1KEMH

Catalytic antibody 28b4 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
EVKLVESGGGLGQPGGSLRLSCATSGFTFTDYYFNWARQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQGILYLQMNTLRAEDSATYYCARWGSYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 28B4 FAB
publication title Insights into antibody catalysis: structure of an oxygenation catalyst at 1.9-angstrom resolution.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kemH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kemH01
1LEIA 2DQGL 2CMRL 1QNZL 5DMKB 4YHOL 1IGTA 1KIPA 2VKWA 1HHIB 4JDTL 5JIKA 1FDLL 5C08A 5F88B 3DX6B 3FT4A 1F13A 4U1KA 3P4NA 1AXSA 4NNXB 1BFOA 1QSEA 1EFXB 4JB9L 3TWCL 4PJ7E 4A6YH 5L8LB 3M17B 2XN9E 3B9DA 1JMZA 2JB6B 1IEAB 2YN3A 3CCHB 5IGXH 2VXTL 4Y1AD 2PETA 4JM2A 1CDCA 2YK1L 1DVFC 3HZVA 1IARB 4X6CF 1JL8A 1T7YA 5BXFB 3LKRA 4OZHE 4X80L 2B1AH 1K4CB 4NFCA 3U83A 4LFHG 3IDYC 1ADQA 5JMOC 4V2BA 1X3DA 2VXQL 4P9HL 4CVWA 2A0LD 5CJ5A 4H5SB 1BFTA 2QHRH 4OLVH 5MEOA 4DKAA 1Y18A 4XPBH 4PP1C 3WN5A 5GS0D 4OF0A 2RCSL 1I8LA 1J7VR 2C3HA 2WBJC 3MFGB 5CEYB 1A7QH 5J56B 2AI0H 2EDLA 4K8RL 4OLWL 2G60L 5EUOA 5DQJA 4P5KA 4YXKH 3HS0A 2BVQA 3OJMB 5DSCB 2W59A 3QFJD 3PV6B 4YPGA 2SEBA 4R90H 1FH5H 1MIML 1UZ8B 3WIFA 2VO5A 1A8JH 3VXRE 1CICB 5I0ZA 1FO0H 3WHXA 3ES6B 4G7VH 4QRPE 5KAQG 4KROC 1XF2B 3AXLA 3V5HA 1PZ5A 3PL6B 4P2RE 3M1BB 1YJDC 3QBTB 4PY7A 3QHZH 4CU7A 4EUPH 4I0PA 3EDEA 4G6JH 2G5RA 4K7PH 3GI9H 2GEEA 3QFJA 3BYYA 4E5XB 1RZIB 4YK4C 4RWYH 3CPLA 1X5KA 5D7JA 1C1EH 1T03L 4J8RA 4C58B 1S9XB 1KN4L 4K71B 2AJUH 5KG9A 3LKOA 1FRGL 3H42H 4PREA 4JFOA 4POZC 5KVEL 4PGCB 4OQTH 5KTEH 3G6JF 1HILA 4DQOH 5HYFA 4U1MA 5K9OB 3FB7A 2FX8H 5TH2B 4NWTH 1AO7D 3EYSH 4JFHD 1JNJA 3FN3A 3S35X 2Y4SA 5DJAB 3UZEA 4YLQT 1NGZB 3S5LA 3BH9B 3UTTD 5DUBA 2LAAA 1A4JB 1JP5A 1P5UA 3HMXL 1G7MB 3QNZB 4NC1E 2P8PB 1OAQL 1ZV5A 3NACH 2R1WB 4EDXA 3LZFL 1KIQB 5DJXB 3QNYA 4NCC1 3N85L 2X4OB 2AQ2A 4KJQC 2A1WL 3LD8C 4P23D 3RRQA 2UZXB 4RGNB 5CZXC 2HT4C 1CK0H 2W1NA 3EDKA 4OD2A 3KS0H 4QHUA 5ID1A 3QUXC 4RWHA 5FM5M 5E6IB 5A2IH 4OCWL 2HAZA 2ICWI 2PN5A 3OB0K 2UWEA 3FOMB 2ARWA 3UTTA 1P6FA 4HMEA 1UFUA 4PV8A 1C12A 3PWPB 5GRZA 1RIVH 4QNPE 1RD6A 1EHNA 5IW1A 3VXMD 2J2ZA 3OJVC 4KRPC 3LN5A 1CFNA 3F7YA 4F9PA 2K7QA 2J8HA 4J4PA 4LVEA 3FQNB 1UXWB 2EDFA 4U6XA 3ARFA 3PGDA 4LP4A 3KNBA 4JDZA 2YUZA 2OL3L 4HWNA 3NFPB 4JHAL 5I71C 3N1GC 3HB3D 4U33A 1AKJB 4M1DL 1MUJB 4OZFB 4F80A 3CXDH 4RISH 5E2TL 1DLHB 4TVPH 3O2DA 4QRRD 4LK4A 4NUGH 1LE5A 4JFEA 3LKNB 3B6SA 3DXAA 3SE3C 1SQ2N 2CGRH 4KTEH 1UVQB 4M02A 4O9HH 1NC2A 2ZPKH 1D3CA 5LGJA 2CIKB 4JVWA 3PNWB 4V1DB 3L9RB 4R2GD 2VRAA 5F1NB 3J7HA 3I6KB 3GNMH 4P46A 4FQ1H 4HSQA 2VN7A 4LSVL 3CSGA 4QTHB 4X0KA 3K8LA 1B9ZA 1FL6B 4LL9A 5DR5H 2QQLH 1FBIL 5HHME 1FZKB 4M43H 1LNUA 1DUYA 4FQPA 3BIKB 4XNUH 3I75B 3V4PH 4LCWB 1RIUH 4MVBD 2XQBL 1HE7A 1BOGB 1A6AA 3MRQA 1OM3H 2AXHA 4BSWB 4WV1C 4JZNA 4G7YH 2J1KA 4DKEL 3SE8L 4ORGB 5ECJE 2CDFA 1YMMD 4JFDE 3FHQA 1A7OL 2C4XA 4NZTH 2OYPA 5MHSE 2XFXA 4ETQB 4KJPD 5F3BA 3H9SA 2F15A 2ZWLT 4M9OA 4Z0BL 3SPVA 5GRUH 4I0CC 2B5IC 3CU1A 1A6ZB 1AP2A 3KPQB 2P5WB 2FNBA 4MAYC 1JF6A 2F19H 1NJ9B 4QT5B 2ENYA 4HIEA 2A74B 4JEGB 1MCRA 3MXWL 5I17A 1NBQA 1JHTB 4ZO8A 4Z7OF 4ZOEA 1ACZA 3IVKA 1NCBH 4Q2ZA 5BVPL 1YMMA 3D25B 3HG1D 4Y4FB 1GGIL 1LP9F 3IRZA 4K3EH 4LVHB 5D2NE 2ZKHH 5CP7A 3WXVH 5IHLB 3G5ZA 5EB9A 2OJZH 4HAGA 3U4EB 5E8NB 2C1PB 4NCC2 2M2DA 2JB5H 1KPVA 5F7DA 2GW5A 1MCFA 4KJWD 5EORH 5AG9A 5DRXB 2IPKA 1FYTA 1A1OB 4PFEA 5DK3A 5F7NC 1L9MA 3SGKC 3WL9A 2YMXL 4LF3B 1H3GA 1ZTXH 2YD8A 3UJTH 1CLYH 3HG1A 1MAML 4U1JA 3BN9C 4EI5C 1RZ8A 1WCQA 4LCUA 4OD3H 1I8KA 3RDTA 3VWJB 5D70L 4IEFB 4D2NA 3A6BL 3MSPA 3HMWH 1CGWA 3EYFB 4P2QE 4FZEL 4KMLB 1G9EA 2CUIA 2A6JA 3FQWB 1MCJA 4Y5YB 4OUUB 5DEGB 1P7QA 3O9WC 2GQHA 1KJ2L 5AYUH 3KPLA 2AXFB 1TFHA 2EO9A 3QO1A 5FKPB 3QUML 3VWKD 4G8FB 2I25N 4MCZB 3Q3GB 4OF7A 4X4YA 4C57C 1U6AL 1INDL 1Y6KR 5J12B 3VFGL 4FABH 2Q7YA 1UH2A 1R3JB 1QBBA 2XG4A 3U6RA 3VH8B 4AEFA 1NLBL 2P5EE 3OAYH 4M6OH 1JHKL 4MDJA 1TJHL 5TF1L 2W9DL 5MI0C 1EHAA 3RWHB 3UDWC 2R2EA 4ZO7A 1F3DJ 4D9RE 2DBJA 2FD6L 1ZHNB 2X4QA 5BQ7A 2YRZA 4PRPA 5I1CL 1M7IB 3MNVA 3SCMC 1YUHB 1WBZA 1BBDL 4XWGL 2ZOKA 1WZ1L 3VWKA 3BD3A 4X4ME 3UAJC 3ROLB 4HMDA 3CMGA 1K2DA 5D6DA 2EEBA 1FL5B 3GKWL 4ELMF 1DANU 3BAEH 3BZEA 1NH6A 5F8RC 3B4NA 4L8DA 4Q0XH 2R9HD 3T09A 4JZJA 3QJFB 3SDCB 3L3JA 3X14B 1NDGA 2PTUA 1W0WB 5IVNA 1GJIA 1J0ZA 2R0KL 1CXIA 1H3PH 3IRPX 1H3UA 3HI6L 1JZ5A 2JJUA 5K33A 3RKDD 3QWOA 3RZCB 3H8NA 2PW2B 4IRJC 2HP4A 4ZSOB 4BA8A 3VMNA 4MXVE 4BKLB 1BZ7A 1OGTA 4GSDL 4JR9L 2DIAA 1Q9LA 3FZUC 3O3DB 1HYRC 3WXWH 4LPVA 5K59F 3BQUC 5FA3B 4Y4KA 3GSRA 1OAZL 5EG6C 1QFWL 3TYFB 2B4CL 2FRGP 1S78D 3BHBB 3BKYH 3SHSA 1IE5A 4Z78A 4ZUSA 1PFCA 2D0FA 4JFFB 3AM8A 3TZVB 5GS1B 1H9VA 3HRZA 1MHHA 3BSZH 1KACB 1S7RB 3VFUB 2A9ML 4OCMC 3DVFA 3MGOB 1JF1B 3K4AA 5J1SC 3ARDB 3BXNB 4GBXB 4JPKH 4X9BA 5HD8D 3L7FA 2PO6D 1JV5B 1NAMH 4WW2A 3A67H 2VLLB 5GQBA 5IHZA 1S7WB 2XWJA 3L95B 3DMMB 4GAJH 1VFOA 5DJ2B 1YPZB 2X70B 4LGPB 3JVGC 4EQ3A 4H88L 1YEJL 4FQXB 3NTCH 4PJHA 1PLGL 1QFWI 1BIIA 5T1LB 2H9GA 1QHOA 1P4BL 3MRMB 4HULB 2MJWA 3BE1H 5C0AD 2PO6A 3L3HA 3QDME 1A7PL 5GGVH 3R06B 1RU9L 1RUKL 1NKRA 3PABA 4JFQB 5T1DH 4XTRD 4GRLD 1NLDL 1K3ZA 3RVVD 1WFTA 4KK5C 5KVGH 1AC0A 3WO4B 4OLZL 3BUYA 3H9HA 4LASH 5MERB 2W0LA 3S37L 4BSVA 5BS0E 3QEQA 4DKFL 4X7SL 3TCLB 2Q86A 4ZYKB 3JV6B 1KLGA 12E8H 4L1DA 1VCAA 5B8CA 3T65B 5LGKA 4F2MA 1FIGH 3NA9H 5C0AA 5FXCH 1NFDB 4BQCA 3MRIA 1I1CA 2XWTB 4YAQA 4GAGL 4ZFGL 4GRLA 5JORA 2BXYA 1UZ6F 3VFTB 1F58H 2GTWB 3PDGA 5SWSA 5GJTL 4G8IB 4TN9A 5EIIB 1IEHA 3E8UH 4HUNB 4NNYA 1H15A 1YMHA 2L7UA 3O2WL 1BJ8A 5HHPB 2JELH 3VFNB 1NBVL 5J89A 4KTYA 4OIIH 1BIHA 1WAAF 5IT2L 3Q6GH 3WFBH 1KT2A 3ARWA 4YXHL 2YRLA 5JTWA 1U3HC 3T8XB 3A6CH 4XGZB 1MCEA 3MLZL 3U0PA 3IETA 3WYRA 4Y5VC 1U8QA 4JDVB 3T77A 4HWEH 3X13A 5I1GH 2NY0B 3LAFA 4LRNH 3D39A 3BH8A 3OF6A 2M8XA 1G1CA 5EUKA 5BW7A 2AVGA 5EU5B 2JCCE 2YZ1A 3GBLA 4HUWA 2X7LA 2FSEA 2OLDA 1MFDL 4TYUA 2FJHB 3OWEA 1PG7L 3QAZB 3LN9A 2NY5L 3UYPA 4BFBD 4KHXL 1QO3A 2M26A 4M5ZL 5F7WC 3KXFE 1IAKA 5CS7A 2YWZA 1FE8H 1OAXH 4G8GE 4OV5B 4CNIA 4NQXB 3U82B 2MMXA 4BUHA 4JRYE 3K0WA 3QSKB 1SJEB 2X4SA 3W11D 1KYOJ 3VXTB 5D96C 4OV6F 1HSBB 2D7QA 2HJFA 5DF0A 2ZUTA 1MRFL 4CADA 1L0XA 3D18A 3BDYL 2OSLB 2ZG2A 1UWEL 3H0TA 2WWKT 1I3GH 2NY1B 4KHTH 3VGEA 3ESUF 1T22A 2W38A 2PXYC 4AEIL 4MSWA 1GOGA 4KGLA 1U8HA 3C6LD 1KXVC 4S1QH 3GK8H 4OFYD 1HXYA 3QXVA 3VGGA 1KJMA 3LH2L 1E4WL 3HE7D 1P4LB 5ALBL 5K9QI 1CE1L 4PJFF 4C54A 3DX7B 3QIBB 5CUSH 1OT2A 1KBGH 4L9LA 2NYYC 3QDGD 4KVCH 1UB6A 1ZHLA 4IRSD 4HV8A 4AEHH 5GGQH 3SJVB 3EDFA 2MHAB 5T33L 1SYSA 1NSNL 4RSVA 3T0EE 1U8KB 1R3IH 5C0IB 1BLNB 3NIGF 3W0WB 3STZB 1M1SA 1T7XA 4LQ1A 1LDPL 4XCNA 5B39A 1EVUA 3GB7B 1I3RA 1QBAA 3RY6C 1T5XB 1XIWD 3HE7A 5I1HL 5TPWL 4FFYH 2DQHH 4P3WA 3PQYA 4JHWL 4FZ8H 3GM0A 3EOAA 2E8ZA 5DA4A 5CSZB 2QADC 4WWKC 3RIAF 1UKSA 4YBHA 1IGYB 3CUPB 5D5ME 3OR7B 4EUPG 3RX5A 5IJVB 1GZPB 1HEZB 2EIEA 3IXAB 3LPGA 5HYSB 3EOBB 1OLZA 5HY9A 4TSAL 4H1LA 3MLYL 3CFDA 3U0WH 1A9EB 1IGML 4KK8C 2ZUSA 4S11A 4Y19B 3P0VH 1A21A 4KQ4L 4HPOL 2ADFL 2X1XR 3SDXE 1IM3B 5DRNB 3V6OA 1GHFH 2HG5A 4XPHH 2FBOJ 1NUDA 4DCQB 3WE6A 1WZKA 2GY7B 1VGEL 1HHHA 3HAEB 4ZUWA 1EHLH 3DETD 3I02B 3H3KA 4PGZA 1TQBB 5JOFA 2ZNWA 4ODHH 4X9HA 3N50A 2BHYA 1CTOA 3VFWA 1X5HA 1HINH 2VDRL 5ISZD 4PLKD 4LP5A 4J1UA 1U95B 5HVHB 2VE6A 4PJ7A 1UJ3B 3D85B 5HI5C 4EOWH 2WWMD 2XN9A 2AV7B 4CVXA 3EBAA 2V5RA 3IFNH 5C0JA 1F4YH 1BJ1H 4I18C 5DVMA 1JNNH 3U1SH 4D94A 3VFMA 4PJXA 4G9DA 5FYKE 2H1PH 2VLRD 2H8PB 4AG4L 5EOCH 1VKXA 1I3UA 4OLYL 4YQXL 3DROB 4QGTA 3BP4A 4Z7OE 2NW3B 1XGUA 4OGZA 3IJSA 4JN2B 4JQVA 4ZOCA 2HT3D 3NCMA 1P4IL 3MMEA 4OZFH 1ZS8B 2FBJH 1DE4A 4HUMB 3MJ7A 1CFSB 1XGRB 3PWJB 3MJ9L 4MDIB 3GSWB 5ISZA 4KVNL 3QCVL 2V2TB 2F5BL 1UXSB 2O61B 4AQOA 2HN7B 4GUPA 2D3VA 4FN0A 4YGVA 3BPNB 3V5KA 1CBVL 1RZGB 2X05A 2CSPA 1UWXH 4NRYB 1BWWA 1D6VH 3T4YA 1NEZA 4ENED 5F9DC 3ZKSD 5IVXB 2VLRA 4HPYH 2R4RH 4JPWH 3SKNA 4O2CB 2IADA 1CU4L 3RWIA 1KCSL 3RA7H 1RJCA 5F96H 3U36A 1NL0H 4MA8H 3QRFM 1JIBA 4NT6A 3ULUL 3QZWG 1CXEA 4HIHB 1ZT1A 1BEYH 5JIHA 2F58L 1B4JL 1FFPA 4NM8H 3H2WA 4XVTL 5KANG 3T1FB 3MR9A 1J5OH 1KIPB 5DZLA 3AAZB 1AI1H 4MXWH 3MREA 1MCIA 2DQCL 3WFEL 1YY8A 1OCWL 2LAGB 4U1KB 1MREL 3GUTA 1ZVYA 2XI9A 2E5EA 3P4NB 4BFIB 1AXSB 3TJEH 1IFHL 2VZOA 1QSEB 4CMMB 1MWAL 1AQKH 3QO0B 4XCEA 4LHUB 1JHLH 1KFAH 1EXUB 3UTSE 3PF2A 3SBWC 4PRHE 5AAMA 5GS2D 4C4KT 1N6QL 5B3NA 5ACZA 6CGTA 5EFIA 5HXMA 3VXSD 2MNUA 3O6KH 3A0OA 1PKQB 4ONOA 4FG6C 4XXDB 3NCBB 1SVZA 3KR3H 2F5AH 3BP6A 3M8OH 3E3QE 5MEOB 3QJHA 3IS0X 1Y18B 3U46A 5KVDH 5GGRA 5I8KH 3R0NA 2DIBA 3ARED 5E8EA 1TZGL 4HD9A 1REIA 1E28A 2FWOA 2OXHA 2NY4D 2VLJD 3RQ3A 1ND0A 1ROWA 1P2CB 1MLCA 4I2XB 4B50A 1EERB 2GY5A 3DUUB 3VXSA 5EUOB 4H8WH 5F6HJ 4UB0H 1RK0B 5JXAH 1CICC 3P73A 2IAMC 2BVQB 3D5OF 4KDWA 3MODH 3S3PA 5B3JF 3T2PA 2D4DA 3KLHC 2ICEA 3MV7D 3MCKB 3L1OL 5HGHB 3DRTB 3PL6C 3L3GA 2BFVH 1GGCH 3DRQA 4HZLB 4WFED 3AREA 3JWOH 1NGQH 3KYMA 2CRYA 5IQ7H 2W9EL 5HHVL 4MXQC 4TUKL 2VLJA 3AXLB 4PD4K 2E8YA 3EYUL 1KJ3H 4PS4L 4I0PB 3S3JA 4PY8I 1F4AA 2HFFB 3MA7A 3IJHA 3PWVA 1Q0YH 3D9AL 4S0TD 4W4NA 3HC0B 5FF6A 5F3HA 5D1QD 4K71C 1R5IA 1S7UA 3MV7A 3L3KA 5E8DL 4HIXL 5D7JB 3DYMA 3VCLA 4D9QD 4J8RB 1KJVA 1OGAE 5DD1L 5CJQH 1TVHA 1KEGL 3MRHB 5KG9B 4GKZA 1KB5A 3WFZA 2B2XH 2V17H 5E5MA 3EOYG 3MLVL 1CGSH 1J1XH 3CVIL 4ONGH 2P24A 1WVZA 4Z7QF 2XZQH 3N0PB 3PWUB 4BK4A 1HILB 5BJTA 1CGTA 4GOSA 3FQRB 1JVKA 4JFPB 4YH6A 3TIDA 2APBA 2NTFA 2WLYA 3BPLB 1JPTL 3NZHL 2C3XA 2O5XL 3S5LB 4LPUA 3I3BA 3S3SA 2D0HA 2QKIA 1NGPL 4LSUH 5L88L 2XTJE 2IH3A 4OFIA 1XF1A 4QKXB 3JWNC 4BFGA 1U3JA 1MJ7L 5C0BD 4EDXB 2DQDH 2ADJA 3ZYIA 5E6IC 4LDEB 4JVPA 5JHDB 1CGUA 3K3QA 5MEND 1KPRB 3QQ3A 2VQTA 2VN4A 2DL2A 4QHUB 4YHZH 4TUOA 2OTUA 5TE7H 4HGKC 4HUKB 1SJHB 2XA8L 4XCFH 5H35B 3MRBB 3S36H 3BP5A 2ZUXA 3I2CH 1G6RL 4EN3D 4UBDD 2DDQH 1UQSA 1BBJB 4NQVB 3B2VH 4MD4A 4YHPA 4JFDA 3MLUL 2VAAB 1FZJA 2BK8A 2P47B 3P77A 3RVXC 3NFNA 1FZMB 5IROA 3OKYA 1CFNB 5MENA 3RPIB 2P7TA 3I50L 5I9QC 2I24N 4DVRH 1DANT 4DVBB 2X9WA 3HE6B 3ARFB 4G80A 3PGDB 4G6MH 4UINH 3KNBB 4QLRA 4U3HA 3UTZA 4EN3A 1HN1A 4ZDHA 1V7ML 4MGXA 1L7IL 1QRNE 2A6IA 4PLJC 5FOBA 1CL7H 4MB4A 2XY1A 4PLNC 4GW4B 3V52H 2V7HB 4ZD3H 3PJSA 4JFEB 5D2NA 1DEDA 3D69B 5HDQH 1OTUD 4DJMA 2WUCH 4GKNA 3D2UD 3MUJA 1JNLL 2L4OA 4FFZL 4GAYB 2BSSA 4M7LL 4NC2B 3WLBB 3EO1B 1J1PL 4L8CA 2DQEL 3HC3H 2D03H 4LCCA 2EDHA 2FLRT 3DBXA 5ICZB 4L3CA 3MYJA 2AJVH 2EXYD 3RWGB 1M6OA 1A6VH 1N0XH 4LLQB 3QXAA 4MA7H 1LDSA 1SY6H 5C0RL 2YD4A 3IGAB 5E2VL 3FB5B 3WFCL 4RMRA 4URTB 4K2UL 2I9LA 4EBQL 4ZXBA 5BOPA 5FDWA 1I1AB 1D5ZA 4OCNC 4U6VL 4ALAL 1P1ZA 4UDUA 3B9KD 3V0WL 3CSYA 2WIIB 4UU9A 3QUKB 2A9NH 2CDFB 2HRLA 4S1SL 4FXKA 1AE6L 4O2EA 5FHAL 5IG7A 5IWLA 4N9OB 4HS8L 4YNYA 2XFXB 4I77L 4XXCC 3ARBA 3NN8B 4CAGA 4OUOA 4KKLC 4YHIA 3SPVB 4XI5C 4ELKA 1CZ8L 4I3RH 2I27N 5KSVA 1A1NB 2XACC 4HKXB 5JOPD 2IH1A 4Y4FC 4HIEB 4LVHC 4WUUD 5T1KA 3NH7L 2X41A 2MTPA 4YX2H 4OZIE 4J3TA 4KAQL 5TDPA 4M4PA 4Q2ZB 1OTSD 4PJEE 5D1XD 3GMNB 3RWDA 1ZSDB 5I1EL 5AZ2H 2H2PC 1BQSA 2HFEB 3MBEB 4X4MA 4RMVA 4IM8A 4XB7A 2XRAL 3NCFB 1JF5A 1XH3A 4P2YA 5T5NF 3WKML 4LSTL 1BVKB 1KPVB 5GRVK 4Y8DC 1CVSC 1UWGL 2BNQB 4H8WC 1PY9A 1XCTB 5FB8B 5JPNB 4PP1D 1F4XH 2DQFA 5SWZE 3VW3H 1E4KC 1DVFA 2IPKB 1FYTB 1RIHH 4I3GA 3WL9B 1ADQL 2DKMA 2RFXB 3EJJX 2MPAL 2VH5L 3VWJC 5IB3A 3MFFA 1C7TA 3CAFA 4E0RA 3AFLA 4XPGH 3JWOC 1RUMH 4U1IB 5A1AA 1A7NL 1V7NH 5CEZD 3HUJB 4FA8A 4TULL 3RDTB 3N9GL 3OAYK 3RVWD 3B2UC 5JW3L 3KHOA 5J7CC 1JWSA 3V4VL 1Z3GL 3TJHC 4N0FA 5I1IH 5GGRY 1NCTA 5F9OL 1E4XL 5LWYL 1FJ1A 5DJDA 5J12C 4HG4J 2Z8VC 1EEYB 1TLKA 4TUJA 1N2RA 2AEQL 3ZTJG 4AT6A 1KXQE 3K7UA 4WFGE 5ESVA 2WBJA 1P7KA 2NPLX 4KROD 2YBRB 1RURH 5F7EL 2Q7YB 2OTWA 5K9KA 1RUQH 1OSZB 1WJ3A 3U6RB 1AXTH 4PRBB 5DZOA 5IW6A 1T1ZA 3K8MA 1P69B 4HUXA 4ZUTA 1RVFH 5GS0L 3JUZA 2OP4H 3ZE2E 4Z7VB 5D6CA 4LLYA 4MB3A 5I1KL 1FC2D 3OKMA 1TPXB 2CKBA 1WBZB 5CZVH 4OAWB 1DQML 5FYLH 1BFVH 4X6CA 5FV2A 3TPUB 1R6VA 4MQTB 4POZD 1E4XI 3KYAA 3SDCC 5ANMB 5LG1A 3V4UH 4L8DB 3ZMRA 4WFHE 1YY9D 1ED3B 1HXMA 1VADA 1YPZF 4GG6E 5F1SA 3BZ4A 2ESVB 5FGRA 5JO5B 3RWFA 5C0NC 1NDGB 5IFJA 2MSPA 3RZCC 4D0DB 5T3ZE 2NLJB 5FA4A 3ALXA 3RBSA 1NKOA 3VXOA 4NZDA 5EU7E 4M00A 4LMQI 4F7TA 3S35H 3T3PE 2MFNA 1PSKL 2YUXA 4RA0C 4IMLA 3I6LE 4H20L 3PHQA 2DLGA 5CZXD 4Y4HC 5EZLA 5BZDA 3QDJB 4Y4KB 3QUXD 3TZVC 4IDJL 4Z7WB 3GSRB 4I13B 2R2HA 5I1DA 2HLAA 1EJ6A 4HKBB 3RNKB 1GGTA 3HAEH 3GRWA 4ZUSB 5ACMA 5I6XC 2BCKA 1QEWA 1U91A 3ARDC 4GBXC 2AXGA 4QXWA 3V6FA 4M93C 1NFDF 5F21B 1RUAL 3O4LD 1JK8A 4QRQB 2W92A 3CZFA 1MSPA 5H37G 5H8DA 2ARJA 2FX9L 1G7JA 5ESQB 5IR1B 1TCRA 3RIAK 2ATKB 5H94B 4M6MH 3EJZD 3DMMC 4LCIH 1Q9KB 2XNAB 3QI9B 2PF6A 1I1RA 2CUHA 3QUXA 1RJYB 4WO4B 3TT3L 3EFFB 4FQXC 5KSBB 5DVKA 2XA3A 1JZ7A 1XZ0A 4KRLB 3DUHA 3BKJH 4XC1H 1W0VB 2VWEE 2DQGH 5D7SH 5HVGB 1WZMA 1I7ZA 5LJYH 1TMCB 4EEEA 2MKWA 2BHZA 2H9GB 4YHOH 5IBLC 4YO0A 3G9VA 4GKSB 3WO4C 4PG9A 4PJBE 4WCYH 2E6JA 2O5ZL 3J8F7 3WS3A 2IBZY 1HQ4A 4C56B 1Q0XH 2LU7A 4HWBL 3MZGB 1I8IA 1G7IA 4QO1A 3KXFA 5IMLA 2VXTH 5CKGA 4G8GA 3CX2A 3QEQB 4L3EE 4OFVA 2YK1H 3D0VB 2CRZA 4YDVB 3SE3A 1K8DA 4JRYA 5I8EA 2Q86B 4X80H 2OJEA 1KLGB 4XP6H 5B8CB 2IWGA 1UA6H 3UJJH 4HX1A 3EKCA 2Y9RT 4LCYA 2ZJSL 4BH7A 1AHWB 4BYHA 4RGOL 1J88A 4R96A 1UM5H 4X6BA 1GXEA 2BC4A 3BD5A 1L6XA 1IM9A 5SWSB 2X4RA 4O2FA 4HH9B 5IM7B 5BZWA 4Z6AT 4NKIH 5FDYA 1YC7A 1ZA6A 1G7PA 1U8LB 5FO8A 4WENB 4PJ8B 2FX7L 4Q97A 1MPAH 4MAYD 2C3WA 2CPCA 5BMFL 4LSPL 4WV1A 2PUQT 2CR3A 3RNQA 4A6YA 1MLBB 5D71L 3AMKA 3MUGB 1Q1JL 3S4SA 4W4OC 4K8RH 4OLWH 5I1AB 2G60H 5SWQA 2E27L 2Z92A 1B0GA 1F2QA 1OAYH 2B7DT 3U0PB 1TTGA 2D2OA 3HI1B 5C9JA 5DUPL 1OLLA 1ACYL 3T77B 4X5XA 4U7KA 5C0EA 2J6EH 3BH8B 43CAA 1RV6X 5EUKB 1D5MA 3FQUA 3F12A 3IU3B 1LEKA 3QAZC 4LLWB 4HUWB 1JGUL 2X7LB 3D3VD 4OCYL 4OBSA 4MAYA 1WWBX 2AQ3A 2PYED 2UV3A 4MQXC 5I19L 5IP4A 4XMKH 4LGRB 4Q9RL 1JGEA 4ZO6A 3EYQC 4F15C 1FZOA 1INQA 4GT7A 3TO2A 4DN4H 4DN3H 1N64L 1QO3B 4V1DE 1D9KD 3BWAB 3FFCD 2AJZA 2APVA 3ARQA 3ZDYE 3BN9D 1AGDB 1BF8A 3I3DA 3DVNA 3GSUA 4EI5D 1U42A 5EBMA 4HUVA 5DWUH 4LARH 2IPUK 1G7HA 2NY1C 2X4SB 4G8EA 4JO2L 4ZTPL 4I9WE 2YD3A 1T1YB 1ZE3C 4CADB 3C2SA 3D18B 4YPJA 3U0TA 1SJVA 1IQDB 4R7NB 3SGKA 3O6MH 5KVEH 2JK5A 1WV7T 4NHCL 5EU4A 5DLMH 1U8HB 1RQ5A 3X11B 2XPGA 4EI5A 1J1OL 4ZFOB 2FGWL 4OKVA 1F6LL 3FOLB 2C4FU 1T66D 1UB6B 2X42A 2PTVA 4UQ3A 4K94H 3C09B 3NPSB 4PGBA 4EUPA 5IKCB 1MFBH 3NBNA 3O9WA 3VRIB 1SYSB 2B1HL 3HMXH 3O3AA 3TNNA 3NAAL 5FAAA 1Q72H 3REVA 2ILLA 2P5WE 1X5YA 4Y0GA 4RFNB 4XCNB 1LO5B 5B39B 1IAMA 4MJ4A 5CD3A 1OWWA 1YDPB 1A3LL 5GGSB 3IDNA 3BO8A 4LSSH 3V8CA 3LQMA 5I74B 2Q8AL 1Q9OA 1X44A 3RBGA 3ARXA 3VFRA 4LQFH 2DM7A 1J8HD 2Y36H 1N5AB 5E8OB 3ULSB 4OQTA 3UDWA 5I66B 3SGDH 4Z76B 1A5FL 5I73B 1S7TB 1IC5L 3CC5B 4PTUB 3SCMA 4PRDB 3CFDB 5FYKL 3MROB 4UAOC 4MNHA 5HHNA 5F1OB 5IVXF 1T7WA 3O11A 4IRJD 5I18H 3OKLB 4RNRA 5JW4R 1XGYH 1E6JH 5D1ZB 5JIPA 1BQHG 1TQBC 2HVKA 1T89C 1BVLB 1F90L 2ZCKL 3FZUD 1CFTA 5DJYB 3WE6B 3LEXA 2YPLD 3QXDA 3G04B 4C59B 4GXUN 3BQUD 1GL4B 1INEL 3G5YB 3RX7A 1QLFB 1YN7B 2GSIA 5E9DB 2PTTA 3OSKA 1ZLWH 1UJ3C 1EVTC 1RZJH 3SDYL 3WCYA 1LE9A 4P2CG 2NY3D 3AB0B 4XAWL 1N3NA 4Y2OA 3ULVD 4IRJA 1S9YB 3CVHA 1NUFA 1ZLSL 4U1LB 3LMJL 4TSBL 1MFAL 4YFLI 3WLWD 5C0JB 1MJUL 3UTSA 3TO4B 4TVPD 3SY0A 1UWXK 4G9DB 1I8MB 2NY6D 2V5YA 2NY7L 4PRHA 3BQUA 5DQ9B 4ODXB 5FO9B 4OZHB 4UDTA 3T0AA 1FBIH 3ME0A 3OPZH 4NKMA 1HZHH 1XGUB 3QZWA 1F8TH 3BPNC 3IJSB 3MMEB 4NQCD 3O2DH 5ERWA 3OGCB 4X7TB 3LEYH 1NEUA 1JI2A 1KN2H 1OD9A 1N8ZA 4UOW1 2AJSL 1QRKA 4DKEH 8FABA 4PYHA 3TVMB 1R3KA 2OR9H 5EOQL 2FB4H 4XAKD 3IAPA 5JNYA 1CG9A 3U36B 1QBLH 2OQJA 3VD9A 5IOPB 5AYQA 4KDTC 1SEBB 5L7XL 4NJAH 1ZT1B 4UV7H 4PJCE 3WD5H 5EUOF 5AD0A 5KVFL 1FFPB 4P9HC 4BM7A 5E8PB 3JVGA 4CJ1A 4ODTL 3QR2A 1QVOB 4BJLA 1W8NA 4XVUD 5C09E 3TBYA 1WTLA 4RMUA 1A0QL 1FPTH 2Z35A 3WSQL 5MEQA 1QZ1A 4OFPA 3I9GL 3VXRB 3B3IB 1XR8A 2NNAA 4Z0XB 1OTTD 1TZIA 4HEPG 2Y07H 3WS6A 4QRPB 5ICXA 4EKXA 3O2VL 5LBSL 2QQNH 4N8CH 4XRCA 5KZCD 5TDOA 5J1AA 4L4VD 3ARPA 2OZ4A 1YEHL 4P2RB 3SGJC 4XCEB 2P8LB 3QP3A 4K8RC 3TEUA 3F6IA 5DTFA 5GJSL 1FGVL 3ZHDA 1R5WB 2PR4H 1A3RH 2F54B 5C0CE 1PG7W 4Y7MA 2J8UE 5DJ0A 4KUCF 4DUVA 5EFIB 3S88H 4M1GH 1NGWA 3SKMA 1OGAA 4MJ6A 4WFFE 3T0WA 3P11L 1MAMH 1P5VA 1T2XA 5IF0A 3U7WH 3BP6B 2GK0A 5KSUB 4KWUA 5DI8B 3ZZ1A 2VLKE 1FNSL 3BDBA 1QA9A 1HCVA 5GZND 4XP4H 2QR0A 4ZNEA 3MJGX 4UIKL 4JKMA 2EH8L 4W6WB 5E5UB 2BJML 3LKPB 1U6AH 1INDH 1OB1A 1P6AB 4NO0D 5F97E 2HH0H 4JY5L 4EVNA 4PJGE 3P73B 1U3HA 2MCG1 1CI5A 1YECL 2E9WA 5EWIH 1JHKH 3UC0L 5IMMB 3O0RL 4Y5VA 4X6EA 1CFVL 1RK1B 1U8PA 3DNKA 1RAMA 3DRQB 2OX5A 1G9ML 1MVUA 1JPGA 2I60L 3PWNB 4JKWA 4R7DA 4XWGH 4KRMB 5HSFA 2UUDH 1WZ1H 4JJHA 3SDAB 1LK2A 1QRND 1BD2D 4LSQL 1MCBA 3GKWH 1F3JB 4F57L 1HHKB 4HKJA 2GUOA 1FVCA 3GZKA 4KK9D 1TVDA 1OSPH 2EC8A 2NYYD 4OCSL 3WJJC 3HPJA 4G42A 1DBML 1KOAA 1QPXA 2R0KH 4UV4L 1RJZA 2NQCA 4WRLA 2DWEA 1KB5B 4GMSH 1J0HA 5E5MB 4I5BB 3AGVA 2IBBA 4P57A 3UXFA 4P2OD 1UCTA 4G43B 5JA8B 5J1TC 5DFWH 3G6AA 3FFDB 1QRNA 3GSQB 4GSDH 2PXYA 1KGCE 1WAAA 4JR9H 3E2HB 2A6DB 2EXWD 5JR1L 1ZT4B 5D72L 1CLOH 3HFMH 4F58H 3BD4A 2NTFB 5EBLA 4WJ5A 5DJ6A 3SE9H 2AJXL 3PXJA 4NOFA 1KLUB 4WWKD 5HI3D 3U4BL 1U93B 2QKIB 5FKAA 4MHHG 1URLA 4NJ9L 1QSFD 4K7PY 5JXEA 3DVGA 2VR9A 4PJIE 4RFOH 3RPKA 1QLEL 3K2MC 2DB8A 1EUUA 5C0DA 3DWTA 3UBXI 1MF2L 2BY2A 4KQ3L 5BRZD 4HGWB 3ZTNL 5GGUA 4XP5L 2PW1A 4F7MA 3P9MB 4BZ1H 3GO1L 1RZJC 2FO4B 2FH8A 4PJDE 2RIKA 3B9VA 3CMOL 4PIRF 1Q94B 1CF8H 3JV0A 1IVLA 3QQNA 4R26H 1CDYA 1RJLA 4WWKA 4L5FL 3G5XB 4YZFF 3EJYD 2R4SH 2GSGA 4JFDB 1QSFA 1WWWX 2X9XA 3AS0A 3HE6C 1RZKL 4L4TE 4H88H 3T0XA 1MCPL 5T3XE 4QHLB 1PLGH 2P7TB 4KKBC 1DP0A 5JPMA 4NQED 4Y89A 1TTUA 3ECBA 1DBKH 3IF1A 4AEEA 2GITA 4MA1B 1CVRA 1N5YH 2FJGB 1HWHB 1A7PH 2ATPA 5HGDB 3LQZB 3MLSL 3MRDA 4OF8A 2QEJA 5EZIL 5FOBB 3R8QA 1EZVY 3CH1A 3W81A 4OIBA 3DTXA 1S9WA 4OLZH 4NQSB 1XGTB 5D2NB 5FCSH 2W0FB 3SJVE 1K5NB 5CJOH 2EIZA 2O5YL 1ZEAL 1BHGA 4NQEA 4MMZC 4UQ2A 4U1NB 1S5HB 3F58L 3JSSA 2EE3A 1P84K 3A6OA 3VU2A 1I7TB 3H9YA 4I18A 2R56H 4OJFH 4LCCB 3DBXB 4JFZH 5SWZA 2ZCHL 4N0YL 4HC1L 3MYJB 1FL3B 1T1WA 1I1AC 1QFUL 4BQ8A 5GJTH 3KPNA 1YQVH 4Z18A 4M1CC 3PP4L 3O2WH 3HUJF 3QWQB 2BSRA 3HZKA 3MRRA 1U0QA 3DGCR 5IHUL 4UDUB 5FUOL 4M93B 3QA3A 3MBXH 3WNKA 1UADC 4P2QB 1JGDB 5IT2H 3TESA 4Q9BA 4GO6B 1AD9B 4KI5C 1ZA3B 3ARVA 3M45A 5TE4L 5HVFB 4TPRL 4ELKB 1FAKT 1F4WL 3FT2A 1UC6A 5F7LB 5B21A 5KSVB 1F3DH 4KUZH 2P5EB 5F88A 4E41D 2IH1B 3DX6A 1N59B 2EECA 1KELH 5T1KB 3IFLH 3TV3H 5IV2B 3MBEC 1BFSA 3JWDH 4NNXA 4MNQE 2BRRL 3RIFF 1EFXA 4Z7VF 2AJYL 5TE6L 3GJEB 3E6FA 3SKOB 2JB6A 3OKDB 4M5ZH 2VLME 3CCHA 1G0DA 1VERA 4FG6D 1JRHL 1NCDH 4Y1AB 3ZDZE 4XPFL 5BXFA 3OG4B 4JHZA 3N1PC 4P49A 1K4CA 2FL5B 3MV8E 2DQTL 4JQIH 3SBWA 1MRFH 1I9JL 2VXVL 5CWSB 1TITA 3BDYH 2GJZA 2HJKB 3RDTC 3WDHA 3G08B 1FLRL 2GTZA 1N4XL 4YFDB 5IB3B 4H5SA 3ABZA 5B38G 4BUGA 4JPVL 1JFQL 2WZPD 1X7QA 2IGFH 3LH2H 5ALBH 1CICD 1CE1H 1JWSB 5IVXE 1DL7H 3KLHD 5HHQB 3KPSB 1WSST 3C9NA 1M71B 4PV9A 1UCBH 4HCRH 5CEYA 4U0RB 1VESA 5DJDB 4S10A 3MGAA 5CCKH 2FJFA 1FAIL 1JRHI 1CXFA 5T33H 2X44D 2VDKL 3BJLA 4NM4H 4W6YB 2WBJB 1P7KB 4Z7WF 3KPRE 3PV6A 3TNMB 2D7NA 1UZ8A 4M5YH 2DTMH 2IANB 5IW6B 1HHGB 3F7RA 2IAMA 3OZ9L 1MRDL 4ZUTB 5TDNB 3CFIC 3ES6A 1MAJA 1TNMA 1ZT7B 5F71A 3GSNL 3QQ4B 4N0CC 1XF2A 5D6CB 1IC4H 5M94B 3T1WA 3PL6A 5EN2B 3QG6B 2DI9A 3M1BA 2KKQA 4OCRH 2AK4E 1J8KA 3ZYJA 1QFOA 4TSAH 3TBTB 2R0ZH 2XG5A 4FQJH 3CK0L 4ISVB 4GMTL 4YDIL 1RZIA 2AV1B 1MHCB 5KSBF 4ODVL 1S7SB 3DARA 4HWUA 3NIFF 4HPOH 2ADFH 4ONFL 3O45B 1MAKA 1HXMB 2X4PB 3RGHA 3BZ4B 1S9XA 3DSFL 1XCQA 1PKQE 1BM3H 3O3UN 4YK4B 1VGEH 4FQ2L 1LO0L 4XC3H 4PGCA 5FA4B 4DUWA 5HI4C 4X6DE 1KEML 2Q3AA 1U92B 1ZANH 2CDGB 3QDMB 4PJBA 4DTGL 4RGND 1CR9L 2C3VB 5K9OA 3EO0A 5TH2A 3QIWA 2VL5A 2VDRH 4YEFA 4H1LH 4IMLB 4CMHB 1YZZA 4WUKH 1IT9H 2MCPL 1BZQK 4WI8A 5DJAA 1TZHB 1NCWL 4I2XE 4OGAC 5JW4M 2R0WH 3BH9A 3UPAA 2DQIH 5EU3A 2UY7A 1A4JA 2C4FT 5BS0B 4WTZA 1G7LA 3MOAH 3G6DH 1G7MA 5DMIL 2P8PA 2HLAB 3E6HA 3PWPD 5F7FA 5I1DB 4NNPL 4YQXH 1KIQA 5DJXA 2X4OA 5GGTH 4D3CH 4OF5A 4KKCC 4HK3J 2I07B 4M62H 3QI9C 4IRZL 3THML 1C16B 1X5ZA 3ETBF 1JK8B 2NZ9C 5E6IA 4KVNH 4KV5F 4WO4C 3QFDA 3MQIA 2NY2B 4JG0L 4OCLC 2UVFA 1TCRB 3Q2CA 1CBVH 4LVOB 1X6NA 3FOMA 4GLRI 1AKJD 4DZBA 1IAIM 5FCUL 1CXLA 3PWPA 3RFZC 2GIYA 4OLXH 1NCCL 5E08H 2YXMA 2VTFA 3ULUH 4PLJD 4PTTB 3NA4A 3WV0A 1MQ8A 3MLWH 3FQNA 1UXWA 2F58H 1J87A 1FFNB 5FGBC 3OB0H 4YWGL 3MRGB 1T2QH 2GJ6E 4WI4A 3CLEH 4IOSD 5C6TH 3X12A 1OAUH 2FGZA 1F6AB 2DQCH 2JCCB 3WFEH 3WS3B 1WUNT 1OCWH 2DS4A 4OF6A 4OZFA 3RU8L 4HLZG 5C6PB 4LCWD 3WO3B 5CJ8A 2NXYD 3FONB 4WY7L 1DSFL 4BQ9A 1UVQA 2CIKA 3PNWA 4V1DA 3L9RA 1KENH 5AZEL 4G8GB 5F1NA 1JTTA 2DL9A 1JWMA 1AHWC 3I6KA 3P0YL 1K8DB 4ZPVA 4OT1L 4QTHA 4FNLL 3SDDA 5GISL 1FL6A 1HWGB 4Y5XB 2ZP0T 5JHDE 1FZKA 1TJGL 1XFPA 4WHDA 3FO9A 4IIQC 5FV1L 5SV4A 2OBGA 3I75A 1DN2A 5LQBL 3CX5K 2I26N 4EXPX 3CFBB 4PJ8C 1BOGA 3DI2B 4RBPK 3JWDC 2E7CA 1T0MB 2QSCL 1JPFB 4BSWA 4XI5D 1Y6NR 3QRGL 1YEIH 5BZWB 5JDJA 2NY5C 5GGVY 1PX3A 4ZAKD 1SYVB 1TZGH 5IB5B 4Y4FD 1PYWB 5HHOD 4WV1B 4ETQA 3RNQB 5CBEB 3ILQC 3VG0L 4QOKE 1JNHB 5SWQB 3BVNA 1LILA 3TFKC 3PGFH 1Y0LB 4WNQB 1B0GB 4B0MM 4Y88A 4JANA 3T0EB 3KPQA 2IJ0C 4XXCA 2WK2A 2P5WA 1OY3B 1MHPL 2NX5E 2UZIH 4QT5A 2VQUA 43CAB 2CK0H 5L2KE 1JHTA 1LK3H 3HN3A 5L9DL 2OTPA 3VI4E 5IVZB 15C8L 5IVOA 3RVUC 3RI5F 5TFSL 4Y4FA 1F4HA 3ALPA 2W9EH 5HDBE 4H25B 4J2XA 1JGEB 1BQLL 4X6FA 4LNRB 5D5MB 1INQB 2YD5A 2KQNA 3U4EA 3EYUH 4PS4H 5E8NA 4WEUD 3V7MA 2C1PA 2H26A 2UVEA 4GQ9H 1WT5C 5GRJL 2AJZB 4PB0H 4P0DA 5T5FH 1T2JA 2Y6SC 1KIRA 1A9BB 1X5FA 2AJ3B 3B2UD 5DRXA 1KUMA 1OVZA 1A1OA 4LF3A 3SDXB 3MCLL 5D2LE 5DD1H 1CYGA 1YEDA 3U0TB 2D4FA 5DHVB 2DN7A 3HNTH 1E4KA 3KPMB 4HBQA 5CINH 3MLVH 5CSBA 1QKZL 1FP5A 3TYGL 3QPQC 3VWJA 2GFBB 3JTTA 1A14L 5E2WL 4MS8C 3C09C 3EYFA 3NPSC 3UJIL 3FQWA 3F6LA 4OUUA 4JM4L 1DUZB 5HHXL 2KQMA 1OP5H 4F7CB 3BGMA 5JW4Q 2CKNA 3NZHH 5FKPA 2OMBA 2DLFL 4RFNC 2YZ8A 4G8FA 4MCZA 1T20A 3Q3GA 4PGBB 6FABL 1QFHA 3O9WB 2VB5A 1OF2B 2VAJA 3EOTL 5I74C 4KI5E 3REVB 3GJFB 3VRLE 1R3JA 1KB5H 3VH8A 4WHYG 5JQ6L 4ZQKA 5CD3B 5CEZL 4OZHF 4K23H 3ULUF 4W81A 3RWHA 3IDNB 3SDCD 3BO8B 5BCAA 1Q9OB 4JGUA 4KTDL 3W9DB 5DC0A 4OB5H 4S1DD 3W5NA 4M9PA 1M7IA 2DMBA 4HXAH 4P3CL 1YUHA 2XA8H 1ZGLM 4YDJB 2HLFC 4XBPB 5C0ND 4OIAA 2GYSA 1ZAGA 3C5JA 1FL5A 5CGYC 1ZLWK 3SCMB 3BMVA 4M03A 4NGHL 1NMBL 5D1ZC 2RR3A 4F3FB 1U8OB 4MNHB 1FNLA 1YJDL 4TOYL 1NCUA 4U1HB 1MJJA 5CAYB 3I50H 4ZUUA 1HI6B 3SDCA 1WC7B 2VDOL 2HVKB 4HKZB 1DLFL 4PJCA 1ES0B 3EO9L 5JHLH 4U4BA 1EGJA 1CD9B 4RRPA 3ARYA 4JFFD 4YE4L 3H3PH 4PR5B 3AB0C 3RZCA 4W6XB 2E3VA 2WP3O 3GMQB 3QT2A 4BKLA 3BESR 3K2UH 1NUNB 3O81A 4JO4L 1YEGL 5ABDE 2RB8A 1U36A 3ARDD 4GBXD 3TO4C 1F11B 2Z8RA 3B5TA 5FA3A 3DHMA 1NCAL 3W2DL 1GIGH 4PB9H 3UCRA 3FO0H 1JNLH 3ULUC 2EYSB 3TYFA 4P9ML 3DMMD 4Y4HA 2DQEH 4PRHB 2P42B 4JFFA 4Q6IB 3T3ME 1N7MH 3LPWA 3TZVA 1GZQB 2J8UA 4I4WA 4FQXD 1I9EA 3QZWB 5B22A 3OXRA 3VFUA 2HWZL 3MGOA 4Z7VE 1JF1A 5E2VH 3TVMC 3DV4B 3BXNA 4GBXA 2A77L 3LKSA 5I8OL 2IFGA 4XHQA 5CLWA 2F53D 4EXKA 1AY1L 4NZUH 1JV5A 3TN0D 3QWRD 2X4NB 3TC9A 2VLLA 4P3DB 2QTEA 4ALAH 1R3KB 1OAKL 3L95A 3DMMA 4ZS6D 3UTPE 4QEGA 4JY6A 3BIBX 5DJ2A 1CG9B 3DURA 1YPZA 2XZCL 2X70A 1J9CT 2OQJB 4LEOA 4FTVD 3RJQB 1QD0A 5KAQF 2ESVE 2YKLL 4FQXA 4Q74A 4C55A 1LO4L 5SX4H 1JE6A 3ZYZA 5EC2B 3BKML 5T1LA 2LU4A 1VHPA 4QXUH 4NKDB 5AD0B 4XNXH 1H0DA 3DUSB 3MRMA 5FGSA 2CH8A 2F8OA 3BPCA 2E7LC 3R06A 3NFSL 4JFQA 3OKNB 4ZG1A 3O8XB 2Z0BA 4FQQB 4P4KB 4GS7B 2ZZUT 3MACL 5TDOB 5J1AB 4UT9L 3QDJE 5MERA 2BY0A 1HKFA 4PJ5E 4EIGB 4Z7WE 1N6VA 3TCLA 2CXKA 4LSTH 1GGBL 4ZYKA 3JV6A 3HTLX 3BRDA 2BERA 2YD6A 5DD6B 3T2NH 5DTFB 3T65A 4XH2A 4RX4D 1I7RA 2R8SL 4BELD 1NFDA 4QNPF 3VG9B 4N8VB 3MOQA 3VFTA 3KG5A 3WMSA 2MPAH 4CW1B 2GTWA 3OX8B 3HNSH 1CD0A 2NY0D 3VFVA 5K9JH 1A7NH 1RHFA 4OI8A 5EIIA 1X5GA 3N9GH 4F8TA 1ZGLA 4QYOA 4CUCA 4Z95H 4QHKI 3QHFH 3V4VH 2BVOA 5LWYH 3KYNB 1J0IA 1VENA 1QA9B 1MEXH 4KKNA 1Z9MA 5HDOA 3NIFE 4RX4A 4A6YL 2AEQH 2QR0B 4NC1C 4OCXH 4XBEL 2COQA 1B0RA 1MFNA 4NQUA 2GK2A 3T8XA 3HLAB 4KDVA 4XGZA 5IGXL 1BOYA 4RAVB 5GIRA 3WNNA 1OB1B 5HYIA 4JDVA 3EYQD 1IGJB 2D7TH 3GDBA 2DJUA 2XTJB 4W4OA 4WU5B 2CJUH 3MV9E 4GAFB 3F65A 1E6OL 4PRAB 4F37F 5EU5A 3ZKNC 3UTOA 4JRXE 4WGVB 1U8PB 4CN4A 3IFPB 4Q9QH 2VISB 4HT1H 2FJHA 3SDAC 3VXPB 1JPGB 2DQUH 3IJYB 1JGLH 3T0DA 4C56E 3RIFK 4FFVD 4OLVL 1EBAA 3WFHB 5BV7L 2R69L 4XPBL 3E0GA 4OV5A 4WU7B 4HH8A 1YNKH 3QIBD 4NFDA 4NQXA 3MPCA 3OXSA 1AFVH 3HR5B 1SJEA 2IMMA 4HKJB 4I8DA 4MJIE 3UYRH 1A7QL 3VXTA 1FVCB 3IDJB 3QEGH 2AI0L 1HSBA 4N68A 3L5JA 4JQXC 5FYLD 2C26A 4AK1A 1LEGB 4EZMA 3HPJB 2OSLA 2R29L 4YXKL 4PPTA 4FFWC 4JAMB 3W0WD 4DGVH 3UTQB 4H26B 3X17A 1JYVA 3F7VB 1X5JA 4Z7NE 2CKBH 3T04D 3RUGB 1JZ4A 5SV3A 4G9FE 1P4LA 3G6AB 2KL6A 1N6UA 1XF4A 1PSKH 1FO0L 4G7VL 3QDGB 4PP2B 3C5ZB 3BKCH 5AUMB 1CCZA 4IRSB 4PJAB 5E4IA 1A6WH 2BOCA 3BT2H 3SJVA 1XF3B 3QHZL 1J05B 2Z91A 3FCTB 4U1GB 1T5WA 1U8KA 3CSPA 4G6JL 5C0IA 1BLNA 3STZA 4DZ8B 3GI9L 4Y19D 4ZUVA 3HZYA 4U2YA 5C0DB 1T5XA 1C1EL 1RUAH 1XIWB 4RMQA 1VEOA 3MCG1 5CSZA 1C5CH 2AJUL 3C8KB 3VRJB 1O7SA 1T4KB 4QY8A 5C07E 3H42L 1IGYA 3OR7A 5IJVA 1GZPA 4OQTL 5KTEL 4CVZA 2AW2A 5HYSA 2V5MA 4G6KL 3EOBA 4DQOL 4LKCB 4UTAH 2X10A 1TDQA 2VJXA 1CDHA 4NZRH 2FX8L 1DBBL 2VNCA 3S36X 1A9EA 4FXGB 5E00A 4Y19A 3EYSL 1IC7L 3ARUA 3GRWH 3C6SB 2EDNA 5CD5C 1IM3A 1IQWL 5DRNA 4MA1C 3MRCA 3SQBA 5CHNB 5MP6L 3ECBB 3IF1B 5F1KC 3P40A 1II4E 4NBZB 3TA3B 3NACL 3HAEA 3FRUB 1MFEL 3OG6B 2GITB 3I02A 3WFDL 1YC8A 1T89A 3W9EB 1RPQA 3F5WB 4PRID 3TGXA 4TSCL 2OS7A 2IBGA 2ICWJ 4OZIB 5DD0H 3ZSTA 3KGRA 1CK0L 4MNQA 4FHBD 3CH1B 4PJEB 4O00A 1UJ3A 4MJ5A 1MCSA 3D85A 2HTLC 1MI5E 2IALB 1CFBA 3TBSB 4LCCC 2EIZB 1D5XA 5GRYA 2VMFA 3C08L 4OSUH 3C60B 4ZPTB 1X4ZA 3DROA 1RIVL 2ICCA 4NC0B 1JMXA 3LV3A 4I18B 2ZJSH 3P4LA 4NQDD 3GFUA 5D7LD 1MNUH 1I1YB 3QUYB 4JN2A 1SM3H 5GZOC 1X9QA 3LKQA 1CFSA 1XGRA 3PWJA 4LOUD 4MDIA 3GSWA 5I76B 5IFHH 2V2TA 5F9AC 3KPNB 1UXSA 3JTSA 3ULVL 5I15L 5JZ7C 2BVYA 2KUTA 3KVQA 4NRYA 2BSRB 4M6NL 3MRRB 5H2BA 1DQQB 5IVXA 3CXDL 3QA3B 4L29A 4TVPL 5JQHC 2HVJB 1WWCA 3S8WA 4MXVF 4LSPH 2Z31B 4NUGL 1QSED 5ICYA 4R4FH 2CGRL 4O9HL 4LU5H 2E27H 3Q1SH 5KS9B 5D7KD 3JUYA 5J6GA 4JM2D 3WHE1 4KZEH 3T1FA 4JO1H 3FT2B 4FQ1L 4KDTA 2V7NB 3AAZA 1ITBB 5E9DE 1OPGH 5DR5L 4K8RD 3VXUE 4HQQH 2IPTH 3H6JA 2EC9U 2EDWA 3V4PL 5I19H 4YHNA 4BFIA 1G0XA 1RIUL 4UI2A 4Q9RH 3HKFA 5DQDH 4NIKB 4YBLB 4CMMA 3DX9B 4KXZH 3E6FB 3QO0A 2DAVA 4LHUA 1OM3L 2NXZD 1EXUA 2AK4A 4G7YL 3WEXA 1K8IB 3TF7C 4HF5H 5DT1L 4D9LH 4W68A 3CLFH 4G5ZH 3EDJA 1WTGT 3SGJA 3ULUE 2A0LC 5TQ2H 4K3JH 5GHWH 2ZSVB 4GG6B 1IC1A 1QLRB 2G75B 4LLVB 1PKQA 2GJZB 4XXDA 2GTZB 4GXVH 2J6EA 4JKPL 1MQKH 1EX0A 4U0RC 3VD5A 1CDJA 2EDRA 1OWRM 1X7QB 5CP3A 2UZYB 3HCVB 2VZTA 5F6IB 1J1OH 1NCBL 3CDYA 3GSNB 3C9NB 5DJZB 4PV9B 4K3EL 2CD0A 4NO3B 3WXVL 2N1KA 1K4DB 5ENWA 1P2CA 2FJFB 2OJZL 4I2XA 3OL2A 3DUUA 3ZKQD 4ZTOL 4I0PD 3NAAH 1DN0B 1RK0A 2JB5L 1LMKA 4DOHE 5DHVH 1FYHB 2ZUYA 5HJ3B 1ONQB 5EORL 2J3SA 4HLJA 4KUCD 2Z93B 1CDBA 3KPOA 2V9QA 3MCKA 5HGHA 3DRTA 5D7JD 4FQLL 4CDGC 3MX0A 4L8BB 2IAMB 4HZLA 3QIUB 3UJTL 3DI3B 3RI5K 1RUPH 1H3VA 3QEHB 2YA2A 4TRPL 2I9TB 1KV3A 4PJ9B 4XX1G 4OD3L 1DQDH 4UT6H 4UZGA 3U9PL 2HFFA 4NDMB 2BNRE 3HMWL 2AABH 3PE9A 5FYKH 3RZWA 4F7PB 3GJFH 3HC0A 5I2IB 2V5TA 2F54E 5AYUL 5HYJE 2IQ9H 3T0VA 1XT5A 3HMXA 1XCQB 3MRHA 2GJ6A 3WJJA 4M6OL 4CMHC 2G9HA 4O51B 3PWUA 4PJBB 1JWUB 4DKDC 3FQRA 2JCCF 3EO0B 3QIWB 4XAWH 2VL5B 3LDBC 2H45A 4JFPA 3BN3B 5DEZA 4XPAL 4MYWB 5DDHB 4Q58C 1SBBA 5C6WH 2VOTA 2XKUA 3LMJH 1MFAH 5IESH 5J13B 2A2QT 1FORL 3INUH 5CMAB 3O6FA 5EU3B 4L3EB 1G7LB 4P23C 4FQHB 2NY7H 3E6HB 5I30H 2AQ1A 1LD9B 3U7YH 4KK6C 5C0BB 2QQKH 4Q0XL 4XNMA 3IU4H 1VDGA 5JHDA 2NY2C 1KPRA 2NZIA 4YHMH 5DUML 1HKLH 4J4PD 4LVOC 4Z9KB 3ARFD 3QCTH 5TQ0L 2OL3A 1H3PL 1H5BC 1SJHA 3QFDB 4J3SA 4OFDA 5H35A 2W65B 3MRBA 5C9KA 3CVHH 1NC4B 1BP3B 2X1QA 1BBJA 4NQVA 4DZBB 2Z4QA 4UOW0 3GMLB 4IMKC 2VAAA 3VDBA 4JFED 1NAKL 4PBVC 3DXAD 3LS5H 1J0JA 1FZMA 3WXWL 4QOKA 2GJJA 1NC2D 3RPIA 2ZCLH 3SO5A 3BDXA 4DVBA 1WFOA 5AEAA 3TH3T 3HE6A 3HB3C 1FV1B 3BKYL 4P46D 1KYOK 5I9QB 4YXLH 1EMTH 3VGFA 4JCMA 3X12B 5EU6E 3BSZL 3WSQH 2KH2B 3I9GH 4MA3B 4QXTA 4KI1A 3GHBL 3KJ6H 4GW4A 2V7HA 2VUYA 5BO1H 4R2GC 5C2UB 3D69A 5L0QC 2VZUA 4E9LA 5D5MF 1B4RA 1D5BB 1NAML 4MD5B 1I1AD 3A67L 2C1OB 4Y5XC 1FVDA 4GAYA 4M1CD 1JWMB 1U3YA 3WLBA 1FVEB 1I4FB 3EO1A 3KYOB 3PDOB 5GJSH 4JGMA 4GAJL 4ZPVB 1I75A 3TT1L 1KULA 3X3GH 3BRFA 3SDDB 1QFWM 3P0GB 1CGVA 4MVBC 5ICZA 1V8HA 3H9SD 2J5LB 3FO9B 3NTCL 3RWGA 5D2LA 4LLQA 1MCWW 3SDXF 3IGAA 3C2AL 3FB5A 2BVEA 2ORBH 3PG2A 5DMGC 5JLZB 3BE1L 2OZ4H 1KIUA 1QQDB 3QCUL 1I1AA 1JPSL 4PGDB 5T1DL 2WIIA 3QUKA 3KLSA 4FP8H 5KVGL 3T0EC 1S3KL 3KYKL 2Y7QB 4M7JL 5DD5H 3NN8A 1GSMA 4JLRA 2BJMH 3RWJB 1YEEH 1IAOB 1MCHA 3BVNB 1Z2KA 4LLAA 1PGRB 3RWCB 4JANB 2BNQD 4LIQE 1VPOH 1A1NA 12E8L 1RHHB 4HKXA 3UC0H 3RP1A 1VACA 1FIGL 3O0RH 2BRQA 1FYTD 3NA9L 1Z0NA 1MH5B 5EULV 1L0QA 5ADOL 3OMZA 1F58L 5D1XB 3GMNA 4BQ6A 2WV3A 1ZSDA 4BZ2H 2HFEA 3MBEA 4KJWC 4X6FB 5B4MC 3E8UL 5GPRA 3RDTD 2FO1A 2H26B 3ARZA 2V9TA 5DC4B 1BVKA 4OLUH 3HHRB 4OIIL 1Z5LB 1R3HA 2BNQA 4HBCL 1KIRB 4TTGA 1W8OA 4HHAB 1XCTA 2G2RB 1KJ2A 1P7QD 5FB8A 4X98B 5JPNA 3Q6GL 2OK0L 3WFBL 2XTLA 3QUMA 2OMNA 2O93L 3TBWA 2YPKB 1OP5K 5SX5H 2MQ0A 2RFXA 1YEDB 2ITCB 2Y5TA 4HWEL 1MRCH 4U1IA 8CGTA 3ARGB 3HUJA 3ARSA 1MCOL 5D8JH 5C08E 1DBJH 3SKJL 1SEQL 1YYLL 4JJ5B 4HJGB 1Z0MA 2AERT 3JTTB 4XVJH 1XGQB 3QQ9D 4PRPD 5D72H 4X8JB 1EDQA 1EEYA 3F7PC 4GRMB 3S9DB 1W72L 4AL8L 3BGMB 1VFAB 5IFAH 1T20B 1JYXA 2Y23A 1FE8L 3U4BH 1OAXL 4N0CD 2YBRA 2W60A 3HRPA 3R0MA 4LLMB 2AGJH 3O3EB 4NJ9H 1OSZA 3GMRA 2VDMH 4PRBA 4ZQKB 1NUGA 4GH7B 1RMFL 4DW2L 5EBWA 1LO2H 4F37K 3BP7A 1BQHB 4YR6A 4Z7VA 1WK0A 1I3GL 3GGWB 3UO1H 2HMID 2IG2H 4FOMA 3CMOH 4N9GB 4OAWA 3GK8L 4ODSH 4TTDD 3DYPA 4M61B 4Y1AE 3TPUA 1MHEB 3C5JB 2J4WH 1MJ8H 5ANMA 1KBGL 5HI4D 3RL1B 4KVCL 5L8JB 5FYJD 1RZKH 5L6YH 2Q20A 2D9QB 4B7LA 1ED3A 1MJJB 4MNGB 2ESVA 4Y4KD 4ZUUB 5JO5A 3RL2B 5M7QA 2MQCA 4P4RB 2NTSP 1T7ZA 1NMAL 4D0DA 4PJCB 4PGEB 4IJ3B 1R3IL 4UIMB 4XZUB 2A73B 3GBMH 2NLJA 3WNMA 4U6YB 3K1DA 3L6FB 3GSOA 1AIFB 1S9VB 5C09B 4LMQE 4O4YH 4FFYL 3ZT7A 1WIOA 3KPSE 4FZ8L 1T21B 1MCNA 4XCCL 2VQ1B 1YQ2A 2CLRB 1IKNC 5AG8A 1A6UH 5C1MB 1S78C 1R24B 4MX7B 1HDMB 3QDJA 1GAFH 3DX8B 2HJLB 4Q6IC 3TBVB 3UPCA 2FATL 4KZDH 2O5YH 4PJ5A 2NZ9D 4Z7WA 3IDIB 3QFJE 3GSXB 4HKBA 3RNKA 4Y4HB 2GCYB 3P0VL 2IANE 5C0CB 7FABH 2G5BA 2J8UB 2YN5A 2HT2D 4NPYB 4HC1H 3CU7A 4I4WB 3O4LB 3E3QC 5HD8C 1ZVSA 4QRQA 4XPHL 2RGSA 2N56A 3OXRB 3FMGH 1QFUH 5I6XB 5ESQA 5IR1A 2ATKA 5H94A 3LKSB 1EHLL 3CDCA 2R39A 1A1MB 1Q9KA 2BVPB 2CLZB 1AJ7L 2XNAA 3GMPB 3PP4H 3QI9A 3K46A 4LSRL 3CXHJ 3LPFA 2HRPL 5LVEA 3ORJA 1RJYA 9CGTA 4WO4A 4ODHL 2APFA 4YEEA 3EFFA 4A2LA 4JFXB 2VLKB 1HINL 1YEKH 5KSBA 3RX8A 2AKRA 1S7VB 5C0GA 4JY6B 4R0LB 3SKUD 1S8DB 3B9EA 1GOHA 3DURB 1H8NA 4EOWL 4Q9CA 4LEOB 1UYWH 1W0VA 3IFNL 1F4YL 3QEQD 5TE4H 1JNNL 3U1SL 5EC1B 1QHPA 4QRSA 4TNVF 2H1PL 4XTRC 4M7ZB 1H0DB 3O8XC 4PJGB 5DO2C 5CEXA 4P4KC 4GKSA 3WS6C 1QYGH 2JIXA 4GS7C 3BPCB 5FK9B 3CDFA 5FGBA 3CZJA 5HDLA 2BVTA 5ETUB 1AO7E 2FBJL 4JFHE 1H8SA 4OTXL 5SWSD 1KCRH 2AJYH 4C56A 3MNWA 3V0VB 3STLB 2EYRB 1C5DB 4LKXB 2ZOLB 2ZSWB 3UTTE 3D0VA 4YDVA 2AEPL 3VG9C 4JPWL 2R4RL 3HI5H 2EKSB 1PX4A 1HNGA 3RA7L 4X5WB 4XH2B 4MJIA 4MA8L 1I7RB 3CIQA 5FEBA 4J7RA 1AHWA 1YN6B 1XEDA 3MRKA 2H2SC 1FFQA 2QLVB 2VXVH 1PKOA 3FHAA 1BEYL 4G6FD 1HH6B 1FLRH 3UZQA 1J10A 3DHJA 4NRXB 3ILQD 4NM8L 3PUCA 5E24E 2X1WL 4WEMB 3VFVB 4K3HA 4IIQA 3D39D 4HH9A 3OF6D 3TFKD 5IM7A 2QJDA 1ZGLB 3D87B 1U8LA 4G9FA 4QYOB 3RUGF 3VDAA 3TIEB 4PJ8A 2BVOB 1KG0A 5F7MC 1AGCB 4XNYH 5GS2H 4LDLB 3BZFA 1MLBA 4WDIB 3VXME 3MUGA 1AQKL 2XTJC 3FTGB 4Y2DB 5BV7B 5I1AA 1FAIH 4PJAF 1B0RB 1FNAA 2A83B 3ILPA 3V6ZB 5C3LD 3RVUD 1JHLL 1KFAL 4QTIL 5JUEL 5GIRB 3HI1A 3ZTJH 5FYKU 1LQSR 1ETZA 5ITFA 5T3ZH 4R9HA 4PJIB 3IB4A 4OM1H 3IU3A 1K6QH 4LLWA 2EYTA 4HIIB 3V95A 3D3VB 3O6KL 3K81A 4QWWD 4ZOBA 1ZWIB 3S98A 4QRRE 2QSVA 3GSNH 1BGXH 5C07A 4PJDB 1RFDL 3BGFB 4WW1A 3M8OL 4M48H 2EC9T 4HXBH 5LCVH 5A16B 5KVDL 2V6HA 3BWAA 4GKOA 1D9KB 3W11C 5I8KL 1AGDA 5DJ8A 4POYA 3CK0H 4C83A 3OXSB 1IEBB 4J3XA 4F15B 4K3DL 2RAMA 1FFRA 4HCRA 2XOTA 1WT5A 1BWMA 4MS8D 4L4TB 5L2JB 3FQTB 1T1YA 1EJOL 2BMKB 3C6LC 4YIQB 4H8WL 4UB0L 5CJBA 1B2WH 4X7CC 1IQDA 4JE4B 4R7NA 3MODL 4ZO9A 3BEVB 4XMPL 4OM0L 1KTLB 1JI1A 1KEMH 3MRPB 1R3LB 4X9GA 4XVSH 3X11A 3C5ZC 4N90D 2E7MA 4DTGH 3DECA 1GPOH 4IRSC 4UOJA 1XF4B 2BFVL 1GGCL 3PQYD 1HIMH 4ZFOA 3LQAH 3FOLA 1NGQL 4OZIF 1KCUH 3PV7A 4U1GC 5IQ7L 1ULVA 1UGNA 4WI2A 4PY8J 4PJEF 4R4BB 3GMMB 1MI5A 3KWWB 1NCWH 3ZYOA 2HKHL 3MLRH 1EFQA 4UTBL 5IKCA 5JXEC 5J06A 1RZKC 2BOCB 4LGSB 1KJ3L 5FECB 4U3CA 2V2WB 4X83A 3IKCA 3VRIA 3O6LH 2Z91B 1T5WB 1VGKA 1F5WA 2MOVA 1Q0YL 1XIWC 5HBBA 3OKOA 4NNPH 1LO5A 2FHBA 4ZUVB 1FNGA 2HKFH 3HZYB 4IS6A 4N1HB 1YDPA 5GGSA 5C92A 5D1ZD 5DURB 2HA1A 3THMH 4OGYH 1GGYA 3OGOE 5CJQL 4XP9H 3HG1E 1DFBH 1N5AA 1UKTA 1J8HB 3R1GH 5E8OA 3ULSA 2B2XL 2V17L 4QY8B 5H37H 5I66A 1J1XL 4ONGL 4Z76A 1WGOA 1CQKA 4CVZB 1S7TA 5DA0B 1G6VK 3CC5A 4PTUA 4PRDA 1Z9LA 2X4TA 3CFCH 3MROA 4RDQG 5E00B 3LN4B 1KTDB 3OKLA 1JGVH 3TA3C 3LRSB 2VXSH 2XN9D 1A47A 3MJ8B 5D1ZA 3O4OC 1UEMA 4UUJA 1BVLA 4UAOB 5KS9F 3MRCB 3T0BA 5DJYA 1GH7A 4LSUL 5IBTH 3G04A 5BVJB 3G5YA 4Y16B 4RZCA 1QLFA 1YN7A 4WVRA 2DQDL 4NKOB 5E9DA 5GGTA 4PLKC 1YNLH 5E0QA 5KOVC 3VXUA 4K9EH 4O02L 3L3IB 3EW3B 2EZ0D 32C2A 1FHGA 2Q76A 2H32B 1OOAA 4NHUB 2YC1B 3MJ9A 4JN1H 3RVTC 4MNQB 2NY3B 3JV4A 1EEQA 1A2YB 4YHZL 3B43A 5TE7L 3ZE2F 1S9YA 5EO9B 4YHKH 3C60C 4MJ5B 2LTQC 4XCFL 4RIRA 4U1LA 4UMGA 3I2CL 3QEUA 4TQEH 3TVMD 3NABL 5AZEH 2AAVA 3TO4A 2CK2A 3LRHA 1D5XB 1U58B 5J0BA 4FXLA 3B2VL 3QUYC 1I8MA 1UG9A 4RCAA 4HG4K 5DQ9A 3S37X 4ODXA 5FO9A 4NN5B 2HT3C 4OZHA 2VDQH 3OKEB 3WUWB 3LV3B 2I5YH 5FUZH 3MV8B 3GIVB 4YDKH 4DVRL 4G6AD 5A3IC 4GG6F 4NQCB 1S5IH 4G6ML 3LKQB 3DGGA 1HNFA 3OGCA 4X7TA 1L7TH 1FC1A 2CO6B 3MZTA 2ENSA 3JTSB 3S96A 3OKKA 2Z31C 3QRGH 5ITBL 3GHEH 2R0LL 2EEDA 3TVMA 5EO1B 2D7MA 4LFHD 5FIEA 5H2BB 3VXRD 3GSVA 3LIZH 3T3PF 1KPUB 4L29B 4QRPD 3MXVH 3V52L 3FKUS 4J6RL 5ICYB 5E1AA 2NW2B 4ZFZB 1HK6A 5HDQL 5IOPA 4P2RD 3VXNB 4KU1A 1SEBA 5KSAB 2WUCL 1ITCA 5DFVC 5J6GB 3IDXL 5EZJB 4NQTA 2VC2H 4UILH 5E8PA 3F62A 3KPRB 3C87A 1QVOA 4YC2B 4KKAD 5CILH 2D03L 2F54D 5DK2B 4YBLC 5L9DH 1C8PA 4HIJB 4H0GA 2AJVL 3VXRA 3B3IA 4Z0XA 3U48A 1A6VL 1N0XL 5FFLA 4AJ0A 1SY6L 5I1JH 4YHNB 3CFKA 1EUTA 4QRPA 5F44A 2E7LA 4B41A 4DGYH 4S2SB 4L4VB 5I8CB 4P2RA 4U7SA 2XICA 2QL1A 5B38B 1EO8H 4OI7A 4Z8FH 2P8LA 2AK4B 1D6EA 1TQCB 1CL7I 4DGIH 1PG7X 2BNRA 3WEXB 3HPLB 1NMCB 1QTYT 3K4ZA 3JBG7 2A9NL 3QG7H 1UM4H 2DI7A 4RAUA 1R5WA 3MLPA 2F54A 4WHCA 4PJHE 2RJMA 4ERSH 2ED7A 4L8SC 5KJRH 5EU7C 3DO7A 4I3RL 4JY4B 5F6IC 1T0NB 3SN6N 4LAQH 3M07A 5KSUA 3WUZA 4X6DB 2NY4C 3FN0H 5DI8A 1YEFH 4LEXH 4PJBF 3UJIH 1UACH 1CE6A 4UT7H 1FNEB 2Y25A 3L7EA 4N8VG 1ZHBB 2DLFH 5CIPA 3ZKND 5AZ2L 2BHUA 5ENWB 5F9JA 3SDAD 3CJJA 3LKPA 5LXGH 2HTKD 4K7FB 4RQQB 3QIUC 1F45A 3VFPB 5CEZH 3GJFK 5C0AE 5IMMA 3KPOB 4QXGH 3VW3L 2EH7H 1RIHL 1RK1A 3S6CA 4PJ9C 3IDMB 5IIEB 1TXKA 4U3XA 4LLDB 2WM0A 2X1PA 3PWNA 3FAXA 5DD3H 1IAIH 4XPGL 3LQAC 2ICWB 1IKFH 25C8L 1MFCH 5D1QC 4FFWD 3SDAA 2ED9A 5HTSA 5CBAA 4TNWF 1CQYA 2Y72A 4N5ED 1F3JA 4ZOAA 1WEJL 1BAFH 2ADGA 2VWEC 1HHKA 4PYGA 3UBXG 3HNVH 5C71A 3TH2T 5DEFB 2VDOH 5E99H 1DLFH 4HDIA 1RURL 2WBKA 3WNLA 4TVSa 1U41A 4JQXA 4I5BA 2NCMA 3QIWC 2J88H 4QHMB 2GJ6B 2VDPH 1AXTL 4JHBA 4P2OB 4G43A 2G9HB 5HHMD 4HEME 5EU6A 3FFDA 3GSQA 1T83C 3NZ8B 2HFTA 5J13C 2OP4L 4JO4H 2A6DA 1ZT4A 3SOBH 4ZS7L 1KNOB 3W2DH 5CZVL 1KLUA 4HK0A 5FYLL 4JKKA 1BFVL 3V9FA 1U93A 1U8MB 1AGBB 3N1MC 3O6FB 4P9MH 3ZDYF 4JFDD 4DK6A 5EBGA 3V4UL 1EGJH 4O58H 5MHSD 4G3YH 5E95B 4XNMB 4NN6B 5DRZB 2P46B 5D7IE 5GGSY 1B3JA 4HGWA 3P30H 1HHJB 1D5IL 3FAWA 4K9EC 2HWZH 3P9MA 4UBDC 2PYFB 5ILTL 3KDMB 4DAGH 1ERNA 1M7DA 1FFOB 2FO4A 4P5MB 2A77H 2OL3B 5CD5D 1Q94A 3AU1A 4O5LL 4D0CB 1ZHKB 3TCXA 3S35L 4N0UB 3G5XA 5EIVA 3ZKMC 4CN6A 4FQIH 3B8YA 2Z4QB 4MCYA 4DFHA 3QH3A 5HYQA 3S7GA 5IB4B 2YKLH 35C8L 4QOKB 4QHLA 2P45B 4DFIA 1OL0A 3BKMH 4Z5RA 2HTLD 1DBAH 4LHQB 4POUB 3VI3E 2BX5A 2NX5B 2FIKB 2FJGA 3RUGE 3UEZA 3CD4A 4M8QB 4QRTB 5HGDA 5L2KB 3LQZA 4XHJC 3QNXB 4QXTB 2BSED 4OFKA 2R23B 3QDGE 2YEZB 3GBNH 2LVEA 4NQSA 4PJAE 3MJ6A 1XGTA 4M6ML 2W0FA 2OR8A 4LCIL 4ZXBD 3MUY1 1K5NA 3EHBD 4JZOA 3SDDC 3MC0A 1L4IA 3EYVB 3NIDE 1S5HA 1XGPB 4U1NA 3VMOA 1FVDB 1ZK9A 4I0KA 4P2QD 4Z77B 5JZ7D 2J5LC 4HJ0C 4Y8AA 4LPYA 4NBYB 4LIQL 1I7TA 1NANH 2R8SH 2K3TA 2DIJA 3BKJL 3ARBD 4XC1L 5HPOA 1FL3A 3DVIA 3FO1A 5DXWA 3VJ6B 5I16B 3PIQB 5D2LB 5D7SL 1QFPA 2CQVA 1RZ7L 1SBSH 4AM0A 3B9KC 1PEZA 2P5ED 3V8OA 3MOBL 1NEZG 1WZLA 4F7EB 2ERJB 5T1KD 4WCYL 1J0YA 2Q6WB 4Z7UB 1KCVL 1MCLA 3GI8H 3QUZB 2Y06H 1MIEH 4P2QA 4D9RD 1JGDA 3L5WB 3WDJA 1QR1A 1PVHA 4KMTH 3DIFB 5DRWB 3EGSB 5IEKA 1AD9A 4XBEH 1Q0XL 1ZA3A 4OZGF 5TJWK 4J3VA 4JLRB 1CFQA 4PJXE 5AWNH 1TETH 2WBWB 2JJTC 4QF1B 4TNVK 2P4AB 1NQBA 3TM6A 1IILE 1MELA 4XP6L 1C7SA 1OTSC 1QBMH 1ORQB 2P5EA 4XPTH 1E6OH 1UA6L 1VACB 2YHGA 5D1XC 3UJJL 5HPMB 1N59A 2BDNH 4E41B 1DVFD 4YUEH 3PDDA 4HFUH 5IV2A 4EI6B 1UM5L 5SX5K 3D48R 4D0BB 1G7QB 3RGVB 5ISZE 1E27A 1FG2B 3DJ9A 3GJEA 3SKOA 2YPVH 3OKDA 5BV7H 2R69H 4NKQB 3GMOB 4NKIL 4Y1AA 4XNZB 1MPAL 1XF5B 2CIIB 2VLRE 3KPSD 4ODWB 1R3HB 5F1IB 1KJ2B 3OTTA 1W72B 2DQJH 2FL5A 3QUMB 5F7YC 3TBWB 2BZDA 1WLHA 4EDWH 5DVNA 5CWSA 3ARGC 1GVIA 2R29H 2HJKA 1WIPA 2WBJD 1FG9C 3WIIL 3G08A 3S34L 1OAYL 4KY1H 3RVWC 1WCBA 2Y5TB 4PJCF 2XZAH 2W07A 4ETYA 3ZLQC 2J6EL 3EDDA 5JW4N 2IAND 3UX9B 4IHOA 5HHQA 3KPSA 4OGXH 1M71A 2WINB 5GRWA 1CLZH 4XMKL 4RMWA 2V5SA 5E6ZA 3WIHH 4IDLA 4DN4L 4HK3N 5KS9E 3K8KA 4DN3L 5E2UL 4XT1C 5T3XH 3T2QA 43C9B 1Y6MR 2LQRA 1A4KB 2W60B 5KW9H 3TNMA 3GMRB 2QSQA 5DWUL 2YSSB 4LARL 5EO0B 2DJ4A 2IANA 3L5XH 5EBWB 1HHGA 2DWDB 2UYLB 2V2XB 2J8UF 3BP7B 3CFJB 5TDNA 4LBEB 1ZT7A 4YR6B 4GG8A 3QQ4A 4HMCA 5EN2A 3QG6A 3O6ML 1A7RH 4JVUA 5DLML 3QDMD 4G6KH 5E94B 1EHXA 3TBTA 3QPXH 1YY9C 3H7BA 5FHBH 4WI3A 2K7PA 1DBBH 3CFEA 4ISVA 5EOTB 4MQSB 2AV1A 1IC7H 1MHCA 1HOCA 1S7SA 4IJ3C 2F9BT 2IQAB 2X6MA 2BNUB 4K94L 3O45A 1ZVHA 1IQWH 2X4PA 3VXSE 1IBGL 2AP2A 1DDHB 5IMOA 1MFBL 5BS0D 1DQLL 4YHLH 5MP6H 1NGYB 2XXCB 1Q72L 1MFEH 3WFDH 1LWRA 3SGEH 4PJGF 3GSOB 1U92A 2CDGA 4LLUB 4TSCH 3QDMA 5LGHH 4ODBD 2YUWA 1U8NB 2C3VA 4LSSL 1QSZA 1I85C 4UNVA 1Q9WB 4DUXA 1IJ9A 2X1OA 5HGBB 4KK6D 3G5VB 4LQFL 4GRWB 1AO7A 2Y36L 4NWUH 2NY2D 3DSNA 4KJQD 2VLJE 1TZHA 5EA0L 2R1YB 2HT4D 3D1MC 5DC9B 5LAXB 3NCEB 5BS0A 4PJ5B 1RI8A 3C08H 5MEPA 4KJYB 5C2BH 2X2YA 1X5AA 4GW5B 3H7LA 3MLXH 2R2BA 3LS4H 3MV7E 5IB1B 5I18L 1XGYL 4P23A 2I07A 1E6JL 2G5BB 3EJZC 5CFHA 4WFEE 2H32H 1C16A 5BOZG 1ZVSB 2W0PA 4KRPD 1RZFH 1T04B 3LSOB 3ULVH 5I15H 3MRLB 3AC0A 3QISA 2DMCA 1IL1A 4M6NH 4RAHA 2ICES 4R0LC 3BJ91 5I1LB 4NO5B 1RZJL 1H5BA 2XY2A 3MLTB 1NBZB 3AMLA 2C7UA 3I3EA 5J57B 3HC4L 3PWLA 2J12B 2EDYA 2AKRB 4HWBA 3BISA 3VXMA 5C0GB 3SGDI 3V2AR 1S9KC 4NYLB 4PTTA 4M7ZC 2PCPB 4IMKA 3KXFD 1HSAB 4D9QE 3LCYA 4G8GD 1AH1A 4QRSB 2CMRH 1QNZH 1FFNA 1HQRA 4JRYD 3MRGA 3WHE0 2ED8A 4JDTH 3MV9B 1FDLH 5CEXB 1F6AA 4PJIF 3OPZL 2JIXB 2JCCA 1HZHL 4M3JA 1F8TL 4R6UA 5INCB 1WITA 4NUJB 4JRXB 3AVEA 4QRRA 3O2DL 4JB9H 1IM9D 3FRPG 3TWCH 2NXYB 3FONA 1CD8A 3LEYL 5DS8A 3MNWB 4PJDF 2J7LA 1KN2L 2X5PA 2X40A 4MAUL 1JZ3A 1TCMA 5HYEA 3C5SB 1FNFA 2OR9L 5DMGD 2D9CA 2FB4L 5DT1H 3BRGC 5IMKB 4AYFA 3QXWA 3PGCB 2WWKO 5J3HC 2VSCA 5C0BE 1CDIA 4PG2C 4Y5XA 4MJIB 1QBLL 5MENE 3MRKB 1BQUA 4NJAL 3O3BB 2VXQH 4P9HH 4UV7L 3T0ED 3WD5L 3P4MB 3CFBA 5F89A 1T0MA 4JKPH 1UEYA 1JPFA 4IIQB 2ADIA 4GW1B 1FPTL 4G9FB 4Y2DC 5BV7C 2RCSH 4ZAKB 1SYVA 2X4UA 5IB5A 2CRMA 1PYWA 2Y07L 1KG0B 5IEHB 1ZMYA 5HHOB 5INDB 3FO2B 4K55A 3BZFB 3DV6B 2QQNL 4N8CL 5CBEA 2HYMA 1KXTB 1JNHA 4ZTOH 3ILPB 4AENB 4GJTB 5HGAB 2JTDA 4WNQA 1Y0LA 3SQOL 4RBPH 3T0EA 3OR6A 4CGTA 1N0LA 5B4MD 1ETZB 5ITFB 1MIMH 4H0HB 2X89D 2PR4L 1A3RL 1QG3A 3HZMA 4FQLH 1VEPA 3BGFC 4S1RL 3U4AA 1XR9B 4M1GL 3S88L 2EYTB 5CP3H 3OHXA 5IVZA 4PBXA 3BYTA 4APQB 1D9KC 4H25A 5FO7A 4TRPH 3U7WL 5C07B 4LNRA 3IFOB 5D5MA 4WW1B 2FR4A 2YRPA 3ZSSA 3U9PH 2B39A 4ONHB 4U49A 1BZ9B 3D0LB 3PHSA 2L7JA 1A9BA 5DJ8B 1CN4A 1WFNA 2FH6A 4C83B 3EFDL 2AJ3A 4MD0B 2X89A 4XP4L 3VFOB 2OI9C 3RY4A 1T03H 3SDXA 2P48B 1KN4H 4HGMA 3O9WD 2AS5M 5FYKD 5DHVA 1FRGH 2HH0L 3KPMA 3PHOA 5EWIL 4R8WL 5TF0A 2EDOA 1T66C 3OAZH 3OAUL 2GFBA 4FQCL 1FGNL 1DUZA 4XPAH 4F7CA 1HYSC 3ULVF 1MI5B 2B0SL 2D7PA 1FORH 4KFZC 1OF2A 2CLVA 3IKCB 3SCMD 4CJ0A 1S7XA 1SVCP 3F7QA 1VGKB 1NFIB 1W2KT 4NRZB 1OAQH 3GJFA 5DVLA 4HWZB 2XYCA 3ZDZF 3OKOB 3LZFH 3UAJD 5JOPE 2P43B 4AIZB 1DTUA 2JJVA 3N85H 1FNGB 4HUUA 4IS6B 1C5BL 2A1WH 4WUUE 5DUMH 1OSPL 4AMKL 2VXUL 3W9DA 5TQ0H 5EPMB 2A6KB 4GMSL 1BX2B 1F00I 3OJ2C 4YDJA 4OCWH 3ALWA 2P1YA 4XBPA 1BMGA 5GSVA 4NO2B 3OQ3B 4TNWK 3MRNA 2X4TB 4F3FA 1U8OA 1G84A 1RULL 3FB6A 1NAKH 5JW5B 4U1HA 4XNQB 1CLOL 3HFML 4F58L 1CD1B 1AC6A 1TTFA 4Y16C 4XBGA 1HI6A 3SE9L