2FT6A

Structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
b'CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
molecule tags Electron transport
source organism Pseudomonas aeruginosa
publication title Basic requirements for a metal-binding site in a protein: The influence of loop shortening on the cupredoxin azurin.
pubmed doi rcsb
total genus 31
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ft6A00
3S8GB 3HB3B 1GW0A 1WA1X 2VW4A 4DP4X 5IY5B 1PY0A 1AAJA 1KDIA 4G70B 4DP5X 1NWOA 1SDDB 3ASNB 1X9UA 2E86A 1JZHA 2FQGA 1CUOA 1OCZB 4YSSA 3GDCA 3HEIB 3OM3B 5I28A 1ADWA 2GB2A 1A65A 1KDJA 4K9JA 1M56B 3NJNA 4FA7B 1QHQA 2FWLB 3G5WA 2QT6A 1AG0A 2AVFA 2B08A 2HLEB 1J9TA 1E30A 2YAEA 1NIFA 1BXUA 1XMEB 4QLWA 2DYRB 4KO9A 3AW5A 1AZRA 2UX6A 4E9YA 2H3XC 1I53A 1X9RA 3IN2A 3UADA 4A2GA 3RYMA 1HAWA 3CVCA 5I6OA 2IDUA 1MG3C 1TEGA 3C75A 4G71B 1MZYA 2IDFA 4W9ZA 1TEFA 1ET7A 1HFUA 2YQBA 2WO2B 3T6ZA 2XUWA 2CALA 4FAAB 1OCOB 2XYBA 1NWPA 3FPXA 3KW8A 1AZCA 3AG4B 1FA4A 4DP9X 4F2FA 1JZJA 4GY4A 3ZIYA 1V54B 1NZRA 2FT7A 4NAJA 3PAUA 1NIAA 3N55A 1AOZA 3TBBA 1ET5A 3BQVA 3FSVA 3FSWA 4G7RB 2HRHA 3NJJA 2EINB 2YXWA 3SBRA 4KO6A 3PCYA 1NIBA 1W6WA 2BHFA 4AZUA 1OOWA 1GS8A 2NRDA 5B7MA 1IC0A 4KNSA 3S3BB 3FQ1A 1M57B 3EHBB 3NP3A 1BEXA 1OE2A 2BZCA 3H56A 4W1TA 1ILSA 1WS7A 2GBAA 2YXVA 3CVDA 1ASOA 4P5SA 1ZPUA 4HHGA 3DTUB 4N4YB 1N70A 3U25A 1JXDA 3X2QB 4YSPA 1BXAA 3IBOA 2PPDA 4ENZA 2IAAC 3ZDWA 1L9PA 2UXVA 3FSZA 5I5IA 3EF4A 1NTDA 1WS8A 2Q9OA 3FU7A 3N2JA 1MDAA 5I5MA 1ZIAA 3FQYA 3NJFA 2I85A 1E5YA 1KYAA 2HX9A 1PLBA 2XXFA 4GP5B 1ZIBA 1SHWA 3ABGA 5I6KA 4E9WA 4YL4A 5B1BB 2DY2A 1ZDSA 4HALA 6PCYA 1JXFA 1JZEA 3S3CB 3UGEA 2VN3A 2Y1AA 5TK4A 3SBPA 5I6PA 1JERA 5I5JA 2PP7A 4YSDA 3T71A 4UF7C 1ETJA 2XU9A 1AIZA 1NDTA 2QPEB 3ABLB 4HCGA 4DP0X 3FYIB 3T6XA 1OCRB 5F7AA 2HZHA 3X1GA 4E9QA 1PZAA 1OCCB 4ZK8A 4A2FA 1V10A 1V55B 5B7FA 2BWIA 3UACA 3TBCA 1BYOA 2YARA 2OJ1A 1E65A 1PLAA 1OF0A 1SDDA 2XV0A 3BVDB 1MG2C 1AZUA 1CURA 2QDWA 2YAOA 4AKOA 4YSEA 2VSKB 7PAZA 2PPFA 2YAPA 2BW5A 2PCFA 1KCBA 1WAEA 4A68A 4N8UA 1QLEB 4A2EA 3FYEB 5I6NA 1GS7A 2YAHA 1W6LA 2QDVA 2ZXWB 2AFNA 2HX8A 3FPYA 2EIKB 4CSPA 2LLNA 4JKNA 4NERA 3OD3A 2VW7A 3NJIA 3PLYA 1IUZA 2UX7A 1NPJA 3WKPA 3ASOB 1NIEA 2GHZA 4L0PB 1GS6X 3CDZB 1NINA 2XLLA 4HHWA 1MZZA 2BW4A 2IDSA 1BAWA 5B7EA 1FWXA 1OV8A 1JZIA 8PAZA 3AY2A 1BYPA 3GYRA 3CG8A 4BWWA 1NIDA 4HZ1A 1F56A 1JZFA 2W8CA 1ZDQA 1UATA 3QJQB 3NJKA 1JZGA 1PZBA 1N68A 3SQRA 1IBZA 2BWDA 1GY1A 4KNUA 6PAZA 3PXLA 4KNTA 1PNCA 4DP7X 1JVOA 1L9TA 4HAKA 2EILB 3UAAA 4E9VA 4YSRA 1KBVA 1XB6A 4P5RA 1AANA 4AKPA 4BDVB 1IBYA 3CZUB 1IKOP 1NPNA 2TSBA 1L9QA 3L45A 4PAZA 2CAKA 2JFCA 4X4KA 3DIVA 1GY2A 4G72B 2IWEA 4DP1X 2R7EA 4Q8BA 5E9NA 5D4HA 1AACA 4DP6X 1PLCA 1ASPA 2BP0B 4E9XA 3ABKB 2FT6A 4YSTA 3FQ2A 4E9TA 4A66A 1A8ZA 3FT0A 4BXVA 2BO0A 1KV7A 4UANA 3NJHA 1A3ZA 4JHVA 1BQRA 2ZONA 2CUAA 5EHFA 4KO7A 2B3IA 4KO5A 5I6MA 5LDUA 2XV2A 1J5CA 1PCSA 1PNDA 3NJMA 2XVBA 3AG1B 4TXVB 4YVNA 2YAFA 3GXUB 1QNIA 2UXGA 1JVLA 2PP9A 3QJRB 3X1BA 4AI7A 2BZ7A 1J5DA 1CYWA 4A67A 1A4AA 3PPSA 3X1EA 1J9SA 1YLBB 2OV0A 1BQ5A 3V9CA 1TKWA 3IE9A 5B3SB 4YSUA 3H4HA 3MX0B 2QPDB 2TSAA 4M4RB 4AX3A 2HRGA 1OE3A 5B1JC 1GYCA 1RKRA 3NT0A 4WTQA 3MBWB 4A2HA 2CJ3A 1RZQA 4YSQA 2A3TA 3IEAA 3ERXA 2MTAA 3NP4A 1L9OA 1EHKB 1B3IA 1BQKA 1GR7A 1ILUA 1URIA 3ZBMA 4BWUA 3H4FA 3S8FB 4YSAA 1DYZA 2CCWA 3QPKA 4EF3A 1SFDA 1KCWA 4F2EA 1T5KA 2MRYA 1ET8A 2IDTA 1PF3A 2I7SA 1VLXA 1SFHA 1WA0X 2BP8B 2BP8A 4JHUA 4YSCA 1JXGA 3FU9A 3FS9A 1TU2A 2JKWA 2AZUA 1XB8A 3EH3B 2PPCA 2DWTA 1PMYA 2VM4A 3WI9A 3SBQA 5AFAA 2DYSB 4BK5C 3AG2B 4DPCX 3TASA 3X1FA 1RCYA 1L9RA 3TU6A 2DWSA 4CSZA 2RACA 1J9QA 1WA2X 3OMAB 5D4JA 1KGYE 4MFHA 1HAUA 4A2DA 4M3HA 3X1NA 1OE1A 1AR1B 2GSMB 2GI0A 1PAZA 3TA4D 2PPAA 4PCYA 3FU7B 1R1CA 1EZLA 3NSFA 5B1JA 3OMNB 3NYKA 3T9WA 2EIMB 3PAVA 4YVUA 2P80D 4GP4B 1SF3A 4UAHA 2X88A 2N0MA 4GYBA 2I7OA 1ID2A 2HXAA 1A4BA 2YAMA 1E5ZA 1SJMA 4Q89A 2XX1A 2J57A 1KBWA 4RH4A 3NJGA 2AANA 1SF5A 2W88A 2J5WA 1AZBA 2FJSA 2PP8A 2J55A 4G7SB 3OQRA 2FQEA 2PCYA 2P80A 2XWZA 2IH8A 7PCYA 3WNJA 3JT2A 3NSYA 2PPEA 2HX7A 3PAZA 4DPBX 1SHXA 4DP8X 3OMIB 3S3DB 2YAQA 3NSCA 2IWKA 3WIAA 1AS7A 2ZWNA 4DPAX 2VSMB 2BP0A 2FTAA 4AKQA 2UXTA 1A4CA 2XX0A 3QJTB 4KOBA 2VM3A 2IH9A 2XV3A 2R7EB 3WG7B 2Y69B 1AZNA 2H5UA 1W8EA 2EIJB 5FC9A 3T6VA 1GSKA 3V9EA 2XXGA 2H47C 3NJLA 1FFTB 4BDVA 3EH5B 4HCIA 3ZX1A 1J9RA 4BXSV 9PCYA 2FNWA 4HIPA 1E67A 2X87A 1AS8A 1RZPA 4GP8B 4YSOA 3WNIA 2ZOOA 1BXVA 2GC7C 1SNRA 3QJSB 3QJUB 1ZV2A 2FQDA 4E9SA 5TK2A 2PLTA 4BWTA 3CVBA 5PCYA 5F7BA 1JOIA 2OCCB 4NB7A 2Q5BA 3IN0A 3D12B 5AZUA 2IDQA 2J56A 5B1KA 4F7KA 1CYXA 2WO3B 1AQ8A 2AZAA 2FT8A 1DZ0A 1M9WA 2VW6A 3FSAA 3ABMB 3UAEA 2WSDA 2DV6A 2GC4C 5D4IA 3T6WA 3FU8A 1AG6A 3CDZA 2GIMA 1ASQA 4KOCA 4GXFA 4HCFA 5B1AB 2CBPA 2IWFA 3AZUA 3AG3B 3EH4B 5I26A 5PAZA 1AS6A 5I6LA 5AKRA 2FQFA 4QKTA 4E9RA 1NICA 3KW7A 3QJVB 4DP2X 3NSDA 1CC3A 1L9SA 3JTBA 4G7QB 2VMJA 1PZCA 3WKQA 3QQXA 2JXMA 5ANHA 1XB3A 5A7EA 2UXFA 3DKHA 3UABA 4WKXA
chains in the Genus database with same CATH superfamily
3ZHFA 1CLCA 4N28A 4PY8J 3NCFB 1KENL 4I89A 3VA6A 4EZMA 1IEAB 5GISH 4F8OA 2J1XA 1DBJL 2XVGA 3HI5L 3CH1B 3VO0A 4AUJA 1NKRA 3UAFA 4BFBD 3RWJA 2E4FA 2UY7A 1O7VA 2ZYHA 4EO5A 1WWCA 4NLAA 1X7QA 1Z9LA 2YA0A 1MCWW 3VD7A 3GEWB 3SB3A 1FAIH 1VB9A 3QIBA 2C3WA 1X5HA 3QCVL 4MKTA 3TFKC 4N0UA 1XO8A 1QRNB 1IIIA 4I13B 4NWTL 4PH8A 5HYQB 2EXYC 3VXUD 1X5FA 1J8HD 5JXAL 1B88A 4PVMA 2FWLB 5SWQB 1AG0A 2AVFA 3OR6A 1BG1A 3U6XS 1HL8A 2PW2B 4IQHA 2AXJA 5INCB 2DQIH 4Y4FB 4M93B 3QEGH 3ZT5A 3K71A 5F89A 1NBVL 4B0MM 4PQXA 1I7TB 4MZ2A 3TH2T 2C9SA 4U6YB 4M8QB 3KPRA 4XBEH 1MHCB 4LFHD 5D1ZC 1LVEA 4YEFA 1KV3A 5FYKL 4H8QA 3L5IA 1U42A 4QLRA 2X4TB 3GMNB 3QS3A 3J8F7 1SHSA 4NDMB 4UNIA 1BW8A 2IOIA 3QG7L 5SWSA 1NGYB 1WFIA 2W9LA 2A73B 4TNGA 3P3YA 1TTBA 5GGRB 1Z3GH 1BM3L 2BSDA 5AB9A 4TN9A 4W9ZA 4LVEA 3MOBL 4UM9A 4ADIA 4CA4A 5KJRH 1KBBA 2CNYA 3LEXB 5FYKD 1LLAA 5C0BB 3BRFA 5F9WC 1E3XA 5HDQH 3MFFB 4OJFH 2BS71 1NCDL 1N64L 1HQ4A 1S7VB 1R5WB 5IQOA 4GRLA 4K15A 1B0GA 5DJXA 5EO1B 1KC5H 2FHFA 3IU4L 4MS8D 5CU9A 5HSFA 4PGBB 4V2BA 1EGJL 1MFNA 2ZICA 3P30L 4PIRF 3RL2A 3F7YA 1NIAA 1BFSA 4GI8A 1GAFL 2AK4D 4KHXH 4AM0B 1DJWA 1KY6A 2A9ML 4O9HL 2J20A 7TAAA 3Q2CA 4RISH 5L8JB 4BV1A 5FYKU 5ICXB 4HEME 2RMNA 3KM1A 3QXVA 3W56A 1C5DB 1QAWA 4NOBA 4PJ5B 2V5TA 3RL2B 4JY5H 3TN0C 2V3FA 2EVFA 4WGKA 3EJQA 1T5XB 1AOHA 3LB6D 4P5MB 3HCVB 5DJCB 2OW6A 2ZUSA 5EEZA 1KLGB 4KQ4H 5B4MD 4ELME 3TXAA 2VYRE 1EO5A 2PYEA 1SJHB 4X9BA 2PPDA 4IBQA 3WFHB 4MB3A 2E75C 3WO4C 1FAKT 3EF4A 4AV5A 3KBHE 4OF6A 2YPLD 4LEEA 1NTDA 5GS1B 2CLVA 4JQXC 1AHKA 1ZANH 3C8KA 2H45A 4E41B 3O2DL 4N8VG 3UOAB 5T1DL 2NNXA 4KRMB 1RL1A 1XGZA 4XAWL 4HZLA 3CXFA 4UCFA 4CN1A 1UURA 3OHMB 5I6KA 1W72B 1UOLA 2SEBB 4GG8A 5GS2H 3LRGA 3UTOA 2PR9A 1Q1JH 2PCPB 4NRXB 1A9BA 3SDXF 4NKQB 1FNGA 2OSLB 3SBPA 1YSOA 5F7EL 1XAUA 5JIMA 3K71B 1JK8B 4P99A 3NIFE 1QLRB 2FBJL 4AEIL 1TU2B 4IJ3C 3V7AG 1INEH 2VDPB 1IBFA 3OPUA 4DEWA 3T0DA 4AG4H 1CYGA 2NTFB 4GBXA 4BKLB 2IQAB 4UZGA 3K91A 1TOXA 3UGUA 5JA8B 2F53D 2HT3D 5HHQA 3KE0A 5I23A 2ZAHA 4N6RA 1WYJA 1CLYH 2A6JB 3HNVH 2YARA 4LLMA 4P4KD 4TSBH 5D8JH 1VGEL 2DF3A 3BSGA 3BPCA 2EXWD 3CHSA 5D1ZI 5TE4H 3FCSA 1NBVH 3L3JA 1ACXA 1E6JH 3EJZC 3LD8C 4FFVD 4G8IA 3GMOB 4UQBA 1UXWB 2CH8A 3BZFA 3KXFB 3CFEA 4NZTH 1CF8L 1UC6A 1GS7A 4N5UA 5A2LH 3W2DH 5I0ZA 3TO4B 2YAHA 1M2OA 2N3JA 2QDVA 1MNUH 3APNA 3GK8L 4JGJA 5AYUH 1T2QL 4L9DA 3BE1L 5ESVB 1JHLH 2NUTA 4Z7UA 4P2RD 3UTPD 4IBWA 3NA9H 3F7RA 3PLYA 2FZ3A 2XTJB 1BBJA 1RV6X 4K4KA 3P3RA 2UV3A 3PFQA 5DURD 1D5ZA 2A83B 1M7IA 1N5AA 4GXUN 4U2ZA 4YHIA 3AGWA 1WPCA 5DFAA 4EUPG 4GAGH 4RFNC 1J1XL 2YD7A 1Y6NR 2VJXA 1CGWA 3MRPB 2YUZA 1NCGA 3D69B 2DMBA 3US1A 2IG2H 4WDIA 1EBAA 1NQBA 3MRQA 3QUXC 3CG8A 1UHVA 1ZA6A 1GYAA 3TEWA 4WF7A 2E9JA 4MD5B 5CR8A 5DJ0B 4GS7C 4HK3N 2A0LD 5I73B 3RDTB 3QARA 1UATA 2C9PA 4DGYH 4X83A 2FLBT 3UROR 4NO0D 3PDOB 2XFGB 3V6OC 1KPUA 3Q44A 4P46B 5BMFH 1DBBL 1RUAL 3QDHA 4Z7IA 4HAKA 5KVGL 1LXMA 4Z7NF 4BBWA 4FNPA 4ZFZB 3WD5H 1XB6A 1P6WA 2OJZL 4YE4L 2ORBL 4QNPE 5IEHA 3GHEH 3L9BA 5A3ID 5DDHA 1KGUA 3PWPA 4G72B 4DN4L 3KWVA 5DZNA 4BA0A 3M1BA 4YC2B 5EIVA 2I60L 1ASPA 2YMXH 2WUBL 3GMRB 4JRXB 3WJMA 2ZJSH 5F8QC 3T0EA 3ASWA 1MRDL 4LOEA 5EMYA 1A6TB 4LEOB 3QIWD 4QAWA 5FGCB 1QATA 2BO0A 4OGAD 1DZBA 2E8YA 2O5ZH 1EFXA 3EYUH 4POUB 4YGAB 2WZ6A 4DGUA 3ULVE 2BSEA 3KPPA 2H6UA 5EHFA 3GSQA 3MUZ1 4YHYB 4PWIA 2XTLA 4QI3A 3WELA 4B9KC 4OT1H 3NRFA 4NN6C 3REWB 5SWZA 2QQQA 3OHXB 4OCRL 2XV2A 1MCRA 5BO1L 3T2QA 2DQJL 1BVNT 2ZWZA 2I25N 1DVFA 1JK9B 1IKNC 2EYSA 1N8ZB 1FV1B 4PI0A 4XVUC 3CPLA 4CC0A 1J5DA 1KJ2A 1H3PL 2MSPA 3W37A 3HBQA 4NNPH 2AK4A 1XR8B 3QJHA 2OV0A 5GXBB 2CUHA 4ZPTA 1U8MA 2FATL 1DBAL 2CQVA 3DROB 1UT1A 1PZ2A 1VRSA 4F93B 4YFEA 4CU6A 5DLLA 3MRLB 5BOJA 3L48A 2F2HA 3EO9L 4K7PL 4F15C 2VR5A 4WTQA 3VFGL 3CC1A 3B7YA 4OFVA 5FM5O 4KKBC 5GRJL 3TJHD 3IEAA 4GLRH 4MAYC 2MTAA 5A2JH 3TH3T 3BLPX 5C0RH 2XHNA 4EN3C 5I30L 4ZMAT 3KL3A 4HJIA 2VDOH 1JWSA 2CCWA 2YD2A 5CGBA 4AMWA 4ZAKA 3CU1A 4C4KO 4I4WA 3DOSB 2VWEC 5CN2A 4DO6A 2NXYC 2XBZA 3DJRA 4KRLB 2XBTA 1UFGA 4NQUA 2W0FA 4JHUA 3ML9A 5I1GH 1KTCA 3NACL 1P1ZB 1XGPB 2L8AA 2WLLB 1JK8A 4C4KT 1RU9H 1OZUA 1H8LA 3SBQA 1BHGA 3A4AA 4KMQA 2ZOLA 4FZEH 3L1GA 3ELQA 4L29A 3GI9L 2DWSA 5GGVY 3FU6A 4B9ZA 5C2BH 4U0RC 3K8KA 5EEVA 1SYVA 2NY6D 3CSPA 1AR1B 2F74A 1KYUA 4I0PA 2AABH 4FLRA 3VFWA 1JGLH 2AK4B 4UQEA 1JV5A 3BQUB 5J6HA 4OZIA 1BZ7A 1HEZB 4PJEB 3N44B 3RVTC 5K9QG 4CJ1A 1UGKA 3GS7A 4MDJB 5FUOL 1DVUA 5I0YA 1MXGA 3DGGA 1I8KB 2P7TA 4RMSA 2WZ0A 2Y7QA 4W9EC 4HA1A 1DO6A 4EUPA 3RZCD 1GTNA 3OLDA 2X4UA 4ODTH 1TLKA 3DRQA 4XCYB 3NTCL 1LYQA 3I6GB 1HZHL 4G7SB 2H0PA 1U6AH 2FQEA 5C0CD 3W0WA 4LNRB 1WC7A 1ZAGA 1SXZA 4L2LA 4XBPB 4FADA 1H6EA 1FLTX 4L1BA 4W4OC 5GS0L 3F7YB 5D5MA 4DP8X 2IANE 2NY0C 1EAOA 3S3DB 4OZFG 3T0EB 2CO6B 3N40P 3OR7B 3QH3A 3MRKA 3WS3A 2AJYH 3MNVB 3UAJA 2ZSWA 1WZLA 2FUQA 5DQ9B 1JHKL 4EN3B 2I9LB 1S3RA 3VXUA 2XV3A 5D1QB 5KJ7E 3WG7B 3WHXB 3U9PL 1NGXB 4O58H 2DWEB 2EIJB 4NBXB 4OFYD 1RXLA 2AJ3B 2DQEL 4JG5A 5KTEL 3NJLA 5D6DA 3FT3B 4PFEA 3EH5B 5DA0B 1TJGL 4JFFA 2GI7A 2CGZA 4CVUA 2AJVL 3TVMC 3U30C 5IGXL 4CGTA 3QQ4A 4GP8B 4JFEB 4JQIL 1PEWA 4XP1H 4J6IA 5DD1H 1HOCA 3NCWA 3DO4A 3VACA 2D7MA 1MJ8H 1OP3H 1XL6A 3RDTA 3I02B 5DT1L 2VDLB 3QIBC 2WC7A 2P47B 4JY4A 4G6ML 3U36A 3UZQB 3H2PA 3HZVA 4ODUB 1N3NB 4YDIL 1DN2A 2W9DH 2PCXA 3PGFL 3QNYA 4FKHA 4M43H 3D4GA 1G9ML 2WWMC 2DQTH 3QDGD 5DQJA 2BIHA 2K4AA 3PQYE 2GC4C 5JIHA 3RDTD 3ZE2E 5E7BA 4J3SA 4PRHB 1MFDH 1CTOA 3PG2A 1NEPA 3DOIA 3VGAC 5B1AB 2IWFA 4JO3L 3BD3A 5KEZA 1U8QA 1ACYL 1BFVH 1WZAA 2YR3A 5FOBA 3VQLA 3BGMB 2Q0ZX 3ZT7A 1QG3A 2EC8A 2JK5A 3EJYC 1L9SA 2CDGB 5DYOA 1ERNA 1KT2A 4RISL 4MHHG 1TJHL 1JMZA 2VR4A 4L3EB 5JLZA 3UABA 3TO4A 1E27A 1Z9MA 3K80A 2JXMB 5C2UB 3G5YB 4JMNA 4OZFB 2GBUA 2B59B 3K6IA 4U6HB 3KXFA 4XPHL 3BZFB 4APQC 5IESH 4GRWB 2OMUB 3UTQB 5A40E 4HK0A 3ARED 4WU5A 4QHLB 4P46C 1E5UI 1YN7B 3AXLA 3GSXA 5JOPD 1XSJA 1JPGA 1Q9OB 4LLMB 2QGEA 4J3WA 4XPAH 4NRYA 5FDWB 2VXTL 1ORQB 3HRZC 3KBFA 4V33A 5GGVL 3KXFD 4EPSA 1R3JA 5JZ7D 3WKMH 3BOVA 4WJG3 4ZW3A 5HVGB 1RH8A 4NENB 2Y7LA 2WWKO 3B9KB 4P46D 2CIKB 3F7KA 4Y4KD 1MQKH 3BUTA 3I02A 4HJJH 4LSTH 2FBOJ 3F00A 1MSPA 4KC3B 4KO9A 4L8SC 3U4BL 4D0BB 4J3OF 5CZXD 1JG9A 2CXKA 2QQLL 5FECA 1V3MA 1NBYB 4J3OH 2NYYC 4MS8C 3GLEA 1I53A 5I0WA 1UD8A 1ZTXH 1FP5A 5IHLB 4U1NA 3DVGB 3O6KH 2IAND 4YFLF 1KCSL 2IDUA 1EEUA 1QWHA 1DFBL 2DM2A 2ENJA 5IJVA 3RWGB 3OLEA 5GS1A 4ZX6A 1TVBA 1RPUA 1SOXA 2ZXBA 1IVLA 5EC1B 5CN3A 1YECL 3V52L 1BJ1J 1OP9A 2X2JA 3Q2VA 4JM4H 1SJHA 1L0PA 1WK0A 1T4KA 2CDEB 1ED3B 1O6SB 4FP8H 4NNXB 4AQ1B 1F3DH 2DI9A 2ZIDA 5AKVA 2OMTB 4GY4A 4NN5C 4E41D 2X12A 1GZQA 4ZDHB 1X5LA 43CAB 1TMCB 3QDJA 2F54D 3N55A 1DQMH 5FO7A 1UVQB 2H32H 3BQVA 3MGTB 1JPEA 1AKJA 2YXWA 4ILDA 1YEGL 5IEKA 2GUOB 3TZVC 4Z18A 2E7LA 3BSHA 4ZUVB 2ZUTA 3EHBB 3CFBA 3QDJB 3NP3A 3O41B 3REVA 2ESVE 4BFJA 4TV3A 5E5MB 2TRYA 3FQXA 5LN4A 1OM9A 3SDAB 4P5SA 1ZPUA 2CMRL 4XP6H 5CBAA 3U25A 1U58B 1NMCB 2DIJA 4JQVA 2IAAC 5DVOA 5J1AB 1J8SA 3PQYD 5TF1H 1B0WA 3MFFA 2VDMB 5IVXB 3GS0A 4YNYA 5KSBF 4EKJA 3G04A 1CGSH 2YXMA 3LYRA 3IXAA 1MDAA 4TSBL 3FFDB 1B4TA 5E6ID 3HNVL 3D0AA 4G9DB 1RIVL 2F74B 2W60B 3NJFA 2EVJA 1JGDA 3L4UA 3Q3GB 3V6OE 4X7TA 2I26N 1QKZL 4GKZA 2NXZC 2Y5TB 4AG4L 3SPHA 5IW1A 2V7HA 3U6RA 5LGJA 1OAXH 3NK4A 1ZLVK 1WWAX 2ZOLB 3SCMB 3BFWA 5BZWB 2VN3A 4M56A 4L4VE 1NCAL 1X5KA 1WT5C 4PMEA 4LQFH 4GMSL 4BZYA 5A3IC 1I3RB 4NN7B 2WTRA 4O2EA 4A6YB 1KJ3H 1QPPA 1KPVA 1MIMH 2BRRH 5F7AA 1E28B 4KHXL 4KJYB 5ICZB 4IGBA 4Y16C 4FNUA 5BZZA 1HZKA 4E0RB 3OAYK 4D9QD 2MOQA 3C12A 3PFUA 1WCQA 2BWIA 4GI6A 5FHAL 3SOBL 1YNKL 4ZUTB 3RGVB 3NN8B 3HG2A 4KXDA 4WFFD 1ETA1 1JPGB 1Q9OA 4PJCE 4JFDB 3R7QA 4UUJA 3SPVA 1CURA 1AZUA 4U1SA 4Y5YB 1WITA 4AIZB 2YSTA 3KPOB 4QJ4B 5L0QB 4D0DB 5BS0A 3CFUA 3NZUA 1EBPA 4R4FH 5EN3A 2BCMA 2VZSA 4AC2A 1EA9C 2LW3A 2K3HA 3GI8H 2AJXH 4UI2A 2HX8A 4KK5C 1M1XA 2Z31D 2QV4A 4HS6A 3RNKB 3OB0K 1JGUH 1M71B 4PW3A 5C08B 3K6SB 1XV8A 5EU6E 3RX7A 3NABL 5A6LA 1KJ2B 3MRCB 1ZE3C 3PNWA 3AREC 1LK2A 3IDXL 3ME0A 4PWEA 4WO0A 3RX9A 4AL8H 5JUEH 1GIGL 2H2PD 5E6ZA 1OAQL 4QTIH 5I1KL 2R29L 4PG2A 5D7LD 5E8NB 4TLUA 4HYTB 1FO0A 1CU4L 4QR7A 3T0BA 4PJCF 1BM7A 1I9IH 1QI4A 4QHMA 3VXSB 2HJKB 5JO5B 3C09B 3ZZQA 4GUPB 4LNVA 3CDGB 2XG4A 1BYPA 4M1GH 4M4PA 2IWGA 4M7LL 3NVQA 2YMTA 2Y2TA 3IJYB 4ZOBA 4NI6A 4TQEL 2DZEA 2DW5A 5KJRL 2OL3H 4NQCB 1OT1A 2ED7A 3LPPA 3IS1X 3ZE0E 1BBDH 3RA7H 1E9OB 2DN7A 4WI0A 4PRNA 2G5BA 3GMRA 4R7NB 3B3BA 4FQ2H 3VH8B 4X6CF 3ULUD 1YEJH 2R56L 1AFVL 1ZT1B 3V5DA 5C0NC 1JHKH 4KNTA 4WJKB 4L18A 4LOFA 1YJDH 3PGCA 4N2DA 4FFZH 3VQ2C 4DGVH 2VT0A 5EOQL 1DCLA 3H6JA 5EU4B 1LNUA 1BOYA 2V9QA 4L4VB 3OTTA 4BUGA 2R51A 3RIFF 4OLVH 4F58L 2D03L 1BDYA 4NCDA 3UBXB 4P5TB 3BIAX 2FT6A 2VLJD 4Z7VA 4XODA 2CKBA 3Q8FA 5MERA 1CE1L 1GZPA 1NANH 4L37A 5DJ0A 5BUGA 3TWCL 5F1IA 5MENA 4LNRA 4U6VH 1F42A 1GJWA 2ALWA 4JHVA 4ETQB 2ZONA 1YPZA 3DA0A 5DD0H 4U3HA 2O4EA 4PCKA 1A14H 2WQWA 3G9AB 1TVDA 3RP1A 1X5MA 1MWAL 4HPOL 1SPDA 3MC0A 1EHNA 2XVBA 3AG1B 4JE0A 3ZR6A 5IB4B 4OB5H 1HHKA 5MENE 1IGML 5C0CE 3G5ZA 4LDLB 3FN0L 3CDYA 2VSDA 3VWJC 2WBXA 2DLTA 5EO0A 4JKPH 3MJ9H 4XT1C 3VD3A 1DJXA 5E9DB 3RWIB 5F0PB 2A1WL 4EOWL 2JH2A 4IJTA 4NKDA 1FVDB 2A6DA 4MB1A 2FLMA 3CFNA 3HW7A 5B8CC 4Y5VC 5DHVH 1QD0A 4OI8A 1RZQA 1UKSA 3T3ME 3ALPA 4XNDA 3QO0A 4OLUL 2M26A 1JGUL 1L9NA 1ZLDA 5D7SH 3IKKA 1NCWH 4GUCA 4KQ3L 4PYGA 2B14A 4QRAA 3RPKA 3HZKA 3HUJB 4MZ3A 5FYKE 4B3EA 4EF3A 3ARBB 1N10A 4PJFB 4JFPA 2DS4A 1GKOA 4ZO7A 4G9FB 2EC9T 3NCCB 1BIIB 1Y1UA 1SFHA 2BP8B 4IGBB 3PJNA 4ZS6C 1ZLUH 4CMMB 3US0A 3P4OA 2X0VA 3BWUC 3FS9A 1WP6A 3W57A 5HVFB 5IBLD 4NQDA 3VSTA 2JB6A 5GGTL 2VM4A 4GW5A 4NNYB 2DYSB 4WNQA 4JQVC 1ZHBA 2IMNA 4JJHA 1SBSL 3TASA 1NFKA 1JWUA 3MGOA 2WTPA 4ZNEE 5ICYA 4PJHB 4GG8B 1MW2A 5ANMA 4CSZA 1UWEL 1J1PL 1K8DB 2RACA 2X4OA 4ICWA 1IT9H 1U8KB 3BZDA 4M7JH 3OMAB 4PJ7B 4UIKH 4J6RH 5DMIL 1L0XA 1JGEB 1HAUA 2IV8A 3ARDD 2NQDA 5D7JC 1MFAL 4KQ0A 4NKDB 5LBSL 5CCJA 2DM3A 2EIZA 3FFDA 2CR3A 1FH5L 1A7OL 4OKDA 1FE8H 1MI5B 4S0TD 1A7PL 3QNFA 2KH2B 5EC2B 5I71C 1GJIA 5I1EL 1KELL 3Q13A 1P4BL 4GP4B 4D3CL 3LKNB 2IGFL 1KCVH 4UTCA 4JDEA 2BVYA 1A4BA 1S7TB 5GZOA 4IMLA 2LOEA 3WLBA 1E0OB 4ZZKA 3ARWA 1MJUH 3UYRH 3O41A 4ZPVB 1BIHA 4POZD 4KKZA 1PJWA 2R4SH 2X4QA 2X40A 1H8NA 2P8MB 4LVOC 4N2IA 4FHJA 2OCJA 4W9IC 5TF1L 2BERA 4W81A 4ANKA 4X4MA 5D7IF 2B4CH 1UD5A 4XVUD 5MENB 4HIEA 1LE5A 1E8ZA 1MJ8L 4MA8H 4CBPA 4FQHB 3ARDC 4MNQD 3RVXC 3QYNA 3GTVA 5DA4A 2QR0B 1JRHI 1LO0H 4NZUH 3OJ2C 2V5MA 4DPAX 2BP0A 1JNLH 2OW7A 5DHEA 1T22A 2H4EA 2P5PA 4FFYH 1SMDA 1PLGL 1T5WA 3ARUA 2XZQL 3SE4C 2G30A 1AQHA 4FXGC 1NM4A 2WW8A 1LNUB 5ID1B 4IRJC 4JKPL 5T3XH 2W5PA 4FFTA 1GCYA 1J8HA 3S8WA 1E90A 1BZEA 4KVNL 4ODWB 3WS6A 3LNDA 4NDMA 1IX2A 4JO8A 4P46A 3ULVF 5ACZB 4JO1L 4O5LL 2FEJA 3V0FA 1WBZB 1CN4A 1RZ7H 3ARBD 2XWEA 5IHUH 4U33A 3UPRB 2EDHA 4FQIL 4YMPA 1P5VA 5T3XL 2O6PA 4XX1E 4ZS6D 4AV0A 2G3XA 3ARFB 4MHHI 4KXAA 4P9HL 3MCKA 3TNMA 3W82A 2IH1B 1IGYB 4F7KA 3C8HA 1D2OA 5TQ2H 4A2MA 3UZEA 5M95B 3TM6A 3CGTA 3FHEA 3F65A 1HHHA 4M3JA 5DUBB 4CN4A 3ULUE 1M9WA 2WAQA 5FIEA 4LVHC 4PUBH 1YCSA 1OSZB 3LJ3A 4MMXB 2WSKA 3U82B 1S5HA 5CEZL 3JWNH 5C0GA 4Y89A 3R1GL 3AZUA 2SODB 4JL2A 1C5BH 3C5JB 3L54A 5K9OB 1CIUA 4XNUL 2DQFA 3KPMB 1FJ1B 1KLFA 1WISA 3KW7A 3EGXB 1HXKA 1D9KD 4G7YH 4D9LL 5EBWB 3GKZA 4G6FB 2ICWA 2B59A 5LGKA 3PHQA 1AC6A 3X14B 1U95A 2F54A 6CGTA 4DNLA 5ID0A 3L6FA 2J6EL 5ITFA 5EU7C 3OAWA 3QWRD 2YQ3A 4IBZA 3UX9B 4HZAA 4NT6B 4R7DA 1CGXA 1KIQB 1PG7X 5DGQA 2B16A 1A6WH 1P5UC 3G5VA 3QG6A 2JLLA 1T7WA 2AEQH 1NWOA 3DMMD 5MEPB 4M61A 1B4RA 3HE7C 1X9UA 1XGTA 3F2LA 1S5HB 1ZRUA 3CNKA 1O0VA 2ZKHH 1R0AH 4HIXH 2XCMC 1C7TA 2AXGA 1A65A 4JFQB 3ZKND 4UIKL 2X70B 3CFJB 4UWQB 5BV7C 4U1GB 3LMJH 4IS6B 2YFNA 4L4VD 5BVJB 1J1OL 4ODXA 5AALA 4GFXA 3O2DH 1YMMD 1B2YA 3CFCL 5CBEB 2DYRB 2FD6H 1UWXK 5JW4M 3KPLB 3PF2A 3ARQA 2D3NA 2ZWLT 2WXFA 4H8VA 1NMBH 2VZVA 4B9YA 3HG1D 2E5EA 2XY2A 3ARGB 2XWJA 4U3SA 3UADA 3A4DA 3RIAK 1WTGT 4MNQE 4PS8A 2M8XA 3HHRB 3V79C 4QHPA 1CLOL 2IDFA 3UTSD 1Z5YD 1OK8A 4IMKC 4G83A 4UDUA 4M7ZB 5TPWH 1E42A 3QA3B 3V5KA 5CIPB 1VPOL 1HKFA 1TQWA 5IQ9A 2ZP9A 2ARJB 4FAAB 2A74C 3IFOB 5E4IA 5EFIA 1FA4A 2EDBA 1T20B 1AD9B 3EKCA 1K4DB 3VFOB 1V54B 1S8DA 4K23H 4XVJL 1OWWA 4DKFH 4CVXB 1ZCRA 4JCWA 4GT7A 2F68X 1EAPA 1WC7B 4HUUA 1HNFA 3MV7A 1GGUA 5G5DB 5D2LF 2EICA 3I6GA 4XPTL 2WWNA 2NRDA 2GCYB 5B7MA 1E9QB 3WIHA 3U4EB 1R9FA 4LHUA 5D5MF 5HHOA 3SEPA 3H56A 3D2UB 4BHUI 2HG0A 3VXQB 3SN6N 2JELH 1K4CA 2ARJA 3R1GH 4LF3A 2IF7A 1MF2L 2DBLH 2BZDA 3VXPA 5C0BA 2VO5A 3KJ4C 4FL4B 3UTTE 2Q9OA 4HKJA 5DEJA 4QGYA 3F5WA 4PWHA 2EAEA 4ANUA 1CDUA 1SHMA 1MJ7H 3P4LA 5HYSA 5T3XE 2FGWH 4J8RA 2GSIB 1RULL 1DLHA 4ZMOA 2Z8SA 1CFVL 5ENWB 3KJ4B 2Y6SC 1ZDSA 1A1MB 2VRQA 1N26A 3VI4B 3QCVH 4XMXA 5IHUL 4N86A 1HNGA 5I6PA 4YSDA 1CICC 3TA3C 5DUPL 2XU9A 3A21A 1KCLA 1AQMA 1N4XH 2B15A 4WENB 5FWRA 3X1GA 4CVZA 2EDKA 2O1AA 3C6LA 3SGDH 2DDQL 3STLA 3QULA 2WCGA 1I4FA 1WAPA 3GSWB 3VGEA 4A2FA 2GJPA 3KYMA 3PL6D 6TAAA 5B8CB 3NH7H 3DOSA 1AO7A 5ECGA 3CUPA 3U1SH 3DUSB 1DQJB 5KUKA 1X4ZA 2FJHA 2NXZD 1MG2C 1L7IH 2NY5C 4DEPB 4XVTL 4WU5B 3PGDA 3UAJC 1SN5A 2AV7A 4R5TA 3MRDB 3SYCA 2XQBL 1SVBA 4ICXA 4XPGL 2EUXA 4LP4A 1JF1A 2GTWA 1A1NA 3LEVH 4R7DB 1AXSA 5A16A 5F6IB 5MEND 1W6LA 1N7MH 4M4RA 4ZMPA 2IAMD 3W38A 3VFTB 4G8EB 3HKZA 3EOTH 1H6UA 1SXNA 3N9GH 1DVXA 4PVBA 3U48A 1JF6A 3MO1A 3ASOB 2W0PA 4QTHB 1JPFA 4OGAC 2BIOA 5GRJH 1QEXA 3U0TA 4YX2H 2VXQH 2ZF8A 2MTPA 1KIUA 3BSZA 4PJAB 3D08A 3UAJD 4QYAA 3WGVB 1NKGA 2XRAL 4JFOA 3RQ3A 4MJJA 3RWEB 1I7UA 3HMXL 4RIRB 4KJWC 4TMPA 2XN9E 3B6SA 5JDSB 3GRBA 2R1XA 4P5TC 1J0JA 1AGFA 4NJ9L 4NO2A 1U4FA 1N6UA 1DUZB 1FH5H 2CR0A 3FCTA 3VRIA 2Y1ZA 1V7MH 3F7LA 3UZQA 1IFGA 5J3HC 4XN1A 2WXOA 1MIEL 2WXKA 5HI3D 1I85A 2CHNA 3ARYA 3FL7A 3FB8B 4NC1E 5C0DB 3S35X 1TETH 3LRSB 4YAQA 1N19A 1WE5A 4FULA 4NSKB 4Z95H 1Z0MA 3TF7C 1U8PB 25C8L 4ZFOL 1GKEA 4DKDC 3QR1A 1T66D 3HZYB 2H26A 2P5EE 3NEXA 3DHPA 1IAKA 2X38A 5B38A 5LBVA 3N42F 2W65B 2CAKA 1C1EH 2ZXDA 3EYOB 5IJBC 3B2VH 3RIAF 4PB0L 5D1QA 4M48H 4G9FD 4ZQKB 4DERA 1QBAA 5BVPL 4HC1H 2NY6C 4YHNA 3HMXA 2R0WH 3QEUB 2V2XB 1G7PA 2W0KA 3OF6A 4DQOH 1K3IA 4C83B 3LRSA 4N0FA 2WBWB 4XC3L 3GTTA 5T3XD 3GZQA 2JKTM 4CU8A 1FG2B 2VQ4A 1VFBB 1FSKC 1LL1A 3QEQE 4YGVA 3PV6A 4HT1L 1AXIB 5FF6B 4G82A 1KV7A 3F05A 5ALCL 1HINL 3AREB 3FUIA 2X1OA 3CU7A 4CSTA 5IOKA 3TZVD 1ZGLB 4HWNA 3UYOD 4QRUB 2WZAA 2UUDH 3KL0A 1KC5L 2ITFA 3IDYB 4ZPVA 5LDUA 2P8PB 4NIYE 2MCG1 2Q8BL 2XQBH 4BA8A 2ZG2A 4IMLB 4TTDC 3KXFE 4L8DB 3MV11 4P2RA 8FABA 5F6HJ 3UTSE 2ZOKA 5C09A 1BP3B 5TTRA 3SPCA 4PVLA 2F6AA 1A4AA 3Q9QA 4LSPL 4WLCA 2BSED 2XC8A 2Q7AA 4MJIE 4N0CC 4Y5YC 4F57L 1UT2A 3SBWC 3VFNB 1P6FA 2AEQL 1M6UA 1DQLH 1TKWA 2DQCH 5DK2B 5B3SB 4Z78B 2BNRB 4XXWC 4Z76B 3TC9A 4DKAA 3II1A 4ALAH 1AYRA 5FKAB 3VM5A 2OA9A 2V9UA 2HVJA 2R0ZL 1X7TA 2R69H 3D39A 3P0VH 4G8GE 2H3NB 3FFOA 4LSRH 4Z7VF 1IC4H 1USQA 2F9BT 4MQTB 2Z34A 1C12B 3RGHA 1PX4A 1U33A 3H4FA 1H3VA 3NIDF 4R26L 4JK0D 2GQHA 3INUH 3VRLE 2XWDA 3IJEA 2A6IB 2ATKA 1KCWA 1T5KA 1HS6A 5ETUA 4EXPX 4X6DA 1U6AL 4TTDD 2BY0A 3JV5A 4GQZA 2GITB 3VFUB 3SCMC 5IROA 4YDJB 3VM7A 1SXBA 4JZNB 1KTDB 3FTUA 4G2AA 2CHDA 3AQDA 1NGPH 3AAZB 4TQPA 4WWNA 3IDNA 3ZIMA 4JJ5B 1X3DA 5EPMB 3IGAA 3IM1A 4JREB 3QORD 5IMKA 2FH6A 3AUWB 3UJTH 4LLVA 1QBLH 2WKGA 4PN6A 1UADC 5I2IB 1INDH 3R4DA 1H3TA 1M2VA 2JWYA 3DBXB 4H4NA 3DSNA 4OAWA 2YZ8A 1A1MA 1L9RA 3QRBA 4YIQB 4J5VA 3U6RB 2HVJB 4U31A 1BZDA 3ZL4H 5D4JA 4DHLA 1A66A 1P7QD 4YDVB 1MLBA 1G7LB 4UOW0 3TPKA 4C56B 3RLSA 5EZPA 3K2UH 1GOFA 5AW5B 2J7LA 3N06B 4WI5A 2N0MA 4Y1SA 4LLDA 1A1OB 4XCFL 4EI5C 1QSED 1LK3L 4OZGB 1WWWX 3HCVA 2CDFB 4NM8L 3NACH 1E5ZA 3EIFA 4QD2E 5C07B 2ADYA 5IMOA 1P7BA 4L4TE 5IVNA 4NN5B 3BIKA 4NZUL 4OUOA 4R8WL 1QI3A 5DC0A 2Q6WA 5C08D 1NCIA 4ADJA 5E1AB 3B9VA 5EOTB 2PP8A 2XQYA 3JXAA 3VFRA 2FSEA 1FIGL 1Z9NA 1FFNB 4JM0A 2HWZH 1HX0A 3FZUC 4HUUB 5E51A 4F9PC 3MGTA 1AZZC 2Z4QA 3MNDA 5MEQA 2FJFB 1JZ7A 4N8PA 3B5HA 3NSYA 3PAZA 4DPBX 2FO4B 1NCJA 4HJGB 2RBLA 3KDPB 43CAA 4DTGL 2V2TB 4WRLA 1AR1D 2DQ6A 5FR3A 5LXVA 1XIWB 1I8LA 3RVTD 3H9ZA 3QIBD 3GSNA 1USZA 1MELA 1U8JB 1G9MH 1EJOH 2DQUL 2EDEA 2HH0H 4U6XB 4DK5A 3SODB 4U3XA 1KXQA 4Y19A 1QBMH 4RRPM 2V5YA 2IEPA 3SOBH 2ZCHH 1LILA 4L8SB 3ZL1A 5M94B 2L7UA 2UZIH 5BOPA 3HAEG 1C16B 2VR9A 3FN3A 2OI9C 3BX7C 4IGBD 1P5UA 1SN2A 3P77B 2FNWA 2X2HA 1AGDA 4NKMA 1JGVL 4P23B 3VTAA 4J7RA 1WZMA 1P7KB 3Q48A 2Y0SA 1ZT1A 2NXYD 3ARGA 4NGHH 3WNIA 2BJML 1R3LA 5GRUL 5FECB 1P84J 4FJYA 5L2KD 3G3LA 1MHCA 1W72L 1AY1L 2ICWI 4MASA 4I88A 1W91A 3DXAA 3FB8A 4LP5A 3O6MH 4LL1A 4DAGL 2RQEA 1IGFH 5F7BA 3DDFA 4AQEA 1ORSA 3SDYH 5CZRA 1A6WL 1L7IL 3DJ9A 3OX8B 5DO2D 5SWQA 1L3WA 3PABA 3QG7H 4XPBH 5HJ3B 4LLYB 4BQ9A 2DEXX 2R0LL 2VERA 3ARGD 2Y7OA 3M1CA 1DN0A 3F12A 3HB3D 4N2BA 1N0XL 1ORQA 2J6EH 1V3LA 5KOVC 1SOSA 1AG6A 2Z31A 3FU8A 3UJIH 3BD4A 3GLZA 5BRZE 1TXKA 4F92B 4PP2B 4KZEL 4PVNA 4DKEL 1IFHL 4FYTA 1GMIA 4QHLA 3VGBA 4C56E 2WQAA 5DHXB 1N59A 3D09A 1XH0A 5DUPH 5MHSD 1Q94A 3VX0A 3L16A 4IHOA 1ZVNA 2ZKYA 4CSSA 1XMWA 1DANT 5E9DE 4PR5A 1SJVA 1EZSA 2G4GA 1P9MA 4JVUA 4YK4B 2R39A 4PLJD 1G1OA 3L8QA 5CP7A 3QHTC 2OYPA 3VVWA 4Z7AA 1Q94B 1R3HA 3TBWB 1GXEA 3NFPA 3IAPA 5CGYD 1P69B 4D0DA 5BS0B 3IGLA 2CBQA 1IFRA 2HMID 3FTXA 5JDJA 3EJCA 3L3JB 4BRJA 4N85A 1FZOB 5LGHH 4KKQA 4U4IA 3UL4A 3UDWC 2IMMA 4B95C 4OJAA 5F88B 3MA9L 4N6RB 1J5HA 1EJ8A 3KS0J 4YPGB 3ECWA 1RVFL 4MXQD 4PJ9A 3EXLA 2XWTA 3UTSB 3STLB 3VDBA 3WFCL 1HHJA 3APDA 2VJ0A 1HH6B 1I1AA 5DS8B 2CPUA 1JYNA 3AS0A 4N2LA 4OIFA 2QVIA 4QRPE 1NIFA 4LASH 2NY4C 1QBLL 5JW3L 1BXUA 1RAMA 1B4LA 4HCRH 1I9EA 1FNGB 1E4XH 5T3ZL 4HCRA 4U3CA 4F27A 1B4JL 2NX5E 4WEUD 4YDZA 3BP6A 3T4YA 4OGYH 2VDKL 2BSBA 2VDRL 5TQ2L 5E8PA 4AJWA 1UD3A 1G7JA 3E2HB 1E50A 1PX3A 4BSWB 4HXBH 1F3DJ 4FQLH 3KBPA 4M5ZH 4XN2A 3VXSD 1VHPA 2CK0H 2X1PA 4HLEA 4YO0A 4PJEE 1AD0B 3T6ZA 4FEMA 2R2CA 3HN8A 2CKNA 1CFQA 3LEYL 1M7DA 4PGDB 2IV9A 4WUUE 1ROCA 1T04A 2FDBP 2QL1A 4UYQA 3CBKB 3ATFA 2WWMD 3V6FA 4NQDE 5MEOA 1NZRA 2NYZA 2EDOA 4NAJA 3VCLA 5E94B 1NDGA 5D6CA 4OLXL 1QVOB 4B5ZA 2XZQH 3VXTA 5G5DA 3CFKA 3MLSH 4Y16B 1F0LA 1Q0YH 1JIBA 2BHFA 3DV6B 4DTGH 5CLTA 3OGCA 3MI6A 2OMXA 1HE8A 2YIHA 4FNLH 3CE1A 1JHTB 2YO3A 4A7TA 4NN7C 2Y7QB 3DETC 3ROLB 4QT5A 2CU9A 1D3CA 1RK1A 1IGCH 4LBEB 1OB1A 4LLUA 4NQSA 2QKSA 4JFDD 5D70H 5FA3A 3F85A 4F8NA 2X42A 4IHBA 1UEYA 1U92B 3RGVD 2BFGA 1IAIH 1Q0YL 5EN2B 4J4PA 3RWCB 2W94A 4ZQTA 3H7BB 2WLJA 4IIQB 2FBRA 3FU7A 3P40A 3HRPA 3AC0A 3NA4A 1G4RA 1LMIA 3T1FB 1J86A 3K2KA 3MBXH 4D94A 2GAZA 1EXUA 3X3FH 1BZ8A 3HVNA 3KVQA 3P9LA 1XBRA 1A0QH 1SHWA 4HIQA 4LLAA 2NUPA 4V2CB 4YL4A 4E9WA 2BVQA 3UTTD 1BVLA 4I3RH 5E00A 4LB8A 4BJLA 1FG9C 3LN9A 6PCYA 1NCTA 1TZIB 3DBXA 4OAWB 4KJQC 3V0JA 1NMCC 3ZTNH 2KPNA 4PJBF 1FE8L 4PRDA 1CK0H 5D7KD 3PWNB 4WJ5A 1NCCL 1C5BL 2K8MA 2PW2A 2E59A 4RAHA 2VUYA 1JUFB 2CHZA 4NQEA 4PM1A 3WNPA 4MRBA 3JV6B 1WUZA 1SEQH 3X11B 1F8TH 2ENQA 1S7UB 3HUJF 5KTEH 1V55B 3FOLA 4U1HA 4NRYB 4JLRB 4YS4A 2OJ1A 2XZCH 3DXAD 2WSPA 1XF3B 2R2HB 4WWKA 4PRIB 5FA4A 1CFTA 3X13B 3PY9A 3U7WL 5F7DA 1TZOA 2AJZA 3P11H 3RKPA 1WAEA 3CFQA 3CTTA 3LX9A 3TP4A 2Z9TA 3MHZA 4L3CA 1K6QH 5KSUB 1CFBA 5L2KE 5D7IA 1OW0C 5JLZB 2OSXA 2XRAH 4PR5B 3ULUL 1RUMH 4TPRL 4JKKA 3ARVA 2XJKA 4N3TA 4WWKC 4NN6B 3SDCB 4CSPA 1QSEB 4KVNH 4TVPL 1HIML 4X99A 4FG0A 4MJ6B 3NCEB 1SDAB 3Q5YA 5DJ8B 4LLWB 2AITA 1ZJBA 2F1BA 3D7PA 4V1DB 2HFFA 3TN0D 2VLKB 2PN5A 1TIUA 2XZAL 4JZJC 4XBMA 1FNEB 5DJDB 5E1GA 1IM3D 3RVXD 3KBEA 4ZO8A 5BUAA 4PWFA 4YWGH 5J13B 4LLYA 5HJDA 5CINL 4GG6B 4Z7WB 2CHWA 5E5LA 2HG5B 3NG5A 4KRPB 5JYLA 1BQHA 3O11B 5MHSE 3RY6C 1UXLA 2F54E 4EDXB 2Q2EB 3N85H 3GRWH 1F56A 4DKTA 5F9OH 5I76A 2EEAA 1ZDQA 3EYVA 1T89C 2RD0A 3WYRA 2F8VA 1KBKA 2E4TA 3RB7A 4PJFF 3UERA 4EBQH 1OWRM 4FNQA 1GGYA 1K2DA 1PNCA 1A9VA 1MAKA 3BP7A 4MWFB 4R3SA 1ITBB 1UYWH 4J2QA 4M03A 1T21A 4ZW8A 4KJWD 3VG9C 1F11A 5HYEA 1N12A 3ESNA 3OKKB 3SDYL 1CCZA 3BVTA 1WF5A 1JPST 1SRDA 3QUXB 5EG6C 3VXUB 3FAWA 4X80H 2BP3A 4DP6X 3QUYA 4JX0A 3APFA 1QFWL 3HI1B 3FQTB 2Y7NA 4NQXB 2IPUK 5DR5H 1ETZB 2PWFA 5JUEL 2QQKL 4UQIM 1XH2A 2RALA 2WP3O 1P4LB 4ONHB 3I6LE 1PQZA 1VESA 3HZMB 2D0FA 1FNLA 3VMOA 4NZJA 1QZNA 4XAKE 2B4CC 4AYMC 3EOYG 4NO2B 1RZJC 2B3IA 1KEMH 3GI8L 5ICUA 4A7UA 1INQB 3QWRA 1H3XA 4K3DH 4PRIE 3BIKB 3FH8A 5D7KE 4X9GA 5C07A 3BLKA 3PWVA 4LOUC 2FO8A 1F02I 1KIUB 4FABH 2HVBA 4XP5H 3ZRCC 1JVKA 2BZ7A 2XDHA 1D5IH 1U8HA 3RG1C 2JIXD 1JSYA 2Z7ZA 1KEML 1T0NA 1ZXKA 2BVTA 3SDCA 2Q7YB 3MRHA 4Z7UB 5AVXB 3N43B 1DP0A 4ZAKD 3MOQA 3B43A 1T0MB 1EDHA 5T1DH 3SZKC 1I8IA 1R34A 3HG5A 4JVPA 4XNAA 3TIEB 3TEZA 1PIGA 1T83A 1HDMB 1CF1A 2BPBA 3MNZA 1ZT4A 1IGTB 3KHQA 2ADJB 1DJYA 4JM2C 2FJHB 1CDBA 5FK9A 4K3GA 5B3JF 4YSAA 2DQHL 3AU1A 1D5RA 2XV6B 2DKSA 2O5NA 5LBSA 4WNSA 1U8LB 2RA1A 2YGOA 1V5JA 3GT6A 4EVNA 3FULA 3I6SA 1S7UA 2J2ZB 3WNMA 3EYQC 3WEBA 5HVWA 4N20A 1KTDA 2E7LC 1RZJH 4JDZB 4JN2A 4F7EA 1F4YH 2VDKB 3FQRA 4F7PA 4ES9A 4JRYB 5D7LE 4YQXH 3LN4B 2JKWA 3ZZSA 3IJEB 3BCDA 3WO3B 1JBJA 3B56A 3BWAB 3HUJA 4RQQB 5DVMA 2HFEA 3QEGL 1JWSB 2VLRD 3H3PL 3O8XB 5KVDL 2FUTA 5AFAA 1MKFA 2HRLA 1J1OH 5HDOA 2VDOB 3TBVB 4CKQA 4BQ6A 2H32A 3CK0H 2H3NA 3FO0H 3GJEB 4F3FA 3LQAL 2YD1A 3IJSB 2Y5TA 1CE1H 3H0TA 2X53A 3OKLA 1J0IA 2CWRA 3GMQA 4EIUA 4LQFL 4Z78A 1CBVL 4KHTH 3ZDXE 4GFTB 2VZ3A 3SKMB 4NXKA 3OMNB 3MUHL 1KXVA 2P80D 4M29A 1DBML 4K3JH 2YMOA 3KLSA 2I7OA 4LEXL 5I5RA 2PWEA 2J21A 1H15B 1KTRL 4ZFGL 2HLFD 2P8LA 4KXBA 1C8PA 3NCJH 3HG4A 2MOVA 2P8PA 1I9JH 2G9HA 4F5CA 1CGUA 1N4XL 2B9BA 4HBQA 4YN3A 3WN6A 4BKTC 2CM6A 1CIDA 2L7JA 5INDA 2BOCB 5AW4B 5T5NG 3UBXI 1K5NA 2VLJE 4OH2A 3QIUC 2OS7A 1FIEA 3QUZA 4OU3A 4Z9KB 3S9DB 1F58L 4MJID 1HQRA 2Y4SA 4E36A 1M53A 1G7HB 4TVPD 5IB2B 4ODHH 1T20A 3IDYC 4PCTA 2EIBA 3AQYA 3KCPA 1R5WA 3GBLA 4XBGA 1J18A 3HS9A 4M6ML 4YHNB 4OD3L 2WPGA 4OZGE 4EN2A 1DE4B 3HS8A 4ODSL 4QRPD 1MVUA 3T2PA 3UTZB 3OAZH 5F6HI 1GIGH 5J8OA 5CJ8A 3V4UL 4BSWA 5JIDA 5EU4A 2V5RA 5JHLL 1FFTB 4JFHE 1BFOB 5T1KB 3VW3H 3FHAA 4B97A 1S9YA 4QCIA 3S96B 5GRVL 5BJTA 1UZ6E 1JV2A 2V3EA 2XNAB 4GQPH 1K2DB 5TPWL 4ZYKA 1KGJA 3LB6C 5HPMA 1RJLA 4D0BA 3Q6FA 4Z7NB 3BUBA 1R24A 3GKWH 1LD9B 2C9VA 4U6YA 1CS6A 4GG6E 1KIPB 1HL5A 1R75A 2CA4A 3S34L 3Q43A 1EZUA 4QNPF 5TH2A 2FJGB 4XMUA 3CSGA 1QR1B 3QXDA 4MCMA 3WS6C 3MJGX 1IE5A 2WBJA 2F15A 3FCUB 1KG0B 4Z3FA 1CGVA 1OAUH 1MFCL 3QUYC 4WWID 1AC0A 2R1XB 3GXMA 1NEZG 5E8OB 1IB5A 1JN6B 5C3LD 1N5AB 2P52A 4AENB 1QI5A 4PHXA 1BZOA 4ENED 1E4WL 2ICEA 3HC3L 1D7FA 1ZLEA 3CHRA 4RLDA 5F3BA 4J3OC 1CGYA 4LPVA 5CZVL 4GSUA 5JHMA 4RGOH 5C8JB 1BX2B 4JFZL 1CQYA 3ZRSA 3RI5F 5FYJU 5A7EA 3VFGH 2K7PA 3OAUH 4LSSL 2NY1D 3O45B 5D7IB 2DPKA 3BDYL 2BM3A 1QNZL 1IRAY 5IIEA 4PBVC 2IGFH 4JKWA 3MRDA 2COVD 1S9XA 2DQFB 4Q2ZB 4BGLA 4JNXA 5IFJA 1J7VR 4JFFE 1HT6A 2OX5B 4PJXB 5LQBL 2ICEB 3LXBA 2YPLA 2RR3A 1F18A 4UTBL 1AY1H 4ISVB 2WMPB 4AYID 4RX4A 4AENA 5EUOF 1CUOA 3FO2B 1VEOA 2BOBA 3JWDC 3MLXH 5G55A 3TYGL 4G9FE 2LE9A 2YEQA 4GS7B 4HXBL 2JF1A 2K0RA 3M86A 3AXIA 1ZVSB 3ULSA 4OF3A 5J1TC 1UJ3B 5JOPE 3EJZD 2X5PA 5L2JA 3DX7A 4K71B 2O6CA 3ARZA 4HKZA 4KPHH 4X6BB 1SEBA 3ARFA 3PWNA 4WJ5B 4ABQA 2JCCB 4Y4HA 4C54A 4RFNB 1T2XA 4Y1AE 1P4IH 35C8H 5BZWA 3L2NA 4XO8A 1A9BB 1C9SA 1HOCB 3AW5A 2MOGA 1D5XB 4MSWB 3D4YA 4EBQL 3MA7A 3EO0B 5IK3A 2EDYA 3FT4A 3L3KA 1GYWA 4G7YL 5BJTB 4J8RB 4G71B 1JGDB 1C5CL 3GF8A 2WZPD 1KB5A 3GDBA 1MXDA 1TYEB 1Z6JT 4XCEB 5HP5A 1Q90A 1YNTF 1FAIL 4H0LC 4PV8A 4WTXA 1QLFA 3QGVA 1F00I 4HS3B 3GSNB 5B39B 3ISWA 5CWSB 5DURB 4XTRC 1XBDA 1G84A 4EAEA 5FO9B 2YQGA 5DMYA 4U6TA 3ZT6A 1C5DA 1AOZA 4EI5B 3B83A 2FRGP 3TBSA 3JV4A 1FORH 4JO2L 3VFRB 2EUZA 3DV4A 2GJ6E 4ORGA 4P5KA 4OF8A 1F58H 4K8RH 3CDFA 5IMMB 5FO9A 1OE2A 4H20H 3ZKMC 2GBAA 3ECVA 1IFHH 2OMTA 3F7VB 5ISZD 3UCQA 4XNUH 5G2NA 2VXUL 1FNSH 4N4YB 1V3JA 1JDAA 1FVCA 2YQ2A 3WE1A 4U0QB 2GJRA 4AITA 4U6VL 3KDMA 4FFYA 3L5XL 5HYJE 3D0VA 4LCUA 1S6NA 1MJJB 4WKZA 1MH5A 3KPSE 4FFZA 1T2JA 2YRPA 2P5WD 2K8QA 4RZKA 3K5SA 3IT8D 1SMAA 1K8DA 3ZL2A 3QORA 3KR3H 1HILA 1NDMB 4AVIA 4CILA 3FB7A 1BD2B 1JZEA 2D7TL 1M2VB 2B2XL 2V6HA 4JFED 4WFGD 4NNYA 5I30H 2OL3A 4XX5A 3BEVA 4Y4HB 3WIFA 3MCLH 3GIZH 3WIIH 4B9GA 4ODXB 2A38A 2E46A 4X6BA 4NKOA 4NZFA 3RBGA 1DR9A 1U3HD 7CGTA 1OF2A 2DTMH 1AGCB 3C6EA 4ODBD 3GHBH 4RMBA 2ATKB 3GIVA 5E8DL 3CVHH 1EH9A 4AH2B 4MNQB 4PRHE 1IEHA 3QHZL 4DEUA 2YEZB 2FL5B 5I0VA 4Y2NA 1BG9A 2UWEB 3QNXB 2H6PA 1BD2E 2FEEI 2EO7A 5C0CB 4WFFE 3EFOA 5CLXA 5D2NB 4B5EA 3C08L 3DXAE 2BNRA 5J57B 4PJCA 1RK0A 3HE7B 3LV3B 2F54B 3UBXG 3EGSA 3HBGA 4MNHA 2LLNA 1IUZA 1EFQA 4HDIB 5EF1A 5C71A 5L9DH 1NGWA 3O0LA 2OR8A 1RUKH 1NC2D 2KI6A 2HRPL 2ZCHL 4JL1A 4K7PH 3BQUD 2J1ZA 4FMVA 1FFOA 1T80A 1XSIA 2VITB 2XLLA 4E42B 3HHSA 5EU6A 1BAWA 2Y7SA 1PCXA 2NY6B 3CC5A 2OM5A 3EOAA 3V4PH 3WN5B 3PYCA 4Z7QF 3GYRA 4XN9A 4YE4H 3STZA 3HZVB 4BQBA 4DUWA 1UUNA 2GPZA 3MKKA 3TCLB 2ITEA 4O9HH 4MMXC 1A4KB 3E1F1 1C8QA 1LD9A 3ZHDA 3HI1A 4I5BA 1GHFH 5E2WL 1A7NH 4PP1D 4NAMA 4L1LA 1JXKA 3PXLA 5AOZA 1L0QA 4IU2A 4OD3H 4B9JA 4ZMYA 4AGQA 2X6BA 4KWUA 2XNAA 3KYKH 5H37A 3P77A 1CFMA 2K45A 3ZDYB 3OQ3B 4JFFB 5E4OA 4F8PA 2DQUH 2HH0L 2PNDA 3JWNG 1F11B 1IJNA 5D2NC 4YJZL 2WXNA 3HFML 2AJ3A 1XHHA 3CH8A 2J1WA 4DCQA 3B1TA 2M83A 1MCOH 1U8PA 4GAGL 5F9DC 3G08A 1ODAA 4K3DL 1XGQA 5AOLA 3PDOA 5EOQH 2YD3A 1IBGH 4TM9A 3RVUD 5I76B 3F58L 3KS0H 5I66B 2ROYA 1A8ZA 4ATWA 4UILH 4IRJB 4NQCA 1T7ZA 2P5WE 2NCMA 4BXVA 3QXTA 1U21A 3NSJA 4XN4A 1LEGB 1WBYB 2HFTA 4LESA 5D96C 5E99L 3FMGH 4PJ8B 5E1HB 4KO5A 3B1UA 4YE0A 3DX9B 3VJ6B 3U2SB 1FFOB 1Q72L 3FO1B 4PRPB 3WMPA 2CDFA 4PV9A 5F6IC 3FN0H 5E4EB 3LKNA 3R06B 1RZFL 4LRNL 4LVOB 5DZAA 3VWKD 4PJEA 3D1MC 4MAYA 4QRTB 5IBTL 3MJ7A 1DVQA 3CQFA 1DQQA 1ML0A 4OTXH 3SKMA 4MNHB 3A6CL 2ADGA 4RZCA 5DF0A 4HPHA 4QHUA 1BVKA 4WUUA 2R56H 2AQ1A 1ZS8A 5EORH 1Q9LA 3OKLB 4JRYD 4G3YH 5C0CA 1J87A 2XPYA 3MBWB 4P2AA 4Q58C 4X9YA 2BNUB 1RZJL 4P5TD 4DIXA 4ENEC 2F7QA 4TL4A 1FPTH 4TQEH 2BS9A 3VWKA 5B3NA 2WJ7A 2X4PA 4GQQA 4NUJA 4F3FB 2K6YA 3LRKA 5KSBB 5AZ2L 5LO7A 3FCSB 3S8FB 1ZHBB 5KSAD 2DD8H 2YRLA 1BPLB 1MCEA 1JHLL 2LHAA 2NMSA 4K3EH 4NPJA 4KJPD 4KPHL 5I2IA 3UP6A 3P4NA 4FQXB 5AYTA 4HETA 3CHOA 1DQIA 5SX4H 2RJMA 4JRYA 1CFVH 1FYTE 3D6GA 3O6FD 3MROA 1W0WB 2PO6B 4J3OG 4P9ML 3WUWG 1M05B 5JHAA 1NLDH 1OF2B 4DSYA 5EF3A 5IFHH 3D18A 4KGJA 2IPUG 1BIIA 1E5CA 1NSNL 1AE6L 1KGIA 1TU2A 4Q4IA 1DSYA 5TE4L 1SLWA 3WIFB 1MQKL 2VE6B 3LKQB 1CG9B 5BQ7A 2JIXB 4FL4C 3IU3B 3O4OC 5E00B 4JR9H 2SEBA 4QRQA 1OK0A 2V8LA 5FKAA 2AEWA 3X1NA 1XF2A 1OE1A 2F1AA 2GVYA 3PXJA 1O7SA 1FCCA 4AMKL 3TA4D 2J12B 1WEJL 3QIWA 1P2CA 2CO1A 5CLZA 1TTAA 4H0GA 2K9FB 1D6EB 1ECYA 4DVRL 4FZ8L 3LH2H 1A0QL 4MDRA 1WAAF 2YPVA 3RWCA 1LQSR 4P3WA 4JN1H 4UOZA 4Y5VA 4W9DC 2H9GA 3SGDI 3UZVA 3QK0A 5KSVB 2ORBH 2OMWA 4ZMTA 2ZOKB 1XD0A 2DYPD 5I1KH 5IB4A 1JGIA 4Z7WF 3MN8A 1HINH 3FC8A 4MJ5B 3ZQXA 4R7LA 2A4EA 2XN9B 4P2YA 3H7LA 4ZNEA 3DX9A 3VJ6A 1UJ3C 2GCYA 1QFWH 3S35L 5C6TL 1ZGLA 4M1DH 5JIPA 1YPZB 4UQ2A 3QUXD 5FYLH 5TQ0L 3TBSB 1M3JA 1LGVA 2HKAA 1QTPA 2ZKMX 4YGVB 3IGFA 3VCLB 4M7ZC 4GAYA 3OMIB 3IJ7A 3D5OF 4N0YL 3JWNC 4IRZH 4N25A 1B0GB 4NNXA 1WDAA 4HUMB 4FXKC 4W9GC 2UXTA 2QZQA 2NDGA 3GJFA 4CNIA 4ZNCD 3WD5L 3VA2C 1OM3H 3ARGC 4NOFA 1T7VA 3QYCA 5EC1A 3E8UH 3MXVH 1I8AA 3I75B 2IDCA 3EDFA 2MEJB 4X8XA 1XCXA 2B1HL 2JVUA 4P48A 4XO5A 4I3SH 1XR9B 4MLIA 4X98A 3LMJL 3LS5H 3ZX1A 2P24A 1CMOA 4Z5RB 2BIQA 4ELMF 1X5IA 4XP1L 1TT6A 1A6AA 4AMXA 1LHZA 4O2CB 3RNQB 4FFVC 2VERN 4F80A 1LO4H 4H88L 1CF8H 2WQ8A 2FECI 3M45A 4L48A 3V9FA 3BZEA 5HDBE 2Z31C 4RVBA 4PJHF 5JOFB 5EZLB 4WY7L 4M6NH 4K3EL 4GKOA 4J2XA 4L5FE 2Z0BA 3IN0A 5C0IA 4AK2A 1R4XA 2XG4B 4M62H 2ZX7A 4UZUA 5I6XC 5CMAA 2C4XA 1G94A 1DZ0A 1RIVH 5JW3H 3NIDE 1GC1C 2NSQA 2DJSA 1FNEA 2DV6A 5EORL 2OCFD 4JM2D 4OJYA 3PWJB 3L7FA 5DMKA 1BOGB 3L4CA 4ISVA 2X0WA 3HJEA 1F6LL 4Y4FD 3GRWL 4Z3HA 3RJQB 4AEHH 1BWMA 2JSFA 3Q6GH 2EO9A 3QWOA 5IBTH 4GKSA 3ZMNA 1NICA 2MCPH 3PS6A 2EZ0D 1E3FA 2QSTA 4FQPA 4WEMB 4DO4A 1JYWA 4OZFA 4X8GA 3O9WA 4IMKA 3OKEB 1FORL 4L5FH 2IALB 4E2OA 5ANHA 3CZLA 3LZNA 3IDIA 4LDEB 2CO7A 1CU4H 3FKUS 2X3BA 3AB0C 5DYOB 4FNTA 5HGBB 3TCXA 4Z7QE 4EIGB 1QR4A 4L8CA 2NQ3A 2OJEB 1PY0A 3FFCB 3NPZB 4OLEA 1AAJA 1CFTB 1KDIA 2VN4A 3C5JA 3UMTA 4PGEB 1Q9KB 1J8HE 1SDDB 5DJ6A 4KXZH 5JW5A 3NZ8B 1ZTXE 3PWJA 1VEPA 3MODL 4OBRA 4JGUA 4YSSA 3GDCA 3DGDA 2VXTH 2ZWYA 1O5DT 3BGFC 3VI3F 5I8CA 1VDGA 2Y06L 1TUPA 2ZYSA 5DS1A 4Z77A 4Y19D 3V55A 2ITDB 2VQTA 5C70A 2HLEB 5CJ5A 3L4TA 2JI3A 1KCKA 4PRDB 2OBGA 3Q1SL 4NP4L 4B41A 2OL3B 3BZEB 1BJMA 2OPCA 5LGYA 4GH7B 4JFHD 3SCMA 1N6QH 1A7RH 5H4YA 1Z66A 4KZDH 4XNZC 3QT2A 4A2GA 3ZYZA 4O02L 4DAGH 1LQBC 1F3RB 1JPTH 2G2NA 2PW1A 4I48B 4N2FA 3VWJA 4BZ1A 4EDWL 3N44F 4ZJ9A 3ATBA 5I6OA 4QCIB 3AY4A 1THCA 4G9DA 3DUUB 2A9AA 3QZLA 4FZ8H 3SSGA 2VIRA 1HFUA 3WNNA 2H3KA 3ILPB 4IIQA 3ATDA 1VPOH 4XP5L 1YAZA 3BAEL 3BAWA 5DRZA 4QOKD 1XZ0A 4YNYB 1KJ2H 5KVDE 1KTJA 1QWUA 2QTVA 4S11A 1HZLA 2JQZA 5FCSH 1UXSA 1H0DB 1X9QA 3VNZA 3K6FA 3MUUA 4LBEA 5D71H 3O8XC 5IBUB 1ES0A 3KW8A 2YPKA 2WLIA 5GGQH 4F9LC 3LY6A 3PWUA 2Q76B 5IB5B 4IOSD 4LXFA 3R8BB 3D2UA 3RKDC 4C8XA 4FQHA 4OJCA 1NMBL 5GGSB 4LU5L 4W68A 3G6DH 3IFPA 2YOAA 5AZEH 4AZUA 2LU3A 1NEUA 1W6WA 1CGSL 3KYNA 4IYKA 1GS8A 2RB8A 4M1CD 1IC0A 1FN4B 2J5LB 2J4WL 3MBED 1IM9B 3FUJA 1CDYA 1NFDB 4FOMA 3DX4A 1MCPH 5KW9H 2BZCA 5IM7A 4EZKA 5MEOB 1UB5B 3BKCL 1AD9A 4I1RA 4JM2B 3IKCA 4AIEA 3SGJC 3G6JB 4P4KB 4XMLH 4YZWA 2BS8A 4ENZA 2J73A 4RNRB 1J05A 2MNUA 5FV2A 4XCEA 2UXVA 2ZD0A 3JTTB 1PU0A 5AZ2H 4NRZB 3DO3A 5DJAB 4A6YH 4NWUH 3ENEA 4UM9B 3VYOA 2XQYK 3TTSA 2EEXA 3TX4A 3TBYB 3GGWB 4XXCC 3RKDD 3T8VA 5GISL 3C5SA 1XWVA 5L4FA 1S78D 4NKIH 1U91B 1C08B 3CFCH 4CKVX 2LAGB 3DOHA 5LNDA 4LGPB 1RZ8B 5IKCA 4H44C 1FNHA 4JRFA 5F89B 3SO3B 2A5UA 3QI9B 4R4BB 1XTLA 1EJ6A 5C97A 2AQNA 1OCRB 4YPJA 4P23D 3G6JE 2MKWA 4HLZG 4E9QA 4S1SH 1R0AL 5JW4R 2COQA 4GSDL 2VL4A 5I17B 1BZ9A 5D55A 1FI8C 2E0PA 4XN8A 4URKA 5IHZB 3BH8A 2ISDA 1X9LA 4D0CA 3UACA 1BYOA 1M3IA 1MRFL 5FKPA 1ZY9A 1E65A 1OHQA 1D7DA 5JW5B 4LSUH 1TZHB 4HISA 5D7EA 1JJUA 3I6KB 3PUUA 5C0AE 4GRMA 2X4PB 3CHXA 4ZBJA 1I7RA 1CLZH 2PCFA 4GBXD 4A68A 1QLEB 2E7HA 4LOUD 4FJ6A 3PP3H 1F5WA 5GGVH 3L5WA 2Z4TA 2QADB 2X9YA 1U8MB 1HYSC 3NTCH 2R0LH 1RU9L 1QPKA 2X0UA 4HJ0D 1ESOA 4AY0A 5FGBA 1RI8A 4ANVA 5DSCB 4B53A 3VI3E 4PG9A 3KYKL 4GXUM 4APQB 3FUEA 3L7EA 4QXGL 5FYJL 4X4XA 2QPUA 4UOJA 3V0DA 1F90L 3PIQB 4Z7UF 1P6AB 4ORZC 3MLUH 4QOKE 2CUMA 1ZA3A 4HWZA 2DL2A 1MAMH 6FABL 2VNCA 3IJ9A 4GKNB 3SY6A 1PFOA 1LEGA 1WBYA 4TUJA 4XHJD 2ARWA 5C0IB 2E56A 5JXEA 4AC4A 4DZBA 4I3SL 4HZ1A 1SBSH 2A9BA 4ALAL 4KITB 2JI1A 4I3RL 5I66A 3BKJL 1OGAA 3EYUL 4LIQH 5GIRB 2QQNL 3BN9C 1YEJL 3Q6FB 4B7LA 3UBXA 1R3LB 3QUYB 1CZ8L 3KPSD 4KNUA 5LG1A 5BW7A 4BZ2L 2NR6D 5GGQL 3MBXL 4X6CA 3WUZA 2J6EA 1GYUA 3SJVD 3O4LB 1D5MA 1GYVA 3QO1B 1J8HB 5K9KA 3H3KA 4JDVB 4N9GA 1E40A 2FIRT 4G6MH 3AWFA 4X7SH 2D4DA 4Y9GA 2D73A 4ZMVA 5CR1A 4YL9A 4YHOH 1GH7A 4FLOA 3U30B 4FKKA 3TVMB 3C09C 3FSOA 4YDKL 4FTVA 2DKUA 1S3KH 1KCUH 1WO2A 4MCZA 9CGTA 4XAWH 5F97E 4Y2DD 2X1XR 3OR7A 4E9TA 1E4XI 3DIFB 3ARPA 3GMMB 4UMGA 2Z35A 1VA9A 2XA8L 3L2LA 2FO4A 5C09D 3AT8A 4LFHG 4NZDA 3MNWA 4HIIA 1AGEB 4PD4J 3LPWA 4TF4A 2YUVA 1K5NB 3M17A 3OSVA 4BZ2A 2DM7A 5IV2B 5JDSA 3CXHK 1NCNA 4M1CC 1ZPLA 3II2A 2XOTA 2XN9A 4N87A 5DEFB 2NY0B 4UV7L 1PCSA 2FSDA 3P73A 2JE8A 4OB5L 1WICA 1H15A 3CMOL 4XO4A 3V0VA 2W9EH 2CK0L 3QIUB 3ECBB 3BWSA 1Z3RA 5L0QC 2B2XH 3O3BB 1CDGA 2R1WA 1KGXA 1N2RB 5T1LA 4EIZC 1FLRL 4NCC2 3HC3H 1TZAA 3B4NA 1FL3A 3EGSB 4JPWH 4Q0XH 5GQBA 2Q87A 3P30H 4GJTB 4Y9BA 4N5ED 4HOMA 1ZD6A 4Y1AA 1DUYA 4RDQF 4FNSA 1I1AD 2EE9A 4U1MA 3LQZB 2X4OB 3HC2A 3FRPG 3J7HA 3IU3A 4R9HA 4CC4C 2UZXB 1XDTT 2H32B 3OKOA 5DJYA 1VKXB 3F7PC 4L9LB 4P9HH 4POZC 3QUMB 5G4NA 1OGSA 3WSQH 2ZJSL 3GXNA 4ZXBA 4AH2A 5J3HD 4G6AC 4LLVB 5EOCH 1SFDA 4HJUA 2Y3AA 1PDKB 1P1ZA 1XGPA 1H8SA 1BWWA 4KJQD 2JJTC 3EH1A 2ODHA 4AIOA 1OAYL 4HV8B 4X0KB 3HFFA 4OD1L 3JV6A 1WA0X 1X5ZA 2LABA 5CJXA 1WHOA 3GNMH 4F2ME 3VFUA 4G43B 4CGUB 1JXGA 1UM5L 2UWEF 3L1OL 1IZJA 1FHGA 1UA7A 4O2EB 3QI9A 1O5PA 1KB9J 3NAAL 1DBBH 3KYOA 4R2GB 4R4ND 3AG2B 3V5HB 4DPCX 1VKXA 2ZWKA 1RCYA 2PCPA 4ODSH 3KWWA 4R96B 3NGBB 5HI5D 5KSBA 2KYIA 4LRIC 4H8UA 1HDMA 3G5XB 4YHLH 4Q74A 3RVWD 1WCBA 1U93B 1O7DE 3DUHA 1DUYB 1G43A 3E2HC 2R27A 1FL6A 1ZS8B 3C8KB 5T1MA 5L7XH 4Y9CA 5HGAB 1ULVA 5DJAA 4Z7OE 3LXCA 3OZLA 5B1JA 2ETWA 3KDMB 4WV1A 1JPSH 1N2RA 5TE7H 3TZVB 1XGYL 2ZX5A 5KZCB 3U0PA 3SD2A 4F2MB 2ENSA 3E8UL 3ECBA 4YFDB 1HH9B 3MJ8A 3EJJX 1ID2A 1BJ8A 3M7OA 2MQGA 3LKRA 4ZFOA 4L8DA 2LTQB 4P2RB 5HI4C 3ROLA 2FVNA 3PL6C 1HEJC 1UA6L 4WI7A 2VR6A 1U2CA 2X1QA 5D72L 5CJQH 3QRLA 2VJ8A 3RWHA 4OZHB 1UB6B 2VLME 4A7QA 7PCYA 4FG6D 1CICD 3TA3D 3HZMA 4H88H 5SV3A 4H8WH 2APFA 1CBVH 1D9KB 2CXGA 1K4DA 4N2NA 1JD7A 4O00A 3WDIA 3RZCA 3V0HA 2OTPA 1A9EA 5CSGA 5ALBL 2J44A 1M9SA 2I27N 2O26U 4Z7VB 2Q8BH 4YHYC 3LHAA 1T4KB 4Z7OF 3D05A 3IVKA 4OFPA 4P3CL 4XZ4A 2JKXA 3V7AE 4DPRA 3TV8A 1DLFH 1E8XA 2IH9A 1RERA 2R7EB 4L4VA 2ZTBA 2FCBA 4YK4C 1XSOA 4NIKB 3MV9D 3D87B 3S3JA 1TVBB 3WV0A 4AUYA 1TETL 3NEEA 4G1MB 1LEKA 4ELKA 1PKQE 3VGHA 1FLRH 2BC4A 2D2CC 1CL7H 4BDVA 1IAKB 4HCIA 3OXRB 1JYXA 1PIFA 3GRGA 3I85A 1SJEA 3SE9L 1TMQA 3PGCB 4HIPA 4BZ1H 1YEKH 1BD2D 4YHZL 4YC2C 5KBPA 1KXQE 5EA0L 3SE4A 2YSSB 4JFZH 2UYLB 3ZKMD 4X7CC 2K4WA 1EVUA 1E7UA 1UJTA 1G5GA 3KPLA 3MLRH 2QVMA 2VOTA 4FG4A 4G6AD 3TIDA 1CDIA 4HC1A 2HPTA 1PS3A 2VDLH 1C1EL 4MD5A 2FIKB 1GGIH 1T1ZB 1OP5H 5FYKH 1A3RL 2F58L 4X4YA 1A6ZB 3HN5A 4JPIA 5DZLA 1DUZA 4JFWA 1KWGA 4N2CA 1CYXA 5BS0E 4EI6A 3Q5OA 4HU2A 4TSCH 2KDYA 5HYQA 3TT1H 2C34A 1Z9PA 3CDZA 1FGVL 4KI1A 5E6IB 3VFSB 1TCRB 2A83A 1GGIL 5B21A 1PSKH 1RHFA 4KRPC 1CQKA 3ZMRA 4PGEA 1T1YA 4LSVL 4WHTA 1I8LC 5AUMB 4E9RA 2XETA 1Z3GL 1RP8A 2MQ0A 1EHAA 2WO4A 3QG6B 3G5VB 4KDTA 4BSVA 5I1CL 1XD1A 4X5PA 2OI9B 5BRZD 1RUQL 3QQXA 5ESVA 1PTZA 2F0CA 2JXMA 3VH8G 2X09A 1YEDB 4XNQB 4OLXH 3QAZB 1XB3A 3M8OH 3MODH 2A7BA 1NA8A 3EYFB 3PHQB 5EUOB 2HLFC 5K9JH 1DQDL 2R2BB 1YNKH 1ADQH 5FHAH 4K9EC 5GSRB 3V7MA 1XIWC 1JPSL 2CHXA 4WWKB 3SDCC 1MUJB 4XOCA 2Z3FA 4OY9A 1DQJA 4AVHA 1ICTA 4Q7DA 4OLZL 3TOPA 4I3GA 5BRZA 1IQDB 3V4LA 1V7NL 1KIRA 1OPOA 5T1LD 3GSNL 4PJGE 2DB8A 4MMXA 1JN6A 2WOBA 3KYMB 4HG4J 4HF5H 1IC5H 2VH5H 2GB2A 4WW2C 1Z9OA 4F58H 2WBKA 5CMAB 4ZFFB 1QHQA 2WBJB 2X41A 3T0WA 3SE8H 1DQVA 4R26H 3VXRB 3WFDH 2YA1A 4G1EB 1P5VB 2D9CA 2GK2A 4QLWA 4XMWA 4DK3A 1Q8MA 3P3TA 3PHOB 2VAAB 1M6OA 1YYCA 4XVOA 4FX5A 3ALXA 2WHVA 3CZJA 2M2DA 1SJEB 2AC0A 1QPXA 4F7MA 4OQTL 4YXKL 1H6TA 1HK6A 3GBDA 1MZYA 3DC0A 3T0EC 1INEL 4K07A 5T8IA 3RDJA 1GW6A 4AWJC 1KTBA 2CRIA 3I74A 3DX6B 1LEKB 4G1MA 3U7WH 4ELKB 2WO2B 4TUOA 1MVUB 4ZX4A 2HPOA 4XPTH 3MDJA 3BN9D 4MVBD 2CALA 3MR9A 3DO7B 1EUTA 3KEDA 3B8YA 2WY3B 1NWPA 5IJCC 3ARXA 5GZND 4UQDA 1YVLA 3I9GL 3LS4L 4F2FA 3KLHD 1TLMA 3CIAA 2LU4A 4XNXH 1TO4A 1G7QA 4YHMH 3T4AA 5DLMH 4HJGA 2IH3A 4PJIF 4QRBA 1RK7A 1KJMB 1E9QA 2PYFA 4MQXC 2ED9A 2HTKD 4X8CA 2VKXA 3IXTB 2W07A 2WOYA 4Y5XA 2X4QB 1QVOA 3BQUC 4J3XA 3SQOH 3PHAA 4OF5A 3S3BB 2APSA 2Q6WB 5IVOA 1FDLL 1MREL 3V4PL 1TTUA 1ACYH 1BFVL 2DTSA 5IQNA 4BK5A 4OLYL 3ESUF 1DL7L 4G11A 2UZYB 2Q2LA 3T2NH 2Q20A 3JV0A 3LPOA 1N70A 3GI9H 5AKTA 2ATPB 1PZUB 1BECA 1KCRL 4J39A 1YJDC 1I31A 2H9GB 5ADPH 3MLZH 5D9SB 4XWOC 4L0ZA 4I2XE 3RVUC 1RUPL 2BSSB 3FSZA 4N1CA 5J6HB 4YR6A 2VDPH 3AFLA 3EUDA 1OPGH 4JPVH 4MQXD 1OP3K 3VTTA 4DZ8A 4Z8FH 4QXUL 3DK0A 2NX5A 1BGXL 2R0KL 4L4JA 4RGMB 2NY3C 2XACC 3DLQR 1OAZH 4U7SA 1IGCL 1BAGA 5FXCH 1W72H 5F9WB 2ZKWA 1M6OB 5L88L 3PJSA 1JXFA 3MRBB 4OBSA 5CD5D 2ZKXA 1D5IL 1RSYA 3UGEA 2QGDA 2NXYB 3QEQA 3TYGH 1ZS2A 2CO2A 3WKML 4QRRE 3EGDB 1ETJA 4G1EA 4GLRI 1R47A 2HT4C 1IEBB 1SEBB 4KX8A 3VYNA 3VXRA 3L4VA 4LARH 1BM3H 4XPAL 1EEYA 3TEUA 2ZE0A 1E2WA 4X0KA 2WLNA 4KMTL 1W0WA 2PO6A 3T3MB 1K8IB 4MQSB 1FSKB 4W9FC 2W81C 5C0ND 1NAKL 5C09E 5DUMH 2MNWA 4A38A 3EDEA 5BRZB 4G6FD 4HEMA 3LCYA 1AE6H 4WU7B 3QEHB 1DHKA 1ZHLA 2AAAA 4D9LH 2KPWA 3CH1A 3SKJL 3HHMA 1REIA 1S9XB 4Q2ZA 7PAZA 1FH2A 4NC0B 3S5ZA 3PRZA 3GC3A 5DT1H 1F4WL 4XOBA 2QJDA 3ORJA 4MD4A 3FN9A 4N2HA 4TLTA 3MRRA 2YWYA