2FT6A

Structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Basic requirements for a metal-binding site in a protein: The influence of loop shortening on the cupredoxin azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ft6A00
3X1GA 2BW4A 4N8UA 1VLXA 5PCYA 3WG7B 2WO2B 1BXVA 2VW6A 3U25A 1J9RA 1NZRA 1ASPA 4HHGA 1ZIBA 1KYAA 2VSMB 3ZIYA 1TEGA 2IWEA 5I6LA 2BWDA 2CBPA 2Q9OA 3T6VA 3IE9A 3KW8A 4CSZA 1AIZA 2IAAC 2P80A 4P5RA 3NJKA 3D12B 5FC9A 4PCYA 1ZIAA 4X4KA 4DP0X 3G5WA 4CSPA 1XB3A 3AZUA 1PZCA 2CALA 2GC4C 5B7MA 2WO3B 3PXLA 1KV7A 5PAZA 2Q5BA 1A4AA 1J9TA 2PPEA 4KO6A 4E9WA 4Q89A 4A2DA 3H56A 3OQRA 4A67A 1AQ8A 2PP8A 1ET8A 1PZBA 5B1JC 1FWXA 4GXFA 1M57B 3X1NA 2DWSA 2E86A 3ERXA 1GS8A 3X1FA 2IDSA 3GYRA 1RCYA 2GSMB 1AS6A 3FU8A 3WNIA 1KDJA 2Y69B 2DYSB 3FU9A 1L9TA 2UXVA 1JERA 4G7QB 1TU2A 1E65A 4JKNA 3OMNB 1JZHA 2IDTA 3NJIA 2J56A 4F7KA 4YSCA 1AZBA 4YSQA 1IKOP 3ZDWA 4ENZA 1GSKA 3ZX1A 2OJ1A 1TKWA 1AZCA 2GC7C 2PLTA 2QDWA 1OOWA 3NSCA 2A3TA 4EF3A 2FT7A 2EIKB 3T6XA 2HX7A 4E9TA 3JTBA 4BXVA 1SDDA 4QLWA 2J57A 1DYZA 3BQVA 3T71A 4A2GA 1JZFA 2PPDA 4KO9A 1SFDA 2IWKA 3WKPA 1XMEB 4F2EA 3QPKA 2CAKA 2HLEB 3NJFA 4KNUA 1W8EA 5B1BB 4UANA 1E5ZA 3WKQA 1MZZA 1E5YA 3EH3B 4DP8X 1V54B 3IN0A 1UATA 4YSUA 2GBAA 2UXTA 1ILUA 1AANA 3TU6A 2TSBA 2CUAA 3EH5B 1PMYA 1JZJA 1BYPA 4DP4X 1ZDQA 1HFUA 1A3ZA 2BP8B 1SF3A 3UGEA 2JXMA 2YXVA 2QPEB 4BWWA 2EIMB 3FPYA 4YSTA 2BHFA 2XV2A 1L9RA 2CJ3A 2I7SA 3AG3B 5IY5B 1EHKB 1X9RA 2H5UA 2FWLB 4BWUA 1OCOB 4W1TA 1OCCB 4HCFA 1AS8A 1KCBA 3GXUB 3AG1B 2W88A 2FQEA 1I53A 3NJMA 1URIA 3FYIB 2IH9A 3QJQB 4DP6X 1ASOA 1BQRA 2WSDA 2EINB 2H47C 2QT6A 3FT0A 3NJHA 4DP7X 1PY0A 3DTUB 3HB3B 4NERA 2VW7A 1SFHA 1L9OA 1M56B 1OE1A 1B3IA 2R7EB 1WA2X 1NPNA 4UF7C 1N68A 3OMIB 1JVOA 5I26A 4MFHA 3TA4D 4E9QA 2OV0A 2B08A 5D4JA 1GY1A 3DKHA 3OMAB 3QJRB 5F7BA 2PCYA 2YAOA 1E30A 3ABKB 2HX8A 4TXVB 3NJNA 4A2FA 2XUWA 2YAMA 5EHFA 4KO5A 3S3BB 1NWPA 4AKQA 4P5SA 2MTAA 2PP7A 3NJGA 1ASQA 2X87A 4FAAB 2ZOOA 1AS7A 1IBYA 1KBVA 2PCFA 2XWZA 3S8FB 1MG2C 3ZBMA 1SHWA 2HXAA 4NAJA 3PPSA 4E9YA 4YSEA 2YAPA 1YLBB 2BWIA 1BXUA 4A66A 8PAZA 1L9SA 1J5CA 1NIDA 3PAZA 4G70B 1GS7A 4YSPA 4DPAX 1NWOA 2GHZA 4WTQA 1A4BA 3PAVA 4HALA 3SQRA 5I5IA 3T6ZA 1CURA 3X2QB 4GY4A 1OF0A 4HAKA 4DPBX 1AG0A 1J9QA 1BEXA 3ABLB 3NJLA 1SNRA 4HCGA 5B1KA 3MBWB 5AKRA 2BP0B 3CDZB 2H3XC 1AZNA 5AZUA 4N4YB 2AZAA 2VSKB 1PLBA 5B7EA 1IBZA 4BDVB 3NP4A 3SBQA 1KCWA 1KDIA 1W6LA 3S3DB 2DV6A 4KOCA 4KO7A 2PPAA 3DIVA 2AZUA 2BP8A 3T9WA 2DYRB 5B3SB 2FQDA 5AFAA 1JOIA 3SBPA 3FPXA 1CYWA 1NPJA 1A8ZA 2XV0A 3BVDB 2J5WA 1PZAA 2X88A 1QNIA 1BQKA 1JXDA 4HZ1A 2HZHA 4YSRA 2VW4A 3IN2A 3UAEA 3QQXA 1PNCA 1ZPUA 3H4FA 3QJSB 6PCYA 1A65A 4YSSA 1JZIA 3KW7A 4K9JA 7PAZA 2BZCA 2OCCB 3T6WA 2AFNA 3TBBA 1BQ5A 4F2FA 3V9CA 4AI7A 3ABMB 4YSDA 2BW5A 3AG2B 3NSFA 3NT0A 4KNSA 3CVDA 2R7EA 1FFTB 2GIMA 2ZWNA 4Q8BA 1ZV2A 2VMJA 1L9QA 3S8GB 4YVNA 5A7EA 1QHQA 3FQYA 3UABA 4G71B 4YSAA 2VM4A 1JXFA 4BXSV 3NSDA 4HIPA 4DP1X 1JVLA 2XX0A 3SBRA 2AANA 2EIJB 1CYXA 1GR7A 1PLAA 3PAUA 2VM3A 4YSOA 4BWTA 3AY2A 4KOBA 3X1BA 2XLLA 2I7OA 1IUZA 2BZ7A 1W6WA 3JT2A 3L45A 5I5MA 3AW5A 3FU7B 1E67A 1NDTA 3ABGA 4YVUA 4WKXA 3V9EA 5ANHA 2LLNA 4M3HA 5I5JA 4ZK8A 1XB8A 5TK4A 4BK5C 2UX6A 3CVCA 4KNTA 3TBCA 3WNJA 1JZEA 3FS9A 2HRHA 3X1EA 4E9XA 3EHBB 1MG3C 1ET5A 2BO0A 1F56A 3OD3A 1GW0A 2UXGA 2XV3A 3HEIB 4JHUA 5B7FA 9PCYA 3AG4B 1NTDA 3FYEB 3CVBA 1IC0A 1EZLA 1RZPA 1SJMA 2XXGA 4AZUA 7PCYA 1RKRA 4RH4A 4W9ZA 4L0PB 3GDCA 4E9SA 2N0MA 2BP0A 3UACA 3CDZA 2UX7A 1X9UA 2DY2A 2PP9A 2XXFA 1AZRA 4AX3A 2IDQA 4YL4A 4GYBA 1NIAA 1XB6A 3UADA 4G72B 4BDVA 1ILSA 3S3CB 1HAWA 1BXAA 1NIBA 1WS7A 5I6MA 1CC3A 2YXWA 2Y1AA 1PAZA 4G7RB 2XX1A 2I85A 3NSYA 2VN3A 5F7AA 4FA7B 1J9SA 3QJVB 2YAFA 2FQFA 2RACA 3NYKA 2J55A 3WI9A 4G7SB 1OV8A 2JKWA 1TEFA 2FTAA 3MX0B 4GP4B 1AZUA 1GY2A 1PF3A 1J5DA 1BYOA 3FQ2A 3FSZA 3NP3A 6PAZA 5I6KA 1OE2A 3UAAA 2QPDB 3FSAA 3OM3B 1ADWA 1V55B 2HRGA 3FSVA 2FJSA 1OCZB 1M9WA 3N2JA 2YAQA 3TASA 3EF4A 1ETJA 2JFCA 5I28A 2QDVA 5B1JA 2YAEA 2FT6A 1JZGA 2IDUA 1HAUA 2NRDA 1T5KA 3QJUB 1AR1B 1WA1X 3PLYA 4JHVA 1MZYA 1PNDA 4A2HA 1OCRB 1NINA 1NICA 4NB7A 3FQ1A 3ASNB 1DZ0A 2HX9A 4HCIA 2UXFA 1PLCA 2ZXWB 4E9VA 2YQBA 2IH8A 4UAHA 5E9NA 4A2EA 5LDUA 2FT8A 1QLEB 4GP8B 2DWTA 5B1AB 3FU7A 4DP9X 4QKTA 1R1CA 3CZUB 2YARA 2TSAA 2YAHA 1SF5A 2FNWA 3RYMA 2GB2A 3ASOB 4A68A 1FA4A 4E9RA 3IBOA 2XYBA 1AAJA 2CCWA 1AG6A 2MRYA 4AKOA 2AVFA 2FQGA 3PCYA 3C75A 4DP5X 2PPFA 5I6PA 1AOZA 2EILB 3H4HA 5D4IA 5I6OA 2IWFA 4AKPA 3WIAA 4DPCX 1SDDB 1N70A 2ZONA 2W8CA 3QJTB 1AACA 1MDAA 1CUOA 2B3IA 2GI0A 1GS6X 2PPCA 1KBWA 1WA0X 1ZDSA 3IEAA 4DP2X 3FSWA 2XU9A 5I6NA 1L9PA 1WAEA 1V10A 3EH4B 1ID2A 1OE3A 1RZQA 3N55A 5D4HA 3CG8A 4M4RB 3NJJA 1PCSA 4PAZA 2XVBA 1GYCA 1JXGA 1KGYE 1NIEA 2IDFA 4GP5B 4HHWA 1NIFA 2P80D 1BAWA 1A4CA 1WS8A 5TK2A 1SHXA 1ET7A
chains in the Genus database with same CATH superfamily
4HT1H 1P4IL 2JLLA 4Y4HC 3DBXB 5C0GB 1ZK5A 4GRMA 4HIJB 3MRIB 2VDPL 4HS3B 5A2AA 4CU8A 3QR2A 5I73C 1GHFH 4G7YH 4PJ5B 5IUSA 4BUQA 5T1JA 2W9EL 4NZUL 4CSZA 3MRJA 4GB9A 4KJPC 1W72A 5CR8A 1X4ZA 2W0PA 1R3LB 3LKPA 2MCMA 1SRDA 2J6WA 4EBQH 3GSQB 1RUKH 2XPGA 3GXFA 4XZUB 5H94B 5HPMB 1RVFL 1E6JL 2J44A 4QRAA 1ADQA 1NLDH 4FERA 1H6FA 1K4DB 4JY4B 2AJUH 3ZTJH 1GIGH 3WO3B 5EO9B 1ACXA 4X5QA 4AV0A 5D93C 4MNQD 5D1QD 1DEEB 2PPEA 1KG0A 4JE4B 4XMUA 2AQ2A 3FU5A 4O4YH 3H56A 1AQ8A 4J6RL 4G2AA 1EMTH 3AC0A 3L3HA 3GMQA 1TQTA 5KS9E 2G2RB 3OQ3B 4M56A 1M57B 4G3YL 4U3SA 1B0GB 3BDBA 5MENE 5IJCC 3RAJH 3MBED 4K5LA 5E4OA 3TP4A 4OD3L 1MCKA 2EUVA 3STZA 1NCWL 3O45B 4NOFA 5ANMA 5DJXA 1KDJA 3MAWA 4MWFA 4ODTL 4RFNC 5F93C 1L9TA 1MFNA 2XZAL 5EUKB 5JW5B 3NFNA 4O58H 1VACA 3BUYB 5TE7H 3U6XS 4EZLA 4B97A 1MIMH 1R24B 3ZYJA 3DMMA 1OF2B 4NFCA 5C7ZA 3RQ3A 1NCJA 4A7UA 1IBFA 3VA2C 4XAKD 2ZCLL 4HUCA 4FG6C 4ZAKD 3FFCE 3F00A 3KG5A 1Y0LB 3QXAB 5MENB 4FGMA 5LKNA 2W1NA 4KUZL 3SO3C 5L8KB 4G83A 3LHPL 3JTBA 1K6QL 1CK0H 4QLWA 3FUNA 1VFUA 3T0VA 4XBPB 3ULUD 3DVIA 3MJ7A 5D7IA 1XMEB 3BI9X 3CVHB 4HS8H 5EC2B 2IFFH 4WO4B 3VVWA 4BKSC 3VDBA 2OAAA 3O4OC 3NVQA 3HS0C 2RAMA 4N0YH 5IESL 1PS3A 2GW5A 3WIFA 4GOSA 1IJNA 4QHNB 3IXAA 1OAKL 3IN0A 2KLTA 1UUNA 4WGKA 4TSBH 4Q56A 1BLNB 2VXVL 2NYYD 3FFCB 5B1CA 3GRGA 1N8OE 1YAIA 2Y06L 1CF8L 2G75A 1TLMA 3KEHA 4UWQB 2VXQH 3IDMA 3RWDA 4DP4X 1WAAA 1WISA 1ZDQA 3KNBB 3MCLH 3WKYA 4HWBL 1ULVA 4FF9A 2JXMA 1BGXL 1FRGH 2QPEB 3SJVE 3SYPA 1I3RB 3GMPB 3FUHA 1OW0A 1QMUA 3FMGL 5AVUB 5LG6A 3DUSB 4I89A 2VQUA 1AE6L 1LE9B 2YWYA 1YYLL 3T2NL 4OIIH 4BWUA 3QZBA 4XN4A 3WS3A 2ALWA 2ZJSL 2CMRH 1DQTA 2JI3A 1CD8A 3GBEA 5FM5M 2BRRH 3UJTH 2ZOKB 4OAWB 3M1CA 1I4FB 2OR9H 3MNZB 4XX1G 2NUPA 2YOCA 3HC4L 1JV2A 4WW2F 3T1FB 4BFIA 4OF0A 4NERA 4AW4A 4WV1C 3DXAD 3SJVB 1M56B 4NDMB 2B39A 3OR6A 5DUJA 5LQBH 5GGQL 4CADB 3UTTB 3RWCA 2ENPA 3QNZA 4PS4L 5D1XE 3MGTB 3N44F 1AD0A 3E1F1 3GI8L 3OMIB 4Z7IA 4BV1A 4H8QA 1RP9A 2E0PA 3Q3GA 3PWPE 4W4OC 3OKNA 4AYFA 2OV0A 2QVMA 3GGWB 3L9RB 3HI1A 4MJJA 4ZO7A 3H53A 3IDNA 3N41B 5AOJA 1CXLA 4FLHA 4L5FL 3WLBB 1HOEA 5IB2A 1MJ8H 2PCYA 2UUDK 4TVSa 3D0LB 3BC9A 3K72A 2NUTA 4HG4J 3HS0B 2XN9E 3QUGA 1IAIL 2CDFB 4PB9L 4G1EB 4TXVB 1I9JH 3BKYH 5D7SH 4A2FA 1FO0L 1PLGL 1X4XA 3RBGA 3GBMH 4X98B 4LSVL 2Q7NA 4OD2A 3SCMA 3WN6A 3ZKMD 3TO2B 1GL4B 1NH6A 5JPNC 5D1XB 2XWZA 4XGZB 1ITCA 3B9KA 4GQ9H 4IMKC 3MOBL 5DTFA 2J8OA 3PWPB 4YSEA 1WHOA 2Q8BH 1YYML 3QR1A 5F7DB 3FW6A 4V2CB 2DAVA 4DH2A 1BZOA 3U6RA 2GYSA 5SV3A 4NQVB 4G70B 1TZGL 3I6KA 4OM0L 5FLUA 3WFHA 1CL7L 1ZANH 3DSFL 1I7ZA 1OCWL 2ZYRA 3EO1B 4XI5D 4EMZA 4Z78B 5A2FA 1WCBB 2DBLH 3T6ZA 3A5VA 4JFYB 5BV7C 4UT9H 3BSZL 5DQDL 1OF0A 2FIKB 4WUUE 5TDPB 3VWKD 5I30L 4C4KT 4J3SA 2Y6SC 1H8NA 4FCHA 2JMRA 1P4BL 1BEXA 3QUXC 3BGMB 3E6FA 4TYUA 2Y7QB 2DKUA 2ESVA 2AF2A 2F7IA 4LLWA 3SDAC 1NMAL 1CFQB 5LN8A 5E4EC 4UTBH 2R4SH 3DETD 5D2LF 1TVHA 3QIBC 2X4UA 4PGZA 1ONQB 1OB1B 4NAMA 4ODVL 3MNMA 2PMZA 5LLIC 4N9GA 5BRZE 1BBDH 1RJLA 3KPPA 4G6FB 5DHVA 3TC9A 2BP8A 3I9GH 2LVCA 2P45B 3DVNB 5B3SB 1R5VB 1A6TA 3FB7A 1BVZA 1JOIA 2DLHA 4HKBA 4WUUB 3PL6D 1HQRB 4OF5A 1OAXL 4OFDA 3QCUH 4FLOA 2ENSA 2TRYA 1OQXA 1NPJA 2PW2B 5H35A 3RGBA 4EQ2A 5IFJA 2WTRA 2F8VA 4NQCA 1RZ8B 4PGDB 4X6EB 3KLHC 1ROCA 2F8XC 5HDLA 1CFMA 3QQXA 2VDLH 4GKNA 1GMIA 4NUGL 1GW6A 1S9KC 2YEZA 3KW7A 3EO0B 4K2UH 3OXRB 4HX1A 4PUBL 3FTGA 3T6WA 3SGKC 1U4EA 5AENA 5IB5A 4P2RA 1C5CH 3BFQG 4L8DA 5JPNB 5H37G 1MCCA 4WI4A 3AACA 5EBGA 5LWYH 1HZHH 1C5BH 5I66B 1CLZH 3RL1A 5E5MA 1H3PH 1X5FA 4NCC2 3HI5L 1FFTB 3P54A 4QYOB 3SKUD 2X0VA 5F0LB 4JRFA 3QDMD 3RTQC 1HH9A 4U7KA 5IB3A 1PFCA 2W81C 1A9BB 2VM4A 3T2OA 4F7TA 1RZGB 4DP1X 5JW4R 4IRJA 2JCCE 3LQZA 3INOA 2VLJA 3JYBA 4ADIA 4EIZC 1PCXA 4AVHA 2OI9C 2JWYA 3QUXB 2DMKA 3QZNA 4AQ1C 3S34H 3MTRA 4IRSA 3MRFB 2I69A 4H8PA 5I5MA 3MREA 4WJ5B 2CBTA 3D39E 4P48A 2OKMA 5E6IC 3FU7B 2YK1H 4XMVA 3ABGA 5D9SB 2ZX5A 1UZ6E 2Z31B 1WWCA 2OMTA 1UA3A 1KPVA 4HG4K 4OQTH 4JGMA 1MLBA 2VDQH 4PVLA 5ELIA 2APFA 3M07A 4PCSA 4L29A 2JCCB 5E8NB 4WEUD 2EACA 1F00I 3ATDA 2NQCA 4IU3A 4YDJB 1P1ZB 3T0EC 3U9UB 2CSPA 1MRFH 5IMMB 4FQHB 2FBOJ 2VZ3A 4NQDE 2JKSA 2LTQB 2NXZD 1UH2A 3V10A 3D39B 1I8LC 1OEZW 4ICWA 4K71C 4YOKA 4GFTB 4L0PB 4PVNA 3MBWA 1RU9L 3AB0C 3CDZA 3O3UN 1XZ0B 1MCHA 5D5ME 2NMSA 4ZS6C 3U7YH 4TUJB 2HJKA 5CFAA 3O6KH 4MA8H 3RVUC 1EAOA 4W9KC 3SZ6A 5TDOB 4FXKB 5BPPA 4JN1L 4PW4A 4NPJA 5DR5H 4S1RH 3TPKA 1OP3K 1XGYL 4NQDB 5ACZB 1PAZA 4LVNC 3TZVD 3Q43A 1KBGH 2AJYL 2YGOA 2YWZA 1X6NA 5E6ZA 2VLKA 4OVVA 1HE8A 1R4XA 4PJHA 3GZQA 2YPKB 5I1KH 5JQHC 1MCOL 2FSEA 4C54A 1N64L 1QZ1A 2J8HA 2GAZA 2HRPH 2AGJH 5CJ8A 2Q2EB 4XPHH 4C56E 4PEEA 3CXDL 4AQ1B 4OI7A 3WGVB 3P40A 4EZJA 4RMVA 1BQHA 1QA9A 2AKRB 1T22A 3FSAA 3MACH 5EIQA 3TLRA 1V55B 2EVIA 1H9DA 2BOLA 2ZUTA 3GSNH 4Y4FB 3U46B 2NSXA 2ADJA 3CN1A 4OZIB 1SEQH 2A77H 3O9WA 3PFQA 5LCVH 3RY4A 3RZWA 4DKAA 3FO1B 4OGYL 3CFJA 4GSDL 1KTJA 2FB4H 3JWDL 5IQ7H 5E0FA 1M7IA 2J7LA 1XTMA 3KBEA 4GAGH 4U6YB 5K9OA 3LN4A 3G5VB 2WYZA 1MZYA 1NBZA 4R5VA 5F0PB 1I7RB 2ZP0T 4NB7A 4HCIA 4UT6H 3NN8A 1AMYA 1IGFL 3HBGA 2FNBA 1G9NH 1NJ9B 4QHMB 1RPUA 4IU2A 4UAHA 1LD9B 1DVYA 4QF1B 2WWNA 3VG9C 1JMZA 5F89A 4QY8A 4PRAA 4FZ8L 3VA6A 5EOCJ 4LOUC 4LSQL 1S9VB 2D7OA 2W0FB 1FIGL 4D0BB 2AK1H 2TSAA 2YAHA 4X8GA 2C3VA 4PI0A 4Z7VE 5DVNA 1U8OB 5FKAB 2NX5E 4RMBA 4TTGA 1PZ3A 3MLUL 4OKVA 3P4NA 3WEXB 3VGDA 3KYMB 2FQGA 4PJAA 1MCJA 2NZ9C 3S88H 4G5ZL 3LV3A 3RU8L 1TVBB 2O6CA 4PCKA 2R0ZL 1AOZA 3CC5A 4I1PA 1EO8L 2VDNL 3T77B 3ULVD 4PJFF 4KQ0A 1FLRL 1PAMA 2AQSA 3GKWH 2EO1A 4QR7A 4IKJA 2PO6D 4JR9H 5IJKA 5DK3A 3EDDA 4TVPL 1A8JH 4E5XB 2VZOA 1GS6X 3V5KB 3SDCA 3BN3B 2NX5B 1Q9OA 2VDQB 3B9AA 3QJZA 1NCGA 1CBJA 1OE3A 3P4MB 2WXIA 3D2TA 3WN5A 4HDIA 4HHAB 2Y36H 1XTLA 5C0NC 3LEVH 1WZMA 4PAZA 3RGHA 1CZ8H 4ELMA 1QI3A 1A02N 3VXTA 4QRRD 1K2DB 3OZ9H 2F5AL 3BP7A 4RMQA 4LNRA 2KPWA 2X88A 3BDYL 4OCYL 3LPFA 2QADB 1CGUA 3WG7B 4LSTL 4V2BA 1FL3A 5EB9A 1JK8B 1XSOA 5T5FH 5JOFB 3C5JB 2F53E 2WQUA 4S1QH 3X11B 2HTLD 5GIRB 4LLMB 2QZQA 2ZSVA 1CLYL 2VZVA 3QZWG 1SJXA 4XNXL 4FXGA 2RFXA 5FOBA 4HOXA 3AWEA 1INQA 1HXMA 3S97C 4AVKA 1RPKA 2NR6C 2NTSP 3VGEA 4WW1A 1MCNA 4NQED 3VAEA 4XP1H 3WTWA 4J3VA 3PAYA 1PZ5A 1DQQB 1O6TA 2FYYA 2ITCB 4G6ML 4N28A 5JHLA 4HFUL 3LOWA 4F8PA 3RWJA 4R3SB 3T04D 1F11B 1BDYA 2AQRA 2F5BL 1Z5YD 1B2WH 3MUHL 4XXDA 2WO3B 3PXLA 35C8H 5FM5O 2L04A 3OJDB 5C3LD 2FHFA 3IVKB 5JLZA 5B3JE 2F53B 1T0MA 3LN5A 4PV9A 4KO6A 4FTVA 4A2DA 3OQRA 4ZW8A 3BVUA 3VXUA 4O2CA 4XP4H 4JQVC 5F70A 5CBAB 2DWSA 2E86A 3AWFA 1ORSB 2Y1ZA 3ERXA 1KOAA 2Q3XA 2VLLB 3GMNB 3IKCA 2BSTA 2F08A 2YEVB 4Z7OB 5EZJB 3FQTB 5AVQB 1KYDA 5DVOA 3WJMB 2DBJA 1SDYA 3HZ3A 2BFVL 1O7VA 1G4MA 4FRWA 2FX9H 3UYPA 4C4KO 2OMWA 5E1AB 5SV4A 3WLWC 1S8DA 4ODWB 2KMWA 3VXNB 3MKGA 5I1GL 5DSCB 4ENZA 1WITA 1MAMH 3QORD 3SQBA 3EXLA 1ETZB 4MNHB 1O6VA 3WIHH 3MRGB 4W68A 1HL5A 3M46A 5BUAA 1UADC 3GMLA 5ITFB 2Y07H 3X12A 3SBWC 4X5WA 3BQVA 2I5YL 5L2JB 4KO9A 2A83A 5DQJB 1F13A 4ANWA 3GLEA 1KGUA 1V7NH 5B1BB 2X44D 4GKLA 2NXYC 1I8MB 4X9BA 5IKCA 2EDFA 2VB5A 3UTQB 3MYZA 3HNSL 3MNWA 1WFMA 5E9DE 4MX7B 3DRQA 3UBHA 1ML0A 4QHLB 2H41A 3K5SA 3CAFA 3EYQC 2XTLA 3FN3A 2DWEB 2WVUA 5F9DC 3GO1H 5JA8B 1RJYA 4JO2H 5K69A 1NCDH 1N19A 1L0QA 1ID5I 3TYGL 4PGCA 4RNRA 3HJ0A 1QQDB 1SF3A 3UGEA 4QXGH 4D0CB 2FBRA 4HZAA 2YXVA 2IO5A 2EIMB 3ATBA 4YSTA 4FKEA 4LVOB 1YEFH 4K3EH 3EYUH 5KUMA 1JGEA 1JYWA 2BOCA 5DWPA 3V6ZA 2HKFH 4HJJL 4BKLA 4KI5E 2A9NL 1MVUA 4FA8A 1AQHA 1W0WB 2LGNA 1UVQA 1DVQA 3D34A 4HKJA 5D4QA 4RGMB 3AG1B 3B5HA 3S5ZA 1I53A 4BQ6A 3C5ZD 3Q9PA 3NCYP 4BSVB 3D7PA 5F6IC 4QHKJ 3D33A 4N0UE 3JTTB 3K3QA 1LE5B 2VQ1A 1CXHA 1R3JB 1AO7A 5I1EH 5KYYA 4MZ3A 3L4ZA 5EF1A 2W0LA 1NPNA 1RULL 4EO5A 3CZFA 3DIFA 3KPOB 1CGTA 3CU7A 5C2BL 5J12B 4N8CH 1IGYB 1CDGA 1YO4A 2WSPA 3EG9B 1ND0B 2ZPKL 5D4JA 3RNKA 3BDXA 3DKHA 4ZMOA 4ZX6A 3QUZA 3BWAA 3NIGF 5GGRA 3H3PL 5DJ6B 3MLXH 5LN4A 3UJJL 2NXYB 5MEND 1N5AB 3GSWB 1JYNA 2CLVA 3IRPX 2MCPH 5C0BB 2D7QA 1RURH 2QVTA 3UH8A 4L18A 3C9NA 1DQDH 1UD6A 2WNKA 3GMOB 2KBGA 1A4KA 3IGUA 4JVUA 4ZZFA 2CO7A 2VDKH 4JZJC 1Z9OA 3LKRA 3GRBA 2X87A 3I6SA 2OMBA 4GKOA 4BQ9A 1FG2A 2KZKA 2PYEA 4B3VA 4GW1A 5F1NB 2H32B 3RFZB 5I0ZA 5DUPH 1K8DA 4B95C 1T6WA 3QGVA 4MS6A 5K93A 3OF6A 1BBJB 1JPST 3VD4A 1WIUA 4XWOC 3TCXA 4V33A 4ACTA 1RZJH 1KC5H 3CFMA 1PYWB 1YEDB 4P2OB 5GJTH 3NESA 4PJ7E 3FFCD 3PAZA 4DVBB 1DBMH 1MRDH 4KROD 4QJ5B 1ACCA 4Z18A 4G8FA 3FUKA 4DPAX 4LCIH 3QHZH 3CZNA 3MLVH 2XV6B 4HEMA 4LIQH 3RA7L 1ZXKA 3FUIA 3VACA 2MSPA 4DCQB 4WO0A 3L5HA 4QTHA 5T33H 1FFRA 1E28A 4NJ9L 5CMAA 1NFIA 3VVVA 3B4NA 1QFOA 2XKNB 1AY1H 1UWYA 1OARH 3T3PE 1Z7JA 2Z34A 4WU5B 2HP4A 3RPIB 1K5WA 4PJXE 4BZ1L 1UACL 1BP3B 2NSQA 3W1ZA 2WLNA 5IB4A 1QSFA 4QRUA 1WGVA 1KCVL 4OLWH 5I1JH 1S7VA 2YUZA 5T1LB 3SJVD 3HG1E 2L8AA 3VFNA 4ACPA 1P4LA 2DQHL 1UYWH 2W59A 2Y7LA 3F65A 5ID1A 4TNVF 1EHLL 2ZKXA 4FQXB 4KV5E 3T3PB 1OO2A 3U4KA 1TQWA 2GIXA 2FJGB 3ETSA 4PW9A 2Z35A 4P9ML 3ARDC 3B8YA 4AEIH 4K7PX 4PJXB 1BQ5A 4F2FA 4AI7A 3QQ9C 1KZYA 5KJ7E 1FC1A 1T66D 2IGFL 1S7RA 1G9ML 4WWPA 4XRCA 2K7PA 43CAB 3PJNA 2ED8A 3O6LL 1R3IL 1MWAA 1HSBA 2ROYA 2BIPA 4LRIC 4P2YA 4G1MB 5HYEA 5D6DC 1IAKA 3UYOD 3VFWA 3LZRA 2R23A 3UABA 4QRSB 5AWNL 3ES6B 3QRFM 5FGBC 5GZND 1OIOA 2EDEA 4P99A 5D1XD 1YEEL 5CINH 2D0GA 5IW6A 5HGGS 3SKNB 3FK3A 3PWPD 4G5AA 2WKOA 3HBZA 3ROOA 4A7GA 5KSUB 4JGUA 4G82A 3IPBA 4WWOA 4BSJA 4AL8C 4MJ6A 1JPSL 2XQYK 4HF5L 2XN9D 3SE4C 3APFA 3K71B 4NO5B 4HXBL 2BWQA 3VRJB 3EFFA 2LLNA 3ARBB 2F54E 5I5JA 2JVUA 4B9GA 2F58L 2WCSA 4LZKA 4Y1TA 1DJIA 1T0PB 3CVCA 2YHGA 1G1CA 3P30H 1A7OL 4W6XB 3FS9A 1DUYB 4S0HA 4HLEA 3L4CA 4MDIB 2DB8A 1NGQH 5KWYC 1RK0B 2AEQH 3QIUA 3R7RA 3ZU8A 1A7NL 3CK0H 4LOFA 4LESA 3WS6A 4OI9A 4JFVA 1VFOA 1FBIH 3CDYA 5DK0A 4PJEB 4G6FD 7PCYA 5FDYA 4FE9A 2VDKB 3L3GA 2SEBB 4LIQE 2G9HA 4LHUA 4WUUD 1T4WA 3VGFA 2PTTA 4KVNH 4Y5VA 4JHZA 1UENA 3NZ8B 4XC1L 4BDVA 3Q6FB 3UDWC 4KKAC 3IPFA 4UYPA 4XE0A 5AAMA 2XZQH 4JRXE 4HMDA 5F9AC 4ZFOB 2J12B 5C7XH 2CRYA 2ZYHA 3KPNA 1D9KB 3Q8CA 4IOFD 2NY0C 4LSPH 4XTRD 2HPOA 5BRZD 4DKFL 5I2IB 2C1OB 3H7LA 2DL9A 4QGYA 1RD6A 4S2SA 1QD0A 2P49B 3WOVA 1VSCA 1KTLB 1PL3A 3B2VH 3BZFB 1FAIH 3BT0A 4RSYA 3OJMB 3WI9A 5IOKA 4GRMB 4GP4B 3LS4H 2ZX9A 1E50A 5GRJH 4RRPA 4Y9FA 1DFBL 2O5ZL 3AU1A 4KTDH 4UINH 4NXSA 2XY2A 2QPDB 5DMGC 5E5RB 5ADOH 4YHML 4QHKI 3MRJB 4P5KA 1QBML 2DQMA 4NZTH 3SE9H 1W72B 3K0WA 3U1QA 3GM8A 3LKPB 2YD1A 1UWGL 3L9YA 2XPGB 1HEZA 1NFDF 5B1JA 4K3JH 4M93B 5FAAA 3K4DA 5ANME 3O2DH 5BOJA 4HMEA 4FX5A 4F1SA 3CE1A 3HE6A 4LEXH 3FUMA 3CFCH 1R3HA 3T5WA 1KG0B 3CFBA 4GFXA 4M4PA 3J8F7 2Z31D 4FQCL 3T3ME 4NKDA 4OJYA 4P59H 3L3HB 5ICUA 5CCHE 3GMQB 4AY0A 2NY6D 3DOIA 4FFYA 1OW0C 2ZP9A 4U3SB 1P2CA 4Y9BA 4ZTEA 5MEQA 5I8OL 4WHTA 5EF2A 3U9PH 1MFAH 5K39A 4Z3FA 2CU9A 2P1YA 4JVWA 1P9MC 12E8H 3EADA 3EOTH 2RD0A 3STZB 4NNPL 4ODSH 5ANMB 5DJXB 3U30C 4MWFB 3H1ZA 3VFOA 1IGCL 1NGYA 2FNWA 3D39D 3NFNB 5D7IE 5B8CC 4HSQA 4A2MA 1VACB 4HULB 4YEFA 5J6HA 3OX8A 1OGAA 3D4GA 4X8XA 3SDXF 1QEWA 4R4FH 1HC1A 2NY0B 3T3MB 4KHXH 3DMMB 1MNUL 1ZJBA 2DQFA 1KN4L 1VZIA 1DJGA 2DKMA 4EJ1C 5F3BA 3DJRA 1TR7A 3D0VA 4NQDD 5KW9H 4OR1A 1E5AA 1PKQE 2BXYA 4K9EC 3REWA 2XZCL 3AREA 3U82B 2R8SH 2PR4H 1E40A 3LAFA 3MJ7B 2JJTC 5D7IB 1CUOA 1U3HD 2IALA 4JFFA 4OJFH 3VI4E 5KBPA 1A9EA 2O72A 1QR4A 5TPWH 3FSWA 1A7RL 2ICWI 3WIFB 3SE8L 5EU7E 5ISZA 4DO5A 2J4WL 2X1PA 3HRPA 5FGSA 3IXAB 2ADFL 1F0LA 2H0PA 4QWWD 1RHHA 5KSBA 2VITA 3B9KC 4GP5B 2G75B 1J1PH 2CK2A 1MCPL 4IIQA 4IOSD 2GJPA 2VL5A 3IDMB 4PCYA 1KJ2A 4Y4FD 3IXTA 3P3YA 5TK2A 3RWDB 5K59E 1D2OA 1MELA 1DL7H 4IRZL 4JPWH 3VRLF 3UC0L 1OM3L 3IK2A 4I1NB 3BUQA 2JXMB 2H1LM 2NZIA 4PB0H 3ZE0E 1INEL 3R19A 5F1KC 1F58H 3DX1A 3HI6H 2VSMB 1MREL 4UT7L 3M1BA 3UCQA 3WKNA 3BGAA 4Z7UE 4C56D 2Q76A 5C8JA 1RP8A 1NEZG 3KL5A 3WS3B 4G8IA 5IVXA 3R8BB 3U30B 4FA6A 2D31A 4OT1H 1FN4B 1ZHKA 1KEML 4FFZA 5DMIL 1NBVL 2EEXA 4Z76A 2NUPB 1JV2B 3TV3L 3A4DA 4XMPL 4JQIH 2Q6WA 1DJXA 1ZD6A 1NFKA 1M42A 1XFPA 4HCRA 15C8L 3V0VA 2ID5A 1TOXA 3GI9L 6TAAA 3OR6B 4ZFGL 4MA1B 1JHKH 2PP8A 3RWCB 2O5YL 1AD0B 2QFPA 4GNKB 4WEBH 4YHPA 5AB1A 3Q3GB 3X1NA 3DI2B 3OKNB 4AYFB 3HI1B 2CO2A 4F15B 3IDNB 1KT2A 2MQ0A 2UVFA 1OP4A 5IB2B 3K72B 2NUTB 3MRPA 4KITB 3MA9H 1JSYA 1X5HA 3H42H 3K8MA 1CDCA 4YUEL 3F05A 5FF6A 2R69L 3T4AC 4H8VA 3OJVC 1BFOA 4YSCA 1A5FH 4OD2B 3SCMB 4KK8C 3B9KB 1TJMA 2XIIA 3ZPDA 2ZUQC 5DTFB 2ESVE 2NX5D 4TLSA 3AUVA 1OOWA 3OWEA 1NL0H 4JANA 4GJTB 1GKOA 3A6BL 3JYCA 3U6RB 3EHBD 2O6PA 4I85A 5EU4A 3MOAH 3VGBA 2JH2A 3I6KB 2IH1A 3WFHB 1I7ZB 2H2PC 2PPDA 4NO0D 5HVWA 4YFLF 3WKPA 2KPNA 3BKML 3DROA 2DQTH 1YEIL 1NGXA 3CVHL 4IRJC 2QADD 2QQNL 4TRPL 3D08A 2X9XA 1YQVL 3O6FA 5G55A 1O7SA 3E6FB 3OV6A 5LGHL 3V95A 1EHAA 4G42A 4G6KH 2D7TH 2ESVB 5D1ZD 4LLWB 1T03H 1QNZH 4JM2A 3TU6A 4AV4A 5BQDA 3SN6N 5LGYA 2X4UB 1IJ9A 1UH4A 1L7IL 4NHCL 5G5DA 5T1DH 3RZCA 3DX9A 3M1OA 1IM3A 1VGEL 5T5NG 1H5BC 4RWHA 4XO9A 3PV7A 3DARA 1CPUA 3U6XA 1JNNL 1RJLB 3KPPB 5DHVB 1ZJAA 4P2RE 2BP8B 2QR0A 4P9HC 4LF3A 2EYRA 1A6TB 3FB7B 4R4BA 4HKBB 3IT8D 5H35B 1B0RA 5DVMA 2D3JA 5IFJB 2WTRB 4YDVB 4NQCB 2F53D 5I18H 5JXED 2YKLH 4OLXH 3LQAH 4XOAA 3RDTD 3QFDA 5C07E 1YG9A 1UEMA 2APWA 4M7LT 4AJ0A 3APNA 1YDPA 4I18A 1F4YH 4UOZA 4POYA 5IMLA 2YEZB 3GEWB 5AKVA 3VUAA 4HX1B 4D3CH 4MAYA 1KPUA 2VLJE 5IB5B 4P2RB 4L8DB 3F62A 5CHNA 3EYFA 5ETUA 4Q9RH 3HB3B 1GZPA 4IBLT 1SLWA 1F3DH 1D6VH 2DI9A 2EIZA 5E5MB 3F7YA 1UD4A 5D7KE 1G9HA 1HH9B 4KXDA 5IB3B 4IM8A 5I26A 4L1DA 4F7TB 1F6AB 2R0KL 2ZOLA 3NG5A 4HJ0C 3QB7C 3N9GH 4IRJB 3WEOA 2G4GA 2KZBA 4DN4H 5CJ5A 3LQZB 2ZYSA 1NLDL 2VLJB 2HX8A 1GIGL 4PLKD 4IRSB 2YRPA 4KO5A 4N0FA 3MREB 4NO2A 4MXQC 1ASQA 3ZO0A 2MOQA 5C0EA 2APVA 2WC7A 2C5DC 1YEJL 4ZNCD 5B4MD 1AI1H 2DLIA 3MV11 3HZKA 4I48A 1SBBA 1J9CT 5FFGA 2OMTB 5IBTL 1WBXA 1KPVB 4O2EA 2R1YA 2J5LC 1MLBB 2QQKL 1A22B 1HOCB 4PP1D 3RAJL 5L7XL 4L29B 5D7JC 3V4VA 4IU3B 4B9YA 2O61A 3RX9A 4MJHA 3FTXA 4TTDC 1JPTH 3ZLQC 4DTGL 2R0WL 3GSVA 1F4XH 4WAFA 3S36H 4U1LA 4O58L 5JHDA 2K70A 4W81A 4PJGF 2F2HA 3MBWB 1MIML 4JKPH 5A3IC 2UZIH 4NNXA 3CDZB 2FJFA 2H3XC 1ITBB 2HJKB 2QL1A 4ES9A 2DICA 3BAKA 5E9DD 3QC5X 3UMNA 3MLSH 1XEDA 1OTTC 1KB9J 4ZW7A 5KAQF 1S2EA 3KXFA 4AEFA 3QFGA 3BQUA 3NRPA 3SKMA 3GBLA 4KKBC 3FN0H 2VIRA 4YHNA 2CXGA 4JDTH 1DJWA 3QCTH 2H2SD 1E9OA 4DW2H 2YD8A 4HS8L 2YLHA 2CRZA 5CD3A 4M7LL 4MAZA 2VLKB 4QHPA 4PJHB 3N5AA 5FGRA 2H3KA 4YXHH 3OLIA 3F7PC 2FSEB 2XTJC 5D7LA 3II2A 2ADYA 4PMFA 5GGVH 2GAZB 5SWQA 4TSBL 1JCKA 5EO0A 3M8OH 4KI5D 3MN8A 6FABH 3QCVL 2VZUA 1CF1A 5IJKC 1HHIA 1YA5A 1BQHB 1QA9B 2F7PA 1T22B 2OCCB 5L9DH 1REIA 3GXPA 1NANH 3SDCC 5B39A 2W9LA 2VR7A 1OANA 1QHPA 4G59C 3MCLL 2ADJB 3RTLA 1ECZA 3CVDA 5HJDA 1SM3H 2R7EA 3O9WB 2VZ1A 2LV4A 1VF5C 3CFJB 3LH2H 3U83A 1M7IB 1G6RH 2P5WA 2ZP8A 5K9OB 3LN4B 4WI5A 3AWGA 4OH2A 1WE5A 1JXFA 3KL0A 1NBZB 5EBLA 4N85A 4OCMC 4ZQTA 1JVLA 1CR9L 1MCQA 4YK4B 4YH6A 3V7MA 1CYXA 1SYSB 3NN8B 1TYEB 4XHJD 1C12A 4PJAE 1EEYB 4IU2B 4PS3A 3UJTL 4WTXA 3AY4A 2HH0H 3ZUNC 4QAWA 1IUZA 5F89B 1W6WA 2BSRA 3D30A 1XF2A 3LEYH 4PRAB 4QY8B 4P05A 1OB0A 3P4LA 4HBCH 5J13C 2WBWB 3FTZA 4H7VA 4FXGC 3RKPA 4G9FE 1CE6A 5F7UA 4CL7A 5LQBL 1XF5A 1ZLWK 4M3HA 1SJHA 3K2IA 2X9YA 1RH8A 2BS8A 3EBHA 5CGYC 2C3VB 5JR1H 4YDKH 1GPOH 5HSFA 2HFEA 4NM8L 3SEPA 3F58H 2J1KA 3AS2A 4I0CC 1F56A 3P4NB 4OKVB 1DJHA 5I8KH 3EFOA 3JZ7A 4PJAB 3DSNA 4FHJA 3LV3B 5JW4M 5C97A 4I13B 3B56A 4Z7WE 1I9JL 3CC5B 4Y5YA 1AGBA 3VQLA 1UQSA 1EZUA 3GBML 2FZ3B 4BFJA 4G9FB 4KC3B 1KMGA 2FRGP 4U1GC 1K8IA 3BP6A 1P6WA 1X9UA 3HFFA 4EAEA 3OAZK 4F7PB 2NY1D 2AXJA 1I9RL 2YD0A 3QUYD 4OZFG 1NIAA 3PV6A 3G3LA 1GAFH 1IE5A 1YEGL 1NIBA 1Q9OB 1UT1A 1KXQA 2ZKMX 1JK9A 1FV1A 1YJDL 4PD4J 4P4KA 3WN5B 1MCFA 5JPMA 4TN9A 2BNUA 4HDIB 1J7VR 3A67H 3FQWA 4MQXD 1E5CA 1ZANL 1IKNA 3BKCH 5TFSL 2DI8A 3GINA 4ELMB 1U2YA 3QHFH 2J3SA 2X4OA 3A0OA 4LNRB 2C34A 2O5XH 1OP9A 2FQFA 1FL3B 4LHQB 4Y16A 5E8PA 2E4FA 4HEPG 1Z6JT 3HG1D 3QISA 3FQ2A 4X5RA 2BSSA 2XSKA 4FTVE 2VDRH 2ZSVB 4HAGA 4ONFL 1L3WA 5FUOH 4ZMAT 1O9WA 3E2HC 3UPAA 3OHXA 4FXGB 4GQZA 2RFXB 4OF7A 5FOBB 1CDYA 1HXMB 1INQB 4M7JL 4WW1B 1JDAA 3V8OA 3KLLA 5D72L 1PZ5B 2FYYB 5EA0H 2OP4H 2VRKA 2WOYA 4RMUA 4CVZA 2LHAA 4DGVH 1N4XL 4FP8L 3RWJB 3BPLC 2WXFA 3KWXA 1CIUA 4XXDB 5DQ9A 3SDYH 5EEYA 1KBPA 2WTPA 1ZVSA 5JLZB 1T0MB 3LN5B 4JPSA 4PV9B 1KACB 4Y8AA 2GBVA 5AKSA 4FTVB 2GFBA 4C8XA 5CSBA 3QK0A 3T0AA 3VXUB 4O2CB 2MOGA 1I1AA 2DQCL 3IDJA 1MPAL 4FQIH 1KENH 4NQUA 1UCBH 3FT4A 2QMKA 3IKCB 4JW3A 5GS1C 2BSTB 4ZFQA 5GZOD 3LRSA 5ICZA 4UQEA 1CLZL 5GGTL 3JV5A 4Y7MA 1ED3A 1JD7A 4PJCA 3ZT6A 5EZIH 3F6JA 4OCNC 1BFVH 1MUJA 2EYTA 3UYPB 2OMWB 3MV7A 3PHQA 1S8DB 2GJJA 2CHNA 1T1XB 2F54D 3W39A 4ZO6A 2B1HL 2NQDA 4Y89A 1H6UA 4OLZL 3G5YA 3DUHA 4PRPA 1LP9E 4DERA 2J6EH 1LQBC 1N3NA 3SQBB 2EILB 2Y1YA 3VCLA 5BV7H 4LOVA 1F90H 2VRAA 3TBTA 2QKSA 1RFDL 3GMLB 3X12B 2H6OA 4YDZA 1HNGA 1XSJA 4X5WB 2YK1L 2A6IA 1HEHC 4MXWH 3F04A 3QPQD 2A83B 1GOHA 4GH7B 1CO1A 3HFMH 4N2NA 5DD0H 3IWUA 5HI4D 3FUFA 4M9PA 4ZOCA 5IF0B 5IKCB 2VDQL 1N9PA 2H0EA 3MNWB 2PWGA 1S4IA 2YD9A 3N55A 4J4PA 1R3KA 1N0LA 3DRQB 1KTDA 3J2PA 1RJCA 3I3EA 3PWNB 5IQMA 4JRXD 1MOEA 1KGYE 3NGBB 4MTMA 3RL2A 1RJYB 1BAWA 1WJ3A 3BIBX 4WFGE 1SOQA 1J05A 4PGCB 4RNRB 3AXIA 3N41F 3U25A 3ARPA 2KQMA 1H9VA 5E2JA 5EORL 4HHGA 1RUAH 1MFEL 1AO7E 1S7WA 3A24A 4Y88A 4JFHE 2XNAA 5I6LA 1JGEB 1LWRA 2BOCB 3E8VA 4TQPA 2Q9OA 3V6ZB 4KXAA 3T6VA 3KW8A 5GS0D 4BKLB 1GC1H 1MVUB 2IAAC 1UVQB 3L2NA 2DIAA 4HKJB 1ZGLA 3D12B 4S1RL 4DKEL 1KEGH 4BGLA 1WICA 4EDWL 1SLXA 1KBGL 2IEPA 2V5MA 2QQLL 3BIAX 2XQYG 3PP3H 3CN3A 2V8MA 1FNLA 3WDIA 3IGKA 1KV7A 1KXHA 3NABH 2Q5BA 2OCJA 2VQ1B 1U2CA 3G9VA 1AO7B 4MKMA 1AXSA 3GBNH 4Y19A 5GRWA 4BFRA 5KYYB 3Q8AA 4KH9A 2V7NA 2P8LA 4HOMA 1JGVH 2EC9T 3E8UH 3UZEA 3CZFB 2IGLA 4KGJA 3DIFB 4QXVA 4NP4L 1KLFA 4OD1L 2BJML 4CMHC 3N50A 1G6VK 2R27A 4XX1E 3F7QA 3RVWD 5C71A 3RNKB 3KVDD 1LGVA 1Y18A 2DI7A 4WFFE 5LCVL 3A6CL 3QUZB 1DO5A 3FBQA 4W93A 1QBLH 4XAWL 5IQ7L 3FU9A 2CLVB 1OAYH 1YC8A 1TU2A 2WXNA 4X8JA 4WHYG 1A4KB 2GSGA 4N1HB 2CO7B 4HEME 3KYOA 3LKRB 2AXGA 1CTOA 4NIKB 4PQXA 3WFCH 4FQJL 4YSQA 1IKOP 4GW1B 4JCMA 2DQ6A 1K8DB 1AZCA 4P5TC 5HHVL 2BP3A 2F8OA 1A9VA 5CFHA 3CNKA 1GA2A 4G8FB 3DHMA 1Z9LA 4AGOA 2AK1L 3GPEA 1B4LA 2WXOA 2XRAH 4XVJL 4I0KA 4XXCA 3GC3A 3ISWA 1Q9WA 1QAWA 3NK3A 4DP8X 3EH3B 4QTHB 1V54B 3L3KA 1E28B 2AJXL 1NFIB 3S88L 2UXTA 4I2XE 4X6CA 3L1FA 4FQ1H 3KYKH 5GGVY 3NDZE 5D7HA 4AQAA 5F6HJ 2PCXA 1EO5A 2RALA 4ZXBA 1XGTA 3CZJA 3GKWL 4KDTA 4GUPA 4ZO9A 3QYNA 3OSKA 1BVKA 3CH8A 4AK1A 1E90A 1G94A 3V0AC 3QIUC 5IB4B 1QSFB 4QRUB 3VXMA 2W9DL 4NC1E 1L9RA 1S7VB 1RIHH 1BWMA 4BZ2H 5IY5B 4XPBH 3VFNB 1P4LB 1J1XL 5K9QG 5ID1B 2N4IA 3EYSL 1M6OA 3HRZC 1OTSC 3LEVL 4YPJA 1CZ8L 3RX7A 3BH8A 4M7ZB 3KPMA 4DP6X 2GUOA 2NNAA 2Z35B 3OZ9L 4Y5VC 1D5MA 4BQCA 3KPSA 2AAVA 1IGMH 1TVDA 2Y5EA 1Z32X 4YDMA 4DP7X 2JCCF 3HNTL 5AOKA 2C3XA 3FONA 5FW7A 3DA0A 1S7RB 4WIQA 3U7WL 3EKCA 3QPXH 4XRCB 3UBXI 4W6YB 4XWGL 1QFUL 1MWAB 1HSBB 1UD3A 1ZTXE 3PDOA 4L05A 4OV6F 4JFDE 1IAKB 5D96C 3VFWB 3ZKQD 1E9QA 2R23B 2GABA 3CBRA 3LVTA 5DO8A 5KG9A 2M26A 5IW6B 3U4EA 1X3DA 1DQMH 4KHTH 3ROOB 2YAOA 2YO3A 4LASH 4I3SH 3B2UC 4KZCA 5F72S 1PX8A 4MJ6B 3A21A 5ALCL 3RUGA 4AKQA 2BNQA 2HN7A 4KTGA 2E47A 4Z6AT 4XOEA 4ZZKA 3EFFB 2ZX8A 4U33A 3Q2LA 4GSUA 2Z4QA 3T0EE 2AXWA 3GEFA 4LVHB 2OSLA 3SD5A 1Y1UA 3N85H 3ARGA 3FT1A 2ESVD 5K1JA 4F9LA 5HD8D 4DUWA 2CPCA 3FO9B 2AV7A 5DC0A 5KBMA 2H3NA 2CDGA 4IGBA 1UURA 3VXOA 2FX9L 3DV6A 4LRNL 5DK0B 1QYGH 2IV9A 1KJ2H 2COVD 3BH4A 3PP4H 3L3GB 4U6HA 2WGNB 2G9HB 2P52A 3WELA 4LHUB 4OZIF 3QVAA 4DJMA 2WJ7A 2DTSA 4H0HB 5FYJH 1HCFX 1MAML 2PTTB 4X7SH 1OWRM 4Y5VB 2EZ0D 5AZUA 4DETA 2AHIA 2VSKB 4EDXA 2DTML 4HJTA 4ZOBA 4J3XA 4BDVB 1RMFH 3QG7L 5DLMH 5I19H 4AK2A 5JUEL 1NSNH 2AZUA 3L54A 3KPNB 2YZ8A 4L4TE 1Y7VA 3P3SA 2ZCHH 4G8EA 3C6LC 1OAUL 4MJ4A 4X5LA 4AITA 4P2RD 4NKQB 3NSXA 3O2VL 3BN9D 4S2SB 4BEIA 3HB3D 2EXWC 3VU1A 2DRUA 1E42A 1QNIA 2ED9A 4MYWB 4D9LH 4GXUN 2W65B 4AQEA 2DN7A 1GGBL 3UAEA 2M2DA 1Z3GL 4L8SC 2HLFD 2OJZH 1U8JA 3DHPA 2VC2H 2YXFA 3FRPA 1S5IH 3AU1B 4ONOA 4UQIM 5C07D 3LHAA 4JO2L 1NCDL 2Y24A 4P5KB 1EGJL 4UOJA 4QKXB 5DXWA 3F2LA 2VLJD 1HEZB 2ZXDA 3UYRH 1PD6A 5IGXL 3WNLA 4F7MA 1Q0EA 4BELD 4Q8BA 1RZKL 1GGCL 3S37L 3MRNA 4IRSD 2ZXAA 1EEUA 4F58H 2HKFL 5JW4Q 1UM5L 5GHWL 2B59A 3HE6B 1R3HB 2KHAA 3BAEH 5D7KD 4HIPA 3CFBB 3BISA 4EN3D 3D69A 3OJ2C 5KVEL 1IC5L 2EE3A 2X05A 2GTQA 4NKDB 2H9GA 2F74B 4F2ME 3BD5A 3SPJA 2J8UE 1NKGA 3DC0A 1NM4A 5MEQB 1P2CB 2XLLA 3LQMA 3UIZA 4YXKH 3LNGA 5K39B 5M94B 2YA1A 1XR9A 3QQNA 5CSGA 2P9RA 3FULA 3MNDA 2VQTA 2WLLA 1D7DA 4F33A 4ZD3L 3VFOB 1NGYB 4BK5C 3TBYA 1CL7I 5J6HB 2G4EA 1J8KA 3OX8B 1OGAB 1QEWB 1H6EA 5FXCH 1HI6A 5IQLA 2Z1KA 2G5UA 3V0DA 1JRHH 2APBA 3BH9A 4QXTA 2DQFB 3VSQA 4LSSH 3WNOA 2X4PA 2ZAHA 2R56H 4FN0A 2DH3A 3FYEB 3LMJL 1RURL 1G7HB 1QBAA 2WVSA 4GT7A 4FEIA 3N91A 3EUUA 3R0MA 2VDKL 2W80C 4HIEA 5I1HL 3D0VB 1GYWA 2FSDA 3AREB 3CHQA 4F7EA 1LHZA 4JFFB 2IALB 1AZRA 3Q2CA 1JGLL 1DDTA 1A9EB 3PRZA 4WEMB 1BREA 2L3BA 4Q6KA 1ZA6A 4KVCH 5F6HI 3VFPA 1KC5L 5CUSL 1YNKH 4MS8C 4HGKC 1OPGL 4R97C 3W9DA 5ISZB 5GJTL 1YY9C 1XD1A 1PD1A 1VEPA 1RHHB 4YFDB 3WTSA 3D85A 5KTEH 5BZXA 2X40A 5J7CC 4M61B 5KSBB 5CSZA 2VITB 1CE1H 2WTOA 3QRGH 5I15L 4XMKH 1EPFA 4IIQB 2VL5B 2DWXA 1KJ2B 1ZV5A 3IXTB 1GRWA 3O9WD 3U7AA 4B9IA 3FDWA 4Z7OF 2O6EA 3FTVA 4HWUA 3WJJC 4J2XA 2KQNA 2XVKA 1AZUA 1AY1L 5I1KL 1W8NA 1GY2A 3PWUA 5F0MB 3M1BB 5HP5A 2IG2H 4W9EC 3N06B 5B3JF 2BIQA 2QSCH 2Q76B 3VFTB 5C8JB 1W72L 1SBSL 5IVXB 5TE4L 3NTCH 1D7CA 2CA3A 2N7BA 5FHAL 4KX7A 4F91B 1ZHKB 1JP5A 1JFQH 1ADQL 1HL9A 3JSSA 4XB3A 1PIFA 2X4RA 1UJ3A 4PVBA 4OGXH 4Z76B 4QCIA 1OGPA 1WA1X 1ZLEA 1UYWL 4M48H 2Q6WB 5GS0L 1FL5A 1I85A 3ILPA 5DURD 3V0VB 3MBEA 4I4WA 4OGAD 3HPLA 1TFPA 2VC2B 1Z9PA 4KAQH 4PBWD 1KCRH 2IH3A 4YHPB 4GP8B 5DJ8A 2IAMA 5A2LH 3ZL4H 5KSVB 3ZTDC 3GIZL 2XCMC 4FULA 1KT2B 5D70H 4QKTA 1ACZA 1HDMA 1XO8A 3UAJC 3WNMA 3LRMA 4GG6A 4ODHH 4PS7A 5HHNA 4D7BA 5FK9A 4G9FD 4I18C 4ZAKA 3W2DH 1DBJH 1WFOA 3PYCA 2W91A 5FF6B 3WXWL 4N2MA 5DUBB 4MXVE 2XYBA 1BFOB 3HS8A 4MAYC 1NGZA 4OVUA 5CINL 2RR3A 3DK2A 1I9IL 3MLWH 1P84J 4OB5L 3VX1A 4K15A 2V8LA 3MBXL 2D0HA 3S7GA 4FG0A 3HNVH 3GMMA 4I87A 2VDOH 4TM9A 4ABWA 3OPZL 2EO7A 3IFPA 2CPUA 5M7QA 4JANB 3U0TA 4MVBD 5B21A 3K2KA 5EU4B 1AJ7H 3LNDA 1CLCA 4M03A 3TGXA 3UTOA 2IH1B 4L37A 1JZ3A 3ARFC 2V9UA 5DD1L 4QOKE 1M2VA 3DROB 1NGXB 3Q2WA 4WHDA 5LXGH 3BZEA 5DMYA 1KBWA 3V0WL 4JO4L 3H9YA 3V4PH 2J21A 3N1QC 3O6FB 5E6SB 4ANVA 3L1EA 3UMTA 3MRMB 4P23B 3LXCA 3WL9A 4G42B 2OSWA 2B0SH 1DBAH 2ATKA 3VW3L 1SPDA 2Y7SA 4JM2B 3QFJA 1FBIL 2E27H 5HI3C 2IDFA 5G5DB 3TT3L 1SGKA 4QLRA 3RZCB 3BD4A 3U4BL 1CLOH 5GRYA 1MF2L 3DX9B 1IM3B 2YSSA 2K1MA 3CBKB 3ESMA 3I50L 1F4HA 4N0CC 3VWJD 2QR0B 3CUPA 4LF3B 3MO1A 2EYRB 2MIZA 1OAZL 4JRYA 4R4BB 1CXEA 1P7QD 3LPGA 3Q8EA 1X5ZA 4YR6B 2ITDA 2AQ3A 2LLGA 4XN9A 1XDTT 1B0RB 4KJPD 3IE9A 1MQKL 5CJQL 4B27A 3TH3T 1LWJA 3K74B 4FTVD 3IDYC 2CBOA 4MZ2A 3DXAA 3QFDB 4LPWA 4LSPL 4OV5A 4MYPA 1YDPB 4H20L 4I18B 4RDQF 1QI5A 5IMLB 4P5MA 1W0VB 1FZKA 4HJGA 1QUNA 1Z5HA 4MAYB 4YQXL 1KPUB 1FLTX 4AZ8A 1QHOA 5HHPA 4M5ZH 5CHNB 3EYFB 1XXFC 5ETUB 1XEUA 4HUUB 4YE4H 5GRVL 5AZ2H 1I3VA 1NLBH 2DMBA 3LS4L 4K5MA 4O02H 2EIZB 3DWTA 3BQUC 5HJGA 3F7YB 3ELQA 4Z7NE 5I1DA 3LDBB 4JS7A 2OMUA 3ETTA 3S3SA 2FVNA 4AL8H 1WTGT 5IP4A 2ZOLB 3QBTB 4JFZL 2OYMA 3BPOB 4QO1A 1V3LA 2F0CA 1JTOA 4K3JL 1N6UA 5JYLA 1A7BA 3OKOA 1JERA 2W60A 1E65A 5F3HA 1MKFA 3NJIA 3CFCL 4F7KA 4N0FB 3QYMA 5DRNA 4NO2B 3CFQA 3ILQC 5C0EB 2X2UA 3GHEH 3JWNE 1QTYT 2XWEA 1YPZA 3EBGA 3HZKB 3NCWA 4I48B 4PJDE 5IWLC 5BZZA 2PLTA 2XETA 2UWEA 3AVEA 2HT3C 5TF1H 3WFEH 2DDQH 1WBXB 1RLWA 4O2EB 2AW2A 2R1YB 1K9TA 1ZSDA 4LVEA 3VNZA 4BM7A 1I3GL 4EIBA 4E9TA 2WNWA 4O5LH 3V4VB 2J57A 3T3PF 1ZWIA 2O61B 3QJOA 3KXFE 4ODSL 4XCEA 3A6OA 5ITBL 2IXQA 1F2XK 1P84K 3GSVB 4NSKA 4WRLA 1W8EA 4U1LB 5DHYA 3SGDI 3QIWC 1MZZA 4WK2B 3PREA 4NNXB 4PR5A 1BECA 2FJFB 5D7LE 2E6JA 1AANA 3IGAA 5HYJE 2ZCKH 4XCFH 2YXMA 4POZC 2BY1A 4WSKA 1KTKE 3K4AA 2X28A 4TUOA 5AW6B 1KN2L 4ATTA 3MVSA 3KXFB 1VJSA 3BQUB 3SKMB 5FYKH 3N0PB 2VIRB 4YHNB 4WFGD 1E9OB 3FPYA 4GLRI 3LXUX 3CN4A 5CD3B 3U0WH 2EC8A 5LGKA 2I7SA 2AQTA 1D6EA 3BPNC 4XVOA 1AO7D 5D71L 2V4LA 2D7PA 3NA9H 5E94A 4JCLA 4JFHD 3V55A 2P5WE 3DUUA 5D7LB 5SWQB 4EI5B 3EJQA 3N04A 3P69A 3GXUB 4H8HA 5EO0B 1OSPL 1NBCA 2DQDL 1ZLUK 3TEZA 2JKLA 2XBDA 1Z9SA 4F5CA 3QYCA 1HHIB 1IBBA 2ICWA 3QEUA 3QDMA 2V17H 4CAGA 1UXSA 1DL7L 5B39B 1PY0A 1V3KA 1N18A 2BSBA 4WJG3 1JYVA 2R7EB 5TE6H 1F3RB 3P11H 1WA2X 5ENWA 1DDHA 5IFAH 3PWJA 4PJEF 4J28A 5IHUL 1FNGB 2P5WB 3NFSL 2UUDH 3DYOA 2AABH 4ZPTA 1ZHBA 5EBLB 3UP1A 1EDHA 1HXKA 4TQ8A 4Q9BA 4K94L 1NPUA 2AERT 1TNMA 5KYWA 4A04A 2XVLA 3OF6D 4C55A 3SE6A 4Y16C 2VUKA 1I8IB 1C12B 3ROLA 4WFFD 5IHBA 2WZ5A 4AG4H 2XUWA 2XWXA 2YAMA 2I24N 2BSRB 2QTVA 5AUMA 2AITA 4LP5A 2OULB 1XSKA 3OHXC 4FAAB 4KXBA 1CE6B 2PCFA 4H88H 1H15B 1XF5B 5IREA 4ZO8A 1SJHB 4HZLA 3QAZC 4FMVA 2BWIA 4WEBL 2D2OA 5ICYA 4XO8A 2HFEB 4TNGA 1KY7A 1HESA 1SJEA 3BT2L 4BZ1A 4PV1C 2AAAA 4U0RC 1L9SA 8PAZA 1KXQE 1V7MH 4JFEA 4K9EH 3EFOB 4XBGA 1XGZA 1KYUA 3DSNB 2GHZA 3SB3A 4PJ8A 4YBLC 5KVDL 5B38G 4A6YA 3WXVH 1PX3A 4PRDA 3UZVA 4PIRF 2CKBA 4Y5YB 3KJ6L 3QE5A 1AGBB 4CU6A 1UQSB 2QGCA 1H3GA 1I1AC 4ZNEE 4WUKH 1QW8A 1MHHA 4QEGA 1GH7A 3BP6B 1UXMA 4Z8FH 3T1WA 3HAEG 2ZUSA 3TZVA 5E08H 2NOYA 4F8TA 2XXMB 5DWUH 3PV6B 1ERNA 5B7EA 4UI2A 2E7LC 5MI0B 1JNHA 3PJSA 1JK9B 1FV1B 4P4KB 4XCYA 2NY5C 3OLDA 3DIVA 5ES4B 1FL6A 2BNUB 3FQWB 5JPMB 4F57H 5K1NA 2Z92A 2DEWX 4ZUWA 2IPTH 4KY2A 5L6YH 3K7UA 3IS0X 2XHNA 3V6OA 2Q10A 2X4OB 3D4CA 3SKJL 3WE1A 3FTWA 5FUZH 4PJ9C 3ZTEA 2Q7YA 4RAUA 1IL1A 2HZHA 1KUMA 2PWHA 4Y16B 5E8PB 2QV4A 4R26L 1ZRUA 1T03L 1HJBC 4HPYH 5EEZA 4LGRB 2BSSB 3G5ZA 1E2VA 2M8XA 1WBZA 5T1DL 5TF0A 3UPCA 1LXMA 1SZNA 1K72A 2COQA 1Y6NR 4ESKA 1CD9B 3AS3A 1JHLH 2CKNA 5E8DH 1MFBH 3AG2B 3UBXG 3B7SA 2VMFA 3QAZB 1J18A 1A1OA 4JVPA 4J4PC 3MZGB 4I5BA 4CVZB 1AFVL 3QJHA 1L9QA 3KJ4C 5A7EA 1QHQA 4U0RB 5DQ9B 4B41A 5I18L 2VL4A 2YKLL 3MV7E 1ZVSB 2MOVA 4IYKA 4YX2H 5DUML 3VB8A 5KZCD 4JFDD 4JY6A 3WTTA 1B2YA 2CJUL 2J72A 2GFBB 5C6WH 2A9CA 2A4EA 1KLUA 1PLAA 3PAUA 1I1AB 1UB5A 1WFJA 4YSOA 4D3CL 3IDJB 2YSTA 3X1BA 3WBDA 5E6ID 3FT4B 1B9ZA 4AYDC 3AU0A 4X42A 2C3WA 3LRSB 5ICZB 1D6VL 4N24A 3B9DA 4PJCB 5ANHA 3UPRA 4ZRGA 5C0RH 1MUJB 2EYTB 1RIUL 2P7TA 3MV7B 3PHQB 4KNTA 1WAAF 4LHUD 3T0ED 3W39B 5LDSA 1FG9C 2WBJC 2ZF9A 3N9GL 5JHMA 3G5YB 4A7VA 4PRPB 3DX0A 1O0VA 4I9XA 1KTRL 1N3NB 2EICA 3K8LA 3VCLB 5IV2A 2DJUA 4F20A 4AZUA 1YCSA 2FJUB 1RKRA 3TBTB 1Q90A 2ERJC 2QFRA 5CBEA 4ZS6D 3FQNA 4XPGH 1P5UA 2UX7A 3LY6A 2FATL 3RI5K 2A6IB 1A6VH 4G7VH 2DY2A 2XXFA 4AX3A 1X9LA 1ILSA 1CDJA 4GUOA 4EE2A 1FH5L 1KXTA 1QASA 2OQJA 2D9QB 4PSPA 1N8ZA 4NRXA 4I88A 5J5EA 1R3KB 1N0LB 2J1ZA 4J6IA 1KTDB 4RWYH 4AQZA 4P9HH 3H6JA 3LIZH 1BQSA 4ALAL 4TULH 4DAGH 1LYQA 3RL2B 2R29A 4DEPB 2K4WA 4L4TD 4HWEH 5E2WH 3MCG1 4F8QA 1DR9A 4YFLI 1J05B 1FJ1A 4Z0XA 3HMXH 3MR9A 4JKPL 4P57A 3TONA 1HYSD 1XAUA 4B60A 5CCJA 4OSUH 4DKTA 3ECUA 4Y19E 5HVHC 1JAEA 4BSWB 2XNAB 2WPGA 6PAZA 1AHMA 5IEHA 3JVGC 2N1TE 3QP3A 3HE6D 3MUGA 3OM3B 3CFNA 2OBGA 1BZQK 4ZUTA 1ZGLB 3ZKSD 3FN0L 3MJ9H 4RGOL 2HKHH 4DW2L 4ZMTA 1Q0XL 1KGXA 1FGVL 4JPQA 5JHLL 2FT6A 1M9SA 4X0KA 3VI3F 1T5KA 1AR1B 4ZMNA 1A0QH 1E5UI 3S35L 4Y19B 4BINA 1AXSB 1IEHA 3OGOE 1TJGH 2V7NB 2P8LB 3H3BC 3ZYIA 1E43A 6FABL 5KVFE 1PLCA 2IGTA 1RIVH 1U8PB 5J56B 1IT9L 1KLFB 2ERJB 2IH8A 4K8RD 1E4JA 1Z5LA 4LOUD 1TQSA 2OCFD 1Y18B 3OHMB 3H55A 2HJLA 3NEOA 2HG0A 3AS0A 3X14A 3LH2L 1TYJA 1R47A 4OLYH 3QORA 5CAYB 3RWGA 4WTZA 4PJIA 5IROC 4YL9A 4AT6B 3PABA 1TU2B 4X8JB 3V0IA 4PLNC 2GSGB 3ZDXE 3KYOB 1GGIH 2AXGB 2CCWA 1YN7A 2OTWA 5I76A 2BVQA 2ORBH 4FNLH 2A9DA 3ENEA 4KFMA 3RVVD 1Y6KR 2ATAA 3IFLH 4M6MH 2EH8H 4XPFL 5KVGH 3ETBF 4X6CE 4IS6A 1BJ1J 1WD8A 3PNRB 2R59A 3V6BR 4HBCL 3Q05A 4WU7A 5KANI 5GQBA 2ARWA 3ZKXB 1DBBH 1AACA 4LLDA 4U1JA 3GKZA 3ZDXB 1Q9WB 2XKUA 2YD6A 3VXME 1LO2L 1QPXA 3AT9A 3I75A 3O11A 4LSUL 3L3KB 2L4OA 3Q5YA 4WVRA 5C0ND 1A6AA 4UV4H 4X6CB 2VH5L 5CLZA 3U4AA 4JZNA 4FQ2L 3C2AH 1T21A 4HHWA 4XX5A 4YDIL 4LOEA 4AQAB 4QNPE 3AFLA 9CGTA 2EVJA 3CQPA 4GBXC 4LCWE 4ZXBB 4MD4A 1XGTB 3KWTA 5EF0A 4ZTPL 4GUPB 5BRQA 1T0NA 3KPSE 3TVMD 4JFSA 1BVKB 2PXYC 2DM4A 4NZJA 4OFYD 4F9LC 4YHIA 3SDDB 1KYAA 2G9KA 1MFCH 3IJ8A 3RGVA 3VXMB 2P4AB 2XFXA 4HPOH 2Q7AA 3C5ZA 2B7DT 1FI8C 4WY7H 1RAMA 4PJBA 5EO1A 3A67L 1M6OB 5FC9A 1KGCE 3HUJA 2Q1EA 3IFNH 3KCWA 1J8RA 3BH8B 3KPMB 4CSPA 3HKZA 2GUOB 2NNAB 4IKIA 4PRHA 5DVKA 5L4MA 1D5MB 2IBZY 1Z0MA 3KPSB 4JG1H 4F8NA 2O5XL 4HXAH 1B0WA 1F6LL 4Y2OA 4NX0A 2AI0H 3FONB 3RP1A 5ABDE 5KS9A 1IM9A 2JI1A 3RUGE 2VLME 4PN6A 5J3HC 3ZW3A 2KS0A 4YFEA 2X53A 2D73A 3PDOB 2MMXA 4J8QA 3K2UL 4KPHL 1E9QB 2WINA 2YMXH 4NFDA 2ZT9C 5KG9B 1T4KA 4K3HA 4R4NC 1BMWA 2BC4A 3U4EB 2CR0A 3WV0A 1IVLA 3DYMA 2J71A 2X41A 4P3WA 4IBUA 5FS5A 3WLWD 3TL5A 5D2NC 1TQCB 3HMWH 4NKIL 5FCSH 1WQVT 5EOCH 3RUGB 1THCA 1X5LA 1J8SA 2BNQB 2HN7B 4H2CA 2VT0A 2XPYA 1O7DC 3UC2A 4I8DA 1LDPH 3CTTA 1KPRA 2C4XA 3O4LE 2BIOA 4U6XA 5L88L 3G6JF 3OAUL 4PJHF 2X6BA 2Y7MA 2B5IC 3L4YA 3O6FD 3C60A 1SQMA 4GW4A 3WFBH 4HK0A 3ARGB 5KVGE 4P23D 1JWUA 3HW7A 5DDHA 5BVPH 3BZ4A 1UCBL 1YN6A 4DQOL 4ZX5A 1ODAA 2AV7B 2H3NB 3S9DB 5DFWH 3EOAA 2CDGB 4GMTH 4B9KC 1WSST 4IGBB 3ZKND 4OLUH 4M1GL 2JB5H 5E4AA 3VXOB 1CG9A 4N2HA 3DV6B 1CICD 1E5ZA 4FYSA 2ENQA 4QOKD 1SY6A 3GHPA 3WEBA 4U6HB 1LNUA 5FV1L 4AIEA 4PGEA 3EYQD 3KL3A 3U36B 3HZVA 4LMQI 3NBNA 1QABA 4EDXB 3D25A 3QWNA 4URKA 4RRPM 4NHUA 3TN0A 3MPCA 5IG7A 1RI8A 4XXWC 4OZFH 3KE0A 3X13A 1FDLL 3GSRA 4MD0A 3F7RA 4G8EB 1XIWC 3VD7A 4JREC 3G08A 5DD0L 3M86A 1L0PA 3WTXA 3L5WA 3L9RA 1E4WH 2FWLB 4QRBA 3IJ9A 5CJOH 4PPTA 3JVFC 1ZKAA 1LO4L 1NGPH 5EG6C 4AQEB 1VRSA 5CD5C 1R19A 3D0LA 2XG5A 1MCDA 3RRQA 1U8JB 3FYIB 4DGIH 3FRPB 1EJOH 3ZIMA 5E99L 4HOWA 3GTVA 3GHBL 4DUVA 2YD4A 5FB8A 5EC1A 2IFGA 5T3XH 4O9HL 3HG3A 1FUNA 2WXKA 3X17A 1NGWA 4TS6A 1BZ8A 4F7MB 2QPUA 1P5VB 1M05A 2X4TA 4EUPG 3MRNB 4IKLA 5B22A 3JWDC 4B3EA 1IQWL 1ORQA 4Z95H 3TWCH 4MFHA 3FB8A 1JTPA 2B59B 5IK3A 3QO1A 3VTAA 1KCSL 3WY1A 1JHTA 1GXEA 2XN9A 1WGOA 2FEEL 3D69B 5F7BA 1H19A 1E4XI 3O3BA 3B7RL 2H9GB 1VADA 3VMNA 4G8GA 3ZZLA 4ANKA 1JZ6A 2CGRH 1S3KL 3NJNA 5D2LA 2EECA 1YMME 5EHFA 2Y7QA 5IBUB 4JZOA 1XR9B 4WF7A 1ZTXL 4H1LH 2XXCB 3O41B 4ELMF 1LK3L 4ZMXA 1MG2C 5C9JA 2TRHA 1EJ8A 2WLLB 3E8UL 5FYLH 1TTRA 4PG2C 5D1QC 5DEJA 4X6DE 4WJKB 4UDTA 5IJDC 3TBYB 1WUZA 4N3TA 5HVFB 5DU7A 4X9FA 5KJ4A 1HI6B 1BOGA 2C9UA 2AJSH 2EEFA 1WFIA 1CD0A 3DVNA 4H0LC 1NOFA 2QLYA 3BH9B 4QRFA 4QXTB 4JGNA 1DJYA 2P24A 1QBLL 2X4PB 4QAMB 3S6CA 5CZKA 1OAYL 1JD9A 3KDMB 1M4KA 1DSWA 4R7DB 3KXFD 3AXLA 2NY7L 4HIEB 5DD5L 1ZT4A 3ML9A 4ODXA 5L4FA 4OGZA 4N86A 2VXUH 4YIQA 2VXSL 4X6DB 3LZFH 4F7EB 4ZMQA 2X12A 2EUWA 3EO0A 1NBYA 1T83A 1MCSA 5BRZA 4CRPA 2VXQA 1F4WH 2NY3B 3VFPB 1ZA6B 5D7LD 4EI5D 4S1DD 2V5YA 4E36A 5HYJD 1HINL 3EJPA 1WT5A 3D85B 2XRAL 3C8HA 5CSZB 3BLBA 1EK3A 5I9QB 3ULUC 2VO8A 1JXDA 5HDRA 1D5BA 2MNWA 3FQXA 3V52H 4KJWD 2I9TA 4LEOA 2EDOA 4YHLL 3PWUB 5SWSE 2P5WD 5AW2B 3UP6A 1RSFA 4L3CA 4OCXH 7PAZA 2NYYC 3VGGA 3IDXH 3AGVA 4L9LC 3ARZA 1A21A 3QI9C 5FHBH 1N26A 3L1OH 1F1DA 3TBVA 2G2PA 5DEGB 2P5EE 2X4RB 1UJ3B 2VMJA 4D9QE 2VABA 1RIHL 1AD9A 4F92B 2BHYA 4QCIB 4W9HC 1FNAA 4YSAA 2DLTA 3B2PA 4X7TA 4BXSV 1FL5B 3RHWF 3BRGC 1HZKA 1FORH 1ZEAH 2NNCA 3MBEB 3MRQA 4RAHA 4R8WH 4I4WB 4R5XA 3HPLB 3M6DA 3QC6X 1JCVA 4J8RA 1MFDL 2HSIA 1UXWA 4E41A 2IH3B 4UMGA 3QQDA 3TA3C 4AYID 3D39A 4FFYL 4M6NH 1EUUA 2IAMB 5DJ8B 2CZNA 2X9ZA 5DCCA 2FX7H 3BWUC 4UIKL 3TYFA 1LO0H 5TQ2H 2EUZA 2WZPD 5LBGA 3IYLW 1L7TH 1HDMB 3GSXA 1FAKT 4YDLB 5I1CH 1UOLA 4GG6B 3VFUA 1HH6A 4KY1H 5G2NA 4B7IA 3KPRE 5FK9B 2FHCA 4ZAKB 5FYLE 1FZMA 4JHWH 3DLQR 4JM4H 1BIHA 4LBAA 4QPEA 4K8RL 4LPCA 5EMYA 2GT9A 1NGZB 3KLKA 4XNMA 1EAQA 1MXDA 2WQSA 2R9HD 2WLHA 1OAQL 3V4LA 3WKMH 3W5NA 1UD2A 4XN1A 1JGUH 3OKKA 1F1GA 2BS71 4UT9A 3GMMB 1U3HA 2WGXA 2EE6A 3IFPB 4ZS7L 2J25A 3U0TB 5AQ0A 3QFJE 5ECGA 5D5MA 3UTZA 5LHDA 4Z7QF 3IMWA 3AXHA 4EZMA 3HOGA 3L48A 4L37B 1NAKL 4UTBA 4P8QA 1FFNA 2VMEA 1M2VB 1PZUB 3B7YA 3K1KC 1J48A 3BZEB 4JRYE 4PRIA 1EAPA 3HHRB 4OZGE 3NH7L 1HAWA 1BXAA 1UZ8A 4RZCA 1CGXA 2DM2A 4NN6C 4CW1A 3WL9B 2ATKB 1TJIH 2DLFH 5BUPA 2B3RA 3GPSA 3QFJB 4DNLA 1QYGL 1KJ2L 1WO2A 4FS0A 2YSSB 2HUHA 2YAFA 3HG4A 4OZHE 3ZE1E 4C56A 4AEHL 5JDJA 1ZGLP 3PP3K 3VWKC 3CUPB 5F96L 4B6ZA 3MO1B 3OWRA 4JRYB 4OZGB 2ITDB 5HYSG 3GB7A 4UOW1 5F1IB 4N8PA 4LLAA 4WNSA 1BG1A 4YLQT 3DETC 4MNGE 5D8JL 3T8XA 1IBGH 4BH8A 3DXAB 1LEKA 4EI0A 3S4SG 2XJLA 1JPGA 1R5WA 2CLZB 3SGJA 4OV5B 4RDBA 2DW5A 3G6DL 4FFZL 3FH5A 1AH1A 1T2XA 4H8WL 4P5MB 1FZKB 4HJGB 3TT1L 5EEUA 3ZE1B 2IDUA 1QUNB 4FL4B 4FQPA 4AZ8B 3PL6C 1ZE3C 5MP6H 5HHPB 1X5YA 3AQDA 1L3NA 2K3TA 4HCRL 2BY0A 4XVUC 3MU3A 1U3NA 1R6VA 4LCCA 4X7CC 2N56A 2OJZL 3FB6A 3MV7D 2HWZH 2VC2L 1H3UA 3T2PA 2B8OT 3ZMNA 2CH8A 5I1DB 1YPZE 2OMUB 1M7DA 2FT8A 1KCLA 4KJYA 4HQQL 3CLFL 1NCUA 1JBJA 3BYYA 4FFVC 4BE5A 4Z7VA 1R1CA 4M62L 1KF9B 3TOPA 1YSOA 3OKOB 4KRPB 5F2FA 2EE0A 4E9LA 2W60B 1DN2A 4OQTA 4ZUSA 4YC2C 4OIBA 4MLSA 3Q48A 4NN6B 5F3HB 4DQAA 2QKIB 4X5PA 5CKAA 3US1A 2EDLA 5T1MA 5DRNB 3WYRA 3I9AA 4N0RA 5AZEL 3S5LG 3WFZA 5CZXD 3CMGA 1YPZB 4DP5X 1CXKA 2R0LH 4NO0A 4HJSA 4UBDC 2UWEB 5DZPA 2WK2A 3L2LA 2GK2A 1RUMH 1ZSDB 2WXQA 3I2CH 4WKZA 3CQQA 1UWEH 1N70A 1IC7L 1ZWIB 4HWZA 5D1ZA 4Q0XH 3C08L 3QEGH 4XCEB 4YN3A 1AGFA 3THMH 1BM7A 2IXQB 3H2WA 4JO1L 1ZK9A 2UY7A 3TH2T 1NCCH 1FVDB 5JW3H 5DHYB 4M7KL 4ABVA 4XT1C 2Z0BA 4KTEH 4PR5B 4JQXA 3CG8A 1HVXA 4H26A 4FZEL 3NJJA 4LSSL 1G7MA 3IGAB 1AMXA 1J87A 2RCSH 3HBPA 3BIKA 4TUOB 1CFVL 5AOLA 5JXEA 5J1AA 1VLXA 2YJQA 3IPEA 2HVKA 2GK0A 2Z8VC 1CD1A 2GY7B 4KX8A 4IBWA 3O3AA 2NXZC 4K7PH 1EWHA 1UCTA 2WKOF 1HWHB 1JXKA 1ASPA 2Z7UA 4HC1H 4MKTA 5DFVD 3RDTA 3S0PA 2G5RA 2W0KA 1HKLL 5I8EA 5AALA 3EO9H 5I6XB 3SD2A 2BINA 4MDJB 4XNQA 4Y1SA 1D6EB 2GIYA 1UB6A 3GSNA 3U0PA 4Y19D 1Q1JL 2B2XL 5I5RA 3OXSA 5E94B 3WMQA 4B50A 1EXUA 3DUUB 3FN9A 5A2KH 4AGLA 4HUWB 1CBVL 3FQTA 2VM9A 3QZLA 4NQQA 3CWGA 3P77A 5KTEL 1Z9SB 3UJIL 4HSAC 1CE1L 2F7RA 2OXGA 2ICWB 3QEUB 1PZCA 3NPZB 1UTDA 3QDMB 3UTPE 4NWUL 5DHDA 1UXSB 1ZLDA 2CLRA 2D8KA 4GS7B 4NLAA 4TUKL 3VSTA 2E75C 1BM3H 2DQIL 4UT6A 1DJZA 1AYOA 1G9MC 3KM2A 4LDEB 1DDHB 1ET8A 4W9JC 3C8DA 1FWXA 3GLAA 3H9ZA 1SMAA 4OZ4A 3ATEA 4ZPTB 1ZHBB 3R8QA 4NBYB 1GS8A 1M7UA 4AGPA 1RCYA 5KYWB 1A25A 2IIJA 4GRWF 5F44A 3S37X 4XMTA 4LARL 2WVVA 4JFEE 3F85A 4GAFB 3KWVA 2WXMA 3ROLB 3QDGA 4AJYV 4J39A 4WFEE 4G7QB 4XP5H 4JNXA 4JKNA 1KGWA 3TEXA 2IDTA 3IMVA 5AUMB 3BRDA 5GGRY 1QLRA 5DZJA 1DQLL 1S7QA 2PCFB 3ZDWA 3U1SH 4NN7C 3FH7A 4NWTH 3VM5A 5HGDA 2OMVB 3ZZ1A 3NIFE 4HZLB 1KCRL 3UZQA 2LFGA 1I7TA 1XBDA 5ICYB 1FE8H 4WWID 3RG1C 5KUKA 1XX9C 3NUKA 3TO4C 5IBLD 1SJEB 2XDHA 3MTXA 1NUDA 3LKSA 3V4VL 5KANG 2H2PD 3FF7A 4JFEB 5D70L 3T71A 1BAFH 1B0IA 1DP0A 4XBGB 3SY0B 1FNSL 1FSKB 3BOVA 4GKSA 4PJ8B 7FABH 3NJFA 2HFGH 4A6YB 4PRDB 3UZVB 1DBJL 5E9DA 2CKBB 3V6OE 4DSYA 1MHHB 1FGNH 3MXWH 1UM4H 2QLVB 3SDDD 1BVLA 3HC3H 4XVTH 2GBAA 1JTTA 3NIFB 4GAJL 3VXMD 4M4RA 1YECL 3DO7B 5CZRA 2VNCA 1GZHC 3HNVL 3QO0A 3TZVB 2VDOL 1IBHA 1EFQA 1T89A 2TSBA 3A47A 4M3KB 2AJVH 4XBEH 1JNHB 1NCNA 3PJSB 4JHAL 5E1QA 4FLSA 4XCYB 5T5FA 4R0LC 1FL6B 4J27A 5HDBB 3ULVC 3TBSA 4YGAB 1BOYA 4LCWD 2Z92B 1Q0YH 1RZFH 4ZUWB 4BWWA 2GSIA 3KPSD 5IR1A 3D48R 3MCKA 2PO6C 1AXTL 2CJ3A 2YA0A 4M1DH 4QGTA 2N0KA 1U41A 1KULA 2VE6A 1MHPL 4NN5C 1IL1B 1NAMH 1HILA 3AS1A 4RAUB 1WPCA 2Q7YB 3RB5A 4KKCD 2OX5B 2G60H 3BCDA 4N5UA 1OT1A 2FQEA 1CJYA 5CZVH 4N0UA 5ESAA 5C70A 4GRLD 2XC8A 3G5ZB 1WBZB 4ONHB 1CLOL 1KGCD 2MPAL 3VQ2C 1MRCH 3KR3H 1H3TA 1MJ7H 4DFIA 1OE1A 3V79C 3FT3B 4UU9A 5E6RB 1MEXH 1A1OB 1DCEA 4UQ3A 3V0FA 5DJDA 4I5BB 1Q72H 3VTMA 3QJHB 1D3CA 1SEBA 2VLMD 2WAQA 4HISA 3CX5K 2CXKA 2HTLC 5F7KC 1B4JH 5JQ6H 3VFRA 3F7VA 4JY6B 4PY7A 4QMEA 5EF3A 1KLUB 5G4NA 4KUCF 1DE4A 1UB5B 4I9WE 3B1UA 3D18A 3GJFH 4MXQD 4WDIA 1NM9A 4IGBD 3US0A 1KBVA 1AKPA 3S8FB 3UPRB 5KSBF 4E9YA 2E7CA 2BSEA 4PJ7A 4WU5A 3WIHA 2O26U 2P7TB 3O4LD 3ZZSA 4F8OA 5D7JD 3WDHA 1L9MA 3QWOA 3VH8G 1J12A 1DBKL 2E76C 2WXLA