2FT6A

Structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Basic requirements for a metal-binding site in a protein: The influence of loop shortening on the cupredoxin azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ft6A00
3BVDB 1SDDA 3IE9A 2FTAA 1JOIA 1OE1A 2IAAC 3NSDA 4HALA 1RZPA 1J9QA 1RCYA 1T5KA 3N55A 1AZRA 2YAOA 5D4JA 1J5DA 2B3IA 2IH8A 4DP4X 3FU9A 4PCYA 4E9WA 1BQKA 5B1JC 1NIFA 2VM3A 1AS7A 1OOWA 5F7AA 2IDSA 1ASOA 1M57B 1PAZA 2PPEA 2PPCA 3NJKA 2ZOOA 4DP6X 1JZHA 2XV2A 1KGYE 2WO3B 2XWZA 5I6PA 1MG3C 5AZUA 1SF3A 2TSAA 4BWTA 2FNWA 1PLBA 3EH4B 2ZWNA 3ABLB 3QPKA 2RACA 3FT0A 3QJVB 1OCZB 3NJJA 4G7QB 3FYEB 2CAKA 2HRHA 3WG7B 3AG4B 5FC9A 3FPXA 4ENZA 5AKRA 1KBVA 4FA7B 1HFUA 5LDUA 1SHWA 3NYKA 3OD3A 4YSCA 2CJ3A 2QPEB 3PCYA 2IDQA 6PCYA 2B08A 3OMIB 1BEXA 4RH4A 3ZIYA 1PNDA 1FWXA 1YLBB 3V9CA 1QHQA 2Y1AA 1L9PA 5PCYA 2QPDB 4YSQA 4BK5C 2EIKB 3ABKB 1L9RA 2IDUA 3S8GB 1TKWA 4JHVA 2CCWA 1HAUA 2UXTA 3H56A 1WAEA 4P5RA 4YSDA 4NB7A 1AR1B 4YSAA 3WNJA 4GP8B 2Q5BA 4WKXA 3FU8A 4GY4A 3QJQB 5I5MA 1URIA 2J57A 2FQFA 1AIZA 1BXVA 2UX6A 4KOCA 2H3XC 3DTUB 2J55A 3IEAA 1GY1A 1WA1X 3N2JA 5TK4A 1JZIA 2GHZA 2BP8A 2YAPA 2DYSB 1AG6A 2X87A 2E86A 2YAQA 3NJMA 2BP0B 3NJLA 4YSOA 4Q8BA 1XB8A 5ANHA 4L0PB 1PZAA 4KO5A 1SF5A 2AANA 2PPDA 1GYCA 5D4IA 3V9EA 2VW6A 5PAZA 2EIMB 1AACA 1QNIA 2YAFA 3NP4A 1GSKA 2YAMA 3H4FA 1CC3A 4E9SA 4QKTA 3FSAA 2XV3A 1ET5A 1NINA 3T6VA 3U25A 1PMYA 4AI7A 2BWIA 2H5UA 2EIJB 7PCYA 4YSSA 4A2EA 3PAZA 2X88A 3NSCA 3DIVA 1JZJA 3SQRA 3NSYA 2HRGA 4E9VA 1ET7A 4F2FA 1N70A 4UAHA 4E9QA 2UX7A 4G72B 1M56B 1CYWA 3FPYA 1ET8A 3PAUA 1JZEA 3MBWB 1XB6A 3CVDA 1JXFA 2R7EA 2DY2A 1V55B 4EF3A 2GSMB 3JTBA 2YAHA 1ASPA 2IWFA 3AY2A 1PLCA 4X4KA 4KO7A 3ERXA 2YXVA 1A65A 4GP4B 4A2HA 1A8ZA 3NT0A 3IN2A 5B7EA 2Q9OA 4G70B 2EINB 1JXDA 1HAWA 3FS9A 1OCCB 4FAAB 5B7FA 2HLEB 1KYAA 4DP5X 1GW0A 1E67A 2AZAA 1A3ZA 2IDTA 2BP0A 2JXMA 1CUOA 2IDFA 2PP8A 2HX9A 2YQBA 3NJGA 3FU7A 2AVFA 4Q89A 2NRDA 4BDVA 3TASA 1UATA 4NERA 3UADA 1ZIBA 3AG1B 2P80A 4F7KA 3WNIA 4N8UA 1ILUA 1MG2C 3TBBA 1V54B 4DPBX 2GC4C 2EILB 1TEFA 1MZYA 1CURA 2HX7A 4KNSA 4BWUA 1BYPA 5I6MA 4G7SB 3NSFA 1BYOA 4GP5B 2GC7C 2QT6A 1AANA 1KV7A 8PAZA 3FQ2A 3L45A 3T6ZA 1AS6A 5EHFA 3SBRA 1E5YA 5I6OA 1M9WA 2AZUA 4PAZA 1SFHA 4E9TA 2XX1A 2FT8A 3PLYA 1ILSA 2BZCA 3MX0B 1R1CA 4HCIA 1IBZA 2OCCB 4K9JA 1BQ5A 1NIEA 1NWOA 4AKOA 2YARA 2QDVA 3WKQA 5I6KA 5B1BB 4AX3A 3T9WA 2BWDA 3CVBA 5B1KA 1L9SA 4AKPA 2W88A 4JHUA 2VSMB 3X1EA 4A67A 3CVCA 4HZ1A 3OM3B 5I5JA 3SBPA 1IUZA 1NPNA 1QLEB 3IBOA 1SJMA 2MTAA 1NPJA 1ZDQA 1PZBA 4F2EA 4G71B 3RYMA 1SNRA 4A2GA 4HIPA 4BWWA 4P5SA 2VW4A 3FQYA 5B1AB 2VW7A 4YSUA 3FQ1A 1OV8A 2PPFA 2QDWA 1RZQA 2VN3A 4KO6A 2IWKA 1J5CA 3TBCA 1SDDB 3ABMB 1E5ZA 2DYRB 2YAEA 3JT2A 1WA2X 3NJHA 4DP2X 4HHGA 2XU9A 2P80D 2ZXWB 3X1NA 2FWLB 4HHWA 1IC0A 4QLWA 1NWPA 3ZBMA 1WS8A 4A2FA 4HCFA 4DP8X 2CBPA 1JZGA 4A66A 2UXGA 3ASOB 4MFHA 2FQDA 1DZ0A 3CDZB 3PAVA 4DP1X 5TK2A 3EF4A 4DP0X 4N4YB 5B3SB 1JVLA 4GYBA 2DWSA 1XB3A 2GI0A 2UXVA 5E9NA 3T71A 2BO0A 1WA0X 3DKHA 5B7MA 3AG2B 5I26A 4YSTA 5I5IA 4KO9A 2FQGA 4DP7X 4AKQA 2FQEA 4A2DA 1N68A 3AW5A 3PPSA 1JXGA 1MDAA 1OCRB 2ZONA 3UAAA 3EH5B 1GS6X 3GYRA 4BXSV 4YSRA 4KNUA 2JKWA 2TSBA 3ABGA 1AAJA 2FT7A 2UXFA 4KOBA 4YSEA 2VM4A 1IBYA 2OV0A 1RKRA 2GIMA 1E65A 3AG3B 3C75A 1KBWA 2XXFA 2FJSA 1ZV2A 1BQRA 1MZZA 2CALA 4CSZA 1W6WA 2PLTA 1CYXA 1VLXA 3GDCA 3NJNA 4AZUA 1A4AA 3TA4D 1PY0A 1AZNA 1L9OA 4KNTA 1W8EA 1NDTA 3HB3B 4W9ZA 3ZX1A 3CDZA 1TEGA 1NICA 3KW8A 1ZIAA 2XVBA 1AZUA 2BP8B 2GBAA 2DV6A 1ID2A 1OE3A 4E9XA 1BXAA 1ZPUA 4YSPA 3UAEA 2VMJA 1NTDA 1W6LA 2XV0A 3T6XA 3WIAA 4E9YA 7PAZA 1ETJA 4GXFA 3T6WA 1JERA 4TXVB 3EHBB 5AFAA 2BZ7A 3QQXA 3ZDWA 1GR7A 3QJSB 2MRYA 2PCYA 2I7SA 2PP9A 3WKPA 2AFNA 5IY5B 5B1JA 1KCWA 1PCSA 1J9SA 2XYBA 2Y69B 4NAJA 4BXVA 1ZDSA 3G5WA 2WSDA 3S3BB 1SFDA 1L9QA 1J9TA 2PCFA 3GXUB 3SBQA 3PXLA 1OE2A 2GB2A 3FSVA 9PCYA 2I85A 3ASNB 3UABA 4DP9X 2LLNA 1SHXA 1GS8A 2DWTA 1I53A 1BAWA 1OCOB 4M3HA 1BXUA 3WI9A 1NZRA 3NJIA 6PAZA 2R7EB 3NP3A 3S3DB 3FSZA 1E30A 2BW5A 2XXGA 1ASQA 5I6LA 1ADWA 1OF0A 1XMEB 2FT6A 2CUAA 4HAKA 1PF3A 3OQRA 5F7BA 1AQ8A 4M4RB 2WO2B 2XUWA 3NJFA 1AS8A 1KDIA 3S3CB 3CG8A 3QJTB 1GS7A 2PP7A 4A68A 2IWEA 1AZCA 3CZUB 1WS7A 2XLLA 4JKNA 1JVOA 1NIDA 2JFCA 1PLAA 1FFTB 3QJRB 1PNCA 5I28A 2OJ1A 3BQVA 3X1BA 2PPAA 4DPCX 1AOZA 3FU7B 1V10A 1EHKB 4BDVB 1B3IA 2J56A 3X1GA 3X1FA 4UF7C 1DYZA 2H47C 3S8FB 1NIAA 4CSPA 5A7EA 3QJUB 2XX0A 1PZCA 4DPAX 1EZLA 3EH3B 2A3TA 3X2QB 1X9RA 1AZBA 1A4CA 2BW4A 3OMNB 1TU2A 3UGEA 2J5WA 4G7RB 2VSKB 4WTQA 1KDJA 2N0MA 3HEIB 3TU6A 3KW7A 3OMAB 5I6NA 4YVUA 1FA4A 1X9UA 1GY2A 3UACA 2W8CA 4YVNA 1J9RA 3FYIB 1JZFA 3FSWA 1A4BA 1NIBA 4ZK8A 3H4HA 4UANA 2HZHA 2IH9A 4W1TA 4HCGA 3D12B 1F56A 1AG0A 2HXAA 2BHFA 1IKOP 4E9RA 3IN0A 5D4HA 2HX8A 1L9TA 1KCBA 2I7OA 3AZUA 2YXWA 4YL4A
chains in the Genus database with same CATH superfamily
4JDEA 1U8MA 1MLBB 3GKWL 4JHWL 4Y7MA 2ZKXA 4X5XB 5FCUL 5EC2B 4DQOL 2LR4A 5E6UB 1P5VB 3PNWB 5HGDB 4HZLB 2CLRA 4KUCD 3FOMA 4U3XA 2ZYHA 4XNUH 4AUJA 4FFYA 4FDWA 3V6BR 3FU9A 4HJSA 2BDNH 3T5WA 4DP4X 5HY9B 1U8LA 4BFOA 5GS1A 3FTUA 3UBXB 1Z9OA 4HUVA 1GL4B 1V3MA 3I85A 4M6OH 4Y9CA 3DHMA 4MB5A 2R51A 4PFEA 5GSRA 1BD2E 4PG2A 2CKBA 1ZS8B 1R3KA 3L48A 3EUUA 3F62A 3EJQA 3QJOA 2ZOOA 5ANME 1RPKA 1QR4A 5EULV 4FRWA 4IOFD 3KD4A 4GAJH 2MCAA 3M1BA 3VXSE 4PJEE 3NZSA 4AIOA 1PLBA 4NC1E 1HE8A 5BUPA 1A6UH 3Q6FB 3FT0A 1A5FH 4HUNB 1S9KC 1MY7A 4MDIA 1BX2A 3CFKB 4OZFB 3Q2WA 5T1KA 5K5YA 5LGJA 3FCGA 4N5EC 2Z4QB 2EEXA 4WI9A 3TZVD 4N0FA 1HZKA 1ADQL 5LDSA 3BN9D 3DTXA 4NCC1 1G9MC 3D85A 4GG6A 1IGML 3RI5K 4DGVH 5D1ZA 5HDWA 4IHOA 1A7PL 2YRPA 3V6OA 4NQUA 2E7LC 1ZK5A 4XNYH 3BPCA 1R75A 5EDXA 3P69A 5BZWB 1S7SB 3JZYA 2D4DA 1QLEL 3H7BA 4HLJA 3F5WB 2CMRL 2OI9C 3PV6B 3DX8B 3MRBA 5TGBB 1KN4H 2WTPA 1JYXA 2IAND 4EN3C 5JYMA 1P2CA 3IPFA 3K81A 4MNQE 2OSLA 5IHWA 4PTUA 5BS0B 1UKSA 2F7QA 4XBEH 3TTYA 4NN6B 3SE9H 5HYJD 3CXFA 1NAKL 2Q5BA 1FG2B 5L2KD 4PM1A 3W9EA 1RJLB 3FU8A 4IU3A 2BFGA 4MAYB 1IEBB 4OLZH 1URIA 1GYUA 1EXGA 3ARBA 3ULUH 2J55A 4PJ7F 3GI9H 5FAAA 5ICXA 1ZA6A 2EDEA 1RQ5A 3GF8A 3CLFL 4M5TA 3OBAA 5FFOA 3T65B 1KJVB 4Y2DD 5HI3C 4BQ9A 4N2OA 5L88H 3G6JA 2PWDA 4UOZA 3MR9B 3OTTA 4XNXH 5DJ6B 4JFDD 5GJSH 1P6FA 1I7UA 5JW5B 4AVIA 1CIDA 3EW3B 4JPVH 2F1EA 4B0MM 3VQLA 3QFGA 5E1IA 3VXUE 4FOMA 1BD2B 3BKYL 4MJ6B 4A7SA 2PO6D 4H25A 5ANMB 4PTTA 3WFDL 1DUZA 5A40E 1V3JA 5E56A 4FYRA 3CHOA 5AWNL 4PJEB 1S2EA 1KGWA 3VXSB 5C0JA 2WQVA 3VSUA 4ZFZB 5BRZE 4GXVL 1CL7I 4IRSD 3OSKA 3NSCA 2D0GA 3WXWH 1G7JB 2HRGA 4E9VA 3D39A 1AXTL 2Z8WC 1U92A 4WU7B 3SB3A 1EGJA 2ATPB 2V33A 4D0DB 3Q8BA 4LL4A 3MLPA 3SQOH 3PAUA 3QH3A 1F1AA 4PJ8A 4ZMOA 1P53A 2DQUH 2AQNA 5HHQB 1IM3B 4EF3A 5FO7B 1J05B 1NBCA 4GLRI 1TT6A 1MI5D 2RBLA 4I1RA 1KTDB 3FOLA 2J72A 4X8GA 1YYLH 5GRUH 1BVOA 3N3EA 4DVBA 2JELH 4KO7A 1U8CA 2QR0A 3NPZB 3WNKA 1Y1DA 3VVWA 4UQ3A 3PRZA 5ABAA 2AMGA 3WHXA 1PZDA 3CVHH 4U6HB 1HAWA 1PIFA 2O6DA 4Z3FA 4WI7A 4WUUA 2HH0H 4JPKL 3SPJA 1DVFC 4HBCL 5DK2B 1E67A 1F4YH 1RUMH 4MNQB 4RMTA 3ARFA 5IB5B 3OLEA 2C7FA 5EUOA 4AVHA 2RQEA 1YEFL 3FB7B 1DO6A 4DN3H 4AL8C 1Y18B 1T22A 3NA4A 1NCGA 3FU7A 2X1XR 2YKLH 3FN3A 2NXZB 2J1YA 3MNMA 3PGFL 1HHHA 2IXQA 4BDVA 5DS1A 1Y6KR 4MS6A 2NY4C 5CFAA 1PQZA 2Z7YA 5IG7A 4KAQL 3U0WH 4X6EA 4GRMA 1QFPA 4ZOEA 2CGZA 3FQNB 2P24A 5I19H 4Q9RL 5F7EH 3RL2A 3ETBF 4G3YH 3RGVC 1QTYT 4G7SB 1NMBL 3TA3C 3VXUB 4GS7C 3IFPB 4L0YA 1IT9L 3UZQA 2VLMD 5AVSB 1AYOA 4IEFB 4HJ0D 1H5BC 1YNLH 3U4BL 3K8MA 1BLNA 2LTQC 1J88A 2Z0UA 3BAEH 3CZJA 4M7ZC 2CNZA 3DBSA 1PZSA 1ZGLP 5BRZB 4BFJA 4CGUB 2AEQL 1SFHA 2BSSB 1T7ZA 1S7QB 2JKJA 2XX1A 3WS6C 5CEZD 4H1LG 4BIKA 3U79A 1IBZA 5F21B 2WXFA 5KYYA 1M2VB 1KIPB 1NWOA 4MJHA 4LCWE 1AHWC 1T1YB 2ADIB 5G4NA 4A7VA 2AQQA 3DBXA 3QNFA 1E4XH 1WYJA 3MRRB 5FM4A 1CU4L 2WN3A 3HZ3A 2Q1EA 5SWQA 4HUKB 1SQMA 3Q5TA 2WZ6A 1ZT4A 3IDIB 4NDMA 3X1EA 3U48A 5IQ7L 5H35A 1DLFL 1NLBH 2R1WB 5DC9B 2VQ1A 3GHEL 4M1CD 4L8CA 1CVSC 1NPJA 4LPYA 3BE1H 1K5NA 5FKAB 4LLVA 1QSFE 3B56A 4B6ZA 4J6RH 4XVUC 5CU9A 5AQ0A 3RYMA 3AS2A 4N2FA 3VX1A 3DRQB 4K94L 4HGMA 3L5IA 2WSPA 3ARGA 3KWWA 1E5BA 1MQKH 1OV8A 3DJTA 1JI2A 2NX5A 2QDWA 2ADFL 3ZN6A 5DHDA 3KBHE 4W9JC 4N2AA 1MVYA 4TLSA 2YAEA 2B4CH 5EC1A 5BW7C 5ACZB 4LLQB 3UGXA 3QPQD 4HHGA 3QI9B 1G7IA 2XU9A 1QYGL 5DZPA 1OAKH 2JIXB 2NT1A 1F1DA 4Y5VC 1FO0L 2ZCKL 1U3HD 5MI0B 4FMVA 2YEZA 3AUWB 3L7EB 5A2FA 1SBSH 3SEPA 4BKTC 4XMLL 2NNRA 4KI5C 4L3FA 5HTSA 3W1ZA 1D7DA 3SD5A 1AXSB 4P46A 2JKNA 1OANA 5EU6A 3WLBA 3ZZ1A 3WIHH 4AQEB 4Y19E 5GGRA 4DP1X 5D1QC 2AI0H 3ZUCA 1SBBA 4MWFA 4CDHA 2WZ5A 2YZ1A 3BRDA 2GY7B 4LARL 1K8DB 4QRTB 5MEND 5F0JB 2FX8H 2KERA 3GMPA 3H42L 1JSYA 4FNLL 4ANUA 4D8PA 2PN5A 3C8HA 2WQSA 3T71A 5C0BE 3QA3B 4BZYA 3K2MC 1ULVA 5KEZA 3OGCA 4GH7B 4L8SA 1E4JA 4ZSOE 1OLZA 5I5IA 4LCWB 5DMIH 2EXTA 3SPVA 2HA1A 3AW5A 1LL1A 4HXBL 4AQOA 2WGXA 4KI1A 3QRGH 3POCA 1BPVA 2EDQA 4NNXB 1KSRA 4HU2A 3LD8B 4XRCA 5DJ0B 3WNLA 2NUTA 2PXYA 3D3VE 5LWYH 1FDLL 1A7NL 4HLZH 3U4AA 5C07D 2BP5M 3RIKA 3F6LA 4X6DE 4OLWH 5DGRA 1MCQA 1QSFB 4E42A 5F71A 4JAMB 4J28A 3RVTC 2FZ3B 3SGDH 4UTAL 3R1GL 3GRWH 3F58H 5I16B 2BNQE 5HHOD 4IRJC 2P26A 4TQIA 3MJ6A 3SDXF 3CTTA 2F53D 3K5RA 4LP5A 5F44A 4TUOB 2K70A 1NDTA 4JKWA 1CPUA 2BS9A 3G7TA 4ATTA 2R4SH 1A1NA 3X13B 1AKPA 5AW2B 5EPMB 2WLIA 5FYLL 2XQYK 2AV7B 1BMWA 2VLJA 1KN2L 1JWMB 4GSUA 5CWSB 3EDEA 4EN2A 4FNRA 3AFLA 3D4GA 4LESA 3ESVF 3TNMA 3AMLA 2ICES 3Q0HA 3WIAA 5HI4C 3T6XA 3LZPA 3BP7B 1AR2A 1HZHL 5HVWA 4YHLH 3V0AC 3S35X 3B9KD 3LS5L 2XWTB 5A2BA 4Y19B 1EJOL 2CO1A 4BFRA 1PCSA 1J9SA 3WAJA 5I9QB 1ZDSA 4ERSL 3GJFB 2CHXA 4LVOB 4WWKC 4O02A 2EYRB 4EI5B 3VTMA 2YO3A 4PW9A 3ULVE 4XAWH 3ME0B 1OHQA 4X9BA 3X3GH 5C0BB 2GB2A 2PYFA 9PCYA 2KC0A 3RWIB 3RDJA 1EVUA 4QRAA 1QFOA 5D1XD 4ZSOB 2QVKA 2NLJA 4K3JL 5I8EB 3SGEH 4UYPA 1VF5C 4XNMA 4HJUA 3UC0L 1NDGA 5E8EB 2J43A 5LO7A 1Y1UA 2J5LC 4XP9H 2XBDA 2WBXA 4P2RA 3WFBH 1G1KA 1U95A 3G5ZB 2WW8A 5AVYB 3GBEA 3IDGB 2ITDB 4P59L 1E9PB 4XWGH 3IKCA 4L4VE 3D3VB 4HK0A 1J5IA 4JO3L 5F7LB 1RK0A 4MJIE 2WO2B 4EJ1C 5E8PB 5JUEL 3VDCA 3G04A 1EAJA 1HWHB 3O6LH 2Q86B 2YSSA 3FRPA 3CG8A 4V1DA 3S3CB 4QAMB 3FCBA 4X4YA 4X6DB 2IWEA 4N1CA 3HLKA 5C86A 1M71A 4Y4FA 4RLDA 3CZUB 5DJXA 4P5TC 1WFIA 1RH8A 4XO9A 5TE6L 2GJ6E 3RWEB 3DYPA 1NIDA 2JFCA 4FJZA 4U1SB 4CILA 1UM4H 2OTWB 2BNQB 5FM5O 4Z0BH 4ADGA 1JTPA 1XAKA 4UCFA 3T8VA 1J8KA 1OP9A 2Z9TA 3OC8A 1XZ0B 3VH8B 4JFFE 3U36A 3WEBA 3HE7A 3Q2VA 2QV2A 1SN2A 2ZNWA 3LIZA 4MGXA 3G6AB 3QJHB 4L4TA 5GGVY 2QSCL 5ACLA 4RSYA 3VI3E 2A77L 2VUOA 2VZOA 3MV8A 4KK5D 4Q9QL 1CL7H 3PJSA 3MLRL 4BA0A 2XN0A 3X3FH 4DO5A 3MJ8B 5ALBH 5DZNA 4K2UL 1W72A 2H1PL 1X9UA 3O6FD 5BNXD 1KYOJ 3ZYIA 1HZLA 2PR4L 5IHUH 2WTOA 4JY5H 3JTTB 3MRJA 2Y5TA 1HIML 1CDIA 4C4BA 1TJXA 1U91B 4GLRH 2WBWB 1FRGL 3C9NA 3NIDE 3OKNA 4MXVF 3BC9A 3UP6A 3BLPX 1L9TA 3WTSA 3NFSH 3WO4B 3UTQA 1P7HL 4IRZL 4WTZA 2WLLA 2VO5A 3B7SA 2FTAA 5DHMC 3VB8A 1TPXB 4KROB 1AO7D 2B59A 5IBLC 3N55A 2XQYA 1AZRA 1C5CL 4JR9H 5GRWA 4PWFA 4JE4B 3U83A 4KQ0A 1G6RL 2DLFH 4PD4J 3IPBA 1NIFA 3GKZA 1MFEL 3OHMB 3DJRA 4KITB 3HFML 3TXAA 2IDSA 1MW3A 3KS0J 5HHPB 5C0EA 4L4VB 3MRHB 2X4SB 5CEYB 4EOWL 5T1LB 4FD0A 4MJIB 3LPWA 2GSGA 3HB3D 4CJ0A 4HQQL 2X12A 1S78C 3VRJA 3G6DL 4V2BA 4BCYA 4YC2B 3HAEH 2DRUA 3CFMA 3V5DB 1GAFH 1O5DT 1NGZB 2N7BA 1YYML 5CGBA 2Z6FA 4XOBA 1I9JH 5EH1A 5FYJU 4WF7A 3MV01 4FXTA 5I1EL 2QQQA 4QJ5B 3PDGA 2AAAA 5I17A 4ZXBB 1OCZB 3NJJA 4ZUWB 4APQB 4RAVB 1IAOB 2ZOUA 3U2IA 2A0LD 3C6LA 3IJSB 2YN5A 3I50H 1UVQA 2IPTL 2A4CA 3MLYH 4JFFB 4BZ1L 5LDUA 4NO3B 1WFTA 1RSYA 3B9AA 2QADD 4UB0L 3EJJX 3KYMB 3VI3B 3L5HA 3IFLH 1RAMA 3C5SB 5CBAB 4PW3A 5DO2D 4UZUA 5AL0A 2OMBA 4WV1C 5F2FA 2DICA 2J6WA 3SO3B 4GQ9L 1TKWA 1EZUA 2CCWA 3MMEA 4QHNA 2X9YA 4J4PD 1F86A 4OIBA 4PGBB 5DF0A 5E6IA 1JI1A 4NB7A 4WU5B 1DEEB 1SVZA 3NIDB 4LLAA 4ZMXA 2C4FT 2X5PA 5HYSB 3KLKA 2AJVH 5IHHA 1IX2A 2WXHA 3MLUL 1X44A 2C9VA 3CH8A 4N8PA 5IHZA 3RZCC 3RUGE 5K33A 1QO3A 2WNWA 3IDXH 2DYSB 1XHHA 4XBPB 1FP5A 2YFOA 3B2XA 2KT6A 3AMKA 3NJLA 5D8JH 4Q8BA 3L5XH 3SDAC 4GO6B 2G2PA 3P11L 4ODXB 3ZW3A 2BOBB 4IGBC 5GGTL 2BJML 3LHAA 3K2IA 4AMKL 3FZUD 4WTXA 1QNIA 5TDPA 3GGWB 3DURB 3GSNH 4JGMA 1F90L 5D7JB 3HHRB 3FSAA 2XV3A 4B95C 3FT4B 1PMYA 1UWFA 4J3OC 4HJGA 4MQ7A 3US0A 3KLQA 3IGLA 5FYKH 4HUUA 1ETZB 1BXXA 1JPGA 2H3KA 2R23A 4OD2B 2EE9A 3VXNA 1IQDB 1HSBA 2BOCB 3A6BL 4P23D 5EZIL 4UM9A 4PBXA 1TZIB 5IMKA 3VXPB 1RZIB 3ATBA 4E9QA 2P5WD 1EFXB 4LEBA 5MERB 4P2YA 4Q58C 5CJ8A 4PWEA 2JK5B 1DFBL 2YEQA 3LAFA 3V0GA 4YGAB 4CVZB 1YNTF 4QXTA 2PWGA 1T2QH 4L8DA 5D4QA 5JR1H 3CLWA 1ZAGA 4HD9A 3WFHB 3UTZB 1PIGA 5EORH 4HIXH 1U8QB 3S4SB 2EACA 1A65A 1MFDL 3KXFE 3WSQH 5ETUA 5E8OA 1VACA 3NT0A 3AROA 1CD8A 1JXDA 1QRNA 3L95A 1N7MH 3QWOB 4XPTL 3DGCR 1KYAA 3CSYB 1W2KT 2IDTA 3IFNL 1A3ZA 1F6FB 2Y7QA 4X9IA 2E74C 2XWCA 5D55A 5J06A 5ADOH 2WIIB 1FV1B 1PGRB 1R34A 1TSRA 2X3BA 5CCKL 1TLKA 1KJMB 4W9FC 3AGWA 5BXFB 3HR6A 4JJ5B 4R26H 1KIQB 4OZHA 1JFQL 1Q38A 3PUCA 4BKLA 2CLVB 3RUGB 4N8UA 1HC1A 1N6QL 2Q76B 2R0ZH 3B7TA 1BQLL 5AB1A 2CM5A 2HFEA 2HRPL 3FQTA 2RR3A 1MIEH 1E2WA 1UCBL 4CBPA 3BP6B 1DN0B 3V4PA 2VLRE 3FO9A 4G80B 3VXOA 1R46A 4BWUA 3SKNB 1BYPA 5H2BA 3L3KB 3LXAA 3NSFA 4L5FH 3RX9A 3KWTA 5DSCA 1UXSA 35C8L 3CN3A 2GJZA 4IOFC 1KIRB 1M9WA 3D1MC 3KPMB 3MJ9L 3ZE0F 5C9JA 4LNVA 4ZFOB 3QJXA 1G9NL 1ZXQA 2O93L 1CGVA 1M7DB 1W0WA 1UWXH 5ICZA 2E7CA 2VXTH 3CHSA 4K7PH 3L7FB 2DQDL 3GKWH 4JHWH 2OCCB 2FO4A 5C97A 4DQOH 3KH3A 4ODUB 4QHMA 1SM3H 2K6WA 1QSEE 4NQVB 3KEDA 4DUVA 3LOWA 3ET9F 3HI1A 1G0DA 2GABA 2V6HA 5IFJA 1FC1A 1QBLL 3TZVC 5E2TL 4JB9L 3EJPA 3FRUB 1B3JA 4QF1B 3K91A 4L9LC 2ARJQ 2N3JA 3TV8A 1GKOA 3LRHA 5I5JA 3TT1L 3OMZA 4PRIA 5KVEL 1RJYA 3KXFB 3S5LB 1PYWA 3N50A 1XTLA 1NGYA 1TTGA 1WBYB 4PYGA 5GGUB 2FHBA 1U2HA 3CFUA 1ZLSL 3BVXA 3VM5A 1U58B 1SZNA 2OR9L 3FQ1A 1V3KA 3N1MC 5CCGE 4E5XB 5T3ZE 3TBCA 4PVLA 5I66A 1P1ZB 1BCIA 2DWEA 3HZMA 1LK2B 1ADQH 2E4FA 5F9JB 5ISZE 4NZRL 1XBDA 3SE3A 4HHWA 2NXYD 4QLWA 3MRMB 2R59A 2VIRB 4Y2DC 1QACA 1EAOA 5E1AB 3AB0C 4FQPA 1ZHLB 4K8RL 2VLRB 1QLEH 1HI6B 1SDAB 2GTZA 3ASOB 1EO7A 1WSST 2EUWA 3VWKB 3PREA 2KPNA 5IROA 1T0NB 2GCYB 4OQTL 4PLKD 4YHIB 3STZA 1NC4B 2X4TB 4HKBA 2VDNL 2PO6C 1A6VH 3U9UA 3FT3B 1NAKH 5AOLA 1Q9OA 2CGYA 3D2UB 4GG6F 2UVEA 2WAHA 5BJTA 3LV3B 1MJUL 5B8CC 4R8WL 4MMXB 2X38A 3DKHA 4MD5B 4IRSC 4J3UA 4W9HC 4PJGE 2WXIA 4RAUB 2GUOB 5I2IA 1A9EA 1IGJB 4KO9A 2FBOJ 1EERB 3CLFH 1QSEB 1H9VA 1JXGA 2R8SL 1ESOA 1T7YA 4JFQB 3LHPH 4BGLA 4X5PA 3SKMA 1CGYA 2CSPA 2Z4TA 3PE9A 3MV9D 3PWUA 5JMRA 3IRPX 5B38A 1OWWA 3H0TA 4NPYB 1S7VA 5E8DH 3CN4A 4J2QA 2H2SD 4ODSL 3V52L 3G5YB 1OALA 1ZS2A 2XCMC 2Y36L 1UEYA 3BEVB 3IAQA 4OLYL 3W82A 3DXAE 3QCVL 3L3GB 4NUJA 3Q9PA 5LLIC 1NFKA 1UHVA 3PWNA 1X5FA 3EYOA 2JCCA 4MBOA 4MHHI 2XKNB 1VKXB 2J8HA 3CCHA 1AZNA 3GD1C 1F97A 5GHWL 3QR0A 3RWJB 4F7TA 5DD3H 1L5GB 5C2BH 5I1IH 2FBRA 4W9ZA 3ZX1A 3KW8A 3SDDB 5EOTB 4H8HA 4JPSA 1KIUA 3TN0D 5EIQA 2B9BA 2DQ6A 4XPAH 5ISZB 1G5AA 4AQ8C 3MNVB 1FSKC 1A2YB 4JM2B 4F3FA 3I6KA 3EO9L 1YEDA 3DGGA 4D8OA 1LO2L 4X5WA 4Y16A 5A6IA 1NM9A 2VZ1A 4X8CA 1IGCH 1YDPB 2VDPB 4NO5B 1TMCB 2EDLA 4J3BA 3V7MA 4ADJA 4F27A 1WJ3A 4GXFA 2QMKA 3T6WA 3FCTA 5AFAA 4AQ1C 3LEYL 1KB3A 1H3UA 1TQBC 4J6IA 5C08D 1NEUA 4JPKH 4HBCH 2Y6SC 1YA5A 4LEEA 3BP5A 5INCA 4HJ0C 1U93B 4QAWA 4AJWA 1YEFH 4EDXB 4AK1A 1QLFB 1X5LA 2NY1D 1CGWA 3Q6GL 5DZAA 5JMOC 1R5IA 1CFNA 4QHUB 1BFVH 2FBJL 4UOJA 1N59A 4PJGB 4ALAH 3F7QA 3IWUA 4RISL 4DKFH 3HLAA 2ZXDA 4ISVB 1BBJB 1FLTX 1MWAH 2GFBB 4OI9A 4OCYL 1SOKA 4ORGB 4U1LB 1JPEA 2OMWA 4F9PA 1ITCA 1P7QD 3QP3A 4OCWL 4BD4A 3BPNB 4KDVA 5GS0D 4IIQC 1HOEA 3KPRD 4G7YL 3BUIA 3H9SE 4ONOA 3WJMA 4XCYB 1DJGA 3OQRA 4Y1AD 4K55A 5AW9B 5EUOF 2W5PA 4NJAL 1NMBH 3QDME 4PRAB 3NBNA 4YXKL 4LSTL 4PN6A 3NRPA 1IT9H 4QRPE 3QXAA 3PV7A 5IM7B 2K7PA 3L3OC 4UV7L 3DXAB 3PJLA 1MIML 1LTXA 1R3HA 4LHUG 5I24A 3KWXA 1EV2E 4ZRGA 3EOBB 2W59A 2Z93A 3RI5F 2ICWB 1HVXA 3NFPA 2Z3FA 2XIIA 4L1SA 4LHUB 4DO4A 1KXVA 2OMXA 2MOQA 3OVUB 4R7XA 4CSPA 4XXWA 1NC2B 2XX0A 4JZJB 3NG5A 1AIFB 1D9KD 2O26U 3LN5A 5F9WC 1CU4H 3QPQC 4LASL 1LEIB 2PMZA 3QUXA 5DZJA 5HDOA 4AC4A 3SDCA 3ARQA 2A7BA 4CC0A 3V4VL 1U3HC 5IQ7H 3TU6A 3KW7A 1F58L 3BMVA 5T5FL 4GQQA 2YA1A 5J13C 2W8CA 3T1WA 1T20A 2Z35B 1FCGA 3TX4A 1WG3A 1PKQE 3TFKD 2Q20A 1LM8V 2J6EL 1E4WL 5T1JA 2WC7A 4HSQA 4K94H 1IKOP 5FDYA 4N9GA 1UQSA 3F05A 3MFGB 3BJLA 5IBTH 2DYPA 2NUPA 4UQBA 1JOIA 5JXEA 1AY1L 1JMXA 4Q74A 3N1GC 2VDKB 3DX6B 1FO0H 1VCAA 4QJ4B 3DVIA 2WZAA 3O45A 2NDFA 2ENSA 5DD1L 1W9XA 4G6FB 4XMLH 4K7FB 4D94A 2VERA 3H9SB 1UB5B 2VM3A 4W9KC 4Q6IA 2OYLA 3T4YA 5C0RL 2H32A 4R5VA 4B50A 1RZ7L 3BLKA 3GSXB 4R0LC 4FP8L 3QK0A 2MCG1 2Q87A 2R83A 3QDMB 4F15B 4EZKA 4L37A 4R83A 2C1OB 3UMTA 4QRPB 1T2XA 4YDLC 5IHBA 3ARDB 3C5ZB 1LEGA 5CP7B 4LARH 5D93C 3PDOA 4S11A 1IBHA 2CO2A 3X11A 5I71C 5IJDC 4C47A 1FE8L 3OZKA 1BFSA 3VM7A 1KLFB 5JLZA 3VD9A 2UUDK 4FNLH 4PJXA 1A21A 5CEZL 1UGNA 2ZWZA 2ZP8A 1R0AL 4IOIA 4TOYL 2VMCA 2Y22A 5D6CB 2IALA 3ZR6A 2P43B 4KUZL 1OGAA 4ZMPA 4FA7B 1VCBC 2IWGA 3QFJD 4MYWB 2FJHB 4XPGH 4ZX3A 4HXBH 1LO3L 5HJGA 1BP3B 2GW5A 1XR8B 4IMLA 5DUBA 1JGDB 4M9OA 5HYFA 4FQ1L 5AVQB 4I2XA 1A7NH 1L0YA 3MRGA 1UB6A 4BK5C 3DMMC 3FO1B 3JXAA 5CKGA 2OXGA 5DZVA 3B9KC 1G7LA 2WWNA 3KVPA 4LLMA 3TLRA 1U2YA 3CZNA 3ZTCC 3BP4A 2F1BA 3CFJA 3R1GH 5HDBF 5C0AE 3GK8L 3DVNB 3QUMB 4P4KB 3RBSA 2GK2A 2FSEA 2HVJB 3VXRD 4JG9A 3QUKA 2DI7A 4HJIA 4F7EB 4KRPD 3EYFB 4G8GA 1RHHB 4MS8D 5FYLH 4DO6A 3L9EA 5FA4B 1XH3A 5D1XC 1SXNA 1F11A 2XWDA 3RNQA 4JLRB 1MCKA 3TBYA 3D69B 3CK0H 4B7IA 3B6SA 2Z31B 1II4E 4XN7A 1HZHH 2VJ0A 4TVPE 2JNZA 3ZL2A 4ZUSB 4Y8DC 3VUAA 2R9HD 1N8ZA 3LS5H 4O4YL 4Z76A 1EJOH 1MOEA 5IQMA 1OGTB 2Q3AA 5TQ0H 1X7TA 4M5YL 3BVNB 3QUZA 2HFGH 4YO0B 5FK9A 3SQBA 4ERSH 5IFAL 2YD3A 4Q6YA 1ZT7B 1DDHA 2C7UA 4D9RD 4A2EA 1HCYA 4M1GL 5INDA 3W0WE 2AJZA 2XG4B 4NZFA 4P5KA 1HEZA 4H8WC 4HKJB 4WENB 5FR3A 2VJXA 2J8UA 4EVNB 5C0FA 1KBKA 3ML8A 1YAZA 3CSFA 4TL4A 2JKRM 4B3VA 4RA0C 4K3JH 1BIIA 1JZ3A 3ULVF 5MEOB 1E9QA 3MUUA 3FCUB 5CUSL 2W60A 3MGTA 3SKJH 4QXWA 4NUGL 1OTSD 2Y3NA 1XF2A 3TF7C 5F8QC 5HI5D 3LNHA 4X6CF 2YPLE 3WS3B 1S9VB 3T2OA 4JO3H 4NQDE 4M4RA 3LZQA 4LB8A 5JUEH 1JRHI 3VRIA 1I1AA 2ADJA 1CF8H 5I1CH 1M7IA 4ELMA 4JFUA 3RVVD 1CVRA 3O6FC 1N64L 2CUIA 2OMYB 5B7FA 1T3FA 4TYUA 3V55A 3D4CA 3FFDB 1R5WA 5IT2L 1KLUB 5GZND 3V4LA 3S3SA 3FFCA 3PHAA 5C0AB 3Q1EA 5FPIA 2A83B 1XH2A 3ZVVA 3ZHNA 3GBLA 4YPGB 4NRYA 2UY6A 3BSGA 4G43A 1L7IL 2ZSWB 3EFFB 1KXHA 4GI6A 4F7KA 4D9QD 5DLMH 1AD9B 1H9DA 3BD3A 1KPVB 3MUGB 4N6RA 4HPOL 3GSRA 3KJ6L 2WYIA 3WJLA 3EJYD 2G3NA 1QASA 3ZR5A 4EQ3A 2R2BB 4FFZA 3AU1B 4TRPL 2ZAGA 4G6KH 3OKLA 3WE6A 4W4OC 2IQAB 3EGDA 1T5XA 1YMMA 5IEHA 5JORA 3HB3C 3F12B 1JHLH 5K59F 2BFVL 5E51A 3T6ZA 1AS6A 1WH0A 3L1OL 1E5YA 4Z7QF 1T21A 2BSED 4XE5B 5FYKU 3W0WB 3NGBC 2EKJA 2FT8A 3U2JA 4OM1L 5EOQL 1MCIA 1RUKL 2FECL 1IEAB 3KPSA 4K9JA 3KPTA 3ZU8A 5D70L 5D9SA 1AGEB 3GMLB 4LNRA 3O2VH 4P57B 4UQCA 5DWUL 1H3VA 5KYXB 1YN7B 3HC4L 4X99A 2A0LC 3R8BB 3T9WA 3F7VA 1A4JB 1U3NA 1ZT1B 4YDKL 1HQRA 3KLDA 2MCPL 1G6RH 5BS0D 4JHUA 4G1EA 4QOKB 2YUZA 2QADC 3CUPB 1NEZG 3MXVL 4ES8A 5FV1L 4MAYD 2YPLB 4ELDA 1JPST 4NQDB 4I5BA 4XN8A 1URLA 2VDOH 2PABA 2VSDA 4AEIH 4ZAKD 5KVDE 5DO2C 3G6DH 1NEZB 4JZOA 5T3XE 4F58H 3HBPA 4LOVA 5LBSL 3ZGHA 2E27H 2WOYA 1SNRA 2DWYA 3RTQA 5I1EH 4J4PC 1KPUA 1C08A 5KBDA 2FUTA 2R1YB 3C6SA 5BZXA 2VN3A 3CN1A 3FTVA 3APDA 3JT2A 1BD2D 3RU8L 2A4EA 1PG7X 2IPTH 4Y4HB 3UEZA 2E46A 1V7NL 3LZOA 3O6ML 1NMCC 1WISA 2NTSP 4NKOA 4NQEA 5E0QA 1F3RB 5KOMC 3WO3B 1PJWA 5DD0L 1HILA 4UNVA 5FV2A 2IMNA 3VXSD 4MCZA 2BP3A 2YUWA 2WSKA 3GXMA 5CD5D 4DP8X 3NH7L 4A66A 3CZEA 3LKNB 1CWVA 3DJ9A 5K1JA 4AYID 1HE7A 1ONQA 4GQ9H 1EH9A 3B3IB 3FZUC 5EZJB 4DP0X 2J21A 4RFOL 1IGFL 5F8RC 2CIKA 5JHLL 3IU3B 5C1MB 1GA2A 4NO0B 3NESA 4GYBA 1IM3D 2X89D 3MCKA 4GW1B 5E5MB 1V7MH 5EO9A 4A7GA 2KLTA 3IDNB 5IV2A 2BH0A 1WFOA 1X5YA 2Q8BL 3V4UH 1DSWA 3MO1A 3OAYH 1I82A 5I26A 2X05A 5C0GB 4DN4L 3MLUH 4M4PA 4P23C 1CI5A 1B4JH 1CXFA 2V0AA 1JWUB 3KGSA 2CXKA 5BRPA 2PYEE 2XWXA 1IJNA 3C08H 1MXGA 4TQEL 1LP9F 3GYRA 4MNQD 1NFDE 2E4TA 3QHFH 3KLAA 4BXSV 3BUQA 3C2AH 3FUIA 4AMKH 5DRXA 1FAIL 2CRZA 4PGJA 1CZ8L 2NXZD 2Z0BA 5AOMA 4ZDHB 2ZCHL 5AW6B 3ELAT 1D6EA 4ZQKA 3RVXD 1KMGA 3HA0A 5KSAB 1XSIA 3VGBA 4UMGA 1DBBL 1KBWA 2BOLA 3QEHB 4J1UB 4LAJH 4UV4L 5EZLB 4ADIA 3EYSH 5G5DB 1O6VA 2PLTA 4OY9A 3ULVD 4IBTA 5JQ6L 1FZKA 1IBFA 4C4KO 1H0DA 3APFA 5EZIH 2BSTA 1L9OA 4XB7A 5FM8A 4CL7A 2BCKA 4PVNA 5D2NA 2E9WA 3VXUD 1GZPA 4GMTH 3WIFB 2W9EL 1JPFB 3MSPA 4PJAA 3TCXA 4XX5A 1XGQA 3ARSA 2FAUA 4FQXC 2WWMD 2Y24A 1ACCA 1JTTA 4Y5XA 2OFQA 1CFVL 4LLYB 2F8OA 1KJ3L 2H6OA 3AITA 1CDJA 2NY7L 1MFDH 4Y9EA 3LQZA 4XMZA 4G7VL 4OV5B 2BZ7A 2PKDA 1MY5A 4XX1E 5DHVA 3AAZB 4HT1L 2ARWA 4LEXL 2X09A 2VISB 2Y1ZA 3CSBA 3ESOA 4XPTH 2XYBA 5D2LA 2X0WA 4DAGL 2L7JA 2XTLA 3QDJE 1LHZA 2PF6A 5DK0A 4DUWA 3G5VB 5J9PA 3NPSB 5IQOA 3ULSB 5CCKH 1OE2A 1SOXA 4GMSH 3VD0A 5DMGD 2BIOA 3VD3A 1LK3L 2PWFA 5DJZA 3NABL 1SHXA 4NGHL 2DQCL 3HZVB 5KJ4A 1U0QA 2ZAIA 2R7EB 2PYEB 1HU8A 3GSQB 2XXGA 3EGSA 2RFXA 1UCBH 4N0YL 3VJ6B 4OM0L 1NFDB 2BVEA 5CEXA 1EHLH 5IKCA 5GQBA 4NZ8A 2ID5A 1GPOL 3IJYA 4CW1A 3I02B 1HOCA 4JFPB 5E0FA 5IIEA 2X4PB 2V7NB 4CKQA 1YEEL 3K1KC 1H19A 4QTHA 3KPQA 5FF6B 1G7HB 3DTDA 2FJFA 3QI9D 5DXWA 2R2HA 3RY5A 1S3KL 1WS7A 2JIXD 2NQ3A 1HQ4B 2QGEA 4OZHF 1G9NH 5DYOA 5L4FA 4HUVB 3JWNC 1J9CT 3U7YL 2G5RA 1FZOA 2C9QA 5GSRB 4A1RA 1CTMA 2CKBB 3QC5X 2CDEA 2QJDA 3RWDA 4NN7C 5KSBF 3AT0A 3OKMA 1NBZA 2ODIA 3MKGA 2L4OA 4AJ0A 1QBLH 3M1BB 5E2TH 4JB9H 1LVEA 1AQDB 2OP4L 2ENQA 3GTTA 3CFEA 5TE4H 1L3NA 5CIPA 3TO4B 1N9PA 4JQIH 3O8XB 5LXGL 3KHOA 4P2QE 2NXYC 2G5BB 3EO0B 3TT1H 1BX2B 5I6NA 2AJSL 3R4RA 5DMJB 1ND0A 4KTEL 4P5MA 3TIDA 5F7DB 2XJLA 1U36A 2BY2A 1PDKB 4X8JA 1MNUL 1MHHA 2XA8L 3DTXB 4LCWD 1CGXA 3DYMA 4WNSA 5BOPA 1RPQA 4PLKC 2OR9H 5GS3A 3DECA 3QDJB 4E9RA 3P77A 4HWZA 3DUSB 2DLGA 2UYLA 2AP2A 2FO1A 1BVLA 3D0AA 3FU3A 4YL4A 3NCYP 3VXMA 3JVFC 1JRHH 1UZ8A 3D87B 4G6AD 5I0YA 3MRCA 2UZYA 4WIQA 5JPNB 1A6WH 5CP3A 3VFOA 1PZ5B 2ITCB 3BH8A 3U6XS 1BF8A 4NZRH 1Z66A 3UZEC 2OSLB 4PTUB 1O6SB 1QSFD 4I18B 4KJYA 3HNVH 3DVGA 3W9EB 1F5WA 4HPHA 2E7HA 3WMQA 4KQ3L 4JO2H 4K8RH 1RIUH 3B5TA 2WCSA 3DUUB 1WTLA 5IMOA 2X9XA 4AVKA 1ZA6B 1EX0A 2P8LB 4IBVA 4OQTH 4A2MA 1KGYE 2XWZA 2WBJA 5EBMA 1LD9A 4QRUA 3APMA 3SGKC 1E3XA 3G6JB 3QPKA 4W93A 4R8WH 4UUJA 4JUTA 2CKNA 1JV2B 4TF4A 1CTOA 1E6OL 1DVFA 2MHAA 1EK3A 2OW6A 4B9PA 3O4LA 1JK9B 3CZFB 3FPXA 1IBDA 4H25B 5DQ9A 4NQCE 1KBVA 1OAXL 3J8F7 2BNUA 4Y19D 1TCMA 2ZX8A 2W0FA 3LPPA 1JL8A 3I84A 3TN0C 3L2NA 5C0JB 2CPUA 3TM6A 2YQ3A 3GLEA 2WK2A 1FFOA 2IPKB 1BQHA 4Q56A 4YIQA 1GOGA 3OMIB 4EI5D 1YUKB 4P2QB 2X41A 3MV7E 4JFOB 5C0BD 4PS8A 2QKIA 1KYOK 4OCSL 3D0LB 5KUKA 4HG4J 3ATEA 2VDML 4YZWA 3TFBA 2B15A 3QULB 2DBLL 4WSJA 3APCA 1WAEA 4I0CC 1BECA 3TONA 3BIAX 2LV4A 3RGVA 4JDVA 3TA3A 5HJ3B 2ZG1A 1JZ5A 1EDQA 1U8CB 4XMPL 5GHWH 4W9CC 1EXUA 1H5BA 3D3VD 3LSOB 4UQ3B 2NY1C 5JIKA 1W80A 5AENA 1KPRA 4G82A 4G42A 3IJHA 3TVMA 2E86A 1BIHA 3WS6A 3EO9H 1F0LA 4UTAA 4FQHA 1LO2H 2RJMA 4PD4K 3KEHA 1W0VB 4U49A 1DBKL 5GS0C 2NX5E 4OIFA 4KK9D 4ZUTA 4XMTA 1B0RB 4BUQA 1ACYH 3VA2C 3LEYH 1QNZL 4GIOA 1G87A 1OF2A 2VC2L 4KMTL 4B60A 1PQZB 1VSCA 2ED6A 3MRQA 4M1DL 1ET5A 1JG9A 2V9TA 3FONA 5ICYB 2ICEC 4H1LH 2P24B 3U0PA 4X7TA 6CGTA 2PW2A 1RZKL 3QO1A 4OGAD 3CZSA 3Q6GH 5E2VL 1Z0MA 2XWBA 1B0GB 2D73A 2J2ZA 1FZJB 1E40A 4JPIA 5C0CA 3LKRB 4I0KA 1K4DA 4RISH 4ZNCD 1UUSA 4OCXH 1LJMA 2BSDA 3FK3A 3TBWA 4OCYH 5F1NA 3VFGL 2HJLB 3LNFA 2VQTA 2XPYA 1YY8B 4NQCB 1XB6A 4GW5A 4Z77B 1JXFA 3EDFA 2N7AA 1HL9A 4G7YH 3QDGE 3VB9A 3A6CH 4KKZA 1D9KC 2BRRL 3D18A 2IWFA 1D5ZA 5FX3A 3KGRA 4P07A 5E08L 2NNAA 4TUJA 5BW7A 1HXKA 2A6DB 5E9DA 3NCEB 2BXYA 2EIBA 4YXKH 3L4UA 5KYYB 3MV7B 2P1YA 4XGZB 4N2MA 2MJWA 4Y5VA 1ZLUK 3A67H 2V3DA 4JJOA 4A6YB 3HTLX 4LAQL 4NQSB 5HYEA 2H26A 4KROD 1J8HA 4TNFA 2YD9A 3S5ZA 2AGJL 4N0UE 3TFKC 3CIQA 5D1QA 5F6HI 4RGMC 5H35B 4HHAA 1ZVHA 3MYJB 5D7LE 1RJCA 5IF0A 2WUBH 1Q0XL 4L4VD 3TASA 3VFTB 2EVJA 5T1LD 1KXQE 2HFFA 4MJID 2DW5A 4RSVA 4NZDA 5E00A 5JIDA 1OW0C 1UXWA 2ATKA 3FQRB 4LASH 3OXRB 4B0MB 4AQZA 2E7MA 1F6AB 3OAZK 4AXWA 4KZ0A 4BZ2L 4ZYKA 3V4VH 4HWBL 4F2ME 2GJ6D 1MZYA 3KWWB 5IOKA 1MCHA 1T4WA 2NX5B 3DX7A 3LKSA 5F1IB 5T5FH 4CJ1A 1PCXA 4ZXBD 4PEEA 3VE0B 2R1XB 4APQD 2BZDA 2KQNA 2XPGB 4F20A 1VESA 4MA1B 1AANA 4YL9A 4LPXA 2J6EH 2HVKA 1E4WH 3BOVA 3TWYA 4BE5A 1FC2D 2FEDD 1XGPA 2YEZB 1T1XA 4PRDA 5KSUA 5GXBB 5TFSH 4HIIB 1CLZL 1WBXA 3BEWA 4ZTOH 4WY7L 3WLBB 2FCBA 2WTRA 2DMCA 4EZLA 3Q8AA 3U9PL 2A6KB 4WW2B 3REWB 3AJ7A 4JN1L 4CGTA 2EDMA 5LUMA 4IRJA 2WWOA 1RLWA 3HNTL 5GS0L 1R3JB 5DD1H 3CFQA 4PY7A 4UQ2A 5GSVB 3QDGB 1TU2B 3H2WA 1MCJA 3CFIC 5C0RH 5CMAA 4M61B 2D7PA 1CFSA 4R97C 4FP8H 4IRZA 3IBOA 3TP4A 2AABL 1EEYB 3TCLB 1HK6A 4JFHE 4AENB 4WWOA 1JF5A 4FGMA 1M9SA 3VFSA 4X98A 5DJ2B 4H5SA 1F8TH 4JRXA 1BM7A 1G6RA 1FE8H 1YC7A 3AU0A 4AIZA 4N0UB 2GT9B 4PP1D 5AKVA 4XBGB 4S2SA 2PPFA 4R4FL 1A9BB 2ZCLL 3LEXA 4HU8A 4OD3L 5D7LB 5JW3L 1SDDB 2X6BA 4KUZH 1EHNA 1TJGH 3E9UA 5D7JD 4LT7A 3UH8A 3O3EB 1UM6L 3P0GB 1I3RA 1BVNP 4WWKA 1HEJC 3E7JA 3FAXA 3EO1A 4KRPC 1CD1A 3HJEA 4MS8C 4L1BA 3X1NA 4GSDL 3LRSA 3RLSA 1DJXA 3GIVB 1QRKA 1S9YA 4FQ1H 4F2MB 3C12A 3JT0A 1JZGA 2FGWH 3PHOA 3LN4A 4PJXF 5IWLC 1A4KA 1BWWA 4LSRL 1EFXD 2R9HC 4BZ1A 5FYJE 1P7KA 2C3XA 4E0RA 2FO8A 2DWSA 3GMQB 5IB1A 3GK8H 4DK5A 4B5ZA 3GS0A 5ELIA 2W9DL 3BWZA 4WVRA 2OK0L 1SOSA 3U2SB 2A74B 1ZKAA 4XP6L 3QQ4B 4O2FB 2V8MA 4P5TA 4IJ3B 2E76C 4O2CA 3O0LA 5T1MB 1K9TA 3KCPA 4MXWL 5F3HB 3BH4A 3QSKB 3MFFA 3Q2LA 3QNXA 5KVGL 2OMZB 4FL4B 1WQVT 4HP5A 4K7PY 1MVFA 5J1TC 4HUWB 2ZXBA 2NSXA 1INDL 3PP3K 4EUPB 2TSBA 2VMFA 4OGQC 3RY6A 5BQ7B 3RWHB 4HISA 2MIZA 4YSEA 3OWRA 5HI5C 2VYRE 1AQMA 2AERT 5JQIB 4QT5B 1CS6A 1KG0A 1OGPA 3L1FA 4M5YH 3ILQD 1PLGL 1I9EA 5GIRA 4CVUA 5IFAH 3RVVC 1TFHA 4EDWH 1MZZA 2CALA 1CE6B 3HPJA 1FORL 1N5AB 3MCG1 4M1GH 3FRPG 3V0DA 5GGTA 3GM0A 5GZNC 4X6FA 2DIEA 5CSZA 4KV5E 4LF3A 2YRBA 3MBXL 1WGVA 3QWRD 3VG0L 4KDTA 4LLWA 5BV7B 3CFBB 2MQ0A 2DEYX 1AZUA 4PRPE 5EF3A 4NUGH 2DTML 3DIFB 1BXAA 4PLOB 1RZFL 2E9IA 1GXEA 5IJKA 4YBLB 7PAZA 3FO2A 4MB4A 1XXFC 2VRQA 3EJYC 2HPTA 3VFPA 4MDJA 3GBML 5IHLB 1IO4C 5IREA 1B90A 2MRYA 2YLKA 3U36B 1N64H 4GAGH 2ZYSA 3N85L 2EDBA 4FZEH 1FVDA 4ZO8A 3EFDH 2IBGA 2WSDA 2I5YL 5LBGA 1UH3A 2PCFA 4RETB 3T1FA 1UTDA 2XPZA 2A6IA 3MRDA 3ATAA 4HIJA 4IOSD 3N43B 4BH8A 5ITBH 4G2AA 1G1CA 3I9GL 3KL0A 5CU5A 1OCOB 1CGSH 2AC0A 3PNRB 3NCWA 1ID5I 1ZWIA 1HHIA 3H3KA 5CSGA 5C6WH 4HFUL 4NM4L 1U21A 4D7BA 4HPOH 4WTZG 1Q94A 1IC5L 1RVFL 4ELMF 5MHSE 4I3RH 5JDSB 4ZFGL 1I3GH 2VITA 2CUAA 1KB5L 3PHQA 1S7UA 2BSRA 2H0EA 4NN6C 2CDFA 5I5RA 2TRYA 1UA6L 2OL3A 1BBDL 3QIWB 2DWXA 4KJPD 4LSPH 1Z2KA 4M8QB 4MAYC 1TQSA 4I8DA 4ILDA 1UD4A 2B59B 4ZPVB 1QZNA 1KT2B 3L6FA 3R7QA 4I9WE 1TMQA 1D2PA 1X5KA 5I1GL 3L1OH 4PG9B 2C3GA 4H0GA 1UT2A 3EG9B 1ETB1 1Q9KA 4WV1A 3LKQA 3T0DA 3WL9A 4OM1H 1EIBA 4R2GB 3ULUE 4NUQA 3PWLB 4PSPA 1IU1A 2A5UA 1IKNC 2DQMA 5C0EB 2VLRD 2WANA 4YAQB 4NOBA 2BMKA 1P5UB 3VWKD 1FL5A 5FFGA 3VRJB 4PRPB 1NC4D 1R3LA 4I48A 4YDKH 5IB3B 3SPCA 2BW4A 5GISL 2GYSA 4AG4L 1OSPH 2YQGA 2YPVL 3MJ9A 3UGEA 3D2UD 2VSKB 4WKZB 3MXVH 4WW1A 1NBVL 1OAJA 5I17B 3RZCA 1VRSA 5CD5C 1WRFA 4NC1C 5K9KA 3WNPA 5DQJB 1UVQB 1WZLA 3P3YA 3SDAA 3TNNA 3MNWB 4AUUA 4I89A 1QSED 1UACH 4IGBA 1HYSC 4XPBH 4BSWB 1GMIA 3KJ4B 2DF3A 2EIZA 4OFYD 4Q4EA 1HESA 3FTXA 5HJBA 3EYUH 1YUHB 3IFOA 4G8FB 4MA7L 1JF1B 5EFIB 1CFTB 1V27A 3FBKA 3TEYA 1I1YB 3RU8H 2X70A 4LVHC 1E8ZA 2DB8A 4DGWC 1MAJA 2DLIA 3O6MH 5FUZL 4Q2ZB 4QHNB 5F3BA 2B3IA 1VJSA 2D3NA 3K2UL 2J73A 3LKPA 3LRMA 4L8BA 4I7ZC 1QEWB 3TBVA 1BQKA 4U31A 5DRZA 1I1FB 1AS7A 1KXTB 1KWKA 1OOWA 4JKLA 1ASOA 1E8WA 2DIJA 1KLGA 1YECH 4NQXB 1EJ6A 4KKPA 3S36X 1BVKB 5T3ZD 4U4BA 1NCDL 3SDDD 2NXZC 4RFOH 1IGFH 5HHNB 1MF2L 5JHLH 3IDUA 3IJEA 3RVXC 3ULAB 1WTGT 4LPCA 1UD8A 5AZUA 5ISZD 1DSFH 1ETA1 2XZQL 4NBZB 5CXPA 4JM2D 5F1OB 5J6HA 2ZWNA 3ZHKA 2Q8BH 3BT2L 4LDCA 2OQJA 4YHZL 2H6PB 5A2AA 4U6VL 5TDPB 3FMGL 3TYFA 4PGCB 4PGZA 5F70A 3P2TA 3CMOL 4ICWA 4P3DB 2ZP9A 4HJGB 3LKOA 2CJ3A 4HUUB 2DD8H 1JPGB 1KCRH 2IDQA 1NEPA 4K4KA 4CNIA 6PCYA 2WWMC 2F8XC 3IMSA 3F2LA 4OFYA 4A7GF 1FWXA 1RULL 3GJEA 3P0VL 4BA8A 4UM9B 3UMNA 2LLGA 1RPUA 1ACZA 2P45B 4UZGA 5FM5M 1SY6L 1XF5A 4DEPB 1EQWA 2DMGA 3NCJH 4FULA 4OFIA 3IBEA 4ZUUA 3S8GB 3PL6B 1BA9A 4XO8A 2DQHL 2LU7A 3FT1A 4PBDA 4QXTB 1KBGH 4I4WA 4RRPM 3V8CA 1FHGA 2ERJB 3MREB 5FO9A 5JQ6H 5LB1A 4HEPG 4Z18A 2J57A 2QHRL 1RURL 1AD0B 2EUZA 2A1WH 1D5MA 1VACB 2FHFA 4FJ6A 4OF0A 3Q05A 1GY1A 1WA1X 2V2XA 43C9A 2W9EH 3W5NA 5DMGC 2H9GA 3C8KA 1RUAL 3WTWA 4YK4B 3O81A 1KZYA 2Y7QB 1PW3A 3DXAD 1FN4A 1CFVH 4KWUA 4XO4A 3NQKA 3VD1A 5ABZA 1KJ3H 2NY7H 4B9ZA 1T4KB 3HHSA 5E6RB 2GSIA 4G7VH 2EIMB 4XN2A 3BDYL 3PGCA 4LHUD 3TZVA 3S3PA 1M53A 4F57L 1NGXA 3BKCL 3CVHB 3QGVA 4FF9A 4L9LA 4L2YA 4EKJA 1NC2D 3QZOA 3EH2A 3T6VA 4DAGH 4ZG1A 3HBGA 3ZL4L 4OI7A 1EPFA 1F00I 5IK3A 2IIJA 3QI9C 1A25A 4PJAF 4N9OB 4CVXA 4OBSA 4RNRB 1HH6A 5C3LD 1KTBA 3SQRA 3V4PB 5MI0C 3FO9B 4WRLA 2K8QA 4LCIL 5HGAA 5HP5A 1DO5A 1EMTH 4R84A 3UPCA 5T33L 4JDZB 4UAHA 5FOBB 1M56B 4NGHH 1FIGH 2C1PB 2IANA 1U3JA 1OARL 4WJKB 3G5XA 5HYJA 4LCYA 5CJBA 5L2KA 4MD4A 2XT1B 3H2PA 4N0YH 3WUZA 4XC3L 5D7HA 3FQXB 1COBA 3CQPA 2QEJA 1GPOH 2K45A 2ZNXA 3HHMA 2YXVA 3NK4A 4OTXL 1MCSA 3MGOB 1XF3A 3L3DA 5JPMB 5CZVH 1YEEH 4NFDA 3LNGA 2Q9OA 4K9EH 3FHQA 3GXNA 4JY4B 3GZKA 2B0SH 2WD0A 4Y2DA 1JAEA 2A9ML 1S3KH 1U8IA 1Y6MR 3N41F 4N87A 3KPOA 2H1LM 4PJCA 2Q8AL 4FXKA 3M45A 3TPUA 2EECA 4JFDA 3SCMB 4G6FD 5EEUA 3FTYA 3H9SD 1F4AA 3U7YH 1OSZA 2C4FU 1JGVL 3LD8C 2GBVA 5J1AB 1AZVA 2PO6A 1IL1B 2H8PA 3A4DA 4FQCL 3QDMD 4J8RA 4PV9A 3UADA 1IMHC 3AG1B 4G6AC 4JANA 5DI8B 1BZDA 5DEZA 1OP3K 4QRPD 4KKRA 1DCLA 3ARDD 3LS4H 3MLWL 3TBBA 3L4TA 1CDBA 1ZEAL 2E47A 5DMKA 4IRSA 5F9DC 5HD8D 4POUB 5KS9A 1DJWA 1UOLA 3U7WL 5LXGH 1YMHB 1R33A 2AJSH 2CRYA 3EOTL 2X4RA 1I8UA 4HUXB 4K3HA 4KTEH 3HZMB 1JDAA 4NX0A 5AZ2H 5KG9B 3GIZL 2QVTA 1WE5A 2FWOA 2Z64C 1BAFL 2FWUA 4ZUVA 4RFEA 1KACB 1MI5A 4MZ3A 4WDIB 4XI5D 1F2XK 1KTJA 3FB5B 3CH1A 4TS6A 1ZMYA 3LXUX 3O3DB 1TFPA 4E9TA 1IARB 1TCRB 4H44C 2BIMA 1FAKT 5GRVK 3OR7A 1ORQB 2OZNA 4RRPA 1GJIA 1FNHA 1UJ3B 4AX3A 2J6EA 2YQ2A 1JNLL 2G4GA 1AGFA 2R69A 4MX7A 4LOEA 1DL7H 3NFNB 1DHKA 1OEZW 4YDVB 5EBLA 3QCUL 3HVDA 4BCZA 1DN2A 5IOPA 5BJTB 4KQ3H 4JFSA 2EXSA 5I9QC 5HDLA 4RZCA 4P4KD 5DC2A 1QLRA 5CJQH 3AT9A 1JPSH 1IUZA 1NPNA 4LVOC 4YEEA 1NUDA 2WYHA 2P8MA 4JM0A 4EI5C 4F24A 2EH7L 3WMPA 3QWQB 1KNOA 1ZDQA 5CD3B 1KELL 2Q7AA 1AZZC 2K9UA 2XWJB 3MTRA 3VW3L 5TH2A 4V33A 3B37A 5B21A 3N9GL 4X80L 1TYRA 1EAPB 4KHXL 4P05A 4YSUA 2AQ3A 2Z31D 5AYUL 1E6OH 1AQKH 1PFCA 3O11B 2DYRB 2I9LB 1FPTH 1OAXH 4MD0B 2ZXWB 4HLZG 4ODTH 1QFWI 1UWGL 1VADA 4F1ZA 5IW1A 3OKOA 4ECNA 2D31A 4ETQB 3NMEA 3EYOB 5I8KL 2JCCB 4XVJH 1WS8A 3L9BA 3L5WA 1SOQA 2ZSVA 3BJ91 3CCHB 4GRLD 3W2DL 5IJBC 2LQRA 1TZGL 4S1DD 4W70A 1XGUB 2Z8SA 3CPUA 3JTSB 4KK9C 4OCSH 2NW3B 1TJIL 2PCPA 4UM8B 4IIQA 3V0FA 3EBHA 1K8IB 5C2UB 5TF1H 2VUKA 2RCSL 1MFBL 4CMMB 1XD1A 3T4AB 1LE9B 4DOHE 4HS3B 1CD9B 3R4DA 1GIGL 1U4EA 4YJZL 4XMPH 2CBQA 1C16A 3EBGA 4ONGL 1JN6B 1SEQL 3L3OA 4LRIA 5MEQA 2YOAA 4OAWA 4FQ2L 2JJUA 3DX0A 4GI9A 3WNNA 1O7DE 3B7UX 2D7TL 4U1MA 5L9DL 4B9CA 2FEEL 3UAAA 3OHXA 2OJEA 1HHKB 4YSRA 3CD4A 1OP5H 5C0AD 3DNKA 5CILL 3MA7B 1R5IB 3SGJC 4CVWA 5H37A 4HGWA 1VGKB 1QNZH 1N67A 2VC2H 2CIIB 4KMTH 5CR1A 5C70A 1OIOA 3WO4C 1IV8A 4M48L 4LBEA 4FQLH 3UCQA 3B2UD 1GMEA 1U3HA 2DQGL 2IQ9L 1GZQA 3VWJA 1TPXC 4KROC 5JIIA 1CYXA 1U8OA 1RZKH 3FN9A 3WAKA 5LQBL 1NCBL 2AV1A 1FCCA 5D72L 1S7WA 5E2VH 1Y07A 5K9JL 4PRHE 4AV0A 3HKFA 5KVFL 4LLUB 2VLKE 5HGHB 1YN6A 4TVPD 2WO4A 3OJMB 4NENB 2F5AL 2DAVA 4PJBE 3VFGH 3L3JB 5IEKA 3M1OA 2L7EA 1LQBC 2HT3D 2BP8B 1CN4A 4AMWA 4KTDL 5MENA 1I85C 1S46A 3OJDA 5LVEA 4OLXL 1MQ8A 1WFUA 1ZHKA 5DUML 1AGDB 4GB9A 1ZGLM 2JLPA 2Z93B 1JWSA 4YC2C 5E08H 5DEGB 2AKRA 3W0WD 1W6LA 3O3BA 1T1WB 3N44B 4OLVL 3ECUA 2OMXB 1QWHA 4NFBA 1X5IA 1GYAA 4TULL 4LAQH 1UOKA 4ZXBC 1LEKB 3OKDA 3VSTA 5A2LH 4C83B 4BXVA 3MODL 4NAJA 1T6BX 1GGIH 1A6TA 2Y07H 4XAKE 3S3BB 4DOHB 2FEDC 3GXUB 2J8OA 3FCSA 3F8UB 5EG6C 3T3PE 2YPLD 1Q0XH 1LWHA 3FSVA 2X9WA 1Z5YD 2GTWA 1I1CA 2AVGA 4NQDD 5C07A 1PSKH 4HFWA 2EDNA 4DP9X 5L8KB 4QYOA 3ZMRA 4RGOL 4XMKL 1WWCA 5EU5B 1HINL 4OF7A 3P30L 2P28B 4H0LC 1Z9LA 4J27A 2F8IA 2C9SA 3SO3C 1E30A 6FABH 3OKEB 3T77B 4BZ2H 4LGSB 4KI5F 5ID1A 4IU2B 4A55A 1UQSB 2NY0B 2F53A 3J7HA 4FYTA 3RPKA 2ZD0A 2MOGA 4PU2A 3SPHA 4Y4HD 3QJTB 4FNTA 1XGTB 4U3CA 3L9YA 4OW6A 5IBUG 1Z3GL 1UC6A 1C5BL 4O5LL 2PUQT 2EC8A 3H53A 3NSJA 2F58H 5DD6A 4FZ8L 4U1JA 1AJ7H 2AJ3A 2IH3A 2NMSA 3S88L 2KUTA 3P2BA 4PRHB 3VDBA 2EDYA 4JGUA 4PP1C 1IGTB 4WY7H 5IBUB 2VLKB 3U9PH 1RZJC 2WCPA 3DIDA 4L37B 1A3RL 4U0QB 3HW7A 3E0GA 1FL3A 4PJBB 4JFZH 3HNTH 3K7UA 3W39B 5D7JC 4RWYH 4TM9A 4HLEA 1YJDL 4NO0D 3RIFF 4HS8L 5IB4B 2AEOA 5JLZB 1VFUA 3MRLA 2Y0SA 4G8IB 3KWUA 1R9FA 3HEIB 3EJSA 2J8UE 5IP4A 4NWUL 3HUJA 4YVUA 1XGYL 3ULVL 3RNKA 1IRAY 2VZUA 5D1XA 3HRZB 3MACL 3PUUA 4P2OB 4HK3J 3UJJH 4DETA 1A4BA 2CDGA 1EHAA 5TE7H 3HAEB 1DQDH 2EE0A 1VA9A 2KHAA 3D12B 3LNEA 5FYKE 5C0DB 3VVVA 2BHFA 4HEME 4HWEL 4HMDA 3IN0A 4R7DA 1EUUA 2GK0B 3QO0A 1Z9NA 2YXWA 1MELA 1OM3L 4RX4D 3DV6A 3LEVL 3MXWL 3SOBH 3U30B 3T3PB 2CK0L 3GHBL 3IE9A 4UQAA 1I4FA 1UB6B 1I7RA 3IF1A 4NNYB 2B5IB 1QFUL 3A23A 1UM6H 2AQ1A 1G7LB 4M7LT 5KSAD 2VNCA 3ZT5A 1MRDL 5LBSA 3BP4B 1RUPL 5T3XD 3CFJB 4R4ND 4GSDH 1CK0L 4NO2B 12E8L 2XXMB 4KX8A 2Y1YA 5E24E 3GHPA 1Z5HA 1HXYA 1LDSA 1SMOA 3ARRA 1ED3A 3RHWK 4JKPL 3FSOA 1BQUA 4G9FE 4LSRH 2DQIL 5CBEA 2QELA 3SKUD 5EO0B 4GAFB 1ZVSA 4IDJL 2O1AA 1F11B 3BUYB 5D1ZI 2HJKB 2OMUA 3TBYB 4E2OA 1MRFL 3BX7C 2FNWA 3FQWB 2W9DH 5I0DA 2OK0H 1FH5L 4ODVH 2RACA 1EZVY 3VXQB 3BCFA 2ZKMX 3O6FA 1T04A 2XFXB 1N8ZB 4G6ML 2VAAA 4YR6A 4PV8A 1EDHA 1GJWA 1CFMA 3SE8L 5AVVB 1CXIA 3WEMA 4FG0A 3II3A 1HFUA 1U8KA 3N43F 2RAMA 4R7NA 4JBSA 1TR7A 3K0WA 3LZFH 5KVGH 3SQBB 2P4AB 2L3BA 3I9IA 3SY0A 4IBSA 2YBGA 1CDGA 3V8OA 3ECBB 4U6XA 1GVIA 4WFEE 4P5KB 2B08A 1BVNT 3L4CA 2BSBA 1DQIA 2J8UB 4KK6D 3V9CA 1N2RA 5C0FB 5A43C 4OF6A 2A73A 1IAIL 4L5FE 1X7QA 2D8KA 3GSNB 3QG6B 1DQML 2NY6B 2B1HL 1AO7A 4NKDA 1BIIB 4QHPA 1IILE 3B9EA 4YUEL 1PLGH 3IM1A 1XO8A 2OSWA 5G4OA 2PYED 1BLIA 3ECWA 4M62H 1WLHA 4WKXA 5ES4B 1H8LA 3KE0A 3RB7A 3WFEL 2J3SA 1PEWA 2E8ZA 2FIKA 4I3SH 1CICA 2ADJB 3KDPB 4JEGB 4W6YB 2ZZUT 2JJTC 3N2JA 3UJTL 4OD1L 3JWOC 1T3FB 3I6GA 3KYNB 4XCNB 1HCZA 5E94A 1DUYA 1XH1A 2IGFL 4U4IA 3MRNB 2DIAA 2Y3AA 5AEAA 1RZFH 3O41A 1I8IA 3MOAL 3WKYA 1J10A 1SVBA 2OKMA 3BAJA 4N0RA 1GSKA 4EBQH 5IR1A 3LY6A 4OSUL 4G9FB 5E5UB 4QTFA 5CS7A 1RZ8A 4KJPC 3N85H 3ROLA 2W07A 3ZL1A 4OCRL 1QFWH 5EBWB 3QUHA 4N6RB 1EFQA 3GSRB 3HZYA 1ZLWH 4AWJC 1E27A 5EIIB 5CINL 3GUTB 1U30A 3DETD 4PRBB 3TO4D 3O8XD 1DQQB 3VFNA 3NSYA 5EZPA 4HKZB 5BPPA 3ZO9A 4XO5A 1P4BL 4YMPA 3H9ZA 4A7QA 5BVJB 3WE6B 3I74A 3FPYA 3EGDB 1T5XB 5AL8A 1AE6L 3G08B 4HJJH 4J4PA 3VAEA 1W15A 4HFUH 4NM4H 2DY2A 2O5YL 1BF2A 3VWKC 1RVFH 2NYZA 1BJ1H 2EDOA 2ZKHL 3H2QA 3Q8FA 4MDRA 1FL6A 4ZFGH 1ASPA 1MW1A 4OCMC 5D7KE 3QDJD 1QP1A 3I75B 5EU4B 5TDOB 4OZIA 4GRWF 4OLUL 1AGCA 4K15A 4UIKL 1UA6H 1BBDH 5DK3A 5GGSB 4LSDA 1A8ZA 4A2HA 4AEHL 5FDWA 1EEQA 4GQPH 2YGPA 1JUFA 4MMXC 3FS9A 3KBFA 4HGKC 4HG4K 4JG5A 1NFIB 2D7QA 3P9LA 4EEEA 3HC0A 3T0BA 3O0RL 4Y2OB 4PJ7A 4Y88A 1H3PH 4Z6AT 3BPLB 3VYPA 2VL4A 1GTNA 3FB6A 4Q89A 2B2XL 2PR9A 4YXHL 4KRNA 1UURA 2B20A 4M7KL 3SYPA 3ZXAC 3DRTA 3AT8A 3DROB 1HHJA 1L4IA 1MW0A 1Q1JH 3WLWD 1GH7A 3US1A 4ANWA 3RTQB 1FGNL 1S8DA 1UOWA 2H3NB 2YPVH 3O2DL 4CKVX 1C08B 3SBWC 4P23A 1TQUA 3C6SB 1ZHBA 3LMJL 4MA8H 2Y4SA 3VFWA 4N8VA 4YN3A 5D2NE 2P5WA 2EC9T 1DVSA 1VPOH 5L4MA 4L3CA 2H2PC 3M17B 2HLAB 4G9DA 2MH4A 2PTVA 4IHBA 2ZOKA 1XH0A 2BNRE 5C8JB 1KCSH 3SDDC 1HILB 3D5OF 4PREB 4UIMB 4L29A 4XH2B 3E38A 4JFEE 4F7MB 4WSKA 2AZUA 4PAZA 2N1TE 4JFTA 3MUJA 4LP8A 5I0VA 4MA7H 3B1TA 3MLTA 4JM2C 4N8CH 5GRXG 3IMTA 2WBKA 4NYLB 4P2QD 3KYAA 4NQQA 3D48R 5DR5L 4BHUI 1BQ5A 4EN3D 5LAXB 3L2MA 1WIOA 2KDGA 1BZOA 4NHUA 5HHXL 5DGQA 3K2UH 3KPPA 5L8JB 1GW6A 3MCKB 1GOFA 1E8YA 1YQVL 2DH2A 4WZ9A 3D2TA 4RDQG 1CBJA 1G7QA 1X9LA 4N3TA 5F0PB 4JDTL 4AEEA 3RL1A 5J6GB 2DJUA 1QLEB 4KVNH 4K7PX 4LKXB 5E2UH 5A16A 3GSOA 5EN2A 4ZFQA 1BOYA 1J1PH 3FKUS 4C4UA 2V7HA 2YSTA 3E1ZA 1IGIL 3NZHH 5F7YC 3D9AL 4E36A 2IGLA 4ZZKA 1PTZA 4J3OF 4JUSA 3ZUNC 4AQAB 2XZQH 4XZ4A 2OJZL 3KAAA 3T3MF 3T09A 1SYVB 3TIEB 3OZ9L 3L3HA 3BT2H 3WN5B 1NKGA 3BPNC 1MRCL 1U6AH 4OZGA 5I8CA 1I1RA 4U6VH 1GC1H 3TESA 5IMMB 4WHYG 3GB7A 5DRNA 4WFFE 1JNNL 4Z5RB 3TTSA 1IC0A 4X9GA 4Z0XA 1FFNA 5I1JH 1TYJA 3CBJB 4QRQB 2OW7A 4TSAL 3TL5A 3P0VH 1FFRA 4OGZA 1CLOL 4RFNB 2VABB 2EKSA 1ZCRA 2VUYA 4LPWA 3II1A 2ZUQB 1KJ2A 1HXMB 3QG7L 4Y5YB 5D2NB 5LKNA 2BVOB 1I8KB 4KY1L 1XGQB 4NQCD 2OCJA 1F6LL 2BNRB 4F33A 5DU7A 1Q9WB 2HWZH 4JZJC 4YDMA 4JFEB 5C7XL 1MJJA 3IB4A 1XL4A 2QHRH 1RURH 1R3IL 3F3HA 2Z92B 3MV7D 4Z7OF 1NDMA 1GGCL 2W0PA 1J0JA 1RD6A 1YAIA 1Z9SB 3UPAA 3P4NA 3F7KA 5C0ND 4QLRA 4FFYH 4KUCF 1A3QA 5L2JA 2WYZA 5J5EA 3WY4A 4XR8C 4LL1A 3BDYH 3PWPA 3GPSA 3X12B 3QEQE 2WWKO 4F57H 5T3ZL 3EIFA 3BKCH 2CJSA 2QGCA 3AG3B 4Z7IA 3G3LA 2ZWSA 4I0PB 1G84A 2CLZB 1LWRA 3QUYB 2UZXB 4JREB 4C58B 4UQEA 1TETL 3DK2A 3TA4D 3JV5A 1UZGA 4UU9B 3BUTA 1MCLA 4XVOA 2JE8A 3H9HA 3RG1C 1NICA 4FQXB 1FNEA 4LRNL 1MWAB 3KPQB 1S7XB 2XVBA 4GUPA 2FJFB 1S7TB 3ETBJ 4F15C 3QEUA 4QGTA 4XC3H 1FZMB 1MCFA 3ARDC 3C5ZC 4QXUL 4D9LH 2P52A 4YSPA 3ZTNL 2E9GA 4JN2B 5HD8C 3W56A 5I15L 2DWDB 3ZRCC 3UZEA 1JERA 1J0ZA 3QCTH 4LCUB 5ENWB 1DE4B 4HDIB 3FTGB 3RURA 1N5YL 5IY5B 2NZ1A 5DJ8A 3CFEB 2YZ8A 3NACH 2IFGA 2JB6B 4NAMA 3QDGD 3MV9A 1BV8A 3RWFB 2D3VA 2IMMA 4XI5C 1XR9B 1PFOA 2X4UB 4TSBL 5ERWB 5K9QG 2YGVA 2EADA 3TIDB 1MXDA 1F4XL 3SGKA 4X8JB 4ZD3H 4H13C 5F7MC 1BAWA 1JVKA 4P9MH 3DV4B 2QQNL 4ZW5A 1ZEAH 4U1NB 5B3JE 2BW5A 2ZE0A 4RMVA 1TNMA 1ADWA 1QQDB 3GMRA 3Q9QA 3U7WH 2ADYA 1XMEB 2FT6A 4PJCF 3RX8A 4BFIB 1DVUA 5CHNB 2HMID 1AQ8A 2YIHA 2OX5B 3MRKB 5CJXC 5LAPA 3UTTE 3UX9B 1Z5LB 2NSQA 3TN0A 3QEQB 5D7LD 1DQJB 2DKMA 2NSMA 1ZXKA 2VO8A 3GIZH 4P4KC 4XZUB 3ILPA 3BH8B 3RPBA 1ORSA 1TYEB 3T8XA 5AB2A 3B2DC 2BHUA 2ATAA 4UDUB 1JD9A 3WTXA 2CH8A 4O2EB 2XLLA 4AGPA 4H7VA 5JA8B 2MNJB 3QQDA 2C26A 1UZ6E 3EOAB 4HWBA 1HNGA 4DF9A 3BZEA 1E3ZA 4XNQB 4Z3IA 4G6JL 3DHJA 4ENED 5AAMA 5IVXF 1V10A 3UO8B 5KS9F 5GJTL 2EO9A 2Z31C 4XN1A 1DYZA 5C08A 3S8FB 4G1MA 3BPOB 5FYLE 1BAGA 3CFDA 1CT8B 3ZE2F 3V5KA 1NCTA 1JNLH 2WBJB 1FO0B 5EBMB 2BIHA 4QRUB 3QCUH 4XXDB 2FR4B 4KKAD 4WTQA 1NSNL 3P0YL 5EEZA 4DPRA 5DDHA 3ARTA 3WCYA 2X0UA 4ACTA 4XPHL 2MHAB 3UACA 4Z78A 4C56E 1J9RA 2EH7H 3NVQA 1BQHG 4PW4A 3BSHA 3QNZB 4KVCL 2BNUB 4S1DC 1P7QA 2VDKL 3U0TA 4B96A 4U6YB 5E8NA 3VW3H 3KPRA 1JNHA 4KHTL 4GKLA 2IBZX 4W68A 1MCBA 2Z91B 1THCA 1B88A 1MCOH 2P8PA 3QE5A 4KHXH 4IM8A 4Y1AA 3PWVB 4ONFL 1W91A 2UWEE 2B8OT 3L9RA 2PW1A 2QKIB 1DBJL 2EH8H 2XZCL 4NRXA 1WAAE 3BXNB 1WD9A 4ODWA 1T89C 4JFHD 1MVUB 5D4JA 2WZPD 3WUWG 1UG9A 1V5JA 3HG0A 3CVIL 3VMPA 1ZLVH 2XI9A 4XNZB 5F7AA 2A9CA 3CX2A 1EXUB 1FH2A 3HCVB 4Y9FA 3WUWB 2LOEA 4WFGE 1M42A 3BWAA 5ESAB 3UTTB 4G42B 4KTGA 3ZZSA 1D9KA 3PAYA 3TVMB 2MKWA 1YPZE 1GGTA 4FQHB 1TTRA 3VD4A 3B2UC 5TDNB 2K4AA 2ZCZA 4WUKL 1MH5A 3MJWA 2XN9E 4AV5A 3HPLA 1J0YA 3EAKA 2ENJA 4ONGH 2NTFB 4Z7VE 3H3BC 5AW4B 4XHJD 4XVTL 1OF2B 4LOUC 1AMXA 4FQ2H 2EO7A 3JUZA 1D3CA 1NOLA 1AP2A 4H20L 3B7RL 2D7TH 1TUPA 3ZTDC 5EF1A 4PI2A 5FYJD 1RSFA 1TZAA 3C8DA 4YHOH 3MRFA 5CILH 4KZEL 2J2ZB 2NW2B 3E9TA 4JPIB 5FHBH 4A7TA 3P2DA 5EV7A 1OW0A 5IW6A 4Z7UE 3QHZH 4C56B 4NT6A 1NCNA 3H55A 3ZDXE 3I2CL 2BVQA 5I23A 5M7QA 3I9PA 2C9UA 3A21A 2IQ9H 5HHVH 5DMYA 4WI4A 4K07A 4YSDA 5LQBH 5ESVA 3WNJA 3D18B 4TUKL 4XCFH 1MFNA 5D72H 4JK0D 5K9JH 2ARJB 4PRNA 4TUJB 1HHGA 5KVFH 5EIVA 1WCQA 2P44B 4L1DA 5IFHL 4V2CB 2AAVA 2DMHA 2UWEB 2VGLM 3QIWD 5CCJA 3ALWA 2W65B 1LDPH 3KPNA 4NFCA 3HKZA 3S48A 3FN0H 3W9DA 1NCAL 4OLXH 2X87A 4YQXL 4TNWK 5DUMH 3HS8A 2Z7ZA 4OLEA 1QMUA 4L0PB 1PZAA 4KZDL 2AANA 2L7QA 1J0IA 4R2GD 1HDMA 2UZIH 4OLVH 5DRWB 5KJRL 2PCXA 1NUNB 3KPLB 2ZICA 4TULH 3FUJA 4RGNE 3V0WL 3VYOA 3H85A 2DZEA 1IBBA 2EAEA 3I9AA 1NMAL 3ILDA 1UXWB 3TS8A 4Y4HC 4PRPD 1T0MB 4EIUA 1YPZB 4U3SA 1RIHH 3K6SA 3CU7A 3A22A 3BSZL 1YNKL 1A14H 2XN9B 3DX7B 2XRAL 1TQTA 3PQYE 5L7XL 2EABA 3BZDA 4Z7VB 4FS0A 2IG2H 2UX7A 4G72B 5LCVL 3D33A 1N3NA 2YC1A 2TRHA 3AREB 3GLZA 3LN9A 3NZ8A 4FXGB 3V6ZA 4OGYH 3O9WB 3P30H 1JZEA 4ZPTB 1G4RA 4N26A 3SJVE 4Z7WA 3PF2A 3TT3L 4PRDB 3DHUA 2Y23A 3ZDYE 2X6CA 2ZOWA 2KBGA 4G5AA 1PLCA 1PL3A 2IH1A 3VXRA 2YFNA 4UNTA 2BINA 3AXLA 3PDDA 5H4ZA 2COQA 1KY7A 3FJTA 4U1IA 5EMYA 4Z7UB 1MHCA 2F15A 4FHKA 5E2WL 3ZDXB 1ZJBA 4UINL 4DKEL 2LT9A 2WB1A 4CDGC 2V2TB 1C5BH 2BP0A 1LXMA 2JXMA 1X5AA 3BVWA 4GAYA 1JHTA 4PY7B 4QIRA 1TZHB 4UQ2B 4WJ5B 2IDFA 5TD4A 5KVMC 5MHSD 4FZ8H 1XMWA 3ML9A 1KB5A 5IWLA 2VB5A 2NY3B 5GGQL 1H8OA 3JYCA 1PG7L 4S0TD 3L2LA 2NY5C 5FKPA 3S2CA 5I1KL 2WLZA 5KAQG 1EZSA 5AG8A 4N90E 5IQLA 4X98B 1DJIA 5FGBC 1YJDH 1GHFL 5EOCL 3TJEL 1MJ7L 1UH4A 4I9WD 3MC0A