1K8IA

Crystal structure of mouse h2-dm
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
181
structure length
181
Chain Sequence
QNHTFRHTLFCQDGIPNIGLSETYDEDELFSFDFSQNTRVPRLPDFAEWAQGQGDASAIAFDKSFCEMLMREVSPKLEGQIPVSRGLPVAEVFTLKPLEFGKPNTLVCFISNLFPPTLTVNWQLHSAPVEGASPTSISAVDGLTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mouse H2-M.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords MHC class II H2-M alpha chain
total genus 35
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k8iA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1k8iA01
3H3BC 1JGVH 3BWUC 2WUBH 1TLKA 2OR8A 1L7IH 4C4KT 4PJFF 1PGRB 1HXMB 1OY3B 3PWPD 3LQZA 3EOTH 1NBZA 5D1ZA 3IT8D 4WTXA 5E2VL 3MV9E 4G43A 4V2BA 5E95B 1NUNB 2AKRA 4HS6A 4HIXL 4MSWA 4NWUH 5HYFA 5D2NE 1IGTA 1LDSA 5IJVA 2X4RA 4FS0A 3AMLA 3FQXB 3L3HB 2VKWA 2VLLA 4YHYB 3N0PB 3OQ3B 5EN2A 4NO2A 3QUMA 2F5AL 5CD5C 1FH5L 5KVFH 1F4YH 3O2WH 2VL5B 2YD1A 2WUBL 4G6AD 3MCLH 1NAMB 4CW1B 5L2KA 1FL3A 1BOGB 1NGXB 5SX5H 1DEEA 1FRGL 2CRIA 5E7BA 1J0IA 4A6YA 3IVKB 1JNHB 3GMMB 4M4PA 1JJUA 2VDLH 3HE7B 2L0DA 1AQDA 3KXFB 3Q6GH 3GHBL 1A2YA 5TF0A 3QPQC 3LEYH 3AREA 4D9LL 1W8NA 1MCBA 3EJYC 3EOBB 4LLWA 5C9JB 3D9AL 5A16B 3BQUB 4JGUA 2IQAB 2VNCA 2X9XA 2B0SL 4M7ZC 5DK3A 1INDH 3VI3F 4YK4B 1XGYL 1YMME 3K0WA 5CSZB 1J0ZA 5T5FH 4PRPA 2GUOA 5AZ2L 1TJGL 2YSSB 4F2MA 4OKVA 3UTOA 4N0FB 5HGAA 4W6WB 3HC3L 5F6IC 2VDNH 1IE5A 4FNLH 2MNUA 1J10A 5GISL 1UWEL 2EYSA 2YRLA 3CC5A 2CPCA 3QEHA 4KHXL 5BZWA 2WWMC 1DN0A 4IMKC 4AMKH 1K6QL 2ADFL 3KYMA 4E42A 1BQSA 5L2KD 1MFBL 2BC4A 4PJXB 4KKCC 4U6VL 2M1KA 3OKLA 2CXKA 4X7EC 2X1OA 3IDGA 2O61A 2H1PH 3S37H 2ITCA 3EUUA 4R7NA 3HLAB 5BRZE 1FZJA 4M6OL 4U1SB 5C0ND 1KJMB 3BSZH 3PQYE 1P7QD 3GMNA 4LVEA 5I76B 4LNRA 2X6MA 3GB7B 2MPAL 3ILPA 2X4PA 5CP3H 1IFHH 1PG7L 4N5EC 3QXDA 2R4SH 4PJBF 2QQKH 5E6ID 3GJFB 1KACB 4Z7UE 3NCFB 2G2RA 1IEAA 3WUWA 3PWLA 4M62L 2R29H 4BSJA 5DJXA 1SJEB 2HFEA 3PWPA 4JDVA 4PY7A 2X4TB 1U3YA 5CINH 3MV7B 1IC7L 5SWQB 1KCRL 2FX8L 3ULVE 1U6AL 1LD9A 1S7VA 1YNKL 3L7EB 3D85B 4PPTA 5DR5H 3LEXA 5KVFL 4L8CA 3KLAA 4NN6B 4M7KH 3NFSL 5KANI 2C1OB 3OV6A 4NNXB 3IXTA 3MMEA 3QPXL 5C6WH 2XQBL 2FL5B 4TUKH 4PREA 2W9EH 1RUPH 5LJYH 5ISZA 5IHUL 4ODHH 1QEWB 4JB9L 4XVTH 4NM4L 3TPKA 1MIML 4PV8B 3R1GH 2DQHH 2ESVA 4GUPA 1NFDB 4G6KL 4Z7UA 2NTFA 3KYMB 4E42B 5T1LB 3DUUA 4HIJA 1IBGL 4HGKC 1CGXA 3EOTL 4MJIA 4NCC1 4TNVK 3MBEA 5D71L 1BVKB 1W0WA 4R9HA 3QB7C 1FNGB 4YBLC 3VWKD 5K59F 3H2WA 3PABB 4PJFA 4YDIL 4GG6A 4POZD 4QHUA 1TVBA 3MV9A 4PJ5B 4XB7A 3WEXB 2R0KL 4GAGH 3WN5B 1QO3A 4JO2L 4U6YB 3KGRA 4I77L 3BH8A 4WIQA 4PG9A 5TH2B 5HXMA 3QCTH 1VDGA 1A1MA 1LO0L 4F58H 1HSBB 3CVHH 5FFLA 3O6LL 2P47B 5E08L 3HB3C 1WIUA 1NCUA 2NY0D 1IQWH 4Q9RH 2MKLC 3FMGH 1JVKA 4JANA 1U3ZA 3C08L 5KSBB 1GJIA 2NY2C 2FJGA 1ZEAH 5CS7A 4J8RA 3BO8A 4YH6A 4LCCC 4TRPH 4FRWA 4ZS7H 1QBMH 4JO1H 4PGBA 1RIUH 3ALWA 2F54B 1EUTA 3BKCH 4KI5D 3U36A 4CL7A 4ZODA 2R1XB 1NJ9A 3H42H 1G9NH 4GKZA 3NZHL 3KDMB 4FFWD 4XMKL 3IGAA 4C57C 3LKNA 4JFYA 5IFAH 2BRRL 3UJJL 2SEBB 4CN6A 1DTUA 1GVIA 2VQ1B 4P9HH 3RGVA 4D9RD 2BK8A 5FUCE 2XWTA 4IMLA 4ETQB 1KF9B 4DN3H 1SMAA 4M4RA 1OGTB 2AEIT 3CDGB 5GISH 5ILTL 4EI6A 4D0BA 4XWOC 4M02A 4G8GB 2QQLL 4AM0B 3C09B 5DTFA 4M7JL 1VKXA 4P9HC 3UYRH 3ULVL 4YLQT 2JE8A 3GSOB 2VN7A 1WSST 3ZDYF 3AS2A 1MJ8H 4X7TA 3U9UA 4NZDA 4JRYD 3IS0X 5HI4C 2VR9A 4NNYB 1AGCA 5KVEH 2AQ3A 2ENSA 3LKRA 5C2UB 1GGBL 5IB2A 4P48A 4M7LH 2W9DL 4GAYA 5D5ME 2D0HA 4G3YL 1I85C 5E1AA 4PJHE 1HSAB 2VLKE 5IESL 2G75A 4TVPH 3BIAX 1VFMA 1CIUA 1QFWH 4NN6C 2XT1B 1QKZH 5ESVA 3W39B 3LH2L 3SEPA 3EIFA 2P48B 4OM1H 3O3AA 2OQJB 1X7QA 1NDMB 2YXFA 1EK3A 2OXGA 1C7TA 2AABL 5BW7C 5DURD 4K3GA 2HG5B 1AXTL 3MGTA 4OIAA 4LIQE 4WUUB 1G7IB 4U4BA 1R0AL 1RSFA 1EV2E 4HBQA 4WFHE 3EYOB 1MIEL 3VXNB 3QDJE 1AFVL 3U0WL 3KPRA 2RR3A 1QHPA 4RQQB 1FGVL 4NRYA 3MRDA 4I0PA 4OD1H 4AT6B 1NGZB 5KSAC 5MEND 3BPLB 3GSNL 4TPRH 4OCXL 3QI9D 5GSVA 5E24E 4U6XB 5EZJB 2EIZA 2G60H 3MGOB 1SYSA 2R0WL 4J4PD 5HHME 2C1OA 1FYTA 1C12A 4R8WL 1NLBL 1RD6A 2K1MA 1KB9J 5D7IA 3VRIB 1XH3B 2BSED 2CO7B 1TQBB 3ARDB 4JPVH 1XGRB 2V7NB 4QHMB 1CIDA 1TETH 3QJHA 4AIXA 43C9B 4P5TC 3SQOH 3TIDB 1R0AH 5JOFB 1JYNA 4L8BB 2EEBA 3MRPB 1MH5A 3DVNA 3KYKH 5E5MA 1EJ6A 3WUWB 1NDGB 1UB6B 3HZYB 2HLFC 4OUUB 4RA3A 1JPSL 4NCC2 5L7XL 3MLYL 5T3XE 3ZHLA 4KJQD 5F7DA 2A1WL 3TFKD 1YA5A 4CMMB 3HHRB 4RAVA 5EZLA 4PJEA 5FDYA 1FO0H 3RZWA 3F6IA 1BIHA 15C8L 5DRZA 1G7LA 2GJZB 4LSRL 4U1IA 2Z8RA 4G3YH 4U1SA 3ULUH 3QIUB 3DUSA 3DSFH 1FPTL 4NDMA 3IB4A 2EDHA 5L8JB 4NKDA 4TSCH 1SBSL 2IH3B 1IGYB 5TGBA 1UG9A 2FDBP 1W0VB 1CGVA 3H3PH 1G9MH 2NW2A 3O8XB 4I9WD 1A7OH 1DFBH 4EJ1C 5EZIL 3UYOD 1CFBA 1II4E 5BZWB 3IDIA 1KCVH 1KN4H 4LHUG 1Q8MA 4ZAKC 1CFTA 5L7XH 2CDFA 4XVUC 2B8OT 4L3EE 1N0LA 2YK1H 4GS7C 3GO1L 2E7BA 1GOGA 3P4NB 3SDDD 4KKNA 2NR6D 3IJYB 4Z95H 3PQYB 3GMLA 2O5ZH 3QFJE 2WBJB 2XQYK 3KPPB 5DJAA 1IQDB 3SKJL 3MBXH 1C16A 1CDCA 2ZCHL 4D9RE 2HWZL 3LB6C 5CJ5A 5D93B 1IGIH 3BT2L 1LVEA 1HHIB 4Y4FC 1Q9LB 4M3KB 2CR6A 2EYTA 3WFCH 1KJ2L 1U91A 5CUSL 4R0LA 4ERSH 2DWDB 3BKYH 1EX0A 2A77L 4OF0A 1T89C 2EH7L 3B5TA 3B5HA 3T0EB 4F7EB 2DOCA 4UV7H 5IMOB 2ZOKA 5AUMA 3OSKA 3PGFL 2DQGL 1KTRL 1Z9MA 1D5ZB 4R90L 3V2AR 2R2BB 1Z9SA 5GZOC 3UTPE 4MJ5A 1XR8B 3U4AA 1CE6A 3A6BL 4FQXB 3MX0A 5E03A 3KPQA 4N0UA 2GT9B 2NXZB 1EH9A 1IT9H 1R3HB 3CFEB 1LP9B 5CAYB 1MUJA 4U0RC 1D5MA 1MFAL 1U8QA 4LDLB 5IQ9B 4ZOAA 4OM1L 5F9WC 2UY6A 2EYRA 2O5XH 4YQXL 3PGDB 4R96B 4XHQA 4JFDB 5BQ7A 2W65B 5ID0B 4TTGA 1VSCA 2X4NA 3VE0A 1OSZB 1IAOB 4KAQL 3QPQD 2LTQB 5EBMA 3IJSB 4MVBC 1GZQB 4KI1A 3MRMB 4M8QB 2VXVL 3AXLA 4G42A 4IOSD 3FB8A 5B39A 5IJKC 3MODL 2ICEB 3MV8B 3ULUF 2VZOA 3VXQB 1NCAH 2HJKB 4FXKA 5EPMA 4GMSL 2HMID 4QXGL 1CG9B 4G8FA 3GSNH 1JFQL 1YNLH 4JRXA 2YA1A 1MCWM 5EWIH 4LASL 2OJZL 1OB1A 2V2TA 1FN4B 2P49B 4WHYH 4P2YA 4YHOH 3V5KB 1BFVH 2A6IB 3BPNB 3EYUH 2NY1D 1VB9A 1ZWIA 2HFTA 2HT3C 4LKXB 4WI9A 2NY4B 1BZ9B 3C60B 4PP2A 3RUGA 2ZCHH 4YUEL 1NL0L 4ODVH 3OF6D 4QRPE 4AL8H 5JTWA 1CFNB 4DGYH 3GI9L 3HPJA 1Q1JH 2FBJH 25C8L 1Z3GL 3VXSA 4JPKH 2JCCA 4UINH 1E4WH 2Q76A 4OB5L 2KQNA 4OJFL 5T3XD 4XXDA 2BSSA 2VDMH 1K2DB 3LKQB 4NKDB 1P5VA 3L95A 1XZ0B 3BVNB 4KI5F 3SY0B 4FN0A 4R96A 4Y19B 5GGSY 3ARFB 1IAIM 1U8HB 1S5IL 3D0LB 4GRWF 2X2YA 3QDGB 1G9ML 2P8MB 1IQWL 4MD0A 1T0MB 1O5DT 5DRZB 4FTVD 1U93A 2BP3A 1T04A 1E4KA 3TBVA 3O0RH 3HZMA 3ORJA 5B8CC 4XP5L 4JO2H 2RBLA 4MDIA 3IAGC 3T0BA 1FBIL 4MA7L 1XAUA 2V2XA 2HJKA 3BDYH 1YEDA 4LCIL 3U30C 5E5MB 4QHLA 5I19H 5T3XH 1RK1B 3Q5TA 3O41B 3QFDB 4RDQF 4HUXB 4D0DB 1QOKA 1H0DA 4P5KA 3MRRA 5MERA 5E2TL 1L0XA 1J8HD 2BRRH 4BQ6A 1J0JA 3L3JB 4RFOH 3FT2B 4JFEB 3MRNB 3VG0L 4M93B 3WKNA 4W6XB 2P7TB 2DDQL 5D1XD 3RGVD 2E9WA 2W65A 1NGPL 2BVPB 3K4ZA 4RCAA 4CN4A 1Z2KA 3JVGA 5C92A 4NYLA 3M07A 3LS5L 1YUHB 3W82A 5EBGA 1I9IL 4NKOB 4X6CB 2FLRT 2XFXA 2CLRB 1XGTB 3EDJA 3P4OA 2NMSA 1F4AA 3V9FA 3I02A 3CFJA 3BKYL 4FHBD 1PEZA 3MLVH 4UZGA 1JZ3A 5IMOA 5I30H 1G7HA 4OAWB 4CVUA 5KS9B 2NX5D 1F02I 5DJCA 4N90E 3MLRL 3MLZH 2BNRB 4WFHD 5KAQF 4PRNA 1YEIL 3VFPA 3BRGC 2PW1B 4AENB 2XACC 4PJ9C 1EUUA 2Y6SD 2VLRB 2Z4QB 5GS0D 4J3UA 1HWHB 2V9QA 4XMPL 1E27A 4YXKL 4LLDA 3WO3B 3RHWF 4PR5B 1B0RB 5HY9B 3BUYB 1U92B 5DDHA 5DUML 2GK0B 4NSKB 4H20H 4H25B 5J1AA 3QIUA 1T2QH 5HGBA 4BFGA 2GJZA 3UPAA 5DJAB 4BZ1H 3MTRA 2ICES 3GSNA 3EJZD 1A6TB 4ZNEA 4QLRA 5EORL 3U9PL 4ELMA 2LU4A 1S78C 2H1PL 1J5OL 1KJVB 3DTXB 5DXWA 1WK0A 3Q5OA 1C5DB 5FCUL 5FKAA 2N7BA 1RZFH 2EE9A 2K7QA 3O3UN 4L4VD 5FM8A 2B1HL 3UTSA 4P2CG 5E00A 2X9WA 5F88B 5ALCH 4IDLA 2NPLX 5EU3A 2K3TA 3LD8B 5F9WB 1PX3A 3BGMB 2YPKA 1B90A 3BUYA 2FX8H 4XWGL 4HIIB 3U48A 3NACH 5C08B 3DXAD 2VISB 5FAAA 1A3RH 4P57A 1QBLL 5A2KH 3D48R 4PRDB 3VXME 5EC2B 4PRAB 1Q38A 4OCWH 1IAKB 2DIBA 4I3GA 3RWGB 3ZE0E 4NRYB 5JHDB 1RULH 1LO3L 5HDOA 3DROB 2J3SA 3MBED 5JW5B 2QHRH 4M1GH 2IALB 4DJMA 1QLFB 4QRPD 4G5ZH 5H8DA 5GS1A 5J6GA 4WY7H 3PDOA 3S37X 5CJXC 5EA0H 1VPOL 3SGEI 3WUWG 4HIEB 4PJDA 5GRUH 4O00A 2VL4A 2FWOA 3E3QE 1RV6X 5DZNA 5B22A 1UC6A 5TQ0H 5JHLH 3ARDD 1OPGL 5T3ZE 1YDPB 4XP5H 4RGNE 5GSRB 3MNWA 3TCLB 5ITBL 3MR9B 4R97B 4RFEA 2IQ9L 1FPTH 3U0TB 1HSBA 4YWGL 4JFDD 1BWMA 2IBZY 4IOFD 2E3VA 3WNLA 1P1ZB 3DXAA 3FQTA 3THMH 1DUYB 4DEPB 3CDFA 1A6ZA 1GGUA 3O2DH 3U6RA 1SVCP 4AT6A 5DD1H 4NQCD 3RDTA 2P44B 3ZSTA 4HPOL 4P2RE 3NPZB 5DRWA 4ELME 1FYHB 1X9QA 1KJ2B 3UTTE 4RZCB 3QWOA 4U1MA 1X5FA 5D5MA 4XCCH 2DJ4A 4U0QB 1XGQA 1CICA 5J89A 3NCBB 2NX5B 1JI1A 1X4ZA 3VFWB 3QRGH 1F11B 1VFOA 2DLHA 4XCNB 3MRFB 3EYVB 1T1WB 3AY4C 1J8HE 4GO6B 4ZO7A 4EI6B 4AEFA 1IAKA 2FL5A 5EC2A 2PW2A 1S7RA 5HJ3B 3NIDE 4HSQA 4MXQC 4YC2C 2B1AL 1NGYB 5ICZA 2EDXA 4L8CB 3G5ZB 4KJQC 1KLGA 2C26A 3ARZA 3WNMA 3MLVL 3LKRB 5FA4A 1U8NA 3KDMA 3SDCC 3OX8A 4PJ7B 1MREH 1FC2D 1KEGL 1M4KA 1ZHBA 1BHGA 1N5YL 3U9UB 3H9SB 4FXLA 4NP4H 1EDQA 3ROLA 1GHFL 3LS5H 4AEHH 1PBYA 1ZLVH 4FOMA 2GEEA 3C2SA 2E27L 1HYSC 1K4CA 3DV4B 1WWWX 4ZQKA 5F1NA 3MFFB 5IBLD 3EDDA 4WEUD 5FYLL 3QWRA 4I77H 5EA0L 1IAIL 1JNLH 1PQZB 4HFWA 3ARBC 3INUL 3UZVB 4IMLB 3D69A 4EN3D 4H25A 5J1AB 1XGPA 5JOPE 4NBYB 1R3KA 2EIDA 2A2QT 4KVCL 4XNXL 5E2WL 3LN5A 4UOW1 3S36X 5D6DA 4DGVL 1G9MC 1CD0A 1BF2A 5H37H 2X4SB 5IW6B 1E6OH 4IRZL 1BPVA 3QSKB 4RMTA 2Z4QA 3TNNB 5DQ9B 5C09D 5FO8B 3ULSA 4YC2B 4JR9H 1QSFD 5FV1L 1W0WB 3UTQA 3EFFB 2HLAB 3ULUC 1LE5B 4MXWH 3A0OA 2BSTA 3DOSA 3M8OL 3X3FL 4PG2A 1S9YB 1XR9B 1G9NC 3VFSA 2OCFD 2EC9U 1INEL 1OAXH 3QUKB 3D0VA 4ENED 1S8DB 1I1FB 1D5MB 1FFRA 2P24B 4JG1H 4ZFGH 2YSSA 1JYVA 5MI0B 3MRLA 5CEYB 2BY2A 1D5XB 3U6RB 5I16B 3VGDA 1FZKA 1GIGH 5D7SL 5A16A 1F6AB 1D5ZA 2KZ1B 3TGXA 1SEQL 1MCQA 4U6YA 4AL8L 3U7WL 1JPSH 3A6OA 4OCNC 1Y6KR 2XZCL 2Z31A 5JMOC 2CJUH 1KIPB 3RNQB 2J1KA 4XMKH 5DRNA 4QOKE 3HE6B 1IC5L 4L29B 2FWOB 3I75A 3ARGA 3R1GL 2ZCLL 5DMJB 2OXHA 3SCMC 3VFOB 4JKWA 1T7YA 4WDIB 3QT2A 4YGVA 1RK1A 5KS9A 5J6GB 1PSKH 1G7HB 4S1QL 3MROA 3MJ9H 3OKKA 3MLSL 1FNSL 4Z7UB 1QSEB 4NO2B 3BAEH 3JZ7A 4LFHD 5LGJB 1RAMA 3VWKA 3FFDB 2ADJA 4PREB 1FFPB 3C87A 2XYCA 2EKSA 1NLDH 5C0FB 3AGVA 3NA9H 1CLZL 4BUHA 1JMZA 5EU7C 4NYLB 5FEBA 1S5HB 2YPVL 1HKLH 4FTVA 5HVGB 5DUPH 1FZJB 1P7KA 1HCFX 3SOBL 1I1AD 2GY7B 4JFDE 1S7TA 3QUXA 2WIMA 3VWKC 3S5LB 1CTOA 3MRNA 5ANME 1CWVA 1NCWL 1P4IH 4K94H 1T1YB 3EFFA 4HHAA 1MHEB 1ZANL 4IJ3B 4IOIA 3M1BA 2FH6A 2J6EH 2V5MA 5HYSB 4N8CL 1KN2L 3UTSE 1E4XH 3U4EA 2HJLA 2GITB 5KSVA 3T8XB 1C5DA 5FKAB 1K4DB 1U9KA 4ZUVA 4PJIA 4MDIB 1IKNC 4O2EA 3VU2A 1E4JA 3GJFA 1A8JH 5E99L 3BW9A 5IHUH 4LKXA 2X4PB 3MA7B 3MA9L 2J7LA 3T08A 4MJ6B 2N7AA 3TLRA 2J8OA 2NXZD 3WS3A 5I8KH 4GQ9L 1CU4L 3JTTA 4IJ3C 5ESQA 3WN5C 1YEFH 3LN4A 1L9NA 4X5WA 4X4XA 2VO5A 1SEBB 3MLUH 3UTZB 3SKMA 5E6IA 2YD8A 3QI9A 4I1NB 4NRXA 4XBEL 2H41A 5JXAL 3ILQC 2CMRL 4JCMA 5J3HD 5JZ7D 3T0XA 4K8RL 4PJBE 2R2CA 2P43B 4G8IA 5HYSA 2LAGB 4GKOA 4MZ3A 2PXYB 5JOFA 4ONHA 2ZZUT 1JGEA 3GMMA 1N6QH 3OX8B 5BCAA 2XTLA 3UYRL 3ULVH 5A3ID 1S7UB 5C0AA 1ZVSA 3K3QA 5JIKA 1I9IH 2WLZA 3T3PF 4NWTL 2AEQH 4EVNA 5T3ZD 2VAAA 4ZNCD 4QRRE 1AO7B 5INDB 3NCYP 1LK3H 3FQXA 3RAJH 4JQIH 5K9JL 3E1F1 1RZKC 5IFJB 2XFXB 2UZIL 3QQ9D 5BQ7B 4WFGD 4MAUL 2IFFL 4FG6D 1WFUA 3Q1SL 4PTUA 3U82B 3OB0K 1KN4L 3ZE2F 4DVBB 1P4BH 1OPGH 5ADOL 4IS6A 4GRLC 5HI5C 2IANB 4JDZA 3ZDYE 1NFKA 1GOFA 3C5ZA 1JZ8A 5D7IF 4G8FB 4GH7B 2EZ0C 1OGAB 4X0KB 4ZUWB 1P4BL 4JVPA 4RZCA 2MOVA 3U30B 1HXMA 3UTTD 3CNKA 4TUOB 4CNIA 5IROC 3PHQB 3TWCH 5MI0C 1EFQA 4Y8AA 3SCMB 12E8H 2NY6B 1DUYA 2VH5L 1BGXH 3GMQA 4TVSa 4W4NA 5FHBL 4FFZH 4JRYE 5BZDB 5HI3C 4YX2L 1I8MA 3WFHA 4X9BA 3MNWB 3ZYZA 4DAGL 2VXVH 2DQCL 5ID0A 5DJDA 5D2LA 2P8LA 2OL3H 5IQ9A 4LOUD 1YEKL 1ZA3B 2XRAH 3LKOB 2CK2A 1IC4L 4NNYA 5IW1A 4O58H 4ONGH 4JJ5A 3PJSA 2EZ0D 3FOMB 4WW2B 3DBXA 1ND0A 1A6AB 3NCEB 1HILB 3DO7A 4LVNB 4RMVA 5IHLB 4UDTB 1TETL 4J7RA 2VOTA 4QOKD 2OL3A 2WWMD 4YXLH 2JCCB 5F6IB 4ZXBC 1YPZF 3UEZA 4YHKL 4CBPA 2PYEA 3IDJA 4NZRL 4UIMA 3BESR 2DIJA 3QQ3A 1R3JB 3GNML 4JO1L 4RBPK 1OD9A 1MFCH 4Y5VB 2O5YH 3C60A 4YO0B 5GGVY 1T66C 1WCQA 4LCUA 5D7KE 4RGOH 2A77H 3QI9B 4NRXB 4NHUA 3SKMB 5M94B 3OXRB 2X89A 2GJ6B 1QLEL 1ERNA 2WMPA 3R06B 4HMDA 4MVBD 1G7LB 3CLEH 1YN6B 3NIFF 4CJ0A 1CR9L 5DFVD 1HQ4A 1MCNA 1YPZE 4Z7QF 5GS0C 1EERB 1J0YA 4QOKA 3ILQD 4KUZL 5EIIB 3Q3GB 4MQXD 5D70L 5GIRB 3EYSH 5T3ZH 2VZUA 3T1FB 2Y72A 1K4DA 2XY1A 2I9TA 1I3UA 4K3HA 2GAZB 3UTSD 2ICEA 3SGJC 4KZDL 1ZOXA 2BDNL 5LQBL 3TV3H 5I1JH 4WU7A 4WI6A 4JQVC 1T80A 5ETUB 3PWJA 3O9WD 5EG6C 4PJHA 43C9A 1UCTA 3LPFA 3MJ9L 1QFHA 3DPBA 1EHAA 1JPTH 3KPSB 3S5LA 3TT3L 2ZOLA 1MNUL 3ZKXC 3FQNB 4HJGB 4WEBH 2A83A 1DBMH 3MGOA 1AXSB 3AFLA 3V52H 3L3GA 3MUJA 3VG0H 1JHLH 3JV4A 1F2QA 1CE6B 3HI1B 2ENYA 1ZHNA 3LIZH 5BVPL 5C0JA 5C0BB 4XC1L 1CL7H 1TJIL 1ZSDB 3Q0HA 3IKKA 3O81A 3EAKA 2XRAL 1U8MA 3MO1B 4XC3H 3G9VA 3I6LE 5J4MA 2FYYB 2G9HA 4ONOA 5CP3A 4GJTB 4EI5B 3NTCL 3IXTB 2LE9A 5I0ZA 5DRNB 1Q9OB 2FSEA 1T7XA 1OAUH 4QRRD 1GH7A 5J11B 3KLAB 2AXGA 1KB5A 4IRJC 2WBJD 3D85A 5DSCA 4Q74A 3FQUA 3ULUD 1IFHL 1ORSB 5H2BA 5HPMB 1D3CA 4HAFA 1CD1B 1MLCB 4KTYA 4B50A 2IADB 4UQ3A 4EI5A 3GZKA 4PJDB 4S2SB 3O4LD 3C5ZC 3CVHB 4OB5H 2RGSA 2DBLH 3MRDB 4I0PB 4NC2B 3ZKXB 4DOHB 3IFNL 4FQJL 1J1XH 2ZG2A 2OJEB 1A14H 3VMPA 2Q7YB 4XWGH 1MJ7L 2FB4L 3T04D 2HKHL 4WCYH 3QXDB 1BQHG 1ORQB 5L2JB 1NGWA 3HPLA 2R8SL 4JY5L 1DQJA 1L9MA 1RZ7H 4JKPL 3K46A 3RWHB 3VI3E 4BFIB 2N56A 4Y4HC 2VLKB 1RU9L 4U6HB 4MJ2A 4OBRA 1J5OH 4UT6H 4U31A 4I5BA 3TN0D 3EOYG 1V7ML 4HG4J 4JM4L 3STZB 5F21B 1U95B 4PGEB 4JGMA 2UWEE 2OJZH 3I9GL 1RUKH 3GM8A 4I4WB 4PJXA 1RHHB 2VR5A 3VJ6B 2DMCA 4G6FB 1BVLA 4YR6A 3QO1A 3MLWL 4HBCH 3V52L 4WNQB 3RKPA 5JORA 5ICXA 4CVZB 4WUUE 3B83A 3CSPA 2CMRH 3T65A 1PKQE 4GKZB 2XV6B 5DHYB 1AKJB 3FCTB 4QHKJ 4KPHH 1OQOA 4UNVA 1HHJA 2DWEB 4PB0L 5IB3A 4OKVB 4TSAH 2GTWA 1YEHL 4U1KA 3SKNA 4PRPB 1N5AA 1PAMA 1HXYA 2M2DA 4YZFE 3V0VA 2CIKA 4Z77B 5FA4B 1KLGB 4P23B 3FRPG 4GLRH 4K9EH 4PR5A 1GGIH 1G7QA 4GBXD 1OGTA 3VXPA 5D4QA 4MA8L 4WW2C 4PP1C 4C83A 3EGSB 1EJOH 5F89B 4HUVB 5DMIL 1FYTE 3QI9C 3VFMA 1A1MB 1TITA 4JFQA 3H3KA 4OZIA 2BNQB 1A22B 1MIEH 2J6EL 2PUQT 1GC1L 4FXKB 3C2AH 2D7QA 4Z7OF 3BE1L 4XT1C 3ZO0A 1BJ8A 1RU9H 5CSBA 1BECA 1KCUH 4PLOB 2EDWA 4PD4K 5CLWA 5EOQH 2IQ9H 5DUBB 3T0VA 1MAJA 1LDPL 4PGBB 1GXEA 1CDIA 3TBSB 1JWMA 1XGTA 5F8RC 4OFYD 3VXRB 2HG5A 4XBGB 2F19H 2HFFA 1OSPH 2R56L 4OZFB 3GBML 3IETB 4LCIH 4FQJH 2J4WL 5HI4D 4JFPA 2FEDD 2OBGA 1IGIL 4OLUL 4LHUD 2X70A 2BZDA 4GAJH 4QO1A 5IGXL 3VFGH 3HI6L 2EEAA 4JFEA 4GXVH 4WFGE 4Y5XB 2ITDA 3GJEA 2GCYB 3BH9A 4MCYB 1JGLH 1QO3B 2VDNL 4PJGA 5GGUA 3GUTA 5E08H 4JHWL 3TH2T 3CD4A 3QDGE 1ADQL 1UXWB 4HIEA 4EDXB 4OJFH 1B2WL 3ARBD 3DARA 1NCBL 3GEWB 3PDOB 1IGJB 1BZQK 2OI9B 4P46D 4Q2ZA 1MWAL 1VADB 5T1LA 5ACZA 3QFJB 4TYUA 3GK8L 2AGJH 1QEWA 5F8QC 3ES6A 1BOYA 1CE1L 1IQDA 4RWHA 4LIQL 5EU6B 4H88H 5EU6E 4L3EB 5DYOB 4XCYA 3LKQA 4YHPA 3ELAT 1XF4B 2ERJB 3QNYB 3WMSA 5CILH 4J12A 3TM6A 4H5SA 3QJFB 5B38B 2IG2L 4DKFL 3QUXD 1U8JB 3U4BL 4LHUA 5I75C 2ITCB 5F96H 3MBEC 2CDFB 4JZNA 2DL2A 5IVXB 3LS4L 3NCJL 3L7EA 4JDTH 1S7UA 4UQ2A 4ETYA 3OKLB 4JFFB 2NY3B 5EU5B 5I18L 2F5BH 5E8EA 3L3KA 3WV0A 1X6LA 4M7KL 1Q0YH 4JZJA 4EEEA 1JF5A 3MJ9A 4BFEA 3RDTD 1XIWB 3VCLA 2JJVA 4Y4HA 5D70H 2CUHA 2VB5A 5E6IB 3NIDF 5KSUA 2PN5A 4BSVB 5KSBA 1C1EL 1PZ5A 4N0FA 4OT1H 4U7KA 3LKPA 4WV1A 1FN4A 4ONFH 4Z8FH 1HE7A 4MQXC 3H9YA 4NO5B 5I76A 1WZLA 1DBAH 4N0UE 2XN9E 4PJAB 2COQA 5I30L 1M71A 2X1XR 4HV8A 1R24B 5GQBA 5JR1L 1QYGL 3I6KA 1OAZH 3MUZ1 2WP3O 3EJZC 3FAXA 2EDLA 5JXAH 2BOCB 4R3SB 1UYWL 5D71H 1WBZB 4NBXB 1MPAL 2H32A 4PD4J 3BAEL 3TVMB 2OK0H 3BSZL 5H37G 4OBSA 4WI4A 5GHWH 5AYUL 3MRMA 1QG3A 2VERN 3VFRA 5IF0A 3TIDA 1TNNA 5FGBC 3SDYH 4JKKA 1QTYT 5C6TH 5C0CE 1AGDA 4PJEF 3S35H 2V2WB 2YD9A 2PXYD 1CXEA 4WI2A 1EXUB 4N9OB 4AEIL 4MB4A 1OT2A 4PYHA 1QLRA 3L3DA 5EN2B 1YY8B 3HR5A 3LEVL 3R8QA 2DIAA 4BUGA 3P4OB 1QKZL 4X80L 2AEWA 1ZLSH 1PLGH 2EKSB 2R69L 4IOFC 3WXWH 2EE3A 2JJTA 1IAMA 1NGZA 1OAYL 3NIGF 4RMWA 4LHUB 4AEEA 4MJ5B 4OIIH 4G6MH 4MSWB 3HS0A 3LRGA 3DV6B 4UOJA 1FYTD 3WE6A 1YEGH 3EO9L 4NQUA 3O2VL 2X5PA 2P7TA 4M62H 1A2YB 2EXWD 1LD9B 1S7VB 1GYAA 2QLVB 4M5ZL 3L3JA 1CF8H 1ZE3C 2BCKB 5J57B 3TEUA 2OTWA 2DS4A 3THML 5HHNB 4Q2ZB 5FYJD 4A6YB 3O3AB 5ECJE 5F7UA 5L0QC 3GO1H 4CU8A 2Q86B 2FHFA 2DQDH 5D7JB 3C6LA 3IU3A 1O7VA 4R4FH 5C2BL 5IIEA 4F7PB 4OF5A 4HH9A 3MJ6A 3IAQA 2V9RA 3X3GH 4NQXB 1B4RA 4S10A 4JRXE 3KPPA 4Y19D 4KMTH 4HPYL 4NQEE 5EOCL 5CJXA 1YN7A 3BH9B 1HI6A 4OCSL 2FX9L 1ZLUH 4K07A 3V6FA 2AJVL 3U7WH 5C0GB 5I1LB 35C8H 4FQXD 4M1GL 4K7PX 4OZ4B 3OBAA 1CYGA 3HCVB 3BDYL 4I3RL 1T21A 3F5WB 3C2AL 5ID1A 3NA4A 4HT1H 1LE9A 1TJGH 5ICYA 1IGYA 3OHXA 1MJJA 1FSKB 1MCWW 1HEZB 2AERT 4M6NL 4U2ZA 4HX1A 4YK4C 3B43A 5L88L 2J6EA 3O6LH 5ALCL 1LO0H 4X6CE 4F58L 1NMAH 1LEKB 4UUJA 4OZIE 1MFDL 4HCRH 4JFQB 4K23H 1ZS8B 4V1DA 5J3HC 3Q2CA 3N1QC 3MV01 5I8EB 2Z91A 4XP6H 2FJFA 3HE7D 2R1XA 1T3FB 4R6UA 3MOBL 5JO5B 3VXUA 4TVPE 1TTUA 2V5TA 3KVQA 5D72L 1ZHKB 4KU1A 4LCWA 4O51B 3O2WL 1JF6A 5J8OA 4OGYL 1J9CT 5JLZB 1P9MA 3PP4L 4M7ZB 1NMBL 5DMKB 4U1KB 4OT1L 3I9GH 1BOGA 4YDLC 3ARDA 4DKEH 1T3FA 3AXLB 2HH0L 2W1NA 5IWLC 2VDRL 4HWBL 4TULH 5L6YH 4F33A 3SO5A 2PXYC 3QIBA 4FFZL 1WBYB 3FOLB 4POYA 3L5HA 1MCJA 1RZGA 1F90H 4ZTOL 4NM8H 2CR3A 1H15A 3GMPB 2BVTA 3BZFA 4R26H 2YHGA 3GSVB 4HW6A 2FX9H 5C9KA 3WFZA 5IUSA 1CLZH 4YDVB 3VFWA 4HPYH 5EOCH 4I5BB 1OWWA 1XF5A 4HKJA 4XI5C 4EBQL 3VMNA 4ZFFB 3RTQC 3CSYA 4P59H 1AD9A 5FGRA 3EO1A 5DT1L 4DFHA 4FQLH 4XHJD 4TSAL 4N9GB 4TOYL 2ZPKL 3T0EA 2P5WA 1A6ZB 5KVMC 2O93L 1MF2H 1MFAH 4X6FA 2AJYL 1QBAA 3CUPB 1XCTA 4M6OH 2WWKT 4I18A 4XNQA 3SGDH 4XPAH 4G9FA 2PO6B 2I9LB 5C0BE 2NYYC 4PS4H 1KPRA 2OZ4A 3S36H 2HTKD 5D1ZC 4PJDE 2DBJA 2VH5H 1ROWA 3L3OA 5E8NB 4FQXC 1RIVH 3LEVH 2HN7B 2JELL 1F58L 3QUXC 4Y1AD 3SOBH 2IALA 4Z78A 5IFAL 4QTIH 1OTUC 2FO1A 4QCIA 4LSRH 1NAMH 3DURA 1JWSB 4WEBL 3TPUB 2YN5A 4JQXA 2F19L 4UT7H 1RURH 3SDYL 2ICWB 1EFXA 1RIUL 1ZVYA 3CZJA 4KFZC 4PRDA 1AD9B 1HKFA 5IB4B 1E6OL 2H3NA 2VDQH 2YN3A 3O9WA 3WS6C 1QRKA 3SKJH 3VRJB 5IQ7L 4LLYA 5I1CH 1K85A 4M1CD 5TDNB 4NQVA 4I8DA 2YMXL 5ALBL 4HDIB 1F4XL 1VESA 4Q58C 2H9GA 4I48B 1C08B 1ZLWH 4GW5A 3SQOL 2C9AA 1Q94A 3V5HB 4ODVL 3SO3B 43CAB 4IM8A 4P4KD 1KFAL 4Y1AA 3WIHL 3VXUD 2FBOJ 4Y4FA 5SV4A 3MFGB 3DX7A 4UV4L 4Q6IA 5ESAA 1IZJA 1ES0B 2XPGA 1MFNA 4N1CA 1TVHB 2X40A 3T0EE 3TA3B 2J12B 3RJDA 5I17A 3BGFB 4BJLA 1WBZA 3DI2B 2B2XH 4LKCA 2Q8BL 2W9LA 3F58H 1UZ6E 4LCYB 1L0YA 3C60D 3QJHB 3CGTA 5C6PB 2JTDA 4G6KH 2CO6B 2MTPA 4LSPH 3QDJB 1FJ1B 4X7FC 4G8EA 2B1AH 2NY5L 4GMTL 1C08A 4X83A 3E6FB 1ZS8A 2DDQH 1VHPA 3O2DA 4N8VA 3LCYA 4GW1A 1BEYL 3LRHA 1D5BA 4XRCB 5LAXB 1JNHA 3PP4H 4MHHI 5GZOD 3PL6B 5E7FA 4X98A 1W8OA 5E56A 1FSKC 1SQ2N 2BDNH 2VL5A 3MRBB 5LQBH 5CEXB 3ME0A 5FYJE 4P2OB 4WTZG 1R5IA 3G5XA 3LZFH 4UQ2B 3EYOA 2Q8AH 1MJJB 1T1ZB 4D9QE 4EIGB 3SHSA 5BMFL 1KENL 2C7UB 2OL3B 1RVFL 2JLLA 4U6TA 2UUDK 4Y16D 3CXDH 1QA9B 4HKBA 1ZT4A 3S6CA 1HHKB 2KZWA 3ETBF 3KJ6H 1BF8A 5ISZD 5HDLA 1B6UA 3FB6B 4NKQB 2JJSC 4OLWH 2UYLB 4OM0L 3O3BB 3SKUD 3D1MC 1HI6B 5DJDB 5A2JH 4IRZH 4I18B 1SJEA 2HFEB 1X5HA 1MRFL 5IMMA 2PCPB 1KJ2H 3ZT7A 3ULVC 1I7ZA 4OZGE 4MXQD 1VACA 4KROC 1JZ5A 1X4XA 4J1UB 4WTWA 2W07A 5D6CA 1WIPA 3PWVB 1Q9KB 3TBVB 5HYIA 4LEXL 3RZCC 1OGAE 1S7SB 4MCYA 4HEPG 2UVFA 4KROB 3GJEB 4PJCB 3VGEA 4P5TB 3OKMA 4X0KA 1RULL 1N7ML 1AGFB 4WWKC 1X44A 3D39D 3NFPB 1MCIA 4Y19E 3I2CH 1NSNL 3FO1B 4IHOA 3GSVA 2C4FU 4ZTPL 2L4OA 4OLEA 2BC4B 3BZFB 3RGVB 1A3RL 2JB6A 2JCCE 3D85D 1P7QA 2H2PC 1JNJA 3GGWB 5IM7A 1JWMB 3BPLC 1T1ZA 3QUZD 5JW3L 4EVNB 5D2NC 3PDDA 1AY1L 5J1SC 3F6LA 1V3MA 4F8TA 5C8JB 5H35A 4PFEA 3VFGL 3WJLC 4PRBA 4F9LA 4I0PC 5KSAA 4MQSB 2VDLL 1HYSD 1I85A 5DD3L 3TIEB 4XNYL 2BNQA 3IU4H 1DANT 4N8VB 3C8HA 1UENA 3MYJB 4O51A 1KIQA 4P9HL 1MHCA 4OZHB 3ARPA 3SKOA 1SM3H 5GS1C 4ZSOB 1FL5B 3FN3A 4JQIL 1X4YA 1U2HA 3G6JB 4PJCA 2VZ1A 1U8OA 3CFDB 3RWIA 3HR6A 2B4CL 3MV9B 4PJ5A 3MZGB 1JP5A 3O4OC 5KSUB 5D6CB 5F7EH 4Q6IB 2FZ3B 2Z92B 4ZUVB 4XPBH 3PDGA 5ANMB 4L4JA 3O4LB 3RBGA 4R8WH 3P73B 2YPVH 4WNQA 5HVWA 1UH2A 4JO3H 5CKAA 3STLB 3CFIC 2OYPA 3N85H 2BSRA 5D1QB 3X12B 5ID1B 5AD0B 4PRIE 2ESVB 1W2KT 1A6PA 5EZOL 2OZ4L 1A7NH 5JA9A 5DD0H 4CAGA 2DQFB 2QSCL 1RJZA 5D5MF 5F1KC 1AGEA 4JQXC 4U3XA 4PJ5E 2Q3AA 4PB0H 5C07E 1D5IH 1BJ1H 5CIPB 5C07B 3U7YH 4LSSL 5D96C 1BBJA 2LU3A 1YYML 1ZTXH 1NGPH 3O3EB 1F42A 1MVUA 2OP4L 5LGHH 4X99B 1F6LL 3JVGC 2D7NA 4MJ4A 1UA6L 3EFDH 4UOW0 2ZCKH 2AJSH 1CDJA 3AS0A 3TJHD 5JXEC 3RGVC 4XVJL 2VSDA 4QRPA 2OJEA 4PY7B 4P2OD 3EW3B 4Q0XH 4MD5A 1KCSH 2Z35A 5I1EL 2IG2H 4S11A 1GIGL 4HUKB 1I7TA 4YHLL 3QWRD 3I6LD 5MEQB 5BVJB 1FVDB 4GW1B 5TE7H 4HMEA 1T6VN 4RISH 2HVJA 4B53A 4PGZA 3F58L 5J9PB 4P3DA 3GB7A 3ILPB 2HP4A 4S0TD 5FHAL 4ZO6A 4H0IA 2GCYA 1HHKA 1CFVL 1MCOL 3MOAH 4X4ME 4MAYA 1N64L 3RVVD 3PXHA 4PJXE 4QY8A 3QNZA 4M48L 2AJYH 2BY3A 3MCKA 3JWNC 1T7ZA 3GSUB 4P2OA 4JAMB 1N7MH 5F6HI 5K9JH 5MENE 2XWBB 2NQCA 1A7QL 4Y4FB 3RHWK 3VD5A 5J06A 2NZ9D 1DN0B 5I66A 1Q72H 2D7MA 2WINB 3D25A 2Z8WC 4CDHA 9CGTA 3JV4B 1T5WA 3C9NB 1MHPH 3ULSB 4KV5E 2C3HA 5DJ2B 4HJJL 1KCLA 5HYQB 2DI8A 3MLXH 3OAYK 3F12B 4G8EB 5IHBA 4XCFL 2BHUA 3KPNA 3QWQB 4PJEB 4P49A 5FYLE 4W4OA 1NAML 4P23C 3QIBB 2R69H 4U6VH 3M45A 2HT3D 2NW3B 2XZAL 1OW0A 4X6DE 5K59E 4WU7B 4RDQG 1S9WB 4OCLC 3B9KD 1IJ9A 1YEEL 3CCHA 3ZYIA 3S34L 1IEBA 4TNVF 3WHE1 3QG7L 4WUUD 1LEGB 4CUCA 4QXGH 4JPWH 2VDRH 4PLJD 5EU4B 2R23A 2ZG1A 2ADIB 2D7TH 4DKEL 5E8NA 1JZ4A 5IT2L 1NC2B 3L3OB 3QO0B 2FJFB 5DHYA 1KIRB 1UA6H 3ZSSA 3R06A 1R3IH 1CQYA 4QRQB 1TMCB 2AV7B 2I9LA 4HZLA 3P30L 4KTDH 4U6XA 1EPFA 1V7NH 1QNZL 2L7JA 3GGWA 5JR1H 5AAWA 3SGDI 4YXKH 1R3IL 4DW2H 4MNHB 4DEPC 2AV1B 4LL9A 2OX5A 4HS8L 4XCEA 3O0RL 2FD6H 5J0BA 5KTEL 3I3DA 3OPZL 5I1GH 4L3EA 5DYOA 2DJUA 1KTKE 2PYEB 5EU6A 1DP0A 2E27H 5DUPL 3OHXB 3PGCA 4BM7A 1PY9A 2Z93A 3V6BR 1RUAL 3O2DL 2Y7QA 4XCNA 2EICA 1H9VA 5D9SA 1YMHB 4HQQL 5JQ6H 1FV1B 3JV0A 5HGDA 1JYXA 4LVHC 4DKAA 2F5BL 3TT1L 2ATKB 2MHAA 4Q9QH 4D9QD 3ZT6A 1EVUA 5HVFB 1OTSD 4ORZC 3SDXE 4XTRD 3RWJA 1LO2L 1NUDA 4K3JL 3SQBA 3U1SH 1OWRM 4EZMA 2ZUTA 4TUJB 5C08D 1J05A 4E0RB 1IKFL 4M43L 5KTEH 5ADOH 2UYLA 5ELIA 1JTOA 4KY1L 4JN2A 1H3PH 1A7RL 4KQ4L 5FYJL 2H6PA 2XA3A 1OP3H 1ACYL 4ZD3L 4BQBA 4U0RB 2MCG1 5BS0D 3BP5B 2VXSL 2FNBA 1JL8A 2F54D 5F7YC 5I19L 2UV3A 3MRCB 2GIYA 3IETA 5EUOF 3VXMB 4R4BB 1WJ3A 1ACZA 4IEFB 2FIKB 1NEUA 4FA8A 3PNWA 1I4FA 3MV9D 5DTFB 4ACPA 1BREA 1VFBB 2AJUL 3HC4H 4CVXB 5JXED 2XTJE 3BJLA 3BD3A 5JDSA 3EYQC 1R5IB 2AJXL 3FRPA 4O2FA 1MCOH 4OF7A 5FYJU 1GPOH 2VXTL 5FCSH 5HHOE 5IFJA 5MEPB 4A6YL 4DQOL 3KPOB 5EFIB 1KEMH 3MXVL 3VGBA 3LY6A 5AWNH 3G5VA 3OAUH 3IS1X 1RZJL 2HAZA 1CDHA 5DZLA 4YE4L 3TVMC 4DW2L 3DX9A 5GJTL 3QDJA 2ZUUA 3P4MA 2PTUA 5KW9L 3UJTH 3GI9H 5DMYA 3P30H 1WBXA 4RGNB 4LSVL 2R23B 4IIQB 5ETUA 4MWFA 3CAFA 4JAMA 4F9LC 2HKFL 4KUCF 3T77A 5JW4Q 3GM0A 2QHRL 3MRQB 1KC5H 3TVMA 3NZHH 1WCBB 2P5WE 2NR6C 2DLGA 5F3BA 2P5ED 3M17A 3TZVB 1KJVA 4TTDC 1VGKB 1YMMD 2W9EL 1M7DA 2PR4H 1V3JA 3O8XD 4FQLL 3BH8B 4YPGB 1DVFA 4ODUA 5HYJE 1DQTA 4ZPTA 3L5XH 2VLMD 3C08H 4BSVA 3OXRA 4O2EB 5D7LE 4NHUB 3MREB 3UYPA 4ALAL 4KC3B 1K9TA 1VENA 1JBJA 4NJAH 3GFUA 2ATKA 5F9DC 2GITA 2LU7A 2VJXA 2YKLH 5IB4A 2XWJB 4ZXBB 4OI9A 4LSUH 1T7VA 1RZFL 1U8PA 3TO4B 1VFAB 1JRHI 1UEMA 2X4QA 4NWUL 1JWSA 3EYFA 3UBXA 4Q0XL 1QNZH 5I1EH 4ELKA 4FTVB 1KPUB 3WKMH 5JA8B 1QVOB 4QNPF 3CVHA 1EEZB 5FK9A 1KN2H 3MJGX 4NQXA 1J8KA 2D7TL 2P8PA 2HJFA 1V7MH 1YY8A 4HH9B 3VDCA 3VG9B 3MACL 3VFUA 5AEAA 3MV7A 3FQUB 3ESVF 4K3EH 2V2WA 2YC1A 4YXLL 4UU9A 2Q86A 3FN0L 3ARGC 4XX1E 1FAKT 2DM2A 1MFBH 1XT5A 3BZ4A 2EH7H 3F7QA 4OI8A 4UTAL 3OKDB 4UB0L 4AIZB 1V8HA 2GTZA 4QRPB 3MLTA 2DL9A 3QH3B 1LEGA 4U2YA 3PHOB 1SHMA 4PS4L 1JPFA 4N8PA 1AR1D 3S5LG 1OT1A 5HGGS 5AZ2H 2ZUWA 3QUZC 4P4KC 4X6BA 3HZMB 5FGBA 4ZUWA 1PFCA 5CFHA 2HTLC 4UIKL 5SWZB 2AJSL 3QZWA 2LVCA 1P7HL 1NH6A 3SN6N 4YDVA 2AK1H 3F12A 4ODBD 4ZFOA 3NGBB 3IDXL 4LFHG 4CU7A 4MXVF 5D1QA 4M5YH 3C9NA 4O5LL 1SMOA 3QUZA 3TIEA 1FCGA 1RZGB 3NTCH 5I74C 1XIWD 4XXDB 3W5MA 3K80A 5DUBA 3UTQB 2IPTH 5FO8A 5DK0B 3H42L 4Z6AT 4Y5YA 2CDGA 1A9BB 3SJVD 4U7SA 2NY5C 4TPRL 2WLYA 5CSZA 3FJTA 4RISL 5KSBF 3RJQB 5B38A 5BRZB 3D69B 1FG9C 4C83B 1ONQB 3UZQA 4YHPB 5F9OH 3DRQA 2HTKC 1YPZA 4G8GD 2F15A 4K7PY 5T1KB 3VXTB 4Y16C 2QSTA 2Y5TB 4U49A 1KENH 1CGSH 2NY0C 1FVDA 4BZYA 2X1PA 3IF1A 3TZVD 3WKML 1XIWA 3KG5A 4J2XA 1UQSA 2W0FA 4L5FL 4LMQE 4TVPD 2ZWLT 5L2KE 1NAMA 5L2KB 5LGHL 4EDXA 4RSVA 1AKJA 1G0YR 4NZUL 4P99A 3VI4F 4DN4H 2DAVA 3H8NA 3T65B 5EPMB 2DLTA 3OGCA 3DVGA 1JTPA 1PD6A 5F97E 4ZMAT 5ITFB 1KTLA 4U05A 4PJAE 5DFVC 1JGUH 1WFNA 4XI5D 1T1YA 4ODHL 1URLA 1A6AA 3FB6A 3DIFB 2IAMC 5JPNB 2AJZA 4NJ9L 3S88L 1FGVH 4OD1L 3EYVA 1FZMA 4U3CA 5ACMA 5EULV 4APQA 2H26B 3BUTA 3GBNL 2B2XL 1LP9A 5C7XL 5IK3B 4NO0D 1MLBA 1MFCL 3CSBA 5FM5O 5GRVK 2J88H 3S4SB 2XN9A 1MCEA 2ZJSL 4KRNA 5DVNA 4EQ2A 1P6FA 2HH0H 1VERA 5DGQA 5DI8B 4PRIB 5I75B 4ONFL 5LWYH 3RY6A 4J1UA 3PV6B 1PG7W 5DRWB 3MROB 5E4EC 4HZAA 3BMVA 4F7EA 5BMFH 1SM3L 1WFOA 1IGMH 4F3FB 4Z0BH 1VCAA 5L9DL 3K4DA 3EZ8A 1UJTA 1U8OB 3CFDA 3RA7L 4FQ2L 1M05B 2X4UB 3C5ZB 2BRQA 3CU7A 5DD3H 1G7QB 5HHPA 4FQHB 4EOWL 3ABZA 3DRTB 1IGCH 1GL4B 4DZ8B 1IILE 4GG6F 2Q87A 5B3JF 5C0RH 2V5RA 2ZCLH 1DBBL 3H7LA 1OOAA 2WSKA 3KPLA 2F54E 4JLRA 2EIBA 5C8JA 1HIMH 3IAPA 5C0IA 3D5OF 3QXAA 1ZGLA 4L4TB 4MB5A 5IMLA 2AGJL 3P2TA 4KKCD 5C0AB 2DQJH 3PL6A 5C0AE 4OTXH 4HCRA 2QSQA 2HLAA 1LE5A 3QUYD 2YEZA 3QULA 4AH2A 2R1YA 2VC2H 3UZEA 4OCYL 4P57B 3BQUD 4FG6C 5HYJD 1B0WA 3SE4A 3NFPA 2AJVH 1H3PL 3V8OA 2BVOA 2VLKA 5D7LD 4P5TA 4N5ED 1HXYB 2J8UF 3KR3H 4LLVA 4KI5E 4KK8D 4M7LT 1S78D 5FYKL 3LAFA 2IPKA 1D5IL 3SDAA 1PDKA 1N0XH 4XMLH 5F1NB 3VA2C 2NTSP 2C4FT 1OP5H 5CBEA 4JJHA 1FO0A 1RURL 4ISVA 4Y1AB 5JORB 3KS0H 2MSPA 3E6HB 2R0WH 4DCQA 5E5RB 3MOAL 5IMMB 3G9AB 4LU5L 3O6MH 3BIKB 2P5EE 4I4WA 4Z8FL 2H32H 4ZO9A 1RVFH 4HS8H 4MAYC 4GBXA 1MRCL 1YJDL 2JIXB 2F58H 5F6HJ 4FZEH 4APQD 5LCVL 4JEGB 1IM9D 3FKUS 4YEEA 5IMKB 3AU1B 1S5HA 2R1YB 2XG4A 2R4SL 3HUJA 1DQJB 1J11A 1KULA 2FYYA 3VWJB 1T83C 4CMHC 3AM8A 4BZ1L 5CHNA 4ZUSA 2HKFH 3S7GA 5LGJA 5SV3A 3LS4H 3NCJH 5DD6A 3BD4A 2NX5A 3I02B 3HZVA 1U8LA 3REWB 3QQ4A 2ZUQC 4LCCA 1ZANH 3ZL4H 1CLYL 4GG8B 2JJWA 4LK4A 4LSQL 4XP6L 2IADA 1JV5B 1PG7X 3NVQA 5EBLA 2DYPB 3C6LD 3GMRB 1MLCA 4NQSA 4M6ML 1P2CB 5D2LB 4WUKL 4HJGA 3TV3L 5I1HH 2W38A 1F4WH 5FGCE 5IVXF 1GAFH 5FGCB 1P1ZA 1AC6A 3DXAB 2VXTH 1I8MB 2GSGA 1NFDE 1HCVA 3PWUB 3EYQD 3QZWG 1ZT7A 1UACH 2UWEA 3T4AB 4C56D 4OQ1A 2P24A 1CR9H 4OZIF 2I9TB 3WDHA 2B4CH 2GSIA 1CLOL 5DI8A 3UTPD 2XXCB 3SJVE 1KSRA 4BELD 4OD2A 4GXVL 1QLFA 5HHMD 5J11C 1HQRB 3F7VB 4KK8C 3FO9A 1SJHA 1MELA 4S1DD 3T2NL 1Q94B 4M9PA 1OGAD 2FGZA 3KPMA 3IRPX 4FP8H 4UT9L 4OLUH 4MLSA 1B9ZA 1JF1B 3GMPA 4YHYC 4NO0B 5JPNA 3CDGA 3DIFA 3Q6FA 3FOLA 2BSSB 3MQIA 3C8DA 1YECH 5LBSL 2Q76B 4WY7L 1K8DB 5FECB 3WSQH 4KJPC 5IG7A 4Q9QL 1FZOA 1BLNA 4GSDH 3SDAD 5E94A 5FUZH 4QHNA 1A4JB 1BQHA 2F8XC 4KHXH 4Z77A 1AHWC 1AJ7H 1UWEH 3UBXG 5E8OB 1RZKL 1OAUL 2YPLE 4WFED 4WWKD 3OAZK 4LCWE 3RUGB 3BPOC 2GTWB 3FOMA 4PV9A 3VW3H 1LHZA 2I26N 2QQNH 3JTSB 1IVLA 3AVEA 3BO8B 4DOHE 4N0CD 4ELMB 4GRLA 2X44D 4YHIA 4KAQH 2I25N 4CVZA 5KVGH 3AS3A 5E2WH 3GJFK 3CLFL 5TDPB 3G5ZA 1YN7B 2ICWI 3RA7H 4Z7OE 3A6CL 1NGYA 4G8GE 5E6ZA 3K8MA 5BRZA 1C7SA 3LQAC 5I1IH 4PJIB 4OCSH 1W72H 1X5AA 5TH2A 3RX5A 5C0EB 3VXQA 3BWAA 3PWNB 2RIKA 1VGEH 3FB5B 1YNTB 5L88H 2CK0L 1WEJH 4HC1L 5E99H 3H9HA 1J1PL 1MRFH 1T03L 1JPTL 5FKPB 4OCXH 4XBPB 2VZVA 4R4FL 4LPTA 1HDMB 5L2JA 3DBXB 4L1HA 4GRWH 4HXBL 4OZ4A 3B4NA 3RWDB 4JFDA 2FATL 4FTVE 4GUPB 3FZUC 3CFJB 1WWCA 2GQHA 2A6DB 4HG4K 2D7OA 4S0SD 4H1LG 4RGMB 5I1AB 1M7IB 2VDOL 3VMOA 4UV4H 5FA3A 1UM5H 2JJSA 3GIVA 5CD3B 2GJ6D 3NAAL 1GGIL 4F7PA 5CCKH 2BVPA 5E2UH 3I84A 1ZXQA 4HWZA 4YGVB 1ZV5A 4Y2OA 2X05A 3HC0B 3FT3B 2ZUQB 2DWDA 2WZPD 2H45A 3T09A 1WVZA 1R5WB 4MNGB 5GGQL 3V5DB 4HWZB 1TQBC 3MNZA 4LSTH 1F3JB 3VFUB 3WFDL 2DD8L 4P2QE 1FZKB 4D0CA 3MRHB 3JTTB 3BPCB 2E6JA 3ARFC 2WBJA 1T20B 1AR2A 4KK9D 3EOAB 4MA1B 3HR5B 3A6CH 4WVRA 5HYQA 2GJJA 5T3XL 3OJ2C 1QSZA 3FQNA 4ODWA 3FB7A 1LEIA 5D1XB 3OJVC 4P4KA 4FZEL 1FO0L 5C08A 4FNLL 4HIIA 4DN3L 2YPKB 1AGDB 3S4SG 4YDJB 3K8LA 4D2NA 4XBPA 1PYWB 4LVOB 4CU6A 4PGJA 4JHWH 2E6QA 3GIZL 5E9DE 3HCVA 2QADC 4JRYA 1T89A 4WHTA 2GAZA 1G9NL 4H0GA 4PTTB 4P46A 2BOCA 4R3SA 4JR9L 4ODWB 3MRGB 1SEBA 1JRHH 3UTZA 3I6KB 5IQ7H 3LKSA 4X6DB 4U33A 3TN0B 4X7DC 4XAKD 3QNYA 3RVXD 3EOAA 4NBZB 4ODUB 4HFWB 2BNQD 2XZQH 1BWWA 2EDFA 2RJMA 1TZHA 1OSPL 2R56H 2OTUB 2IQAA 5F7DB 5FYLD 2NLJA 4KVNH 4G80A 3NPSB 2HYMA 1F3JA 4XNZC 3X17A 1U92A 5DDHB 5ACZB 3IU3B 2Y07L 3RIAK 1QZ1A 2ZSVA 5FYJH 3DSNA 4R26L 5DA4A 4JZJB 3V95A 4AMKL 1UXWA 2VLRA 3I75B 4WI8A 4MWFB 4BZ2H 5E8OA 2B7DT 2VC2L 4HHAB 15C8H 3QUYA 4NWTH 4XTRC 1KLUA 1S9XA 2J5LC 5DQJA 1NGQH 4WENB 3O6FC 3DYMA 3O3DB 2R9HC 1HILA 3DO7B 4FFYL 4NJ9H 1JPST 1FIGH 1WIOA 4KJWD 4RWYH 5I16A 3T2OA 1FFPA 2GW5A 1FNHA 3RKDC 5IJVB 2CGRH 1JF1A 1T1WA 2NY4C 5KOVC 3TESA 1RUPL 3D3VE 4X5LA 3MODH 3RVWD 2AKRB 5AD0A 1G7PB 2Y25A 3VD4A 5CILL 1CXHA 3KPQB 3AROA 4N0UB 1Y18A 1S7WB 4NN7C 3P0YL 2DQEH 2Z0BA 3UTTA 4MNGA 1RHFA 2ID5A 2BNRE 2X41A 3FONA 2GSIB 4FMKA 5K33A 3TNNA 3RX7A 5IBUB 3MRCA 4YDKL 3RDTB 3QFDA 3RIAF 4Z0BL 4N0RA 2A9NL 4WW2F 1EEQA 5CINL 2A0LD 2DQCH 4MS8C 4PJBB 3EO0B 1I1AA 3BEVA 4PLKC 4KV5F 1EEYA 1DDHA 3O4LE 4MLIA 1R24A 1ZT1A 3H9ZA 1CDGA 3W2DL 4JDZB 5MP6L 4YXHL 5ACLA 1B6DA 2I07A 2PTVA 2WQ8A 5C08E 1V3LA 1S8DA 4MHHG 1C16B 3MFFA 4XWOD 4ZQKB 1JV5A 3HE6C 3N50A 3R4DA 5F3HA 1M7XA 1KELH 1H8SA 1KTDB 3NZ8A 2CD0A 5CUSH 5GS1B 2Y36H 3LDBC 5E8DH 1L4IA 1CICC 5FF6A 1INQB 5KW9H 3F62A 2XQYG 2AP2A 3KPSE 1Z5LA 3ARBA 5CGMA 4F7TB 3FB5A 1U8NB 3VWJA 4NC0B 3IDIB 1FNSH 1A1OA 2BNUB 3MLSH 2FR4A 2XTJD 5D1ZD 1BLNB 1NC4D 4HULB 3BEWA 3QO1B 4M5YL 3O8XA 3RQ3A 4HGMA 1EGJL 2IH3A 5TGBB 4P2QD 5C71A 2YR3A 5DO2C 4P23A 2P45B 4JHBA 5B21A 5BXFB 5MENB 3UCRA 4G9FE 3ZE2E 3VDBA 3BIKA 4HXAL 3PE9A 4UAOC 3B8YA 4BFIA 5GRZA 3AC0A 1E4XI 4JZJC 3IDNA 4KXZI 1N5AB 4E9LA 1XGQB 4RAVB 5EZLB 3WJJC 5J1TC 1CD8A 4PJ8B 3BW9B 3BDBA 3OJDA 1JGLL 3BN3B 3ROOB 1MQKH 3PF2A 4FQQA 3DTXA 1Z3GH 3B9KA 3D2UB 1GAFL 4RFNC 3NOIA 5DJ6B 4QHNB 3P0YH 5DWUH 2HJLB 1E28A 1UGNA 2EDQA 4R4ND 1CGWA 2YUVA 3BYTA 1E0OB 2J4WH 3OG4B 4Y2DB 3TYGL 4PBXA 1KCSL 3HG1B 1WZKA 1N3NB 4EXKA 2B39A 4KRPC 4XAKE 1B0RA 5HY9A 2QKIA 3MLYH 3O8XC 4MAUH 3MV7D 1P2CA 3V6ZB 3SE9H 3VFNB 3KYKL 1PY4A 4P2RB 5EBLB 2HFFB 4LVOC 1F11A 2YEZB 2AI0H 3RFZC 4MNQE 1ORQA 2D2OA 2LQRA 2M26A 3HB3D 3RVVC 3T4YB 4ZXBD 3OWEA 4FXGA 3GRWH 4C59B 3VXNA 3CH1A 2J5LB 3S3SA 1UJ3B 4I3SL 4OD3L 1A7NL 3LN9A 4LDOB 2DM3A 2DLEA 3JUYA 3JV5A 4L4VA 3L3GB 4I2XB 1A47A 2B5IB 3T1WA 1N6UA 3EHBC 1PG7H 5D6DC 2DQEL 5DMGD 1UB5B 2XY2A 5KN5A 3HMXA 1KOAA 2VDQL 3KYNA 2DQTL 4E5XB 4Y4KC 5D1QD 3RVTD 3WFDH 4DZBB 1NMAL 3FO2A 4Z7VF 3V0VB 3D3VD 4ZAKA 4NM4H 3ZDXE 5I74B 2DQIH 4LKCB 2RHEA 4NN5C 4C4KO 3E6HA 1QR4A 1TVHA 3QHZL 3RWCA 3MLWH 4RFOL 5CBEB 4H8WH 3P4NA 5JW5A 4XPFL 5T33L 1OLZA 2P5EA 4PJFE 4KJYA 1CXKA 2FCBA 4X7TB 1V3KA 3MUGA 6CGTA 5J12C 4WWID 3GSOA 4FQPA 3FFCB 2BVQB 1IC4H 2UVEA 4AQOA 1HNFA 3SJVA 3WL9B 1AXSA 1CZ8H 4YR6B 3V6ZA 3NAAH 4I48A 5IKCA 4I0PD 1DLHA 5MENA 2QQNL 4GT7A 3GRWL 5HDQL 1SVZA 1Z6JT 1T0NB 5J6HB 1INDL 4ETQA 3EBAA 3BZEB 1RFDH 3BKJL 1CXIA 1UH4A 2CUIA 3P9LB 4GXUN 3RVUD 3GSXB 3VFVB 3SJVB 4MA3A 4WRLA 1OQXA 4MDJA 1HINL 4F7TA 3BQUC 2XIDA 3LHPH 4KJYB 5CZXC 1GZPB 3B8SA 4L9LC 4PJDF 4QOKB 5I1JL 3QCUL 3RL2B 4X8JB 4MGXA 3AREC 3MUY1 4LLQB 4ZD3H 1OAQL 8CGTA 4QWWD 3CH8A 2AK4B 1AH1A 2ZUVA 4NFBA 1KBGL 4GFTB 4QHMA 4CRPA 4HAGA 1CTNA 4TNWK 1D6VH 3ZKQD 2YUXA 5D7IE 1UKTA 1Q9OA 5GJTH 3BE1H 4PJCF 2ORBL 1LO2H 3TO4C 1Q9WA 1SYSB 4OTXL 1QBML 1GC1H 3VH8B 5C0CD 3RL1A 1DE4A 2VLJB 3GBNH 5DEZA 4KKBC 4UI2A 4G42B 5IMLB 4ZSOE 3HE6D 1YNLL 5T5NF 1FFNB 2ARWA 4PJ8C 3B3IA 2A9ML 3WNPA 3UTTB 1OGAA 1RUQL 2YRPA 3PJSB 5EH1A 5C70A 2Z8SA 3WDJA 3BP4A 3HC4L 1WTGT 5IVZB 5GGQH 2V5YA 1KJ2A 2FD6L 2XKSA 5H94B 3SPVB 4Q9CA 5ADPL 4APQB 2R39A 4IRJA 4DUXA 4JPVL 2WW8A 1EIBA 1ZMYA 1NFIB 4PTUB 5DHVB 5JZ7C 2PYFA 2X89D 4Y2DD 5ISZB 1MUJB 2NY0B 3B6SB 4J4PC 5I8CA 3CDYA 3X14A 4NZUH 5BOPA 1KIUA 4O58L 2I27N 1ZT1B 3MCG1 3P0VH 1AO7A 5INDA 3V4VH 4DGYL 4L5FH 2F8OA 3BMWA 5E2UL 2XA8H 1AHWB 5C0DA 3WLWD 4GAYB 3VXSB 5T1DL 1N8ZA 4JFOB 1ZVSB 2DQHL 5IW3A 1A0QL 3FTGA 3V6OA 5D96B 5DLML 4WHYG 3QYCA 3WHXA 4XP4L 5I73C 3LSOA 2CIIA 3SGEH 3MRIA 2J8UB 5KBNC 2WBKA 4EQ3A 2E7LA 5T1MB 1A7PL 1EGJA 2QL1A 2XN9B 4UV7L 1KT2A 3I6GA 1T04B 1HQ4B 1MREL 5M95B 1KEGH 2OR9L 3BGAA 5HVHB 1QR1A 5I8EA 3U46B 1T7WA 2NY1B 2BHZA 4KKLC 2OTUA 3TH3T 1WEJL 4HC1H 2CK0H 1DSFL 2CKBB 3NCMA 2OSLA 2DKUA 4RNRA 5FYKU 2XZQL 4KH2A 4M7LL 4ELMF 1CU4H 1GC1C 5B8CB 2XKNB 3BRDA 1FGNH 3QQ3B 2SEBA 1SJVA 3GI8L 1TTGA 1HNGA 3KR3L 1SY6H 2W0LA 3FB8B 4M1DH 4BH8B 3U4EB 3RVXC 3G5XB 1BFOA 1CXFA 4OLXH 2RCSH 1G7MB 3HRZB 2APFA 3TJEL 5B3JE 5HDQH 4YGAB 1HOCB 4KK5C 4WGWB 2OS7A 5I9QB 4P9ML 4OGXL 3QIWC 1TNMA 4OZGB 5DD1L 2EDTA 1ZA3A 1J12A 1Z0NA 4JANB 3PGFH 3S35X 5J7CC 4EN3C 1R3HA 3CFEA 1UM4H 1LO4L 4YPGA 2EDBA 4MJ6A 2IANE 4LLAA 4FQXA 4LVHB 4GSDL 1LNUB 4WUKH 3DSFL 5EUOB 4M03A 3DWTA 2Y07H 4OUUA 1RK0A 1TCRA 3GSWB 3GMQB 4LBEB 3ZE0F 1JZ6A 3WEXA 1X5YA 2F8VA 1DJSA 4LQ1A 4XGZB 2HVKA 5CGYD 4LRNH 4IIQA 4KDTA 5EBMB 1WBXB 4WFFD 5GRWA 4NQTA 4XB8A 5T5NG 1KIPA 3RNQA 1ZEAL 1JRHL 4NQEA 1MEXH 2R2EA 1BD2A 2I60H 1FL6A 4P4KB 4N8CH 5SX4I 3OKYA 1TZGH 7FABH 3BZDA 3U7YL 4HGWA 5C3TA 1J18A 1AO7D 2D0GA 4LLYB 2CLRA 1D5XA 4PRHE 3MMEB 4NCDA 2E5EA 1AGBB 5FUOL 3MV7E 5IEKA 2F74B 3B2VH 4KUCD 4V1DD 1DSFH 1A3QA 1I8LA 3MNZB 3O6ML 2J88L 1KG0B 3SE4C 3DHJA 5KS9E 1KB5L 1QD0A 4M61B 4ODXB 4MNQD 4XBEH 1VFAA 2X4TA 1IM3A 4BA8A 3WHE0 3OKDA 4GQ9H 3PL6C 4X6CF 1EO5A 4QXTB 3MACH 5C6TL 3TYGH 5ESVB 3JWOL 3KJ4C 4OQTA 4OF8A 5EUOA 4NIKB 3LN4B 3GIVB 5CD3A 4EOWH 2YD2A 1EEZA 5FA3B 1T2QL 3L5WB 4LNRB 1RUKL 4Y2DC 3PQYA 3WFBL 4WV1B 3DX8A 3RWJB 5CGTA 5BJTA 5C86A 4Y19A 1RPQA 3G6AA 4PTTA 1S9YA 1XR9A 1DBAL 2O61B 5DJ8A 1A9EA 3BJ91 3JBG7 4NQDD 5KSVB 2BXYA 2H8PB 4YNYA 1HOCA 1EVTC 1U8PB 4FQIL 1N59B 2GKIA 5GRXG 1MHEA 4BH8A 3K1DA 5E6IC 2A9MH 5IROA 1Q0XL 1XF5B 1OAKL 1WT5C 4BK5A 1T22B 1XH3A 1GSMA 4XCEB 5KVDL 3ZKNC 5C7XH 4RGOL 3ET9F 2YWZA 4HXBH 1CGUA 2DBLL 3BGFC 4MMXC 3RWFB 4NHCL 5DQDH 2VQ1A 3OMZA 4QRUB 4LRNL 1T20A 2WIIA 2R1WB 4KMLB 4CMMA 3CDCA 1J7VR 2ADGB 3U4BH 5JHDE 3WCYA 1F45A 3RY6C 2E9IA 4KGLA 3TZVA 3QO0A 5HBBA 2QQQA 5KAQG 3AREB 2AVGA 4JRXB 3RGHA 5DMKA 3RZCA 1U58A 4PY8I 1UM4L 5M7QA 1X5XA 1RZJC 5EDXA 4PJGB 5GGUB 4RX4D 1YEKH 4N0CC 2YK1L 4GAFB 4RA0C 5AWNL 4NQCB 3GKWH 4M8QA 4HMCA 5D7IB 1J8HA 3WDIA 2DQDL 2NW3A 1ZA6A 5KVEL 5T5FL 4YPJA 2HA1A 2PW2B 5JUEH 3DMMA 4U1JB 4NN7B 4JZOA 3KPNB 3WD5H 2V7HA 3X14B 5C0NC 4NT6B 3B6SA 3SDDB 3PABA 5D2NA 3GMRA 5SWZD 3DVIA 4ODTH 3ZLQC 5JDSB 3VFSB 4G43B 2QQLH 3B2UC 5LKNA 2IF7A 3ULUL 4MJIE 5D5MB 5DT1H 3IKCA 3T0WA 3FRUA 1CLYH 4U1GB 3SDXA 1NFDA 1U42A 1T21B 1ZK9A 1JHKH 2G5RA 2A74B 5ISZE 4JFEE 1FP5A 4WWKA 4WFFE 4QXUH 2IFFH 3TCXA 4YEFA 3ULUE 2IPUK 2UWEB 3T4AA 3OG6B 5C0EA 1MCRA 2AV1A 3AU1A 1LK3L 3RAJL 4G7YL 3IDXH 3U0TA 1MCDA 2R0ZL 3QXWA 5GSRA 3TCLA 5CEZL 3LEXB 5TDPA 4KKBD 4XP1L 2RFXA 3WFEH 5D1XC 2GJ6E 4LASH 3OKEB 4NUJB 4PUBH 4V1DE 4FQ1L 2F53D 1I9JL 1T03H 3HZVB 1OTUD 3HUJE 2W92A 2MQ3A 1CN4A 4FZ8L 3H6JA 3BYYA 1ED3A 5EO1A 3SDAB 4AM0A 4NC1C 4UNTA 4MDJB 3PXJA 1DLFH 2DI9A 2DM7A 1AFVH 4HFUL 3REVA 1N0XL 4XMLL 3T3ME 5TQ2L 5IG7B 1RJLB 5FYKH 4KKAC 2IPUG 4X4YB 4WTZA 2BVOB 1U95A 4PGEA 2JIXA 2VABB 3Q6FB 3JV6B 1NUGA 2IAND 4JM2C 4H0HB 3WN5A 2DQFA 4LPYA 2P42B 4ORGA 1MCKA 3RY4A 3DUSB 2BVUA 3QIWB 1CDBA 4GKNB 3OGOE 4R4NC 3TF7C 2BVQA 3UJTL 5DJ0A 4DCQB 5FDWB 2MQ0A 3CX2A 3NCYS 4PJAF 4K2UH 2OTPA 1P4LB 3IFLL 3QWOB 1MRCH 2W9DH 5C0IB 4H88L 4Z7VA 1QRND 1TJHL 3D87B 4OFYA 3ARXA 4CJ1A 3UROR 3ZKSD 1TQCB 2FHBA 5GGSA 3GSNB 1JNNL 2AEPL 3QA3A 4POUB 4NGHL 2VXUL 5IHZA 3FO2B 2AQ1A 4EN3A 3RP1A 1S9VA 2OLDA 4RFEB 1MNUH 1ADQH 5HHPB 1F3RB 5CZXD 4JFZL 5KN5B 3VRIA 4P3DB 2D9QB 3TJHC 1E27B 3I85A 5EO9B 1AI1L 1QSFE 3OR6A 1M05A 4KRLB 4HIHA 5SWQA 1FNGA 4HUNB 4Y4HB 2BJML 2YMXH 1BVKA 5DZOA 4D0DA 4M1DL 4OSUL 3T2QA 2WAHA 3O41A 5DJCB 2EXYD 3S96A 3MO1A 1U8MB 1IL1B 3LMJL 1FL3B 1NGXA 2ZPKH 3IFOB 5HHOB 5H35B 1AD0A 3E3QC 4K7FB 3QXAB 1HWGB 3C6SA 3GSUA 5F93C 4FXGB 4OQTL 4Z7NF 4MMZC 3Q48A 3QNZB 1FAIL 4H1LA 4KKAD 3LDBB 3MNVA 2NY1C 4K3JH 1UT9A 3MOQA 1U93B 4F7MA 4YE4H 1DQDL 2APVA 3FQWA 1I9JH 2DQJL 3QJFA 3QDGA 4YZFF 4RNRB 3TC9A 2NNAB 3CPLA 1G84A 5J13B 1OM3L 2PO6C 1P84J 5EO0B 4DTGL 1EBPA 4JFFE 3TO2B 3FN0H 3KPSA 1QQDA 3BGMA 5IR1B 1NBVL 4YXHH 2NXZC 4NFCA 1RUAH 1FLRH 4P5MB 3X12A 3KJ4B 1VADA 2P4AB 1IZKA 1FVCA 4EUPA 1CL7I 3QR2A 3CC5B 1H5BA 3WLBA 3PWVA 1LP9E 5E1HB 4JHAH 4EUPG 3JSSA 2BNRD 5EIIA 3NIFE 4JRXD 3ROOA 2W60A 4NQED 3HNVL 4YDIH 3TYFB 1TXKA 5LXGL 1HHHA 1OAZL 4ZFZB 4TVPL 1YYMH 1FC1A 4LLVB 2VITA 1YN6A 3O3BA 1WFTA 1FZMB 4R7NB 5FGSA 1KEML 4ZSOA 1HH6A 3VW3L 2V2TB 3L95B 2X70B 4WI7A 2C3VA 1UXSA 4L8DA 1UH3A 4FZ8H 4CADA 2G60L 4LLDB 1NBYA 1RUQH 5JW3H 4MNGE 3WD5L 2ZKHH 1WQVT 1N2RA 4GW4A 5EBWA 5IVZA 3SPVA 2PW1A 3IJHB 3AB0C 1V05A 3MV8A 3UDWC 5FOBB 3D3VA 4ZAKD 2Q6WB 1LO5B 3TN0C 3RWEA 2ZUXA 4PJXF 3ZYJA 4HWBH 1INQA 4TULL 2EXWC 4LPVA 1HYRC 3KPLB 2C3WA 4GKSA 3O6FD 4NPYA 4ZYKB 4X7SL 4G6FD 5TFSL 3VXRE 1N2RB 1YY9C 1U0QA 3V5KA 5F89A 4HUVA 1U8QB 1FL5A 1EAJA 4X7SH 3EOBA 4LLWB 3V4PL 1MJ7H 3DRQB 5IBTL 3ARWA 3ARTA 3U1SL 1PEWA 4EN3B 5GS0L 5SWZE 3MXWH 3VXOB 4K55A 4GRMA 3DJ9A 1CBVL 3WJJA 4RIRA 1ZHLA 4JVUA 4J3WA 2CLVB 2RAMA 4ODTL 1A9BA 1D9KC 3CK0L 5DURB 5B39B 3PHQA 5D7LA 4CW1A 2FRGP 2W60B 2QHLA 4GG6B 4XVUD 3QUMB 4NGHH 1J88A 1CF8L 1QRNE 2DKMA 1OSZA 3CXDL 4QXWA 3BP7A 1Y18B 3BHBB 3QAZB 1QFUH 5ITBH 4GAJL 5IGXH 2DTSA 1HZHH 1T0NA 5BV7B 5IR1A 4I3RH 5BV7H 5GS0H 5GS2D 3S36L 3VWJC 3ZL4L 2AXHA 3T3PE 1XR8A 1FFQA 2H3NB 4NZJA 1NKOA 2HWZH 1GGCL 3LQZB 1DQML 4NO3A 1IAIH 1UKSA 5BS0A 5ITFA 3AMKA 3LMJH 4KDWA 1KYOJ 3QNXA 4D94A 3C8KB 4Z7QE 1ZLUK 3SBWA 4H1LB 3PHOA 3KXFD 2X4QB 4MJID 1MIMH 1G6RB 4GQPH 3DVGB 1YJDC 2VRAA 1JTTA 1JGEB 3QH3A 4LSPL 3P0GB 5GRYA 2PXYA 3QIBC 2VDKH 2HN7A 3RWCB 4G8IB 1YJDH 5GHWL 2J2ZA 4OLWL 4ZPVB 2DTML 3NGBC 1FORL 1N6QL 5EZIH 3C5JA 1UVQA 2VKXA 3L7FA 4BQCA 5AZEL 1KPRB 1OAKH 4ZDHA 2NLJB 3OTTA 2P1YA 3NH7H 3H3PL 4XX1G 5DSCB 1A6UH 1IMHC 5T1KA 2EDKA 2G5BB 3WS3B 2Q20A 4OFKA 1YPZB 1L6XA 2VWEC 1LP9F 1QA9A 1KPUA 4L4VB 4IRSB 4S1QH 4LSQH 4OIIL 4IIQC 4WHTB 5DLMH 1FDLH 4RFNB 4Y5YB 5EU7E 2XNAB 1PKOA 2BJMH 1ZSDA 4KXZH 1EEUA 3ULVF 1T83A 4RWYL 3T4YA 5DC9B 5HHOD 3FT4A 1RMFL 3IFOA 4UTBH 3IKCB 3SDCD 1OL0A 2XA8L 4Y4HD 3GNMH 3QUXB 3ZHKA 4P2RA 5DS8A 2A83B 4O4YL 4WGVB 3ZKMD 3H7BB 5INCA 3G04A 1NCWH 1P4IL 4K94L 4Y4KD 5D1QC 3RVTC 2CRYA 5CGYC 1QHOA 2ED9A 1S9VB 5E9DA 4UBDC 3BPCA 3LRSB 5DMGC 4Z0XA 3UO1L 3X11A 1UADC 3VWKB 4X4YA 2W0KA 3V4UH 4Q7DA 1RJLA 4NJAL 3T0ED 4DUWA 2OMBA 4NQCA 2P5WD 2XNAA 3B2VL 3P9MA 2NCMA 5AZEH 4J3TA 1IC7H 4PJ9A 3I3EA 3IFPB 3HC3H 5C0RL 5TJWK 5DEFA 5F1IB 4PJHF 5JLZA 1HN1A 3Q3GA 1BFSA 5DRXA 3Q5YA 1JE6A 3WFEL 5MHSD 4K8RC 4DUVA 2ED7A 3SE3C 3EFDL 3W0WA 5AG8A 5AYQA 1I9RL 2O5ZL 4KJPD 1EGJH 4FQCH 4L4TE 2Z31C 3W39A 1F6AA 4R2GD 1MCFA 2CH8A 5HHXH 2ZNXA 1LEKA 1MWAB 3ALXA 4GOSA 3B9DA 1XCTB 4LCUB 3H0TA 4Z5RB 3MRLB 5CEYA 5JNYA 5IB5A 4EI5C 3O4OB 4S1DC 3BKMH 8FABA 5F71A 4XC1H 1K3ZA 4XPHL 1G6RA 2FR4B 1FH5H 3TPUA 1U8IA 3DMMC 4OIBA 5D1ZB 1NCTA 1CFQA 1JN6B 1IGFH 3PP3K 4LPWA 5FB8B 1CCZA 1ZAGA 4U7MA 4Z76A 4UDTA 1WC7B 3OR7B 2YOCA 4O9HL 1TPXC 5IOPA 3BKJH 1RUML 3PV7A 4NN5B 3G6AB 2D9CA 4JPIA 1YYLL 1CI5A 3MREA 1SYVB 2H6PB 1R3KB 3AY4A 4P9MH 3L3IB 4J4PA 1J05B 4E0RA 1HSAA 1TDQA 4ZPTB 1NSNH 2XG5A 3L5WA 5E1AB 3RNKB 4AG4H 1C5CL 4QRTA 1MRDH 3G5YB 3QEQE 4Y1AE 4PY8J 3LZFL 1FNEB 5L8LB 3LH2H 4XXCC 25C8H 4DFIA 1SYVA 2CDEB 1VGKA 3EJYD 1ITCA 4XPGH 1J8HB 1XCQB 5A43C 1MRDL 2MHAB 1NC2A 3QHTC 3TBTA 3MLUL 4Y8DC 1I3VA 3L1OL 4OF3A 4PV9B 3W0WB 4WWKB 1I1YB 5JXEA 4K23L 4N9GA 3MRPA 3MLZL 2OTWB 3MLRH 4J3SA 3BN9C 4AYFA 4EBQH 2BCKA 4GMTH 2ZSWA 4MB3A 1B0GB 4YIQB 3N1FC 2EDOA 4G8GA 4JPWL 1ZHKA 5F7HA 5GGRA 4HLZH 1MCSA 2CUMA 1BQUA 2PYEE 4WW1B 4HUWB 4MCZB 5B38G 2X7LB 3WE6B 4S1SH 2Y23A 1G0XA 4HUMB 5D2NB 1B4JL 1FNAA 5IB5B 1OM3H 4V1DB 2Q8BH 3LRSA 4MD4A 4Z0XB 1IGFL 5EZJA 1SY6A 2XZAH 1JZ7A 3VXUE 4QRUA 2VAAB 3B9KC 2YD4A 2A6JA 3O3DA 4C55A 4F57H 1QLRB 3L3DB 2VE6B 3TBYB 4X5XB 4LAQL 1KFAH 1YMMB 3BXNA 3NFNB 5K9OA 5I1IL 4TSBH 1DQMH 4WO4B 3CFCH 4N8VG 3RTQA 3FT4B 4NRZB 5EU4A 1FNFA 1BX2B 4ONGL 5T1LD 3QCUH 3F5WA 3WFBH 1J1XL 2OQJA 3KYAA 1WF5A 4DK3A 1A9EB 4K71C 5BO1L 2ZSVB 2H32B 4WO4D 2FLBT 4NHCH 1A6WH 4KRPD 4OGAC 4X4XB 1T5XA 4NNXA 1DEDA 4L3ED 1YYLH 4XNMA 5E9DB 3S37L 3NACL 2E6PA 4BYHA 3H7BA 1PJ9A 2DYPD 2HVJB 3QFJD 4XAWL 5I0DA 1I1RA 1AGCB 3KWWA 4PYGA 1JCKA 1K6QH 1SEQH 4M7JH 2B1HH 3R0MA 4JDVB 1KLFA 4PB9L 3ZTJH 4ZS6D 1OTTC 1WICA 1CZ8L 3MJ7A 4CGTA 4F9PA 3REWA 1WC7A 1YMHA 3VDAA 1FAIH 2E7LC 1MJUH 1VKXB 1TFHA 2VXQH 1VPOH 2XICA 3NN8A 3RWGA 3SDDC 4XXCA 3FB7B 1LEIB 3VG9C 3DETD 3O3EA 5HHXL 5C0GA 5I1LA 5A2FA 1ADQA 2R4RL 2QQKL 1XF4A 2JCCF 4B7IA 2Y06H 5CBAB 2AEQL 5TQ2H 4N1EA 4XMPH 3SO3C 1MWAA 3IGAB 1H3XA 4PRHD 5FUCC 4QRQA 2NXYD 4HFUH 1I8LC 3GHEL 1KIRA 1NC2D 2BSRB 3C6LB 3SBWC 3B9AA 3UTSB 4HQQH 1U3JA 1IGJA 5F44A 1EHXA 5B3NA 3P73A 5IB1A 3PWLB 4WDIA 5F70A 4ALAH 2J8UA 5F7NC 1XF2B 3OB8A 2AXFB 2XZZA 3CFCL 4RAUB 1JNLL 2CLZA 2VLJE 1KELL 4XGZA 1MI5E 5CJOL 5D7LB 4M61A 3T3MF 2Z31B 1CICD 4QGTA 4RIRB 1PX4A 5FCUH 5GPRA 2F74A