1KEMH

Catalytic antibody 28b4 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
EVKLVESGGGLGQPGGSLRLSCATSGFTFTDYYFNWARQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQGILYLQMNTLRAEDSATYYCARWGSYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 28B4 FAB
publication title Insights into antibody catalysis: structure of an oxygenation catalyst at 1.9-angstrom resolution.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kemH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kemH01
1ROWA 4ZFOA 5C0EA 4JRYD 4I13B 4OAWB 4GRMA 3QQ3B 3RKDD 4MD4B 4LVOB 4LAQH 4TUKH 4IJ3C 5HYFA 5HHNA 4KK5D 1PSKL 5CSZA 3NPZB 1WBZA 2DLHA 3RNQB 3RKDC 1EK3A 2CGRH 3P9WB 2R1WB 3ZDZE 5D7JD 4GLRH 4KK5C 3U0PB 1FL3B 3RVUD 3CX2A 2GK0B 4U1LB 2EKJA 5D7JC 3T09A 2VR4A 1NMBH 2DM4A 2UZYB 3WSQL 2APWA 2R2HB 1O0VA 1OHQA 2QLVB 5FO7A 3EFFA 1ZA6B 2VZVA 4HT1L 4WIQA 3FQNA 4N8VA 3TNMB 1J1PL 1VACB 1IZKA 5HGDA 1ZGLB 1BJMA 2BDNH 3FB5B 5IB3A 2YKLH 3IYLW 2MCPL 3MV8A 4BSVA 4GFTB 3HN3A 1EFXB 1ONQB 4Q6IA 5D2LF 3FT4B 5T5NF 4FFZH 1RD6A 3ZDXF 3O41A 5C0NC 4MVBC 4F7PB 4GT7A 4OCSH 2YXMA 3ZYZA 3DI2B 4JKKA 1G7MA 2AJZA 3K1KC 4U1GB 3NZHL 4LVNC 4L1DA 1CVSC 2F74A 5KVGL 4JGJA 5J89A 3EOYG 4R3SB 2O5ZH 4RAVB 5ESVA 1XR9A 1S7VB 3VXUB 4U6VL 1F00I 1I1YA 5CWSA 3RUGA 4KTEL 5C0RL 4JY4A 1U92A 2QSTA 3OKEA 2PTUA 4WY7H 1UACL 2FLBT 1BJ8A 2X1PA 4Z76B 3L5WA 2HN7A 5M7QA 5EO1B 5HHME 4GSDH 1N0LA 2OBGA 5A2IH 2AK4B 4BZYA 4JRXA 1AC0A 4JFOA 4CMHB 4Z95H 3BRDA 1ZAGA 2RR3A 3MLZH 5SWSD 4YHOH 4X6DA 5CD5D 5FUOH 2XTJB 5KSUA 5DHVH 1KN2L 3HG1A 4PJIE 5EULV 5D7LE 2AXFB 3D39E 1EBPA 4WHDA 2VE6B 1BD2D 5CD5C 4ZG1A 2UYLA 5KSVA 5I73B 1F2XK 1P6AB 3UROR 3IFPA 4JM2A 3P30H 4MA3A 5T1KA 4G80A 4S1RL 1JNJA 1JGEA 4JAMA 4S2SA 3DVGB 5DI8B 5FV2A 1H3XA 1OCWH 1JF1B 3MV7D 1VFOA 5C0GB 1MQKH 2IMNA 1OQXA 1BPVA 5C0CB 3RQ3A 5CZXD 4PJ7B 1GYAA 3GSQB 1I4FB 4LOUC 1GH7A 1NCWL 1DBAL 2D7MA 4Z18A 1FZOB 5CZXC 2YSSB 4C56E 3BDYL 2NW3A 1FN4B 4O2CB 3WDHA 2O5YH 3LHPL 2AEQH 3FZUD 1ZEAH 4QOKE 1F2QA 4ELMA 3SJVD 5FYJL 1P53A 4MD5A 15C8H 1O7SA 3ZKND 3WLWC 1FLTX 2F54A 1ZK9A 4ZUWB 2VDQH 5CFHA 1N4XH 3FZUC 3GSUB 3QP3A 3MRGA 4XPGL 5FOJA 1MWAL 5AG8A 5C08B 3ZKNC 2AXJA 2AKRB 4N9GB 4JHAH 5E56A 1OP5H 4ETQB 3QHZH 4BZ2H 2CIIA 3C2SA 4J3XA 4FXLA 3ZYJA 4H25B 3EOBA 2VKWA 4IRJA 3FL7A 5EUKA 4DUVA 5I76A 3MR9B 2BVQB 4KJYA 5HXMA 3MV01 2OJEB 4UNVA 5ITFB 4KRPD 4Q74A 1X5KA 4ZQKA 5KVEL 4PJXB 4JB9H 1KJ2B 2R0ZH 3KGRA 5HYJA 3MUJA 5I1IL 5LJYH 2Y9RT 4WGWB 4KRPC 5KBNC 3SKNA 3HMXL 4PB9L 3VFUA 3HZMB 2AXGB 4PGDB 4MNGA 4ODWB 5E99H 4M6AA 4WNQA 1FJ1A 5HYQA 2B2XH 4LFHD 5J1AA 2Y25A 4OLXL 4XPHL 3MV8D 4FQ2L 2Q6WB 4FTVE 2J88H 1CDJA 4OD2A 1BVKA 4UOJA 5L9DH 1NGWA 3TBTA 1RI8A 3SO3B 3PWPE 5CCKL 5ACZA 4X9HA 2Y4SA 4NM8H 2W07A 5K93A 2FX9H 3LKOB 5DWUL 1U3YA 4MCYA 5ALBH 4YHYC 5ANMB 1A4KB 1FYHB 1JPGA 5I9QC 2EDNA 3ULSA 2JJUA 4LLWB 4HMDA 4LRNH 4XX1E 5DLML 3ARFC 2W65B 4X80L 2OXGA 2Y23A 1F3DH 1IKFL 1AIFA 1JPFA 3RUGF 4D0DA 1G7JA 4PG9A 1MHHB 1U8MA 1WK0A 4IRSB 3QRGH 2IPUK 4JRXD 4PRPA 3ARDB 1IGTA 1T83A 4DGIL 5JZ7C 4R2GC 1Q9LA 4GRLB 3ARUA 1OLZA 3BH8A 2DQEH 1T2JA 1A1MA 2MQ3A 5E8DL 3V2AR 5JA8B 1TTFA 3HG1D 4X6DF 1S5HA 3BGMB 4U1MA 3OR6B 1KTRL 1KLGB 2GCYB 4Y16A 2HLFD 1KTDA 2JIXB 4I8DA 1CDIA 3X3GL 1ZHKA 2A73A 2BERA 4JEGB 4ZUSB 1KCSL 4PUBH 1S8DA 2V5SA 4JM2D 2DQJH 3RHWF 4OQTH 3NCJH 4EJ1C 1MRDH 1CFQA 3LN4B 3LPGA 4TSAL 4EI5A 4JM2F 1TXKA 1ZLSH 4R7NB 4N1EA 1YEIL 4HD9A 2W0LA 3BHBA 2CUIA 3FTGA 3NVQA 3I6KA 1EJOL 3JWNC 1QSFE 3WFDL 4JQIH 1S7XB 5F6HJ 5EO9B 3O3BB 5FYJE 5D7IE 2R9HD 4RAVA 2Y6SC 4Z8FL 1KPVB 1E6JH 4U1IB 3TF7C 2IQAB 1PX3A 4K8RH 2WBJB 2FSEB 1FYTB 5E1AB 3G6JE 3V0WH 2R9HC 1DR9A 1F11A 3F7YB 3FB7A 3LRGA 5ID0B 1CQYA 2AQ3A 5E2UH 3MFFA 3IU3A 4DQOL 1U3JA 5I1CL 4B7IA 3FOMB 1CGSL 1KTLB 1N59A 4X9BA 1UM6H 3UTQB 5C0FB 1NPUA 2P49B 3QH3A 3S98A 4KZEH 1S3KL 4GKSB 3FHQA 3O2DL 2F54D 4ELMF 1ZLVH 2J4WL 1XFPA 3W5NA 1C5BH 4ZXBA 3UTSA 4XP4L 3K7UA 4WUKL 5C0DB 4RX4A 5A16B 3SOBH 1CDGA 2FBJL 4QCIB 1OL0A 1PLGL 5SX4I 3O6KH 3M1BB 1MPAL 4MLSA 4ZOAA 5GISH 1BZ9A 3GSOB 3BSZL 1CLZL 2JCCB 2X44D 4FNLL 4IRJD 4JFPA 2X4QA 3LKSA 5DYOB 4QF1A 4KQ3H 3O11A 3E8UL 3WKMH 1FHGA 2FWOB 2BNQE 3PUCA 4DW2L 4BFGA 5LGJB 5KSBF 4Z7UB 2BNRE 4IRJC 4Z77A 5DSCB 1ZLWH 3WKNA 5HYJD 5BRZB 1XF2A 4HUNB 4U3CA 4LLAA 4ZSOB 3OMZA 2VC2L 1L9NA 1YQVL 3TN0A 3RY6C 4ODXA 4YWGL 4AH2A 5FCSH 5HHQA 3VGAB 4M6MH 5D93C 1FFPB 2YC1B 3IRPX 4M8QB 1LEGB 1LP9A 3L3OB 4FQIL 5FO9A 4PRAB 4GXUN 4WUUE 1JYWA 5C07A 1Q9OA 1SJEA 4M43L 5T3XD 1OAUH 3O9WC 4GOSA 2C7UA 4MQ7A 4PS4L 4HEME 2E6JA 3GSNL 5K33A 43C9B 3ARBB 3KXFE 5E8PA 4FQCL 4OD3H 5DGRA 3HTLX 1OPGL 2EDFA 3HZKA 3V5HA 1TZIA 1CDHA 4AM0A 3CSYA 1A02N 5L0QC 3V5KA 2ICEB 1I8IA 2FEEL 4ETQA 4HQQL 2DQIL 2ZUSA 3GK8H 3FFDA 3K0WA 2HJKB 1ETZA 3SKMA 1NANI 3X17A 2XWBB 4JY5L 1MRCL 2A9NL 4RGMB 3SDXB 1IC5L 1MFDH 1U8KA 3HI6L 4MA1B 3RWJB 2ZNWA 4JY6A 5SWQB 3F7PC 3FT3B 4M7JL 1K4DB 2LVCA 3T04D 4H1LG 5IKCB 4PRPD 5TDOB 2X09A 3S36L 3B9DA 5IFJB 2HAZA 2LU3A 2VDOH 2P44B 3TA3A 3CXDL 3BEWA 4GW5A 3IFNH 1J8HA 2C3VB 3ZE1F 5CJ5A 3RWEA 3PWNB 4TYUA 1MLBA 4L8SA 1XH3B 4J23A 4Y2OA 2Z8WC 4YGAB 4C58B 4KHTL 3ARWA 4JN1H 4M9PA 4Y16D 5B8CB 1CD1A 4KUCD 4PRHB 2A83A 1FZMA 1F8TH 2FYYB 4K3EH 4JCLA 3GRWA 3KPRA 5DQ9A 3SE3A 4KUCF 4JZJC 4Y16C 2GSGA 3GB7A 4XBEL 1I7TA 4JKWA 4EI5D 3GSVA 5F9OL 1TTUA 1YEHL 5ENWA 1U8IB 1V8HA 3C09C 4ODHH 1TLKA 4WJ5A 1OQOA 2IPTH 2XKNA 1UB6B 5IMMA 1BBDH 3ZHKA 1P84J 5GJSH 2EH8H 2XNAB 4U33A 2RGSA 4JHWL 1TJGH 4F2MB 3I85A 5IB1A 1RMFL 5TE6L 1V3LA 1B3JA 3EGSA 2B4CL 4L3CA 5EU6A 3MRCA 3OAZH 3RZCA 4QGTA 5D72L 1F3JA 3DRQA 1Q1JH 1EGJA 3B4NA 3VWKB 1SEQL 4HJGA 1SY6L 4NZDA 4EZMA 3P4MB 4K94H 4PJFE 1AD9B 5MEPA 1FPTL 4ZXBD 4AEIL 3UTSD 5D4QA 4QRUA 4RX4D 1DBBL 4BH7B 3TO2B 3PL6B 1XT5A 1WFTA 4ZFFB 5ACMA 2FZ3B 5ICXB 5H94B 5B38A 5CEYA 1OW0A 3CFEB 4P46C 5EZJB 1P7QB 1YEFL 1XGTB 3CMOL 3OQ3B 1Z0NA 3A6OA 1U8OA 3IJSB 1CGWA 6FABH 3KR3L 2XA8L 4U1NB 3O6MH 1CK0L 1ZA3A 2DLEA 3K81A 4NJ9L 4NWTL 5FDWB 1S9KC 4W6YB 4X4XB 1AHWB 1GZQB 4O00A 5FKPB 2BVPB 3WFBL 1DLHB 1NL0L 4TUOB 1TVBA 2PCPA 1ZT1B 4PJ5B 3TN0D 4DKAA 4NZJA 4PJ7F 4NQCE 5IQ7L 2GSIA 1SYSA 2B7DT 3ZTNH 4Z7WB 4XP6L 1OP5K 1BMGA 4JKPH 3U9UA 5B4MD 3E6FA 3CZFA 3TN0C 4DK3A 4YFDB 1KTLA 4XI5D 1LP9F 1T80A 1Z3GL 4M7KH 4RNRA 5GGVL 5C07D 4XMLL 3NGBC 4KY1H 2N1KA 1LE5B 4NRZB 4JFDB 2YD7A 2ZOKA 4KTYA 3TT1H 4JRYE 4NN6C 3QEQA 4KPHL 2MNUA 2D0FA 4NKIH 1IAII 1CIDA 2DQCH 3QDMA 2H6PA 3GKWH 5IW3A 2APXA 2NY0B 1NFDA 3G08B 3MJ9H 4HUKB 3JV0A 4DJMA 4LKCA 3CH8A 3RX5A 3VXSA 1HILB 4UINL 4H1LH 3NN8B 4LPUA 1B90A 4XVJH 1ES0A 3OZ9H 5DQDH 1OB1B 3MRRA 2DICA 1J1XL 3O4LA 2ENYA 5IIEB 1ZGLP 1LO3L 4ENED 4A6YL 3DIFA 2DMCA 3MLVL 3KLAA 3DRTB 3IKCB 3V7AE 1J5OL 4BQ9A 2I27N 4FQXB 3OKDB 5JNYB 3FFCB 3MNWB 4ZD3H 5CBEB 2IFFL 4F3FB 1L6ZA 4M7ZB 1YYLH 2W0FB 3TA3D 2P5WA 1JGDB 4JDTL 5IVOA 1IARB 4U1SB 4HGWB 2XFXB 1J8HD 3ARXA 2ZG3A 4OZFH 5J11C 3OXSB 3D48R 3TA3C 3DGGB 5C6TL 1RZ7H 2G60H 2E27L 4IJ3B 4X6EB 1IL1B 1EO8H 3NFSH 4L8SC 3KPRD 3IJYA 1BREA 2VLKA 5GRXG 3EYUL 1Q9KB 1G9NC 3GHBH 1YYMH 4ZFZA 1BJ1H 4WW1B 5EC2B 4W81A 1Z0MA 2D03L 3HB3D 2J8UA 3N0PB 2E5EA 1MOEA 1T04A 1I3RB 4O9HL 5EFIB 2ZCKH 3VXNA 4I3RL 1NLBH 3KPNB 3HB3C 2IGFH 1E27A 3Q2CA 4JPKL 2WINB 1JV5B 2XACC 3X14B 4DKEH 4JO4H 1MCHA 3EOAB 2X4UB 1NCDH 4NRXA 3BZEA 1EA9C 5EU6D 4ELKA 1NCTA 4RA0C 3TIDB 2WQ8A 1KN4L 2YUVA 3CK0L 3N9GH 5I2IB 4PGCB 1VERA 3MYJA 1PG7W 4JPWH 1ZSDB 4P5TC 3V4PH 5IHUH 1IM3B 3C5ZB 1J0JA 1TVHA 1X5XA 2DMKA 2HVKA 3EFDH 3X13A 3RZWA 3MRHB 2Y7QA 2VXUL 4GS7C 4NWUL 4QY8B 1S7WB 3TYFB 3P40A 1DUYA 5JO5B 1RZIB 3BRFA 3STZA 5F3BA 3WFHB 2LQRA 3L95A 1C1EH 2DB8A 7FABH 2XY1A 5FF6A 1TETL 2EEDA 3K2MC 1OW0C 4QXUL 1P2CB 2FGWH 5IV2A 4U1KA 2Z8VC 3BEVA 3AXLB 2I5YL 5DK2B 1NDGB 5EBMB 5I71C 3AAZB 4Q0XL 1ZLVK 1G6RH 4WTWA 2PO6A 1V7ML 1ZMYA 1XF1A 3PNWA 3QA3A 3RGVB 3FT2A 3WV0A 3OJDA 1RJLB 3MV9B 1CD8A 1WIPA 4NP4L 3QR2A 1AR2A 3MRJB 3FO0L 5CINL 5E2TH 2Z92A 3ZSTA 1WIOA 5ICZB 3RWIB 5GGQH 4YO0B 3KDMA 3MLSH 4LHUG 5F9JA 5J13C 2NLJB 3TBWA 2ZOLB 3RAJL 3DJ9A 1M1SA 3UPRB 1U8LA 2DBLH 3GIVA 2VAAB 3QEQD 2D7TL 2G2RB 4I2XE 5DR5L 4C83A 1MNUH 1TITA 4LCIH 3QDMD 5EG6C 2W9LA 1YPZB 25C8H 1UVQB 2ICWI 1QLRB 3GBNL 3VXSD 3JWOH 3IETA 3SKJL 5E8OA 3GSWB 1H3PL 1KENH 1NFDF 3H6JA 1NAMB 2NY4D 4MSWB 2BRRH 1P7QA 2F19H 2EDYA 1GC1L 3O4LD 3RWCA 2CK0H 4YFLF 4MNQB 3RTQA 5DHVA 4XNQA 4TQEL 4W4OA 2NY4C 4Y1AA 4L8BA 2WIIB 1T0NA 3MLYH 1A7QH 2RHEA 2DWDA 3BT2H 3CMGA 4G5ZH 1K8DA 2CKBH 3ARRA 2YD2A 4XCCL 4Z7UF 1GAFH 5T1MA 1UWEH 3I50H 3CFDB 5DC9B 4M9OA 4M00A 3E6HA 4Y4FC 4ZTOH 2P5WD 2W59A 2CO7B 3CUPA 3S97C 1NEZB 1CGYA 1FZKB 1LK2A 4NZTH 3LEYL 1L6XA 3C6LB 3O3DA 4MD0A 3PV7A 1A3QA 1A3LH 1T2QH 2BZDA 2EYRA 5EU3B 4B7LA 1ZHLA 3QIWB 3SDCA 3TFKC 4OGZA 5E2JA 3TV3L 3TEUA 2VLKD 1DSFH 4OSUH 3KYMB 4NCC1 5ESAB 5SX4H 2Q76B 1AR1D 3SPVA 1NGXB 5GRYA 5DJ2B 3LMJH 1VEMA 5FV1L 3RUGE 4AT6B 3AM8A 3MRLB 3QXAA 3ESUF 1AQDB 4IHOB 4FXGA 2AW2A 1AR1C 5IB2A 4MX7A 4UDTB 3GHEH 5DFVC 2ED8A 2BOBB 1GPOH 3MOBL 4JRXE 2RB8A 2IANA 1A6TA 3WUWG 3IDXL 1U8QB 2NNAA 1H3WM 3OAYK 4PJGA 4CBPA 4WI9A 5F7UA 1D3CA 2VXSL 1TJIL 1JGLH 1INEH 3QIBA 4UQ3B 4LLUA 5HHOA 1A4JB 1MCOL 1CXIA 2X4OB 3DX7A 4G8IA 4L8DA 1MFAL 3N85H 5IG7A 3OXSA 2CDFA 1YMME 4LCYA 1BM3H 1M7DA 3N50A 2YPKB 1GVIA 4HPOH 1MCQA 3Q6FB 4R6UA 4D8PB 5IBLD 1IMHC 4YHYB 2L4OA 3H7BA 4IBLT 5ISZD 4P4RB 1JZ8A 3V8OA 4OI7A 1X3DA 5JPMA 2G5BA 5EZIL 2X4SB 5FHBL 1OARH 3PWUB 3QULA 1KBGH 2BSTB 5IBLC 2CLZB 2AJVL 3VFNA 4HKJB 4H5SB 3ARFB 5CJQH 3OAZK 3QDAA 4JZNB 5IBUG 3DLQR 3STBA 3NACH 4HBQA 3EYFA 4KROD 4XGZB 1LDSA 5GGUB 3TPUA 1DE4B 1RZJL 1TQBC 2PO6D 4R2GB 1NANH 2NTFB 3IAPA 1FV1B 3D25A 1ZHBA 1CFSA 3S4SB 4KROC 1HH6A 4LSDA 5C3LD 5TDNA 5F21B 4YHLH 4CGTA 3KLHD 3GM0A 4JPVL 2PO6C 3UX9B 1OAYL 5I75B 2MHAA 2DDQH 3KNBA 1U36A 8CGTA 4ZYKB 3V0AC 4X5LA 1AP2B 3ZHLA 4OIIH 2O61B 5DUBB 3I75A 4M1GH 3ES6B 1Q8MA 3GMPA 4OGXL 4ZUTA 3ZDYE 2QJDA 1N7ML 3UC0H 3VWJC 1JHLL 3L3HB 3ZKMD 1DBMH 3GMLA 1W72H 4M4RA 4X4MA 4M62L 3QDGB 4PRNB 5E6IA 5BV7H 3OHXA 4GAFB 3DURA 3T0EE 5IM7A 2VZ1A 1EPFA 2CH8A 5H2BA 5K9JH 5IF0B 5KSBE 4XZUA 2CQVA 1YUHA 3D18A 4YQXH 5I17A 3RTQD 3Q3GB 2ZJSH 3VXRB 1GHFH 1BBJB 4Y1AD 1XR8B 2YPLE 1XF4B 4S1SH 3W0WA 3RTQC 1Q9WB 2CMRH 2X1QA 2I9TA 1JPTH 3G04A 2YA0A 4C4KO 4NZUL 4OQTA 4X5WB 4ZOCA 1HEZA 4G7VL 4RRPG 3N1PC 4Z7WF 2H3NB 5KS9B 4DGVL 1A6VH 4NHCH 3EO1A 1NCAL 3S88H 5KANI 2NY5H 3SDCD 1PQZB 1R3KB 2JF1A 4HWBH 1FGNL 2ZG2A 1M71A 4JVWA 5F89A 1QR4A 3L5XL 3V52H 2VDKL 3HUJA 2Q86A 5JIKA 4P23A 1TZGL 1D5ZA 1F58H 3SDCC 3WDJA 4Y5YA 1MJ8H 4JJ5A 1CS6A 3C6SB 3PXJA 1UEMA 1F6AB 3QUMH 3K3QA 1NAKH 1UA6H 1MHEA 4XP1H 3AY4A 4RISH 4K55A 1MELA 2VLRA 4PLJD 1HXMA 1RHHA 1D6EB 5FECA 1A6AA 1DANU 1GSMA 3F12B 4IM8A 2IAND 3AM8C 2OZ4H 5L6YH 2GTWB 2IC2A 3VA2C 2R2BB 4M5YH 1BWMA 4ODTH 4DKDC 5FGSA 3UPAA 3TCLA 1N5AA 3BD3A 3C87A 5GSVA 1G9ML 3O9WB 1HINH 3BN3B 4H8WH 4JKLA 3QIBD 1L4IA 5HHOD 1KJ2L 5EOCH 1T1XA 3L3IA 1G0XA 4FFYH 4HWEH 5L0QB 4Q7DA 4U0RC 2AJSL 4GG8B 4J7RA 2B1AL 1I8MB 1HXYB 1FFOA 3FCTB 4H0GA 4APQA 5TGBB 1LEIA 5E2WL 4CADB 3OAUL 4NM4L 4PLKC 5F1SA 3MLRL 3AC0A 3GMQA 5IB5B 3FKUS 4LCCA 3GRWL 3VXUE 1BZQK 4RGOH 4EXPX 1HSBB 4O02H 3W9EA 1XF3A 4W6WB 5GS0H 1CCZA 3T0BA 4EQ3A 5F1NA 5J6HB 4XP5L 2OR9H 1UH3A 2AK4E 3EW3B 2UUDH 5CEZH 1KACB 5DO2D 3FQWB 3UTPE 3FO1A 2F15A 3JV4B 5IEHB 2XTJE 5LXGH 1KJVB 1T66C 1ZT7B 4UQ3A 5DO2C 2QKIA 3EZJB 3QCVL 4TVPD 4X98B 4JZJB 4D9LH 3F58L 3ROLA 1L7IH 3LQAH 4I4WA 3MCLL 2D31B 1EGJL 2R0LH 4BM7A 3QNXB 4QHMB 3C09B 1IEAA 5E6ID 2WUCH 1U8HA 1K8IB 3OR7B 3GGWB 3HC4L 2EIEA 5CS7A 1DEEA 3NOIA 4PJCB 1OP3K 1J05A 4M48H 1RVFL 2VLMD 4PRDB 4HS6B 4XAWH 2EXYD 5C0CE 4LEOA 3RWHA 4PJ7E 4OM1L 1UWXH 4JFEB 4N0YL 4R90H 4WHTB 2NXYC 5GGUA 3W0WD 4DUWA 1MAJA 4LU5L 4NDMA 2CD0A 2DL2A 3VFRB 3IDMA 4ESKA 5BVJB 1HIML 1W0VB 1C5DB 1LP9E 3OPZL 4OI8A 2PW1A 2DQFA 3U0WL 3D0VA 4I0PA 2OL3H 1BX2A 1JRHL 3D2UB 1MCKA 5KVMC 2AJXH 5DGQA 1IILE 1VGEL 1YN6A 2HT4D 1RJYA 3SE8H 1AP2A 1MCCA 3S34H 1CDBA 1N0XL 5LGHH 1HKLH 5FYLH 4IMLA 3MV11 3BIBX 4P46B 2UWEA 2A74A 1A1NA 1G0DA 5C08E 4K8RD 2HT4C 3LS5L 4NRYA 2BY0A 3MACL 4XC3H 4DK6A 4M6NH 4H88L 3H9SB 3C2AL 4P23D 3DWTA 1N6QH 4E41A 5HHXH 2XKUA 1BIIB 1RZ8A 4P4KC 4EBQH 3W2DH 2Q20A 4P23C 4V2CB 3HCVA 4P5MB 3GMNB 4KQ4L 2V5MA 4PJXE 3FQTB 5I74B 1ACYL 2VLRD 4ONHA 3RWGB 5DJYB 1AO7B 5KZCD 1XCTA 2D2OA 3MNVA 2I60L 4B53A 1K4CB 3CXHJ 4CMMB 1MREH 3SGJA 3U7WH 1DCLA 2GFBA 1CN4A 2E9WA 4NN6B 5DFWH 4MQTB 4QT5A 2ARJB 3S7GA 3F7RA 4I9WE 3DUHA 1Q0YH 4F7TB 1UJTA 5BXFA 3H0TB 4R4FH 2YK1L 4OB5L 1R3HB 3RY5A 3E0GA 2B8OT 1I7UA 3VI3F 4APQD 1VKXB 1RZGB 5IFAL 3QEGH 5BVPL 5EO0B 1XZ0B 3G6AB 3MO1A 2XWTB 5JR1L 5DS8A 3QCUH 3D85B 3O3AA 4YBHA 1UWGH 4APQC 4IDJH 2EYTB 2VZTA 5IROA 3BESR 2A38A 3E3QE 4R8WL 4I18A 1JYXA 3QI9C 2O5XH 4NNXB 3SDDA 2V17L 4YE4H 1ADQH 1NFIB 5E5MA 3TZVB 1ZVHA 4JR9L 2OMBA 4E0RA 1EHAA 1FFQA 1KIUA 5E8EA 4OKVB 5F7DA 4OCRL 1WSST 4H1LA 4ONFL 1E6OH 1QLFB 4KK6C 3QWOA 4MCZB 1CD0A 1JGUH 3F7VA 4F7CB 4MA7H 3Q48A 4N8CH 4HKZB 1YEGH 2ILLA 1S7UB 3HFMH 4NJAL 3HE6B 4F9LC 2W38A 5TF1H 3QCTL 3U4EB 5KAQG 2NCMA 1C16A 1MAML 1R5IB 3J7HA 4KTDH 5HHVH 1RZFL 5E08H 1KEMH 3DV6A 2GW5A 4Q9QL 3KPLA 2F8OA 5E9DA 5I6XB 3MOAL 3GFUA 4LPCA 3U7YH 1FCCA 4X6CA 1MLCA 4J3UA 1N6VA 4MNHB 5ALCH 1F90L 1R0AH 1S7TB 5IMOA 4WFHE 2QV2A 3LKQB 5TFSH 3T65A 1YECH 1OGTA 3P77A 3KS0H 4UQ2A 5M95B 4LLMA 4FFWC 1LE9A 4HCRH 3INUL 4GKNB 1AGFB 1FYTE 5DJ0B 4UUJA 5HDLA 2CJUL 5IVZA 1BVLA 2HH0H 3L3GB 1A7BA 3CPLB 4P5TB 5ICYB 5CUSL 3BRGC 5CJOL 3PHOB 2R8SL 3TH2T 3T77B 1FAKT 4I0PD 4Z9KB 4GQPH 1QACA 1ITBB 1IFHL 1WCBB 3PWJB 4LGPB 3W82A 3MRFA 3PXHA 2XRAL 4HXBL 2BHUA 1A1OB 4ZDHA 1QBLH 4GS7B 4XNUL 5ID1A 3QEQE 2ZKHL 5DC4B 2FX7L 4I0PC 1HQ4A 4MZ2A 3EYOA 2Z8SA 4MXVF 1IAOB 2UWEF 1KCVH 2VLJA 4XCYA 4W68A 5CGTA 1QBMH 1LO0L 5IHLB 3PDOB 4XX1G 4D0BA 2JCCE 4YXLH 4E41D 5I71B 2PTVA 4K2UL 5IJVA 5J0BA 5DMIL 1B0GA 2CIKA 4MS8D 4AMKL 5JXAL 3DV4B 3ESVF 1T5WA 3HC0B 1Q94A 1LGVA 4Z7UE 5D70L 4F7EB 2P5EA 1FGVH 3TC9A 4FQQB 4OD1L 4QWWC 1RFDH 5BRZE 5F9WC 4PJEA 1G7IA 3V6OE 3I02A 4ZSOE 1B88A 3FO2A 1LDPL 4Y5VA 3VXQB 4K94C 3VRJB 5JPNA 3LEXA 1UGNA 1V7NH 2HT3C 5HVFB 2XWJA 1MF2H 5LKNA 3E2HB 1U6AL 1ZANL 1KYOJ 1C5DA 1M6OA 1Y0LB 2R23B 4KI5D 3D5OF 5F6HI 4M1CD 2IAMA 2AJ3A 4PP2A 4JO2L 5I16A 4PV9B 4KI5F 5EBWA 4MDIB 1A5FH 1XGYH 1F13A 4JVPA 4NKMB 1FGNH 1G6RA 4NN5B 4GBXA 3UEZA 2EC9T 2YZ8A 4F37F 2E3VA 1PEZA 5KOVC 4DZ8B 5FXCH 3MRQA 4R97C 4WFEE 4OF0A 5IW6A 3MUGA 1PSKH 2ESVB 4RFNC 4EDXA 3MA7B 1JYVA 1VFBB 2FECL 3CDGA 3MGOB 1F6FB 4U6TA 2AGJL 3TYGL 3LZFL 3SDDD 5LAXA 2WANA 1FG2A 4LCWA 1K5NA 3RDTB 3MRDB 4Y4FB 3MRPA 5DMGD 3VH8G 3VRIA 1DN0A 4I18C 4GXUM 3T4YB 4LNVA 3D3VA 3WSQH 3SDDC 5EB9A 1T0MA 3VFOA 3OKKA 3FMGH 4EKXA 2E7BA 4HT1H 1J1PH 1R6VA 4NUJA 3WJLA 2MCPH 2AK1L 3FJTA 4LRIA 5IQ9A 1JTOA 4TRPL 1A9EB 1JUFA 4PRHE 4PY7A 2V2WA 4NO3A 3UYRL 2FD6H 4PG2A 3QXWA 3QJFA 3FN9A 4XXCC 2CKBA 5C0IA 2OTWA 4YHKH 5IW1B 5FOBA 3PABB 4OZHB 3WLBA 4YPGA 4UMGA 3NZHH 1G7PB 5EOQH 4OV5B 3HMWL 5E9DD 2UUDK 1HSAA 4NQSA 1U2CA 1EDQA 4LP4A 4MWFA 4DCQA 3OTTA 3QFDA 5EC1A 5JW5B 4U6VH 4X6CF 3VFTA 3PWVB 3ULVF 1OF2A 1WZ1L 4KTEH 1Z5LB 5C0RH 4WFGE 2MMXA 3BYYA 4LKXB 4PV8B 3F7QA 1UACH 4G6FB 4P5KA 2ZCLL 1YDPB 4ZPVA 4POYA 3MGTA 1FL6A 1LO4L 2Z0BA 5DJ6A 3MZGB 5LWYL 1N3NA 4FP8L 2QQQA 1JP5A 4A2LA 4LDOB 2QSQA 5CIPH 5GSRB 3BKCL 1I75A 4NQTA 1KN2H 3CVHB 3D69B 3PV6A 1XF5A 2BY2A 4O2FA 4PREB 4X7SL 4L29B 1HCFX 1UWXK 5D9SB 1UYWL 3S5LB 2VLJD 4U6YA 1FRGL 4U1HA 1AI1L 5EBLB 2PYEA 1CQKA 1QFOA 3IFLL 4S1RH 5KJRL 5KW9L 4TVPL 2DLFL 1UXSA 1GGTA 4F7MA 1JWMA 4HC1L 3GBML 4OT1L 4Y1AE 2XN9A 1NC2B 4NNPL 2P5ED 3HAEB 3HZVA 4LDEB 3S37X 1QKZL 2DTML 5EU7C 2R2EB 4PJ5E 2R1YA 1NCWH 3FB8B 1DBAH 4KXZI 4RBPK 5F93C 4PJEF 2EECA 1ZS8A 1EHLL 1JZ3A 5K9OB 2NY2C 3BZ4B 5FGBA 5DDHA 3SGDI 4Z7WE 4JFFB 1CXFA 3IS1X 3ETBF 3LHPH 1KXTB 4Y5VC 2IAMD 5FYJH 3VWJB 5EU5B 5C09B 3DGCR 3F8UB 3IB4A 2IPKB 3QFJB 4YHPA 4AIOA 3DROA 3HPJA 4JFDE 2EDKA 4NKQB 4XPGH 4LHUA 5CP7B 1MWAH 5JMRA 4GBXD 1EXUA 3DSFL 4OZGA 4P2YA 1BFOA 2FO4B 4BH8A 4DZBB 2E7LC 4J8RB 2YWYA 4PTUB 4PJ8C 4GBXC 4L8CB 2GTZA 1BEYL 3REWB 2PKDA 4LCUA 5DJZA 1S7SA 2DYPA 1JNLL 3NPSC 4QRPA 3WN5B 4YUEL 1D9KA 1KFAL 3BW9B 3Q5OA 5KVEH 4LCWD 3ARGA 4LF3A 1IGYA 3EZ8A 5BS0B 5I1IH 1G7LB 3FFCE 3HMXH 5KN5A 5FAAA 1W72A 4PB9H 3D3VD 1NAML 5IK3A 1VESA 3VXQA 3CCHA 4JDZB 4O2EB 5A3ID 4BK4A 2CXKA 4LLQA 2OI9C 4G8GA 3ZKSD 4JFQB 4FN0A 1NJ9B 4OLXH 4XPHH 3R0NA 4L4TD 3V6FB 1KCLA 2A6KA 4FQ2H 1U41A 3JWOC 5DJAA 5E4IA 2IH1A 4P3WA 1L0QA 1FC1A 3WJLC 3T0XA 3ZL4L 3QDJB 5I1KL 2E9JA 5CCKH 5DRWA 4PJDB 1A64A 4JZOA 2VL5A 4GRWB 5DWUH 4YIQB 1JN6B 4I0CC 4PG2C 4XRCA 3DMMA 3L6FB 1KSRA 5E00A 3VG9B 1F42A 3WE6B 5EPMB 2YA1A 3IDGB 1BAFH 1FVCA 1SMOA 4HFWA 5DLMH 4AENA 4BSWB 4I48B 1AD0A 4X80H 5JOFA 5F70A 2A6JB 1T1YB 4MB4A 5HSFA 2ARJQ 1IKFH 5I1AB 3VD4A 3MNZB 3KYAA 2A0LD 2PYFA 2QQKL 4ZNEE 3WFEL 5MEQA 3VFGL 1Z2KA 2FL5B 3BMVA 3OX8B 5FB8B 1DQTA 3ZO0A 4DGIH 3ARPA 2XTLA 5J56B 2WBKA 3PE9A 1UCBL 2EDQA 4M5ZL 5D1ZA 1YEDB 3WUWA 2WWKO 1IM9A 2ICWB 2EDEA 2A6DA 4ZS6D 4G6ML 5E8DH 1C12B 4HK0A 4TVPE 3QUMA 4EN3A 4YDIL 1IQWL 2ORBL 4KKAC 1KJ3L 2NY6D 1T22B 1RK1B 2HTLD 2P8LA 3CH1B 4G42A 3TO4A 3X3GH 4ZS6C 1FNGA 1K3IA 5F7EL 1KCSH 2J6EL 5FUZL 2NY6C 2P46B 4M7LT 2G9HA 2H32H 1U95A 1F4YL 1UADC 2PYED 3G5ZB 4TSAH 2Q7NA 4KK8D 4LPYA 4PJBA 5LCVL 5IMLA 1FNLA 3V7AG 3G5YA 1YEIH 4ONGL 2X1OA 1EJOH 3EDEA 3WFDH 1W0WB 1HOCB 2BOCB 4LQFL 1PKQA 2XN9D 3NCYS 3QHFH 1UM4L 4KZDL 3CDYA 3W39A 5GHWH 1A7RL 3VGDA 5K9KB 4LLYA 5T5NG 5C0AA 2Q7YB 4NFCA 4PIRF 4WI7A 2FH8A 3QEHB 2MQCA 5CSBA 1IGFL 4ORZC 4TUJA 3KG5A 1FVEA 4DQOH 3MXVL 1RIUL 5FA4A 5I1CH 3MUHL 1CGSH 4UTBL 4QXWA 4XC1H 2J3SA 4G9FB 3D87B 1S3KH 3O2DH 4HS3B 2J4WH 1C08B 4X6FA 2AQ1A 1A2YB 4XP4H 4MAUL 4WUKH 2C1PA 1U3ZA 4LHUD 2FBJH 4XXDB 4KDWA 1PLGH 4YGVB 1MPAH 1YPZE 3MCG1 1NKRA 3BSZH 1CLZH 3A6BL 3HC3L 3RRQA 1QVOB 1TCRA 4FNLH 3N1MC 1QFPA 2DKMA 4D0CA 1KT2B 2YD6A 2DYPD 2NXYB 4MNQE 1XGQA 3E8UH 4QRPD 2VAJA 2VLRE 3FQRA 1D9KD 4O51A 1KGCE 4DW2H 2QR0A 1S9VA 4HSQA 3ARGD 5D7SL 3QUXC 1DQDL 2H2SD 3SE4C 1TDQA 3LKNA 1D9KC 2QSCL 3KVQA 1FCGA 4UV4L 2VC2H 4TPRL 4JM4L 1YQVH 3AB0C 3BP7A 2GHWB 3ARGC 4YWGH 5I1EL 1NBYB 5F1IB 2H2SC 3FB6A 4YDVB 3QXDB 2QADD 3WIFB 1NBQA 1KIQB 4G8GD 3OKOB 4FQIH 4GUPA 2V2TB 4JFYB 1G6VK 1CWVA 3FQUA 1MH5B 4WCYL 5BV7C 4M43H 2WWMD 3SKUD 2QADC 4RRPA 2NTSP 4PS4H 4GW1A 2OXHA 3FOLA 3GSNH 3DVNA 1ED3B 4FQCH 3U46B 1OPGH 2WWMC 4P4KB 1SQ2N 4GW4A 4UU9A 1P4LB 1KB9K 1NMAL 2X4NA 3L7FB 3DMMD 4HQQH 2DQIH 3I3DA 1SYVB 3G6DL 2Q1EA 5E94A 2OL3A 5HGHA 4KHXL 3QZWG 2F53A 3P73B 3V4UL 1QP1A 4O58L 3VFVA 1MRCH 1F45A 2A9NH 5MP6L 3DMMC 4QNPF 1IC5H 1UB5B 1K85A 1GXEA 3HI6H 2EDJA 3TVMB 1LNUA 4M7JH 4S1DC 1HZHH 1OM3L 5A2LH 1QO3B 5J4MA 1QQDB 5IMKA 3S36H 1I8KA 3TJHD 1CT8B 2NY5C 3IXTB 5D1ZD 4NIKB 3KWWA 1CL7I 1WEJL 3CXDH 1NCNA 1IM9D 3JVGC 2FHCA 1CLOL 3R1GL 1M05B 3UDWA 4EN3D 2R1XB 3TJHC 1MEXL 4KHTH 2PXYB 5J6GA 2GUOA 4MB3A 3TO4D 1L0YA 2AVGA 1QSEA 1OY3B 2JB6B 4EN3C 1X44A 4NQEA 5I1DB 2XXCB 2BJML 3DX9A 4XBEH 4EUPG 4O4YL 3TO4C 4LLVA 3RBSA 4XVTL 3QI9B 4CL7A 4HKXB 5FYJU 5F9OH 1XIWB 2EKSB 1KCUL 1YEHH 5JHDA 1P7KB 2IALA 4PJBF 4OZHF 5IVNA 1QA9A 3O45B 4NGHL 4M3KB 4IMKC 1JFQL 1NCCL 4OF7A 4H8WC 3ZE0F 1IGJB 1M7XA 5C0AD 4JHWH 3KPPB 1RMFH 5TE6H 1JPSL 4MJIB 2VTFA 4RGNC 4OM0L 5TDPB 4HZAA 2IWGA 3ULVL 1EAPB 5D2NA 2B4CH 4YDJB 1EEYB 5D72H 4CN6A 4N0UB 4PJAA 1P9MA 5MENA 5CSGA 1SEQH 2EIZB 1SY6H 3DO7A 3QO1B 2BC4B 3EO0B 4MXVE 2HG5B 1FPTH 1CDCA 2CRMA 4AEIH 1MFBL 5E24E 4N0FB 4PYHA 4LLDA 3DXAB 3MRMA 1DBBH 4QRSB 3VFWB 1X4ZA 1DQLL 1CFTA 5C70A 1HH9A 4P59L 5GS0D 1KV3A 4HUWA 4HIHA 3C5SB 4QHLB 3HS0A 3C08L 5CEZD 2CLVA 3CMOH 1YEFH 3ALXA 1RQ5A 4G8FA 4HX1A 4NZRL 2VNCA 3KR3H 2XA8H 4BELD 3GSXB 3NTCL 4DKFL 2N7AA 3A0OA 1CK0H 5JUEL 4Y5XA 5F7HA 3MRKA 4N5EC 1NKOA 3BWAB 1OAKL 4NJ9H 4NWTH 4ODUB 3VXRE 4HAGA 4P2OC 3O8XA 4OCWL 5FUCE 3SDAB 3WFBH 1U3HB 1KLFA 1JNHB 2FR4A 1NL0H 4P2QB 4HPYL 5JW4M 3ARYA 5IQ7H 1VGKA 1U91B 4XP6H 3B9KC 5B39G 4KI5E 2FJFB 3LQAC 4P0DA 3JV5A 5KS9E 1WV7T 4WO4C 1Z3GH 4PRBA 5GGVH 4XMLH 5F7WC 4RZCA 1JTTA 3IXAB 3MJ8A 4K3DL 3MBEB 2C3HA 4KPHH 3X11A 3PP4L 5ADPL 5J9PB 2E8YA 2ZNXA 1I9RL 4HCRA 2FX8L 2JK5A 1KC5L 4UILL 2X41A 2EIBA 4UINH 3F62A 3KPMA 4XNXL 4B50A 1J1XH 3ELAT 3VJ6A 2F53D 1FL5B 1LO3H 3PGCA 3DSNA 2D7QA 2M8XA 4HIJA 3TM6A 4A6YH 5JXEA 5KVFL 3MLVH 3VXMB 4PBWD 3PGFL 3CFCL 4G43A 1J5OH 4TNVK 4D2NA 4Y7MA 3L7EB 2D4FA 1INQB 4CVXA 3RVVD 4Y19B 5CBAA 2XICA 5DEFB 1P6FA 1QFUL 2IFFH 1S9XA 5D6CA 3BH9A 1T1ZB 4JDTH 3BKJL 5HYSB 1R5VA 3DOSA 4XTRD 4CN1A 3RVVC 3WIIL 4EUPH 1HNGA 4JJHA 1SJHA 1U9KA 3MA9L 4PJIA 5D7LA 3D39A 5I0ZA 3CFKB 1T4KA 2VQTA 1X5GA 3SCMB 5C6TH 1IKNA 4XTRC 2E27H 2AEWA 5KOMC 4ZO6A 1QSED 3MLPA 3UDWC 4NQED 1J87A 1WCQA 5FM5O 4PYGA 3EYUH 2HJLA 2YEZB 2XZAL 3ULVE 3MJ7A 2D03H 3H9HB 2G5RA 5I8EA 2D0HA 4D9RD 4YPJA 1FNEB 4O9HH 1BFVL 1A6ZA 2ED9A 1AXSA 1DP0A 4I3RH 2JLLA 4X5XA 4JPKH 4LVEA 1G9EA 1WC7A 2ITDB 1IAMA 5I1LA 1QR1B 2V7NB 2FJHA 4X6BA 2BCKB 4C56A 2IADB 3DETD 4QOKA 1KN4H 3CK0H 3B3IB 1CLYL 5MEND 3QXTA 1PW3A 4WEBL 5DRZA 2VIRB 2DQHL 4PJAF 4P9HL 4C55A 3BKYL 3DETC 3QJHB 4TOYL 3TIEB 3KYOB 5JTWA 1QRNB 1YNTB 2P24B 4UTAL 4FXKB 4CVZA 4P2CG 4NO0B 2VXUH 4NWUH 5HD8C 5GIRA 1ORSB 3I6GA 5T1LA 4OIBA 1EEZA 1T2XA 1B6UA 2Z35A 4Q9BA 4BQBA 4HIIA 3O6FB 5MI0C 5F71A 1TETH 3T1FB 4QXUH 4OZFB 1EO7A 1G9NL 3TNNB 2B1HL 2I5YH 4PJEE 3O8XD 3ARQA 4L4VA 5HHPA 3BIKA 4Q0XH 1U0QA 2DQTL 1FZJA 4JFEE 1N8ZB 3UJJL 3D0LA 1V7MH 4BK5A 1JJUA 3HPLA 1TZHB 1T3FB 2APBA 1YMHA 1MVFA 3MXWL 4NP4H 1AGCA 1C7TA 2DI9A 2FIKB 5L7XL 3FO0H 4RCAA 5CINH 4X7TB 3STLA 2CDGB 1FAIL 4JKMA 1SJXA 5F44A 4FTVA 4XAKE 2XV6B 1WWCA 4H26B 4YX2L 3FONA 4NQDB 3CD4A 3RIFK 3PF2A 5DURB 5DR5H 2D7TH 3OL2A 1BECA 3VFWA 1P7HL 4FRWA 3UZEA 1U8PB 3H9SE 3GBNH 3UTZB 4LNRB 3TPKA 4P3DB 4Q9RL 3UJTL 3SKJH 2E7MA 1H3PH 3R0MA 4X8XA 1GC1H 3X12B 4OV6F 4PGJA 3CDFA 1E4XI 5JXED 3TBVA 3O3EA 4TQEH 3JV6B 1AQKL 4LEXL 2NY2B 4YBLC 2PW2B 5BZWA 2E7HA 2HT2C 5DJ8B 5L2JB 2OX5A 2OS7A 5HHMD 1AO7E 3GDBA 3BN9D 4XCCH 1N2RB 5F88B 5JXEC 1I9JL 2EDOA 3CLEL 3VFPA 4OCLC 5FK9B 1KPUA 5FKAA 1OP9A 3SBWA 4BUHA 4RIRB 4HHAB 5H35B 2BSSB 3P0VL 1XCQA 4P3CL 4WI4A 2XI9A 5D7LD 1J10A 3D39D 4YBQC 1KB5B 3LEYH 3NCYP 5D5MB 1RUML 5KSAA 1AXTL 3LKPA 4PJ8B 3GJEB 3BPOC 5BW7C 3CX5J 3NFNB 3PWLA 3R8BB 5AAWA 3TV3H 1IKNC 1S9WB 3MLTB 1SEBB 3NPSB 1RK0A 3SY0B 3KHQA 1QSFA 2OQJA 2GJZA 3SDYL 5E8NA 1FP5A 3PQYB 1KOAA 2AI0L 5D7IA 2CLRA 1E28A 1CF8L 1OAXL 5LG1A 2QHLA 4LAJH 4V1DA 3EYVA 4QRQA 3G6JA 2OI9B 2R69L 1MWAA 1ORQA 4C56D 3IDXH 4KJWD 5GRZA 4IRZL 1JVKA 3U0TA 4Q6YA 3SGEH 3IFOB 3ILPB 4P99A 2LTQC 3ROOB 4QOKD 3VH8A 1DDHA 4HIEB 4MYWB 4Q2ZA 3TBSA 4AQOA 4A2MA 2VXSH 1T6VN 1TJIH 4BFIB 5E5UB 3W9DA 1MCOH 4X99B 3QQ4B 4OQ1A 1T1WA 1JZ2A 1QHPA 2Z91A 5FYKU 3RIAF 1MFAH 3BPCB 3WS3B 2ADGA 3C60A 5DJDB 2HVJB 1HHGB 5F3HB 1XEDA 4DVRL 5LQBL 2HFEA 1XGRA 5EZIH 1ZWIA 5FGRA 4XCNA 5IEKB 1RUKL 5T1LD 3V8CA 5FHBH 5D1XA 2AJVH 1MCIA 3V0VA 1FNSH 3H8NA 3FO9B 4FABL 3REVB 5FO8B 5KAQF 5EOTA 2BNQA 3OKMA 5BQ7A 4LPVA 2BNRA 2VLLB 1K2DB 2UY6A 2Z4QB 3NFPB 4LBEA 1A9BA 4H0HB 4L4VD 1F6LL 1FVDA 3O4OC 3OKLB 1RZJH 3VXTB 1FG9C 3I6LD 1QYGL 1JWUA 2CUHA 4YNYA 2XQBL 2FBOJ 4ZAKA 4Z0XA 4JPVH 3JTSA 3CC5B 4MJ2A 2YWZA 2NX5B 1OAYH 4WUUA 2N7BA 2ZSVA 2DWEB 4UT7L 4DUXA 2AABL 3PIQA 2EDLA 4FTVD 1CXKA 2H9GA 1UH2A 1AKJB 5DEGB 2GITB 1E4KA 3KXFA 4TVSa 1N7MH 1JHLH 2HTKC 3AREC 1VFAB 1FNHA 5C1MB 2P7TB 3K4DA 2FECI 2X9WA 2D7PA 1SM3L 1G7HA 2DJSA 4M62H 3QEUB 1IAIL 3AMLA 4XB8A 4YHIA 2VITA 1IEBB 3WHXA 1R3LA 2GJ6B 2X4RA 4K23L 1I1FA 1QFWI 2OM5A 2MKWA 3CVHL 2WK2A 5MERA 2XY2A 3C8KB 3BPLC 4MXQD 1E4JA 1RY7B 3DARA 5JORA 1UJ3A 1EAJA 2BSED 3P9MB 4RWYL 3DUSB 5A40E 1JHKL 1F4WL 2V7HB 1JWSB 4OCXL 2P8PB 3L5JA 5DHYB 5DQJA 4AEFA 4NZUH 2H32A 3L3JA 2F58L 4LQ1A 1M4KA 1CXLA 1GGBL 2CDEB 4G7VH 4GKZA 3FAWA 1G7QA 4DGVH 3LV3A 3NMEA 4HGKC 4L9LA 3QUYA 5AUMB 3DX6A 3GMMA 5HDOA 5C9JB 5KSAD 5HY9B 1NCAH 3S3SA 1WVZA 5IJKC 3CGTA 3JUZA 1CR9L 3DUUA 2H8PB 4IIQB 5DD6A 2VABB 1AGEA 3L5XH 2LV4A 2VDKH 3EYQD 4XMKL 1IEHA 3IDNB 1RUPL 2A77L 1TZGH 3DBXB 2BVOB 4XNMA 3HKFA 4FQ1L 1QSFD 3C9NB 1H3VA 3QUXB 3VMPA 4FG6D 3P2TA 2P47B 3EYQC 5FYJD 4NO5A 2G75A 2JB5L 2DLGA 1BZ7B 3ZT7A 3F5WB 3O2DA 3ET9F 2HRPL 4WDIB 2BMKB 5HJ3A 4FZ8L 2J7LA 4FG6C 4HZLA 4V1DD 5GS1A 3IDIA 1HNFA 2AEIT 3LN5B 1HI6A 4JLRB 1OTUD 4OUUB 5EUOB 4XBGA 3IGAA 5C86A 3OGCA 3HLAA 4QYOA 4JFZL 5BV7B 4MMZC 3MROA 4YHOL 3K8LA 1G9MH 4OFIA 4EEEA 1GZPA 2EZ0D 1TJHH 1TNNA 4UDUB 4PJFA 1KJ2H 3U83A 1AH1A 3WJJC 5HI3C 4XCEA 3C60D 4CNIA 5SWZB 4TNWF 3NIDE 2EZ0C 2AJSH 2W9EL 2ZUQC 3IT8D 2B1AH 4Z7OE 3C60C 3MRBB 5J1SC 2UVEA 4OZHE 3U2SB 4QTHB 5E2WH 1N26A 3SQOL 5D1XD 1PAMA 4JN2B 1VPOL 3OAUH 4NM4H 1EEQA 4DTGL 3MLRH 2BNQD 4BQCA 1VADA 2IF7A 2AJYL 1J1OL 1NUGA 2BNRD 2NXZD 3GRWH 3U6RB 4ISVB 5D1XC 3BZFA 2ATPB 2OJZL 1L0XA 3UBXB 3R06B 5IHBA 5MEOA 1FORL 4KJPD 1TNMA 2VXVL 2H1PL 4NQCA 3GSNA 4XP5H 1MCWW 1NUFA 1DQQB 1T20A 2JTDA 4ZAKD 4U6HA 4KJPC 1DUZA 4OZ4A 5CKAA 4WUUD 1JNNL 3OJVC 1YN7A 1J0HA 1S7RA 1FSKB 5AZEL 3PHQA 2VXQL 4U7MA 1Z9SA 3QCVH 3F58H 3RHWK 3KXFD 2YD8A 32C2B 4Z78A 1Y18B 2YD3A 1TPXB 4L3EB 3GMRA 3MCLH 2C4FU 1LD9A 4OLWL 1EGJH 2X42A 1UQSB 3QNYB 4IEFB 2X70B 2ZUYA 4Y88A 3EJJX 3L5IA 3HC4H 5DUML 2IH3B 1KELL 5F8RC 5GGRA 1EZVX 3NZ8A 4Z5RA 1RVFH 2K1MA 4JPIA 2ADJB 1HDMB 4YR6B 2VRAA 4RGNB 4DAGL 3B5GA 3LKRB 1PYWB 1MJJA 1CZ8L 2E6PA 5MHSE 4OM1H 4WW2B 3FHAA 4N0YH 4KKCD 4MAYB 4M93C 4NNYA 4NCC2 1KIPB 3QDHA 4LU5H 4XH2B 3HNSL 2EYSB 4WV1A 1I3GL 5JDSB 4P57A 1I1CA 3CFIC 2GT9B 1HYSD 5DMJB 1HIMH 2HLAA 1MVUB 3OPZH 4KKCC 3GZKA 3U0WH 4ZNCD 3HRZB 1JRHH 2D9QB 4G8EA 3UAJD 4HULB 5C09E 3QUYD 4QHUA 1VGEH 4S1QL 5D1QC 3GNML 1U8NA 3NABL 2GQHA 4MJ6B 1OAQL 1N0XH 2YD4A 3UAJC 4KVNL 2UZXB 4L9LC 2GK2A 3LS5H 3MACH 4N8PA 4H88H 5IFHL 1AGBA 3C2AH 1CG9A 1WZMA 3K8KA 3I9GL 4ORGB 4XNZB 2NW2A 4BKLB 4P2OB 2LABA 5INCB 4HK3J 4PRIB 2F53E 4GG6B 3BXNB 1SY6A 4KQ4H 2V9QA 3V5DA 5M94B 2B5IB 1G1YA 1ACYH 4POUB 3WHE0 3VFMA 1UXWA 5BS0E 2VISA 3B9KB 5DVLA 5CHNB 3G9VA 3B9AA 3K2UL 2VOTA 4R0LB 5DTFB 3BDXA 2I60H 4NQVA 3QQ9C 4WO4B 3WIHL 4M61A 3JXAA 5C0BB 5KG9B 1RUQL 5AD0A 3ZSSA 4NT6B 3WDIA 5DD1L 3FRUB 5EIIB 4PGEB 5HI4D 4PJFF 1RJZB 4R4BA 4NSKB 1DQJB 4E42A 3KAAA 3RL2A 1EVTC 3QIUA 4NKOA 2YK1H 2Z31C 4OB5H 3QDJE 2NZIA 4RMRA 4RFEB 5D5MF 3LSOB 5HI4C 2P8MB 4LSRL 2RFXA 5IFAH 4GRWE 2YOCA 5BVPH 5JHDE 4OF8A 1A7NL 1PEWA 2X4TB 3C5JB 4HBCL 4U1JA 5F72S 4ZUUB 1E6JL 3GSRA 3VG0L 4R8WH 2C3WA 4PLOB 3KJ4C 1NH6A 1FIEA 3GJFA 5IUSA 2V17H 2NY1C 2EICA 2A6IA 3QZWA 4NQCD 4NQXA 2XT1B 3OKYA 2VH5L 4JR9H 3OKNA 3WS6A 4BFBD 4UV7L 1DZBA 1OD7A 5GQBA 5ESQB 2PTTA 4OFPA 2I9LA 3S6CA 4PTTA 3MREB 4OCRH 2DIAA 5DMYA 2Z93B 4ONFH 5AWNL 4RAHA 3GBLA 3KPOA 1XGUA 5GGSA 4H20L 4A6YA 3P4NA 4I2XA 3ALPA 4NJAH 1CICA 4S0TD 3QCTH 1DQML 1MAMH 4ZOEA 5DK0B 1RZFH 3DX8A 1LO5A 3PP3K 4Q9QH 2J12B 4NO2B 5GGTL 1N6UA 1CXHA 3IDJB 5C8JA 1BLNB 5DMKA 4NC1C 2UZIL 3MOAH 3BDBA 2HA1A 2AV7A 3KPQB 1IT9L 2W60B 4EUPA 1VENA 2LAAA 1F90H 2RJMA 4PB0L 4YDLC 3RVUC 3LCYA 4MB5A 2HP4A 3RI5F 3INUH 2GI7A 2CJUH 3PJSB 5BJTB 1MIEH 2IBBA 4RQQB 3BPNC 3ILQD 1OSZB 4PGBA 2FATL 5CUSH 5CJOH 2R8SH 4G9FE 4WTXA 1CE6B 2AERT 3EJZD 4WV1C 1IFHH 2XRAH 4HXBH 4EI6B 3ILQC 4XNUH 2DRUA 5F7LB 2VZ3A 4XMPL 2NPLX 1D5IL 2ZKHH 2FX7H 3HZYB 3TLRA 5CD3B 1FFNB 2D4DA 3EJZC 2OK0L 2E8ZA 1KLUA 4Y4HA 1EX0A 3L3KB 4RAUA 1QOKA 4Y2DA 2EH7L 1DFBL 1EZVY 2D7NA 2XA3A 5DJXA 1LO0H 1KIRA 1ZGLM 4JE4B 1HHIA 3GUTB 2DN7A 4PFEA 4X4YB 2HKFL 4MDJB 1D5XA 4K2UH 4ERSL 9CGTA 2ERJB 5DMIH 4HKBB 2V9RA 4AMKH 3IAQA 5JXAH 5TE7L 1VEPA 2B4CC 5GS3A 5D70H 3RPIB 3A67L 1QLEL 1A6UL 3V95A 4JREC 4OD1H 5CMAB 2B39A 3BVNA 1WFNA 4PLNC 1LDPH 5EN2A 3UTTB 1I1AA 1JYNA 2YD9A 2YMXL 3BO8A 4ZS7L 1UFUA 5HYEA 2YBRA 3QUKB 1U6AH 1ZANH 4L4JA 1IGML 1HE7A 2VQ1A 2CUMA 4R7DB 4JO2H 4GJTB 5FA3B 5BOPA 4NPYA 1N64L 1DTUA 3T4AA 4Y4KB 5B39A 1YMMA 3QO0A 2N4IA 3L3DA 4XBPB 1QD0A 4Q58C 4LSTL 5HDQL 3VU2A 3QIUD 5FYKD 3P3YA 3G5XB 5H8DA 2C1OA 3T8XB 2J2ZA 2EDDA 3CFJB 3WL9B 1KNOB 3A6CL 3QIUC 2MFNA 4QTIL 4WI2A 4D9QE 4YAQA 1NGYB 2BNUB 2UVFA 4FQHB 2R4RL 4N0CD 2AGJH 1OT2A 3TYGH 3LZFH 1ND0B 1I7RB 1EEUA 2DM2A 1X5AA 5D7KE 4LPWA 1BJ1J 1WT5C 2YUWA 4HG4K 3U82B 4U6XB 3DTXA 2DQUL 3V79C 4EIZC 5IVXA 3SGKA 3S8WA 4KI1A 1H15A 4WWKA 1DJSA 1MAKA 4XHQA 4PJ9A 4YHZL 2HYMA 2X5PA 3BPOB 1YNLL 3OB0K 1L7TL 3QUZA 4K7PX 4D94A 1KPRA 5IHZB 1MCBA 1CICD 3ZMRA 1AGDA 4TRPH 4EVNB 5DJCB 3OXRA 3M17B 3UYRH 4Z7VB 4AG4L 5CGYD 4HEPG 4HV8B 4B41A 4K71C 3T0EA 1U93A 5JLZB 3P0YL 4R96A 4X0KA 5KSBA 2DLIA 3BP6A 3HMWH 4UOW0 3QNZB 4JVUA 2I25N 2C3XA 5CGYC 1LEKB 3QAZB 5HGAA 5HPOA 4QKXB 3UZVB 2V2XA 1EO5A 4UIMA 4YHNB 4L4VE 4KMTL 3OBAA 2YPLA 4IOIB 2OSLA 4PR5A 3I6LE 3RWFA 2ZP0T 1DANT 1WZ1H 1BQUA 1H5BA 3O81A 2XPGA 2ZCLH 1ZVSA 1H8SA 1NEZG 1R3IL 3MCKB 5AZ2L 1LO4H 1GOFA 2I07B 4WU7A 4F33A 5LWYH 4OZIB 4FP8H 4N0UE 2FJGB 3NIFE 1IBGH 3RNKB 5JMOC 3WO3B 4U49A 3BKCH 3IDYC 2ADIA 4LGRB 1X7QB 3DXAE 4Q6IC 1JGVL 4OAWA 4Y4HD 5DZOA 1T5XB 3R8QA 3QQ3A 4X7SH 3SKOB 1T0PB 1MI5B 4MD4A 3UYOD 4Y2DD 1UYWH 4X8JB 1FRGH 1AI1H 4MLIA 2OTUB 4Y4HC 3RNQA 3IFLH 1C8PA 5KJRH 5KW9H 4TVPH 2DLFH 2R1WA 3RWDB 1J11A 4V2BA 5T3ZL 5A2FA 4HC1H 3U0PA 1KG0B 1FL3A 3GBMH 4OT1H 1ZXQA 4NNPH 2GK0A 1S7QB 3H42L 4U1LA 1QKZH 2WIMA 2ATKB 4HUVB 1MJUL 2DTMH 4HUUB 4P2QE 2R2HA 1EHLH 2R0WL 4G3YH 2F5AL 4I3SL 1ZHNB 3EDJA 4AIZB 1I1AD 1ZA6A 1M7IB 3TNMA 1VACA 5GS2H 1ZGLA 4HDIB 3FB5A 1W0YT 3AREB 2ZSWB 1I1AC 1EFXA 1ONQA 3FT4A 1YMMD 2VDPL 3AUVA 1MHCB 1MIML 1CGXA 4F7PA 3IVKB 4QRRB 3DVFA 3PWPB 4PJHB 2F9BT 2HLFC 5T1KD 3DSFH 1QEWB 1D6VL 1YYML 3WYRA 5DA0B 4AY0A 4JM2C 2K9UA 1BEYH 4R3SA 2J8HA 1FE8L 5EA0L 3HI1B 3JWDH 4LP5A 3QPQD 4NYLB 5CIPB 1S7VA 3VXUA 1R3JB 1HHJB 3S4SG 4KFZC 1JNLH 3MLWH 4YUEH 3VRLE 43CAB 1KFAH 1BOYA 4MA8L 3VXME 4V1DE 1Y6KR 2VR9A 5IESL 1HHHB 3OG4B 2X2YA 4UOW1 4Z76A 1BQHB 3QPQC 5EO1A 4X83A 2AK4A 3ALWA 4TSBL 4OTXL 3IAGC 3TH3T 3T0DA 3SEPA 4Y19E 1NAMH 3GI8L 1H0DB 2NR6D 4NC0B 4WWKD 5IVXF 3WXWL 4L3AA 4PJ9D 2DS4A 3JTTB 1C5CL 4G6JL 1BOGB 2OLDA 5C71A 2AXFA 3QUZD 4WWKC 1R24B 2VE6A 4ZODA 4PJ9C 4G9DB 3LD8B 4U2ZA 4ZUVB 3L9RB 4N5UA 3ZDYF 1JF6A 1GC1C 2CK2A 5ERWB 3ZL4H 5I1KH 3D6GA 3AMKA 3T0ED 4JFXB 3DVGA 5DI8A 1I8LA 2X89A 1NCBL 3CFBB 1KB5L 1JF1A 4KWUA 5C0GA 1WISA 3ECBB 5I66B 2IQ9L 1A7OL 3NA9L 1LMKA 3BUYB 5C0CA 4DFHA 2YPLD 4PJ7A 3GSQA 1I4FA 5FM5M 1PZ5B 5L2KB 1RIVL 4WRLA 5DK3A 4MHHI 3QPXL 1FZOA 1P1ZB 3BZDA 2QQKH 1UKTA 5EU4B 3WFEH 2YSSA 4GAYB 5C2UB 1JHTB 2X1WL 4JANB 1FN4A 4O2CA 3VFGH 4KU1A 2R2CA 4K7PY 4LL9A 5DRXB 4F8TA 1UCBH 4M5ZH 4EDWL 4QHNB 5JIPA 4QHKJ 3PGDB 5I19L 5F7FA 4QXTB 4ZUWA 4G6MH 5HGBB 4WHYG 1EERB 3QG6B 1B0RB 3GSUA 4KV5E 5T3ZE 4YDIH 1IQWH 2ORBH 3BP4B 4W4NA 3HE7B 1KJ3H 5C08A 3U30C 1QRNE 2AKRA 4N9GA 2EE9A 4CW1B 4TTDD 3T2NL 3LQZB 5F7EH 3K4ZA 4JDVB 5IB4B 2J6EH 5DXWA 5FUZH 4H25A 5FIEA 2HJFB 5IOPB 1F4YH 4M1DL 1NMCB 3MR9A 4OLYL 2BVQA 3CX5K 5LCVH 4LVOC 3RL1B 4TTDC 2OJEA 5ITFA 4ONGH 3BQUB 2K3TA 4LQFH 4PJXA 5GRVK 1KJ2A 1UM4H 4KZDH 3I84A 1UKQA 3ISWA 1DVFB 3BD5A 3LH2L 1A7RH 1MQ8A 4I5BB 2DBJA 3HZMA 3MSPA 5I18L 2AXGA 3K1DA 4PGDA 2BVYA 2YA2A 4ODWA 4OI9A 1D5MB 3D9AL 1IGFH 4DVBB 1MCRA 1T83C 3MXVH 1RIUH 1YY9D 3MJ6A 1NDMB 4UTBH 4AQ1B 3AU1B 2Q6WA 1NBZB 1EFXD 3IF1B 3BP5B 1CBVL 3MC0A 1KEGL 2VZUA 3MRIB 1YY9C 4NQDE 4MAUH 1WZKA 1XGPB 1JF5A 3LKOA 1WWWX 3NAAL 8FABB 1VFUA 3A6BH 1A4KA 1U58B 3HC3H 4HJJL 5ANMA 1RZJC 1NC4B 3WBDA 4EI5C 4P2RB 1LVEA 4U1GC 4F15C 3VXUD 4LLWA 3BE1L 5DD5L 1PBYA 3EJYD 2W65A 2ITCB 5E5RB 5F7YC 4IS6B 2AXHA 2Y5TB 1OWWA 5CJXA 1G1CA 1YY8B 5D7SH 4K9EL 3RX7A 1DQDH 1MHHA 4IRSA 2BHYA 2AK4D 3NCBB 2D0GA 1WBXB 3EJYC 4IOSD 3ARDA 2QSCH 4UV4H 1CFNB 4TPRH 4JM4H 3P9LB 4GRLA 1J12A 3UTPD 5D1QB 3GMOB 5I1EH 3WEXB 3EOTL 1INEL 2XTJD 1PGRB 1NGZB 2JELL 3BGMA 3WCYA 3OR6A 3WNLA 2H26B 1KUMA 4WCYH 1KLGA 2GCYA 4XPTL 5D5ME 1WUNT 2JIXA 2XTJC 4K7FB 4ZXBC 4ZUSA 3T3PF 4DGYL 4B0MM 5CZKA 2GJJA 3LN4A 3O2WL 4UNTA 2JE8A 1JK8B 4R7NA 1NMAH 2X89D 2OR8A 5DRNB 3G6DH 1S7XA 2QHRH 5EO9A 2ZPKL 3PQYE 4KHXH 5C0CD 5FYKL 3O3BA 4U7SA 1KPVA 4U1IA 4O58H 3V4UH 2IQAA 4NHUB 5MP6H 2AQ2A 3T3ME 1H8OA 2WBJA 2FSEA 4WHYH 3N1FC 1FYTA 5E1AA 3JZ7A 4XVSL 5BZDB 3F7YA 1OM3H 5ID0A 4HH8A 1Q38A 4I77L 3NCMA 3FOMA 3G5VB 1II4E 3UTQA 2YUZA 3UXFA 5C0FA 2APTA 2VB5A 1WEJH 5B4MC 4GKSA 3RX8A 1RURL 3R1GH 2Z31B 5I8CB 4LARL 4XI5C 3JUYA 1MEXH 5C0DA 5A16A 4QCIA 5C08D 1JIBA 2X7LB 4MJ5B 3M1BA 4M6OL 1ACZA 1ZT4B 3GSOA 2EC9U 4DOHB 4GLRI 2JCCA 2BJMH 3MRNB 3TBYB 2FEDD 4O4YH 4G7YL 4Z7VF 5DYOA 4XVTH 3LS4L 4UT9L 4FMKA 1KCUH 3FQXB 2FWOA 2NY1B 1IQDB 2B0SL 3BFOA 4HWZB 5EZLB 4F80A 4BQ6A 5TF0A 5LGJA 4Z7UA 5DSCA 1I7ZB 2FEDC 2V5TA 4GH7B 4HIXL 4KVCL 4NGHH 5BRZA 3MMEB 4ENEC 3MGAA 3V6OA 3IJHB 1G9MC 4PJXF 4ZSOA 1S9YB 5HPMB 5INDB 1JFQH 4ZO8A 1NCCH 2NY3B 2WP3T 5CEXB 1JPSH 2AV1B 1UZ8B 1L9MA 2QEJA 3OG6B 1HHKB 4OM0H 3ULVH 1FFPA 2YC1A 4M8QA 1LEGA 3V6ZB 1FO0B 1EIBA 3L3OA 2XXMB 4PRAA 4C59B 3CU1A 1OGAB 4I9WD 3KPSB 1YNKL 1H3UA 3GO1L 4JRYB 4NN7C 43C9A 1MFBH 3ARBA 4BUGA 1EJ6A 1B0RA 5DD3L 4TULL 1DQLH 2FLRT 2FHBA 4HUXB 4P59H 4YHML 3V52L 3GIZL 5E95B 3U36B 5IWLA 5TH2B 2XIDA 5JIIA 2ICEA 2QQNL 4QO1A 3SE3C 2N56A 2GJ6E 3VCLB 5L8JB 3C08H 3LIZL 2HJKA 4NZRH 1KJMB 5D7JB 1YC8A 4YDLB 4NUGL 2XWBA 2PNDA 3NTCH 4DKFH 5JUEH 1UZ6E 3T2QA 4FQJL 3SDXA 1OAKH 3RWJA 2JJSA 5SWQA 3FT3A 5IR1B 2FRGP 4OCWH 1K4DA 3GI9L 5FCUL 4FQPA 3BPNB 4IRSD 2MOVA 2KBGA 3E3QC 5IKCA 3RZCD 3ARDD 5TDOA 5CJXC 4HPYH 5IFJA 4GRLD 1I3VA 4BQ8A 5D2LB 4IRSC 3V6BR 1HQRB 3RZCC 1K9TA 2C3VA 1RJCA 3PWNA 3FN3A 1XH3A 5EORL 3VFSB 4GRLC 4HFUL 4LVNB 1CU4L 5JOEA 2DKSA 5B8CA 2JIXD 1BFTA 3LRSB 4PRHA 1OSPL 5HDBF 5FYKE 4K3DH 2FYYA 3VI4E 5D96C 4ZPTB 1WWAX 3S96B 4KJQD 3PP4H 1IAKB 5ADPH 1A0QL 1I9RH 2FX8H 4PJHF 4IOFD 1I85A 1KC5H 4UILH 4AZ8A 1U8IA 2HFFB 2BXZA 2NY7L 5H37G 4JREB 2C4XA 4XNXH 1ZVYA 1UB6A 5I1HL 4WFHD 4IOFC 2BSRB 3B6SB 5KVFH 2XNAA 2WBJD 5BMFL 4QRTB 4F2MA 3PGFH 4X7FC 3CFCH 3HR5B 3VE0B 1FYTD 1BP3B 2GAZB 3VW3L 4OF5A 5EUOE 5SWSB 3P4OB 3H9ZA 4YDKL 3VWKA 3CVIL 1QBAA 3BKJH 1RHFA 1HYRC 3P4MA 2DQGL 3WIIH 1D5BB 1AD9A 1BD2B 3MA9H 1ZLWK 1B2WL 4JQVA 4J1UB 4BH7A 3TO2A 3PL6A 5SWZE 2VDRL 4QXGL 4ZFFA 2FZ3A 4YZFF 5ICXA 3VXPB 5H94A 3CFEA 1ZTXL 2MWCA 5EZJA 1XGTA 5J1TC 4U2YA 3IJSA 3MV7B 2JCCF 4WU5B 4R26L 4U1NA 2Z8RA 2XZAH 3THML 1JZ5A 5FDWA 3HNTL 4X4XA 2IPUG 3RPKA 1AHWA 1GZQA 5IGXL 5FKPA 3KYNB 2BVPA 2COQA 5BRZD 1BFVH 1DLHA 4PD4K 4TUOA 2WW8A 1ZT1A 4PJ5A 1U8JB 2RBLA 5EWIL 1MCSA 5D6DA 3ULUD 5C0JB 4HF5L 4Z7WA 3SJVB 1WBYB 3ULUF 2X4PB 1CLYH 3KS0J 4WEBH 2DQHH 5CKGA 3VGAC 1V3KA 5ETUB 2X9YA 4P9HH 1HKLL 3BIAX 3BKYH 4ZFOB 5C0EB 1LE5A 4NRZA 4JFDA 4JG1L 2ENSA 3ARBD 4GRMB 4TOYH 5A1AA 1F02I 2KZ1B 3B9VA 5CJBA 4F57L 4HS8L 4L3EE 4UTAH 5HHNB 5CSZB 4XT1C 3G08A 1A21A 1FNFA 4N90D 1WBZB 1HILA 4WFED 3CAFA 3NN8A 1LQSR 1OB1A 2EDHA 4KRPB 1CGTA 5F9AC 5IIEA 3ZTJG 2VDLL 3DRTA 3IKCA 4RGNE 1A3RL 2B1HH 3K46A 3SDXF 3VA6A 4FQXA 3SE9L 3OKDA 2DQTH 5JNYA 3UJJH 4KUZL 1REIA 3FFCA 3MNWA 4RGMC 5CBEA 1EH9A 5FO7B 3EFFB 1T21B 4Q97A 5ILTH 3FQNB 4F3FA 4N8VB 4OLUL 2Z9TA 4J3OC 3MXWH 2W0FA 5IBTL 1JGDA 4U1SA 4HGWA 5HGDB 2XFXA 5IB3B 3X3FL 3MV8B 4BSVB 5L7XH 4Q6IB 3DECA 1FAIH 3O41B 5C6WH 3DGGA 5GXBB 5H37H 4PRHD 1NSNL 4X6EA 1IL1A 4YX2H 3S37L 1G7MB 1A14L 3LQMA 2AJZB 3T08A 5I9QB 1RULL 2F74B 5B8CC 1Q9KA 4WW1A 3BD4A 5EC2A 4Q9RH 3UJTH 5ESVB 1XR9B 4OGYL 4PRIE 1I1YB 1VEOA 2EIDA 1I3RA 5CWSB 3RUGB 1T7YA 4JY4B 1U92B 4JG0L 5EFIA 3OKEB 1Q72H 3KPNA 4U3XA 3L5WB 2HN7B 4WFGD 2WINA 1JV5A 1AQKH 4LEXH 3X14A 4XP9L 4JRXB 4P9ML 4JFOB 4ZNEA 5JDJA 1PVHA 2X4UA 3EOAA 5IVXE 1NEUA 2WLZA 1I9JH 3CLEH 3TIDA 3IKKA 4X6DB 1CFVL 5I2IA 5JQHC 5KSUB 4PGCA 5JW4N 3VWKD 3KLHC 5C0BE 3HG1B 3P0VH 5J06A 4P3CH 1ZSDA 4YXHL 1CL7L 2UYLB 1IM3A 4PPTA 3S5LG 5KSVB 5DZNA 4HC1A 3C5ZA 1KB9J 4F37K 3PL6D 1RUMH 3IFPB 3QXVA 4AIXA 4JM2B 3MRHA 1IRAY 3V9FA 4MA3B 1KEML 5E08L 4QY8A 1S7WA 5T1KB 3MLXL 3TYFA 4G80B 2EEBA 3ZKMC 1JGEB 1MJ7L 4JAMB 4JQVC 4S2SB 1P7QD 2DM3A 4OJFL 2YPVH 5JO5A 1RZIA 2EXWD 3WFHA 5I8OL 3HAEG 4FZEL 2MKLC 2VDML 1P2CA 3SDYH 5KTEL 4WHCA 1QG3A 1J86A 1U2HA 3AXLA 5DK2A 1NDGA 5EBMA 3RVXD 3AAZA 2AI0H 2V9TA 4MXWL 1CF8H 1OAXH 2O26U 2VO5A 3B43A 4W4OC 4PJ5D 4Z0BL 3Q0HA 3RGVA 1AHWC 2NW3B 3RVXC 1RJLA 3MV9A 2VDNL 2BVEA 2R69H 4IRZH 4LGSB 3MRJA 4ELMB 4MD5B 1D7FA 1S5IL 5ICZA 3RWIA 2F54B 1WF5A 4YO0A 2EDWA 2NLJA 3J8F7 2ZOLA 4DN3L 3MRGB 1QRKA 3CLFL 3UPRA 4JFDD 2VAAA 3ZTJH 2G2RA 3RA7H 3PDDA 4CJ0A 1VDGA 2RCSL 2W0PA 1PKOA 2CIIB 3IS0X 2NY0D 1YPZA 2PETA 1UVQA 2VN4A 3VGHA 1QLRA 4DVRH 5JW3L 5LQBH 3MX0A 3EOBB 4IRJB 5EUKB 5I76B 2WMPA 1RUKH 3GSWA 3P0GB 4KJYB 4AL8L 4MSWA 1NAMA 4AEEA 4ZQKB 3U7AA 4FABH 4MNQA 3W11D 5HYJB 5D93B 1X6LA 4C4KT 2WIIA 5DFTA 3SKNB 5ITBL 1Z9OA 2FHFA 4FQXD 3VFUB 5F96L 4PLJC 3FFCD 1QYGH 4MNGB 3CFDA 4WNQB 1FJ1B 1SMAA 3P11H 2XQBH 5HYQB 5J1AB 2AAVA 4LVHC 3T2OA 1NEZA 4NFDA 4UT7H 1FZKA 2AABH 1BVKB 4OD2B 3U30B 4C57C 3C6LA 1NGWB 4YEEA 3QIBC 3TBTB 1X5IA 1B4RA 5EU3A 2VYRE 2R15A 5ACZB 4HH9B 3QIWA 4U3HA 2NYYD 3OSKA 3DYOA 4MCYB 1SM3H 5E1HB 1JPGB 4X4ZA 3KYMA 1IAIH 5ESAA 2NYYC 4K23H 2Q76A 3ULSB 4KRLB 1NGXA 3CVHH 5DJ2A 3Q6GL 2FDBP 1CYGA 3U48A 4AT6A 2MSPA 3MRLA 1E0OB 1AIFB 1AQDA 4IHOA 1JPFB 2DD8L 1PDKA 4D0DB 1G7JB 4PG9B 1U8MB 1WTGT 4UDTA 2BOBA 2BX5A 4PRPB 5CILL 1IGTB 1NCUA 1Q9LB 4RWYH 4D3CL 1PJ9A 1U8QA 1F4HA 3FMGL 1JHKH 3MJGX 3BH8B 1F4WH 1T21A 3UTTE 2J6EA 1A1MB 4OCXH 5DF0A 5C0ND 2F58H 4MVBD 1S5HB 1RUAL 4U1MB 1GGBH 1A4JA 4UI2A 2X4OA 3HAEH 2HFTA 4Y16B 1KTDB 2A2QT 3T3PE 1ZHKB 2A73B 3C5ZD 2YPKA 3Q6FA 4XPFL 4D8PA 4EQ2A 2FD6L 1S8DB 4P4RA 1CFQB 1DLFL 4YH6A 4YHKL 5HYIA 1CR9H 4EI5B 2X4SA 3C5ZC 5EOQL 3PWUA 4F15B 2BSTA 5DA4A 3BHBB 1TQCC 2CLZA 3FTGB 4HKJA 3I6KB 3ARFA 4H5SA 4XMKH 1RUPH 2A77H 5E6IC 3UMTA 3WNOA 1PG7L 4JZNA 4FQ1H 5GS2D 4W6XB 3E1F1 4XGZA 2W9DL 2JB5H 1DE4A 5J12C 1A47A 2HRPH 1INDL 2EXYC 2NTFA 1FV1A 5LGKA 3RGVD 4FZ8H 1F11B 3FB7B 3S4SA 3MFFB 3MV9D 3IU3B 4YC2C 1DL7L 1N59B 3RGVC 3QH3B 4JFZH 3NCFB 3QT2A 2D9CA 5DT1L 4HAFA 4ZYKA 4ZXBB 5JW4R 3UTSB 3HI5L 4CRPA 2O61A 5DUBA 3ES6A 3EDKA 2KZWA 4XVUD 1EMTL 4EOWL 1UM5L 3L3HA 4J12A 1BZ9B 4TSCL 4Z7VE 3JWDC 2W9EH 3QDGA 4PRNA 4JFPB 3BAEL 2Q3ZA 4GMSL 4K8RC 4XVUC 2X4QB 3LKSB 1YPZF 1NLDL 4QF1B 1WICA 3O11B 5IF0A 5HI5D 3SQOH 1VPOH 3K80A 4LOUD 4MNQD 4DTGH 4Y5YC 4Z77B 1IC4L 1KGCD 3Q3GA 1VFMA 4WGVB 3WD5L 5TQ0L 5K59E 2AJYH 1J1OH 5GJTL 1XF2B 3VXRA 1BBJA 1XR8A 5HI5C 1DN2A 3AY4C 5ADOL 1XF4A 2OJZH 1QNZL 2PN5A 3TN0B 3QBTB 3KYKL 1Q9WA 4ODXB 1FORH 3LEVL 4AH2B 5HVWA 2VXVH 4GRWH 5HHQB 2H1PH 3NGBB 4J3SA 3WLWD 5FM4A 1LP9B 5FO9B 4OZIE 4X5WA 4PBVC 2VSDA 1LK3L 5C07B 1Q9OB 1SJEB 2CKNA 2H3NA 1JNNH 2Y06L 5KS9A 2C7UB 3N1GC 4MQ7B 4E5XB 3VDAA 3C6LD 3VMNA 5AZEH 4JO3L 3MODL 2VXQH 5JOPE 5E8PB 3ULUL 3QIWD 1EBAA 3HZKB 1PQZA 3O6LL 1R3KA 1G84A 3V5HB 1TZIB 4AM0B 3CSYB 3C6LC 3V5KB 1I8IB 1MI5E 1GGIL 3GKZA 4OLWH 5ANME 3FFDB 3QIWC 1ETZB 1T7ZA 3SKMB 5E7BA 4OCYL 1BIHA 3C6SA 1F6AA 1KF9B 5DUMH 2Q8AL 1KELH 1U8KB 4GAGL 3V4VL 4JY6B 3RY6A 1E4XL 4LCCC 4DAGH 1D6EA 1ZOXA 3F12A 1CZ8H 2GTWA 5J11B 2R2BA 3R4DA 4LSVL 3TA3B 3HNSH 1I3GH 3BEWB 4GW5B 1J8HB 3LRHA 3O9WA 1YJDL 5GRUL 5T33L 1T7VA 5EZOL 3RWEB 1MLBB 4L8SB 1FIGL 2BVTA 4NN7B 3DPBA 4BA8A 5HDBE 2MJWA 3Q5TA 1CD1B 2A83B 1FZMB 4S1QH 2VWEE 3GNMH 1MY7A 4U0QB 3NABH 3KPRB 5DQ9B 4GG8A 1OAQH 4QRRE 5AYQA 4PJHE 4HH9A 1I8MA 2GSGB 3GB7B 5SX5H 1CE1L 4KVNH 1HXYA 1I7TB 3TJEL 3FCTA 3GSVB 5TGBA 4CADA 5ENWB 3ARFD 1LHZA 5IFHH 4M4PA 4GXVL 4ODBD 3I9GH 2HKHL 4WJ5B 2XKNB 3FRPG 3FN0L 5IMMB 2R39A 3QXUA 1JE6A 1BAFL 5IB5A 4NOFA 3S35L 3M07A 1JZ4A 1HSBA 2YHGA 4UB0L 5IB1B 5JZ7D 4R2GD 5KANG 1MCPH 3NH7L 2BK8A 4ONOA 3EGSB 5J6HA 4L3CB 5EU6B 2Y36L 3MRCB 3RZCB 2VR5A 2GKIA 1F3JB 1WFOA 3DRQB 3K2UH 1X5YA 1WFUA 3BX7C 3FQWA 4HJGB 4I3GA 3WIHH 2VUOA 2OTPA 2YRPA 3JV4A 5IEHA 5MEPB 1KJVA 1RUQH 1ZT7A 5D96B 4QRUB 5DD1H 4X98A 4JZJA 5I75C 5TPWL 4YZFE 3EDFA 3KJ6L 4OLVL 2D31A 2R29L 5B38B 5CEYB 3QNXA 4QHMA 3QDGD 4POZD 1U8OB 1K8IA 1OAZL 3ZKXC 2QSVA 4LSRH 3OR7A 1RZKH 2Y6SD 3GGWA 1ZA3B 1X4YA 4PJCA 1A7NH 4POZC 4HBCH 3S3JA 4PRDA 4HS6A 1T7XA 3QHFL 3VXRD 4MS8C 1TVBB 2PCPB 5GHWL 3B2UD 3VG0H 4JO1L 4JFEA 5L2KE 4WHTA 2XZCL 2GSIB 1SYSB 3ULUE 5DD0L 3VFRA 5J13B 2YRLA 5FUCC 3U9UB 2VH5H 3B2UC 3CZFB 3E6FB 3MLUL 5BVJA 1W0VA 1BF2A 4UV7H 2EEAA 4XC1L 3HNVL 4RNRB 3D2UA 1FBIL 3SGJC 4LIQL 5GPRA 5AWNH 4KI5C 1BQLL 2ZOKB 4M1CC 5KS9F 3QEQB 5D8JL 12E8L 4H20H 4P46A 1MFEL 1QBBA 4OCNC 3QDMB 2H6PB 4DEPC 1NFDB 4LKCB 4N90E 3VXSB 1DQMH 5E2VL 1AJ7L 3H9SA 2NY4B 1ES0B 2ARWA 3MRRB 3O4LB 5D71L 5GGTH 1BIIA 3DIFB 2ZZUT 1SBBA 2UZIH 3SDXE 1QFWL 3KLAB 4P5MA 3GMNA 1IT9H 3FQTA 3RWGA 5IROC 5DJYA 4PB0H 3U1SL 1AO7A 1KTKE 3G9AB 5JQ6L 5HYSG 1H3TA 3OJ2C 5I8KL 2P5WB 3WO4C 5DMGC 1K4CA 4CMMA 3O2VL 3CSGA 3O9WD 5DVOA 4HLJA 1E4WL 1J18A 2XZZA 2FATH 2A9ML 3QHTC 4JHZA 5IT2L 2LFGA 4LSUL 2ARJA 1SVCP 4E5XA 4F7TA 3H0TA 1IGIL 3IJYB 3L1OL 2ZWLT 4XMPH 1D5IH 1R3HA 2VLKB 4QEGA 5GRJL 2OK0H 1VKXA 1RZGA 4ZFZB 1FO0L 5L88L 2EH7H 5KVGH 1DFBH 2J8UB 5EO0A 1XZ0A 3G6AA 2XWTA 3ULVD 1T04B 3D85A 4QHKI 4XPBL 2GY5A 2HKFH 4P2RE 4ERSH 3VXNB 2EYTA 3NA4A 1E27B 5TE7H 3ULVC 4NNXA 1HWGB 1NFIA 3A67H 3I3EA 1QLEH 1A6UH 5DVKA 1HZHL 4Y8DC 3TZVA 3UCRA 4NRXB 2IG2L 3BZEB 4XWGL 4ELKB 2WM0A 1OLLA 3MYJB 2IBZX 2WUBL 2DQDL 4OKVA 4DN4L 4ZS7H 2YMXH 1QLFA 4MCZA 3RKPA 1DBJL 3WNMA 3EIFA 4F7CA 1IGMH 4OBRA 1IZJA 5J57B 4KC3B 1TVHB 2HVKB 4HKZA 1N64H 3X13B