1K8IA

Crystal structure of mouse h2-dm
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
181
structure length
181
Chain Sequence
QNHTFRHTLFCQDGIPNIGLSETYDEDELFSFDFSQNTRVPRLPDFAEWAQGQGDASAIAFDKSFCEMLMREVSPKLEGQIPVSRGLPVAEVFTLKPLEFGKPNTLVCFISNLFPPTLTVNWQLHSAPVEGASPTSISAVDGLTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II H2-M alpha chain
publication title Crystal structure of mouse H2-M.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k8iA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1k8iA01
3EOTH 2I5YL 3OKEB 4N0FA 3ULUC 2IMMA 4H25A 1RJYA 2X5PA 1NAMB 2V5SA 4NQEA 3T2OA 4GG6F 1NAMH 5E8PA 1CQYA 4I1NB 1LO4H 3QIUA 3SDCD 2EE2A 1IQWL 1V8HA 5EFIB 1W0WA 4EUPB 2BNRD 2JB5L 4D94A 3PGCA 3SE3A 2BX5A 2V2TB 1JJUA 5C09B 3S35L 5HVWA 2Y5TA 3OJDA 1KIQA 2R0WH 4MA3B 1MVUA 3DYMA 1FORL 2DDQL 1IGCH 4G8IA 4UT6L 3FCTB 4GUPB 2WMPA 2P8MA 5E4IA 4R7NB 2FGWL 4G43A 4LSQH 4ONOA 3FB5A 3HC4L 5ESAA 1TVHA 1IC7L 1M71B 5HD8D 1CGSH 1QOKA 5HYFA 3RVTC 2OL3A 3KPRB 5I30H 2GK0B 2R15A 3HNVH 1Z0NA 1I7UB 3RVUC 3TZVC 3RWCB 1QNZH 4DGYH 3O4OB 3QNZB 1EAPB 3T0BA 5HDLA 1CICC 5CJOL 1DBML 5KAQF 4RGNB 3QUZD 1MREH 2A0LC 4PV9B 3HI6L 3CLFH 3G5XB 1K6QL 3C5SB 4PJDE 1J05A 2ZCHH 3MOQA 3GKWL 1PG7L 5CGYC 4XVSL 4OCSH 2CXKA 3O8XC 5KSAD 3U0PA 1S7RB 5DJ6A 4FFVD 4DEPB 3VFTB 4I3SH 4HJJL 3RUGE 2JELL 2QJDA 2H3NB 1G6VK 5GS1A 2H45A 1G7PB 2J8UB 3ZSSA 5KVFH 2C1PA 4BH8B 4V1DD 1QSEA 1WBZB 3LKSA 2AEPH 5DJCB 4I13B 5EIIA 3GI9L 1Q0XH 1TZIB 3PWPB 3C09B 5GGUA 3BSZH 2NX5A 1MJ7L 4YFDB 5ISZE 1ZGLP 5JMOC 4R26L 3KPNB 2AK4D 5I15H 3OWEA 1EJOH 1BIIA 3TBYB 3FQNB 2A6IB 2VKXA 4P3DB 5J11B 2AI0H 3VRIA 3FFCE 4ELMF 3N0PB 4TSBL 3HN3A 3STLB 4P9HH 4GAGH 4MNGA 4IDJL 4PJGE 1CGYA 4U1GB 4GSDH 2OLDA 3MJ8A 3MCLH 4XBEL 1PVHA 4HC1A 2BY0A 3WIHA 4OLWL 1DVFD 1RZIA 3WNOA 3T0EA 1ZLWH 2KQMA 3TLRA 3DI2B 3QDJA 3G5VB 2IJ0C 3WFDH 4JLRA 1NLBH 1QSFD 3CVHA 4ODSH 2EH7H 5BO1H 5EWIL 5L88L 3NFSL 2BRQA 4BZ2H 1FZMA 4WIQA 1FAKT 1AH1A 1CDJA 1AGCA 1DQMH 5CKAA 1ONQB 5LWYL 3QA3A 1KJ2B 3BYTA 3ZKND 3FAXA 1TJGL 3H9ZA 1QO3A 5BV7C 5L8LB 1MHCA 1CE1L 1YMMB 3KYAA 1WZKA 3ARED 2IBZY 1OTTD 5CEYA 3BD3A 4PJXB 4LHUA 1DE4B 3SKNB 3T3ME 4HS6A 1A7NL 1ED3B 3NACH 1HXMB 3GSNL 3ILPB 1BJMA 1IC5H 4ZYKA 3BOVA 4KI5C 5D7IB 1WVZA 2P24A 4KRPB 2EDNA 3V95A 1EV2E 1HYSC 2A6KB 1QPPA 3QNYB 1M7DA 1JE6A 2X4SA 3E6HB 3TN0D 4LLDB 1LDSA 4R7DA 5FM4A 1IC1A 2X7LA 4PJIA 2DMCA 4PB0H 1AY1H 4D0CB 1QFUL 5E9DB 3CFCL 5HGAB 4WV1C 2HKFL 2C3VB 2ZUTA 4GG6B 4LP5A 1E4WL 4RMTA 5DD6B 2EDXA 4XCFH 1KCUL 3EO0A 3EFFA 3QBTB 1ZGLM 5J13B 1XGPA 2ID5A 5E6IB 4NNXA 1ETZB 4MA1C 5I1IH 1ACYL 5I8CB 1MWAH 1S7TA 5KSBA 1SQ2N 4PGDA 1CLOH 5BVPL 5INDB 5KS9A 3W9DB 3TJHD 1F3DH 2DQUL 3MV7E 3Q3GA 1MCWW 3M1BB 1AO7B 3NIGF 5GGRY 4KK9D 2BOCB 4N5ED 5JORB 4FTVD 1QFWI 4ZTPH 1TCRB 3BGAA 4YHIA 4HX1A 3C5JB 1JGLH 4HXBL 3RFZC 2ESVD 1I8MA 1DUYA 2QQLL 3JV6B 1EERB 5C0ND 3ARSA 4Q9QH 3KDMB 4O02H 3BKYL 3B5TA 5F88A 1FIGL 3HR5B 5JQ6L 4JFQB 4XP4L 3QZWB 5ESQA 5FYLL 2YPLA 5H8DA 1WT5A 4DN3H 2XXMB 5I8OH 5D7LA 3ULUF 4QRRA 4JN1H 2IQAA 4MQ7A 2PO6C 1JYXA 1HCVA 4GAYA 4KZDH 1PAMA 1YPZF 4APQD 3ULVD 3VE0A 2VQ1A 3U46A 5LXGL 2Y1VA 3V6OC 4D3CL 3ZT6A 1IAII 5JNYA 4DGIH 2MCPH 2UWEA 2R23B 2J4WL 4MA7H 2GEEA 1CXFA 3ZO0A 5C0FB 3NIDE 4JG1H 5KVEH 4GRWE 5AAMA 3P9LA 5IP4A 4LLMA 5HDBE 4PJ5D 1XR8B 1I1AB 2O93L 1FFPB 4Y4FA 3WDIA 5FUCE 3PWVB 3INUH 4C83B 3ZDZE 5LGHL 4U1MB 3FO9B 4RAHA 5FGSA 4F7CA 3QHTC 2XRAH 1RUQL 3W0WD 2PETA 4OUOA 2OTUB 1QKZH 2Q8AH 5IMLA 1YA5A 4Y4KA 1ZS8B 3QJHB 2W60B 3I02B 5GS0C 4MXVE 1G7LA 4ELMB 1S7XB 5IB1B 5CEXA 4Z0BH 1O5DT 2OK0H 4Y0GA 1L9NA 5I1KH 2R0ZH 3BDYH 1BGXL 1LO2L 4S1QH 5BMFL 4PRDA 1EO8L 1RUAL 4J4PA 4PJDA 4F7TB 4L4TE 1DN0B 2YKLL 4L4VE 3C6SB 1VDGA 2Y06H 1KN2L 2WQRA 5ILTH 4X7TB 1CF8L 3DECA 4GRLB 1CYGA 2GJ6A 1CZ8L 1XIWD 1NCBL 5FUOH 2JKXA 3EO9H 4NHUA 1KLGB 5DA4A 3VXUE 2XI9A 2BNQA 1BVKA 3QRGH 4M6ML 3PL6B 1X5IA 3AAZA 2P5EA 3KPOA 4YWGH 3S37L 3VJ6B 3QULA 2WP3O 3CFBA 3OKMA 3V6FA 2CDEB 4M48H 2VH5L 5IROC 5JHDB 4R0LC 5A16A 5JOPD 1T6WA 1CN4A 1KJ2L 1T7ZA 3OF6A 3GSRA 4MJ5A 5HHOA 1YEEH 2KKQA 2XIDA 4WUKH 1FVEA 2E27L 4XXCC 4NBZB 5GGRB 5I9QB 3SBWC 4B41A 1JIBA 1AXSB 2HKHL 2VNCA 2NY6B 1T20A 1OM3L 3DVNB 3P11H 1YNKH 5F89A 4KMQA 3LKOB 4JFEE 2EICA 1SYSA 5HD8C 5EUOF 1U8PA 5KVMC 1QFWL 4RX4A 1UWEL 3O11B 4LVOC 2DYPD 4WHTA 1ZLSL 3FFDA 1JYVA 3GHBL 3OKOA 3VFNB 3TJEL 2WINA 3IETB 2CR3A 4HGMA 4PJGA 4JGUA 3C6LA 1IKNC 3RL1A 3NN8B 3KXFD 3QUZC 1F97A 5CZKA 3VXSD 4ZFZA 5E0QA 5GRWA 5EC1B 3B6SA 1ZMYA 3P0YH 1VHPA 1DUZA 4HWZA 3K3QA 1SJEB 3WBDA 3FO1A 4OLXL 4Z77B 5KSAC 4TN9A 3KPMA 4L3CB 4FFVC 4NQXA 4P9MH 3D5OF 3IJHB 4JQVA 2ZUQC 3GMQA 4OTXH 4MLIA 5HHNA 2WP3T 3O2WH 3U9PH 5CGMA 2ED9A 2J12B 1QBLH 4BFIA 1I3VA 43CAA 3V5HB 5C0IA 3AROA 2KUTA 1GZQA 3BUYA 3LQZB 1IEAB 5M95B 2XWTB 4KVNH 3U4EA 4Q6IA 1AGFA 1EAJA 5HHQA 4P4RB 3RWDB 1PKQB 3FQTA 1MRCL 4XCEA 5SWZA 3HMWL 3VA2C 1BMGA 3VRJA 2YBRB 5E5UB 4POZC 5FYJH 3D39D 4M1CD 3H3PH 1UJ3B 3VXOB 3SGKC 3CFKA 3ARGD 5KZCB 5AYUL 3FONB 3B4NA 4KK6D 2IANB 4G8EB 2DQGH 2H1PL 4B7LA 2DN7A 4CVZA 1LO0H 2CO7B 4LCCB 3H3BC 4AT6A 2FLRT 4K94C 2NY5H 3MV8E 4KKCC 3DX7A 4QRPB 4LRNL 4OFYA 1YPZB 3BIKB 1DVFC 4MJ6A 5LAXB 4H8WH 2QQQA 1A14L 1IAKA 4KV5F 4H5SA 1SEQL 4HWUA 3X12A 4HBCH 1IGIL 1KN4H 3CZFB 4Q2ZA 1RD6A 4X6DF 1RZKC 5FA3A 1FFOB 1BD2E 4NQVB 3BEVB 3BWAA 3FQXA 2WBJA 3OAUL 4U2YA 2G60L 2ZKHH 1HSBB 8CGTA 1S9XA 2AJYL 5DJ2B 1IM9A 5KANG 2R8SL 3DSNA 4BK4A 4UIMB 3FT2B 4JEGB 5E1HB 4ZFGH 5AEAA 4HMCA 2ATPB 3AU1A 4RBPH 1VGKB 3AREC 1CL7I 1OTTC 3VFUB 2V7NB 3HPJA 4NZUL 4U1NB 5EZLB 4PGZA 4NUJB 1KIUA 3ZYZA 5JQHC 5EU5A 3WXWH 3AMKA 3RWFA 4RAVA 2YEZA 1A2YA 4JHWH 3P9WB 4E5XB 4EDXB 4PD4J 2VL4A 1JCKA 3QCVH 2CR6A 4TSCH 3DYOA 2X4QB 4LOUD 3NCJH 2VR9A 3TN0C 5ITFA 4QRSA 4PLJC 4XPAL 1JGEA 5FHAH 2RB8A 3EOBB 3QO1B 4XPHL 1NC4D 5HYSA 2ITCA 1RIVH 3SJVD 2G9HB 35C8H 1B6UA 3SE8H 3W9EB 1I9RL 3JUZA 4AEEA 1X5FA 4S1RL 5ANME 3IJSA 3D69A 3RVWD 4LSSH 3UJIL 2OR9L 4XVTH 1LEKB 3LSOA 3VWKB 5IT2H 1RK1A 2FATH 3QDMD 4JM2F 5E5MA 4MVBD 7FABL 5IFJA 2GJZB 4TQEL 4J3XA 3ARRA 3CMOH 5FCUH 1OARL 5DQ9A 1Q94A 5I76A 3ZHKA 1JL8A 3EJJX 1AXTH 3FN0L 3HRPA 2EIEA 1I9JL 1RMFH 3TJHC 4F7MB 5D93B 5DD3H 4ZFFB 3GM0A 5I19H 25C8L 1WWWX 4HZLA 3CFEA 2DL9A 5D5MA 4KTYA 5EUOB 4ETYA 3F62A 1U8MA 4X8JB 1KTKE 4JY4B 3OR7A 4PJ7F 4QNPF 4G7VH 5C0NC 3WEXA 3RPKA 3PHOA 1MLBB 1AHWB 1OPGH 3K8MA 4RZCA 1LE9B 1HKLL 4OV5A 1P6AB 1U3JA 2VZOA 4G6JL 4YHPB 4YHKL 2F19L 4MNQB 1M05B 2QSQA 3BVNB 3QQ9C 3RDTD 5HHVH 1AR1C 3DX9B 3MGOA 1I7TB 3NIFF 3H42H 1MQKL 3RI5K 4EVNB 1NJ9A 2Q6WB 3S4SA 3MJ9H 4APQC 4XPGH 4EJ1C 3ULVC 5EO9B 1KB5A 4ODBD 3ZKQD 4G3YH 4NKIH 4F3FB 1V7NL 1AJ7H 3L6FB 4RFEB 3VXUA 2X4PB 4YXHH 2GSIA 4OLYL 3VCLA 3FHAA 4NN6B 1MSPA 1ZHNB 4FQXD 3O3BB 1CXIA 4G6ML 5ADPL 4PGEA 3TESA 4LHJB 5JXED 1UXSB 3GSUA 4L8BA 4BZYA 3K2MC 3FN9A 3IGAB 2QHRL 4OM0L 4ZOAA 1MY5A 4WO4B 1XZ0B 5C0AB 1FFQA 1KB9K 4N8CH 1M4KA 3O8XA 4NN7C 2X89D 1FC2D 2ZSVB 4JDTL 4G6KL 3T3PF 3EYQC 4FQCH 3C5ZD 3HE6D 1MI5A 3SQOH 5IW6A 4ZPTB 1HNGA 5I1DA 1S9VB 3QXTA 4M7LH 3ULUL 1I3GL 3JWDH 2NY7L 3MXVL 4XMLH 3D9AL 2CK0L 1OGTB 1X44A 3BDBA 3EZJB 5T3XH 2UYLB 1BIHA 1G0XA 1DANT 4YNYB 5FDWB 2OJZH 4WHYH 3B9KA 1S9KC 1Y0LA 3N9GH 4AL8L 4X6DB 3QFDB 1U92B 4AM0A 3H7BB 4WW2A 1ZT1A 1P7QA 4Y89A 2A9NL 3VG0L 1N7ML 1ZEAH 1OSPH 2CKBB 4LFHD 2YD2A 1XF4B 2D7TL 1RZJH 4JY6B 4N90E 3BZFB 5K9QG 5TF1L 1FN4B 2CKBH 2CIIA 3VXTB 2BFVL 4W81A 3VFSA 1KB5L 1KIPA 1TJIL 1U2CA 1E28B 5JOFA 1YNTB 1QFOA 3TGXA 4YBLB 1T1ZA 4JZJA 4OCYL 2MQCA 4PBWD 1Y6NR 2YA1A 1FO0L 1LEIA 1G7QA 3G08A 4LCIH 4QXTA 2Z92B 3B9VA 1FYHB 2VTFA 3KNBB 3RIAF 1P4IL 1RAMA 4UDTA 1UM6L 1WITA 4BELD 5F7DB 4C54A 3TBVB 1A6WL 3UTQB 5FM8A 1KCVH 2IFGA 1ZVSB 5CP7A 4YR6A 1NBYB 2FECL 4UQ2A 4HH9A 2KQNA 4ONGL 4ZUTB 3D3VB 3TT1H 3UX9B 4J3UA 1T2XA 1ES0B 3OKKB 5E08H 3OKNB 3SE9H 4KFZC 1W8NA 3LQAH 3B8YA 5EO0A 2VDPL 5INCB 1L7TL 3SCMB 2HAZA 1NFDA 5EBMB 5GS3A 4W4NA 5DVMA 4GBXB 4JM2B 1U2HA 3V79C 3T2NH 4G9FD 1PY9A 4NGHH 5CJXA 1JHKH 1RFDL 2APWA 4H20H 1JWUA 1OAUH 1V5JA 1MRFH 1D5MB 5E7BA 4B7IA 4MDIB 1WLHA 4HIEA 5SWSD 1ZLUH 3LS4H 1KXTB 2ILLA 1BX2B 2GT9A 3Q5OA 1UEMA 1FDLL 3U4BH 4LSRH 4YX2L 3MV9B 4X6BB 3JWOL 4GKNA 4R90H 1K8DB 3NH7L 5MEND 4NBYB 4UV7H 5L7XL 4KKAC 4M1CC 4PJ7B 4WV1A 5C0EA 1L7IH 3CLEL 5L6YH 4GMTH 2XZAL 3X11A 4YHNB 4XP9L 3ARGC 4ODHL 4F58L 4Y19A 4S1SL 4YO0A 5C07D 4KK6C 1NDGA 1EEZB 4WRLA 1X6LA 5D2LF 4UNUA 1XF3A 3IFLH 1JRHH 1X4XA 2C4FT 3HS0B 4Y5VC 4TOYH 1PLGL 4QRTB 3FB6B 4LASL 2MHAA 3L7FB 2Y7QA 5AWNL 5I1JL 1FNGA 2Y25A 3ECBB 5F6IB 4XAKD 5IEKA 3QDGD 1KEML 2NY2B 1AFVH 4NQCA 4B5EA 4YHMH 2EKSB 4R97C 3SDCB 5FYKL 5DC4B 5CEZH 1RURL 5DR5H 4QYOB 4U1HA 5SWQA 4R0LB 4UV4L 2X05A 4CAGA 5EU7E 2ZUSA 4MJIA 3KJ6L 4HCRH 5BV7L 1KC5L 2Z31A 5IHZB 3QFJD 2P42B 1JK8A 2RFXA 5C86A 4M6OL 4OIIL 5CILL 4RFOH 1HINH 4OCWH 4HD9A 4LLYB 4X6CA 4GAFB 1KTRL 2A9MH 4NKMA 4LK4A 1Z6JT 5JZ7D 3WS6A 3L5IA 2E7MA 2NXZD 3BEWB 3QXDA 3NTCH 2DQTH 3EFDH 4PR5A 3DURA 2JE8A 2KDGA 3T0VA 1EMTH 1L4IA 1U8OB 2BSRA 1LDPL 2YRZA 3V6OA 5GGTA 4I77L 1P4BH 3VI3E 15C8L 2VLKD 4K7PH 5IOPB 1J86A 5EZOH 1OQXA 3V0VB 4HKZB 3OSKA 4JQXC 4QTHB 3U30B 5GGSY 5IEHA 3V4UL 4YQXL 4R8WL 1NFIB 1T0NA 1X6NA 2BHZA 2VLJA 4GO6B 1R3KA 4LOUC 1BZQK 4MB5A 3S96B 4PBVC 3ULVF 5FK9B 1NPUA 2C1OA 3GB7A 3I3EA 1UM4H 1XCTA 2F9BT 2DLIA 1MPAH 4P23A 2P5WD 1A21A 4WU5A 5F72S 4YLQT 3MRCA 3BP7B 3LIZH 1T22B 5D4QA 4K9EH 2WUCL 5GZND 3RVWC 2VISA 3QUMA 4KI1A 4LLWB 4NDMB 4PP1D 4NKOB 1JZ2A 2DTML 4PG9A 3D2UD 4EI5D 1MAML 4MVBC 2HWZH 3H9YA 5DJ0B 2YR3A 5C0GB 2O5YL 3MUGA 1S3KH 1J1OH 4CMMB 2R4SH 1VB9A 5EUKB 4FXKB 1P84K 2NY3B 5MP6L 4P57B 2CSPA 1EBAA 2D4DA 3PWNA 5T1DL 4PS4L 5IB4B 3ABZA 1J1XL 2HRPL 3CUPB 2GSGB 3F7YB 2GFBA 4HLZG 5KOMC 1T89C 4HPYL 4C56A 3VWJA 5C09E 4CW1A 2R29L 1JN6A 4M62L 1OP9A 1LILA 4XPFL 2IPUG 2OI9C 3B9AA 4DWHA 2PCPA 4M7JL 4KDWA 4JDZB 5F3BA 2BSTA 3MV11 4U6YB 4ZXBD 1NAKH 5JO5B 1NEZB 4U4BA 4TNVF 4N68A 2BNRA 1YECH 1UB6A 5IROA 3KPRE 4JRXB 5JUEH 3S9DB 3WO3B 3FMGL 5B39A 4Z0XB 5DD1H 4F7PB 3D18B 5FYLE 3L3IB 1YUHA 5BZWB 5DK0A 3SBWA 1EEYB 4XP1L 2F5BL 3G5YA 4RGNE 5FAAA 1CE6B 1F4HA 3QUXD 3HPLA 4FRWA 4LHUG 5IB3A 2G5BA 4PRPB 3NCYP 3SGEH 2P43B 5EC2B 4QF1B 5HPMA 4HKXA 2Y36H 5IQ7L 2FL5B 3VFWA 2BJML 3AREB 3MRIB 2D3VA 2B4CH 3TIEA 4NQUA 4HG4J 1NMAH 2X42A 1IKNA 3GMLA 2XWBB 3QUZA 3MRFA 1YEGH 4HKBB 5JXEC 4MZ2A 1ZSDA 5CHNB 1N0XL 2J8UE 5D2NC 5GS0L 3AXLA 4JANB 1GH7A 2RQ8A 3L3JA 3PWPE 1CFBA 1NGQH 4CADA 3TN0B 4ERSL 1N5YH 1BJ1H 2VDOL 4OIBA 5D2LB 3C5ZC 3HE6C 2IPUK 1NKRA 5HYJB 1UZ6F 5GGSB 4GXVH 1S7VB 2PW1A 1DDHA 1KT2B 1QSVA 2XKSA 3B3IB 2AKRA 2HVKA 4XNZC 3RNQB 1A6AA 3FRPA 4NYLB 3V0WH 1GHFL 3ZE2F 3FO0H 4PJFA 1BAFL 1MF2H 2B1HH 1HN1A 5K9OA 3ZE0F 1A3LH 2IG2H 4G8GD 4W70A 4DCQB 4ZMAT 5TFSH 2ICES 1BFVL 3IAGC 4YXKL 4QTIH 3F5WA 2IADA 1B0GA 4RMVA 3QXWA 4F9LC 2X2YA 4JFFD 1EGJH 4U1KA 1DZBA 1A1MB 2YRPA 1JNJA 4ISVB 2D0FA 1IGMH 3L3HA 4ODXA 1P7KB 2HJLA 5DVOA 3DV4B 2VXTL 4QXWA 4JQIH 2NY5C 4GXUM 4CKVX 1B0RB 3BZDA 3DUSA 4I0PD 5H2BB 2JK5A 2VZUA 5IKCA 3ARFA 1K5NA 4IRJD 4LLAA 1ZE3C 2E6QA 1U93A 1E4XL 5CEZD 1YMME 5C0DB 3L3OB 4Y2OA 1I7ZA 4KROD 4JFXA 4TRPL 5J1SC 3G5ZA 1KIRA 2XTJB 1NL0H 3TO4A 2B0SH 4APQB 5BQ7A 3DMMD 2AABH 5DJAA 2X70A 3REWB 3LS5L 2AJUL 2DS4A 5D7IE 4JFYB 3KPQB 3LD8B 4I3RH 4RWHA 3ARWA 4FFYL 2Y6SD 3IDGA 1C12A 3O6FA 2XA3A 4NO2B 5IHUH 5HXMA 1A1OA 2A6DB 4TUOA 2DQDH 5DJYB 3PQYD 5IG7B 4NFBA 2YK1L 2ZG3A 1DBBL 4L8SC 4PJHB 1CGTA 2VITA 4PY8J 4NWTH 4TVSa 4OBSA 1Z3GH 4NC1C 4OCXH 5E9DE 2OP4L 4RFNC 2D2OA 1G9EA 5BS0D 1YMHA 3CK0H 4GG6E 2D31A 1SVZA 3G6DL 1BFTA 3MR9B 3W0WB 1FSKC 3U36B 2R69H 3HC3H 5EORL 5HHMD 4X9BA 5IBLC 4N0UA 1MRDH 5IMOA 4GW1B 1XF2B 1NBVH 1RZ8B 1MH5A 5E94B 4FQJL 4NN5B 4LSPL 5IGXL 3P9MB 3KYOA 1KCLA 1KGCE 1KTLB 4M9PA 2PUQT 1AO7E 5FO8B 4P5TA 4K94L 4PRAB 5E1AA 3ARTA 2ICWJ 5TF0A 4OIAA 4LPCA 3B9DA 3KPSD 5IJVB 2RJMA 2ZUYA 3WCYA 4MA8H 3NCEB 4XCCL 3VMNA 1KPUB 4KAQH 1XIWB 3OB0K 1I8KB 4JKLA 4KDTA 1BBJB 5F70A 3CFDA 1HXYA 2YZ1A 3C08L 1NQBA 4FTVA 2FBOJ 3LVEA 4LRIA 5DMGC 2MQ3A 5D1XD 2AJSL 1OAYH 2K9UA 3MLUH 3MLSL 1NGXB 1JPSH 2ESVA 4K7PX 3RVXD 4LKXA 4FQIH 3RVVD 1FVDA 4MAYD 3GRWL 3DSFL 3OKEA 4DTGL 2A77H 5C7XH 3DETD 1A5FH 1UWXK 5D7JA 2FX7L 2AV1B 5D1ZD 3MC0A 1NAMA 4JPWL 3LRGA 1G7IB 4PPTA 5I1LA 3BZEB 4PRHB 5IV2A 1FGVH 5JZ7C 2FYYA 1R3IH 2Q76A 3EYUH 1GL4B 2JIXD 2NXZC 3EUUA 5EFIA 2HJKA 3H9SD 4O58L 4XNQA 4I4WA 3EO1B 5JTWA 1DSFH 1EEQA 4Y5YB 1Q1JH 2AQ2A 2DYPB 4NFDA 5C09A 1KBGL 2EC9T 3P0GB 1QR1A 3JBG7 4XXDB 2DQEL 4MA3A 3MXWH 3FOMB 1MJJB 4AEIL 1ORSB 2HFFB 1M7XA 2FBJL 3BP4B 5DLML 5JHLH 1MFEL 1BLNA 1OAQL 3HG1B 3GMPB 4XMKH 3KXFB 1D6EB 3VXSB 4JKMA 3OHXB 4YC2C 4AIZB 4AQOA 5E95B 2P1YA 5JW5B 2ICEA 3MRJB 1YYML 4MD0A 3VW3H 1Z0MA 2ADFL 4O51B 3OAZK 1KJVA 4ELME 4D0BA 1KTDB 3RWCA 3VXRD 2VLRE 4NHCL 5I1EH 1U8QB 3SKJL 1I9IH 2VDMH 4JO1L 3WNPA 4P2QA 1UB5A 4XH2B 4YBQC 1KCKA 4MS8D 3KHOA 4WHDA 5F7NC 2F54A 2AV7A 4I5BB 1VFBA 4PP1C 1BVLA 3IDIB 5HDQL 1KSRA 3MRBB 2JB6A 4OSUL 1RUKL 4EI5C 4Z7UF 5EIQA 3EYSL 1Y6KR 3QDAA 2BXYA 1IFHH 4UQ3B 4EIZC 1M7IA 2OMBA 5CLTA 1JPTL 3VFTA 1AGBB 2R56L 1FL3B 4YEFA 2LAAA 3RGVD 5I1AA 3X3GL 4PB9H 3O6LH 3EOTL 1E6JL 1FCGA 1G6RH 4WW1B 3VFGL 1G7PA 1WAAF 4BH8A 3P30L 1WBZA 4DZBA 3IT8D 5DJCA 2V6HA 3GJFB 3DTXA 4Y5VB 3PWPA 4A6YB 4X0KA 3X17A 3S6CA 1MNUH 1XCQB 2NCMA 1HI6A 4HGKC 3R8BB 3UTPE 4R97B 5ID1B 2I60L 5DVNA 5LGJB 1IGCL 1QZ1A 3IDJA 3ULVL 1GCFA 4FQQA 4PBXA 2A6IA 3VH8B 4ZO6A 4OUUA 1NC2A 3QWRA 4NM8H 5ALCH 4HF5H 4LSQL 1EHLH 1J87A 3UTTD 5DC0A 3N06B 2HJFB 1CGSL 5B8CB 3PABB 5FGRA 2HN7A 4URTB 3QUXC 3HNVL 2GIYA 1BQHA 2E9WA 3DXAD 4OZFH 3RWEB 3UBXB 4IOIB 3TPKA 1R0AL 3KJ4C 1QQDA 1UKTA 3KG5A 5DI8A 1LK2A 1EHXA 5HTSA 1NMCC 1HOCA 2W9EH 1NGPH 3CLFL 2WIIA 1OD9A 3HR6A 1KPRB 32C2B 5J12B 2DQJL 1A6TB 1VEMA 3AFLA 3CSYB 4CU7A 1U8IB 4QXGH 4OCSL 3L5WB 4Y16D 1WJ3A 2D0GA 1ONQA 3I3BA 1IQDB 2XZCH 4LSVH 4P2OB 2HTKC 4PJEF 4BH7B 3KYKH 3NIGE 3TNNA 2EXWD 3LQAC 2N1KA 4BJLA 5KN5A 1PQZB 4ZUSB 5GJSL 3O2DH 1CIDA 1PKQE 5TE4H 2HA1A 1SBSL 1A6ZB 1ZAGA 4PJXA 2AEPL 4XAWH 1PW3A 3EHBD 2UUDH 3E6FB 1ED3A 1X5JA 1A7BA 2G5RA 1PGRB 3UZQA 1IMHC 2R9HD 1NKOA 3BSZL 1GC1L 4Z78B 1PZ5A 3ZTNH 5D7IA 2IANE 4JPIA 3AS2A 4MJ2A 3NFNB 3UBXI 3QDMB 4KY1H 5I15L 3ULUE 1NMBH 3MNWA 5EZIH 1FAIL 1D5BA 4ZUWA 4UAOC 4TUJB 2X4NA 2ZCLH 1TENA 4Z5RA 4QRPE 3BKCL 5DYOB 1YPZE 3ARGA 4D0CA 4DVRH 5ETUB 4LIQH 4DZ8A 4GAGL 4X80H 2OQJB 2A74A 1UJTA 4P5MA 3SDAD 3RNKB 3LH2H 2C3VA 3W39A 5DD6A 2A73B 3LDBC 3QP3A 3RQ3A 4YK4C 4PJ8B 2IPTH 4RAUA 2OI9B 4NPYA 4K3EL 2XA8L 5T1KB 3WFDL 3C60D 2C3HA 2K1MA 1CXHA 4ODSL 1MVFA 4YBHA 3RGHA 2ZJSH 4IRJC 5JW4M 5CD3A 1A1NB 2IF7A 5BO1L 3RDTB 3M1BA 4DVBA 5L2KA 4BZ2L 2B39A 2BOCA 1I1YB 4K8RD 4GS7C 4KROC 3TC9A 1DQML 4P2RD 5JORA 3GUTB 4PLKD 1AE6L 2R2BA 3QUYC 1K4CB 4LDEB 1QA9B 4LQFH 5HYQA 2DI9A 1UACL 2GJJA 4TYUA 3U6RA 2B20A 5DO2D 3HUJF 2JJSC 3EJYD 5DURD 5BW7A 3PGFH 3QZWA 3RZCD 1KEGL 2Y6SC 1NGZB 3O9WB 5IWLA 3WXVH 3P40A 4FQXB 1J0ZA 5TE7H 3QEHA 3TH4T 1L6ZA 3WE6A 4Z7UB 1N2RB 3BYYA 1T7VA 1D7FA 5E99L 2GW5A 4HDIB 2FRGP 1LD9B 5FYKU 4XP5H 4F8QA 3H3KA 3VA6A 4U7KA 3X3FH 4I8DA 4PB0L 1AY1L 1FRGH 2V5TA 4Q0XH 2DLEA 1FYTA 2AS5M 1FL5A 1YYLH 3HE6B 3PV7A 1ZT7B 5HDOA 4FA8A 2CLZB 2PTTA 3DVGB 1IL1B 4YHYB 3MCKB 3PWVA 4C83A 1CFNB 3F7RA 3DNKA 4HIIB 4WCYL 2EDLA 5I1IL 3EBAA 1MWAL 4PG2C 5TPWH 2GITB 5E2TH 1CLOL 5EUOE 4DUWA 4KQ4H 5CKGA 4ZDHB 4UNVA 5DT1L 3QJHA 5DGRA 1A02N 4KPHL 4QT5A 2JTDA 5HSFA 3MRLB 4AIXA 4Z7NF 4XNUH 4K71B 3Q6GH 5E8DH 3MRPA 5F96L 4F37K 2LVEA 1N5AA 1EK3A 5J1AB 1FQ9C 4BKLB 3T65A 4MNQE 2HRLA 3TO2B 1NUNB 2IALB 5D1XC 1M6OB 4O02L 3VXNA 1PX4A 1ZV5A 4NZTH 1DN0A 4F7TA 3OAYH 1INQA 4X7TA 4MAYC 3V52H 4GRLA 3DETC 4PYGA 2X9YA 3V6BR 4C57C 2BVOB 2DWDB 5FHBH 1JGDA 1KLGA 2GHWB 5AD0A 2Z93B 2NMSA 4KZDL 2YPKB 1G9NH 4U1IA 3VJ6A 3RTQB 4NM4H 5IHLB 4JRYD 5JHDA 4U3CA 1U8LA 4PJEB 5CSBA 3QO0B 3RWHA 4DGIL 1YQ2A 5KJRL 1NCTA 5ENWB 4JG0H 1FBIL 4RGMC 4TNWF 2ZOLB 2YHGA 3TP4A 5C0AE 2OL3H 3S7GA 5DUBB 3INUL 5MEQB 2IWGA 1TLKA 4Z6AT 3EYOA 4HXAH 4Z76B 3WS3B 3UC0H 2G2RB 4RGOH 2Z35B 2R2HA 3G6JF 3O11A 3GI8H 4TUKH 2B4CC 5ADOL 1QKZL 5D2NA 2Q8AL 3VFNA 1B4JH 3EOAA 3IETA 3DLQR 4KMTL 5BJTB 4MS8C 4PV8B 3DI3B 4NNYB 5H35A 3GBMH 1D9KD 2P7TB 4CVXB 1T1YB 1E27B 3E3QE 2VAJA 4KV5E 1YC8A 4NQDA 1RJZA 2OK0L 2IH3A 2XKNB 2FEDD 5I1KL 1RIUH 4TULH 3LHPH 4GAJH 4X6DE 1X4ZA 4YDKL 2BOBB 4L3CA 4ODWA 3NZHH 3IJHA 1CR9H 2BRRH 5MENB 1MFBL 4M5YL 1L0YA 3RGVC 4ODUA 2Y06L 3HAEH 3P4OA 2Y72A 5GSVB 4WEUD 4K2UL 4LLQA 2AXGB 2OJEB 4PJ9D 4Z8FL 3MFFA 5C07B 1D5XB 2BC4B 5HBBA 1JMXA 3BN9D 5DMIH 3PIQA 3ZKMD 3LQZA 4LNRA 1FFRA 4OFDA 3CGTA 4P4RA 1HHIA 5ACZB 2MWCA 4M48L 3VXQB 4F9LA 1CTOA 1IT9H 4M93C 4NKDB 2YBRA 1WCQA 1VADA 3BAEH 4G8FA 1CGVA 2J3SA 1YEEL 2EO1A 1UJ3A 2FJHB 3AS3A 2H6PA 1AKJA 1I75A 1KG0B 4Y5XB 1Q8MA 3DV6B 1Q72L 2AGJH 1GGIH 5F8QC 3OB8A 2YA0A 1FZKB 3FQWB 1YNKL 1UKQA 4OLVH 1IKFL 4HC1H 1XGRB 1KCSH 3M45A 4R2GD 3D3VE 3QEQD 3GZKA 3QFJB 4LCCA 2NW3B 2UY6A 4UIKL 3R1GH 1SEBB 1LMKA 3NPSC 1S9WB 3O45B 5LAXA 4ZSOB 3HLAB 1J8HD 4WI5A 2ATKA 4AMKL 5MEPB 5A2IH 5C0CB 4FQLH 1CVSC 4NQVA 3CAFA 4LPXA 3BEVA 1ACZA 2X40A 1MUJA 2VLKB 4LU5H 2D7OA 4IIQA 3WNKA 4P9ML 4JFZH 2FSEB 2DM7A 5BVJA 2CDFB 5J0BA 1DQQB 3U9PL 5KW9L 1J9CT 3MV9E 4L8SA 2ATPA 3LRSB 1OGAB 3VFUA 3NCMA 3VXMD 1OWWA 4QNPE 4PJ7E 3EHBC 1T1WA 5LJYH 1OAKH 2IH1A 2FNBA 2XN9D 4KVNL 4LDOB 1DQLL 5FV2A 3SOBH 4AH2B 2R9HC 4IS6A 5C0BB 3QUKA 1WQVT 1WFNA 4JREC 1QRND 4I0CC 3MMEA 3ARPA 4L9LC 4WY7H 3D2UB 3PJSB 4CL7A 2X4QA 4PJBA 3H3PL 4WFFD 1TZHB 1OCWL 3MTRA 1KFAH 1QP1A 1PKOA 3EOBA 2ED8A 3QO1A 3RAJH 1CGXA 3D0LA 4U2ZA 4JFDD 3W9EA 4UU9A 1LO0L 2FZ3A 1P6FA 4YPGB 4M43H 3SDAC 5A2KH 2XOTA 3VD3A 2NY5L 1XMWA 1QLRB 1EJ6A 1A7QH 4WUUD 3TYGH 1TMCB 2NQCA 1RY7B 4HMEA 3QHZH 4MGXA 4ZAKD 5CCKL 5B39G 4HJ0D 3MNZB 5F1NB 4ZXBB 3SKMB 2OTWB 3QQ3A 1VFMA 4HBCL 3T04D 1KN4L 3S34H 1UADC 5IK3B 3C60C 3WMSA 1GOHA 1GIGL 1W0YT 4PRIA 2B1AH 4H1LG 2RIKA 2WM0A 3V4VH 2XY2A 4O5LH 5DJ8A 5HHPA 2ZKHL 4K8RC 2KZWA 2XPGB 5E6ZA 3NABL 4GKSB 4PLKC 3T3PE 3TIDA 3T1FA 3FT4B 1Q9LB 1JTOA 3KHQA 3G6JB 1CK0L 1IGJA 5DO2C 3SPVB 3O4LA 4P3WA 3EJYC 5FM5M 5JOEA 3VFRA 1BF2A 3QIUD 3KJ4B 3CXHJ 2XQBH 1NMCB 2UVFA 5D72H 4YHPA 2NY0B 2FX8L 4MNQA 2X1OA 5HVHC 3WXWL 4OZGF 1ZTXH 3TFKC 1KACB 2DMBA 3UAJD 1I7TA 1N4XH 2DQIL 3MJ9A 4EVNA 1TVBB 4JKPH 3OTTA 4TSCL 4X9FA 1YEHH 4LF3B 5KSUB 4L8CA 3O3DA 5F21B 5EBLA 4V1DE 5CJ8A 2AXHA 3N50A 2VZ3A 4OD2A 4Z95L 1Z9MA 3KS0J 5J89A 4HV8A 4MLSA 4RFEA 5D7SH 5M7QA 4MQTB 2X4PA 1RIVL 35C8L 4Q6YA 4LLUA 3WLBB 3OBAA 3A6CL 3IDMA 2R1WB 3U1SH 3S5LB 3BISA 3VDBA 1MIMH 3GSQB 3O3BA 4PREA 3UZEA 4BYHA 4LSSL 3IDNB 1IE5A 1FV1A 5IT2L 2CMRL 5DEZA 4YDVA 5DHVB 1EUTA 1BBDH 2FATL 2QL1A 4LQ1A 4LGRB 5CZXD 1YZZA 3M17B 3IGAA 3UXFA 1HH9A 2IAMC 4U1SB 5ICXA 5C6PB 4OGYH 2EC8A 1AXTL 4YHZL 2FIKA 4G8GB 4IBLT 1UWXH 2AJXL 2EDOA 4PJCA 3MA7B 4X4MA 4JFOB 3P4MB 5LQBH 2QSCH 4IOSD 5JXAL 2OXHA 4ZPTA 1MCPH 3KLAA 4N0CD 4WNQA 3TA3B 1LO5A 1R24A 4JFFB 1QSED 3F7PC 5BRZB 4JRXE 2EEDA 4GKZB 2YS4A 4K3GA 5C08A 1C16B 4FFZL 3W5MA 1QSFE 3D6GA 3MBXH 4X6EB 2NX5D 4QY8B 1TTUA 3W11D 4OB5H 3KPTA 4P0DA 1TPXC 1CLZH 4K23L 5C8JA 3MYJB 1W72B 2F8VA 3M8OL 4TTDD 5T5NG 1DLHB 2ZNXA 2O61B 3TBSB 4PRPE 5HHVL 4XPTH 4G6FD 4I0PB 3S36L 1Q9WB 4O2CA 4NJAH 2CKBA 4P2CG 5HDBF 3SDDA 3OAZH 4U1LA 5D9SB 4MSWB 4JY6A 1R5WB 1X5YA 3DGGB 2DQFB 3IAPA 4ODTL 4KROB 4YAQB 5GRVK 2EDKA 4G3YL 1IGYB 5MERB 2V7HB 4N9GB 1G7JA 3R06B 3QUXA 5BOPA 3DMMB 3C2AH 4GXUN 4HK3N 4FABL 2QADD 43C9B 2Y4SA 1UQSB 2PYEA 4WEBH 3T0ED 5D71L 5CJ5A 4RA3A 5AAWA 3QDJD 4WI3A 4LKCB 3ALWA 5F7DA 5D2LE 3PQYB 4ETQA 1NH6A 1ORQB 1WV7T 1KNOA 2YUVA 3UTQA 4E0RB 1A0QH 4YFLF 4X8XA 5J6GA 1ZVSA 4N8CL 3F7VB 4GW5A 3HNTH 4ZUTA 5K93A 1BM3H 5A40E 1OD7A 1GOFA 4NO3B 4DKDC 4IRSB 3AS1A 5HHMB 1ES0A 1WC7B 2OZ4L 3OKKA 3QEGH 3SQOL 4Z7VF 4Y1AD 1B0WA 2XV6B 1WIUA 4JKKA 5J1TC 3FB8A 4M7LL 1U3YA 3SCMA 4LHUD 2I07B 2P48B 1JNLH 1F2QA 1QBML 1SJVA 2EEBA 4JFHD 1Y6MR 4GBXA 4JM2A 4RIRB 3IRZA 5J9PA 4EEEA 4KDVA 4X7EC 4EDWL 2P47B 1F4AA 4KXZI 3ORJA 2OJZL 5DUPL 2XFXB 5ALBL 4RA0C 4PGBA 4X7SL 2H41A 2NW2B 4MDIA 3T4YA 4FXGB 1BX2A 1OSPL 4KRMB 4R4ND 4XNMB 5DJXA 2R0KH 4R4BA 5IVZB 3O6MH 1AGDB 3LZFH 1K8DA 3CU7A 2Y5EA 4FP8H 4M1GH 3C8DA 1FGNH 4F57L 2EEAA 4YHNA 3SGDI 3S8WA 5F1IB 3BE1H 2X1WL 2PKDA 1RHHB 4EQ3A 2W9DL 3STZB 2A38A 4MAYB 1UA6L 3ULVE 4R2GC 3GIVB 1HHHA 4OZGB 4QRTA 5D1ZB 4JN2B 1F11A 3IXTA 4LVNC 3LN5A 1KCVL 5CBAB 3I2CH 2NY1D 2EKSA 1CT8B 4K3JH 2JIXB 3TT1L 5K33A 1J5OL 4PJ5E 1UKSA 5GSRB 3QUYA 1URLA 1WZLA 2EE9A 4HCRA 3SE9L 2OX5A 3HE7B 2JJSA 3LQAL 5HJ3B 5IHZA 1I1RA 5CSZA 1JZ4A 1IJ9A 4MQXD 3AY4C 3W0WE 2YPLD 3CVIH 4HH8A 1HWGB 3BO8A 5D7LD 3RY4A 4NGHL 3JZ7A 4QRRD 4X5XB 1J1PL 3WIFA 1JHKL 4RSVA 5LBSH 3TT3H 4H20L 5K9JH 3ZYJA 1INEH 1BF8A 3QAZB 1MRFL 1MHHB 1T66D 2Z91B 4KZEL 3VXRB 2DAVA 5FCSH 3MRGB 3NOIA 3NVQA 3SY0B 2BDNL 2CGRH 3LS4L 5DQJB 5BS0A 1RPQA 1UVQB 1A9EB 4HPOH 3Q1SL 2APTA 4IOFD 2PXYC 3U4BL 4AEFA 4LSRL 1UM5H 1XT5A 1YEIL 1EZVX 2KL6A 3V0VA 1NCCH 1H15A 4KRLB 1CS6A 4HKZA 3L95B 4R90L 4H26A 2FJGB 2FB4L 1IM3B 1L7IL 2VLLB 2W92A 3S96A 5TDNA 4WFHD 5FK9A 4NCC1 4OZ4B 4IDLA 1JRHL 1FZOA 3E2HB 2H8PB 2YWYA 2VKWA 1T22A 1A7RH 3VFPA 5JOPE 4Y4KD 2V5MA 2BNUB 3KPSA 4KUCD 1C7TA 4NKOA 2H32B 4GRWH 1FVCB 2HG5B 5DJZA 1MHPH 2EYSB 4ZAKC 1S5IH 5DJ0A 5CEZL 1FFNB 3FQUA 4HJ0C 1WBYB 3DVIA 1OF2B 4X9HA 5C0GA 5IFHL 5DR5L 1ZXQA 4XP6H 3LKQA 5EUKA 2ARWA 1K3IA 4J2XA 2VE6B 2EDQA 4P57A 1BQHG 4PRHE 1U3HA 5FO7A 4J4PD 1I8IA 1CXLA 1H3WM 2H2SD 5IB4A 5CS7A 1U8HA 1QLFB 4X4XB 4HK0A 4BZ1H 2PTVA 2DI7A 2A9ML 3LB6D 2GUOB 5SX5H 1G1YA 2Q86B 1CLYH 2AVGA 3U9UB 2X4OA 3HG1E 3UJTL 5IF0B 3IU3A 3KXFE 1HDMB 1UZ6E 3DXAB 4JDZA 3EFDL 3MLWH 2BNQD 3VXSE 2P5ED 3OG6B 2WANA 1PSKL 2GCYB 3QIUC 5F7KC 5JO5A 1EMTL 2DKSA 1ZHLB 1OLZA 3H9SA 4L4TB 4OF3A 4DKFH 3SE3C 1W0VB 1G9NC 4OLUH 4ZUVA 2D9QB 3ZE2E 3MRKB 4JRXA 4Z7VB 1CCZA 3CSPA 3OF6D 5HHOD 3QRFM 4QRUA 3KVQA 3HFMH 3ZE0E 1GPOH 1A6PA 4Z0XA 4F7PA 3D18A 2FO4B 4MD5B 3UAJC 5ISZD 4QGYA 4TOYL 1IARB 3HRZA 5E2VL 4Y16B 4GLRI 2Q1EA 3TWCH 4PRPA 4U6HA 2BCKB 1HH6B 3WFZA 4QF1A 3RWIA 3TPUB 3U83A 4KHXH 4RX4D 1ZHBB 3QI9B 5IQ9A 3C2SA 2HT2D 1AD0B 4MDJB 3LIZL 4M3JA 1P7HL 3C6LD 2XWBA 5E4EC 3UZVB 5CZXC 4HFWA 5CHNA 4HGWA 1S3KL 4YFLI 1ZLWK 2R4SL 3RA7H 3I50L 1MHEB 4ZPVB 1X7QB 4BSJA 2ADIB 2UZIH 4JO3H 5FF6B 3WN5A 4WDIB 1C7SA 5E8NA 5HYJA 1R3JA 1VGEL 2V2XB 3UCRA 4HUXB 5DEFA 3MCG1 1QFPA 4KTDH 1S7UB 3TBTB 1XAUA 2W38A 3SDAB 3B3IA 2VXUH 4R4FH 4NC0B 4NYLA 4UTAL 1IC4H 2B5IB 2NY4B 4OGXH 5FUZL 3DHJA 3PWUB 4JPVH 2BMKB 4WU7B 4GW4A 1WTLA 2VC2H 4I2XA 3W11C 4DCQA 5JUEL 4F2MB 4TTDC 3QIBB 3VMPA 1JZ3A 3N85L 1NDMA 1JF1A 3C60B 1EGJA 1F3JA 3MGTA 5DWUL 1KENL 2B8OT 1X4YA 3RZWA 5MI0C 4DGVL 1A1MA 3QZWG 5EB9A 1HHKB 3K74B 1IBGL 4ZO8A 3IVKB 3HMXH 3LMJL 1TFHA 4BFGA 1U8KA 2I9TB 2XQYG 4OFYD 1T03H 5DURB 1ULVA 3T0EC 2CDGB 5JW4N 1B0RA 3OPZH 3RZCB 2HFGH 2NTFB 4L3EA 1A3RH 3CX5J 1WBXA 5D96B 1FPTH 4PGJA 2X4TA 4HS8H 3SJVE 2WBJD 4QWWD 1BZ9B 3QG7H 4MD4A 3MA9H 5IESH 1A22B 1N5YL 4QXUH 1IM9D 3IJYB 2BXZA 5GZOD 1RZGA 3KPQA 1YNLH 3WKMH 3X13A 4GXVL 1V3LA 3QDME 3A67H 1HHGA 1OP3K 1S5HB 1RZFL 3FOLB 4UUJA 1Q38A 1HSAA 4HEME 3GHEL 3C9NB 1RJLB 5C0JB 2X4RB 2FJFA 1MCCA 2Q8BL 3FO0L 3VI4F 4PJHA 1A6VH 1MF2L 4DQOH 1H3PH 5H94B 2NYYC 3ESVF 2MSPA 3IU4L 2BY3A 4KTEH 3O41B 5GIRB 3U36A 1C1EL 3G04B 4ZO7A 3PP4H 4QTIL 3FJTA 3W82A 4ELKA 3GBLA 2E7CA 3BRDA 3FKUS 1J12A 1MFAH 5IW1B 3GO1H 4JO4H 1HQ4A 5DMKB 1JNNH 2XQYK 3NZ8B 3ROLB 5HGDB 2W0PA 1PFCA 5E94A 2J88H 3CXDH 5IMMB 3ROOB 3AMLA 2DM3A 2APFA 5L8KB 2KZ1B 3L9RA 1JWMB 5TQ0H 2QKIB 3GSVA 3FL7A 1QVOB 3HI1A 3EZ8A 3U7WL 1F4WH 4BSWA 4PTTB 1C5BH 3T4AA 3BPCB 5EOCL 5FOBB 1FG2A 1NL0L 3O6KH 4YDLC 1VACB 5JA8B 1KJMB 1CGUA 3CCHA 2NY1C 2AABL 2EZ0D 2V2WB 1QYGL 5TH2A 1CFVH 2DQHH 1NGXA 4J1UA 4I3RL 1ZA6B 2X1XR 5EU6B 4BQBA 1IZKA 4Z7UE 1FIEA 4CN6A 1PDKA 3DRTB 3OKDA 3VFOA 1T4KA 1RVFL 3HZYB 3QH3A 5IHUL 4UILH 4DW2H 1GGCL 4OGZA 2GQHA 4TVPD 3MNVB 4MQXC 3ES6B 4OD3L 1DL7L 1FH5L 1UXWB 1FL6B 5B22A 1IGTB 4GJTB 1WT5C 1A7OH 3BZEA 3HTLX 2FD6H 4NWTL 4PRHA 1B2WL 3QXAA 1WAAE 5F3HA 1JZ7A 2C9AA 3CK0L 5TGBB 5L9DL 1VEPA 2WK2A 4Y5YA 1T66C 1EFXB 2R69L 4P5KA 5GGTH 3RIFK 1JI2A 4XXDA 3O2VL 1MJJA 5EO1B 5DD5L 3AC0A 3CX2A 1DBAH 1MRDL 3H7LA 4IOFC 4JKWA 1D9KB 3VXUD 3WO4B 3MJ7A 4L8DA 3T77B 4AIZA 3OHXA 4LCUA 4G7YL 3O3EB 3RVUD 3ARDA 3BGFC 4D9RE 5JW5A 2B2XL 4RRPA 5IBUB 4NKQB 3AVEA 1MLCB 3QHFL 3HZKB 1U91B 4O51A 3RU8H 4FZ8H 3WDJA 4NNPH 1KTDA 3L5XH 2ZPKL 2VRAA 3QG6A 3RWJA 2IAMA 3MREA 4JVPA 4PJ9B 3T2QA 4MA8L 1OSZA 3DBXA 3L3GA 2EDBA 2V17H 3H9HA 3O8XD 3QR2A 4KAQL 4HHAA 5IB5B 2YN3A 1A4KB 2CIKB 4Y4KC 3LV3B 4G5ZL 3GNMH 4QHUB 1MI5D 2APXA 4ALAH 4GMSH 4L5FH 4E42B 1JI1A 2YC1A 5ABDE 3DARA 3MLUL 4K8RL 4DN4H 1Q9OA 4CVWA 1FL3A 1JPSL 3LKNA 4EBQL 3ULSA 1G6RA 4FQIL 1UWGH 4J4PC 3QPXH 5J6HB 2H2SC 1MCNA 4G80B 2PYFA 5FOJA 4NQSA 1HEZA 4IMLA 4PJEE 1YEKH 3B9KD 5AZEH 3RY5A 5EPMA 2F74B 3GJFA 3LB6C 3QEQB 1FGVL 4M8VA 1P7QD 3EYUL 3LEXA 5F1SA 3C8HA 4YIQB 3BXNB 1FNAA 1ZGLB 1TQCC 1HQRB 2GAZA 4Z7WA 4IHOB 5ID1A 2EECA 2OS7A 1C5CL 3UTZB 3VFMA 1J8HB 1QEWB 2EDDA 4XMKL 3V6ZB 5T33L 3F6IA 5GRJH 4FS0A 4LVHC 3RX8A 2X4UB 4G9FE 4NC1E 5CUSH 3GSWB 1K2DB 5JPNA 3QDHA 3VW3L 2HJFA 4H1LH 4OZFA 3PABA 2I5YH 4O2FB 3TVMD 4IOIA 2APVA 2J2ZA 1ZANH 3CX5K 3OV6A 2VDML 5FKPB 5DJDB 1U95B 3G9AB 1KJ3H 2HT2C 5FYKD 1GAFH 3OJVC 5MENE 2JB5H 2VR5A 3VXMB 3C6LC 1EFQA 1A6TA 3S35H 1JHLH 1AIFB 1IFHL 5C07E 1QTYT 3WJJA 2EXYD 1IQDA 2DWEB 5E8EA 3RL2A 3BGMB 4PFEA 4PB9L 3O2DA 3O6LL 2EIZB 4LLVA 3K80A 5CLWA 4JQVC 1EO5A 2XG5A 3HC4H 5JR1L 1IC7H 1QSZA 1FNEB 4JFDB 4P46C 1XFPA 4LCWB 4CU8A 2DD8L 3HUJE 2AXFB 1MNUL 5CJOH 4Z78A 1DBMH 4LBEA 3CDFA 4WUUB 4DK6A 3MOAL 1LHZA 2ZP0T 3MRNB 4Q6IC 2WW8A 3HI6H 1K6QH 4RBPK 4XWOC 4OF6A 1OB1A 3ARBA 4ZAKB 4NRXA 3QFJE 5JIPA 5DRWB 4JDVA 4N8VB 5DYOA 4HIXL 1EHLL 4XVJL 1N64H 4HJGA 4Y19D 1EX0A 2YPVL 1R5IB 4PJIF 4HJJH 2JELH 3P73A 3Q48A 1CD8A 2YD8A 3CC5A 4OZHA 2A73A 4N0FB 5MEOA 4H25B 5C0CE 4PJ8A 4NQEB 5T1LA 2SEBA 2P8PA 2VLKE 1DQJA 5E8PB 2W9EL 4NQCD 5T1KA 1MY7A 1W0WB 1JPFA 1MJ7H 3PGCB 3U82B 3BP5B 2HFEA 2FX9L 4R26H 5HHXL 2R4RL 2Y5TB 3OJDB 4MJID 1KIQB 1MVUB 5KSBF 4LSTH 1SJHA 4G8IB 3SDXA 1XGTB 1OGAE 2Z31D 4CMHB 5KS9F 2XZCL 1K4CA 2P5WE 3AY4A 3E8UL 1AQDA 4G43B 2W65A 4U1JA 4Z7NE 3FB5B 1LE5B 4Y7MA 5ESAB 1TVHB 5C0BE 3LN4B 2P44B 5GZOC 4XNXL 4XBEH 1MJ8L 1WEJH 4XAWL 3WUWB 4NT6A 5JW4R 3FQRA 3ZTNL 2BVYA 2R2EA 4XBPA 4I9WE 5DHXB 2PXYA 1B3JA 1N2RA 5IVXA 4KY1L 3HCVA 2LV4A 1J05B 4OQTL 4M7KH 1NMBL 5B21A 5D1QA 1QRNA 2ZCLL 1U0QA 5EWIH 3NFSH 2AERT 2VLJD 5LWYH 4DFIA 4RWYL 3EOYG 4WHYG 4FMFA 1TJGH 2UWEF 2CLZA 1Z9SA 4NO0D 4P23D 3IFPA 4QHNA 5GS1B 1CE1H 2C1PB 1J0IA 3MCKA 1QSEB 2IPTL 4TPRL 3LKSB 4K7FB 1LEGA 4Q9RH 5GHWH 3GSNB 4PY7B 4HIIA 5EIIB 1A7NH 1DQDL 3GJEB 3GSNH 5GS0D 3F8UB 5GGUB 3FT3B 5DS8A 2NX5B 3T8XA 1KF9B 1R5VA 4X5LA 3G6JE 4FQ1L 4QHLA 5FUCC 1IVLA 3FTGA 3K2UL 1Z5LA 4Q97A 4KUCF 5J1AA 4BQ8A 4C56D 5A2FA 3VWJD 2VN4A 2EZ0C 3ARZA 1MFNA 5TJWK 1QFUH 4EN3B 3MJ8B 4JFPA 2HKFH 1PX3A 1OLLA 3PP3H 3U7AA 3MLRH 3NGBB 3KS0H 2QADB 4WFED 3WXVL 1T5XA 2P8LA 5DK2A 3IKCB 1RZIB 4ZO9A 3T0EB 4WTZA 2BVOA 3OXSA 5CINL 1ACYH 4EUPH 3V5KB 3QDJB 2Z93A 3P3YA 3RTQA 5T3ZD 3CVHB 4XP5L 3RKPA 4BQCA 2DQUH 3X3FL 5DQDH 1FZMB 1U9KA 3LEVL 4AEHH 1NCAL 4QGTA 3CD4A 3PNWA 3QA3B 2ZOLA 3DIFA 5B4MC 1YYLL 4X6FA 1QO3B 1V3MA 1MHCB 3S88L 4S1DC 3GSXB 4YUEL 3BW9A 1LQSR 2Z8RA 4QOKA 1VFOA 4G8GE 3BKYH 1H3UA 4PGCB 5CEYB 5MEQA 4JY5L 4S2SA 4S10A 3A6BL 4XP4H 4QHKI 5FYLH 5I74C 3CPLB 5TPWL 1UZ8A 5GISH 4JFFE 2P24B 5BJTA 4KQ4L 4FMKA 5ID0A 4NNYA 1J0YA 5BRZE 5I1CH 1F90L 1M7DB 4JE4B 2P7TA 2X4SB 3OJMB 5J06A 4NRYA 3Q6GL 5E8DL 4FNLL 5LXGH 4R7DB 5F9WB 4D3CH 1XH3A 2AEQL 2W0FA 3MBEC 2X7LB 5I2IA 4PJIB 4U6XB 2A1WH 4XBGA 5I17A 2XNAA 1JYNA 3U0WL 1FJ1A 2E3VA 2BOBA 5GRUL 1UCBL 3HAEA 5ICYA 4QCIB 3L3DB 3KPPA 5CEZE 3V52L 3EDEA 3GIZL 5E6YA 1XGPB 4J6RL 3CH1A 2BC4A 4WFGD 3CFJA 3B9KC 3IRPX 5FHBL 1BJ1J 3WFBH 1I7RA 1RUQH 1S7TB 3ET9F 4POZD 5IM7A 4XGZA 1G9NL 5KSBB 1ZWIA 4WW2C 4PGDB 5KS9B 1MCHA 2QR0A 3SGJA 3Q3GB 4YDLB 4NKDA 4A2MA 2NY1B 1AXIB 1MCQA 1H5BB 4JG0L 1ZLUK 4YHIB 4HX1B 1HIMH 1HYRC 4Y5XA 3D85B 3DV6A 3PQYE 3S35X 1I8MB 1DUYB 4KKCD 1FZKA 2OL3L 4HSQA 1EO8H 1RUAH 4Y8DC 1OAXL 1GVIA 4U3XA 4JZJC 5F88B 5DK3A 1Q9KB 3MUZ1 2AXJA 4HXAL 1MJUL 5ESQB 4NO5B 2YPLB 3UC0L 5HHME 2AQ1A 3ARFD 3JTSB 4ZNEE 5D6DA 1SEBA 3TVMC 3VFVB 1CZ8H 1ZHKB 5F93C 1S9WA 1B4JL 5GS2D 3M07A 4JO2H 1F58L 3QSKB 3STBA 4ZSOA 1J0KA 4XCYA 3TO4D 4LARL 3GBML 1CBVL 2C7UB 3VE0B 3S37H 2F15A 4Z7QF 2VQ1B 3U46B 5C0CA 2VH5H 1ZA3A 2VQTA 2AJZA 2DLFL 1RIUL 4TULL 2UWEB 3LHPL 4NWUH 4J7RA 1KJ2H 2YD6A 1IEBA 1BECA 4Y1AA 4F15C 3O6FD 1ZLVH 1F3RB 1CR9L 2BRRL 1PG7X 2EXYC 1D5ZA 3BGFB 3P9LB 4LLMB 1KLFA 1NCDH 2CDFA 1ZKAA 1DQQA 1VEOA 2A6JA 4Y4FB 1QLEL 4ZUUA 4HUVA 5E03A 3TYFA 4FFWD 1U8NB 5CJXC 3LRSA 3O0RH 4F7CB 4J3VA 5DMIL 2ERJC 1QFWH 1TQBB 1PJ9A 1CVRA 4W68A 1G84A 3EW3B 1JGVL 1ZLSH 4L9DA 4AH2A 3TJEH 5IMLB 5C0BA 2COQA 4PLJD 1MOEA 5DRXA 1RUPL 4ZD3L 3PJSA 1K8IB 3MRDA 1G7LB 3PGDA 5DD0L 5CEXB 1TZHA 4OZGE 4NFCA 1TIUA 2AGJL 1GGIL 4Y2DA 4PRDB 2BK8A 1HWHB 2YMXL 4JB9H 4OLVL 4HC1L 4P5TD 1KCSL 5CGTA 4D9LL 5HYEA 3MSPA 1XF1A 3WIHL 1WIOA 1SY6H 3R1GL 5I73C 1U3ZA 5EOTA 2GJ6B 2JJWA 1IAIH 3GK8H 4CGTA 5L0QC 4Q74A 4NHUB 5F1NA 2BNQB 1BVKB 2VDLH 3CVHL 4OD1L 3SKMA 3AAZB 2P5EB 1CGWA 3KPOB 5IK3A 1OP3H 4WJ5B 3QULB 3OKMB 3V6FB 1MRCH 4FQLL 3QIWB 1ZVHA 5A16B 1AI1L 2E6JA 2E5EA 3GSRB 5DHYB 3HC0A 5HHOB 4YZFF 4QRQA 1CD9B 4LU5L 2ZUWA 3VXRE 4P49A 4I18C 2R1YA 4X5WA 4WI9A 5F9OH 1DBKL 2Z31C 3U7YH 5AYUH 5D7JD 4GKSA 4IMKA 2H1PH 3MFGB 3MLVL 3IDUA 5F89B 1YY8A 1UG9A 3SPVA 3QQ9D 1DTUA 5D5MF 3WS6C 3WL9A 4M6NL 3ZHLA 4MXWL 1AR1D 1U8PB 3EGSA 2KBGA 2Q87A 1V05A 4XC3H 4LRNH 2DI8A 2FWOB 1XR9A 5C09D 1OAKL 2I27N 3FFDB 3SOBL 1CU4L 2V9RA 3OKOB 3RIAK 1A14H 5D6CA 3C6LB 3UP1A 1TVBA 1IGIH 4WY7L 4JGMA 1C5DA 1D6VH 1TXKA 4MAUL 4J3SA 2HYMA 3QNXA 1DUZB 1CD1A 2ZSWA 3RAJL 5KTEL 4HWZB 3OAUH 3FO1B 3KPMB 2AJYH 2ITDA 3WLBA 5FO9A 2DJUA 3MO1B 2R8SH 3GMQB 2R1WA 3GFUA 5HHNB 4P2QD 1VFUA 2L7UA 2WQ8A 3IDNA 4P23C 5I16A 1A7QL 1AQKL 3HZMB 4BFIB 43CAB 3K4AA 5C0IB 3OR6A 2F54D 2DIAA 5F44A 1GZQB 4NZUH 3BUYB 4M7ZB 1YEDB 4ONFH 3EYQD 1EPFA 4FQPA 4KRNA 4K3DH 4U1SA 4F37F 1AGFB 5HHQB 5FKAA 5IBTL 2HT3D 3UTTE 4XCEB 5SWZB 2VLRB 2EDFA 2VLMD 4U0QB 2M26A 3VRJB 3DXAE 5IJKA 3V4VL 2YZ8A 3CFKB 2QSVA 4XPHH 3VWJC 4E41B 4Z7VE 1L6XA 3PWPD 4CVZB 4NIKB 4PP2A 4AT6B 5C6TL 4QY8A 4Y4HA 2OR9H 3DX7B 3UJIH 3PDOA 5D72L 3RUGA 3RP1A 3EYVA 4GG8A 4XC1H 1W72A 4MJ6B 1CDCA 5A43C 7FABH 2VZTA 4TQEH 4BUGA 1N4XL 3BPLC 3MOBH 3X12B 1OARH 3LEYH 4JKPL 1JTPA 1YEHL 1NC2D 3QWRD 4MSWA 5EG6C 3WDHA 1I9JH 3MJGX 4WW2F 2VERN 4NUGL 4XWGL 4HT1L 1OTUD 3BWAB 1OP5H 3FQXB 4P2YA 2WBJB 5ISZA 3R06A 3V8CA 4D9QD 4J8RA 5E2UH 2HVJA 1IM9B 1BZ7A 4M61A 4G42A 1O0VA 4HFUL 3IDYC 4LHQB 3AU1B 3FFCA 1BBDL 4LKCA 4H0HB 1HKLH 1I85A 3DX6A 2P49B 4ZOEA 4G6JH 2F19H 3L1OH 3SHSA 3KLDA 3RWFB 4RAVB 1P2CA 2YEZB 1A2YB 1A9BB 3K8KA 1TVDA 3GGWA 4NO3A 3BT2H 4L29B 3MX0A 1YEJH 4LSUH 2IGFL 5ITFB 3P4NA 4U33A 1MCPL 1ZT4B 1YMMD 2W9LA 1JGEB 4ZODA 3TEUA 1V7NH 2R1XA 5HYSB 5C3TA 4P46A 2I07A 4OLYH 4M6AA 3QB7C 2JF1A 2RAMA 1INDH 3W81A 3MBXL 3MRHA 3D69B 1VPOH 1NFDF 2AJVL 3K81A 1PEWA 2YD9A 3LSOB 5F7YC 1H0DA 1CLZL 1RK1B 2XFXA 4NSKA 4WI2A 5E5MB 3C8KA 4P2RE 2VAAA 4XPTL 2NW2A 4KI5F 2QHRH 4IJ3C 3WD5L 4ODVL 1Q94B 5DQ9B 2IPKA 5I76B 2P46B 3MLYL 2QTEA 3UTSB 3B2VH 5IMKA 2WUBL 2K7QA 2XTLA 2KH2B 4D8PB 4JDTH 3V9FA 4G6KH 1SHMA 1CL7H 3D25A 1YJDH 3S37X 1LO3H 4HZLB 3PXJA 2QV2A 4ESKA 3C2AL 5D5MB 3BIBX 4ZS7H 3ARQA 3ZE1F 5F1IA 1OWRM 5EN2A 1RHHA 4WEBL 1U8MB 1I3GH 3ULUH 3OR7B 3TV3L 3FB7B 3A6OA 2CK0H 2PN5A 1LNUA 1T5WB 5FB8A 1T83A 5F71A 3VGFA 3ARFC 2PW2A 4XVUD 3WSQH 1A0QL 4JRWA 1MCLA 2E8ZA 4AL8H 1UYWL 5CBAA 2VZ1A 5JPMA 5L2KD 2QQNL 1CT8A 3MGOB 2A9NH 3VG0H 1BM3L 1NJ9B 1IAMA 4YDJA 3S4SB 4TNVK 3TO4C 4UDUA 4RRPG 8FABA 3QEGL 5TF1H 1HK6A 1KB5B 3P77A 3DGCR 5JDSA 3HE7A 3EDJA 3IS1X 4I3GA 3WHXA 1TJIH 1T2QL 3MV7A 5GRXG 2GSIB 3R0NA 4HQQL 3VCLB 4S0TD 2YD1A 3MLTA 3O6FC 3TZVB 1FO0B 3UPAA 2G75A 5DZOA 5IHBA 2ARJA 1FO0H 1CICB 4MWFB 1U58B 2NPLX 5I74B 2LTQC 3BH8B 4X6CF 1MHHA 4FFWC 5JIIA 3GSUB 4NOFA 1CFTA 1H8NA 3MRGA 3P0VH 3SY0A 2ICWA 4FG6D 1A6WH 2VN7A 4BUHA 3N1GC 3BKML 1TETL 4FHBD 1LGVA 1WWCA 1UH4A 3ZSTA 2F8XC 3O8XB 4LMQI 2R0KL 1FYTD 4OLEA 3LZFL 2NXYD 2CJUL 2EYRA 4XPBL 5I66A 1MI5B 1IM3A 1FGNL 3LPWA 5IW6B 3BD4A 3QQ4A 4OFKA 2GYSA 4I48A 5I1DB 4BQ6A 3WFHA 2XY1A 2VDPH 2ZOKA 1L7TH 5DZLA 4ZQKA 4JVWA 4P5TC 3BHBA 1G9MC 2VSDA 2FR4B 4JRYE 4JZNA 1RFDH 1S7QA 3JSSA 3OGCA 1S7SA 1J88A 1Y0LB 2BNUA 5EU6E 3DYPA 3TNMA 4BM7A 1MEXH 5SX4I 3D48R 3VH8G 1P7QB 4K3JL 4KDTC 4OFIA 3QYCA 2A83A 5I1HH 1T2JA 4YX2H 4OZFG 3HZVA 2CIIB 4LRIC 2VE6A 3JWOH 1ITBB 3MZGB 1KCRL 4OAWA 1JGUL 3VFSB 2FECI 3NH7H 5L7XH 2O5ZL 3ZMRA 3CLEH 2XZAH 4X4XA 4XP9H 3SN6N 5JOFB 3CVIL 4YXLH 4GRLD 2VIRA 3OXRB 5D7JC 3QEUB 4S1SH 1T1ZB 4JZJB 2GUOA 3RX5A 3CIQA 2EE3A 2HP4A 3BESR 1G7QB 2ZZUT 3G08B 2W59A 5LBSL 3U9UA 5K9JL 5F1OB 1U8JB 5IF0A 1HDMA 2OM5A 4DKEH 1AGEB 2OXGA 1PLGH 4O00A 3VRLF 4LASH 3SE4A 1FZJA 4L4TA 4L4VA 1IAOA 5JHDD 2YD3A 5CP7B 3Q6FA 4YR6B 4XI5D 3GJFK 1NCCL 4PRBA 4MD5A 4NQTA 3JV4B 5IIEA 4UV4H 3EYFA 3K4ZA 5BV7B 3KJ6H 5L2JB 4OKVA 1KC5H 2C3WA 1NFDB 1HH6A 1Y18B 5B38B 4OIIH 5CILH 5DUML 4Q9CA 4DUXA 3QI9A 3ARUA 3I6LD 4MDJA 3CMGA 1JWUB 4RGNC 3FHQA 4HIEB 4JAMB 1MHPL 4JFEA 1LDPH 5TQ2L 1UEYA 4NQDD 5DFVD 2GT9B 3MBEA 4LEOA 4XP6L 1A4JA 15C8H 3RBSA 2HT3C 3QEQE 4GKNB 4ZPVA 3T08A 2ADIA 3V4PH 4DEPC 4W4OA 2EDWA 3IFOA 4WV1B 4AENA 5C0EB 2AJ3B 3BPNC 2V2XA 4HUXA 1FNFA 4Y19B 4YO0B 1NDGB 1XF3B 1J8HE 1XGQA 4RDQF 4MA1B 1JMZA 5EA0L 4TVPL 3MLWL 1Q0YH 3C09C 3UPCA 2BMKA 5L0QB 1MAJA 2MHAB 2Y7QB 1FNGB 4DKFL 5FYJD 5IEKB 1V3KA 4OLUL 2DTMH 4NQCB 3VI4E 1QG3A 1MAMH 3QIBA 4LCYA 2UUDK 4PJFF 5F9JA 5I0ZA 4IM8A 4EOWL 1AKJD 2O5YH 3PWJB 2CLRA 4U1HB 5SWQB 1J0JA 4JJ5A 4MJIB 3UJJH 4P9HC 5J11C 1JPGB 3HMXA 3PUCA 4W6WB 5T1DH 4PS4H 4FZEL 1HILB 1J1XH 3LCYA 1JK8B 2RFXB 3VXME 1OTUC 4MQSB 2LE9A 4HPYH 4KHXL 5LGKA 1D3CA 2XN9E 4X6CB 1NANI 5JLZA 3TVMA 1EA9C 4M62H 4NKMB 3GMNA 5J3HC 3QXDB 4M7JH 5E00A 2PO6B 4PR5B 1NLDL 2NTFA 5C0RL 3DURB 2HT4C 2ZWLT 4WFFE 3VXPA 2BSRB 1CDUA 4XNYH 3RA7L 2DF3A 1BFOA 3MV8A 4JFDE 2D7QA 1JBJA 4LCWE 2QBWA 4JO3L 5JA9A 2YXMA 4F80A 4MMZC 2VWEC 3IJYA 4XP1H 2E7LC 2F5BH 1T0NB 4WUUE 5T5NF 5DDHA 1R3KB 4BSVA 1EEUA 2C1OB 1S5HA 2L7JA 2FEEL 1EVUA 1BD2A 1XCTB 2VXUL 2Q7YA 3C9NA 5IQ7H 4WU5B 2BJMH 3I6GA 3ALPA 4PD4K 3MRCB 2O5XH 1AD9A 4WTXA 2F53B 5H94A 1P4LA 5IBLD 2VISB 3QUMB 3EDKA 3QXUA 3BKJL 3QWOB 5C2BH 4FOMA 1G1CA 3MUGB 1P1ZB 4OLZL 3DRQA 2NZIA 4NQEE 2X41A 4N0RA 5B3JF 2BVPA 3PWNB 1BQSA 2VDOH 5CIPB 3NMEA 2MKLC 2HLAA 5CIPH 4WTZG 3ROOA 4YHLH 4C56B 5DGQA 4J12A 2WV3A 4YGAB 1E6OL 1JN6B 2QKIA 4D0DB 3G6AB 3MROA 2M8XA 3WYRA 4TSAL 3BPOC 3RPIB 5J13C 3OPZL 2PCPB 5E6IC 1X5LA 5F3BB 2BSTB 4AYFA 2HFGL 1DEEB 3EDDA 1BQUA 3NA9L 5DMGD 1IILE 2BNRB 3JVGA 1UB6B 4PRID 4XVUC 5ANMA 2MOVA 1NGWB 1BFVH 4HS8L 5LCVL 1KJMA 2Z0BA 2MFNA 3QG7L 1WZ1H 5BCAA 3GMOB 4I18A 1YUHB 1WZMA 4D2NA 5DK0B 2V9TA 3G5YB 2J1KA 3PXHA 2YSSA 5EU6A 2AEIT 5IB3B 3W2DH 2G5BB 1V7MH 3O4LD 3A67L 1FHGA 3TBWA 5BW7C 2BVEA 3FO2A 3HZYA 2LU3A 4PTUA 4M1DH 1SJXA 1GGTA 4HKJA 2NZ9D 5HPMB 3MNVA 3ES6A 3VFWB 1IGTA 2EYTB 2VXTH 4LVOB 3ZLQC 1T1XA 4MNQD 5IWLC 3MRMA 2FCBA 4DQOL 4EIGB 3TIEB 2EDEA 4DKAA 4KTEL 3GMLB 3OAYK 1QHOA 5TGBA 3RRQA 3QUZB 3MRFB 4P59L 5KVDL 1WK0A 1EFXA 2L0DA 1ZSDB 2R0LL 5KSVA 1CDIA 3AXLB 1QSEE 4FG6C 4TRPH 2F5AL 2DM4A 3HAEG 3X14A 3LKPA 4JZOB 3UDWA 5KSAB 2EIDA 4CADB 3T77A 5FV1L 4NRZA 5GGVH 3O3EA 2ZUQB 2NX5E 2J88L 2NXYC 1JUFB 4GRMB 1CDHA 3H6JA 1MFDH 4PUBL 4P4KA 5TQ0L 4YBQD 4FFYH 4NO0A 4WWKA 1I1AC 1ROWA 1FNSL 1K3ZA 1ZOXA 4V1DB 1U6AL 2AKRB 2HVKB 1T80A 2LVCA 2YD7A 2YK1H 2KPNA 1X5ZA 4PJFB 1DBBH 1CQKA 5K9OB 4J3WA 2OP4H 3ARXA 2FDBP 5F7HA 1A4KA 2CIKA 1UFUA 1WFOA 3RKDD 3G6DH 2AK4B 4QHUA 5EORH 1ODAA 1T04B 4E42A 5FFLA 2IADB 3WHE1 3T0EE 1E4XI 1F6AA 3BRGC 1SM3L 1IRAY 4U1KB 2PTUA 2DQHL 2VDRH 1TZGH 4KUZH 3QDJE 5T3XD 2ZG2A 5C08D 3WJLA 3OX8B 5J6HA 2NNAA 3L3HB 4FN0A 4DW2L 4G80A 4LSPH 5IGXH 3ZKSD 4ZFOA 1EHAA 4ODXB 4ENED 1MCIA 2HJLB 4GRLC 4X9IA 4K94H 1DVFB 1F4XL 2VMFA 2DICA 1YY9D 3DUSB 2JK5B 1HCFX 1K5NB 4QHMA 1JHTB 1ZGLA 1U93B 3SDDD 5DVKA 5E8OB 1HQRA 5GGTL 1RU9L 4XCCH 5FGBC 2RCSL 3U0TB 1K4DB 1QSFB 4JFXB 3G5ZB 1KIRB 4KKNA 1EIBA 4JFHE 4XI5C 2X70B 5DJAB 2YUZA 2AJSH 2MPAL 2OMNA 4H1LA 5KBNC 2HH0L 5I9QC 4JR9H 2PYED 1K2DA 5DRZA 4R3SB 2RR3A 2NY6C 4LAQL 3SKOA 3RU8L 3GRWH 1C12B 2VDQL 3DSFH 4NNPL 4DTGH 2HTLC 3VGDA 1A1OB 1B90A 4TUOB 4PJIE 3BH9A 1O7SA 5FKPA 5DJDA 4L1HA 3QUML 1JP5A 1BWWA 3F58H 1RK0A 4QO1A 1YMHB 2D31B 3UROR 3GNML 2FO1A 2HTKD 1KBGH 4RCAA 5ITBL 4AEIH 5JW4Q 1RULL 2FBJH 5DFVC 4N0UB 1OAQH 5EU3B 1EUUA 3SCMD 1OVZA 5KG9A 3BGMA 1UWGL 4B53A 5KSBE 2EIZA 4GBXD 2VJXA 4JM2D 5IFAL 3MLXL 3IXAB 5KS9E 1YYMH 5CWSA 1OAZL 3WLWD 1RV6X 2ZCKL 4P5TB 2AK1L 4AIOA 2FIRT 4LCWA 3T1WA 1JNHB 4NHCH 3SKJH 2APBA 4JO1H 4PJXF 4MNHB 5F7EL 1ZK9A 2DLHA 1T21B 3MRNA 3JTTA 1YQVH 5IB2B 5DRWA 5T3ZL 5FIEA 2YPLE 1HXYB 5GRJL 1MCBA 4Z9KB 1A8JH 1S8DB 4FTVB 3VU2A 1UJ3C 4OCRL 5I75C 4GKOA 5D7LE 5E5RB 1J8KA 4QRRE 5TDOB 1BVZA 1JPTH 1YJDC 2LU7A 1Z2KA 2MJWA 2DQCH 2ESVB 5DC9B 3X3GH 4C59B 4O2EA 5CJQL 1DBJL 1FVDB 2H9GA 3AS0A 5GJTL 4JHAH 1E6JH 1N59B 2GTWA 3H8NA 3VFGH 5D7JB 1H9VA 4LCCC 1ZANL 2R39A 1RZ7L 3P30H 5ERWA 1A7PL 2UWEE 4H8WC 5I1LB 2VZVA 1KJ3L 2NY2D 4DOHB 5IV2B 1GAFL 5FM5O 1BQLL 2FYYB 2Q76B 3GMMA 4UOJA 2HJKB 4XNQB 1S9YA 4I4WB 3BP5A 1I8LA 3QUYD 2YD5A 1T7XA 1QR1B 4WFHE 1JHLL 4MMXC 3IYLW 3BD5A 2I60H 5K9KB 5HPOA 4K3HA 4ACPA 3ULVH 1BLNB 1XGTA 5J7CC 4NC2B 1XGYL 3PDGA 3S3PA 3S5LG 1O7VA 4F7EA 4IIQC 2I9LA 1S7WA 5GRZA 3F65A 3MRRB 1LE5A 2ICEB 9CGTA 2ZUXA 4MD0B 2EE6A 3LN4A 1NSNL 3B43A 3KYNA 4PJ5B 4TNWK 3WUWA 1KJVB 2DBLL 4D0BB 2VXVL 2H2PD 5DSCB 1R0AH 2NR6D 4H0IA 5GRVL 4P2QB 1UB5B 4OT1H 3DUUA 4XRCA 3V7MA 3VGAC 1NBQA 1NGYB 1RIHL 2XZQL 4G9DA 3MV01 3MRQA 1WTGT 3P2TA 4NN7B 2F54B 1C08A 3DX8A 2AV7B 1VFBB 1EXUA 1BVLB 2DQJH 2JB6B 4QKXB 1DLFH 1XF5A 2GJ6E 5FXCH 4XHJD 1M7IB 1N64L 3C87A 5HY9B 5I1AB 2BNQE 2C4XA 3BPNB 5JIKA 1N3NA 2P5EE 3KGRA 4ORZC 2JLLA 5GJSH 3DROA 3IDXH 4O9HH 1SBSH 1I4FA 4K7FA 4DZBB 3GSOA 3S3JA 2CRZA 4GFTB 3VWKC 3GSNA 4PY7A 4GQ9L 3DTXB 5HHOE 4X0KB 3GJEA 3ISWA 1DN2A 3FT3A 5EBWA 4X98B 4FXLA 1GC1H 5JMRA 1RZKL 4FQHA 1HI6B 3BQUA 1SYVA 2NY3D 4LSTL 1U3HD 3IDJB 1FAIH 5IR1B 4FQQB 5D93C 1JV5A 3BZ4A 2R2CA 1PY4A 3BKCH 1NC2B 4OUUB 3HNSH 3JWOC 5CZVH 3D0VB 4DAGL 2YOCA 4EN3A 4Q7DA 4KVCL 2HN7B 3L5JA 3ZL4H 1JWSB 1WEJL 1BQHB 3QCUH 4U6VL 1AHWC 4OFPA 4NP4H 1QQDB 3IKCA 5ACMA 5DFWH 4L4JA 5DI8B 1LK2B 2NZ9C 4EUPA 4OV6F 4K3EH 1HOCB 3RIFF 3V8OA 1B9ZA 2XA8H 2V2TA 1J7VR 3V5KA 4JRXD 1QACA 2WIIB 3KR3L 4M7KL 1F8TL 3FCTA 4M9OA 4UT7H 4GUPA 1KELH 4R7NA 2IBGA 3WFCH 3GKZA 4F33B 5D70H 4PRPD 2JJUA 4OI7A 1AE6H 5EU4B 1M71A 2HMID 5I0DA 3KPRA 3TNNB 2GK0A 2RBLA 1UACH 5BZDB 5KN5B 3GSXA 4HG4K 1I7UA 2XYCA 4NN6C 2ORBL 5SWZE 3QNZA 1EAPA 4PGCA 1G9ML 5SV3A 4Q9RL 5GHWL 2WWMD 1KEGH 3IKKA 3CPLA 4PJAF 4PV9A 5EOCJ 3G5XA 3C5SA 3ZYIA 2BVQB 1PZ5B 2EH8L 2IFFH 4JPIB 4WO4C 2BHYA 3VD7A 4E41E 3LPGA 5E99H 3MNWB 1S7RA 3GBNL 1D5BB 4ZUWB 4MB3A 3HHRB 2X4NB 3RKDC 3D39B 4U6XA 4Z5RB 1CD0A 5HYJD 1UGNA 2Q7NA 1MELA 4M00A 3ARGB 3BFOA 3SO3C 4DZ8B 5LKNA 4Z7QE 2H3NA 2J8UA 3JWDC 2FHCA 1G7HB 2DTSA 4EZMA 2A74B 4P5MB 4QCIA 3ZTJH 3W39B 4N9OB 2Z8SA 2GI7A 1E0OB 1NAML 2VDKH 3L3DA 3MLRL 1TZIA 4GH7B 1LO4L 3GJFH 4A6YH 3BPOB 3E3QC 4RAUB 4NPYB 3EJZD 1MWAB 4ENEC 4WCYH 3KPNA 4H88H 2R0WL 1YY9C 1OT1A 1RZJC 1WICA 4RISH 3TBYA 1IGFH 5AUMB 1JF5A 5DT1H 5CD3B 3SDDC 3FQNA 4P3DA 4KPHH 4DVBB 5L2KB 2CRIA 5DQDL 3F12B 4AEHL 1GGYA 1AP2B 2UV3A 3LAFA 5DFTA 1L0XA 5ESVB 5F96H 3STLA 1H5BA 2R2BB 3D85A 5CJBA 5HYQB 5I30L 2VL5B 3U6RB 4HIJB 1QNZL 1BFSA 4DGYL 5A1AA 4CJ1A 2CO6B 4XZUB 4YBLC 1Q9KA 4NO5A 3S3SA 4L3ED 3JTSA 4Z7OF 1MREL 3UEZA 4MXQD 3G5VA 1R3HB 5GISL 3VFVA 1ZHKA 2BZDA 2ZCHL 3I6KB 3QEHB 1S78D 3WE6B 2XTJD 5I1CL 2E9JA 3DVFA 5TE6H 2C7UA 5F6HI 4I3SL 1KJ2A 2A1WL 4M4PA 2E7LA 5KJRH 4ZS6D 3ME0A 2DIBA 3I85A 1YMMA 1FBIH 1FYTB 5KVFL 1FL5B 1P5VA 2NXYB 1CFQB 1NC4B 3SCMC 2Q3AA 1DE4A 3SKNA 1KPVB 3SJVB 1Q0XL 2PTTB 4YZFE 1T7WA 2VOTA 1OW0C 4GBXC 1HXMA 4JM2C 3UTSE 4C4KO 3ILPA 1U8NA 4M5ZH 1KXQE 3WLWC 3T09A 2W91A 3WFBL 2M1KA 2A6KA 3QNYA 5ADOH 5D5ME 3E6HA 4LLDA 1EJOL 4KMTH 1MFCH 4QT5B 1K8IA 2AI0L 3PDDA 2WAHA 4WI6A 3MRPB 1ND0B 4LMQE 4P9HL 1P9MA 5E9DA 1RSFA 1FG9C 2VXSH 4TVPE 1N5AB 1HIML 4GSDL 3KPLB 5HGAA 3MCLL 4GG6A 3T65B 5A2LH 4PJBF 2OCFD 3QPQD 4YDKH 2DOCA 5FGCB 1SY6A 3VXNB 3TF7C 1MFBH 4M5YH 4HEPG 3BMVA 1INQB 3EDFA 2IQ9H 5E6IA 1ETZA 4MCZB 4K2UH 4N5UA 5I8CA 4Z8FH 3ALXA 3WFEH 3CNKA 3PHSA 5INDA 1NLBL 4JO2L 4NOBA 1JGDB 5F6IC 3W9DA 2EH7L 5AD0B 2NY2C 4U1IB 1AO7A 4ORGB 3SDCC 1DFBH 4WJ5A 2AAVA 1RJCA 1TCRA 3NCFB 1KLUB 3ILQD 3QIWA 4C4KT 1U8LB 3C5JA 3RWHB 5F7UA 4NWUL 5DHYA 4JHBA 3JV6A 1DEDA 1SMAA 3KDMA 3OMZA 1Q72H 3HR5A 2VSCA 4JFQA 5I18H 1NCDL 1IKFH 3NACL 4PJAB 2Z8VC 1IC5L 4PRHD 3EYOB 1KV3A 3O0RL 3TFKD 4UIKH 5E2WH 1MI5E 2R2HB 2D7PA 2FWOA 1PYWB 2H2PC 2NR6C 5CP3H 5D2NB 3EOAB 5SX5K 1SBBA 3MUHL 4YGVB 5H35B 3HG1D 2WLYA 4AMKH 1L0QA 2R23A 3ZYOA 3ELAT 4NQDB 4YDIH 3ARDD 1RJZB 1KB9J 2IH3B 5C0FA 3U30C 3C5ZB 1PZUB 1N6UA 3V0AC 3AUVA 1XR8A 4JB9L