2FT6A

Structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Basic requirements for a metal-binding site in a protein: The influence of loop shortening on the cupredoxin azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ft6A00
1L9QA 1ASQA 2ZOOA 5B1JA 4X4KA 1RCYA 2YXWA 5D4HA 2VW6A 1F56A 2DYRB 1MZZA 1NDTA 1AZBA 4E9RA 2B3IA 1MG2C 3EH3B 5IY5B 3BQVA 2VM3A 1BQ5A 3NJIA 4M4RB 3FSVA 1CC3A 3C75A 4HHWA 1PY0A 2FWLB 2ZWNA 2X88A 4PAZA 3FPXA 2W88A 6PCYA 1PLCA 1UATA 2W8CA 2IDSA 4KOCA 1SHWA 2FNWA 3D12B 9PCYA 4DP1X 1EHKB 1JZJA 3IN2A 2R7EB 2A3TA 2DY2A 1N70A 3NJJA 1J5CA 1SHXA 4YVNA 3FSZA 3CDZA 4A2HA 2E86A 3ZBMA 1M56B 2R7EA 3QPKA 3UADA 3T6VA 3EHBB 3OM3B 2YAHA 5B1KA 4F2FA 1ET8A 1ZV2A 3HB3B 5EHFA 5B1BB 1GS8A 2OJ1A 7PAZA 4YSPA 3TBBA 4ENZA 1TKWA 1BAWA 1NIAA 2X87A 3X1GA 3N55A 4GP4B 4YSRA 2WO2B 4HCGA 1MZYA 5PCYA 3FQ2A 1ID2A 5D4IA 4EF3A 3AG2B 3NP4A 1MG3C 2GBAA 2NRDA 4CSPA 1TEGA 2PCYA 3JTBA 4A68A 1JZIA 1OE1A 3L45A 4HALA 3NYKA 2XVBA 3T71A 3QJUB 1AQ8A 4DP7X 5I6KA 2VM4A 3NJFA 2I7SA 2Q5BA 5I28A 1J5DA 5B1AB 4P5RA 4A2FA 2OCCB 1OE3A 2AVFA 1KBVA 3X2QB 2IH9A 1SF3A 1PNDA 4BDVB 6PAZA 1I53A 2MTAA 1KCWA 3PCYA 1SDDB 3WI9A 4DP6X 4DPCX 3PPSA 5ANHA 1JVOA 1GY2A 4WTQA 1AG6A 2PPCA 1NINA 4YSTA 4BDVA 1HFUA 1RZQA 5AFAA 1AS8A 1SDDA 3OMIB 2YQBA 1X9RA 1NIEA 4GY4A 4HCFA 4YSOA 1L9PA 1A4AA 1WA0X 2PPFA 1PZBA 1J9SA 3T6ZA 2MRYA 2PP8A 4HAKA 3H56A 1J9TA 4W1TA 4E9QA 3AG1B 1IKOP 2BP8B 5B7FA 1NPJA 1A65A 2J55A 5AZUA 5D4JA 4BWUA 2HX9A 3DTUB 3N2JA 2IDQA 1BXVA 2H47C 1XB8A 4BK5C 2BP8A 1ILUA 2JFCA 2WSDA 4QLWA 1YLBB 1AG0A 1EZLA 1JXDA 1QLEB 2HX7A 1WS7A 2XX0A 3ABLB 4Q8BA 2N0MA 1PZCA 4AX3A 4DP5X 1VLXA 4E9VA 3NSYA 2CJ3A 3NJNA 2UXVA 4KNUA 4DP9X 1TU2A 3KW7A 3PAZA 2YAEA 3X1NA 1AAJA 3OMNB 1BEXA 2FQDA 2H3XC 4M3HA 4AKOA 3X1FA 1NZRA 1IBYA 5FC9A 2P80A 1E5YA 3CVCA 1SJMA 1V54B 1N68A 1IBZA 3T6XA 4WKXA 4AKQA 1WA1X 5E9NA 4NB7A 1PNCA 3AG3B 2CUAA 4YSUA 1CUOA 4W9ZA 4DP4X 4YSSA 1V55B 1A8ZA 4KNSA 4HZ1A 4UAHA 2GI0A 2UX7A 3IBOA 5I6NA 3FS9A 1OOWA 3ABMB 3NT0A 2HXAA 4DP2X 1WS8A 2FT8A 2UXFA 4Q89A 1OCCB 4GXFA 2QDWA 4JKNA 1SFDA 2IDUA 3UABA 4A67A 4P5SA 1BYPA 2BZ7A 2EINB 5B7MA 1L9OA 2PPDA 2XX1A 3QJRB 2PP9A 1OCOB 3WG7B 3QJQB 3JT2A 1BXUA 4GP8B 2IWEA 1AANA 1SFHA 2YXVA 2CBPA 3WKQA 1JOIA 1BQRA 3UAAA 2RACA 3S8FB 2VW7A 4JHUA 4G72B 3QJVB 4UF7C 7PCYA 4N4YB 3S3DB 4JHVA 1FFTB 3H4HA 3IE9A 4G70B 4E9SA 1J9QA 1AS6A 2HZHA 3TU6A 3SBPA 5A7EA 4HHGA 1ET7A 3NJMA 3NSDA 2IDFA 3UGEA 4N8UA 3WKPA 4E9TA 3GYRA 2GIMA 2IH8A 3CVDA 5AKRA 5TK2A 1AR1B 2AFNA 2ZXWB 1J9RA 1ZDSA 3NJGA 4UANA 1KBWA 2TSAA 1PF3A 3ASNB 5I26A 1BQKA 4A66A 3SBRA 2XXGA 2XV3A 3DKHA 4TXVB 1GYCA 3HEIB 1NIDA 3S8GB 3FSWA 1ASOA 3FYEB 3UACA 1DZ0A 3QQXA 1R1CA 4E9WA 3RYMA 3MBWB 2EIJB 1RKRA 2FQFA 2YAQA 2PLTA 3EH4B 1GS7A 4KOBA 4A2GA 1E65A 1ZIBA 2Q9OA 1L9RA 2PPAA 2B08A 5I6LA 1JZEA 3PLYA 2Y69B 2QT6A 1AS7A 1BXAA 3WIAA 1OV8A 1NWOA 4DP0X 3FT0A 1KCBA 1AIZA 1V10A 3NJLA 2CAKA 3SBQA 1E30A 2EIMB 3OMAB 4DPBX 2I7OA 3WNIA 1PCSA 1AZNA 1ETJA 1ET5A 1OE2A 3ERXA 3AY2A 1CYWA 3KW8A 4KO5A 4QKTA 3EH5B 3UAEA 1AOZA 4ZK8A 1DYZA 1URIA 2BZCA 1NWPA 2TSBA 1ZPUA 2IDTA 2VSKB 2XV2A 2YAFA 2XYBA 4NAJA 4DPAX 3OD3A 1IC0A 1OCRB 1GY1A 5LDUA 1NPNA 2FQEA 3NJKA 3V9CA 4A2EA 2BP0B 3TASA 1ILSA 3ZIYA 4BXSV 3ASOB 3IN0A 2PCFA 5TK4A 3NSFA 1JZGA 1JXGA 2J5WA 2FQGA 3U25A 1T5KA 2BP0A 1GSKA 3FSAA 4G7SB 4K9JA 1ASPA 3FQ1A 3ABKB 2PPEA 3CG8A 4HIPA 2GC4C 3FYIB 1E5ZA 2HX8A 2XXFA 1JVLA 3IEAA 3WNJA 4YVUA 4GP5B 1HAWA 1KGYE 3PAUA 1NIFA 3FU9A 2CCWA 1GS6X 2JXMA 2IWFA 3TBCA 4YSDA 3TA4D 5B3SB 2QPDB 2DYSB 1OCZB 1HAUA 1AZUA 1NICA 4DP8X 1PLBA 3FU7B 1X9UA 5I5MA 2I85A 2BW4A 4KO6A 1FWXA 2XUWA 5I6OA 3X1EA 1XMEB 1ADWA 2UXGA 3DIVA 3GXUB 1W8EA 1KV7A 3FU7A 4G7QB 3CDZB 1AZRA 2BWDA 3V9EA 3OQRA 3AZUA 4YL4A 1PZAA 1KYAA 2FJSA 3ABGA 1TEFA 1GR7A 4YSAA 2UXTA 1PLAA 5PAZA 3QJSB 5F7AA 3AG4B 3T6WA 2XU9A 1FA4A 1AZCA 1M9WA 1BYOA 3S3BB 1KDJA 4AKPA 2QDVA 2XWZA 3T9WA 1CURA 3AW5A 4NERA 3BVDB 1OF0A 4A2DA 2VN3A 4E9XA 2YAOA 2Y1AA 5I5IA 2VW4A 3ZX1A 4F7KA 1NTDA 2HRGA 4L0PB 1A3ZA 3ZDWA 2IWKA 4YSEA 1MDAA 2GB2A 2AZUA 5F7BA 3X1BA 1JXFA 8PAZA 1XB3A 3CVBA 4FA7B 3NP3A 4KO7A 3EF4A 4F2EA 2DWTA 4AI7A 1E67A 3SQRA 2HRHA 3FQYA 3CZUB 2YAMA 1A4BA 2P80D 1RZPA 3G5WA 5I6MA 4YSCA 5B1JC 1PMYA 1XB6A 1PAZA 2IAAC 2VSMB 4FAAB 2PP7A 1A4CA 2CALA 1WA2X 2BWIA 4BXVA 2GC7C 1NIBA 2QPEB 2UX6A 1QHQA 2DV6A 2EIKB 2J56A 4YSQA 3QJTB 2AZAA 1JZFA 2ZONA 4HCIA 2VMJA 1CYXA 1L9SA 2YARA 2HLEB 5I6PA 2EILB 4KNTA 1L9TA 1QNIA 4G71B 3MX0B 2OV0A 2BO0A 3PAVA 3H4FA 1JZHA 1JERA 3FU8A 1M57B 3S3CB 5B7EA 2AANA 1IUZA 1W6WA 4MFHA 4KO9A 3NSCA 5I5JA 4E9YA 1SNRA 2GSMB 4CSZA 2FT7A 4BWWA 2FT6A 1AACA 1ZIAA 1KDIA 2JKWA 2LLNA 3FPYA 1B3IA 2H5UA 2FTAA 2J57A 3PXLA 3NJHA 1GW0A 1W6LA 2YAPA 2XV0A 2BW5A 2BHFA 2XLLA 1WAEA 4BWTA 1SF5A 2GHZA 2DWSA 4PCYA 1ZDQA 2WO3B 3GDCA 4AZUA 4RH4A 4G7RB 4GYBA
chains in the Genus database with same CATH superfamily
5GZOD 3JWNH 3SCMC 3F2LA 5LXGL 1IGTA 4LLYB 4P2QB 3OAZH 4XPBH 3KAAA 3T6QC 1EBAA 1RZJH 4ELKB 1AD9A 2Y06H 2Z7ZA 4NQDB 4BSJA 1MHCA 4J39A 4CDGC 1OAYH 4K3JL 3UFIA 1RUQH 2FWSA 1U0QA 3PQYD 4GUPA 3W0WE 3ZZ1A 1H3GA 2VM3A 4OZIA 3FSVA 3UAFA 2MHAB 3TC9A 5K69A 3GKWH 4G43A 1T03L 4UZUA 2FSEB 4ZAKA 3NCCB 3QWOA 2HKHH 2HTLC 4KOCA 3FZUC 2W81C 2FJFA 3D12B 2XZAH 3AACA 1J86A 1N70A 3QZLA 3WEXB 4CC0A 1I9RH 3HZMA 4S1QH 4N2FA 5IBUG 3MLTB 5IVZA 2DLIA 4OZ4A 1JD9A 2J8UB 3S98A 1CFBA 2AEQH 5C09A 3SKJH 1HL4A 1IIIA 4LIQE 3NABL 1A1OB 3T6VA 1U8NB 4P4KD 1CD1B 2GY5A 5HHXL 4WU5A 5I74C 3DX9B 3EH1A 5AW0B 4Z7OB 1WBZB 5B1BB 3P2BA 4JPSA 4P23B 2WBWB 3BZEA 3JQOB 2FUQA 2GPZA 4Z7UF 3FRPG 4OF7A 1MUJA 2IBBA 4MX7B 3QIBB 4R97C 2LLLA 2EDBA 1KBPA 2ISDA 2IV9A 3BVNA 1IO4C 5ICYB 2YPVH 2ZP8A 3ULUF 1EJ8A 3KDPB 4AYFA 1DDHB 3LEVH 3O6LH 5K33A 2IH1B 2OJZL 4N1EA 1JWSA 1AVAA 3NP4A 4X4MA 2QZQA 3ZYJA 4B0MM 1E40A 3L3OB 3EUUA 3JWOC 2G0KA 4ZSOB 4EN3D 4KK5C 5FO8B 1LNUA 3RVUC 1FGNL 1OY3B 1PFCA 1UWEH 4Y4FA 3RPIB 2FJGA 4BQ6A 4B50A 2LVCA 1X6NA 4CBPA 2CG9X 4IBQA 3H7BB 3WTYA 2PW1A 2VQUA 2WLIA 4K5PA 1GGCL 4XCCH 3VX1A 1I31A 1M4KA 2BSRB 2C7FA 4Y2DB 1RULH 3BZFB 3S2CA 1KGWA 3S96A 4NN5B 2N59A 3NZUA 1BYNA 4R0LB 2ZCLH 5DQJA 3ARGC 4FMVA 5GS0L 2IH9A 1WV7T 2WBJD 3CD4A 3QXWA 5FUZH 4IKJA 3LV3A 5DTFA 5IBUB 1K3ZA 4EE2A 3GMNB 3LSOA 2WUBL 4IU2B 4U6TA 3V9FA 2EDYA 1GY2A 1A7PL 1YEDB 5DHVH 3QZWA 4O5LL 2IVFC 4WUKH 1BD2D 4UV4L 1VJSA 1XCQB 1IGFL 1ND0B 4ORGB 2FYYA 4LEEA 5KVFH 3EJRA 3V6FB 3FRPB 3QCTL 3CZJA 1H3PH 4V2CB 3CVHL 4HUKB 4L4VD 2Z9TA 4P59L 4W6YB 1ZJAA 1A7QH 4MA3B 2QADC 3P2DA 2ZWLT 3EADA 3PQYE 1HN1A 4IW4C 4ZBJA 5FYJD 1JVKA 2CR0A 4PRNB 4GLRH 3ULSB 4A7VA 4AC2A 3N2JA 1OCWH 3BXNB 1ZHKB 1QLEL 3ZE1E 1SEQH 4LLUB 2DQHH 3H55A 3UTTA 1CDHA 1H3VA 2CHDA 3CFKA 4GUCA 5I15H 4NC1E 3N1MC 3VW3H 2HVKA 3VD7A 1O7SA 1RXLA 5HVHB 2N7SA 1EMTL 1MCQA 2MQGA 2GITA 3JV4A 3K4DA 3CFCL 3P11L 5D7LD 5GGVH 5LBSL 3S35L 4DP9X 4LDOB 1OF2A 3BO8B 3GI8H 3C60A 3EFOB 3Q01A 5EH1A 1G7HA 2NR6C 3BFOA 5FC9A 4D0DA 4XPGH 3RTQD 5FDWA 1AD0A 2E7CA 2BXYA 3GSNL 1TNMA 3KLAB 2GW5A 4GRWH 4NKIH 2VH5L 1F6AA 3KJ6H 3O4OC 5DSCB 1OT2A 3NEEA 3G08A 4FS0A 1YPZE 1QW9A 3Q2LA 1SUHA 3N85H 2W0LA 3H85A 2NDFA 3VXTB 4JFTA 2BS9A 5IJCC 5E24E 1HS6A 2FT8A 2EDJA 1P7QA 2QGBA 5EUOF 4MMXB 3WL9B 3M7FB 4JAMA 1IV8A 3B2UC 2B2XL 3L2MA 3B9DA 3HMXA 4PWIA 1B6UA 1FVCB 5E9AA 1ITBB 3NFSL 3AXLA 1KCRL 4L23A 4Y5XC 4XMKL 2A6JA 2CR3A 5KVMC 3NBNA 1K4DB 4QRTA 3L1EA 5E8OB 2HRPH 4A6YB 3GZPA 5JHMA 4X98B 2EADA 3P2TA 1AR2A 1WRFA 3V5HA 2UZXA 3KR3L 2YGVA 2JKNA 1KNOA 2WMPB 1LXMA 3DHJA 3IMUA 3SZKC 2ARJA 2HKAA 3QUGA 4P0DA 1FFTB 3AAZB 2F58L 1VACA 2HZHA 5E2WH 1CFQB 2BVPB 2ZXAA 4PP2B 2XWTB 3BKJL 2DWDB 5DEJA 1BD2E 1E6OH 5HHMD 1F1DA 4GO6B 5MP6H 1OKEA 5JORA 5ESVB 1YNTB 5IBLC 2H32A 4FABH 4D9QD 3MLXH 1X9QA 4UANA 2JVUA 1NGZA 3GSVA 4L4VE 1ES0B 5C0GA 3U7YL 4YX2L 4HUVA 4OM0H 4PJ8C 3K2IA 2DRUA 2XV3A 1LO5A 4I3RL 1NIDA 5DK3A 4AQ8A 3S8GB 3I02A 1BEYH 4M93B 5FYJE 1L6PA 5TQ2H 3TH4T 4G1EA 1BBDL 1Z9SA 2OLDA 3BVTA 1BQLL 4F8OA 5F8RC 4DZBB 3KPSB 4C59B 1V7MH 4QCIB 5D1XC 3EJTA 5LGJB 3RDTD 3CSYB 3CSFA 4CW1A 1OGTB 5JQ6L 4XT1C 5D7LE 3RUGF 4XNXH 1I8IA 1F3JB 3HE7C 1SLUA 2VERA 3MBWA 4NQCB 4XMVA 5DCCA 2V9RA 5F9JA 5EEWA 2WUCL 3FN3A 4K3EH 4PJHE 1X5FA 4UWQB 1F58L 3BWAB 4FCAA 5J11C 4KNQA 1A22B 2QQKH 1OV8A 2XN0A 3FQNA 1VFUA 3LB6C 5CSGA 3UC0L 4AZ8A 5SV4A 2OI9C 2YJQA 4DP0X 5IHWA 2KZ1B 1BM7A 5JYMA 3QB7C 5BZXA 5JUEL 4MJ5A 2OP4L 3MDJA 4QNPE 2H6OA 2QGCA 4MMZA 4UQCA 4FXKC 2I7OA 4P57A 2DWEB 1FVEB 2N1KA 3GBDA 3AY2A 2M2DA 1G9MC 3CFUA 3TZVD 1EHAA 4NUJB 1YEWA 4HDIA 3IE4A 4XMUA 3N42F 1AOZA 4NYLA 2EVHA 1NFDF 3MLUL 5F9DC 4ETQA 1RJZB 2I60L 4RGOL 5DDHA 1EZVX 5DD3H 3NJKA 1IEBB 2E27H 5KAQF 4XBMA 3AY4A 3H2QA 3CDFA 2NY2C 5LBSA 4N0UB 4RX4A 2BVOA 2AV7A 2WZPA 1T5KA 2XIDA 3EHBD 4XNMA 2BP0A 3CE1A 4FC3E 1P4IL 1M42A 3MCLL 1D5IH 1W15A 2A73B 3LN4A 5FW8A 4TMPA 2ATPA 3S6CA 1LO3L 1JXKA 3FQ1A 3K4ZA 4PLNC 2D73A 3WNKA 4WNQA 1G7LB 2D7TL 5D7JB 1KGCD 3OSKA 2CLVA 3N1FC 4W9EC 3UAJC 2HKFH 4MS6A 1JVLA 4XCYB 1EZVY 2C1OB 4DZ8A 2CBTA 4U1IB 3MREB 5BV7L 1KCUH 1MFVA 3HMXH 2ZKMX 5GGQL 3NCFB 3UG3A 1UG9A 4FQCL 3ZKXB 1QRND 5I2IB 1JRHL 5DQDH 4DT2A 3MODH 4CU7A 4L9LA 4GAJH 1MIML 5HHME 3MRBA 4I1RA 2Z65C 2ZJSH 2EZ0D 2AJYL 2MKLC 2QMKA 1FORH 3BDYH 2P5EA 1XCTA 4M1GL 4D9QE 5K59E 4KC3B 1Y0LB 3DSNA 3F7VA 3GXUB 1JNLL 2IO5A 3MCKB 1BVZA 1H3TA 1RI8A 1KIUB 3NABH 3SYAA 2JQAA 3TEXA 5BNXD 1PDKA 5BVPH 3GXMA 3UBXA 1BZDA 4WRLA 4HCRL 4ZMPA 3BHBB 3FMGL 3WV0A 1ZHNB 3WXVL 1KOAA 1GZHA 5F3HB 3WUWG 3II1A 3LKPB 2NLJB 4PYHA 4WTWA 4JG0H 4PGDB 1QFWL 2AQQA 1M9WA 2BVUA 3MLSH 4G6AC 3QIUA 3BFQG 3P9MA 3VA2C 3RVXD 1TG8A 4PBWD 3FO0L 2NY1C 1ZOXA 3Q43A 4NERA 1CTMA 5CD5C 1UB5B 3AUVA 4N2AA 4OQTL 1UM6L 3FFCA 1CICC 4L9DA 1Z5HA 4BZ2A 2KUTA 4FQJL 3U0TB 4LARH 5I18H 1FZKB 1BMGA 2ZNWA 3T0BA 2HG0A 1EFXA 3OJMB 4X7FC 1A7NH 2RMNA 2Q76A 2R83A 3NIDE 4QRUA 5IHHA 2DWTA 3E0GA 4V11A 3PABA 4B9JA 4ODWA 2PETA 2SODB 4X9GA 3HZKA 2ZCKH 1N4XH 1VEOA 4BSVB 2AP2A 1PGRB 3HS9A 4H8WH 5F9OH 4YSCA 1UEYA 5JA8B 1A4KA 5KJ7E 1HCFX 1MJJB 1BFOA 1CYGA 4OF0A 1TQBB 2N0KA 3VWKC 5CSZB 1A4CA 1MQKH 5I76A 3SDYH 1ZT1B 3QCVH 4PBVC 1L5GA 2J1ZA 4J2XA 1KG0A 4J3BA 3SE6A 3MKGA 4D94A 3WUWB 5IB1B 5FOBB 3MLVH 5TE6H 4JFZH 1GYWA 4JRLA 3FUNA 2ITDB 4I4WA 1KGCE 4IIQB 2W91A 5IW6A 3TA3C 2EC8A 3RP1A 3NSCA 3DJZA 1DVQA 4L05A 1MI5B 1CWVA 3U0PB 1U8HA 1RK7A 5D6DA 3QFJA 4UBDC 5IFHL 4TTGA 4OSUH 4BHUI 2ETWA 4XNDA 4ANVA 1BFVH 3LH2H 4GS7C 4FLRA 2X6UA 4AQAB 1HT6A 1I7TB 2PTVA 3MRNB 4UUJB 5IQLA 1QRNE 2X89A 4CADA 2ERJC 5ITBL 4HIXH 4F27A 5B8CC 3S34H 1WAEA 4GG8A 1FDLL 1R75A 3VUAA 3ILQC 4FHKA 2H26A 5KSUA 3MV7D 4ZT1A 3HB3D 4HIHB 3SQBB 5EOTA 3BZ4B 3FB6A 2Z64C 4JG9A 2CHXA 3MRGB 1QKZH 3U30C 2QKIB 1X7TA 1H5BC 4NPYB 4NHUB 3LNIA 3DURB 1JZ7A 1JZ5A 1MNUH 2ADGB 4FQXC 3I6LD 3G9VA 3SYCA 2WGNB 5IGXL 1DN0B 3OG4B 2Z6FA 4JX0A 2CO6A 4A39A 2VKWA 4D7PA 3C75A 1DQVA 2E9WA 2LAGB 4HH9B 4LT7A 3S3PA 3VD3A 2LVEA 3VWJD 5I1IL 3TFKC 3VGBA 3QBTB 1RLBA 2X40A 3FCSA 5J4MA 2VB5A 1IC4L 5CN1A 3WKMH 2CHZA 3PWVA 3EBHA 5LBGA 2IDSA 4FYSA 5IV2B 4EUPG 5HYSG 1XAKA 3EYUH 3HRZC 4Z7UE 3AMKA 2VABA 3O3AB 2DY2A 2H4EA 5BMFH 3CZFB 1C5CL 4UAOC 1SXZA 5SWSA 2ATKB 5TGBA 1H3UA 5E9DD 3O8XB 4YDKL 3O4LD 4TNFA 5EO1B 3ULUE 3O6FA 4ONHB 2BIOA 3GJFK 5JNYB 3GF8A 2YAHA 5L4FA 1G0DA 1PAMA 3KPPB 4F2FA 1AE6H 4AGLA 3KR3H 2J20A 5EHFA 3ZT5A 3W39A 1FFPA 7PAZA 4PWGA 4APXA 1JZ8A 2E0PA 4CVXA 4UM8A 5TQ0L 1SMDA 5C0FA 2WBXA 2CGRH 4TLKA 3SE4A 1XCWA 3ALPA 4TSBL 5TF1H 5HHNB 3GJFA 4BZ2H 2RCSL 4E42B 3IJ8A 3F85A 3FQ2A 3LNHA 3LS5L 4ODHL 4R83A 1DUYB 3TNNB 1S5IL 4NQTA 4DW2L 5EC1B 4HWEL 3LPPA 2G0LA 3SDAC 1NCHA 3KCPB 3WFCL 1XF2A 1GPOL 1S46A 2XBDA 3J2PA 3MV9B 2F8XC 4X6BB 2QGEA 1IAMA 4XO3A 3LZQA 3HI5H 4GW1A 1O0VA 2XQBH 1WT5A 3GBNL 4J3OD 3SYOA 5E08L 5IB4A 1Z9LA 1BM3L 1YEJL 3HR5B 1C7SA 2BM3A 2G3ZA 2R39A 3EOTL 4JFEB 3NYKA 4UYQA 3V55A 5SWZA 2MQ3A 4Z3HA 3WS3B 3SGDI 4W81A 4MDRA 3Q8BA 2EEDA 4FMKA 3V79C 1A2YA 4X6CA 1PIFA 3GO1H 4YUEL 3SN6N 3NJFA 1E0OB 1FV1B 3DX7B 3Q06A 3N0PB 5HYSB 3B9KB 1HHKB 1UURA 5D70L 2GT9A 5MI0B 4F37K 1JGUL 1UD3A 1SF3A 3D3VB 3I84A 5FM8A 3IYLW 1PZUB 5D7HA 4EZMA 4N8CH 4ALAL 5I30L 2WUCH 2PCXA 4F8PA 2ADIA 3MV7E 3HS0A 5C92A 2VSCA 1AS8A 1JV5B 2YQBA 5GRUH 3DXAB 1DVTA 3QUMB 1J9SA 3WLBA 2H2PC 1ORSB 5BS0A 4OIBA 3H56A 2ICES 4W1TA 2QEJA 3OAWA 1YMMD 5E4OA 4IEFB 3HCVA 1NPJA 3BJLA 4HJGA 2A1WL 1W8OA 2CLRB 4HS6A 3I6LE 3MTXA 2HX9A 4UT9H 1SJEB 4XP4L 2LGNA 2TRYA 3NZ8A 4DK3A 3IGAA 4PJAF 3UO1L 1ILUA 2PABA 2Z93B 1GAFH 2V7HB 1OSPL 2YGQA 5DHMC 1OM3L 1BZ9B 3VXNA 3WE1A 3D0VB 5JXEC 5I8CA 2Z8RA 3DX0A 3TO4A 4XBEL 3TGXA 1RK1A 5BOPA 4EZLA 3JTSA 4UV7H 2NY0B 4OD3H 2O6FA 3KW7A 1KENL 3ZTNH 3VDAA 4BFEA 4DVRL 2XPZA 5E9DE 1IBYA 1PZ3A 2E6JA 3LPOA 3O4LE 4MYWB 3GSWA 1KN2H 3WD5L 5HI3C 5JYLA 2CMRH 4G59C 1X5IA 1Y07A 5CJOL 1WA1X 5I71B 2HG5B 3OHXC 5E2UH 4LGRB 3DHUA 1JS4A 5E5MA 4F3FB 2X38A 5DRNB 3PWUB 5KG9B 4PY8I 3PHQA 4NO0D 3HR6A 4BCYA 2R1YB 5MEPA 3KYMA 3HNVH 2X4PA 1AI1H 1X5JA 3LRSA 3Q6FB 2BIIA 1PZ5B 4TLUA 1CCZA 2WWOA 3HUJA 4UB0H 3FU3A 3ZRFC 1R3KB 5IJVB 4P2OC 1WAPA 2UZPA 1V3LA 3H0TA 5LB1A 2BZ7A 2NNFA 3IKCA 2FEDD 1M3JA 4DF9A 3FL7A 1BVOA 2EO1A 5BO1L 3UZVB 4MA1B 1MCLA 2IWEA 3TX4A 2E8ZA 1R3IH 2BLFA 1OAKL 2CBPA 4HK3J 4KTGA 1BQRA 3FN0L 4DNLA 2NUTB 3EYQC 4OCWH 2VE6B 2MH4A 3WN5A 3GJFH 4JDEB 3QJZA 4N5UA 3BQUD 3WFHB 2E9IA 3L3KB 1GGIL 3R18A 5GGRY 1MCCA 5JHBA 3IDMA 1ZHBB 3MRIB 3H4HA 5C0JB 5L2KD 5F8QC 1GZQA 4P9HC 1CIUA 1DBBL 1G7PA 5A7EA 4UQ3B 5I0WA 5K5YA 2DQUL 1NGYB 5IVXF 4HHAB 5ESQB 4LSRH 4ODTH 3WFEL 5EEZA 1ZTXL 1F3DH 1NC4B 3BZ5A 5KW9L 1EWHA 5HI4C 4HMEA 3C8KB 4MQXD 1YMME 4RMWA 3MBEB 3BEVA 3DKHA 1KJVA 3KDMB 4LVHC 5B3NA 4FFWC 1S3RA 1JPGB 1ZS2A 4LSPH 3MJ7A 2EH8H 3CN3A 3SPJA 3RZCB 1QSFE 2DQDL 3FQWA 4PJGA 1CFVL 1P4LB 2PO6B 4QHMB 2ZYRA 4TF4A 4KOBA 2D2CC 2PPAA 1JGDB 1IC5H 4DN4H 5AW3B 4F7CB 4H20L 1CR9H 4ES9A 3QC5X 4H0IA 4P2RD 1J9CT 1BXAA 4H25A 1DQLL 2JCCA 2HH0H 3L6FA 2OX5B 4G3YH 5DWPA 4CVZB 5MEOA 2ZF8A 4C4UA 4OZGF 3PV6B 4IGBC 4GSUA 1M2VB 3G04B 2BRRL 4YPGA 4X9BA 4G80A 3WIHL 3BD4A 3VG0H 4K5MA 1KTRL 3A4DA 3ZMRA 4AM0Q 4GG6A 4O4YL 3F6JA 3PV7A 2C26A 1K5NB 3ZDZE 2X0WA 4LU5L 3N40P 5L2JB 2VR3A 2IAND 3B56A 1ANUA 2YD0A 4MJIA 4J8RA 5FGBA 1NBZA 3NAAH 2YA0A 4OM1L 2FWUA 1IC0A 1E4XL 2APTA 1OCRB 2XNAA 3G9AB 4AE1A 4N6QA 5KVGH 2ROXA 1U8MA 3X13B 4KZDH 2GTZB 4JJ5B 2IH3B 1W9XA 3KPRD 3U25A 4B9IA 4ZTOL 2BCKB 2YPLD 4UTCA 3CQPA 5JTWA 2W92A 4NC0B 3J7HA 1THAA 3SDDB 3M1OA 3OAUH 2PPEA 3QUYC 5D1ZD 4FFTA 4Y1TA 4M6OL 4X5WB 3INUL 5J6HA 2HX8A 3FH7A 4QIRA 2NNXA 4BE5A 4KZEL 4R9HA 1HX0A 3GXFA 2IJ0C 2VDRL 2VDPL 1X7QB 2Q8AH 3MLRL 3VGGA 5E5UB 2YSTA 1J48A 1OT1A 3BEWA 3EZ8A 1EK3A 1UM5L 4TQ8A 3TP4A 1OCZB 2YMTA 2J73A 2Z31A 3P02A 3WJLA 1HJBC 1J1PL 2WTOA 2X53A 4MDIB 4PRPA 3MRMA 1D9KB 2M1KA 4KO6A 3PGFL 3GXIA 4ODVL 3X1EA 1XMEB 1ADWA 1D5BB 2YEZA 3PDOA 1DVFD 4GJTB 1FFQA 1W8EA 1LEGA 1CIDA 2DQTL 4E5XG 1A6WH 3EJZC 4ZOCA 3V9EA 2H1PH 3WTVA 1LO4L 4Y2NA 1PZAA 1DO5A 4CDHA 4X9HA 2NTFA 4GRLD 3T2PA 5BXFA 4JPKL 2X1QA 5EU3A 5FFGA 1BQHG 4BZ1A 3QJSB 5B4MC 5IROD 4ZTPL 3GS7A 2WXNA 4KKCD 4HK3N 3L3IB 2AXGB 5ID1B 2VR9A 2HN7B 2AITA 4X6DA 5HVGB 1KWGA 3KPQA 4PLJD 3DK2A 3RWGA 2BOLA 1XCXA 5T1LA 1NANH 1OTUD 2HJLA 1OF0A 3RPBA 3P9LB 2HVJA 4GW4A 5CIPA 1LLAA 3GSOA 4P2RE 2Y1AA 1EAJA 3WO3B 3ZX1A 4PP1D 5DFVD 3MJ9H 2NXYB 3LRMA 4RESB 1R3JB 4FN0A 4D0BB 5EBMB 3U2SA 4JFVA 1JNNH 3FONB 2P26A 3GMMA 3KPTA 3BN9C 4MBOA 2EXYC 2WV3A 4G6KL 3ZYOA 5EUOB 3D2UA 1IM3A 2ALAA 3CHQA 4Y5VC 1WCBB 1LD9A 1FH5H 1PL3A 3A4AA 4PH8A 3L3JB 4K8RD 1JPSH 5D93B 1IQWH 1YYMH 2R69A 4W9JC 2F53D 4P4RA 3HG2A 2IANE 4GKSA 1N18A 3DBXB 3MUJA 3QR0A 4JQXA 2P80D 1FZMB 4U1LA 4OR1A 5E2TL 3KXFA 1K2DA 2BOCA 1OOAA 3JWNC 4L3FA 4M62H 5E8EB 4RNRA 2E3VA 3BWUF 4KKLD 5KN5A 4S1RL 4CN1A 2VDLH 3KPRE 1RZJC 2MOGA 2YPLE 2DV6A 2E7LC 1H15B 4PJEA 1J1OL 4PB9L 1JZFA 2WB7A 1I1AA 2OJEA 1L9SA 1NCAH 4HEMA 1BLIA 3GBLA 4EN2A 2WQ8A 1HCZA 3A21A 1L9TA 3PXHA 2WJ7A 3TVMB 1DBML 4X8JB 4ANXA 5D9SA 4P49A 4URTB 3Q8CA 4RMVA 1E3ZA 4GMSL 1EQWA 4UQDA 5JQIB 3UPRB 3OXRB 5K9OB 3FQTA 2FT7A 2H7WA 4P5TC 1KFGA 2Y6SD 5DK0B 1L6XA 3NIFF 3WIHA 1AACA 1WC7B 4U33A 4NSKA 4F58L 4FX5A 4KTDL 4RISL 5C6TL 3C6EA 4CU8A 3IRPX 2CKBH 4NZFA 1Z0MA 2WB1A 5HGDA 3T77A 1S4IA 4C4KT 1R3LB 1YN7A 3U46B 2WWMC 4NO2B 4OUUA 4QWWC 2DQCL 1RZ8B 2NY3C 4XMPH 4AYDC 2OMXA 1RHFA 3WFBL 1CO1A 4R7DB 1A9BA 2CDGB 3JT0A 3GHEL 1KYFA 3LAFA 5GRVL 4ZZFA 3OKDA 4IRJB 4P23D 1SXCA 2OR9H 4YBQD 3EG9A 1UHVA 3BSZH 1CVRA 2AXFB 3W11D 4Y4HD 1F4YL 4L1HA 3RUGB 5IUCA 3NA4A 1MFDL 2YR3A 4AEIL 1XV8A 3FTGA 3P30L 1PLGL 2J5LC 3APFA 1MZZA 1LDPL 5C0CD 1NDTA 1Y6NR 5EBWB 3ZTJH 2ZPKH 4LLYA 3BQVA 3HE6C 4P2QA 3SQOH 1KJ2B 2XG4B 5DZAA 4C56B 2DQMA 4ELKA 5GJSL 4NQDA 4ZO9A 2EUVA 4WEUD 4X4XA 5JOEA 3LQMA 5K1VA 4TQPA 1OSEA 2UZIH 3NK4A 2Q2LA 4RGND 1J1XH 4HIEA 3E7JA 2A38A 1AQKH 2CGZA 3HC0A 4QRFA 4W68A 2A3TA 2L8AA 1GJIA 2CK0L 3QXTA 2FSEA 2OCJA 2YHGA 3N42B 4K7PY 4BZ1H 1BSIA 1NFDB 4G11A 5FECB 1KEGH 3EGDB 4M8RA 4HSCX 4YHPB 1M56B 1U91A 4XP9H 2ICWB 4TOYL 3JYCA 3DVNB 4C83B 3LDBB 4FQIL 1YAZA 2OJ1A 1E27A 5E70A 2F53E 4A6YL 1SLXA 1YJDL 1A1OA 3I9AA 3WTUA 3X1GA 4ILDA 2DQFB 2CKNA 4IOIB 3AWGA 1T1ZA 3TT3L 4PUBL 2WO2B 4LCWD 1AJ7H 4JLRA 5A3ID 5F7KC 2NY4D 3M7OA 1NUFA 3IMVA 2EE2A 4MX7A 1Q8MA 4HH8A 1TYEB 4L8SC 3SDXF 2NX5B 1B4JL 5ICYA 1UOVA 4JRXB 5KZCB 1QFUL 5JXAL 4TUKL 4P9MH 1DDHA 1CLVA 1TEGA 2IH1A 3BVUA 4MRBA 5BQDA 1QP1A 2R69H 3L3OA 3TYGH 3QNYB 4ZSOA 3K3QA 4M3JA 4YR6A 5FO8A 2R23B 4LSTH 2RHEA 2ZIDA 2ZCHH 1DQTA 5JHDD 5MENB 2DLFL 3DSFL 3GD1C 4G6MH 3QJUB 4MXVF 1PIGA 4AVIA 5I28A 2QVMA 1F1GA 2VIRB 3EF7A 5DHEA 5HYIA 1CGSL 2EE9A 2R56L 1INDH 3PGDB 4HK0B 4UILL 5LVEA 3BIBX 3P4OB 1HDMB 2FX7L 1JCKA 3BZFA 3GPSA 4LP5A 1SDDB 1RZFH 2BJML 2OSXA 4G2AA 4GAFB 4ODXB 3X3GH 2WXQA 4R0LA 3VGAB 5AW4B 4Z7OE 1E9OA 3WHE0 4JFFD 3OMIB 2A9NL 4PY7A 1QUNB 3GMNA 4IU2A 1LO2L 4PTUB 3T6ZA 1UOWA 3T65A 3ABZA 4MA7L 2EJ1A 4CJ0A 2F68X 2QFRA 1J88A 4UQEA 2R2EA 5C0CE 5CEYB 4ORGA 5I1GH 4LIQL 2Z4TA 1FZJB 2R0LH 3V6FA 3HLAB 2IDQA 4MA3A 3TN0B 2JFCA 1KSRA 3PUUA 4OGAC 1TU2B 3QXVA 1DJXA 1EZLA 5AB2A 1ZA3B 4IBZA 3ULSA 4I1PA 4DP5X 1QHOA 3ROOB 1J10A 3C09B 1ZHKA 4R96B 3NSYA 2CJ3A 4KNUA 1R33A 1MN4A 2H3KA 4OT1H 1NL0L 4HFUH 4NAQA 4P46D 4NZJA 3THMH 2JSFA 2A6DB 4Z7QF 1N5YL 1HE8A 5CP7B 5FEBA 5A16B 4ZFOB 2H3XC 4N0CC 3EO9L 4AG4L 2IEPA 4OQ1A 4WUUD 5CS7A 4IRSB 5EU4B 5H35B 2EVGA 3BO8A 4IOSD 3EFOA 3VI3B 1CZ8H 5GZOC 3KYKL 1YEGH 2JELL 4RQQB 4KRPC 1EXUB 2BHZA 12E8L 2ED6A 3A6CL 2PTTA 1Q1JL 1DVXA 3B2MA 3M88A 4OCMC 3DOSB 4DP4X 3AQXA 4KK8D 4KNSA 1QSED 3KLAA 4HZ1A 4PJ7E 2UX7A 4OD1L 1WWAX 2B1HH 4JW3A 4BELD 4GUQA 3QH3B 1XAUA 5I1KL 2HXAA 4XVSH 1IFHL 1R24B 2EE6A 1MFNA 2GTWB 3HIZA 5EEUA 3H9HA 2PF6A 4LCWE 4Q89A 4GXFA 4Y4FC 3VXTA 4F33A 4HJUA 3BC9A 1LK3H 1C1EL 3QQ9C 3PL6B 4GLRI 1MVYA 4KI5D 4NC1C 1ZLEA 1OAQH 4DIXA 3LCYA 2XZQL 4XVUD 3DROA 3OGCA 1NFKA 2K8QA 4Z7WF 2JJVA 5C7ZA 1S7WA 1U3ZA 4MMXA 3WL9A 3L5IA 2BVTA 3QJQB 2FATH 3V6BR 4XP1L 3U82B 1FYTB 1OZUA 1FVCA 3CAFA 4MQTB 2VR7A 3BIKB 3JV6A 5JHDE 4K9EH 5IOKA 2BXZA 2FGWL 5CUSL 4GW5B 1F90H 4UINL 4UU9A 1K4DA 3BKCH 2ADJB 5CJ8A 3QUXB 5F1KC 1A66A 2XDHA 3OLEA 3MRRB 4A6YA 1FO0H 3ISYA 4X98A 1JZ6A 4OVUA 4LSUH 4KKAC 3TU6A 3ULAB 4PHZA 1V7NH 2WMPA 2DIEA 2XQ0A 5E95B 2YD5A 1IT9L 4JPVH 2O93L 3WLWD 5HHPB 2H9GB 3AAZA 2WTRA 4JFFE 1GTFA 3D18B 3CZNA 5D5ME 1BIIB 5D7IA 5AKRA 1RFDH 1CFQA 5AOMA 3HC4H 4XNYL 2A0LD 2BVPA 3QI9D 5TE7L 2XWTA 5GISL 3UMNA 9CGTA 5LCVA 3WYRA 1KBWA 5AOJA 4EN3C 2QJDA 3P77A 5JQHC 1HK6A 2YRBA 1XSOA 2DQIL 1HHHB 4X6EB 2QV2A 2ZXGA 1YNTA 2VLLB 2DQGH 2W95A 4Y7OC 2AEWA 3C60C 2WVUA 3N1GC 2J4WH 1ES0A 4FI8A 4LCIL 4HWBA 3BRDA 4M9OA 2FBJL 3D8MA 1WG3A 1Z66A 4ZS7L 3KNBB 3M1BB 4MCNA 3V0JA 4OZGE 4YHLH 2V9UA 4Y2OB 1GS7A 1MF2L 3FU5A 3LNFA 4OKDA 3W0WA 5BUAA 3PS6A 3B5HA 3LNEA 5IWLC 5EZLA 2VZTA 3KPSA 4PD4K 4DZBA 2D3NA 4QCIA 4XC1H 3CSYA 2I32A 1OGTA 3MNMA 4LSQH 4IKNA 4M3KB 4YNYB 4WUUE 4WI5A 1F3JA 4AQZA 2KQMA 4A04A 1JF1B 1JDAA 2V8LA 1IBGH 4NQCA 3FT0A 2OR8A 2OMWB 4HQQL 4OFQA 3HW7A 3BWAA 1NC2B 5F0LB 4OLWH 5FA3B 1M6OB 1Z0NA 4ERSL 4CNIB 1G7IB 1QSEE 2N7BA 3WSQL 1JF6A 4NENB 4K15A 2XWJB 3L4VA 5FW6A 2K4WA 3FCGA 2W60B 4Z0BL 5H4ZA 4WHDA 3BPNC 1P1VA 2XN2A 2DWEA 1FVEA 1WFJA 2MPVA 3SYPA 4BQBA 1CF8H 3T3PF 3OD3A 1I7RB 2B7DT 3FT1A 1LP9F 4NUJA 3BAKA 4ZYKB 3GBMH 3BAWA 1T5WB 3B3BA 2DQEL 5F0MB 3K71B 4BXSV 1TJHH 3LTVA 2FAUA 4PJIF 4XC3H 5B22A 4YXKH 3ZMNA 4HLJA 2ZKHH 3RWCA 1MCPH 2G60H 2H0EA 1E8ZA 1UGKA 1IEBA 1ZTMA 3R7RA 1QFHA 4L3ED 1WZ1L 1N19A 4GKNB 1EA9C 4K9JA 1PQZA 4N0UA 4U6HB 1SXNA 4Y16C 4HJTA 4F1ZA 2NY7L 3CG8A 3EO0B 3L9BA 2G5BB 1DBJH 2W65B 4TNVK 1M1SA 3L2LA 4Q6KA 2VITB 2A73A 4JR9H 4RLDA 3MUGB 5FYJL 1UKTA 5J1SC 4QRAA 1JYWA 4EDWH 1HAWA 1I1CA 3DUUB 3FU9A 4FLQA 2VL4A 1MCFA 5D7JA 5JMOC 3TA4D 3LPGA 1WAAF 4Z3GA 3OX8A 4TSCH 5KYWB 4XCYA 4AQ8C 4ZQKB 2C1OA 3HPLB 4PS8A 4U1IA 3MREA 2NXZC 3C5ZD 3AQDA 3AT8A 2JNZA 4HX1B 4NHCL 4PJDF 3RX7A 4A63A 1UOKA 5H94B 1I3RB 3EXJA 4EI5D 3CJJA 4I0PC 4OLVL 2XPYA 4FYTA 2B0SL 3MACH 4PJAB 5I2IA 1CXKA 2HUEA 3NMEA 4Q58C 3CMOL 3U0WH 1MHPL 4ZMYA 1AKJA 4M5YL 3HS8A 2QQNL 1B2WH 4FTVD 3LQZA 4K3GA 2K70A 4QOKB 1ODUA 5CGTA 1O7DC 4LSSL 2B9AA 3VXPA 4H8WC 3VU2A 5DXWA 2YPKB 4NUQA 1JGLL 5CO1A 3FQUA 3GHBH 3KYOA 2ODHA 5JO5A 3EXLA 5GHWH 2HLAA 1ZHNA 3P0VH 1Z1WA 2BERA 2WP3O 4ZMNA 5F3HA 1A1MB 3LKPA 1U8KA 2AXHA 2NLJA 2O5XH 4MMZC 4PGDA 5EOQH 2L7EA 3BE1H 2BFVL 4G42A 5LCVH 5HHOD 5T3ZD 5JXAH 5ECJE 4F7KA 2BS71 2X2YA 2AQRA 4BFNA 2IWKA 2WIIA 3ZN6A 1JD7A 4GBXB 5LGHH 1UB5A 1W91A 2GB2A 4L4TD 3V5DB 3UYRL 3MJ8A 3LMJH 4L5FH 4BRVA 4HWBH 4J8QA 4K71C 5INDB 4MZIA 4IBSA 3U0TA 1T04B 5KJ4A 3EAKA 1FZKA 4JZOB 2X4NB 1T0NB 3FT2B 5T3XD 3EGXB 3SQRA 3MOAL 2Z1KA 1M7XA 4YHZH 4W9HC 1IJ9A 4HFWA 5IVOA 5L6YL 4D8OA 2F5AL 1BP3B 3PWPD 3I2CL 3KJ4C 2WLMA 4W70A 3KLHD 4OY9A 1JK8B 4BSVA 1AFVL 1ICTA 4FAAB 4JRYB 2BWIA 3NIFE 1RP9A 3F62A 3LEYH 3MOQA 5DJYB 2UX6A 2J56A 3X11A 3QDJB 1MJJA 3BD3A 4JHAH 3SGEH 4L3EE 1X4YA 4GSRA 2EILB 5HHQB 3QUML 5GZNA 1ZT1A 3V6OE 4DVBA 3O6ML 2OV0A 3PAVA 3ZL4H 1JERA 2XYCA 3V7AE 5IVXB 4L9LC 2VR5A 4ATWA 5D8JL 5IB1A 3P73B 2IBZX 1N5AA 1Q72L 4KK9D 4PQXA 2XY2A 1KUMA 2DMKA 1M6UA 1QO3B 2ITDA 2X44D 4IIQA 1DQQB 4HXBL 2HUHA 1GGYA 2BNUB 1DSFH 2MIZA 5IT2L 1MI5A 3U0PA 1F4WL 5ICUA 2P8LA 1JPFA 5HPMB 4NX0A 3RVVD 3VI4B 4AQAA 1I7TA 4UUJA 3MRNA 5KBPA 1T1WB 5IFJB 3QIUC 3SB3A 5JIQA 1FL6B 2OW7A 3B37A 1OAUL 2IBZY 4FTVE 1RERA 2VW6A 1F56A 1VFAB 5LKNA 5F0JB 2CDFA 1RUPL 4ETYA 4YHYC 4KKQA 5CCGE 4HIHA 3S48A 3SQBA 1NDMB 1HOCA 1FGVH 1MG2C 4QRPD 3ARSA 5IY5B 3F12B 3K4AA 5D2LF 2OK0L 1EV2E 1UACL 1JZ4A 4FL4C 4JY6A 2QKIA 3CLEL 2R4SH 3GINA 2KS0A 4NPYA 1HZHH 4I2XB 5DJZB 5A2KH 2VMFA 1E2VA 4K2UH 3T2NH 2V5SA 3DURA 2HAZA 3EOYG 2ADGA 4JFYB 2W94A 3V4LA 4S1DD 1DN0A 2DN7A 3B5GA 4QHNB 5EZIH 2CIIB 2YLKA 3BKML 5HHOE 5T3ZE 3CBKB 3ELAT 5A2CA 4KDTA 5EA0H 4BCXA 3ZW3A 4WGWB 1QBLL 2VLKB 1T7XA 4N2BA 5IKCB 4IHBA 4L4TE 4PV9A 4YXHH 4J12A 2DLEA 1A5FL 1S7SB 4PJHA 4RA0C 1AGEB 3CZFA 2ATKA 3NSJA 5T3XE 1YYLL 3AS2A 3O8XA 1PG7L 1ZV2A 1FBIH 3DC0A 1XXDC 3L17A 5EO1A 4ONHA 1Y1UA 5JNYA 1ZVHA 3NOIA 1MH5A 2J7LA 3KPPA 3GSXB 2JLPA 1U58B 3PWPE 5FYKU 3KH4A 5EFIB 1H8NA 2JTYA 4LPWA 1VGEH 1F4AA 4LMQI 4MXVE 2NYZA 1MG3C 3GM8A 5AKVA 1MAKA 4B7LA 4E42A 3AGVA 4R2GC 2MCMA 3ZE2F 3APMA 5IBTL 5EC1A 3SKOA 2CD0A 1JGVL 3NFNA 1BZOA 3KCPA 1OE1A 3HJEA 3MV9A 5EORL 2I07B 5EN2B 1CLCA 4X6BA 4XVJL 3BPCB 2XPGA 3UBXI 2DJMA 2XVBA 2F1BA 3V0WL 3R0MA 2A77L 3W9EB 5JPNB 4LPVA 1AQ8A 2CO4A 2OULB 3G7TA 4HMCA 5CSBA 4U31A 3ULVD 1ZKAA 3CTTA 3HR5A 5CWSB 5AZ2H 2NY0D 4TNEA 5F7UA 1EAQA 4JFEA 4J3XA 4PJXB 1WGVA 1EHLL 3WS3A 5F89B 3RIFK 3D05A 1RZ7L 4TVPH 3BRFA 5C07D 4YWGH 3RDJA 4CAGA 1FV1A 3HZYB 1P1ZB 1P4BL 3GS0A 3V4PL 1I3GL 1H6TA 3KMDA 5HYSA 4D3CH 3B9KA 5J3HD 1X5LA 4WEEA 3U2JA 3A23A 3RY5A 5DRZB 3GIVB 3AT9A 2J3SA 4MAUH 4I3SH 1WIUA 2L7UA 1MEXH 4E9LA 1IEAB 3FUJA 3RFZA 4ZMOA 2VJXA 4JDTL 1AIFB 3ULUL 3MV8D 3DXAA 4QRPE 1L7TL 1J0HA 2AJSH 3QUMA 4WO0A 5AZUA 3SEPA 4R4BA 4TNWK 1ORSA 5BRZD 4YBLB 2JQMA 3SO3B 1H3WM 3O9WB 4IEFA 3ARDB 4ZFFB 3GK8L 4HYTB 3LZOA 1ED3B 2C4FU 3O6FC 4QRRE 4R84A 7CGTA 2XTJD 3QUZB 2NSMA 1UKQA 3NJNA 4U4IA 1S7QB 5DWUL 3PHOA 1MWAB 4WLCA 4J28A 4M3HA 2BNRD 5E1GA 3VO0A 3NH7L 2I24N 4U0RC 1O9WA 3HB3C 4FHBD 3RHWF 5JIPA 1TETL 5L0QB 4M7JH 2QR0B 2HJKB 3HBGA 3T8MA 4ZMWA 2O5YL 4XOEA 4AKQA 3W57A 5L88L 4MB4A 4FZ8H 1CUOA 1RZKH 2EEAA 3DJ9A 1TVHA 3HNTH 4B41A 5DR5H 4R3SB 4PJ9B 4F9LC 2UWEA 1QVOB 4MJ2A 2IAMB 3QWQB 4BH7B 1S7TB 2WTPA 1WT5C 4U2ZA 4JZJB 2HG5A 2KT6A 4B9PA 4F3FA 3PWJB 1JDDA 5B38G 4YFDB 5DRNA 1QR1B 3PWUA 3VWJC 1XIWB 2Q7YB 1U6AH 3EYVA 3I50H 1EHNA 2AGJL 4U3XA 2D9QB 2CUIA 2EINB 3Q6FA 5FWRA 1EJOL 1PZ5A 5GSRB 1PKQE 1CDIA 3TPUB 1R3KA 2XV6B 5FW7A 5IJVA 4P05A 2J21A 1T5XB 5HGAB 3ZO0A 2VLJD 4WO4C 5AAPA 3CLFH 1VERA 2PO6D 3UAAA 4LPXA 1UASA 2H6PA 2H2SD 3KPNB 1HSAB 4JY5H 4KK6C 2ZOLB 1KGXA 4KQ4L 3HS0C 3K7UA 2G4EA 1BAFH 4FQLL 1T89C 3S3DB 2APVA 2VE6A 4O58L 3BRGC 3IWVA 1TTCA 1NKRA 2B5IB 5C07E 5BQ7B 4JHVA 3NTCL 1IILE 4DFHA 4JDEA 3BAYA 2AABH 3L3KA 3L5HA 3KLSA 1Y18A 3UJTL 3V5KB 3IVKB 2E4FA 2AI0L 1IL1A 1ZHBA 5HD8D 4HBQA 3O3BA 2H0PA 3MRIA 1YN6A 4B9ZA 1I8KB 1OARL 4YQXH 2IH8A 5C0JA 1Q9LB 5BW7C 1EH9A 1JRHI 4K73A 1ZDSA 5CCKL 1NGYA 1Z9OA 4HHAA 5ESQA 3TO4C 4YEEA 1NC4A 1FNHA 2SEBB 2XXGA 2Q7NA 3MV8E 2XA8H 5C0AD 3MMEB 3KS0H 4I13B 3OWEA 1RPUA 1XGPB 5INCB 3T4AB 3WENA 1QLRB 5B38B 5BRZE 4LASH 3FSWA 2BY0A 4XNBA 3LRGA 5L9DH 3UACA 4WI8A 3MBEA 3KDMA 4XB3A 3Q8FA 4EUPH 1BVLB 1JPGA 2P8MA 4I87A 3WAJA 3J27A 5AAMA 3TXAA 5CINL 3EJSA 2Y2YA 2XTJE 3EYSL 4A2GA 4DHLA 3RZCA 1QFWI 5F7WC 4Q9RH 1M53A 4PG9B 4ESKA 3JUZA 3TOPA 3RJQB 5HY9B 3OKYA 1P4LA 3BT0A 4FFVD 4OLYH 3FOLB 2X9ZA 5GGRA 3ZIMA 2BNRE 3UCRA 3ARXA 2QQLL 3DMMB 4RAUB 3SPCA 5CJQH 5C9JB 5C9KA 5ICZA 1B0IA 3RWFB 1JGDA 4A2MA 1HILB 3MGOB 1KCBA 4NZUL 1N9PA 2DM3A 2Y7OA 3T3PE 2W0FA 1LP9E 4YDLC 3K5RA 4O02B 3LZPA 1ET5A 4CVZA 1ZSDB 3DTDA 4E2OA 4PJIE 3SDXB 2C3WA 2F7IA 1QW8A 2FIRT 3PV6A 4CUCA 3VFRB 2CXGA 3F5WA 4XNUL 1H9DA 1LWRA 5A40E 3C8HA 1BCIA 3I3EA 3NRQA 1DSWA 1OTTC 5AZEL 4IKKA 2NW3A 5DS1A 3BP6B 3WN5C 4ZMAT 5L2JA 1ZMYA 5GGUB 3ULVH 3KWWB 2DOCA 4A2EA 3HKZA 5I19L 1EO5A 4J6RL 3RNQB 1YDPA 2NY6B 1V8HA 2FBOJ 4OFKA 3EJYC 4G5ZH 2YMOA 4ABQA 4BH8B 5C7XH 5HI5C 4XCNB 5KANI 4BK4A 3SPGA 5F71A 2PMZA 2ZAIA 2Q3XA 3L7FA 4HLEA 2VLJE 1RVFL 3Q8AA 3SJVE 3X13A 5AWNL 4ZODA 3FSAA 1T7YA 3TYFA 1JF5A 1KXVA 5E0FA 5B39G 2GTZA 5T33L 2IH3A 4F9PA 2O5ZL 2O72A 3BCFA 4MB1A 1E9PB 4QYOB 1J8HB 2BCKA 3TBVB 4JM2B 3V7MA 2PWFA 5FV1L 4MCMA 1EERB 1QFWM 3QAQA 4OZFA 1FC2D 3FAXA 1KJ2L 1SM3L 1YEFH 3NCYP 4BE6A 4R90L 2K8MA 3U4BH 4YSDA 4YFLI 1RSYA 5DA0B 3ZKQD 1YHPA 1PLBA 4PRID 1GKOA 1VDGA 1X7QA 5DHXB 4IRZH 2A9ML 4V33A 7FABL 3QDMD 2VUKA 1KCVL 3QHTC 3G6JE 2VXUL 2UY6B 4U1JB 2ZOWA 4XMLL 4LLMB 1RIVH 4B9FA 5EEVA 4MDIA 1A5FH 1ZEAH 1D9KA 4PVLA 2ARWA 1IZJA 3B2XA 4FZEH 3RNKB 4WDIB 5C0AE 1D5BA 2J12B 2DBJA 3EOAB 1EGJL 4OLZL 1FLRH 1PLAA 1U21A 3UJIL 4Z7QB 1NGQL 1FYHB 3U4KA 5L7XH 3WFZA 4F93B 3HG1B 4OW6A 4UMSA 2YWZA 3TIDB 3KWTA 1CU4L 1CGWA 2IF7A 5LUMA 4N22A 3TLRA 2HLFD 3GHPA 3SHSA 1F18A 3R8QA 4BQCA 1OSYA 3L3IA 2AXGA 4CU6A 1NBVL 4FQ2L 5ALCL 1QYGL 2H3NB 2OMUB 3H9SB 4Z1PA 4JK0D 3U7WL 3OGOE 2P1YA 4NFCA 3KVQA 3P9LA 3WAKA 6FABH 1G6VK 4ZXBB 4LBEA 1H19A 2PXYB 3QEGL 2CE6A 3CVBA 3CSTA 2KYIA 4K7PL 2BHYA 1R3JA 4YDIL 4A7TA 1ML0A 5EBMA 1T4KB 4HP5A 3APNA 4M6AA 4RRPA 4NLAA 3V2AR 1GYUA 3SDCB 1JZDC 2EDDA 3GRWA 1XGRA 3QQ3B 4ANWA 4Z7WB 5LNGA 5EUOA 4XO8A 5SWQA 2F54B 3LKNA 4B95C 2PWEA 5J13B 4I18C 3CZUB 4KJQD 1FE8H 4NM4L 4R4ND 4FXGC 2H8PB 1SJHA 5DMIH 2XKUA 4YDMA 3EJQA 3O41B 2IAAC 5I1AB 5DJXB 3DBXA 1JZ2A 3IDNA 3WO4B 4UOQA 2FVNA 3DBSA 4HBCL 1FZMA 3EJCA 4MJ6A 3ZU8A 3WE6B 2FD6L 1NANI 1OVZA 1PSKH 3GXTA 5E8EA 4NQEE 3RVTD 1RLWA 4LKCB 2GJJA 5FB8B 1WFTA 1CGTA 1GHFL 3WJLC 3S5LA 3D7PA 1H15A 3H4FA 3QG6B 2Y1YA 1LJMA 5DEGB 5F7HA 1AMXA 3IBEA 3OTTA 3L1OL 5A6LA 1XF1A 2HT2C 1EEQA 5JW3H 5D7EA 3ESOA 5CZKA 4AENB 5D7SH 2BIHA 4LLQB 4X8JA 4OLXH 3TVMA 4FE9A 4UYPA 3AGWA 5IK3B 4LCVA 2X4OB 5ABAA 5A7BA 3UPRA 1R0AL 3OXRA 4PRIE 3L54A 5CGYD 2VN4A 5DO8A 4XPFH 5K9OA 5DK0A 3QIWD 1WC7A 1IBHA 1CQKA 3QDME 3MJ6A 5HDOA 1B9KA 5D2LE 2C3XA 3KYAA 1R3LA 2DEXX 3Q5YA 2VN7A 3U46A 3LS4L 4NO2A 1U8PB 3MPCA 1RZ8A 5DD0H 5DYFA 3OZLA 5B1JA 4ENED 4R7DA 2V5MA 1H0DB 3LKQA 1N0XH 1BECA 4KXZH 1W0VB 4DGIH 1RY7B 4IRJA 3TL5A 3X3FL 5K93A 3KD4A 3DETC 5G4OA 5AW2B 3E8VA 3E2HC 1A14L 2IFFL 3U9UB 2AXFA 1ZV5A 1IAOB 3FO2B 5D1ZC 2B1OA 2AS5M 1WJ3A 2EDMA 4U3CA 4W4OC 1U92A 3RUGA 1UZ8B 2NX5D 1BQ5A 3NJIA 4KKRA 2V3DA 4JCMA 4W9LC 3BPLC 5EBWA 1AY1L 4FTDA 3KZ8A 1KJ2A 2XG4A 3F65A 4C56A 1QSFA 2DKMA 2XTLA 3DHMA 4N2CA 1HIMH 1QA9B 3WCYA 4NGHL 1AR1D 2FNWA 4P3CH 2NZ9C 3IN2A 5B3JE 2GSGB 1YYCA 4QEGA 5C0IB 2C9XA 3C2SA 1SHXA 5F6HJ 4YVNA 1AO7B 4JQXC 4RDBA 3PP4L 5ILTH 1K4CA 2AEPL 4Z7VF 4HKXB 5I8KH 1TKWB 5E6IB 3RQ3A 5CAYB 2ZX5A 4AV5A 4XZ4A 5B1KA 1NFDA 2WXKA 2Y24A 1GZPB 4N26A 3W82A 5FECA 3HJ0A 3EGDA 4HIQA 5CEXB 2XWEA 4N2MA 5FYLH 4NRZB 5IROC 1EGJA 2ICWA 3D39B 5ABDE 1UXLA 3ZQWA 1RSFA 3DVNA 4KKCC 3KH3A 1TENA 5T1MB 1ZVYA 2W0PA 4X0KB 5EU6B 3ZZLA 4IOIA 1CLZH 3NZHH 3T0ED 5HJDA 2FH6A 3L9RB 1MKFA 4NRYB 4EXPX 4WWKB 1R46A 4CA4A 4W93A 3GRWH 3HMWH 4G7VL 4WF7A 2XFGB 5IFAL 3S88L 4JRXA 1HI6B 5HYJD 4PJDB 4XCFH 3C8DA 3MNVA 2QSQA 4S1SH 3PFUA 2CDEB 3B6SB 3F58L 3GB7B 1TR7A 3QNYA 4AEEA 1YEHH 1OPGL 5CJXC 2R23A 1MJ7L 5MENA 3QR1A 4BDVB 1PNDA 3VG9C 3OR6A 4OJFH 1MREH 2WPGA 3SE8H 4DPCX 5TD4A 5FGCB 35C8H 3VA6A 4G8GB 1U42A 2L3BA 4PD4J 1HDMA 3DX2A 1SDDA 2D4FA 1WFMA 3GSRB 2RJMA 4KKLC 3VRLF 1L9PA 5KOMC 2ZSVB 3RWIB 3TTYA 2HFGL 3UDWA 1QSZA 3LZLA 4ZNEE 1BFTA 2AJXL 1KY6A 3GXDA 1E4WH 1QUNA 4WV1B 4FERA 2VDQL 4PTUA 3DTUB 4POZC 3TV3H 4RZCB 4K8RL 4N8VG 3T2QA 1WSST 3QPXL 5CEYA 2P47B 4N25A 4PGEB 3H6JA 2YSSB 4MZ3A 1FZJA 1KN4H 1ADQA 3NDZE 4HLZG 3HLAA 4JB9H 5DZNA 1UA3A 4UTAA 2BHUA 3VE0B 1BJ1J 3TN0A 4OJDH 1TU2A 3KLQA 3TH3T 2YAEA 1JAEA 1VCAA 2WWKO 3OJDA 5E5LA 2AK1H 4APQD 2MPAL 3OB0K 3ROOA 5CP3A 1LWHA 3OMNB 4I48B 4BBWA 4H5SB 4R96A 1NZRA 1RVFH 4K9EC 2FLRT 1KCSH 3BPOB 1MY5A 3GMOB 5KWYC 4GFTB 5A2AA 4P23C 1FAIH 1TMQA 1I3UA 3QUXD 4JFHD 5CP7A 3US9A 3SCMD 5A16A 4ZFOA 4KKPA 4QGTA 3W11C 4XOCA 5JIKA 1CDCA 3QIBC 4LCCB 4LSVL 1AC6A 4OI7A 1FIGL 4H40A 1VZHA 1QQDB 3UTPE 4G9DB 3MNWB 4IRSA 5EU4A 5H35A 4JKPL 5J56B 1HINH 1H9VA 2W9LA 4RQQA 4RCAA 1EXUA 4KITB 2QHLA 3DOSA 1YQVH 4ADIA 3L3OC 4LRNH 1Z3GL 1LGVA 2IPUG 1HQ4B 3NESA 4LAQH 2JCWA 3LQAL 2F5BL 3GLAA 2GTWA 5FV2A 5GGTH 4ZFGH 3T0EE 4N28A 1GIGL 1RURL 2HTLD 1W0YT 2Q7AA 3FZUD 3ZHLA 3PL6A 4Y0GA 4H0LC 5EC2B 1CK0L 3JT2A 4K3DH 4QHKJ 1L0PA 4FYQA 4YHOL 1QI5A 1U41A 4Y2DC 2Q3AA 2E9JA 2NZIA 4BQ8A 5HYJE 4CKQA 3IDIB 4NN5C 4PJFF 3WIFA 4AVHA 5KUKA 3HAEG 2EQDA 2YPLA 4R0LC 2YD8A 2R0WH 4URKA 2IALB 3UIZA 2XWXA 3IXTA 1YMHB 1J7VR 3BIKA 3R4DA 2JB6B 2WVVB 4E9SA 4L8CB 3F00A 1ZWIB 4F15B 1F2QA 4P3DB 5AB0A 4MZ2A 4QF1B 4GW5A 2Y7SA 2ADJA 1W8NA 4FP8H 1KWKA 4UCFA 3MRRA 1HCYA 3K72B 2XBTA 2KLSA 1VFBB 1SOKA 4N2IA 1U8JB 1B2YA 1E4JA 3WDIA 3T0DA 5IB3B 4WSGA 5AVVB 4EIUA 4O2EB 4KK5D 2C3GA 1PF3A 3RVUD 4A66A 2H9GA 1X5YA 1N12A 2QPSA 2VWEE 1DVFA 4UIKH 4YGVA 1JPTH 3OLIA 1BIIA 1S7XB 1KB9K 5DHDA 1GYCA 1N3NB 4ONOA 3IXAB 4JG1H 2QVKA 1A47A 2XRAL 1SGKA 4PB0H 5H2BB 4GRLA 3V52H 4X6EA 1UA6H 2VLLA 3FK3A 2CBOA 2P44B 4PRDB 2X41A 3RWEA 1DFBH 2WLYA 4ZUWA 2WLLA 3KNBA 3M1BA 3K6SA 3X12B 4NI6A 2Y69B 1TTFA 3B7RL 4UOZA 1XD1A 3LKSB 3E6FB 4Y2OA 4QAWA 3HAEB 5DGQA 1XO8A 3STBA 2FHFA 4JFHE 2MCG1 1NLBH 3NG5A 3VSTA 4B3VA 3M17B 5LGYA 3VXSD 1Q94A 3EFDL 4YNYA 3TEWA 3RGHA 1PCSA 4XBGB 4H4NA 4WW2F 3VD2A 1G43A 2OMWA 4KUZL 1OL0A 1ADQH 2QADD 4EZJA 3HVDA 2ADFH 5FA3A 4F7PB 1NC2A 2D3LA 2JJSC 4MMXC 3ZE2B 4UTAH 2CM6A 3CC5B 4A55A 3NCJL 4CNIA 2YQ2A 2V17H 2VAAB 2YXFA 2VOTA 2G2NA 4GKZB 1R3HB 4NENA 1ZLUK 5CP3H 1EZUA 2XWJA 4PJCF 5F1IB 3R1GH 1X3DA 2W60A 5JIMA 4U3SB 4JUTA 1NPNA 4DO6A 4HUWA 3V9CA 3WHXB 5K9QG 1BHGA 5EIIA 1SY6L 3EO1B 1I7RA 2FQGA 4ZYKA 2B4CL 2NR6D 4XXWA 4KQ3L 1IGTB 1O7VA 4HUUB 4QHLB 3REVB 3K71A 4OU3A 5DD1L 3X3FH 5BUGA 3D85D 1KULA 5KYUA 1V3KA 4H1LB 3ETTA 5GXBB 2X2JA 2LOEA 1E5ZA 1MCIA 2K6ZA 4ABVA 5JR1H 1F97A 4GKNA 2LU5A 2B8OT 4OZIB 3IEAA 3IU4L 5B21A 5FHBH 1H8LA 1KGYE 3PNWA 3EO0A 3KL3A 3LEXB 2W65A 4HJIA 5I0ZA 4MMYA 3MI6A 2YFOA 1D6VH 3BAXA 5EDSA 4NKDA 3MUGA 4ZAKB 5B1CA 2VLRD 5LXVA 3RBGA 3DUUA 4IBVA 1RQ5A 3NCEB 4ORZC 4OCSL 5TE4L 4KI5C 2ATAA 4NO3B 4JREB 2DB8A 4I77H 4QTHB 5I1CL 2EACA 1MJ8H 3HZMB 2FWOA 4AEHL 5I5RA 4PRHB 3QFGA 5IB2A 4M93C 3ZVVA 3RGVB 1AZRA 3VXMD 5IEKB 5DO2C 2BWDA 2AJUH 3AZUA 1KYAA 3NZSA 2Y07H 4WU5B 3GZKA 1TEFA 4X42A 4PJAA 4YSAA 1AH1A 3TTSA 4LF3B 5LQBL 2VZVA 5E99H 1EVTC 3BZEB 4Y4HA 5AVRB 3GJEB 2JJUA 1DQML 2Y7QB 4HW6A 1MUJB 4X7SH 5SV3A 3K8MA 5C0CA 4QOKA 1YEKH 4K4KA 3KG5A 4XWGL 5K9JL 3QDJD 4ZOAA 5AOIA 4AYFB 2IWGA 1C5DB 5CXPA 2D3VA 1IGIL 1WFOA 2AERT 3MXWH 4J4PA 1Y6MR 2Q8BL 3QNXB 5DVNA 1PZSA 2Z8VC 2VDKL 2HRGA 1A1MA 4AL8H 1LNUB 1SXAA 3WLWC 1B0RB 5DGRA 1KC5H 3IDXH 4N1HB 5D1QB 4Y9BA 4KH9A 2VSDA 3VXSE 5ISZB 4WWID 2VDOB 3RB5A 5FF6B 2ZQKA 2YWYA 4PJ8D 4GBXA 4L4JA 4WHYG 4LQFL 2IQ9H 1ROCA 3T0WA 5INDA 1E8XA 1A6AA 1D7DA 1OAXH 5T5NG 1T04A 3RAJL 4IMKA 4ODUB 1DJHA 2X4NA 3BH4A 1T0NA 4U1GB 4F7TA 3FT2A 3LV3B 1C9SA 5DTFB 3D6GA 1DVZA 3D52A 3MJGX 5D1XD 2JB5L 3LIZH 3E38A 3LSOB 4KI1A 1CVSC 1JHKL 6CGTA 1IC7L 3KEHA 2LT9A 2VSMB 5D96B 2MCPL 5I0XA 1MCWM 2PP7A 3KPOA 3L5WA 3HE7D 4BXVA 4XNQB 1GOFA 2VC2B 1KLGA 1QHQA 3DGGB 1JK8A 5D7JC 1A3LH 3N43F 3LB6D 4JM0A 5CLTA 5IESH 1TUPA 1QNIA 3ZT7A 4XN1A 4KTYA 2VUOA 3G6DL 4TPRL 5KN5B 1BZQK 5HHQA 3R8BB 2EABA 3ZKXC 1Q1PA 2D03L 4MCZB 5AOKA 5IVXA 2P24B 1P0SE 2MEJB 3FCBA 3P73A 1GCYA 4ANKA 2VLRE 1HVXA 4N9OB 3DO7B 2GITB 4L8BA 4PCSA 4Y19D 5DYOA 4BFFA 1OF2B 4N2NA 1ZLUH 1IKNC 1TPXB 1DQQA 3HC2A 2RA1A 1T83C 3N1PC 1JXJA 1N6UA 2WO3B 1OO2A 5FDWB 1AD0B 3K6FA 1MFEL 2NY2D 3BDXA 3GUFA 4X50A 4L1BA 3VXME 4NQUA 2EIDA 3ETBJ 3O0RL 2R27A 1I9JH 5DMGC 3QC6X 1FCGA 3VI4A 2O6DA 4YOKA 5KBMA 2Z35A 2GBTA 4HXAL 1T1WA 1GMEA 1XBDA 1DTUA 2V5YA 1FL6A 2DBLL 4W9GC 3SGEI 4NUMA 1UD5A 5DEFB 3T04D 1CLYH 3UAJD 4RFOL 2ZWNA 3SZ6A 4XPTL 4UT6H 4LOVA 4WI0B 1UCTA 1DP0A 3F12A 2ZXDA 1EO8L 1GYVA 4JAMB 3TCXA 3LXCA 2W8CA 2R29L 3C6LB 5CFHA 2L0DA 5DURD 3VH8A 4I2XA 4FQ1H 4JPIB 4OZGA 3W81A 4JFYA 2BSED 3D07A 2K7PA 3AXLB 3NEOA 2AJ3B 2CIIA 4P46A 3G5VA 1XGYL 4EI5C 3SKMB 1XEDA 3P0YH 4DUXA 2QV4A 2E86A 2X28A 3ZBMA 1DLFL 1CGXA 4IJTA 2VLKA 5IHUL 4WUUA 3VNZA 5IKCA 3CX5K 4H44C 3JWDL 3T09A 4JO1H 2ESVB 3V5HB 2UZXB 1JTOA 2H1LM 3CXHJ 1S7SA 2PW2B 4PS3A 1R9FA 1TQBC 4B6ZA 5D1XE 4G6AD 2YK1L 5GZNC 4FG4A 2FL5B 4HGWB 1T1YA 3SODB 2NY1D 3GSXA 1UWFA 1U58A 3W9DB 2ITFA 1Y7VA 3QEUA 2NRDA 5JORB 5EFIA 4DGVL 1R34A 1CICD 4IIQC 4CKVX 5C0GB 1P7BA 3M1CA 2O6PA 2X4SB 4TL4A 3QT2A 5I17B 3G5XB 1TSHA 1ZT4A 4NUGL 3V0FA 4MAYD 4G1EB 2YBRB 2Q5BA 3I9GH 1HYSD 4RMQA 2EKSB 1S9KC 1O5DT 4XR8C 3W9EA 4CW1B 5HDWA 5JPNA 5JIHA 2BDNH 4RMUA 3W37A 4NCC1 2APXA 3S37L 1J5HA 5CWSA 1I8IB 4Y19E 2WCSA 1S9VB 4GMTL 4PJXA 3NCBB 4XN2A 4BJLA 5F9JB 2ITEA 2ZE0A 3BKYL 1AC0A 5F89A 1INEH 2C1PA 4ELME 1UT9A 3OPZL 3PJSA 1UKSA 4JBSA 5IZ7A 5T3ZL 2ZG2A 4UZGA 3VWKD 2VQ1B 3ZE0F 2QKIC 1P1ZA 2ENQA 1NIEA 1RZKC 3OF6D 4YZFF 1PX3A 4ZW3A 4AGPA 2WNXA 3WELA 2MRYA 4B3EA 3EBAA 3GIVA 3CN2A 2GJ6B 5F96L 2BP8B 2DDQH 1PCXA 1UXMA 3CVHB 5HPOA 4F8QA 2GIYA 1IEAA 3NIGF 2JIXD 5ACZB 3SE9H 3QWNA 5T3XL 3DX1A 3NQKA 4OCLC 3TA3D 1AIFA 1BXVA 2H47C 4NYLB 3BT2H 1KJMB 2EDHA 4JO5A 4GB9A 5F9WC 3VXOA 4DUWA 4UBDD 1EEYB 4ETQB 1QLEB 3ARGB 5BRPA 15C8H 2Y9RT 4G9FD 4FADA 1NCBH 3OKOB 3O9WA 5EIQA 1IFRA 1WFNA 2Y72A 4Q97A 1ED3A 1L9MA 4MS8C 2MNWA 1N2RA 2R1XB 3I74A 2BVOB 3ILQD 4GXUM 1HL9A 3AMLA 3QUZA 2EEFA 4FNLL 3RVVC 4UDUB 4U7SA 2X05A 4KY1L 2ORBH 4KAQL 2ATPB 2QLVB 5KBNC 1MRDL 1MWAA 1YUKB 3TJHC 3GSNB 3MRLB 2VXQL 5E9NA 3QWRD 1RHHB 1K6QH 4GNKB 1NSNL 4OTXL 2J6EH 1RIUH 4YPJA 3LH8A 2HJKA 2IGLA 32C2A 5ADPL 4HIJB 3DIFA 1IE4A 2I27N 1KYUA 2ZICA 5AYTA 1WWBX 4WHCA 5JDSB 1NGPH 3QRFM 4PJ9A 5CFAA 1K5WA 1QVOA 2IAMA 3K1KC 4JKNA 3TFKD 1S7TA 5TE4H 1PS3A 4XXCA 3ZDXB 5CU9A 5ANME 3CBRA 3LHPL 3MRBB 4JZJA 3ARFD 3BGAA 2P5EB 3PWJA 3FT9A 5B7MA 3IDYB 4PJBE 1JFQH 1DHKA 4DAGH 1XIWA 2D4DA 2Q7YA 3BCDA 3L1GA 4ZMZA 5JW4R 2A74B 4TLSA 1SFHA 3V95A 4S10A 3DJSA 4KVCL 4XWOC 5GSRA 5ACLA 1TQSA 2IADB 4N68A 3TPUA 5FXCH 3B9KC 3SO5A 5MI0C 5HDBE 5AOZA 1W16A 1T5XA 5HGAA 5DLLA 3MRPB 4UF7C 4HAGA 4AW7A 3FB8B 2EIEA 1NAML 1XEUA 2W38A 3VFVA 5JW4N 1HSAA 2EDEA 2VXVL 2YKLL 2ZOLA 3IFOB 5LN8A 4NDMB 2FSDA 1P9MA 4NI3A 1G84A 3B2VH 3VB9A 5LG1A 1N64L 3FHQA 4QI3A 4AH2A 4HHGA 3PWLB 3CHRA 3NJMA 4BA8A 4DTGH 5BQ7A 1MFMA 5DJCB 2WKGA 4Q6IB 4UQIM 2I9LA 1BZ7B 1U2YA 2CLZA 4OCYH 3SDAD 2OSLA 3V5KA 3C5ZA 3LXAA 4XH2B 1J9RA 1EFXB 5I26A 4JFPA 1EXHA 1NLDH 1A6PA 3AXIA 1I8AA 1Q9LA 2C3VB 1NBYB 2LU4A 3DECA 4QXGL 3ZK0A 5DT1H 1G7QB 4M9PA 3ZDYE 5IOPA 3W5NA 1ASOA 2WYZA 4N90D 4RA3A 1VIWA 1UQSB 5H8DA 4AGMA 2SEBA 3HZKB 3MMEA 3ULVC 2NY0C 5TH2A 5INCA 5B38A 1QLRA 4JPWH 4ZOBA 4G9FE 1PVHA 4Z7VB 1NEPA 1MLBB 4XHQA 1VZGA 3RURA 4MNQD 4YHIA 1BVLA 2IG2H 5I76B 1HL5A 2WN2A 2OMTA 1L5GB 1TJXA 4GEIA 4AQEA 1JL8A 1KG0B 1Z2KA 1ZAGA 4GKLA 1VADB 5I71C 1UVQA 4PG9A 3AQYA 1E28B 5HY9A 3GC3A 4AM0B 5HDQL 4AIXA 4AJ0A 1KCLA 4OFVA 1UWGL 3DMMA 4RAUA 1RIHH 4I4WB 4PV1C 5EBLB 5FK9A 1KTDA 2D7QA 5KUMA 3RWFA 4UZSA 1HILA 1NAKH 1CYWA 1U8HB 4QTIL 3U6XA 3QFJB 4JPQA 4OVVA 4LEXL 3DJTA 4DGUA 1G1CA 4O02A 2NUPB 3UAEA 3HI6L 1S6NA 4XO5A 2LHAA 1ZSDA 2XFXA 3SDXA 2IDTA 4GQ9H 4NAJA 3WUZA 4CADB 5IR1B 2H6UA 5J6GA 4HF5H 4J23A 5JXED 1J5OL 3WMPA 4GG8B 4MA1C 4HD5A 5HJ3B 1MWAH 3ASOB 1UA7A 3W1ZA 2R1WB 3NVQA 1YECL 3BP6A 4R6UA 2JI1A 1IKFH 3BJ91 3FB6B 1GL4B 3KWWA 3GSQB 1FPTH 2YFNA 4BH8A 4XCNA 3CC1A 3ABKB 4ZUUB 4UT7L 4D7BA 2VXQA 3UMTA 5DFWH 4F24A 2Y36L 5KVDE 2XACC 3C08H 3T8XB 5KVEE 3P0GB 4GP5B 5DZLA 1DEDA 3VFGL 1E9PA 1J8HA 5GGSB 2O26U 1CBVL 3TBVA 3LXUX 3FCSB 3FRUA 2DYSB 2IC2A 5E8DL 3WMQA 1QBML 2GKIA 1S9WA 4GAYB 2E7DA 25C8L 2CHWA 4P2OD 2MQCA 2CIKB 3IB4A 1KEMH 3HZVA 3IMTA 3MBEC 5SWSB 5TGBB 3DA0A 3D09A 2P5WA 2LLGA 5D72L 5AAMC 2GEEA 2DD8H 3RZCC 2A7BA 3SGDH 2QBWA 3EOBB 4X83A 1JI2A 3VQMA 4LZKA 1MCNA 4U1JA 4LLMA 3EYQD 2PO6C 1L7IH 3VYNA 1WHOA 2H2SC 3WEAA 4EO5A 4M6MH 4E41B 1J5IA 3RNKA 3QRGH 4CVXB 2XU9A 3E8UL 4IDJL 4Y4KB 1A6UH 3B9EA 3KPMB 3T1FB 4U0QB 3S3BB 4QRPA 3K8LA 1IEHA 4LFHG 4PLKC 1J0KA 1NAMA 2X42A 3AW5A 4H8VA 4XPHL 1CURA 4MNQE 4NNPH 4QO1B 3TIDA 4A2DA 3RY6A 2BNQD 3QEQB 2F7RA 2HB0A 3MROB 1XF2B 4ZW5A 4QRRA 3QJXA 1OP5K 4GW1B 3Q6GH 3T08A 2WZAA 2QSVA 1MAMH 4N9GB 4TSAH 2FIKB 1B3JA 5HI4D 2H3NA 2OMUA 2B1AL 3H9SA 5SWZB 1SRDA 1VF5C 4JO3H 1Q0YH 5KBKA 1JXFA 5DUML 2VQTA 5J8OA 1A2YB 4OGYH 4NZRL 4YE4L 1ZY9A 4FFWD 1OLLA 1C5BH 3N0AA 4X7TB 5IF0A 4GRWF 2PXYA 1Q38A 1RJYA 2WNGA 3VFWB 1T4KA 2DEWX 2I5YL 1WE5A 3SDCA 1KXVC 3QQ3A 3UX9B 3RTLA 4Z7WA 3IFNH 4PJFB 2NY5H 2H0JA 2F54A 5T1JA 1P5UA 2DKUA 4QRSB 3RZWA 1MAJA 1NCGA 4EKXA 1T6BX 1E3XA 4X80L 4YO0B 3D4CA 5KVEH 2HVBA 1SVZA 2VZSA 3SDDC 2PR9A 2XT1B 4NBZB 1TLKA 3O41A 1KTLA 5AKTA 1SBSH 5I1AA 1WITA 3GEFA 1CYXA 4JQVA 3WLBB 3MAWA 4HEPA 4WFFD 5BS0B 3S36H 3TWYA 4K94L 1UXWB 3HCVB 3O2VL 4O02H 2P42B 1D6EB 2K6WA 4IGBD 4HJGB 3SOBH 4BV1A 3WE6A 5CGBA 3WN6A 3IFLL 5B7EA 2AANA 3PNRB 4KO9A 2CCVA 2FDBP 3ARYA 4LKCA 4E9YA 5FB8A 1MCBA 1UWYA 3NZ8B 3IGAB 5IQNA 1CMOA 1D9KC 1N7MH 2E46A 3QG6A 5AVZB 3VXNB 1X5AA 5CZVH 2B16A 4NS0A 3CPUA 2H5UA 1IAIL 2FTAA 4YK4C 3VFUB 1YNLL 1W6LA 2YAPA 4AENA 2CNYA 2ZNXA 4LLQA 5FYKD 3HNSH 5IK3A 2X4OA 3DDGA 3KWXA 4PCYA 3HN5A 2QVTA 4OGXL 4NP4L 5EOCL 3GDCA 4JKWA 2VXTH 3GSWB 4OF6A 3QORB 3ECVA 3P4MB 3ARED 5JHLA 4UNUA 3VXUD 2ZG1A 1U8PA 1MW1A 2HT3D 2OZ4L 2P49B 4E9RA 1QEWB 3K6NA 3QUYD 4N2LA 3EH3B 4PJ6A 3PHQB 1F8TL 5D71H 1RMFL 2DMGA 1JNJA 1FNSH 3AT0A 3V4UH 5T1KD 1W0VA 3WNPA 3KYMB 5E6UB 1X4ZA 3D4GA 1PY0A 3LRSB 2UVEA 4HUXA 4PGBA 2ZXBA 4KXCA 5GS1B 1IZKA 4PAZA 5ITFA 3IRCA 5BRZA 3FPXA 2R8SH 2NXYC 1NCWL 4W9IC 4A7SA 2BNQE 5CKAA 4KPHH 1PLCA 1DVYA 1UATA 3UYOD 2GUOB 1XZ0A 4WW2B 3WIIL 3J07A 1JWMB 5B8CB 3EDEA 3ARWA 2X9XA 3DGCR 4KH2A 1YPZF 1FJ1B 2AEIT 1GH7A 3MLZL 4LE8A 5D93C 4PJCB 4JO4H 2O61A 1PX8A 2GSGA 1YRKA 2XXCB 3EJZD 3H8NA 3MLWH 5GJTH 5C0IA 1XDTT 1T80A 3U30B 1AO7A 1MCOH 3M8OH 3G6AB 3TNMB 4FFYL 3UERA 1T3FA 4HJJL 4HKXA 5B4MD 1LP9A 1TKWA 4FQXB 2DJUA 2VM9A 2XOTA 3O81A 3UP6A 4HKZA 1GZPA 4PJIA 3SSGA 2KZBA 1GZQB 4KHTH 1B4RA 3D39A 1LE9B 1IJNA 4WEBH 1NCDH 3AG2B 1ZLWK 2BIMA 4X0KA 2YMXL 4WFFE 1IGCH 1VSCA 2JKTM 1OP5H 1G6RL 3L5XH 1F4XH 3LNDA 4FEMA 4ONGH 3IJ7A 1FLTX 1GGUA 1JZIA 1SXBA 2R4RH 3BEVB 4HALA 3L9RA 3BN9D 4LESA 4WWKA 4WEMB 2CJSA 2IPTL 1Q0XL 3SJVA 3ZE0E 4HKBA 1WAAA 3OJVC 5DD6B 3FQWB 1J5DA 1HI6A 4YZFE 4L3AA 3CXDL 4OI9A 4PJDA 4KKZA 3K6DA 1D3CA 2CRYA 4XN9A 2CDEA 1THCA 3GB7A 4IRJC 5FYKE 4PWKA 4ABWA 3QDGB 3NIGE 3IGUA 3ZOAA 1NINA 2JCCB 4BDVA 5F44A 4AV4A 5T5FL 1AKPA 3D9AH 2N1TE 3L4UA 5MEOB 2KPNA 4F91B 4CSSA 1WA0X 1CDGA 4FYRA 1MRFL 4JVUA 4NT6B 1MW0A 1LHZA 4HC1L 4G8GA 5DVLA 3VXUE 1J9TA 2XBZA 2NQCA 3CMGA 3UPCA 3GSRA 1CL7H 4JO2L 3GI9H 4HUMB 3UH8A 4GG6B 2J55A 3RWIA 5F97E 2GG1A 4XAWL 3DUSB 3HZ3A 2K0RA 4EBQH 2NW2B 5M95B 3CZEA 3MCYA 2E6QA