDDA 4O51B 3K8KA 5AW8B 5EEWA 2V9UA 3EYUH 3UG5A 4O00A 5I74B 3FRUB 4GKZA 3L81A 5EIQA 5TQ0H 4Z7AA 2Z7UA 3QNXB 5DWPA 3MLSL 1YEGH 3UTPD 2I7OA 3NGBB 5LGJB 1RIVH 2HVKB 1XGQA 1J9QA 4JY4B 4RMRA 1G7JA 2VB5A 1M57B 1AY1L 2VLKD 4J7RA 4FX5A 1BFTA 2DB8A 3L9YA 1BGXL 2WGXA 3TNMA 3EFFA 1M7IB 1BVNT 3TVMB 4KROB 2H1XA 1DQTA 2F1BA 2O61B 4Z7WF 1N8OE 3QORC 1XIWD 1OD9A 3L3GA 4GY4A 3LRLA 2F19H 4HXBH 5C2BL 2QQKL 5AVUB 2Z91B 4BZYA 5CEYA 5AFAA 3E3QC 1A25A 1CT8B 1LO0H 1OGAA 1B0RB 1IAKA 3RGBA 1XF5A 5LVEA 4ZFZB 3O6FC 2F7QA 3MUGA 5MEOB 2FB4L 2NY4B 5LNEA 5FECB 5FO7B 1JYXA 4LIQH 1BVLB 4XNMB 4X9YA 1V7NL 5HHXH 2A7BA 1AXIB 4GMSL 2QFRA 4CVZA 2Y1AA 4ZODA 4AKPA 5GS3A 3J07A 2B8OT 2A9DA 4ZNEE 4KQ4H 4AG4L 3N5AA 2Y1ZA 3AADB 4YDVB 4DOHB 3MLPA 1PLGL 4R5VA 4DP6X 4EI5C 2C9AA 2CBOA 2I69A 5DMGC 3NQIA 1OAYH 2ITDA 3SDAA 3UMTA 1B4TA 1F8TL 1XXFC 1RJCA 3IPBA 3PHSA 5EC1B 4MNHB 4IDJL 4FQ2L 1NBVL 3QNFA 3B1UA 1F6AA 3MV9B 4Y19E 3PNWA 1DR9A 5T8IA 1T7VA 5F7UA 2H1PL 3NRFA 3GF8A 3ARDA 3L2MA 3A4EA 3B9VA 4LPTA 5ANME 2E7DA 1RUKH 3OKLA 3IDNA 1NLDH 3AC0A 1OP9A 3HFFA 3RFZA 2A74B 2AJUH 4MMZB 4QHUA 4YSEA 4FLSA 1QHPA 3ULUH 1YEWA 4P2RD 4BA0A 3GBNL 1GSMA 1Z0MA 2FWLB 2E8ZA 4X9HA 3RVXD 3GJEB 5DJ8B 3FRPB 2HT4C 3QCVL 4YVUA 4YHLH 4YSCA 4UQCA 3NMEA 5AYTA 5TGBA 3GKWL 1TQVA 4MXWH 5JO5B 2NXZB 1IGCH 3CMOL 4X7EC 5CWSB 2ZWNA 4XB8A 4CGTA 1AXSA 4MNGA 3RWFB 3DRQB 3BH9B 3PWPE 1FA4A 3R18A 5IQLA 4AVKA 1MFEH 4ANUA 4P48A 4HALA 3LEYL 2ADIB 1EO8H 5DZNA 2QKIC 4AWJC 1KB9K 5I1JL 4YHML 1WFMA 1V54B 2EAEA 3PAZA 1QFHA 1CDYA 4HJGB 3RY5A 3U2SB 4LPUA 4OLXH 4QF1B 5C6WH 2HG5B 2BSSA 3CQFA 3S88H 2P9RA 3Q2CA 2J8HA 4LVOC 1R0AL 2BLFA 3F2LA 1AP2B 3GUTB 4LU5H 4NX0A 1KEMH 1ILSA 2CJUL 4K9EC 3S8GB 1L0QA 1WA2X 5GZNC 3APNA 4S10A 2BNRE 1PJWA 3JWNH 4LGRB 1ERNA 5BO0D 3QRFM 3H2PA 4L3CA 4PEEA 3RWGA 1FZJB 3HRZC 1PYWA 4HU2A 2X3CA 1QMUA 2EIMB 2F53B 3MJWA 3ZR5A 1F11B 4FQJL 5BUGA 1PF3A 1E0OB 5TTRA 5ADPL 3F64A 1HH6B 4JZJB 2WLLB 3FBKA 2VDNH 4MQTB 4PJIA 5ECGA 3QIWB 4LCCC 5JOFB 2WXGA 5HYEA 2VUKA 3LRSB 4N26A 1Q0YH 4Z7WA 2X1WL 1QWUA 4ZFFB 4MZ3A 4HCRL 2AV7B 2Z7ZA 2OYLA 3RTLA 4E68A 4FG6C 3DGCR 4Z0XA 5FKAB 1RK0A 3FQ1A 5KWYC 1VGEH 3TT1L 4TQEH 2K45A 3SPIA 2ED9A 1ED3B 4H0HB 5DURB 4N2IA 3D07A 2AK4B 4AQOA 5B38B 4F58H 3F04A 4AEIL 3D0AA 1LQBC 1G6RH 3B7TA 5CIPH 1JNJA 4B3VA 5T3ZE 2WXOA 2ZKYA 3MJ9H 3A6BL 4FC3E 4U1LA 3TIDA 4BJLA 4OF8A 4I87A 4QLWA 2X88A 1F58H 5F3BA 1OP5H 2E0PA 5LQBL 4PG2A 2DTSA 2Q5BA 4JPQA 4L0PB 1ZE3H 3JTBA 2YEZB 2C8NA 5GSVA 1GZPB 1WA0X 4Y19A 3KPRA 3MA9H 4W9DC 4L4TE 5IJBC 4WHTB 3VD3A 1YJDL 1JCKA 3L1OL 4PRBB 3LKQB 4MA7L 3WXVH 5JR1L 2ZONA 3NJXA 1A6WL 1TMQA 1SJHA 1Y07A 2GC7C 3Q6FB 4HEME 4ACTA 3U6XA 1REIA 5BRZD 5LUMA 2I9LB 1GTFA 3B2PA 5ABAA 3ATAA 2AJZA 3CV5A 2XWXA 1YEHL 4FXTA 2CH8A 5D1XA 2J7LA 2PTUA 2DQCH 3D52A 4W6YB 4XMKL 1YJDC 3ZYOA 4P3CH 3AJ7A 1IBGH 1KJ2L 2DYPD 4X5LA 4PJBF 3L3IA 1SJXA 4ETQB 4LRIC 3U36B 3MRGB 3FSWA 4KAQL 1CFTA 4NKQB 3OKEB 2ZX6A 3T4AC 4BGDA 1KSRA 1HESA 1GGCH 4PV1C 4BUQA 1AP2A 1LK3L 4ZXBD 4Y4KA 3GM8A 1KMGA 4LCWB 2Q76B 4W70A 5IT2L 3U0TB 5FO8A 1H6EA 4JUTA 2FX8H 3KZ8A 4BK5A 3KM2A 4HKZA 3RX5A 3M6DA 4GSUA 4X2UA 2YAPA 4FQQA 5L0QC 2HJKB 2G0LA 5DYFA 3FU3A 4HFWA 1KJ3L 4PJGB 1OD7A 3S34H 1A7RH 3C60D 4HWEL 4F2MA 4BFBD 3DV6A 4G8IB 3ZTDC 1MJUL 3I6GB 3MOAH 5DUPH 4KDVA 2PCYA 1E28A 5DVPA 3D18A 5GS2H 2ZG3A 2UXGA 3MXVH 5JHAA 4YGVB 3EYOA 2FJGB 3F7PC 4P2AA 7FABL 5L8LB 2DEYX 2GITA 1CICC 3C87A 1R24B 3KDPB 1TFPA 5E6IC 3LHAA 3WJLC 1O75A 3TBVB 4G80B 3HC4H 1F42A 4HJJL 4ZX3A 2WPGA 3F7VA 1B6UA 3D1MC 3X1GA 3ROLB 5KSBE 4IS6B 3T0EB 3DJTA 4LOEA 1O9WA 1DCLA 1PKOA 2E9GA 2NY6B 1ZIBA 2W88A 1KLFA 5BW7C 1AQMA 3LPWA 5J11B 3HMXH 4FHKA 3RWIA 1TFHA 3V4PL 4DQOL 3KGSA 1F4XH 4JG9A 4NQEB 3TTSA 4YSPA 4KKCC 3FQUB 4XNXH 3LYRA 2BSTB 2IMNA 1AMXA 4PREB 5DQDH 1XF2A 3NCJH 2ATKA 4L5FL 1ZLWH 4ODHH 3CH1B 4R7XA 4OGXL 5GGTH 1E9QA 2EINB 3NCYS 2GJZA 4YXHH 4XX5A 3RG1C 4MNGE 4K5NA 2Q6WB 1X5AA 5I76B 2GTWA 5HYQB 4S1DC 3KPSB 3WN5A 2BX5A 2AKRB 3VWKD 3BUBA 3SPGA 2JKNA 4GQPH 3GZPA 5SX4I 4N25A 1B0RA 3KL0A 3GXNA 3NIFF 2EH8L 1R3HA 1OSPH 2X28A 5J1AB 2YPLB 3VFWB 1PCXA 2ZUWA 3P2BA 1N6QH 4GUOA 4CVZB 1AXSB 2JKXA 3Q13A 4MNGB 1NGZB 1NMBH 4O2CB 1FDLL 2J73A 1PAMA 5I1HH 1ZHNA 5IEKB 2WBXA 4WI3A 4K0OA 2OX5A 5CN1A 3SDAC 4I0PB 4G9DA 4ZTOH 43CAA 5C09A 4LFHD 1LE9B 4WHYH 3GSUA 3IVKB 1ZT7A 2GK2A 2VDRL 3D2TA 3NCFB 4UT6H 5CEZE 1CD1A 3GSWB 4JNXA 5I1DA 4KH2A 1S7SA 1YEEL 5L2KA 1FWXA 3O0LA 4ZUVB 4FKHA 4X7SL 4B0MM 1KCLA 3FSAA 3L8QA 2ICWA 3QUZA 1RU9H 4OCSH 2YPVH 4E41B 3HZMA 4ZD3H 5I0ZA 5ALCL 2WIIB 1OAKL 2YAMA 4M5ZL 3PJSA 4XO5A 4LVHC 4YHIA 5MHSE 5T33L 4DHLA 2V9RA 7PAZA 5A1AA 5GGVH 4TQPA 4JRYA 2R27A 2B16A 5A2CA 2C4FT 5CP3A 4JR9H 4GW4B 1HKLL 4E5XG 1N3NB 4MNQD 4WI4A 2EACA 4MB3A 5DF0A 2A9AA 3HZYA 3KPMA 1JHLH 1ZIAA 1GTNA 1U3ZA 2QPFA 5IMMB 4KZEH 3VWKA 4OUUA 3ATDA 4D8PB 1GS7A 4PBDA 4EUPH 3REVB 1NEUA 3G6AA 4JZNA 3QXVA 3BRGC 3RHWK 1J87A 3UL4A 1I8MA 4WTZA 3OMNB 1KF9B 4AH2B 4B41A 4XTRD 3BSHA 6FABH 4LCWD 3WLWC 1EHXA 4QDGA 1RUMH 2HLAA 4D7PA 4MQXD 1SY6H 4WTXA 5CU9A 5ESVB 4Q7DA 4R4FH 2VDQH 4PREA 4HK3J 5F8RC 1BX2B 4UANA 3INUL 3VTTA 3SKJH 3QSKB 2BRRH 2XOTA 1RK7A 3GMNB 2YXVA 3ZZSA 2CR3A 4JQVA 1X4YA 3X3FH 2OLDA 1BOGB 3QYCA 5I8KL 2PF6A 4YUEH 4IHBA 1ACZA 4K7PL 2ICEB 3I6KA 1T0NB 3N06B 3VGEA 1AD9A 4P2RB 4P2QA 1AI1L 2C3HA 5DHXB 3VI3B 3MNDA 2NY2C 2NW2B 4H1LB 3WN5B 2ERJC 3QDAA 4G43B 4U6XB 2EQDA 1UA3A 1WAEA 3TBCA 1S7WB 5HHPA 3ARZA 3L9BA 4I3GA 1MVUA 4LQFL 5IB3B 1A7NH 1UZ6E 2DW5A 2NTFB 2VDOL 2L3BA 3DTUB 3SO5A 5DZVA 3CVHH 2FWOB 4X6FB 1RVFL 4JFWA 4XAKD 4X4YA 1YEIH 2YXFA 4YDKH 3MROA 1E5UI 5BXFB 3HMWH 4GIOA 4Z77B 1JZ7A 1CQKA 3L5JA 3NVQA 1G9HA 1Y18B 2X2HA 5FS5A 3WFDH 1MNUH 3CSYB 4CVWA 2A77L 1NCBL 1MKFA 1WWCA 2EE6A 3GSOA 4PJ9A 4NKOB 1DVQA 1LEKB 25C8H 3F12A 4OQTL 2JF1A 2CO4A 4FFZL 4AV5A 4PJ5B 1M42A 1ED3A 1TZGL 2BZCA 4RCAA 2BVPA 3RUGA 1MY7A 4I88A 3SGKC 3VFGL 1U93A 3ARSA 1G94A 3JVGA 4XNYH 5CFAA 2VDPH 1WS8A 4APQA 5CLYA 4QHNB 5CSBA 2D03L 4OF0A 4KKAD 4XN4A 2VITA 4NUGL 1EZVY 5B1CA 3MI6A 2CPCA 1V3JA 5F44A 4K07A 2GIYA 4HXAL 3RL2A 1NL0L 4XPFL 1EDYA 4G8GD 1E7VA 4OCNC 3KPMB 3ZTNH 5B4MD 3ARRA 4ZQTA 2CLZA 3BE1H 3QXTA 4Y16A 5KVEL 3B9KC 2ZKHL 2XNAA 2HFGH 1TO4A 1BVOA 1OCZB 3BWSA 5DLML 1CI5A 1ASPA 2QPSA 5J4MA 1UXWB 4NWUL 3VFNA 1JFHA 1P4LB 1K72A 2DQFB 1L6ZA 1JMXA 5ES4B 5C0BB 3C5JB 4G80A 5DD6B 3I3EA 1OSEA 2UZXA 3MN8A 3QG7H 3SDCC 2B4CL 3UC2A 5M7QA 1YMME 3JZYA 5IFJB 1OANA 1UH3A 1J0HA 2OKMA 3GMOB 3RE0A 2JB5L 5IBUG 1NIBA 4KPHH 3UERA 5F9OH 2QHLA 1IM3B 4AM0Q 2BNUB 3QARA 3ZDYB 1AGCA 2CKBA 4QTHB 1A9EA 1BZ7A 2PW2B 2YLHA 1BAWA 3LHPL 3M1BB 3VM5A 3NA4A 3CH1A 1VKXA 1R9FA 4A6YL 1S7WA 5HHPB 3CUPA 3V9EA 1PG7H 3WNPA 1MG2C 2B4CC 3EOBA 1A3RH 4R7NB 3L7EB 3K2KA 5EEVA 1XH2A 1FAIL 5GZOD 3X1EA 1I8KA 2YQGA 4YDJA 2CWRA 3AAZB 1BECA 4B5ZA 1J9TA 5I8CB 5TDOA 3UABA 5C3IA 5IB4B 2I5YH 4UM8B 4QY8B 2J88L 1A1OA 3IFOA 2XFXB 3N43B 4PI2A 2GKIA 3MLUL 3PWPD 2WLNA 3AVEA 1QNIA 1AZCA 3VCLB 2CXGA 5H37G 4WNSA 3L4VA 1J86A 1PY9A 5C0JA 1KCUL 1WICA 3C09C 4GW5B 1GC1H 3IXTA 3UBXG 3V95A 1QI3A 4N1HB 1TQUA 1IGIL 4CC4C 3B8SA 3PS6A 4F7CB 1YEJL 3ME0B 4DFHA 1G5GA 3QH3A 1ZXQA 5FWQA 4DVBB 1CDUA 1DE4A 4L48A 4JPVH 1CVSC 1EVTC 3EOAA 4AQ8A 1WEJH 2HPOA 4MJIE 2EP6A 2IXQA 4L4VB 3VWKC 2P44B 4YDLB 3QAZB 4UAOC 3B9KA 2CRZA 1A7QH 2G2RA 2IANE 2BHYA 1NBQA 3S2AA 1BD2A 4BDVA 2ZWZA 4RMWA 1WA1X 5I66A 2QGDA 5DJ2A 5FGBC 3P4NB 5AB2A 5FYKE 1JK8B 2UX7A 4HS6B 4F3FB 2DMKA 5KBNC 1INQB 1L9NA 5BQDA 5JXAL 3E6HA 5LGYA 4ODTL 1HU8A 5FB8A 3SBWA 5D7LB 5F1IB 1G7QA 1UWEH 2DZEA 3ZE2B 1GRWA 5IMMA 5J6GA 1NDGA 1Y6KR 4UQAA 4P4KB 4F33A 1OP3K 5AVRB 3HAEG 1IAKB 2WJ5A 4ZTEA 3BOVA 1BBDH 1OAXL 2M8XA 3CVHA 5HHMD 5C0GA 1JHTA 3G6AB 1WD9A 3RQ3A 3QUYC 4KUCF 2FJFA 5E6IB 5EBWB 1MF2H 4Q9RL 1ZLSH 2BRQA 2J43A 5FGBA 3VWJB 1L9OA 3BH4A 3V2AR 1YNTA 1CE1H 2X4PA 1A3LL 3MJ6A 3R8QA 1DQLL 5KYNA 2BJMH 4MYPA 1AZNA 5DDHA 4CC1A 3KXFD 3EBHA 3GMPB 4N3UA 4YAQB 3QRLA 2AJVL 4FJYA 2WXRA 1HCYA 3FO1B 3GT6A 4OCYH 5T3XE 3OR7A 2Y2WA 3RDTB 1YEKL 4BHUA 3GBDA 2HH0H 3OMAB 1HYSD 1GR7A 1L3NA 3O6MH 1MLCB 3ARFC 3C8DA 4L8DA 1CDHA 1N2RB 5I6PA 3ZKMC 5DFTA 3QISA 1JP5A 3HG3A 1KIRA 1YN7B 3FUHA 4RX4A 5DT1H 3H2QA 2B39A 4DVRL 4YHZL 5JZ7D 2EZ0C 1RZKC 2X4OA 4G9FD 5FO7A 2WYTA 5DD0L 4K23H 1F4YL 3QO1B 3RTQB 4JANA 5CZXD 3LD8B 2KZWA 3LNHA 5HP5A 4E9QA 1C1EH 2NYKA 4QTIL 3GRBA 2ENPA 3JVGC 5HGDB 1SPDA 2QSVA 2UWEE 4OFIA 1ZJBA 1DQJB 5D2LB 3V0VA 4PTTA 3T0VA 2GCYA 1M71A 2OS7A 5C70A 4UIMA 4YO0A 1CZ8L 3FCGA 3CHQA 3C12A 1AS7A 4XN7A 4PJ6A 1FC2D 2R0LL 3QGVA 5C6TH 1NAML 1TEGA 4R5XA 5I19H 2ZX7A 1DVZA 5HDOA 4W9LC 1UXSB 2HJFA 1H9VA 3FHQA 3LCYA 5DFVD 2A6JB 1RP9A 3PFUA 4TOYH 1ACCA 1QWHA 2ZCLL 3IGAB 3Q8AA 4HKXB 4J3BA 3LXAA 1Q90A 3T8VA 3V4PH 4TQIA 2IDCA 5ITBL 5AW0B 2XN2A 2Q0ZX 3CXDH 4RGOL 1QKZH 3FFCD 2BWDA 2VLKB 3QFGA 5AVVB 3P4OB 4ELMB 3FH7A 5HHOA 1U8QA 2ZCHL 1AQKH 2IV9A 4KI5D 1Q0EA 2IQ9L 4XP4H 5K9JH 5IQMA 1PIGA 1CK0L 5KBDA 1DBKH 1N70A 2PCXA 4LT7A 3BVDB 2B1AH 5IVZB 3VTAA 1RZFL 1YO4A 4AENA 3VH8A 4XBGB 4KBPA 3CCHA 4A2MA 1NPUA 3U6RA 3KGTA 4P2RE 3CLEH 3KBPA 5H37A 1AG0A 2JNZA 5GPRA 2FJUB 3T65A 1ZVNA 3BH9A 4C56D 4NDMB 1J18A 1XR9A 1JVKA 4XE5B 3AB0B 1H19A 1IFHL 3OXSA 2V2XB 1EV2E 4FQHA 1G84A 4PGBB 2W9EL 2KERA 5I1AB 1EK3A 3GC3A 3MLYH 5F1OB 4TTDC 3JT0A 5BV7B 5EOTB 3DDGA 3N1QC 3UZQA 4ZMPA 4PBWD 1MAML 4QKTA 3CZUB 3G6DL 4W4OA 1M05B 4JN2A 5AW7B 4Z76A 1B0IA 3FT2B 4DKAA 5ABDE 1R3LA 3HHSB 5I1HL 1QI5A 4N2FA 4JJOA 3JWNC 1K8DA 2VUOA 2F1EA 3KLAB 4J1UB 1QRNB 1TCMA 2BP5M 1WFNA 5K9QI 3QCTL 5AVTB 2WXMA 2XN9D 4XN8A 2SEBA 1DO5A 5TK4A 3U4KA 3UTSE 4P04A 3EJCA 5FFOA 2JKWA 3MGOB 4MRBA 1CDJA 4U1LB 2XI9A 4HIXL 6TAAA 2EH7L 1DLFH 2K8QA 4H2CA 3TWYA 1P84J 4M5ZH 3GZQA 4E9RA 3VXMD 3E9TA 3TPUB 1WISA 1IKFH 5E2VL 5A3IC 1BF8A 4AQEB 4QRQB 4UT9A 4PLJD 3VXOA 1W72B 5HYJD 2H8PA 3RUGB 4TM9A 3UJIH 5IV2B 5DJDB 3SPHA 5CJOH 3T3ME 2Z0BA 2LGNA 3VMPA 1CD0A 3QEUA 5I1IL 5KG9B 5KZCD 4U49A 1I9JH 4PJ8B 5F7WC 3NCYP 3V6FA 2WVVA 3CIQA 4RMTA 4XPBL 2UZXB 3ARBC 4M48L 1FRGH 5C0ND 4TQ8A 1ZEAH 4LLVA 2JJWA 2YD4A 2EIDA 2QQNL 3P69A 4A2FA 4AC2A 4XBEH 3NCCB 4P2QD 5H2BA 5EEZA 3SDDC 1A0QL 1AJ7L 1CU4H 4JDVA 3RPKA 4AVIA 4KK5D 1TETH 3GZOA 4WW2F 4L4VA 1HZLA 3EJJX 2APWA 4L4TB 3ZKNC 1JBJA 4FFWD 2EEDA 3HG0A 5EZIH 4D0DA 3HI5L 4MCZA 4PQXA 4BFNA 2AQSA 1YPZE 5KYXA 3FQRB 4PP1D 2UY6A 4XMZA 5ICYB 1OCRB 3LXBA 4XZUA 1Q1PA 4WHTA 1JJUA 4GRWH 1H8NA 2GSGA 5D8JH 2PPEA 2IWFA 4TVPL 4FA7B 1ZA6A 2YRZA 4JVPA 5CJQL 1JRHI 1IBBA 4X6EB 4ISVB 1F2QA 4NQVA 3CGTA 1MRFL 5E2UH 1P5UB 4BA8A 1NCWH 3FPXA 4B27A 3PREA 3ARDC 3GIVA 1G7QB 3BKJL 4FN0A 1OP3H 5KVFL 3KPQA 1BD2D 1R3JA 2PW1B 3ZJAA 1E6JH 3TBBA 1YPZB 1RERA 4KKBD 3VFVA 4A7VA 2KC0A 4JPKH 4Z3HA 4OZIF 4KX9A 5ETUB 1C5CH 1ZCRA 4R0LB 3MNVB 1XIWB 1MWAB 3RVVD 4EAEA 3CN2A 1BQHA 3VYOA 3Q7JA 1RULL 1WQVT 1VADA 1CG9B 2AJYH 4Y5VA 1FG2A 2BVQB 3I85A 2MCMA 1UVQA 1P9MC 3HVDA 5DEFA 2VN7A 4RZCB 1SN5A 2BIMA 3AS1A 4F37F 3ETBJ 3VX1A 2WW8A 1R3KA 1TZGH 3BESR 1UACH 2CIKB 4FQLH 4TF4A 4WUUA 3SBWC 5E24E 2CCVA 4OCLC 2E7LA 4WFED 4GUCA 1XF2B 4IOFC 5IVXF 5E5LA 1FIGH 3SEPA 2XY1A 3D69B 1AZZC 3WIHL 1HQRA 1NIEA 4O2EA 4EEEA 1WYJA 1JK8A 1GY2A 4I13B 1JXKA 1XSKA 4N6RA 1ZGLM 2JVUA 2FJGA 1VZGA 4OKDA 3HAEH 3BP7B 2EO1A 3RI5F 1L9TA 4QRSB 5F0MB 4KXZI 3WFHB 1JPFA 3KPPA 4MHHG 1NGXA 1CFQB 4OF7A 1Z3RA 1TJHH 3HG1B 4B96A 1CXEA 2OAAA 5A2BA 3RWFA 3OXRA 1NUGA 5CBAB 2RA1A 4GQ9H 5BVPH 2KZ1B 5C0FA 4PRPB 1SJVA 5EBWA 4Q89A 3BUYB 3MRMB 1H0DA 4LDCA 3BT2L 4A2LA 4DEPB 4N8CL 3P9LA 2AP2A 3BMWA 5JDJA 2GTZB 3ABLB 3FU9A 1E4XH 3D9AL 3BVWA 2LE9A 2NY7H 1M2VB 2GIMA 4XMLL 2CR0A 3VDAA 5A40E 1MCFA 2X4SB 2O5XH 5LHDA 4NGHL 3LRHA 4ZFGL 2NXZC 4FAAB 1WFUA 2DQIH 5BV7L 1CB4A 2HJLB 3FT1A 4LP8A 2GBTA 4XP6H 3FUKA 5DD3H 4ZS7L 1A6VL 3MLRH 3U9PL 1JDAA 5J89A 1LK2B 5I6NA 2EDWA 3G5YA 4F2EA 4JKPL 3TXAA 1FZJA 2IAND 3ORJA 4IRJD 2ENQA 4MD4A 4U4IA 3CZGA 3QDHA 1UJ3A 1W8OA 1GGTA 3L5WB 4LSRH 4JZJC 1YPZA 3VFVB 4XRCB 4PJHE 1E9PA 3T3PE 3S35H 1ETB1 4OSUL 4KU1A 4WO4B 1NAMA 5D93B 1JSYA 3MRLA 4M1CC 2ZG1A 3E1F1 3Q2VA 4GP4B 4KO5A 4KRNA 5C09B 1EEYB 3MV7A 3TBSB 3BKCH 1LE9A 4CSTA 3QUML 5I30L 1GGYA 3DYOA 1SUHA 2AABH 3DURA 1FG2B 3SYPA 3GSWA 1YCSA 2DMBA 4X80L 3WHE0 4AV0A 5K9OA 3HNTL 1O0VA 2QPUA 4PU2A 1IGMH 1AQDB 3LX9A 4UQDA 4Y9BA 1KCBA 4XGZB 5JHLA 2EVHA 1GC1L 4ZSOA 3RGVA 4B97A 2ODHA 4Y1AA 1I3GH 3MNWA 4HZAA 1R1CA 1KV7A 4EN3B 1LE5A 3ZOAA 3M86A 1B2WL 4AGQA 2ENSA 3JZ7A 4JFSA 3BW9A 3Q2NA 1EHKB 1QFWI 2KDYA 2XG5B 4OR1A 3FB5A 3L5HA 5EU3B 3X3GL 1G7IB 3RTQD 2VR5A 3CN1A 3BPLC 3ESPA 4UOW1 4M43H 2F7IA 1JUFA 3BFQG 3A47A 4YE4L 2X6BA 5CZKA 3TPUA 3UTTE 2IAMA 3JV4A 1BV8A 2X9YA 4PJ7A 3ERXA 4FQXD 4L8SB 4HPYL 3CG8A 2W9DL 3JWOL 3HC3H 1W72H 3MRMA 2XZAL 2CBQA 4Z7UB 3O3BB 4GG6F 2GJPA 1UUSA 2BIHA 2XXFA 1DBBH 4LKCA 3EF7A 3QFJA 1TSRA 3CQPA 1N8ZA 3HIZA 2A5UA 4BFIA 3L4UA 1QFWH 1P2CB 2IADA 2W59A 3AU0A 4N8VB 1LO5A 5DJCA 3GSOB 4PJ9B 2AV1A 1C08A 5A7EA 1TYRA 2GTQA 4PRIA 1EMTL 2EDKA 1JPSH 2FD6H 2NY3B 2XVLA 4XPHL 2Q87A 3WKQA 2PLTA 5AYUL 2WMPA 2XWCA 4R5TA 3AREC 4MBRA 4RISL 3SZ6A 1QPXA 4LEOB 4TN9A 1F13A 1YLBB 5IQ7L 1CLVA 3FB7A 2WWKT 1LJMA 1HNGA 2NTFA 4QHMB 5KSVA 3NA9H 1P6FA 1SXAA 3BFOA 4UIKH 3VSTA 3MROB 4FD0A 3SDCD 3V6OC 4JFFE 4LSUH 5EUKA 3IJEB 1I9RL 1CFMA 1LM8V 5FW7A 4GB9A 5CGYC 5D96B 3QQ3B 1K5WA 3A4DA 3U30C 1THAA 5BZWA 2R0WH 1U3HA 3AT9A 1CICB 5AVSB 4DN4H 3OPUA 5LNDA 3AU1A 4TLSA 1SEQL 3WGUB 2C26A 4WIQA 1RXLA 3F12B 5FGRA 1RD6A 4IM8A 2HRGA 2R4RH 4ORGB 1G43A 4U1IA 3KYKH 4AL8H 2UWEF 3PHAA 3BSZL 3V6FB 1FGVL 1WGVA 3V9CA 5DS8A 1X9LA 3M17B 4WRLA 1RK0B 4KK8D 2KPWA 1BZEA 1CZ8H 3V0AC 4AUYA 5C97A 4TULL 4MD5B 1U8PB 5I1EH 1PZAA 2OJ1A 5D7IF 2R0LH 3MLTA 5C6TL 2BP8B 2FVNA 2R69A 2ZUQC 3KLDA 2EDLA 4WFHD 4DGVL 4OQTA 5DC4B 3NK3A 3F05A 3IMRA 4AJYV 3WNMA 2IWKA 3O4OB 2KLTA 5I74C 1DJWA 3UDWC 3NTCL 5KUKA 3GI8H 5ID1B 1E4XI 1AGCB 1YMHA 5HYSB 1OHQA 2V2WA 1YQVH 4KZ0A 1HQRB 2HTLD 1EFQA 1HOEA 1U92B 3FB6B 3ILQC 1JNHA 4QRRE 2FZ3A 4JFDD 3ZDZE 3FT4A 1EO7A 4GKOA 1M9SA 1O6TA 3FK3A 5HPOA 4KX8A 2EYRB 2OZ4A 1D9KA 4NEHB 4WU7B 4LMQI 5I15H 5ID0B 2XU9A 4HBQA 3GRWH 1FLRH 1WH0A 3JXAA 2G75B 3ILQD 4IBLT 2X4QA 3DGGA 4TKWA 5FEBA 3DK2A 3TZVA 4FLQA 1L7TL 2YK1H 1G7HA 3BZ5A 4ODXA 2CKNA 4UQ9A 1ZHNB 1J88A 3QQ4B 5D6DC 4KRPB 1SRDA 3N91A 4UUJA 3RVXC 1NAKH 2NOYA 3HE7B 1XTMA 1BQHB 3H54A 1N18A 5K93A 4OJFH 4TSAL 4PR5B 1IM3A 2E27H 1CT8A 4NWTH 1JGUH 1N7ML 2X3AA 2Y5TB 3MA7B 4H13C 4HUUB 4JPIA 3HFMH 2R2BA 3LPGA 3UEQA 3UPAA 4AXWB 3LTVA 5FCUH 3M7OA 4FI7A 3KCPB 2M1KA 5BJTB 3EHBB 2MKLC 3MX0A 4PJ5D 1UWFA 4R7LA 3O3DA 1FZKA 1T1WB 2EVJA 3FUNA 5KS9E 3HJ0A 3QXUA 1OB1A 4ZI8A 2LU7A 2C9VA 2PPDA 1AZUA 1I1FB 2W92A 1I9IL 4R7NA 1MHEB 4FNQA 4PJBA 4I2XB 3WFCH 3MCYA 3K6FA 4P5TC 3ULUL 4PCKA 4QXUH 4UZUA 2YOAA 5JDSB 1FG9C 4Y2OA 1P7KA 4NI3A 4HGWA 3WY2A 4XPAL 1EJ8A 4O2EB 3SYQA 4I3SH 3GS4A 2AI0L 2JELL 1DP0A 4EKJA 5BRQA 2V7NB 2IALA 3WTUA 4XTRC 43C9A 1OAZL 2DEXX 2E46A 4IU2A 3QQ9D 4AYGA 4XP9L 1NCAL 3B2UD 5I82A 3RGHA 4XWGL 4RWHA 2DQEH 1FJ1A 1ZHKB 1Z3GH 2XZCL 1F1AA 1DSYA 1S2EA 1CCZA 3ZDXB 3ZHDA 5JMOC 1BYNA 2VRQA 1KG0B 1N4XH 3EBGA 4WI9A 4OIBA 1IVLA 1KYDA 3MRDB 2COQA 5DMIH 5CJOL 3INOA 3BPCA 5FIEA 2CRYA 3QH3B 4PJ9C 2DN7A 3U1SH 4JB9L 4GW1B 1AO7B 4NHUA 1LTXA 2Z31A 3CFBB 3O41A 5CD5D 1GOGA 2IBBA 5F9WB 3L08A 4BUHA 1JD9A 4BFJA 2WTRA 2P7TA 5DRZB 1LMIA 3BDYH 2BM3A 4UB0H 4NZUH 2R1WB 5E4OA 4B9FA 3CX5K 2AMUA 3GXPA 4X50A 1J05B 3L2NA 1TQWA 1O6SB 2G3XA 4XI5D 1TNMA 2NZ1A 2AK4D 3TCLA 3DHUA 1SFDA 2CIIA 2Y4SA 3FAXA 2NUTB 3VSVA 1M1XA 1WVZA 1WZKA 1UKQA 2BSSB 4DUXA 1ES0A 1UASA 4V1DB 1TZIB 1INEL 5F93C 2AANA 4GH7B 1MFAL 5JW4M 3ZRFC 2WNKA 3BWAA 5T3ZL 1D3CA 4L3EA 3H7BA 1ADWA 1EGJA 4PGDB 3ARGD 1IKNA 1ZSDA 4NENB 5FM5O 1T2XA 2HVBA 4XT1C 3APFA 4KMTH 2RR3A 3FB8A 2K8MA 3QIBA 4F24A 1KCSH 2X4PB 2A4CA 4GI6A 2WQXA 4O58H 1LP9B 2H9GA 1HT6A 2EKSA 2HRPL 3DURB 4DW2H 3A22A 3VFUA 3W2DH 1PYWB 1YYMH 3KPRD 5ELIA 1SF3A 3GSUB 1J5OL 5LXVA 1FV1A 4HIJB 4M7LL 5MERB 3WJMB 2X4RB 2JCCB 2Y3AA 5ACZA 1GHFH 4NP4H 3CVIL 1JNLL 3TV8A 5HD8D 3OB0K 1ZHBA 2AGJH 3LMJL 5KN5B 4NUJA 4HBCL 3V4LA 1CYXA 4HZLA 1A6ZB 4BZ1A 1HHHA 2H3KA 3MLXL 3OZLA 1N2RA 5C08B 5GGSY 3G5VB 3FF8A 1ZVSA 4HZ1A 3FZUC 4WO4C 2FQEA 2XG5A 3IYLW 1BZOA 1CUOA 4Z0XB 5T5FH 4EDXA 2X53A 3HG4A 2CDFB 1BAGA 2V8LA 3Q8BA 1P1ZB 1FPTH 5K1NA 1S6NA 3IRPX 3UTOA 3ESNA 4LCVA 3O9WB 5I9QC 4A1RA 1YY9C 3EAKA 3HAEA 3PP3K 3PWJA 1IT9L 4HC1L 4M1DL 3WS6C 4KO9A 1GYAA 5E6YA 1FI8C 1MFUA 2OCFD 1JXGA 2V17L 4XMTA 5GGTA 1ID5I 3NN8B 4EI0A 5HPMB 1M71B 3QIUB 4LF3B 4W9JC 3VXUE 1PX4A 4ZUUA 3F7YA 3D0LB 4FTVB 4Y4KC 4ANVA 1SVCP 1U95A 3TN0A 1FBIL 2F7OA 4M7ZB 2VR6A 1NCDL 4JFZL 1RK1A 2OTUB 4HIEB 1JXDA 4ZW7A 1PZUB 3H0TA 4XVSH 2F7PA 1XCTA 2ZOKA 1T22A 4BFFA 4JCWA 3EYQD 1TDQA 4PCSA 4AJVA 4FABL 5B39B 3D8MA 1V5JA 3NSJA 1BFOA 1HOCB 2UZYB 4F7EA 2EDEA 2FIKB 2A9BA 2ZTBA 3NPSC 4Z76B 3BAIA 5HVWA 3VXPA 4MXQC 4GOSA 4JHAL 2CG9X 1UD5A 4HWBH 4HHWA 2ODIA 2HT3D 3L54A 4HGMA 5FUZL 2L04A 1I7UB 5C7XH 5ACMA 2CDGA 4FG2A 2EUVA 1MN4A 3G6JB 3KL5A 3LS4H 1L0XA 1HHGA 2EXWC 4RA0C 1Y1DA 1Q72H 1RIUL 3CFJA 3MU3A 5ERWB 1UXMA 4LASL 4DKFH 2MEJB 4FQXB 3SIKA 4XHJD 5FYKU 2PYFB 3BP5A 5D1ZB 3UXFA 2JQAA 3EHBD 8CGTA 5F9AC 3L3KA 3GI9L 3QULA 3LQAH 4NJAL 2V5TA 2Q76A 3MLVL 1T83A 4JQIL 4ZPVB 4GXVH 4WUKL 1ZT1B 2ZXDA 3D18B 5IVXA 2AZAA 1FZOA 1OEZW 2VMCA 2LVEA 1H5BB 4FF9A 4LL4A 5GJSH 3VCLA 4Y4FA 4U6YB 3ZIMA 5KAQF 1FORL 5E4EC 5ITFB 4F2MB 2J55A 4GW5A 1JZGA 3E6FB 5AKVA 5LXGL 1BXVA 2WQRA 1NOAA 4I1NB 4XMPL 3GO1L 3GSQB 1GL4B 3DMMA 3FQNB 3ZGIA 3AS0A 2VXTL 5L6YL 3L17A 2E9IA 2Z8WC 4DGIH 2XDHA 2D7MA 4NRXB 1JF6A 4YDLC 1Z9NA 3TURA 3C6SB 3H9HA 5CP7A 5DK0B 5E0FA 3NIFE 1F6LL 1XSOA 3B83A 3ILEA 4QRRD 4YZFE 4AZUA 3HNVH 15C8H 1OGTB 3LKRA 4R90L 1T03H 1DZ0A 5ALBL 4KOBA 2DQTL 4U2YA 1T0MB 4J4PC 4IBUA 2EYSA 1WHPA 3DYMA 2LAAA 2B0SH 4MMYB 4LLWA 2UWEB 1J9RA 5F6IB 1L9QA 5KYXB 1A02N 2G0KA 5AVXB 3TFKC 1QFUL 4MD0B 2PUQT 2AK1L 4M43L 4I5BA 3FFDB 4LOUD 3NABH 4PJXE 5M95B 1JZIA 4UCFA 1Q94A 3QUZD 2VTFA 4Y0GA 2WWOA 4L37A 3AITA 1JOIA 1NZRA 3VFRB 4BRJA 3BRDA 2IGTA 5L9DL 4QWWD 5H37H 5EIVA 8PAZA 4DO6A 2DI7A 2Z31C 4J3OH 4GFTB 1CD8A 2YD8A 1V7ML 5I0YA 4OF6A 3ZX1A 2AKRA 1T21B 3SZKC 1A1NA 3EFDH 4PJAE 4QRFA 3ZKQD 5C09D 4S11A 4IKLA 4KO6A 2XACC 4M1GH 2DQUH 1KB5L 4N2HA 1QLEL 1S9YA 2YD0A 3OAYK 2P5PA 2CDEA 2GJZB 3EYUL 1BZ9B 3TO4A 1QLRA 3U46A 3AABA 4WGVB 1P84K 1FNAA 4XZUB 1CMOA 1XGRA 3NT0A 4LCIL 4P2OD 5T3XL 3WKMH 5EZLB 4PJBB 4NAJA 1U8KB 4NPYB 2D4DA 2ZF9A 4Y5YA 2MCPH 3LN9A 2DJ4A 2YRLA 4KJQC 3NSCA 2WWNA 1HHIB 2JQZA 5HHME 4OCRH 1OGAB 4LVHB 1TTGA 4CN1A 2E7MA 1OV8A 4G7YH 3I3DA 1UOVA 2IC2A 4OD2A 3ZMRA 1T7XA 4XB7A 5TK2A 2BOBB 3HZMB 1SJMA 1H3TA 3QIWA 4ZUSB 1XBRA 3KJ4C 5E7BA 4JL2A 3DSNB 3PQYE 4PJBE 2X6VA 5HHQB 1FJ1B 5C9JB 2FB4H 4L2YA 3V6ZB 3IJSB 4JZOA 1KIUA 4XCEB 4AY0A 1U8JA 4A2HA 1CJYA 3QJZA 1E8ZA 1V7NH 4NXSA 2J20A 1N26A 3BZ4A 3IXTB 4JMNA 1QBBA 4MDRA 4L1HA 4X4XB 2CUMA 4M4PA 1QR1B 12E8L 2Z31D 3BUYA 2OPCA 4UBDD 2C9QA 5CP7B 3X3FL 3IETA 1BQLL 3C2SA 2WLIA 2X1QA 1MDAA 3TCXA 3AG1B 1W0WB 5IFAH 4HH9A 5IQNA 5T5NG 2EE9A 3VXUA 3B9KB 2EEFA 1DFXA 3B7SA 1HINL 2OMUA 3MGTB 3D0VA 5D70L 1J1PH 1EXGA 4BQ9A 4NN6B 1BOGA 3BSZA 2L4OA 1HHJB 1UWYA 1B90A 2BWQA 2WB1A 2H1PH 4FQXC 3JTSA 4WFFE 1MRCL 2AFNA 4FOMA 2CSPA 1TQCB 2CO7B 2HKFL 5B8CB 4Y2DB 1BMGA 3MRNA 1FFTB 5HY9B 1P7QD 3WY1A 4KZDH 4XN2A 3QHFL 4AIEA 3S5ZA 3RIFF 2VNCA 3OMZA 5TGBB 3OHXB 1EBPA 5T1KA 1JHKL 1HWWA 3FCUB 1IGJB 1MNNA 2VC2B 4JUSA 5BXFA 2VT0A 4I18C 4XCCH 5ESVA 3EYSL 5AVQB 5MEPB 1ILUA 1QSFB 1R5IA 3SKNA 4HKBB 1QO3B 2YBRA 2CHWA 5KYUA 3QDGB 1FNGA 2DRUA 4L3EE 3V9FA 1DN0B 4XNYL 4Q52A 4HYTB 4TNWK 4GUQA 4G6AD 2FTAA 4PM1A 5DI8A 3L7FB 1NFDE 1NCHA 1PNCA 3EH2A 4F27A 3LRMA 2BFVL 4K3DL 2NY1B 4OZIB 3RUGF 5JQHC 3QZOA 3ECBA 4N5ED 5TE6H 3O6LH 5CSGA 3RDJA 3MV7D 2IFGA 3AY4A 4F9PC 1E90A 3GWJA 3O2DL 1NCIA 5SWQB 4LO9A 2HN7B 3GSVA 3BVVA 5F71A 1CFVH 1HK6A 2LR4A 1KDJA 2LFGA 4QF1A 4PAZA 3IMTA 4FQ1L 1OTUC 5DJYB 1NH6A 4L9LA 1DVFB 1HSBB 2CJUH 3O6FA 1VFOA 3KPNB 3BH8B 4YHPB 4I3SL 5E1HB 3MNZB 4PVNA 3HBZA 1OPOA 2YD2A 3BPLB 4PJCF 4RFOH 3QULB 3NSDA 4XVOA 1V10A 3GSNA 3MLWH 2EKJA 1FH5H 3D0LA 1HE8A 5FFGA 1U95B 1E4JA 2WO2B 2P5WD 4P4RA 2ITCB 2X2UA 4HUWA 3UTZA 2UUDH 3FNKA 4W1TA 2GSIB 3A21A 2Z4TA 3UGXA 3OG6B 1OF2B 3ROLA 4M5YH 2BSCA 1NEZA 3RZWA 4JFFD 4F8PA 4LCYA 3C5JA 3RFRA 1OTSD 1KCKA 4KK8C 2O5ZL 2K78A 3MRHB 1N4XL 4FTVE 4TQHA 5DWUH 4PGCB 3TA4D 3HE6D 1EJFA 4HH9B 3TYGL 4G6FB 4CL7A 4UV7H 5JPNC 3QPXL 1FFPA 1MEXL 4MX7A 2DYSB 4A6YH 5J0BA 4BQ6A 1JWUB 3DVFA 5EOCL 3UEZA 3EXJA 4PJXA 1YECH 2CHNA 1WUZA 4XHQA 4F58L 1NCJA 4F5CE 3WFEL 5K1VA 1DQQA 3SQOH 4UINH 3FQ2A 4GBXA 4JQXC 4ZSOE 1H3GA 3GMQB 4FZ8H 2VXQH 4NNXB 5D7JB 5E7FA 1ND0A 5IFJA 1MCOL 1KGCD 1NFIA 2ESVD 2VIRA 4WK2B 3MJ8A 3QORA 1OE2A 1KB5B 3RIFK 5AG9A 1NFAA 4WU5B 4DNLA 3MOBH 1K85A 4OVUA 5F3BB 3STLB 2R29L 2R56L 3WHXA 1OARL 3ARWA 1KEML 3EGDA 1ZTXL 3PWLA 5JUEL 3BN9C 4HK0A 4JG1L 2AQQA 7PCYA 3G6JE 3HRZB 4HIIA 5KEZA 4HPOH 4X6BB 1C5DA 3QRGL 1QSFA 3DX6B 4BH7A 3HI6L 1U2YA 3IDYB 5IB4A 1A6WH 4EUPB 1L9PA 2VM9A 4Y4FB 5D1XB 2DL2A 3FO2A 2R1YB 5K1JA 5JPNB 1KWGA 3Q9PA 3K71A 3QT2A 2XV3A 5J3HC 3AROA 3MCLL 2YA0A 2NRDA 1IFGA 1ZDQA 1KPRB 3MVSA 2VL5A 4K55A 1DJZA 3S6CA 3AM8C 3HHSA 1YYML 4G59C 1DBMH 1MCPL 1S7RA 3NPZB 1S9YB 1WLHA 4X7TA 5EU7C 1PL3A 5J57B 5JIDA 3KVQA 4HIHB 4LPWA 5GSRA 4MD5A 3H9HB 5DK0A 5G5DB 3FB7B 1UFUA 2K7QA 1A64A 3EOYG 5CD3A 4AUJA 1EZSA 2W0KA 1SOKA 1MAKA 2RFXA 1YNKH 4N22A 1HZHL 2I7SA 4KXBA 3C6LD 4GSDH 4PRIE 4XVUC 4Q2ZA 3D69A 1A4AA 3IDUA 3MV01 4RGMB 4JN1H 2H3NB 2MRYA 1HL9A 4F80A 3VDBA 3D50A 1BPVA 4GW4A 3O2DA 1MAJA 4OTXL 1FZMB 1MFBH 3BLBA 4GIPD 3Q1SL 4I5BB 5I1KL 4HWEH 4K3EL 3SDXF 1I1YB 1SDDA 4LE8A 1KYAA 1T89A 2CO6B 3VFPA 3OAWA 2OSYA 5LQBH 5J3HD 2BP0A 2UZPA 4MA8L 5JTWA 2P28B 1F3JA 2G2NA 1IQDA 1JPTH 1AKJA 2ZJSL 4XCEA 1U41A 4Z8FH 2DQJH 1ZY9A 5EZJB 3TV3H 3OB0H 2PPAA 5D5MA 5KS9F 5ICZB 1T1ZA 5DRXA 4BZ2H 3QUGA 2ZUYA 1UJTA 1GJUA 1YYLL 4GG8A 5AKTA 3A24A 2WY3B 1A7OH 2KQMA 4O2FB 2XTLA 2ORBH 1LWJA 3WSQH 4AITA 3GXDA 4P5TB 1PD0A 1NMCC 3PHOA 2VC2L 4G8FA 2PTTA 3HMXL 4FCAA 3MRKA 1FN4B 4S1RL 2DQCL 5SWZA 3IMBA 1FP5A 3P2TA 1DQMH 3N55A 4JHVA 2X05A 1T66D 4Y5YC 4JO5A 1U9KA 5D71L 4F1SA 5EZLA 3SODB 4JHUA 4WY7H 3V6BR 3KYNA 1QSFD 3A67L 3GIZH 4JL1A 3SCMB 1OY3B 3HZVB 4WW2A 4QRBA 3H9ZA 4RAVA 2OM5A 5FA4A 3KWTA 5HYJA 3BPNC 1T83C 2GAZA 4AT6A 5DZPA 4PG9A 2EDTA 5EOQH 5LBVA 4CVXA 4PP2A 4UTAH 3FDWA 1X5YA 4OD2B 3T2NH 4Y8AA 3QI9D 3TT3H 1CLYL 1VSCA 4UQBA 1QNZH 1AOZA 1MVYA 4PWHA 3N3EA 5JNYA 2NX5D 2UYLA 4PH8A 1ACYH 1ADQA 1AO7D 3B5HA 3F7RA 4BFRA 2EUWA 1G0YR 3GHBL 2PO6D 3KVPA 3CHOA 1BREA 4WEBH 2FWSA 3K6NA 1DJXA 1BYOA 3RIAF 1MI5B 4MBOA 1KXVA 2VM3A 4QRUB 2BIPA 3LKNA 4N20A 4N1CA 2ZX9A 1FL6A 2YRBA 3NDYE 2LLLA 3IDYC 4OCXL 4OT1L 4BWTA 4YBLC 2NY5C 2Z4QA 1NBCA 4IKJA 1PY0A 4OY9A 4BKLB 1SYSA 3KLLA 2IQ9H 5F7DA 1DBAH 1XB8A 2DL9A 3WIIH 2VW4A 4XCNB 1Q1JH 3IJ8A 1TIUA 2MSPA 3S3CB 1AIFA 4GNKB 4XC3H 1XZ0B 2Y2YA 4P57B 3CLEL 1SBSL 3GHEH 2XN9B 3D7PA 3JVFC 3SDXA 4PRDA 4NO3A 3KJ6H 2NPLX 3PGCB 3T8XA 4NFDA 2BP0B 5IHUL 3B2DC 4J2XA 1CR9H 4GRWE 3CSFA 5KSAC 1R75A 3VWKB 3GS0A 4L4VD 3PAVA 3DTXB 2MCG1 5CXPA 5DHEA 3O3AA 1KN4L 1U3JA 4QHPA 1LVEA 1YG9A 1XGZA 4H8UA 5DFAA 5E51A 3T65B 3ZHKA 4FNTA 1DFBH 2ZP9A 1DLHB 5A16A 1N3NA 1EAPA 2VLJB 5LJYH 1A6AB 1K4CA 1MCHA 5MEPA 4E9WA 2VISB 1YNTF 4BV1A 3QIBD 1GPOL 1R4XA 2HB0A 2NCMA 3P9LB 3PXHA 4EPSA 1GYCA 2VJXA 1FNGB 4N8UA 6FABL 5LAPA 4RBPH 2IFFH 3DSFL 5D5ME 3WKPA 1CI3M 2GUOA 2ZOWA 1OIOA 4XHJC 1EUTA 3OV6A 5IESH 1QABA 4IK6A 2OR8A 2FUQA 3RAJL 4U3SB 1IILE 4P2QB 3PXLA 3U83A 3ECBB 4IBTA 1I75A 3FF7A 3LIZA 5EOTA 4DERA 5JORA 4NKIH 4IRSA 4MTMA 1FC1A 1XZWA 2QDWA 4GEJA 1FNSH 3LV3B 4PV8B 4U1JB 1LMKA 4OAWB 4JW3A 4U4BA 1YAIA 4DN3H 1P1ZA 1EJOH 5ALCH 3KXFB 4A37A 3MNMA 1U3HB 4NQTA 4N0FA 3BHBA 3T2PA 1GY1A 4A2GA 1ZOXA 4AQAA 2CM6A 3CPLA 2Y1YA 5T33H 2XTJB 3TIEB 3M45A 4WZ9A 5TDNA 4EIUA 2H6PB 2W1NA 3WIHA 2IF7A 4GSRA 3EYQC 4K9EL 1NBZB 3CWGA 5IJCC 5I6XB 2R23A 1F00I 4NNPL 5C6PB 1U0QA 3TN0B 5C07D 5ACZB 4Z3IA 5JYLA 5DD5L 1EUUA 2BNRA 5E5MA 1A7PH 2N56A 4MJIA 3VFSB 1QPKA 4HZLB 4E5XA 2BO0A 3TS8A 1E8XA 2ZXQA 1I7TA 2NTSP 4GI9A 3HI5H 1VFAB 4HCIA 1KBKA 4Z7OB 5DURD 5EEUA 4XNQA 3HBQA 4FQJH 3OZ9H 5LGKA 1YY9D 4NQDB 1FCGA 3M7FB 3S35X 2BS9A 4POZD 3VG9C 1WAAE 4YQXL 5G2NA 4LP4A 2QVIA 4J3UA 3L4XA 2TRHA 2DLGA 1QBAA 4ERSL 2WAQA 1J0KA 2R7EB 4KVCL 2XIBA 1I1CA 2GIXA 5FM4A 2WP3T 3GTVA 4P07A 3VFTA 3QEHA 5I17A 5GZNA 1XEUA 3D4CA 5IMOA 4YUEL 5ICYA 1FGNL 3TEZA 5D7SL 5KSBB 5KW9L 4HUNB 1UG9A 4W4NA 2VDKL 2JCCF 1C7TA 4QTFA 4D0DB 2P80D 1RK1B 2HVKA 4PJ8A 1X5IA 3CFDA 3VMOA 1AXTH 2ZUQB 1T6VN 2RMNA 3AQDA 3F8UB 3FFCB 2COVD 5HVGB 1JMZA 3VJ6A 4QWWC 1J1OH 4JY5H 4PLKC 5LDSA 3NSFA 3VA6A 1F58L 2C9XA 2HAZA 4XPGL 2D8KA 5F7BA 3AT8A 4HMDA 4D7BA 1AZRA 2MHAB 5E1GA 1AE6L 2DQFA 5D7JC 4DK5A 1QHOA 2RAMA 3DBXB 1HEZA 3FOLB 1X7QB 2VWEE 2GI0A 5IBUB 2EXYD 4QUOA 2FLBT 4FZEL 3KEHA 5IWLC 3IDGB 1OE3A 3AGVA 2XWEA 2Y5QA 2OL3B 4UM9D 4KPHL 5SWZB 4S1QL 3RIKA 3OKOB 1KULA 5ISZB 5JW4Q 4LRIA 2BMKA 4TYUA 5JIHA 4HV8A 3CX5J 1ZA6B 2ADJB 1IC7H 3MRQA 4DUVA 2LW3A 2NZIA 1SFHA 4OD1L 4TUOA 3L3GB 1A4JA 1NMAH 4GUPB 3BAEL 1JG9A 4AT6B 3TNMB 1EX0A 1VCBC 5ABZA 4HT1H 3BSGA 3U0WL 3NZ8A 3BAJA 3S3SA 1VB9A 2XQBH 5FGCE 3FTVA 2N7AA 1MCLA 3JUYA 4CU6A 2OTWB 1NJ9B 5L2JB 1E42A 1NC2D 1KTCA 3ZTNL 5HGHB 2IH1A 5D1QE 3QR1A 3WFHA 2VSMB 4DFIA 3STZB 1P6AB 4YSTA 1MFDH 5DZOA 3VQLA 4WSGA 2RCSL 3BUPA 4L8BB 2JLPA 1W8EA 4G8GA 5LCVA 3II3A 1OHZA 1ZPUA 4P2YA 1E50A 2V3FA 2ZT9C 5LN4A 2A74C 2CBTA 1F5WA 3VXSB 4OUOA 2GB2A 5F1NA 4DVBA 3L4WA 3HS0B 4ZQKB 1U36A 4U05A 1KCRL 4XP6L 3H3PL 3LS5L 4EVNA 4MMYA 2YN5A 5C0FB 2ZWYA 4OF5A 1WTLA 2OMVA 4IGBC 3B1TA 3ETTA 3O8XD 3RWJA 1NGWB 4BCYA 1ESOA 1BVKA 2X0WA 2ZOOA 1TTFA 5T5NF 3TL5A 5B3SB 1QBLH 5DJAB 1BBJA 3EOAB 5DVMA 2YA1A 5KBMA 3VI3A 5KSAA 4ZMVA 1H3PH 5C0IA 5I8OL 1L9MA 2R0KH 3KMDA 2KZKA 5GGQH 3WFBL 1TLMA 4HHAA 3QEQE 4L9DA 1HYSC 3QEGH 4XNUH 5ID0A 3LH8A 4S2SA 2PPCA 4UQ2B 3ARBA 3RFZB 5JXAH 3SKUD 3UPRA 3R7RA 1C5BL 4IQHA 4CNIB 2ZUSA 2ICWI 4MASA 1MJ7H 4CSPA 5DQ9A 5CO1A 4QOKA 2PR4H 2J4WL 1NDTA 4KVNL 3ZKXB 3ZE2E 2D3VA 4ATWA 4X6FA 3LKOA 5IQOA 1F4WL 2DLFH 1QSEE 4FERA 3TTYA 1N0XH 3G5ZA 3GJFA 1UYWH 4AQ1A 4CMMA 2JCCA 3K80A 4KJYB 2XETA 1ZLUK 5FYLE 2SODB 4JFFB 3D3VD 2XPGB 4RA3A 1QR1A 1D5ZB 2R15A 4J6RH 3LZLA 2MNJB 5GGRA 5FCSH 2E76C 3HN3A 5IIEB 1PEWA 2XTJD 5DLLA 1DBML 1MCPH 5DZLA 1I1FA 1U93B 2SEBB 2D7OA 5GRZA 5IM7B 2P42B 4YS4A 4G6AC 1SMAA 1VGKB 2TSAA 1KTJA 4EDWL 2UVEA 1UD4A 4KV5F 5FOBB 4JPVL 2MFNA 2K70A 3AUWB 3B2XA 4PS4H 1UWXK 1W8NA 1RJYA 4QO1B 2A4ZA 1DQDH 3KHQA 2ENJA 4AQEA 5LLIC 4LGSB 1Z2KA 1MHHB 2MJWA 3FQWB 2DEWX 3MJGX 4PWJA 3ZKXC 4DGUA 2WXJA 4JRXD 1IEAA 3B7UX 3DHPA 4YGAB 1JPEA 1T3FA 4FFYH 3TBYA 3DTDA 3GNML 5I1KH 5K59F 4ZFFA 1U3YA 3BAKA 2PCPB 2I27N 1KBGH 3AS3A 1K4CB 3CZLA 3TZVD 4MA8H 1IKNC 3SN6N 4CC4A 1AR1D 1LL1A 2WLLA 2DDQH 3BPCB 4PJIB 1BSIA 1JZFA 3SDCA 4CMHB 2DICA 3CNKA 4JE0A 4ODBD 4ILDA 4JO2L 3IFLL 3RWEA 4POZC 1RZ8A 4ZUWA 2V5SA 2VW7A 3MBEC 5DJXA 3P3UA 1XSIA 1HZKA 1A7OL 4PGEB 4W9KC 1B9KA 1WBYB 2ADFL 4GIAA 3BP6B 4AYFB 1CURA 3QZWG 3MRPB 2VLKA 4DP1X 1CBVH 2J44A 4XI5C 1G9NL 3N85H 1AGFB 5DK2A 3U9WA 1G6RA 4EF3A 2DLTA 4YSQA 1I9RH 2VH5H 4APQC 4MDJA 2AJVH 3SOBL 3JTTA 4DKEL 4KZCA 4DZBB 4JRXA 3RX8A 3NZHH 2RGSA 4FFVD 4XC1H 4MJJA 1PCSA 1ZPLA 2P5WB 5HHVH 4EMZA 1AQHA 4GQRA 1DBKL 1IGJA 3L3KB 4E9VA 4TVPE 1CFNB 1OCWL 2Q9OA 2VGLM 2EUXA 5H94A 5EOQL 3P11L 4N1EA 3QFJB 1HXKA 5ESQB 5KS9B 3T4AB 1H5BA 2XFXA 5ETUA 3QS2A 2QQLH 4LLAA 2Z91A 4IBSA 2D7TH 2J6EA 4U6VH 4OQ1A 2ZUUA 5DI8B 1NBVH 3N40F 3AAZA 3GKZA 4OBSA 2H26A 1IMHC 5D2NE 3JT2A 4WNQA 2E4FA 1MFCH 1LILA 1X7QA 2ZE0A 4XVUD 4PRHA 3EKCA 2QV2A 4PLJC 4M93B 4H44C 2CK2A 1VHPA 4WJG3 4QOKE 1EGJH 4LMQE 5F2FA 1MQKH 1N64L 4U1HB 1A21A 1A6ZA 5IR1A 2DKUA 5K33A 5D4IA 4JFEE 3TBWB 5SWQA 2HA1A 2DQ6A 4PJFA 5E9DD 3FT2A 1VPOH 1BJ1J 4IRZL 3DECA 4P5TD 3WAJA 3HUJA 4MXVF 4HU8A 2G60H 2F5BL 2VR3A 3QXDA 5DO8A 4XX1E 1NCBH 4PS7A 3P4MA 2F19L 3IDMA 3PQYB 4HXBL 4UI2A 3GJFK 1BD2B 2Y2TA 1CDIA 1SLUA 3L13A 4LSPH 5E8PA 4MNHA 3HAEB 3PWJB 5KJ4A 1ZJAA 1FLRL 1RZKL 2E3VA 4OI9A 1QKZL 3NP4A 1TQTA 5HGBB 1FUNA 1IGCL 3JQOB 3QORB 1SBSH 1QBMH 1DANU 2J25A 2K6YA 3FT4B 1P7QB 4HUWB 3IAQA 3UTZB 2QR0A 2VDRB 2O30A 4JRWA 1G7LA 1KFAL 4PRNB 2V2WB 4I8DA 2ZIDA 3LEYH 2DYRB 1WFIA 2OTUA 4HIEA 3S96A 2AXJA 4IOSA 5IROD 2CK0L 1U8PA 2XRAL 3UJIL 1KOAA 1U33A 2Y7QB 2YGNA 4L4VE 4ODXB 4YWGL 2V7HA 2CQVA 5HYQA 4Y2DC 3V10A 1CLZL 4YHOH 4KTDH 5ANMA 4Z0BL 2Z1PA 4KK6D 1TZOA 4OKVB 3LZPA 1KV3A 4PY8J 4K94L 4WI8A 1R0AH 2HX7A