1KEMH

Catalytic antibody 28b4 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
EVKLVESGGGLGQPGGSLRLSCATSGFTFTDYYFNWARQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQGILYLQMNTLRAEDSATYYCARWGSYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Catalytic antibody
molecule keywords 28B4 FAB
publication title Insights into antibody catalysis: structure of an oxygenation catalyst at 1.9-angstrom resolution.
pubmed doi rcsb
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kemH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kemH01
4JFDB 4PYHA 3T4YA 5FUZH 4HXBL 4JHZA 2ED9A 3QBTB 5C92A 4MCYB 4GRMA 3QXDA 3U7YL 4NQCE 4FQXD 4KDTC 4FQXA 4JFEE 4LIQL 1EO8H 2HH0L 1N5AB 2UWEB 4WFGD 4JHAH 1UJTA 4FQLH 5JW4R 3G9VA 1IM3A 2JCCB 5B39A 4BQ9A 5CKGA 1IGCH 5ITBH 5T33H 2FJFA 2IPKB 1VADA 2CDGB 1UFUA 3RNQA 2XTJD 3O8XC 1KCSL 3L3DA 2VB5A 4V1DD 3VMPA 4PRPB 4V1DA 4QCIA 2B1AL 3VFMA 2QSCH 4U6YA 4GRLB 3U9PL 1HQRA 4DGYL 3IDNA 2OX5A 1IEBA 3HNSH 1OT1A 1AO7A 4POUB 1CGSH 4E41B 1QO3B 2B4CL 5KANI 1RVFL 1TQBB 4HH8A 3OR6B 1EGJH 3X3GH 2VLKB 2FR4A 1BHGA 4D8PB 4GW1A 1UXSB 4NZTH 4L4JA 1ETZB 4OI9A 4PJDE 2DTSA 3T0BA 4CW1B 1IARB 2PO6C 2YEZA 1C5DB 3NZ8A 3KVQA 1YECL 4ZUTA 3AY4C 2YUXA 3ZSTA 1IAKA 2A74B 3W9EA 2E6PA 1AXSB 4YBQC 5IB4A 3GSNB 5TQ2H 1XGYH 4RGNB 1KXVC 4ZO8A 5DVKA 2BOBA 3GHEH 1FL6A 2AJ3B 1A14H 3L5XL 3P73A 1JZ4A 1W72A 2FX7L 3T77B 2BOCB 5CJXA 3S3PA 2GK2A 3DWTA 5D2NC 1NAKL 3MMEA 3UTPD 3D0LB 1YNTA 2IH3B 4LCCB 2C3GA 4XHJD 4XPBH 1CIUA 1WBXA 5F3HA 1NAMB 1U41A 2CXGA 4LP4A 2D03H 4PJGA 1H5BA 3V5HA 4OZIE 5EORL 5E8DH 5DRWB 1YEEH 4NN7B 1R5IA 2C3HA 5ETUA 5GHWL 2JJSC 4FN0A 5DC4B 3HHRB 3AC0A 5GGTL 2H9GA 5T5NG 4KJPD 4FXGB 5GGUA 2FCBA 1FGNH 1RQ5A 1JCKA 2E6JA 3P77B 1R3LB 4PJ7E 3S4SB 4MD4A 1TVDA 4GMSL 2FWOA 4PGBA 4WTZG 2FRGP 2Q8BL 3O11A 1KC5H 2FHBA 1MCEA 3EO1A 4LLDA 2OQJB 4JPIB 3WEXB 4PJIA 5HHMD 4M93C 1VENA 3ALXA 2LVEA 5LGJB 2H2PD 4U1KA 3NH7L 2X4QB 4KVNL 5JORB 5IEKA 4G8IA 4GAGH 4U1NA 3CFCL 4ERSL 1WZ1L 3NMEA 2Q6WA 1AC6A 4V2CB 5CSGA 4GJTB 3V6FB 4DN3H 1TETL 4NRXB 2P5ED 4PJ7F 3VFGH 2G60H 2P5EA 5C0AD 5FKAA 2XG4A 5C0AA 2N1KA 3W0WB 3QO0B 3MRDB 2OYPA 3VFOA 5DJXA 3CFJA 3ROOA 4U3CA 4UNUA 2DQDH 3Q6FA 5K9JH 2J8HA 4KKAD 3C5SA 2GY5A 4CMMB 5C0EB 3IFOB 1SQ2N 4PRBA 4HH9B 1IC1A 4M6MH 4HF5H 1UJ3C 3G08A 2UZXB 4EUPA 4RGOH 2DD8L 1K8DB 3FFCB 1J18A 4Z7UB 4U33A 5DD1H 1A22B 3QUMH 1KACB 5C0GA 1HNGA 4JM2C 3H3PL 4LOUD 3FO9A 5HYSG 2AP2A 5L88L 2AJVL 2DLIA 3IVKB 1VFMA 2EKSB 2Z4QA 2J6EL 2FB4L 2C4XA 3QZWG 4Y4HB 3PHOA 2HG5B 3QP3A 1FFRA 5J8OA 1RHHA 1JZ5A 3MBXL 3RDTD 2QKIA 4GKZB 3D3VD 4HEME 2BNRD 4NBYB 4QTIH 3RDTA 3PHSA 3D3VA 1HH6A 2BNRA 1RZ7L 4F7CB 3QUKA 4J3VA 3GMMB 3WUWB 2C9AA 1E4XL 1OSZB 4PR5B 5J6HB 1T2QL 1T7ZA 3VXOA 4MXQD 5HI5D 3U36A 3NABL 3QEUB 3SGJA 1F11B 3VXNA 2CKBL 5ACZA 4CBPA 1H3VA 4QGTA 2VXSL 4PJEA 4HC1H 1U8PB 1HH9A 3TH2T 1T83A 1BP3B 4Y16C 4M6NL 3ULUL 4ZFOA 3RWEA 2R9HD 2GSGB 4S0TD 1D6EA 4TSCL 3HR5B 3WFDL 1QEWA 3GMLA 5FXCH 4OD3H 1YN7B 1D5MA 2KUTA 2YPVL 3LPWA 1HYSC 2DQCL 5CMAA 2Q7YA 3SE4A 3DI2B 3P4LA 1NC2B 4LCYB 1PGRB 3JVGA 4GAYA 1X5LA 5D1XC 4NDMB 4KK5C 1KFAL 3O3UN 1JNNL 2HLAB 4J23A 4IRJA 2PXYB 1BEYH 2OZ4L 2DM2A 4OLZL 1KEGH 1A9BB 1HILB 3QI9D 4QF1B 3QI9A 5MEPB 1KIPB 4GW4A 3RP1A 3IU4H 2I9LB 3KYMB 4I3RL 1MHCA 2EC9U 2EDXA 3QQ3B 4JFFD 2VN4A 4JFFA 4Q6IA 4LCWB 1GZPB 1B90A 1NUFA 4OCRL 4N8VG 4GW5A 2VKWA 5GGRA 2A9NH 1YYML 5C8JB 1RY7B 5IMKA 5HHOE 3B5GA 1N3NA 2PTTA 3CPLA 4H5SA 1IC7H 1OWWA 5AAWA 5GGSA 4M62L 3TNNA 4BZ2H 4OFKA 4XCEB 3TGXA 1F4WL 4JZJB 1A5FL 2CO7B 3MLTB 4ONGH 1YEIL 2G5BA 1Q72L 3OV6A 1PSKH 3QFJD 5J06A 1ZLUH 4NJAH 3QFJA 1I1AD 5HDQL 1I1AA 3CXDH 4JRXB 1UM4L 3MRLA 2I07A 3UYPA 4OT1L 1QA9B 3SBWA 5JIIA 4QOKE 4RAUA 3VXMB 4BSWA 2FJGB 3MLSH 3E6HB 3VFNB 3MRMA 1JWUA 4ETQA 2W92A 3BQUC 3RVVC 5C08B 1T6VN 3T4AB 2VH5H 1G0YR 3C5ZC 4XBGB 3OPZH 4IDJL 2FZ3A 4NQSA 4L8SB 5IMOA 3V52H 2Z31C 1HN1A 1Y18B 3UTQB 3V9FA 4ISVA 5D7KE 1R5WA 4AEEA 5JQ6H 5H35A 4WU5B 1CBVH 2BVTA 3GI8H 4F7MB 1DQJB 1KCRH 1NCCL 3F62A 1I3RB 3P9WB 3SPVA 2NW2A 2RR3A 1DBJH 1EFQA 1FG9C 5DHVA 4KAQL 4PBVC 12E8H 5BZWB 2CD0A 1MRDL 3B2VH 1GZQA 2A73B 4HS3A 5INDA 1KLGB 3KS0H 3V4PH 4F7EA 5C9JB 3ILQD 3GSNL 4PJHF 3PF2A 1E4JA 1XGQB 4DN4L 4GXUN 2AJZA 3B9DA 3NFSL 3QNZB 5EULV 2R29H 4G8EA 4U7SA 5C0BA 5CP3A 5TDNA 3QXUA 4YXLH 1YEHH 1V3JA 3HMWH 5IB3A 4D0CB 1IL1A 3NIDE 4F9LC 1FYTB 4LPXA 3S35X 3OB8A 1KIQA 2B2XL 4BQ8A 5IMMB 4GQPH 5C07B 1NAML 1R0AH 4H26A 1FO0H 5A2IH 3CSYB 1RJYB 3RZCB 4MJID 5FKPA 4YXHH 4PREA 4MJIA 1EUTA 1FVCA 1T6WA 4PRIB 1EDQA 4PJBE 1QRNE 3C6SB 3GBML 1QLRA 1S7XA 2D7OA 5TE7L 4N5UA 4RWHA 3ARGC 3SDXB 1NDGA 3G6AA 2VDRH 3WIFA 1MIEL 1Z5LA 3NIDF 4XVSL 1WC7A 2OK0H 1ITCA 4ODXA 4PP1D 4E9LA 3H42L 5EA0L 4C58B 3GSQA 4QRRB 3CC5B 2PYED 3IGAA 3OTTA 3RKPA 1QSVA 1ZT1A 2BSRA 2PYEA 2P47B 1DSFH 1X4YA 3VXSD 4KJYA 3LEYH 5FYKE 3RJQB 5IVXB 3VXSA 4HFWA 1RU9L 1OSPL 1D5IL 1BFOA 5EOCL 1Y0LA 4CUCA 3IDMA 5HGDA 2XXMB 4OV6F 3MJGX 1IILE 2YA0A 1BWWA 1KJVA 4U0RB 1F02I 4TVPH 4PGJA 4XNYL 3OKKA 3UTSB 3L3GA 4UQ3A 3HAEA 3QQ9D 3EJJX 4TTDD 5EBGA 5C0DB 4ELME 2ENSA 4DKFH 4F80A 4Y5XB 3SGKC 3S8WA 4PRAB 1M7DA 2VWEE 3MRPA 1U3ZA 2DL9A 4BFBD 2X4OA 2JIXD 1X7QB 4GUPB 4OCWH 2JIXA 4KXZI 2XWJB 4Z78A 3PP4H 4NZUH 4KKLC 1DEDA 2CDEB 1FV1B 2CDFA 1MJJA 4G6AD 1RURL 3TH3T 3VD5A 3WXVL 4H0GA 4ELMF 5IFJB 1CLYL 1T20B 3EYFA 3EYUL 2YD3A 3HRZA 3TP4A 1NCWL 2CGRL 3QZWB 3GRWH 2WIIB 1ZVHA 2V5MA 4NZRL 3AB0C 1SYVB 4OZHB 1TCRB 1N6VA 4OD2A 4ODWB 4LSPL 3BGAA 5ADPL 2ZSWA 1S7TB 3O9WC 2AAVA 4M8VA 1TCMA 4GS7C 5MENE 4BELD 4LEXH 5TPWH 1H3WM 4ZTPH 5DK0A 3TBTA 1M1SA 4JFZL 43CAA 2APBA 2X7LA 3PWPE 1AO7E 3QUMB 5EPMB 5IWLA 3QG6A 1C7TA 1G1CA 1AY1H 5KSVB 5H2BA 2VLRB 1IAOB 1F6AB 1BJ8A 3IYLW 3RY5A 4ZOEA 5BMFH 2X1OA 3HZYB 5L8LB 1EPFA 5KSBE 3O8XB 3BD4A 4L3CA 1JGEA 5F1KC 5GGTA 2GK0A 3EYSL 3NN8A 4WNQA 5DSCA 4LASL 3TBYB 1U8NA 2D0GA 4PRDB 2Z0BA 3DUSB 4QRSA 2CLRB 3ECBB 4H88H 3PWJA 5I16A 1CDHA 4LF3B 3VFRA 3S5LA 3H8NA 1EA9C 4JANB 4NIKB 5BJTA 3BIKB 3TIEB 4JDVB 4ODSH 3MTRA 5IW1B 3FO1A 3GSWA 1NGPH 3TFKD 1Q0YL 3ABZA 4K7PH 1E28A 2F5BL 5E2TL 2Y7QB 2ITDA 4ENEC 2VLMD 3F7QA 3BUYA 5KSBF 3I3EA 4DGIH 1N4XL 4WUUB 1ZEAL 2VKXA 4X9BA 3ARBB 5I1DB 1MJ7L 2QLVB 3LZFH 3KJ4C 3D9AL 1J86A 2PUQT 3RUGA 1H3PH 2FYYB 4XMPL 1A3RH 4K3EL 5KW9L 1HHGA 3FOMB 3UZQA 2X4PB 5HYIA 5DEGB 4N8VB 5GIRB 4WO4A 4YHLL 2Z8RA 3VRIB 5A2JH 2DQHH 1J1OL 2HFGL 4JJ5A 1L7IH 2AK4D 4XAKE 4Z7WA 4J3WA 3UTTB 2AK4A 5D2NB 5KVGH 5CEYB 4LSRH 3MV9E 1I75A 4OF6A 4HUKB 2QV2A 3OAYK 4J8RA 4W6XB 5ERWA 4M7ZC 2AXGA 1XF3B 4JDZA 7FABL 1S7QA 4FFZL 3QIWD 1UKTA 3TYFA 3QIWA 5IVZA 5HD8C 1MF2L 2APVA 4ZUWA 4RMRA 1IRAY 4G6FB 3SGDH 4XI5C 1QFWL 1BQUA 3CVIH 2VR9A 4WV1C 2W60B 4N5ED 3C5JB 4G3YH 1UH3A 3CLFL 3G04B 1N26A 3HPLA 4JFYA 1NGWB 2J6EA 3IXTA 1FFPB 4D0BA 1S7WA 3TIDA 4S0SD 3VMNA 4DVRH 5E1AA 4ODUA 3VE0B 4X7CC 5C2BH 2VLLB 3TVMC 3DNKA 2MOVA 1CQKA 3JTTB 1B3JA 1DQQB 2CIIB 4FFVC 5K59E 1WCQA 1CDUA 3QJFA 3H9ZA 3TWCH 4NO5B 3QISA 4RWYL 4M93B 1INDH 2WNGA 4GMTL 2VDPL 4L3ED 4M43L 4X0KA 2F5AH 4XNQB 5D7LB 3QUXC 3L95A 4L3EA 1C7SA 4P2RD 1QRKA 4P2RA 5BQ7A 2B1HH 5DQDL 3V7MA 4MNHB 2CKBA 1MLBB 4NCC2 2G5RA 2WANA 3EUUA 4P4RB 4EDXB 4TTGA 1YNKL 1LILA 5DMKA 5F7DA 1T7YA 2KL6A 3MBEC 4Z0XB 3ULUD 5T33L 1K3ZA 1F4XH 1OM3L 4ZFZA 1AJ7H 1VEOA 1FZJB 2HJFA 5EBMB 4M9PA 4YGVB 4CL7A 4P48A 5GZNC 4OAWB 4J7RA 1A6ZA 4IS6B 8CGTA 5EUOA 3PQYD 3CH1B 1DE4B 1DN2A 3PQYA 1GOHA 1BQHB 4G8GE 5EZIH 1URLA 3BH9A 4FQIH 4P2QD 1KCUH 4P2QA 3S34L 3MXVH 1MFDL 1UJ3B 3GK8H 1VFBA 4HKXA 3ARQA 4LLWA 4OB5H 4ZUSB 4PJFA 5E4EC 2LU3A 4PLJD 4Y2DD 3PWNB 4Y2DA 3T1WA 4JM2B 5F1SA 2OZ4A 3DVGA 5DRZB 5CBEA 1HXYA 2JJTA 1NGQL 4ODVH 5J7CC 5DO2C 1I1CA 3CZFA 3X13B 2HFEB 3K1KC 4GRWE 3IDIB 4DCQB 1EEYA 3CDGA 2DQIH 1XGYL 4M1DL 4Y1AB 3QEHA 1BOYA 1WT5C 2I5YH 1JF1B 5TF1H 1A14L 3I3BA 1SMOA 4IOSD 1CXHA 1BX2B 4J3OC 5F9JA 4RMWA 2VISB 3MZTA 1TFHA 2W9DL 3U4EA 3ZL4H 4JFQA 4MCYA 5KANG 1M7XA 3HCVB 4Q2ZB 5DT1H 2EYTB 3WFHB 5FDWB 1A47A 1QFWM 4KRPC 4I0CC 2DQFA 3BDYH 1FO0B 2VZ3A 4JPWH 4AL8H 4Y16B 3KXFB 4PY8J 1OGAE 2JCCA 1P7KA 5TH2B 1T1XA 3UDWC 2W9EH 1VKXB 2IPKA 2SEBB 4HBQA 1N0XL 3P40A 4TULL 2NY1C 1JRHI 3ARZA 1U92B 3BAEL 5FCUL 5C0NC 2F19H 1HHJB 3LV3A 3UC0H 4GRLA 5DJ2B 4F9PC 3GMPA 5D1XB 2AJSH 3X17A 2AV7B 3F58H 3OR6A 3SE3A 1RK1B 2BHUA 1A0QH 2YZ8A 4GT7A 5BVJA 2X05A 3GM8A 4D8PA 1UXSA 3U6RB 4JN1L 1NBVH 1ETZA 2E7MA 5EO1B 4DUVA 4CW1A 5DS8A 5C6TH 2A6JA 3VWJB 4F7PA 5KSAD 1JNLH 2ED8A 5KSAA 2CH8A 4DN3L 3FRUB 1DP0A 1I8MB 1R3IL 2BERA 3OJ2C 2DKSA 3KPRB 4UNVA 1IGJB 5GXBB 1WZMA 5HGAA 5ICYB 4X4ME 3GSNA 4TNWF 1KB9K 1CDYA 4K23L 4RDQF 2E5EA 4WFEE 1A6WL 5HSFA 1CD9B 1XGRB 2OJZL 1LO0H 2AJ3A 3PXJA 1ZLUK 1U91B 4P5MB 2BDNL 1YEFH 2VR5A 3DV6A 4QHMA 3FQXB 5IHUH 3ZTJH 1CGYA 4JEGB 3T77A 3MRHB 1CDJA 2BOCA 3P30L 2AXJA 3NFNB 3CNKA 4KTDH 5CCKH 5IW6A 3MJ9L 4M6ML 1IKNC 3EJYC 3EJZD 3P9MB 3KPSE 4KQ4H 3D0LA 4OKDA 4RGOL 3AM8A 4M6OH 2IH3A 1WQVT 4GKOA 4LCCA 5I1IH 5DD1L 3CDCA 1NAMA 2ESVE 2OBGA 2R69L 5KSUB 3G9AB 3TBSB 5DRWA 2Q86A 3T3MF 4JDTL 2XFXA 3SDDC 1MREH 4IHOB 2O26U 5JHLH 3KJ6L 4UQ2B 5JW3L 1VEMA 3C5ZB 1FZKA 4N0UA 5M7QA 3BKMH 1U8KB 2WWKT 2Y9RT 3UP1A 4RISL 4DZ8A 1CXFA 2DQEH 4J4PC 2R23A 2Z31B 4OBRA 2WLYA 4QTIL 2HT2D 3N50A 3SE8H 3S4SA 4GG6A 4GAFB 3R4DA 1NCDL 1GRWA 4YJZL 2FX8H 3H6JA 5E2UH 4QHUB 4CNIA 2OQJA 4JPIA 3LS5H 3WEXA 2YC1A 4IMKC 1U2HA 2R15A 2YXFA 5C0BE 4U6XA 5CJQL 4K94C 1E6JL 1TJIL 2I26N 4LPCA 3CVHL 4LLVB 4NRXA 4QNPE 2ZPKH 2A6KA 4H0HB 1M05B 1YQVH 3LKQB 3MJ6A 4HLZH 5D93C 5T1KD 3ARDD 3G5XB 5T1KA 5HHPA 3ARDA 4JO2L 3QO0A 4WUKL 5DJDA 5EU6B 1W0WB 3MRDA 2DKMA 4BSJA 1N6QL 3AROA 2ZKHH 4FQ2H 3DMMC 3UTZB 3MC0A 1JJUA 5I71C 1QLEH 3I6LD 4PBWD 5ALBL 5J11C 4C55A 1O7SA 3EOTH 4LAQL 4CMMA 4LVNC 3MLVH 4EVNB 1LP9B 1GHFH 1YMME 2ZCKH 3U0WL 4P57B 2APFA 3RHWK 4Z7UA 1Q9OA 1CTNA 2MTPA 4LLYB 4R9HA 3NZHL 3CU7A 4PJCA 3T1FA 3W5NA 3JV4B 2OR9H 1MFCH 2CRMA 5J3HC 5HHVH 4HG4J 3ARGB 1JHTA 1UADC 1LK2B 4Y4HD 5GSVA 4XBEL 4DJMA 1S8DB 1RMFH 3K3QA 4Y4HA 2HG5A 1IAMA 2WQ8A 5BRZB 3T65A 1Q0XL 4D9RD 3KPLB 4PJAE 5KZCB 3EAKA 3MUY1 1GAFL 1TQCC 3G5YA 3GMMA 3QCTH 3AUVA 1IQDB 4AIXA 1U2CA 4PR5A 1P2CA 4JKMA 3V4UH 2OSLB 3MV11 3ULVL 3OAUH 2WWKO 2C1OB 5GS0L 5KOMC 1GPOH 1AGDA 4AM0B 1FNGB 1F11A 2EZ0C 2VXVH 4WFFD 3QHFH 4YHML 4YEEA 1BLNA 3KYAA 3IDXH 3DX7A 3RIAF 4KI5F 2H26B 3CX5K 1R3HB 1U8PA 4LGRB 1HEZB 4Z7OE 4OZ4B 1NEZG 1QLFB 2A1WH 5ESVB 1XFPA 4JHWL 2F15A 2P5WB 1IE5A 5EOQL 2GSGA 1LO5A 3FO2B 1A6VL 2WM0A 4JY4B 2XQYG 4B7LA 1O7VA 1ZV5A 3OKDB 4Z9KB 3S96A 4HUWB 5FV1L 1RFDL 1YN7A 2R2BB 3V52L 3MUGA 4MYWB 5I19L 2HFTA 1BQLL 1RUKH 4MJ5A 2E8YA 4G6KH 1S3KH 1NC2D 5HGBB 3SDYL 1NC2A 4LFHD 3B3IA 1BREA 1CBVL 2EE3A 3STZB 3TM6A 2C1PA 3MV7E 5DEZA 4NDMA 1WCBA 1YC8A 5HHNA 4ZQKB 4Z7OF 1A21A 2HLAA 4JG0H 4QRQA 3X3FL 2PXYD 3BYYA 1P4LB 2PXYA 4ALAL 12E8L 1ZANH 5C0RH 3CLEL 1H0DB 4XZUB 1HILA 4QF1A 1PJ9A 3KHOA 4I4WA 4I1NB 4M1CC 3M1BB 5MEPA 1KIPA 2I9LA 2R0KL 3AB0B 2BJMH 4LCWD 3TA3C 3PXHA 5ECJE 4HZAA 4LCWA 3D87B 1GZPA 1MHPH 1FRGL 3D18B 3O9WB 3TCLB 4MJ2A 4ZPVA 1CE6B 1KYOJ 4GS7B 3FB8B 3P2TA 3MV8B 1HXMB 5ANMB 4GAJL 3BH8B 1EO7A 2R29L 1LDPL 4OCXH 5DVOA 3VDAA 2JK5B 1ZGLM 5ESAA 2J2ZA 5SWSD 4YXLL 2AS5M 3BT2H 4XCEA 4TUJB 5LXGL 4JZJA 1TXKA 3CSPA 1RJZB 1DQDH 3O3BA 3OKMB 1Q9LA 2YUVA 5LGKA 1HHHA 1I9JH 2E6QA 3G6JB 2VE6B 3MCLH 4K94H 5GS2D 4CVUA 3KLHC 1FO0L 2DF3A 2DKUA 2D7QA 4MNQB 3NA9H 4Z76B 1QA9A 1CG9B 4YO0B 1EV2E 5E2WH 2FJGA 3NCCB 5C08D 4TN9A 5C08A 3IETB 4XPHH 1MI5D 1WWBX 2GUOA 1MI5A 2EDDA 2OJEB 4XBGA 2F53B 3WMSA 4L8SA 4FQJH 4OUOA 2A77L 4ZPTB 3OZ9L 4WEBL 2VDNL 2VXTH 5I1HL 1Y18A 4AMKL 5DFTA 5GRZA 3UTQA 3KJ4B 4S1QL 2NY0C 4WU5A 4YHYB 4F7MA 5EN2A 5FYLL 3OR7A 1FNHA 2FO1A 4M9OA 4JRWA 5DRNB 1HHIB 4RQQB 1MJUH 2YPLD 1NGXB 3EBAA 2YPLA 3DARA 1TDQA 3QUYC 3GMQB 2A73A 5IBUB 4FP8L 2NXYD 2W9LA 1ORQB 4XP6H 5F7KC 1T21A 4DKFL 5C9JA 4M7ZB 3F7VB 2XN9E 4EI6A 4X4XB 1KENH 2AI0H 5DZNA 1I8LC 4G6MH 1XGQA 1WAAF 2GJZA 5GGRY 1SY6H 4Z77B 3LQZB 2XRAH 3FQUB 5IESL 3BMVA 3FQRB 3PP4L 4P46C 2FIRT 3IXAA 3UEZA 4JQXA 5GGSY 1QBBA 4RZCB 4KXZH 3MLUL 3KAAA 1JHLL 4O9HL 2C7UB 4KRNA 5IJKC 1OAKH 2BVOA 1EMTH 4YDVB 1KIUA 2G2RB 4XXCC 3TV3L 1T22B 4NP4H 5KVFH 3EO0B 4OD1H 4I18B 3RZCD 3VI3F 1RJYA 3N1GC 3RZCA 3V2AR 1II4E 1ZGLP 1CL7I 2NY2C 5DUML 4WW1A 4BFEA 2B5IC 4PRIA 3RY6A 5I0ZA 3VD9A 2PN5A 4I0KA 3ZE1E 1T3FA 4FQHA 4KVCH 3QUXB 2VZTA 1VFAA 4LEXL 3SDXA 4XTRC 3V4VH 1JGUH 1LO2H 3VFPB 1NFDB 3MACH 5GRUH 2W91A 2GHWB 5HYEA 5I76B 2R39A 3MBEB 1AY1L 1MHEB 3CC5A 3C6LC 3VH8G 1MLCA 3WJLC 5C6PB 3WHXB 1AKJB 5BMFL 4PJFE 3QIUB 5FA3A 4FQQB 3EOAB 4Y8DC 2ZOKB 2NY6C 4H88L 4OFYD 3QJHB 3ARED 3TO2A 4OFYA 2ADIB 3AREA 4XNXH 4OLUH 2O61A 2EDEA 1L0XA 3ALWA 5D1ZC 1DFBL 3HE6D 4IRSC 3HE6A 4NO2B 2AXFA 5C0DA 1G7LB 4BQ6A 1J12A 5E4EB 2J4WH 4PRAA 5L6YH 4J3TA 2CRZA 5CP7B 4YE4L 4PJXB 4G9DB 3FT4B 4ZS6C 2LFGA 4JFDE 4EBQL 1X7QA 4GUPA 2KBGA 4XNMB 3I6GB 4KU1A 1C5BH 3NBNA 4MJ6B 1PY4A 4EKXA 2Y07H 5IK3B 4R26H 3TJEH 4G7VH 4G9FE 1D5BB 4JZOB 2GJ6B 1KJ3L 3MYJB 5HVFB 5KAQF 4R4FH 1A3RL 1FV1A 1ZHNB 3PL6B 3HKFA 2UWEE 3RWGB 2BMKA 1Z3GL 1ACYH 3WS3B 1EH9A 5IFJA 1UACL 1T20A 1U6AL 4HIXH 5IR1B 1DQLL 1A4KB 1B4JL 1MFAL 1VDGA 3V5KB 3VFMB 4K3DH 4XPTH 2IQ9L 4LSRL 1RIVL 4HX1B 2MMXA 5FHAL 1OL0A 2AJUH 5F1IA 1MVFA 4ODWA 5IKCB 1V7NL 5DURD 4PRPE 2KQMA 4R6UA 3P9LB 4W4OA 3MJ9A 4KRPB 4HHAA 4O5LL 4HKJB 3FONB 3GO1H 4Y7MA 1OARH 2Z8VC 5I1EL 3QUMA 3T0XA 3MZGB 4E41E 1VACB 4HGWB 4YBLC 1HSAB 4DQOL 2VLRA 2EDYA 1BIHA 2VLKE 1CYGA 3BHBA 4LL9A 3QXAB 2NY1B 3JBG7 1NEZB 1T1WA 1CR9L 1H15B 4QRUB 3TBYA 4W4NA 3S98A 4Y19E 1CE1L 4PRDA 1EHLH 2CLRA 3ECBA 1PKQE 4MS8C 1KTDB 5CEXA 3GNML 1AFVL 5IP4A 1S7SB 3B5TA 4JANA 3W81A 4LSQL 3TIEA 5SX5H 5E99L 5IW1A 4OQ1A 2ZUYA 4HIEB 4F2MB 2WBKA 4RGNE 4ZNEA 2EDNA 2X4RA 1KJ2L 1E6OH 1RK0A 4XP1H 2Y7QA 3KPTA 3MOBL 5EIIB 1SVZA 2GI7A 5HBBA 4F3FA 2A6DA 5F7LB 1OWRM 3WS6C 1JPST 3L9RB 4Y2OA 4XB8A 3ARBD 3L3JA 2OTUA 3ARBA 4MX7A 3AY4A 2H45A 5I1DA 4O58H 2D4DA 4OLXH 3CVHA 4A6YB 4MA1C 4P9HC 3M17A 3MO1B 1VESA 4PLOB 1MQKL 2B8OT 2FYYA 5KOVC 5CILL 5KVDH 4NWTH 4XVJH 1NH6A 3IRZA 4WI5A 5DEGA 1UWEH 5GIRA 2MQ0A 5T5FL 5CINH 3VRIA 3WN5C 2XZAL 4XT1C 4NZJA 4HT1H 1R3KB 2UZYB 3DXAD 3DXAA 1KIRB 3OB0H 5I8CA 5D2NA 1X5HA 1KCVH 5CEYA 3RZWA 2FD6L 3FCTB 3FZUC 3RVXC 3MJ8B 2MWCA 4OB5L 1XF3A 1KPRB 2N4IA 3H7BB 3ARYA 1XGUB 3KYNB 5A16B 1XF4A 1ZLSH 4HV8A 3V6OA 4PRNA 4G6FD 1F13A 3FL7A 4OQTL 4OZGB 3SDDB 2JJSA 1G7PB 4ODVL 3NCYP 3T04D 2YK1H 4YHZL 5FHBL 1U8HB 4QHKJ 2DQIL 1ED3B 4HGKC 4G43B 4FG6C 1FFPA 4OZFH 4P2OD 2E7LC 1X44A 4P2OA 3U48A 4P2CG 4NM8H 5E8EA 4EDWH 3ARVA 3HZKA 3DUHA 1QD0A 5FYKU 3DX8B 3W0WE 1ZWIB 1WTLA 5JMOC 4ZUUA 1U8JB 4J6RH 3PIQA 4KDWA 4NO5A 5HJ3B 4MGXA 5D7LD 3ULVD 3NGBC 2VOTA 5D7LA 4XNQA 1A7NH 5GS0D 1YEGH 5A2KH 5F8QC 4QEGA 4RMQA 2BXYA 1CICD 1BPVA 1CICA 5DMIH 4C56D 1TNMA 1U9KA 4C56A 3K4DA 4EDXA 4P4RA 4P9ML 1P4IL 2J8UB 4S1DC 2FJHB 3MX0A 1HOCB 1CL7L 5LAXA 5D93B 5IT2L 1QHOA 1FVEB 1JPFA 4OZFG 3FFCE 3T2PA 3THMH 4NKDB 4YDIH 2YRLA 1NL0H 5EBMA 3FO0H 1CDBA 4YGVA 4L8DA 2VC2L 4OAWA 2X9WA 5I1JL 2VWEC 5I71B 3JTSB 1B0WA 1KPVB 1DE4A 1BQHA 5J11B 3PJSB 5MP6H 2R0WH 4LVNB 3WXWL 1I7UB 4PUBH 3QEQB 2YSSB 5D6CB 5H37H 2IBBA 1BVZA 2DI8A 2IPUG 4YNYB 4XGZB 4ZUSA 4I77H 2QBWA 4NO3B 5LKNA 5LJYH 5C6TL 4JM2D 2DQUL 1WUNT 4JM2A 4QRTB 4ZOAA 1JPSH 3PABB 2XQYK 2F8VA 1LVEA 2HFEA 4WIQA 3AMKA 2ORBH 1JWMA 2HLFC 3DGGB 2PKDA 1JZ7A 4KK9C 2AQ3A 3TBVB 1O0VA 2HWZH 1TQCB 1OQXA 4BM7A 4I5BB 1NANH 1YEFL 3PGCB 1BX2A 1N8ZB 2NY5C 2LABA 2VISA 4KTDL 1T04B 5CCKL 3FFDB 4AEHL 4BSVA 3M45A 1J0JA 5DGRA 3HI1A 3N9GH 2N56A 4Q2ZA 3VH8B 3ILPA 2HVJB 4HWNA 4MAYD 5E2VL 1U95A 2EDTA 4MAYA 2WQRA 4YFEA 1JL8A 1DBKH 3C9NB 3F8UB 1FO0A 1P9MA 2ZG3A 4Y16D 3F7PC 3KXFD 4UTBL 4P9HH 4Y16A 1WF5A 2R1XA 3KXFA 2WINB 4E42B 1OAYH 1JV5A 1I1YA 1XGPB 1B0GA 1G6RH 4W81A 2D4FA 1OTUD 1QFPA 3BI9X 1PG7W 3QQNA 1VKXA 1HINH 1HYSD 2Y72A 2SEBA 4L4TE 4LPTA 3SKUD 1H9VA 4PGCA 4M5YL 1U42A 5B4MC 3EYVA 4G80A 3ZLQC 4OJFH 1ADQL 2WW8A 4QXGH 5D1XD 1S7RA 3FB6B 5D1XA 1JUFA 2P7TA 1F3JB 3JWDL 2ZWLT 4KHXH 4XMLH 3O2VH 3H9HB 1H3UA 3MA7A 5FYLD 1RK1A 3FB5B 4HMEA 1R5VB 3VFSA 5B21A 2IPTH 4OGXH 3U6RA 2NR6C 2ADJA 2JELL 3DI3B 4R7DB 3VWJD 4IIQC 3VWJA 3TA3B 2VMFA 3F12B 4HIIB 3FRUA 3MRQB 4NQXB 4Y0GA 5SWZE 5IB5B 3OG6B 1A1OA 3ARWA 4JRXE 5ICYA 1AHWC 1YPZF 2JJVA 1BAFH 3GKWH 5HDBE 3I9GH 3VXME 3FHAA 1KEML 4GSDH 5DDHB 5DWUL 1U91A 1FZMB 3TBWA 3W39A 3MLVL 4YC2C 1L9NA 2FECI 3TYGL 3S37H 4LLUB 3RA7H 3NACH 2ZUVA 3IJHA 3W11C 4UT9H 1JI1A 1K2DB 1BD2D 1CFSB 1BD2A 3TBSA 4HJGB 4PJ7B 2PETA 3RVVD 2OR9L 3LDBC 1N7ML 5HHVL 4OKVB 3C5ZD 3BWUC 5DI8A 3BEVB 3C5ZA 3BD5A 5CEZE 1QSED 5F70A 1QSEA 1U8KA 5F21B 4G6JL 1KGCD 2VDKH 2A6IB 1J0YA 5T3ZH 2MFNA 2FBJH 5C70A 4UMGA 1UVQA 3SKJL 4H1LH 1LEIB 2NY0B 3BWAB 3DETD 1F4YL 3SQOH 2D7TL 3REVA 3UJIH 4LMQE 4PJ9B 3OAUL 4NJ9H 3LN9A 4DK6A 1PLGH 2VXVL 3OHXA 2H2SC 2V17H 4LCUB 3QUYB 3IDXL 4OCYL 1DN0B 2PW2A 4ZFFB 5EO0B 4A6YL 2A1WL 4PG9B 1FYTE 1FP5A 4NCC1 25C8H 4LLVA 4Z7QF 4K3JL 2H6PB 5C07E 4M7JL 2DQJH 4O4YL 3LKQA 1IGFL 2V2XB 2R2HB 1MCBA 4NQVB 2BSTA 3G5XA 4H1LG 1W0WA 3IFLL 1S9WB 1INEH 1MAMH 1RUKL 5J1SC 1XH3B 4G6KL 4Q9RH 2NY5H 4P46B 4PRIE 2X4TB 5IB2B 1LQSR 1KTRL 4C83B 4GXVL 3LOWA 3EOYG 1BWMA 3QUZC 1MAKA 4F9LA 2IBZX 4JCMA 4EVNA 1G0XA 3WSQH 4QRPD 5L2KD 4QRPA 3NCJL 5EB9A 2P45B 4Z0BH 1NGYB 4QRRE 3NIGF 1BFTA 1CU4L 4AK1A 4BH7B 1QBML 4LLYA 4QWWD 1MCCA 5IVXE 2NY2B 2HMIC 1N59A 3O6LL 2B5IB 4PJGF 1MHPL 3HR6A 2EXWC 4RAHA 4X5WA 4WVRA 3V7AG 3ARGA 5JPNA 4X7TB 4NO0B 3CFIC 4N1CA 4OLVH 1GXEA 1JPGB 1NBYB 1SBBA 5BRZD 4LSVL 5BRZA 4X8JA 1WIUA 4L9DA 3UTSE 3SEPA 3QRGL 3KPLA 4JLRA 1IFHH 2RB8A 3C6LB 4EN3C 2M2DA 1Y6NR 5E8PA 5FA4A 1EJOL 2I60L 4XCCL 1IGIH 4MWFB 1KV3A 2OSLA 2FEDC 4G5ZL 1Y6MR 3SJVB 2C1OA 3MRNA 2FGZA 1BOGB 2NLJB 1I9JL 2X1WL 3PDGA 5E9DB 4AM0A 5ADOH 5T3XL 4OZFB 2VAJA 5D1ZB 2F58L 4E5XA 4KJWD 2B39A 4IRSB 3ZMRA 3L1OH 2V2WB 4LHJB 4PY8I 5E2WL 1UEMA 3WE6B 4OZ4A 2EDBA 1QLFA 3FO2A 4NC1E 3SGKA 2EH8H 1I9IH 2W0FA 2YKLL 4N9OB 2VZOA 4ZXBC 4HUNB 1KJ2A 3WUZA 4MSWA 5CUSH 1X3DA 2CR3A 15C8L 3R8BB 4OZHE 4NKMA 2AGJH 1UA6H 5HGBA 2Z35B 3R1GL 3O4OC 3M07A 5IJVA 3STZA 1FFOB 4M3JA 3VG0H 3U9UA 2ADFH 1FZOB 1R24A 1A3LH 3LKRB 2E3VA 5C09D 4YHIB 5C09A 2P44B 3C2SA 1P4LA 4OM1L 1KLFA 1TMCB 1H0DA 3OXRB 4XZUA 1D9KC 2VLRE 4K9EL 3WKMH 1OB1B 4XP6L 4YH6A 3VI4E 1PYWB 4BYHA 4CU6A 3O9WD 2AV1A 3D18A 3O9WA 1KENL 4TVSa 1X5XA 3VRLF 3FB8A 1HXMA 3BKYH 2PTVA 1QACA 3BH8A 2WWMC 2XZQL 3DRQB 4YHKL 2JK5A 4YBLB 3E3QC 5IBLD 2OP4L 4JFOB 1RIUH 4OQTA 3HB3C 1PG7L 4TUJA 2J8OA 3PGFH 1RJZA 2IFFL 5CZVL 2FHFA 1OAKL 1EMTL 4X6CA 1AGCA 4HIHB 2VE6A 4WUUE 4AIZB 4PB0L 1B4RA 2VDOH 1GOGA 1UM5L 4MNQD 3NAAH 4MNQA 4MVBC 4Z76A 1B2WH 3T8XA 3ARRA 3A6BL 3BRFA 1HHKA 4PJHB 1XGTA 3FQTA 5HI3C 1OAXH 4PJEF 5GRWA 4TSAH 4KVCL 2A9MH 3DX9A 1KBGH 3CCHA 5LBSH 1J87A 2OJEA 5GS1B 1JGUL 1I3GL 3LH2H 5DJ6B 1LO2L 3Q3GB 5E00A 3P4MA 3MACL 1QUNA 2K1MA 2CQVA 2H3NA 4QTHB 3UTTE 4M4PA 2WAHA 4CKVX 3T2QA 5HGHB 4I3GA 4JQVC 4MA1B 4I3SH 1X5ZA 1KELL 2UZIL 1WTGT 5EH1A 2HAZA 4K7FB 1G6RB 2R56H 2YXMA 4IMLB 5C0FA 1UZ6F 3D39D 3D39A 3OB0K 4ODTH 5DRNA 3A67L 3WFBH 3WN5B 3MRFB 1HZHL 2GSIB 2HVKB 3BKCH 3GMQA 3WIIH 4AT6A 2NYYD 1ORQA 3UZVB 3TNMB 2R1YB 4CJ0A 3RGVC 2Y06H 5CJ8A 3F7VA 6FABH 4EOWH 1C12A 3R0NA 4XC1H 1TVBB 4ODHL 5HD8D 2F8XC 3KG5A 5I18H 4ZOCA 4OIIH 4Z77A 4NKOB 2MCPH 2ICEB 3LQZA 5HHQA 4XI5D 2EDHA 2BVEA 3CAFA 4CN6A 2VXQH 2BXZA 1U93B 3CMOL 2A83B 4G7VL 5FUOH 2Y5TB 4RZCA 5FM8A 1CGVA 1HKLH 2W65B 4JO4H 5DJCB 4YQXH 2C7UA 3T09A 1WVZA 4EJ1C 1AQKL 4YDVA 1J5OL 4KTYA 1UQSB 4PD4J 1T22A 3HC3H 3EO0A 4KI5C 4CVZB 3JZ7A 5MI0C 1PQZB 1KN2L 4I18A 1OTTC 4K71C 1Q1JL 3RX7A 4F58L 1Q94B 4Y5YC 3IFNL 3MLZH 4HWUA 4S11A 2IPUK 3M8OH 4R4BA 3S36L 3NGBB 4PY7B 4M48H 4FZ8L 2PR4H 1L6XA 1S7UA 4L8CB 2YA1A 1IGYA 1NFDA 5I76A 5EDXA 5FGRA 3L6FB 5CHNA 1MHEA 2AEWA 1SEQL 3UCRA 1AKJD 3HUJE 3L3OB 4P5TC 3RTQC 1AKJA 4XCNB 1T0MA 1X4ZA 1HCFX 5EOCJ 3QIUD 4ELMB 3QIUA 5F89B 4NC2B 3WJJC 4ZTOH 3ZKMC 4ZAKC 1RUQL 4UTAH 3OJMB 5I15H 3QJHA 4HBCH 4TOYH 2ADIA 1IGML 1XR9A 4Y4KD 3F5WA 4Y4KA 3WO4C 2F54B 5HTSA 4XRCB 1ADQA 3GSRB 4NO2A 3OGCB 3DECA 4ZFGH 4W70A 4Y1AE 1NJ9B 5D72L 2V5RA 2VR4A 5TQ0H 3ARPA 1BBJA 2IAND 1PDKA 2IANA 4NNPH 4XCYB 3HUJF 2MHAB 4N0YL 5CP7A 4PJXA 3U1SH 3FT4A 4IDLA 1KB5H 2V9QA 4JB9H 3FQWB 5DO2D 3VJ6B 1L9MA 3SOBH 4S1RL 4YK4C 2JLLA 2UYLA 1FH5L 3BJLA 2GJ6D 1D5BA 4M61B 2GJ6A 4PLKC 1NEUA 2P8MB 3PL6D 4NWTL 4LRNH 5BO1L 1MH5B 3PL6A 2IC2A 4UT7L 3RWGA 3TLRA 4AEIL 2R0LL 1WT5A 5MENB 5EIVA 2C26A 3PWUB 4HLJA 3ETBF 1T1ZB 3PWPB 5MERB 1TZHB 1Z0MA 1DQML 3WDHA 5ID1B 3DVFA 1BFVH 2BC4A 2BHZA 1V7ML 1W0YT 2XWTB 5KSBB 3EHBC 1RSFA 4ZDHB 1ZLSL 5F7EL 1U8LB 3FONA 3HC0B 3DSFL 5JW5B 5T1DL 5EC1B 1VACA 1YEDB 2HFFB 4HD9A 2YK1L 5IGXH 3T2NL 5E08L 4IOIB 4P23C 5C0ND 1H15A 4TVPE 3OKOA 4KKCD 2DQGH 4NKIH 4EDWL 3ZZ1A 4PJ5B 3KPRE 1NCAH 5FB8A 3TF7C 5ALCL 3TT1H 5EZJB 3ULSA 4NC0B 1RUAH 1T7VA 4BFIB 3MRGB 4HS6A 1UKQA 1A7NL 1MAJA 4YPGB 5LGHH 4NGHH 5M95B 5DLMH 1UB6A 1CDGA 2VUOA 3DBXA 5EIIA 4N0FB 4XP9L 4IIQB 4O00A 3L9RA 4ZUVB 5D6DA 3HMXL 3K4ZA 4HZLB 2YHGA 2HKFH 1XR8B 4A6YA 5FFLA 3NA4A 3UJTH 2ED7A 4PP2A 4HXAH 1K6QL 3MO1A 1AHWB 4FFWC 5TDPA 4DKEH 1KG0B 5DJYB 3O3AA 4RFEB 1KCLA 1YNLL 3VFTB 1FN4B 2WMPA 4LRIC 1TJHH 5F9OH 1TPXB 3TZVC 5JXAL 4FA8A 5EO9B 1T66D 4OGYL 2YUWA 4NT6A 3MREA 5MP6L 1YY9C 1I9RH 4C57C 2YWYA 1QSFE 4YC2B 4HMCA 1IAII 3UAJD 1Q9KB 1RULH 4K2UL 2XZCH 1MFBH 4F8TA 4MQ7A 1SHMA 4I77L 1KPRA 4D2NA 5I2IB 2AJXH 1Q9WB 2E9JA 2OL3H 3KYNA 5A16A 4LLQB 4F57H 2M1KA 1NKOA 1WEJL 3NVQA 4I9WE 3SDDD 4FABL 1JPSL 4OZGA 3SDDA 1A64A 3LDBB 2HN7A 2HKHH 3IDGA 3HE7D 4I0PC 1F90H 3HE7A 4W68A 2ARJB 4DEPC 3EYQD 1U8HA 2AW2A 3L3HA 3LB6D 2ORBL 3OKLB 4J4PD 5IVNA 1A7QH 1BZ9B 4J4PA 1Z9SA 2C3WA 2APTA 1ODAA 4UV7H 2NXZD 2YD8A 5GISH 3UJJL 1XCTA 1L7TH 1ZT7B 3PNWB 4Z5RA 4KPHL 3UBXB 4PTUB 4HWEL 4X7FC 4KUZL 5HJ3A 5E6ZA 1FL5A 4EI5C 5EU6E 2AEQH 4IMKA 3NCYS 1ZT4A 1RZJC 4BKLA 1JYWA 1PBYA 1MVUA 1PEWA 3HG1D 3HG1A 1MHHA 4DAGL 3IJSB 3LS4L 1EBAA 5T3XD 3AAZB 3PWVB 3ZDZE 1AGBA 2ZNWA 1OAYL 5EZOL 4G8GB 5JZ7C 3ORJA 1VGEL 1LP9E 1DBAH 4NRYB 2LU7A 4Q74A 4YUEH 1OP5H 4MB4A 1FVEA 4M1GH 4NUJA 3RUGF 3RU8H 1WFNA 5ISZD 4YX2L 4X80L 5ISZA 3BP4A 3QT2A 5DK2A 4YAQA 2Y1VA 4JGMA 1FSKB 4X6DA 3JTSA 1KPVA 1XF1A 3V6ZB 2HRPH 3QUZB 3L3KB 1VHPA 1I7UA 2EIZB 2Y36H 2YSSA 4HMDA 2Y23A 5D6CA 4WFHD 4LSUH 4X99B 2J88H 4TQEH 5JDSB 4YNYA 3C60D 2IPTL 1MSPA 3HPJB 3O4LD 4JR9H 3C60A 3O4LA 4NO3A 5CD5D 4MAUH 4APQC 3QDGD 3O2DL 3I2CL 3QDGA 5EFIB 4N0CD 4TPRH 4QRTA 32C2A 2XQBH 2E7BA 4Y5VA 3PABA 5EZLA 4ACPA 4Z95H 5FAAA 4YXKH 3BP5B 1I7RA 5DMJB 4LU5H 3DROA 4XP5L 2G9HB 1NUDA 4NQCD 4XP4H 4NQCA 4JFED 3QULB 3BJ91 3TBVA 5DJ0B 4JFEA 5EWIH 4LVEA 2V5YA 3IT8D 4LPWA 3P4NB 4EN3B 2P5WE 2Y6SD 4I5BA 3H3KA 4UDTA 3PGCA 1N8ZA 5FYKL 3S37L 1SJHB 3FFDA 2VIRB 5IIEB 1Z2KA 1OGAB 1ZK9A 4Y4FC 2DDQL 2EZ0D 1T0NA 2CMRL 3ZDXE 3VH8A 4L4VB 5K93A 3RJDA 2XOTA 5DXWA 3C9NA 3NPSC 5IROC 5AD0B 1EX0A 4HUUA 4M5ZH 1RI8A 2GY7B 1F8TL 2DLGA 5IBTL 2Q76A 3U7WH 4KGJA 3WYRA 3G5ZA 4JFXA 3RWJB 1DBMH 3G6DH 1BJ1J 1UYWL 1GGIH 4O2EA 4MLSA 4ZXBB 3ULUF 1MCJA 3OGOE 2R4SH 4HCRH 3ZDXF 1GGCH 3GHBL 1OP3H 3BPCA 4PJDA 3O4OB 4JY6B 2GAZA 1KUMA 1CD8A 1D5XA 4JM4H 4ZS7H 3UJIL 3AXLA 3FB6A 5EUOF 3MV8E 5ANME 2C5DC 4PYGA 4NOFA 1PLGL 1RUMH 3Q5YA 3BIAX 5IFHH 1PEZA 2F74B 2V17L 3FB5A 4Q9QH 1R5VA 5F96H 1D9KB 4R97C 2EYSB 2MPAH 3TA3D 3BVNB 3VXUB 3TA3A 1CF8L 4KWUA 3F12A 2XA8H 5JOFA 4NQXA 1QKZH 1ZTXL 2DQJL 3G6JE 3HNVH 1JF5A 1ZLWK 1MPAL 1R3JB 3SDAC 1MAML 4JFHE 1IEAB 1ZA6B 3V0AC 1I4FA 5FO9B 4HDIB 2NY5L 4Q9RL 2ESVB 4LKCB 1KB5B 4JAMA 3TC9A 1SYSB 2DTMH 5DDHA 4OZIA 1FZMA 1HWGB 2OTPA 3NCMA 3K0WA 5DFWH 5IV2B 1OGTB 1HCVA 2EEDA 5H8DA 3WLBB 1RZJH 3GJFH 2F53E 4LLUA 4PB9H 5HVHC 4YZFE 2VQ1A 5JDJA 2GYSA 4ONFH 4M3KB 1A6PA 1I9EA 1MCFA 1CFSA 2P8PA 2DLFH 2X89D 2Z91B 2X89A 2FIKB 1FPTL 4PJ7A 5BW7C 4QHKI 1VB9A 1G9NC 2GITB 3P0VL 3TPUA 1IAIL 4OKVA 5C0IB 1UZ8A 3BEVA 1CFNB 5SWQB 2VSDA 1RZKC 4P3CL 2D31B 2O5YL 2FGWH 2NY0D 4MA3B 5DTFB 4WW2A 2WBJC 1NBZA 4PJ9D 4PJ9A 5EBLB 1JGVL 2QQKH 4EXKA 2IF7A 3MLYH 1SMAA 3WFCH 4U1SA 5KAQG 4UNTA 2V6HA 3V79C 5LCVL 3MRJA 3Q1SH 3DGCR 4ZFFA 2IWGA 1CD1A 1W0VA 3RGVB 2WUBH 5EU3A 1FVDA 2H6PA 1BGXL 3VDCA 1I8LA 5TE4H 2V2XA 2R2HA 4N90E 1G1YA 4NQVA 1AC0A 1YMMB 4RA0C 4M7KH 2R4RL 4ORGA 2JB6A 5FYJE 5DD0L 1MCLA 7CGTA 1GIGH 4P46D 5E24E 3EOBA 4NQDE 1N5YL 2AEPH 3FN0H 4LLMB 4P46A 4KZDL 2X4TA 3ARFC 5IB2A 4G8FA 2XKNB 4C83A 4JO3L 2NY3D 4N9GB 2ADFL 1ZS8B 2O5ZH 5EUKA 5ICXB 2RFXB 5JW4N 3L7EB 4WY7L 1OAQH 2VXUL 4FNLH 4HIJB 4TNWK 1JK8B 4UDUA 3TPKA 4K71B 4KTEL 5CD3B 4Y5YB 2IFGA 2CKNA 2NY2D 2MNUA 3QSKB 4R90L 2H8PB 4OGZA 3GBLA 3FN9A 1CIDA 2Z8SA 2P24B 4NO0D 3G5VB 4X7TA 4NO0A 2C3VB 3CFKB 5E8NB 5B3JE 4MDIB 3DRTB 2XPGB 2WUCH 3JWOL 3C6LD 1SM3H 3I85A 4FMKA 3C6LA 3ZKQD 1FG2A 2C4FT 5DUBB 5I8KH 5L8KB 4P5TB 4OFDA 2HJKB 4K8RC 4UUJB 5DD6A 3RTQB 2JB5L 5DQJB 4GG6F 4QHNB 1A7RL 43C9B 2HTKC 4HAGA 4ZAKB 2VDOL 3I3DA 4HKZB 3NAAL 3WIHL 3K7UA 1S5HB 4MQSB 3WO4B 1IAIM 3CDFA 5B3JF 5JPMA 3MNZB 4KH2A 5MEOA 4UIKH 1KPUA 4CRPA 3BIBX 5DFVC 5FV2A 5JIKA 2ENYA 4Y88A 4YHOL 5KVEL 1GVIA 2A9ML 4XPAH 3MV7B 3LH2L 4ZS6D 3EIFA 2Q7NA 4QO1A 4U2YA 3LKPA 3LQAC 4S10A 3GB7B 1J11A 4XHQA 4OF3A 4YK4B 2Z35A 3LHPH 2VNCA 3HMXA 3QFDB 1FFOA 4UU9B 3HI6H 1FZOA 4FXKB 1RZFH 3LKRA 5JO5A 5AZ2H 2YD4A 1UEYA 4YHIA 5L9DH 3WFBL 5HHOD 4FZEH 5HHOA 5DJAB 1DLFL 3OXRA 3BZFB 4U6VL 3BW9B 1G9NH 1J0ZA 3KS0J 1UXWA 1PYWA 3SN6N 1LE5A 4KMTL 3WD5L 4PJCF 2Q87A 4B50A 2IALB 1RZKH 2OMBA 1FNSH 4LHUG 4OIIL 1JNHB 3PDDA 5GJTH 3OSKA 4GKSB 2MCPL 1F58H 2A0LD 3BDBA 3UYRH 4DTGH 1NMAL 2QQNH 1GGUA 1JF6A 2D9QB 3DRQA 2XTJC 2FATL 5J56B 3WO3B 3OAZH 3O6FD 3O6FA 5FUOL 4QOKD 4QOKA 5DMGD 1HKLL 1OF2B 1MRFH 1I8IB 5DC9B 1NQBA 4XCFL 4ZNCD 3D25B 4HFUH 2ZJSH 1XF5B 1PW3A 5KS9F 4G42A 4XX1G 5D7KD 5IFAH 4Z8FL 4YWGH 5GGQH 4G7YL 1CT8B 2PR4L 3RWDB 1JFQL 2DOCA 4JPVH 5GS1A 3WS6A 5DJ6A 1PG7X 3QO1A 3Q3GA 5MHSE 3QA3A 4JGJA 3BN9D 3VRJB 5F6IC 2QSQA 1NGZA 1GH7A 3RIAK 3X12A 3PE9A 1CLCA 2J12B 1TNNA 4JY5L 4OF5A 4IMLA 5D96C 2Y25A 3TZVB 4UTAL 4NYLB 2BRRL 4HBCL 1MCSA 4TOYL 5I1CL 5KG9B 1KN4H 4XWOD 4JFPA 3GKZA 3FZUD 4XBPB 1BFSA 4QY8B 3MFFA 3TNMA 3O0RH 4YHPB 3CX5J 3QH3A 5I17A 1DDHA 3D2UD 5AG9A 2CLVB 4XVUD 3VWKC 1J1PH 4KJPC 4NKOA 5LWYL 1KB5L 1GOFA 4GG8A 3U82B 4LLAA 4JB9L 9CGTA 3O2DA 2AK1H 4K8RH 1FNEB 5DR5L 4I0PB 4DEPB 1A7PL 2H32H 3SO3C 3OXSB 5FK9B 4OTXL 4ZD3H 1MJ8H 2W65A 4PJBA 2CLZB 1QRND 4FG6D 4OF8A 1QRNA 5IG7B 4QYOA 4I2XB 1OAZL 4DVBA 4JO1L 2E7LA 1UQSA 4OM0H 4PV9A 2J8UE 1UWGH 4CVZA 3FMGL 1DUYB 1FDLH 1PQZA 3JV5A 1JGDA 3KWWB 1Q94A 4X6EB 3DTXB 4EI5B 5E5MA 2FH8A 5FYKD 5D5MF 4PY7A 5AUMA 3KLDA 3O6KH 3LQAH 4OFPA 4RMTA 4NQTA 4XH2B 1IT9H 1NLDH 1H3TA 1E4XI 1RZIA 1T1YA 3U46B 3QEQE 4YDKL 1DANU 1G7QA 1L6ZA 3L3IB 3L3OA 3BUTA 4XC3L 4YDJB 4XCNA 1YUHB 4ELMA 3QCUL 3ZDYE 3TN0C 5D7SH 3S36X 3K8MA 1NCAL 4GOSA 4WEUD 3PDOB 3GUTB 1FE8H 4JQIL 2Q8AH 3GSRA 1FAIL 5KTEH 4IOFD 4LOUC 1NJ9A 2RAMA 3NTCH 4G9FB 3OF6D 3DVNA 5K9OB 1INQB 3OF6A 3KNBB 2X4SB 4APQB 4M8QB 1JNJA 1KT2B 4CADB 1LNUB 3ZDYF 1DANT 4R96B 3RDTC 1QR1B 4PTTB 1NCTA 3UJTL 5HHXH 4HXAL 3MA9L 4M61A 1A6UH 2P8MA 3B9KD 3B9KA 5CEZH 3C2AH 4NKQB 1MH5A 5CWSB 3L5WB 3HTLX 5MEND 3IJYB 4MXQC 3GEWB 3SGJC 5HI5C 5MENA 1JMZA 4LBEA 1Z9LA 3UPRB 3PWUA 3PWPD 2DWDB 2EE2A 1AO7D 2QEJA 3PWPA 3S35H 1XF2A 2E7CA 5KN5B 2YBRB 1BVKA 1MCPH 5MERA 2EYRA 2WZPD 3BX7C 1QPXA 2EH7L 4Y4FB 1T83C 4M03A 1ZA3B 4I13B 1I8KB 2R9HC 5F3BB 2XWTA 2AJXL 3STBA 5MEQB 5KSBA 3GI9H 1U3HC 3DVIA 3NPSB 1S9VB 5GPRA 4F57L 4UT6H 1RV6X 3HC0A 4Y19B 1PKQB 4UB0L 5EC1A 1YEDA 4O51B 3CFEA 3U4AA 3BFOA 5E03A 1WBYB 3BEWA 4UV7L 3QDMB 3D85B 5C6WH 2HJLB 5B4MD 2BCKA 4K3GA 4PIRF 1IQWL 5JNYA 1WK0A 1AXTL 1K4CB 1H3XA 4HWBH 1EHAA 5EZJA 4Q58C 1MWAL 3RPIA 3ARSA 3EO9H 4Q6IC 4BFIA 1RJCA 4L9LA 3N1MC 2QQQA 3MUZ1 2V9RA 4OI8A 4TUKH 5I1KH 4R97B 1C5CH 4PJ8B 3QIBD 3PWLA 4HK3N 3QIBA 4ZUVA 2IH1A 2YD2A 3QDJE 3HZVA 4FQCL 5C7XL 5L2JB 1XR8A 4DOHE 3RWIA 4XAKD 1FLTX 3NCEB 3MV9D 4QT5B 3MV9A 3SDAB 1OAUH 2CIKA 3MGTB 2P43B 1I1AC 1DL7L 1WISA 4JHBA 4AQOA 3I02B 3QCVL 4BZ1L 2V9TA 2HT3D 3FKUS 1Q9KA 5SV3A 4B0MM 2EDWA 4I48B 4LSUL 5HVHB 4KY1H 4KKBC 1N64L 4QXTB 4MAUL 1CXEA 3CUPA 1DLHA 5F8RC 4TPRL 1N2RA 5HVGB 4D9LH 1JPTH 4LLQA 1RZ8A 3KDMA 1W8NA 2CK0L 1MCWW 4Z95L 4NRZB 1B9ZA 3EDKA 5A2FA 4HS8H 3V5DA 2ARJA 4LU5L 4JKPL 3OKLA 4JRYE 1S5IH 1BZ9A 2XG5A 4EUPH 4YHNB 2APXA 5FEBA 2H1PL 3FT2B 2IJ0C 5JOEA 1AE6H 4CN1A 2WBJB 3QNYB 5T1MB 1ZT7A 3PNWA 3F7YA 3UBXA 3BN3B 4PTUA 1LO4L 2R0ZH 3MGAA 2H2SD 3TH4T 4JN2B 1UM6H 5EOTB 1YMHB 4HPYH 3ILQC 2QSVA 1DVFD 1QBLH 1DVFA 2ICWB 4HWZB 3DO7A 3AAZA 4ESKA 3OX8B 3WIHA 3U4BL 1M7IA 2ZSVA 3PWVA 4AG4H 3FHQA 4G8GD 3O2WH 4G8GA 3IAPA 2ICCA 3DOSA 4NRYA 4EUPG 3DPBA 5IQ9B 2D3VA 4CVXB 1QR4A 2BY1A 5J4MA 4LCIH 2V2TB 2W07A 3SY0B 5C71A 2ADGB 2IQAA 2XIDA 1EAJA 2G75A 1FORL 3CX2A 3P11L 3REWB 2P48B 1QFUH 4HJJH 3ARFB 4J3UA 1EAPB 4JM4L 5A3IC 5FOBB 1DZBA 1ZVYA 3V6ZA 2V7NA 1NMCC 4X83A 1YJDC 1UWXH 3E8UL 4ONOA 1MCHA 1SJEA 3DYMA 5DJ8A 3GSXA 3MGOB 4W6YB 1RUPL 1I3UA 4UV4H 4XWGL 4Q9QL 5GSRB 3HPJA 3LIZH 4LNRA 3C8KA 3BXNA 1ZHLB 4OSUH 2HMID 2X40A 5C0JA 5EFIA 1HDMB 3KR3H 5B38A 2VJXA 5D2LE 2EXWD 4PP1C 4EQ2A 3SJVE 1R6VA 3L7FB 4J3XA 5E9DE 2J5LC 1A1NB 3NCBB 2QHLA 2G9HA 2NNAA 4HQQL 4OCSL 2GEEA 5CAYB 5F1NA 4MA8L 3VD3A 4EN3A 5BS0B 4U1JB 1NFIB 3VXRB 5B3NA 2ZNXA 1G84A 5DQ9B 2H32B 4BUHA 4HGMA 4H25B 1TZIA 5BV7L 1SJHA 4YIQA 4IRJD 1OGAD 2VIRA 2YD6A 5D2LF 2PCPB 3QQ9C 4TTDC 1OGAA 5IIEA 2Y4SA 4ZSOE 1RIHL 3S9DB 3OJDB 4NQUA 5I1GH 2B4CC 4UIMB 4L4TB 1Z6JT 3ULVF 2IAMC 3PV6A 1DBBL 3IU3A 5AD0A 3BP6B 6CGTA 1BZ7B 3T08A 2YPKB 3GSVA 4FTVB 1MEXH 1OD9A 5DHYB 4NUGH 2QADD 5JLZB 1YPZB 1TVHB 5JOPE 2DWEB 4ZXBD 1UB5B 3DURB 3K81A 4ZXBA 1QVOA 3N85H 4GQ9H 5A43C 3CGTA 2BY3A 4G6AC 3QHZL 3MFGB 4B53A 5DUPH 5HPMA 1IEHA 1CI5A 3T4YB 4JREC 2E9BA 5INCA 4NPYA 5KJRL 3IAQA 5SWZB 2ZCLL 4GRMB 3QXDB 1A7OH 1FFQA 3WFCL 4WI3A 3ZHKA 4X4MA 1NFKA 2CJUL 3C87A 3E6FA 1CK0H 1D9KD 1D9KA 4X98A 3D6GA 4WFED 4LSTH 3BVNA 4DZBB 4U7MA 2W1NA 5K33A 5IWLC 1X9QA 1QPPA 1ZHKB 2DQTL 4M00A 3VXTB 2DS4A 3KPSD 4ZODA 3KPSA 1R3JA 2DLHA 3L3DB 2XTJB 1IEAA 5J6GB 4V1DB 3NFPB 5FO9A 3EGSB 4HDIA 3LY6A 2AEPL 2ESVD 3QB7C 1TZGL 2PYFA 1LD9A 4PJHE 2ESVA 4U6YB 5SX4H 1KB5A 1HQRB 1FNAA 1SYSA 2KQNA 3RY4A 3W82A 3MRBB 1CFBA 3IDNB 1IEBB 3UO1H 2FX9H 3AS1A 5CIPA 1OGTA 1IKFH 2PTUA 3E1F1 3WLBA 3RVTD 2EIDA 1QQDB 3TFKC 4FNLL 3BO8B 4HUVB 2FR4B 4KHTL 1EFXD 4GW1B 3BKJL 1EFXA 2LAAA 1BF2A 1QFWI 5CSZB 2Z91A 4KRMB 5JUEH 2NX5E 5CP3H 4HG4K 4QKXB 2YEZB 3OKEB 4MHHI 5D71H 3B8YA 5AAMA 3D48R 3ZT7A 1QNZL 2IGFL 3LMJL 2FEEL 4GLRH 2ITCA 1T80A 4OI7A 2GKIA 2BFVH 3U2SA 1OTSC 1VPOH 3DV4B 3INUH 1S9YA 4MQXC 5F6IB 2WUCL 3KYKL 2D31A 2DL2A 5C0BD 5AYQA 4JPKH 2GTZB 3B43A 2JKXA 3P4OB 1M71B 1YJDH 4NSKA 1FLRH 5I0DA 4L1HA 2R8SL 2AVGA 3O81A 5EBLA 4OV5A 1K85A 5D96B 1CGUA 1BVLA 3MMEB 3VFVB 2GFBB 3RVUD 3U7YH 1YNTB 4EIGB 1XZ0A 5LQBL 3HNTL 4LIQH 1WBXB 1HK6A 5F3HB 3V5HB 2HH0H 2VDML 4PJGB 1SJXA 4JG1L 3QXTA 1MNUL 2CPCA 2KZWA 3STLA 5GRVK 3RGVA 2AJYH 3BRDA 1BF8A 4GBXC 5ICZA 2NTFB 5DA0B 1YMMD 3VWKB 3IDYC 3JV6B 4N5EC 1YMMA 2VAAB 2CSPA 1KCSH 1VGKA 4MB5A 1SEBB 3LSOB 3SO3B 3LHPL 2ARJQ 2VLJE 3HAEH 4DGYH 4UINL 5I66B 4JVUA 3KPOB 3EO1B 3RWCA 2RFXA 2B4CH 5AZ2L 1RVFH 5HHMB 1JK8A 4J3SA 4U1KB 2ZCHH 1JMXA 1WITA 5CD3A 4Y5YA 4M6AA 4U1NB 4PJAA 1KYOK 2H8PA 4R4ND 1QG3A 3S88L 3BRGC 5K9KB 1YECH 4LAJH 2P5EB 1Q38A 2MQCA 2P24A 4L5FL 5T3ZE 3G5VA 3ULUC 3PUCA 1DEEB 5E8NA 5CJBA 5BVPL 3HAEG 3VFOB 4BJLA 2F54E 1EEZA 1J0KA 3Q6FB 3QWQB 5T1LB 2BNQE 5DUBA 3QAZC 3C5SB 2XYCA 3DYOA 4QLRA 5DQJA 2E27L 1AQDB 2FX7H 2BY0A 4PRBB 3QQ4B 5HYSB 5A1AA 4QHNA 3CDYA 3WJJA 4MLIA 3DLQR 3TN0B 3SCMC 43C9A 1U8OB 4EUPB 2OLDA 2ZJSL 3RL1A 2BVPB 5CZXD 5HPOA 4H20H 4Y2DC 5C0GB 4O02H 4BZYA 3UPCA 1ZHBB 1J1XL 1YDPA 5GHWH 2NY7H 3Q6GL 3RWHA 1MWAA 4LARH 3MV7D 3MOAL 2Z4QB 2QL1A 5E5RB 1GGBL 3MV7A 3VGFA 1ZLVH 4JPVL 3V7AE 2B0SL 5GGTH 3PHOB 4DK3A 4KDVA 4D9QE 1RHHB 3ELAT 1MELA 5GRJL 2W0PA 3RDTB 3AU1A 3QUKB 3I75A 5I6XC 3RRQA 5CJOL 3QFDA 4GMSH 4UU9A 4WHYH 1BBDL 4FXKA 4O2CA 2Q8BH 4POZD 3VXOB 3U36B 2HRLA 3WBDA 1KULA 1S9XB 3NH7H 1OCWL 4KVNH 4PJEB 2NPLX 3RI5F 1HH9B 5C1MB 1FNLA 3CFCH 1XIWC 1WZ1H 4ERSH 1QZ1A 3RWEB 5BCAA 2IALA 1MCWM 3EHBD 1V8HA 1QEWB 1U3HB 3GMLB 1MUJA 2PO6B 3S5LG 4PJ5E 4GKSA 4AH2A 1D5MB 1HQ4A 3ARUA 2VDLL 2AK1L 1C1EL 4K8RL 5JIPA 3BSZL 1X5FA 4WHYG 4NQEE 4Z18A 1FC1A 4FOMA 4XVTL 1MJ8L 2YOCA 3BE1H 1OF2A 2Z92A 3QNXA 1I8IA 4P99A 4FFYL 4XPFL 4WO4D 4AJ0A 3SE3C 5D7IE 3UXFA 3D25A 2DD8H 2VL4A 1T89A 3ARTA 1XF5A 3FQNA 3FRPA 1BM3L 4JE4B 3WLWD 3BZEB 1SBSH 5KSAC 4JFFB 3H3PH 5B22A 1NCUA 4P2YA 4WI4A 5GGRB 5L88H 4GW5B 2ILLA 3L5HA 1CT8A 1MY7A 2J6EH 3O6KL 5A2LH 2FB4H 4U1LB 2N7AA 4XXDA 3EYOB 2GJJA 2IG2L 1IT9L 1NLDL 3ESUF 2DRUA 5GGSB 1GC1L 4Z7NE 3MBXH 5JMRA 1B0RA 5D7IF 4U1IB 3KPQA 2XICA 2EDKA 1T03L 1RZ7H 4FFWD 1T5WA 1E4XH 1EO5A 2VRAA 1T2QH 2G5BB 1LK3L 1CLZH 2XN9D 3TO4D 2XN9A 3TO4A 5IQ7H 3GSOA 4NYLA 3EJZC 2P46B 2OI9C 3VCLA 3AM8C 2CKBH 1D7FA 1J05A 4LCCC 5TF0A 5KG9A 5FUZL 3KLAB 2Q8AL 5IM7A 5D4QA 4Z7NF 3NTCL 3MRMB 1JWUB 4M6NH 4MZ3A 4LDOB 4ETQB 4DUWA 3ULUH 1LWRA 2I27N 5TDOB 1U8QB 4WU7B 1EO8L 4TSCH 1M6OB 3VXQA 3WFDH 4JHAL 1A6AA 2CLVA 5EU4B 4FQLL 5IMOB 2YPVH 2W0KA 1WJ3A 2DQCH 1UCTA 5DEFA 1FNEA 2HT2C 5AYUH 1R5WB 5H35B 1IGCL 5ITBL 3OXSA 5FK9A 3WNKA 5CEZL 2CLZA 3C2AL 1KFAH 5IG7A 3SPVB 4L29B 3A0OA 4F7TA 2QSCL 4P3DB 1DUZA 1MCDA 2DM3A 4X6CF 1MCRA 1WFTA 4WWKD 4WWKA 2OZ4H 3HNSL 3GZKA 1MCPL 1CGSL 3KWWA 3NIFE 4I3RH 4HS3B 4I8DA 1EGJL 1KLUB 3DTXA 3X3GL 3MRRB 3PGDA 4F7EB 3HUJB 4OCRH 3VA6A 1AGFB 4NZTL 1YYMH 2XXCB 2AJZB 4EXPX 3ARDC 3FT3B 4XH2A 3WFEH 3ROLA 1JP5A 5JZ7D 3W5MA 5DJZB 2UY7A 5IB1B 4OIAA 4P4KD 4YDJA 3T0VA 4ZYKA 5IB3B 1F4WH 4P4KA 3MSPA 5TQ2L 3NIFF 4LSDA 1YUHA 1KIQB 4FQ1H 5HGGS 4RAVA 1Q72H 1LDSA 3VW3H 3GHEL 3GJEB 3RL2A 3KYOB 5HDQH 5IEHB 1UM4H 4H26B 4JFDD 4N8CH 1JI2A 4JFDA 1NMCB 4WEMB 4HWBL 3TEUA 2QHRH 3PDOA 5FKPB 4KGLA 4OT1H 4MJIB 1FVCB 3EO9L 4JVWA 3UTOA 4G9FD 5F44A 3MXWH 5IHZB 4G9FA 2EDQA 1J88A 1S7XB 1INQA 4XPBL 2PF6A 2X4SA 1F2QA 1N5AA 2D03L 3G6AB 3HI5H 4PRHE 2AKRB 2UWEA 5E8DL 1YEEL 4IDJH 4Y4HC 1UKSA 3GSUB 1KT2A 4ODXB 1WWCA 3GSQB 4YR6B 1QR1A 3IGAB 2J5LB 4PTTA 1ZT1B 3BGFC 1FL3B 4L4VE 4KJYB 4KK6C 2CDGA 1FGNL 1KXQE 1NCCH 2NQCA 3EZ8A 4PRPD 5CWSA 3IDMB 4PRPA 1A6TB 3VGEA 4GRLD 4DW2H 4KAQH 3ES6B 2DWDA 1MRDH 2C3XA 3OKKB 4U4BA 3MUHL 1KC5L 2YBRA 4E41D 1RZGB 4E41A 2KKQA 3HAEB 1QO3A 2VLKD 2VLKA 3ISWA 1EBPA 1I8KA 3GSNH 1IC4H 3LQMA 3MRPB 5MEQA 2IAMB 4DN4H 4GAGL 4YLQT 1S9VA 4IJ3C 3NFSH 4Y19D 4NN5C 1C5DA 4Y19A 1PKQA 3U79A 4Z78B 3VFGL 2G60L 4HS8L 1F3DJ 1ROWA 2A74A 5FUCC 1AXSA 4CVWA 2EXYD 4RGND 5F97E 5I1AB 3T3ME 4X4YB 2CDFB 1MJJB 4X4ZA 2B2XH 5CGMA 5FO7B 2HJLA 1I1FB 2DQDL 3VXUE 5FYJH 5K9JL 3EYFB 4JREB 4TNVF 4HF5L 2R0ZL 4OD2B 1E27B 2ZSWB 3E3QE 5TE7H 3CMGA 3QUML 4PJ8D 1QBLL 4PJ8A 3TBTB 4XVSH 5F88B 3MOQA 3BQUB 3H42H 3QG6B 5L2JA 4P5KB 5H2BB 3WL9B 1QSFB 2Q3ZA 3TJHD 1I3VA 2UV3A 2VSCA 4FXGA 1RU9H 1OSPH 4L3CB 5EOCH 2EDRA 2GK0B 3P77A 4WI9A 4WNQB 3MGTA 5DSCB 1R3LA 1U8NB 3T2OA 4HJJL 1EHXA 4QRSB 3PWJB 3T0EE 4Z7VE 4LNVA 3VFRB 4LVHC 3S5LB 2VUYA 2DI9A 3FO1B 3GSWB 1LE9B 2MQ3A 4HUXB 4X9GA 3S97C 4ETYA 5LGJA 3S4SG 2X4QA 5E8OB 4R8WH 5JORA 4HC1L 1A1MB 4POYA 2DIJA 3V6FA 3AS3A 3W0WD 5DZLA 3RUGB 3W0WA 4Z7VF 3S7GA 4OD3L 5LG1A 3B2UC 1ZE3C 1DQTA 1RURH 3FT2A 5HI4D 3HLAB 4R2GC 3WXVH 3V6BR 3MUJA 2WBJD 2WBJA 3ME0A 3QNYA 5T1MA 1NCWH 2CGRH 2MKWA 5C0EA 4JJ5B 4CN4A 3IFOA 2AK4B 4BFGA 4NZRH 4HH9A 2NXYC 4WHDA 3RBGA 1BEYL 4J8RB 4JN2A 5ERWB 3FFCD 4CMHC 4LSPH 2AXGB 1K8DA 3FFCA 5EOTA 1KEGL 4JDZB 4MQTB 5F7MC 1J8HE 5TFSH 3IU4L 3K4AA 5IVZB 1NDMB 2ICWA 4JFZH 4HWZA 4ZUWB 3OX8A 3E0GA 2NZ9D 4LQFH 2A9NL 1YZZA 3IVKA 2EKSA 4CGTA 5IQ9A 4GBXB 3MROB 4CVXA 1MCQA 3IDYB 4KI5E 1U0QA 3SY0A 3N85L 1IC7L 3HPLB 4JFYB 3IXTB 4D0BB 3TIDB 4GKZA 4WJ5B 3EYSH 2FL5B 4NWUH 3REWA 3HFMH 4LASH 2FNBA 3JWNC 4ODUB 4BZ2L 4F7CA 3WUWA 2W38A 1EAPA 2X44D 5FOBA 1OSZA 1V05A 2DBLH 2DJ4A 3RZCC 4ONGL 5J6HA 3V95A 5C3TA 3QJFB 1PSKL 1PX3A 1V3MA 3LAFA 3MGOA 4NJAL 3QEUA 1JWSB 1A7OL 2W59A 3RY6C 3CXDL 4B5EA 1Q0YH 4L3EB 3L95B 2F5BH 1ZOXA 5E2TH 4P2RB 3IS1X 1GSMA 1ZHLA 2KDGA 3MLSL 4MNGE 1N4XH 1ZEAH 3GIVB 3WNMA 5I73C 5F7DB 1MJ7H 5H94B 2VH5L 1BQSA 3D9AH 3HR5A 3OPZL 3W9DB 1A1NA 4ZFZB 5HYFA 4LK4A 5F7WC 4XMPH 2HTLC 3WHE0 5KW9H 2OXGA 1ZAGA 1A6ZB 1I7TB 5EUOB 4YHLH 5JQ6L 2Z93B 3QAZB 4LCYA 4K8RD 3GI8L 3AREC 4U1JA 1KCRL 2EKJA 1J1OH 2DMBA 2H32A 4P2QB 4H25A 1S7VB 3HE6C 5TGBB 2ZOLB 1DBJL 4OIBA 5CGYD 3SCMB 4HKXB 5C3LD 4LLWB 1CDIA 1A9BA 3SGDI 4L4TD 4UIMA 3B2VL 5BOPA 7FABH 4L4TA 5IVOA 4FFZH 4Y2DB 4LFHG 5JUEL 1P1ZB 3KYMA 4AZ8A 1ZLVK 3RGHA 1MF2H 3QQ3A 3BP6A 1F2XK 3AS2A 3DVGB 3V4PL 5CBEB 2YPKA 3V0WH 1HXYB 3RIFF 1QFWH 1QSZA 5C8JA 4Y89A 1GJIA 3CZFB 5D7JC 1TVHA 2DWEA 1VPOL 1EEYB 3DURA 1V3LA 3CLFH 1B6DA 5E70A 3LPFA 4JPKL 5GS2H 5JTWA 1YEHL 3HMWL 2HT4D 5I6XB 4FMFA 4X6DF 5F9JB 3MLTA 3U4EB 5SWZD 4JFQB 5SWZA 4RWYH 4JRXD 1R0AL 1D5ZB 4JRXA 4GMTH 2VDPH 4M43H 4RBPH 4W4OC 2DQFB 1U36A 4YXHL 5DQDH 5E95B 3VXMD 4R0LC 3VXMA 1XIWB 3K2UH 3E6HA 4MHHG 4DZBA 3VFNA 1YNKH 2AJYL 3T4AA 4P3WA 1P7KB 1JN6B 1ZHKA 1X6LA 1T1XB 2VDRL 3ZKNC 3ZE0E 3VXTA 2OK0L 1OM3H 4MZ2A 1J8KA 5FM5O 3CXHJ 4PG2A 3V8CA 5J6GA 3NFPA 3BISA 3LV3B 3EGSA 2DICA 3CZJA 1DSFL 1RJLB 3MRBA 3LEYL 1WAAE 4HEPG 3GMPB 1DQJA 4EIZC 1I3RA 2JJUA 3S34H 3VDBA 1QQDA 1MFDH 5CEZD 5E56A 3BO8A 5BVJB 5BZDB 4HUVA 1P6AB 5BZWA 5D8JH 4TVPL 2ZCHL 5GGVH 3ZE0F 2D0HA 4Q97A 3IS0X 5CSZA 1G7JB 4PV8B 2A6JB 5DS8B 4F7PB 5KSAB 1EEQA 3OKEA 4KQ3H 3MR9B 1KLGA 2D7MA 3ARBC 1NGQH 1EGJA 3VI3E 2FSEB 5HGAB 3DV4A 3QNZA 3RAJH 4OCWL 4AENB 4M1DH 1VEPA 3BOVA 2GTZA 3P4OA 4WV1B 1M71A 4NZUL 1AXIB 2Q20A 3DV6B 1FYTD 4QHMB 4PJDF 4D0CA 1MFEH 4U6HB 1FYTA 2D9CA 2W9DH 4U31A 5IMMA 5C07D 5IW6B 5CKAA 5I30H 5C07A 3VFVA 1FC2D 2OI9B 2GFBA 3FAWA 2BVUA 4LHQB 3TVMB 3IRPX 3CSYA 4H20L 3GRWL 4X7SH 4ELKB 3SKNB 4O02L 2Q86B 1QBAA 4NQDB 4PRID 3OAYH 1NMBH 3V6OC 4TSBH 4F15C 2XFXB 2NY7L 4HWBA 3C6SA 1H8OA 4I2XE 4LARL 4HJ0D 5EBWB 4WTZA 1YEJH 1FZKB 5TPWL 4ZTPL 4N0UB 3VWKD 2NTFA 4U05A 3VWKA 4RIRB 3JV6A 1BJ1H 4DZ8B 5C0CE 2VAAA 2R23B 1N0XH 4TULH 4QRRD 3GFUA 4QRRA 3BAEH 5FCUH 4P2OC 1E4KA 1SEBA 3LSOA 4GG6B 5D1QC 3WFZA 4NNXB 5IVXA 1AR1D 1X5IA 5ESQB 4D94A 5I66A 5JIHA 4OZIF 3KPOA 4CNIB 2MSPA 1T2JA 4BQCA 1OT2A 2YC1B 1L0YA 5HYQB 1VERA 3ULVC 3RKDC 1OVZA 4U6XB 5GS0C 4JN1H 3UTSD 5JR1H 4ODSL 1CICC 3UTSA 2VABB 1NGPL 2LE9A 4J2XA 5K9KA 4K7PL 1R3IH 3QPQC 4LDLB 4Y5XA 4RMSA 2A6KB 4UZGA 5T1KB 5HHPB 1DEEA 3ARDB 5DJDB 4DGIL 1KJMB 1OHQA 2XWJA 4K23H 3LZFL 1A6WH 5JHDE 3VA2C 5T1LD 1H3PL 2OJZH 5T1LA 4UBDD 3N1QC 2EICA 2BDNH 3BE1L 1AQDA 2CDEA 4WW2F 3QQ4A 4F37F 3P30H 5HYSA 3MJ9H 3TN0D 5JA8B 3TN0A 3BESR 1U8OA 2DQHL 2GQHA 2BSSB 2BVPA 4KC3B 1Q9OB 3HN3A 1D3CA 3QZWA 4OFVA 1L7IL 3BGMB 2WIIA 3MQIA 2R69H 5KVGL 1SBSL 1SYVA 4OZHA 1TCRA 4PJCB 1ZHBA 3T1FB 4JDTH 4ORZC 1S7TA 4KDTA 3KJ6H 4J12A 5JW3H 1JHTB 1OQOA 5GSVB 4RISH 3T65B 5EPMA 4JKWA 3CVIL 3IDJB 3C09C 2VLRD 5KSVA 3G5YB 2VQUA 1IAOA 1F6AA 3BGFB 3UPAA 3F65A 4G3YL 1NCDH 3HZYA 1IC5H 1P2CB 3O8XD 4W6WB 3O8XA 1CLZL 4DVRL 1IZKA 1I7ZB 5IQ7L 1AGDB 5C2BL 3NPZB 3DUSA 3FTGB 5KS9B 3PHQB 5IHLB 4MAYC 4LF3A 1BLNB 1S9XA 4FHBD 3DX7B 5F7YC 5CJQH 3BIKA 3PG2A 4JDVA 3TWCL 1GGYA 1E6JH 1TJIH 1P9MC 2YN5A 3CVHH 1INDL 1TLKA 1EVTC 3IAGC 2F5AL 3QDME 1LO5B 3T3PE 4KUCF 2K9UA 1U3HD 2B1HL 1U3HA 2PO6D 3S96B 1JZ2A 2PO6A 1OTUC 1FCCA 2RGSA 3GBNH 4IJ3B 4JO2H 4NN5B 3MUGB 4WUUD 4WUKH 4WUUA 3WHE1 1N6QH 4MJ5B 4HC1A 4U49A 4CU8A 5AYUL 3VGGA 3UZEA 3B3IB 4YBQD 1F4XL 5ALBH 4PD4K 2C1PB 1AJ7L 3ARXA 4LAQH 1WCBB 3FOMA 5HHNB 2X4PA 4N8VA 4QRQB 1HI6B 3T3PF 2DIAA 3U0WH 1NBQA 5EZIL 4FQIL 2WV3A 4I4WB 1KCUL 3SQBA 3PV7A 3UTTD 3BZEA 3VWJC 3UTTA 3MXVL 3NZHH 5FGCB 4F33B 3GK8L 4M02A 3CFDB 4ZPVB 1DR9A 4U1LA 4WI8A 2MCG1 4XBEH 3EYOA 3WFEL 3AFLA 1HE7A 3CSBA 1Q0XH 5ESAB 4E0RB 2XZZA 4U1IA 5SWSB 4N8PA 1GAFH 2W60A 3VMOA 3C5JA 3G04A 4FQ1L 1NGWA 2QQLH 3ULVH 3O3BB 3VW3L 1Q9LB 3RWFB 5GS0H 2I5YL 1HHHB 5TF1L 1FQ9C 3VE0A 4N8CL 5B8CC 2VLLA 3ZYJA 4YHMH 4LVHB 3JTTA 2CIIA 1DQQA 4AEFA 2EC9T 2QHRL 3KLAA 3ZL4L 1YC7A 5D5MB 1JTPA 4XX1E 4KKBD 4UAOC 5DT1L 3B8SA 3MXWL 4JHWH 5J1AB 5TDOA 5EOQH 1U8QA 4WU7A 5HDLA 1A6VH 2GUOB 2EIBA 3HC4H 1MI5B 3HI5L 1M6OA 2N7BA 5FDYA 3BDYL 4MNHA 4N1HB 4JPWL 5EU4A 1RFDH 1MLBA 4AL8L 3VU2A 3SDCC 3H9SE 5I19H 1BQLH 2EDOA 2ZP0T 4Z0XA 5I74C 3FOLB 4OLWH 3SDYH 2LU4A 4RMUA 3DETC 2W9EL 3QR2A 2O5XH 5EN2B 3OR7B 1FZJA 3DMMB 4L29A 2F19L 3UC0L 4CJ1A 4DW2L 3X3FH 4P3DA 2BK8A 4IS6A 4IRZH 4R2GB 2EE9A 1YY8B 3CH1A 4ALAH 1ORSB 2YPLB 3CLEH 1JRHH 4GKNB 2AJSL 5FECB 5F6HI 3CK0H 1T7WA 3F58L 2R0KH 2VDQH 1KLUA 2NXYB 1T21B 1UJ3A 1BZQK 2CRIA 1A0QL 3MRRA 4CMHB 2P8LB 1FRGH 3HUJA 1AGFA 4EI6B 1IC4L 3VXPB 1NBVL 3OL2A 2GJZB 4H0IA 1BQHG 3PWNA 5F7FA 1JNLL 4GAJH 2EC8A 3FT3A 5DRZA 5DF0A 1LDPH 2YZ1A 1QP1A 2YRPA 3VGHA 5DJZA 4URTB 3IXAB 3X13A 3HS0B 1P53A 2FHCA 4RMVA 5IB1A 3IDIA 4DCQA 5LXGH 3IB4A 4Y1AD 4Y1AA 1FFNB 2X1PA 4K3HA 2BVOB 3OG4B 1LO0L 1JF1A 4WGWB 5FYJL 3GJEA 5IEHA 3KYOA 5A3ID 3EDEA 5IHUL 4U1HB 5FGBC 2ZUUA 3SE9H 4QWWC 4WW1B 4KQ4L 3HCVA 4C59B 5IHZA 4M6OL 1T3FB 2EYTA 5F9AC 4FQHB 3WFHA 5FDWA 5I1IL 1VFAB 3TESA 2DLEA 2AKRA 3QXVA 1S78C 5BS0E 3VXRE 3GSUA 2A77H 1MREL 3RBSA 3OZ9H 4WEBH 3IKKA 2VDNH 5I1HH 5I73B 5JHLL 4AMKH 4YR6A 2A2QT 1MLCB