2JKLA

Drae adhesin in complex with bromamphenicol
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
139
structure length
139
Chain Sequence
b'GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A Structural Study of the Interaction between the Dr Haemagglutinin Drae and Derivatives of Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 27
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jklA00
1UT2A 1UT1A 2W5PA 2IXQB 2VERA 2JKNA 1USZA 1RXLA 2JKJA 2BCMA 1USQA 2JKLA
chains in the Genus database with same CATH superfamily
3X3FH 1NGWA 1RVFL 2CH8A 4KDTC 5AD0A 4PN6A 4FRWA 4QDGA 2QFPA 3ATFA 3S5LB 2DQIL 4ABUA 1XF2A 1JGLL 4R84A 4PLKC 3V6BR 4D9QE 2F58H 2KL6A 4D0CA 1QRNA 2YFOA 3MLTB 5FGBA 2W9EL 2CO2A 4PRAB 3D25B 3CLWA 3MODH 4ICXA 4AC2A 5I30L 4YWGL 1MI5E 3HB3B 4YE4L 4QIRA 3FCUB 2GTWB 1MZYA 4PVLA 4WDIA 3GZKA 1MWAH 4LKCA 5E95B 2ARJB 2BHUA 2VRKA 4KH2A 1SGKA 4TSBH 4AQEB 1R5VB 4IJ3B 4R0LB 4MYWB 3RQ3A 4YJZL 3FQTB 1GGBL 2MRYA 3K4ZA 1FZOA 3GSWA 5EF0A 5DJAB 2K9FB 2XYBA 1KV3A 4JQXC 4FCHA 1DL7H 5E6ID 4BQ8A 3VXME 1WTGT 1UXWA 3C6LA 3REVA 3D2UB 3L3JB 1L0QA 4F9LA 1SDAB 1F45A 3TWCH 3GSUB 4XHJC 3L5JA 5E23A 2OJEB 4OGQC 5CEZL 3DHPA 4AYBA 4GUQA 4DCQA 2NXZD 4F24A 5EU3A 4CUCA 4F7EA 2NYZA 3UYPB 4FEMA 4ZAKA 3QDMA 4IRJD 5EUKB 3O6KL 3UJTL 5T3ZD 1JWUA 5L88L 4FFYA 3ZZQA 4XNZC 1EJFA 4GKNA 3E8VA 5I5MA 4XCFL 1U3YA 4GQ9H 2A77H 4ANXA 1M7DA 4YO0A 4IMLA 3WEXA 5ALBL 4WU5B 2WQ8A 1LO2H 3QPQD 4RETB 5BVPL 4U6VH 4NKMA 2XA8L 1B2WL 3P0YH 4CKVX 3HS0B 3EYFA 5I8CB 4TUJA 4GG6F 1M4KA 1OXYA 3Q2NA 4P2QD 1A4CA 3QDHA 2F5AH 3JZ7A 1Q9OB 1WJ3A 3FTWA 4KJYA 3UTSA 3TO4C 4RDBA 5D7JD 2EZ0C 5C0EB 5T3ZE 1XGQA 4LQFH 3MGAA 5EG6C 3DYOA 4Y19B 3RGBA 2BS8A 3T0VA 3CXHK 4PJ5A 4HCRA 4JFDA 3WI9A 1KLUA 5E8EA 1PEWA 5CZKA 4P99A 5AYUH 3WE6B 1EO5A 4GYBA 1YAIA 4AH2A 3WG7B 4EZMA 3AMLA 4XWGL 5HGGS 2FGZA 5T33L 3GNMH 3QQDA 5I19H 4XN8A 1QOKA 2K45A 3ET9F 2QPUA 2VXTL 4PJ8A 4FQ1L 4U3HA 1VPOL 3MNWB 1A3RL 4N2MA 4BRJA 12E8H 1OQXA 3T6QC 3ZDXE 2ZSWA 2UX6A 3DK0A 5DYOB 2FR4A 2B3RA 4MS8C 5C0GA 4MDIA 3HA0A 3BUYA 3MACL 2R1YB 2IOIA 3P0VL 1JGLH 3ZSSA 3A6CL 3RGVA 1O75A 1I9IL 1KXQA 3BH8B 3PHSA 2W9EH 1A9EA 1DBBH 2YUVA 3OTTA 4HK3N 3N42B 3TBTA 4W9JC 2LLNA 2VJ8A 3AQYA 1C8QA 5EORH 4OZFB 4YWGH 4YXHH 4R4FH 5ID0B 1IC4H 3NH7L 1HXKA 1X5KA 5AW2B 3OXSA 4K94L 5F0LB 2IPUK 1JFQH 2Z8VC 3LH2L 1A6TB 2IDSA 5FYLH 4LKXB 1NPNA 2A1WL 1CLYL 1SYSA 2JELL 5EOQL 1J8HA 2C9UA 1X7QA 3WJJA 4CILA 3WXWH 2G2RA 3HAEH 2F7IA 4KFZC 2VR7A 4AMKL 4EIBA 2YA0A 1LM8V 4UOW0 2ZAGA 3V6ZA 4OF0A 3S8GB 1OAZL 3N50A 4YAQA 2XPZA 4UIMB 2XBTA 4PLKD 1G9HA 1QSEA 4UU9A 5GGSB 2H7WA 4HUKB 4JHWH 4PSPA 5FDWB 2YLKA 1AQDA 1TPXB 1XBDA 4DZBA 2KPWA 2MCAA 1NGPL 3V6OC 2HMIC 4OQTA 4ZMVA 2OMXB 3CHPA 5C0FB 2XNAB 1KYFA 2B2XL 4JRYB 5LG1A 3D18B 5EHFA 3UGXA 3IMUA 1RZIB 3QIWD 2BP0B 3K80A 2CRZA 5ALBH 5LAPA 4ZXBA 3HG1D 3QFJD 4JO2L 2ZUTA 1QFPA 2CLZA 1EZSA 2E6JA 1SUHA 2YN3A 3IRPX 4JKPL 4ODSL 3WSQL 1NBVH 4QAMB 1S5IL 3KM1A 3L9RA 1I8UA 5EZOH 3B7YA 2I24N 2C9XA 2WYHA 2XTJC 3L5XL 4LAQL 5DZPA 3IXAA 2RGSA 4XHJD 4W9LC 2FX8L 4FMFA 4PRDB 1XDTT 2WYTA 2J88L 1S7WA 4RMBA 3WL9A 5JOPD 5JZ7D 1PFOA 3L4VA 2CBTA 3TZVB 4B97A 3KXFB 4L0YA 2WZPD 2P5WA 4X7TB 5BQ7B 1WEJL 3E0GA 1IAOB 3RWGB 5KSVB 5CEYA 4YC2C 3CVHH 1P5UB 4XT1C 5JHLH 2AJVH 4NRZB 5FEBA 4CC4A 5JIQA 3EG9B 4CN1A 3QT2A 3RVVC 4OZIE 3KWUA 5DS2A 4AQOA 4F57L 2HN7A 3IFLH 3FH8A 2Q76B 1HHKA 2PO6B 1KOAA 3HG1E 2KS0A 3C5ZC 3QFJE 4NGHL 2XZZA 1X5LA 2ZKYA 3TC9A 4PRNA 4Z7NB 2AQ1A 3QORC 3T8MA 1IFRA 2OYLA 4G9DA 2EDTA 3FH5A 5A7BA 2IBZX 1RJYA 1RURL 1RIUH 4JQVC 1N5YH 3JXAA 2FEEI 1OAUL 3OVUB 4WTQA 4M93C 4M5ZL 4C59B 5BW7A 3RWHB 2YLHA 3SDCC 3W5NA 4M1DH 4G42A 1KN2H 1L9OA 3GLDA 3H8NA 3N0AA 2JJTC 3ZQXA 3T71A 4CDHA 3I85A 3DX7A 4YBHA 3TO4D 1I9RH 4H8PA 5E2TH 2ZCLH 3FO0H 1BQHG 1N26A 2N7BA 1TZIB 1XGPA 4C54A 2NY1C 4CMMA 1AC0A 4ZMLA 2VLRD 2YBRA 1YEEL 4NKOB 4ZOAA 3UCRA 3ARFD 1FJ1A 2FEDC 4AQEA 4POYA 1KBWA 1RZPA 3BWUF 4LU5H 4JREB 4PR5A 4TRPH 3M8OL 1UWGH 2OQJB 3LIZL 2HFFB 4G6KH 5E8PB 3H2WA 1CFTB 5EOQH 5FA4B 4EI6B 3P2DA 5IMKA 4G6JH 3GI9L 4APQC 1O0VA 5ES4B 1NIDA 4LSDA 4D94A 3KDMB 4FFWD 3U6RB 1JN6A 4MQXD 4MS8D 5HTSA 1YDPB 4F33B 4M43L 5DI8B 1DO6A 1S9WB 3QFDA 2ICEA 4Y5YC 1JNLH 4OGAD 3N0PB 2GJ6E 3PU7A 2UZXA 4ANUA 4HCIA 4X6FB 5LWYL 2VLRE 5D71L 3CFBA 2ZYSA 1RI8A 1UB6A 1H15B 1MELA 5K9KB 1TYJA 2CBQA 3FCSB 3MAWA 3QNZA 3HC0B 5DS8A 4JJOA 5HGBA 4L4VE 3WFCL 4I18B 1FRGH 3CIQA 3JWDH 4CVZB 1CFNA 2D0FA 3L4ZA 1PDKB 1NCCL 2NXYC 1ETZA 2YD3A 4FFVC 5KJ4A 4LASH 2UWEB 3DXAD 2NPLX 4B60A 2OK0L 1YJDH 4IW4C 5I6XC 2GC7C 4PS8A 1UOKA 2UYLB 2YUXA 4DGWC 4P9HL 1XVSA 2VAAA 3EO0A 4HMDA 3WCYA 3TBSA 1Q9OA 3SDXA 3JV6B 3KPLB 4KI5E 4G11A 2L0DA 4HKJB 4FFYH 5T1LB 4RMTA 1RUAH 1MRDH 4AIOA 3A47A 5C0CD 5EBWB 1CLCA 3FCTB 1UM5L 1DBAL 3NQIA 3NSXA 3DJZA 4GOSA 1KN4L 3ZDZF 1P1ZB 5KBDA 4UQBA 4ZTPL 1AZNA 4BINA 3SKNB 1TQBB 3E1F1 5K39A 1P5VB 2FD6L 3ZU8A 1XCTA 2Z93A 2R0KH 5CBAB 5AG9A 2EYRB 2AKRB 3ETBF 4WEBL 2CKNA 2OW7A 3ZGIA 4K0OA 4K7PL 5JDJA 1L7TL 5JW4N 5IG7A 4D0DA 1YNLH 4A68A 3WBDA 5CCGE 2VDQB 2R1YA 3KPPB 3O11A 2NYYC 4YHPA 3FOLB 3L3HB 3GDCA 1UURA 1A5FL 5EU4B 4WHYG 1MFEL 2VLKB 4K9EH 2J1XA 4U7SA 3KLAA 1RZKH 4HCRH 2X4NB 3BWUC 1WK0A 4TN9A 3IDXL 2I5YL 4JN2A 3WKPA 1FE8L 2ICWI 3BP6A 1YEEH 2D7PA 1U6AL 3RVVD 3CZKA 5HP5A 4Z7WA 5E00A 4X2UA 3S96B 3TF4A 1KJMA 1Y18A 4GIAA 2I9TB 3U9PH 5IKCA 3FTGA 4XPTL 5FCSH 1DJIA 1F6LL 3AY4A 4FQXA 3KW8A 3TT3L 4B9KC 1NCAL 5DUMH 3QORD 3CU7A 1MHEA 2R59A 3IU3B 2BNQA 1XF4B 2EEAA 3GI9H 3E6FA 4HT1L 3T0WA 2X70A 3L16A 3RP1A 3MO1B 3Q6GL 2APVA 2V8LA 4XOAA 1HDMA 3VXQB 3CDGA 3EGXB 4BIKA 4XN1A 1H6TA 3L3OA 2AVGA 2HWZL 3SOBL 3H3KA 5I1GL 4NUJB 3VD7A 3DURA 1I7TA 4HULB 2OFQA 1L0XA 5BO1L 1A8JH 1GR7A 3QUGA 2EIBA 5ERWB 4ZQTA 4Y2OB 4XP9L 3A0OA 2GSIA 1LO3L 3DO4A 1F8TH 1TYRA 1G6VK 2HJKB 4YX2L 2XETA 4L3ED 4P9MH 3QYNA 1W80A 4M6MH 3QDGD 5F7DA 2B5IC 2E9IA 3DARA 5TGBA 1MVYA 4PAZA 1JZ7A 3GLZA 1CR9L 3DNKA 3DOSB 3DYPA 1N6QL 3GHEH 2XFXA 1E4HA 1KUMA 3L3GA 1T7XA 3FT2B 3VXRD 2R23B 2C8NA 5IMLA 3U46A 2BNRB 1CT8B 1NZRA 1GL4B 4HIXL 3QUXB 1JZJA 4U6XA 2X1XR 3GPEA 2IH9A 4LRIA 1IAOA 3MJ9A 1MFDH 1M3JA 2E7DA 4JLRB 2HRHA 4LBEB 1FIGL 4P2OA 4KDWA 1JPGB 4I85A 4OQTH 4WJG3 5HJ3B 1UD4A 3LZQA 4NRZA 2R2CA 2XY2A 2AANA 3PWUB 3GB7B 2GSGB 4QRQA 1DBAH 1AI1L 3TYGH 2CO7A 2PO6A 4TVPD 3X12B 3FB6A 4KJWD 3V52H 2CDEB 1UQSB 2NY3B 5GZNC 3QXAA 2QSCH 5K9OA 1DQTA 3FTVA 4B96A 3PAZA 2AV1B 3E8UH 2YXMA 4MGXA 5F7EH 4IDLA 3WXVH 2VUYA 5AB9A 5FW7A 1KIPA 1OSEA 2Q1EA 2YD2A 4WNSA 3DPBA 4ZFZB 5HDOA 1L9QA 4JVPA 1LD9B 5DFWH 4GAAA 1AP2A 1UJ3A 3ERXA 1Z9OA 1M71B 3QXWA 5AL0A 5KAQF 4H26B 3K8KA 3FFCB 5C07E 1UD2A 2AK1L 3QNFA 5IUCA 2ZWLT 4JPWH 2I85A 4AOFA 5F0PB 1T83A 5LDUA 5AVYB 5PAZA 2KYIA 1J1OH 1KTDA 4I0KA 2X4PA 1Q94B 32C2B 3BO8A 5IV2B 1CFTA 3WNMA 2OSLB 4EI6A 2BVEA 1B88A 4ZUTB 1MW0A 5AFAA 4F7PA 1BIIA 1NCAH 2ZOWA 4HAGA 3GMLB 3HMWL 4AMXA 4BA0A 5IY5B 3APFA 1ZLUK 1UWXK 4H2CA 4WWKB 1SEBB 2R1WA 5C6WH 1W9XA 2ATAA 2ZOKB 4XI5C 3B7TA 4Q58C 5F3FA 4C56A 3DETC 2NYKA 1Q90A 4TOYH 1MUJB 5JQ6L 3CPLB 3EW3B 4X6FA 3SCMA 3I2CH 2Y23A 1K8DA 2PTVA 1N59B 4IRSC 3R1GL 5AKSA 3VFNB 1E8XA 4MLSA 4D3CL 3X14A 5I6OA 4JZJA 4IRZL 4HWZA 5L2JA 1H3TA 3QJOA 4AKQA 1CUOA 4DW2H 3SE8L 3ZT5A 3KAAA 1LDPH 1MVFA 4QYOA 4JDTL 1BDYA 3O3DB 1FDLH 1KXHA 1PDKA 3CN2A 5CJBA 2QHRL 1OF2A 4DP6X 1EDQA 4FC3E 4PJXB 3ZKQD 2BOCA 4PG2A 3IGFA 2OP4H 3MLVH 2RH0A 1ZANL 5FWQA 1A7QL 4RBPK 2DI7A 2FT6A 4U1SB 4HS6A 3QZNA 4JE4B 2EDYA 1X4ZA 3UTQB 2A9NH 1PZ2A 3D69A 3ALPA 5EBWA 3OLIA 5CD3B 3ARBB 3O41A 3FCTA 5D1QC 1EXUA 1UM6H 4ZQKB 5EUOF 1WVZA 3VTMA 1J0HA 3QC5X 3NYKA 4XBGB 5EO9B 1C5DA 3ZDYE 2C3VA 3IGAB 3KPSB 2QVIA 5TDNA 3S4SG 2YD5A 1R9FA 1P5VA 2WKLA 3IDGB 5E51A 2XN9D 4GXUM 4MCZA 1S5HA 5IREA 4P49A 4X0NA 4Q9QH 3O6FC 3RWJB 4AVKA 1GYAA 3HHMA 2A6KB 3RBSA 3N04A 4Z23A 2DW5A 4MQSB 4JO3H 2AGJL 3MOAH 4UILL 1D6EB 4KROD 2B4CH 4NO0D 5CU5A 1PKQE 3WMSA 3FUNA 4U3SB 4B0MM 4TF4A 5LQBL 4PG9A 1NSNH 3MV9D 1SJEB 2FJHA 3FOLA 3L2LA 5DZ9A 4O02A 4A7GF 4OKVA 5B38G 1NBZB 1T21A 1XR9B 4XP6L 2AZUA 2XRAH 4LOUD 4AGOA 5DRNA 3NK3A 3PAYA 2YD9A 4A7UA 4RA0C 5D1XB 1OV8A 3K74B 5EOCL 3S36H 4B3EA 4Z78B 1FNSH 2Z6FA 1A7PL 5FYKU 2VKXA 2XN9E 3WKYA 4YHOL 5BMFH 2ATPB 2FK9A 4UMSA 3BVXA 4MKTA 5DEJA 3FTXA 2FRGP 5T5NF 4OW6A 5GZND 2HRLA 3VDAA 3CSPA 4D7PA 2HJFB 4IBQA 4IBTA 4Q7DA 5KTEH 3QJRB 2GTZA 4RGOL 1T5XB 1U8OB 4HYTB 4YDIL 3D3VE 4OBSA 3MV9E 3OR6B 1R6VA 3FO2B 5B3JF 2V5SA 3B8YA 3TONA 3HUJB 4DERA 2FJSA 2HG0A 2J8UF 3MREA 3U2JA 3II2A 5T5FA 4OI7A 3F58H 1RHHB 5C0ND 2IPUG 3F7KA 1I1AA 1G7MA 1SNRA 3B83A 1KELH 3OQRA 1WGOA 3JWNE 4KK8D 3ETBJ 2ZSVA 4PJHF 4RCAA 4Y2OA 1ZK5A 4OZ4B 2Y25A 2QELA 4LBAA 5E56A 2E75C 2WY3B 5DJ0A 2LTQB 1RZJH 4MLIA 1KT2A 4XO8A 3VGAC 1HILB 3QUYB 3VI4F 5D72L 5DDHB 2GJZB 2DLIA 4AMWA 4PJAB 2NNFA 4TLKA 1H0DB 5KYWB 1VGEL 3HG2A 2FIKB 2UVEA 2H0JA 1JERA 3VI3F 1U8QB 2DYPA 1TYEB 2HYMA 3HCVB 4YR6A 1FPTL 2H6PA 2FBJL 1KFGA 4QY8A 4R2GB 5D7LB 2B14A 4HOMA 3L3DA 4OCYL 1NWOA 2BY0A 3AWGA 4WGWB 1Q1JL 5LVEA 2E4FA 3FT9A 2X3CA 5EZIL 1FVEB 1NMCC 5HJ3A 3ARGA 3P11L 3IDJA 1HEZA 4IRSD 2WOYA 1RSFA 4N85A 1WZ1H 4PJGE 1U3HD 1MCFA 5FDYA 3MRQB 2GSGA 1NEZG 4Q6IC 2ZG3A 3FONA 1AQHA 4JM4H 1HIMH 5I28A 4OZHF 2BZ7A 2IMNA 5HHOD 4JG1L 3MU3A 3NOIA 2CDEA 1CDGA 2UUDH 2X9XA 5CJOH 1QFOA 4N5UA 2ZONA 1I7RA 3RY5A 1PD0A 4XC1L 1ZY9A 4P57A 4DEPC 4G80A 3RJOA 1RJLA 3RL1A 1ZLWH 4CBZA 3QXDB 3DUHA 1GGCL 1MNUH 1N8ZA 5JIKA 4RFEB 1GZHC 4BJLA 2K4WA 1DANU 3MJ9H 5KYUA 3GI8L 3SGJC 1GW0A 1DUYA 3INUH 3FFCA 2J71A 4XCNB 1WFTA 1AFVL 4EKJA 4WEEA 5D1QD 4PRIE 1B0RA 5D70H 3QEUA 1B4RA 1M2VB 4NKIL 3EJZC 4RZCA 5HHOE 2XN1A 5AZ2H 3VXPB 3WD5H 4BK4A 1J5IA 2VQUA 4AZUA 4W1TA 3R0MA 3EFDH 4HIIB 5D9SA 4J3UA 1MOEA 1U8NA 2OPCA 4ATTA 3B56A 3PS6A 3QDJB 3UMNA 4OLUH 1M7XA 1W72A 1XHHA 2NY5C 3B1UA 3LKOB 2VDQL 4ODXA 1NDTA 2BZDA 2J3SA 2E59A 4WWKA 3CVDA 3U7WH 3VDCA 2DB8A 3BUTA 3LEYL 2WVVA 3T3PB 3T0DA 3VFVB 4P3DB 2MEJB 2R56H 4RX4D 5BJTA 1BQLL 2P5EE 2X2UA 2Y69B 2V33A 5TF0A 4LLVA 3S3DB 1QBLL 1XF3A 1R5IA 5CN3A 3ALWA 2IH1B 2OMYB 4FABL 2WXIA 3WS6C 1SDDB 4WUUD 2VGLM 1CB4A 3D39B 4DUVA 3FU6A 4LP5A 4PEEA 2B08A 3VNZA 3CCHB 3FSOA 1I1YB 3H55A 3PABB 4QHMA 2E6PA 1E0OB 1HHHB 4JFSA 1FZJA 3AXLB 1KPUB 2F7QA 4AJYV 4PJXA 2B3IA 5DFVC 2V2XB 2HRGA 4FJZA 5IMOB 4PB0L 2IV9A 4GW4B 5IHLB 4GS7B 1KCVH 3S37H 1T7WA 1W15A 3R4RA 4E41E 1JMXA 1NH6A 7CGTA 3V7AG 3GRWA 5CJ8A 4L1SA 4M5YH 5FYJE 5DMKB 3EJJX 4GSRA 1YY8A 1SXZA 5DQ9B 4KPHH 3T08A 1GS8A 1MRCL 4BSWB 5GGVH 4GRMB 1ZIAA 4HP5A 3CDCA 4JM2B 1AHWC 1TQWA 4FQCL 2MQ0A 5SWSB 5BZXA 4LCCC 3EH5B 4G7SB 4HPYH 5K93A 4PCTA 3QG7H 4L8DA 1K4DA 4WWOA 3D50A 4K15A 3UP6A 4PGDB 4YL9A 3BH9A 2ARWA 3VXTB 2Z8SA 3IGAA 5GGQL 4AL8H 5DD5H 1KJVB 1R1CA 4YHLH 4G8IB 4JFFD 1K3IA 1U8CA 4LVNC 3KJ4B 4NOFA 4P23A 4JPIA 1RUQL 4PWJA 4PRBA 5CGYC 1G7JB 3ZTNH 4ELMA 1ZT4A 3PY9A 4EVNB 1J5OH 2P8PA 4OSUL 5DT1L 5KSUB 5JHDE 2WGNB 5JPNC 3U1SL 2WB1A 3EIFA 1SBSH 4HPHA 3OR7B 1ZS8B 3QEGL 4NM8L 5AW5B 3Q05A 2A74C 5KVGH 2OTUA 1UH2A 5B39A 1HI6B 4GG8B 4NQCE 4H2AA 2VO5A 1E4WH 1XR9A 4A7QA 4ONGL 1EJOL 4QRSB 1NPJA 3BAIA 4LFHG 1K72A 1L0PA 2HKFH 3TT1L 1CICD 3ZLQC 2XI9A 3H85A 4HK3J 2QVKA 3A4FA 4F93B 3L4UA 1OGAB 4JKWA 3MXWL 5E8NA 3PGDA 1PNDA 4HJJL 1OKEA 1GZPA 3CLFL 3EDKA 3PHOA 2ATPA 3R8BB 4PBDA 4HU8A 4Q56A 3BDYL 4HEPA 2WQVA 3IB4A 2OMBA 3ZE1E 4OV5A 3T6VA 3FDWA 1BM3H 2XZCH 4OLXL 4AWJC 3DX2A 1RZGB 2BPBA 3RFZB 1NBQA 4G7VH 5TK4A 1T5XA 3IBOA 3QFGA 1Q0YL 4I77L 4O2FA 3FO9B 5DC4B 1AO7E 5DD6A 1J86A 4O02H 3LZLA 4LSQL 4NRYA 4U1GC 4L8CB 3RNKB 3HUJA 4CADA 3TNMA 1RHHA 3H9SB 3GSQB 4HV8A 1YA5A 2AP2A 1C7TA 4DGYH 1QBBA 1UKTA 1DDHA 3BRGC 3DX8A 1WFNA 2JI1A 1EO8L 3W56A 2GW5A 3EJZD 1RJCA 4FP8H 5J6GA 3QUYA 2VMEA 1JGIA 3EFFB 2XQYA 4P5TC 5CJ5A 1HNYA 2IO5A 2VDLH 4FQLL 4QCIB 1M05B 2CUAA 2DWEB 2OW6A 3N91A 1UEMA 3GS0A 4IIQC 2DTSA 3FQUA 2W60B 2NMSA 1A3ZA 5JXAL 2BHZA 4ZFFB 3VSVA 5E1HB 3QWOB 3SGEH 1LEIA 3CFEB 4NQUA 2QPDB 3A23A 3UGUA 1KBGH 2KZKA 1KEGL 5T5FH 1JD7A 4HA1A 4GP4B 3NVQA 3BD3A 4HUMB 3BSZL 1E40A 1FVEA 2YBGA 3GMNB 4DPRA 4P4KD 2IBBA 2RQ8A 1R46A 3LN4A 4WO4D 4ABQA 4ANVA 5ALCH 3U4EA 1FSKC 2YJLA 2AQPA 4QI3A 1TQCC 1OW0C 1MRFL 1ADQA 2BRRH 2BXYA 2WK2A 4GO6B 1KC5L 2DPKA 1IKFL 3BPCB 2PR4L 4GW1A 1U8IA 3NIDE 2OULB 5F7AA 1S9XA 3VQ2C 1YN6A 3S88L 1Z0MA 3C87A 1MFBL 2CM6A 4MXWH 2N4IA 4UDTA 3ABKB 4H8HA 5GISH 3OMIB 1S7XA 1WT5C 1JK9B 2H45A 1MVUA 2YAOA 2ARJQ 3L3KB 4UT6A 5L8KB 1WC7B 4DQOH 5AOKA 4I87A 5I73C 3FT0A 1XT5A 2WLLB 3KWVA 5F70A 3OAYK 2X0UA 1ZA6A 4WO0A 4F9PA 4GSXA 4J4PA 5FUOL 1BZ9B 4N8VA 4RAVB 4BKLA 5IOKA 4TNFA 1VAHA 4YN3A 1HJBC 1E28A 2AEOA 3MRNB 3V9EA 3Q01A 3RNQA 3MJWA 4IU2A 5FYJL 1FIEA 2ZUXA 1M2VA 4MNQB 3FSZA 1FG9C 4PRHB 2W65B 3SE4A 1QHQA 1P6AB 4MZ2A 3RTQC 3VXPA 4TSCL 2YAMA 1GSKA 3EOYG 4HXBL 4J3WA 3UG4A 4Z1PA 2WKOA 5CGYD 5F88A 3ZHLA 4ZMPA 1F86A 3WUWG 1F90L 2H9GA 1OB1B 3B2PA 2Z92A 1W0WA 4N0FB 4I13B 3W9EB 4Z76B 4WTXA 2QGBA 2Y7LA 3ES6B 1UEYA 5CJXC 4DAGL 5EU7C 2BSEA 1AD9A 5F89B 1BFOB 1ACYH 1EFXD 1AIFA 2OM5A 4PVBA 1V5JA 2IH1A 2XJKA 4NENB 1XF5A 2XQBH 2DJMA 4OCLC 1BEYH 1H8NA 2WN2A 4GUPA 3B3BA 3TA3C 4DUWA 5TE7L 2DTML 1VF5C 3BUPA 3GZQA 2EVFA 1CURA 4JRXB 4GT0A 2VZ3A 5EH1A 5EFIB 2Z8RA 3VFSB 1HHHA 5ESVB 3MLPA 1W72H 1OGSA 4NWUL 2XV0A 5E5MB 4OLVH 2XXGA 4S1RL 4LDCA 1JV2A 1PQZA 4UWQB 1HWWA 3QCTH 2IGLA 5IQOA 4P8QA 4I2XA 3AREC 3ASOB 5SWZE 1GC1C 1KEML 2DKSA 1AZRA 3OZ9H 4WHCA 1BGXL 1ZSHA 4KVNH 1GHFH 3DOIA 4XZUA 4W4OC 5SWSA 4YVNA 1IGMH 1YHPA 3QCVL 4JPQA 2CG9X 4PV8B 2SEBA 3JWOC 4BK5C 1XGUB 3M88A 4JANB 3RWIA 2PPDA 3MUJA 3GSXB 4K8RL 3VG0L 3VFTB 4UYQA 5EPMA 4G7QB 2BRQA 1T3FA 2CPCA 5C09E 4XMLL 5E6IB 3AAZB 3BLPX 3O3EA 2PYEE 1UD3A 2ZKWA 4P5TD 3ARYA 3U79A 1RUMH 3LD8B 1XGRB 2ZOLA 3H4FA 1MCKA 2R15A 3QIBA 4FYTA 5BUPA 1P6FA 4RGNC 3TGXA 2DQUH 3T2LA 1FO0B 3GRWH 3OR7A 1HH6A 2NXZB 4XZ4A 5MERB 4OJFH 1BJMA 2ZUQC 4IRJB 4MJ6B 3FPXA 3N6YA 4UUJB 2EH8L 3MRRA 1OM3H 3SPVA 5GIRA 4AZ8A 4GXUN 1WGVA 2GG1A 2XJLA 4V1DA 1QUNB 5E2WH 4ZO6A 1ZXQA 1AOHA 1NFIA 4Z7AA 1LO4L 2DQDH 5LHDA 4R5TA 3D51A 2G3XA 1BSIA 3US9A 3JTSA 2ESVA 2DLTA 4AG4L 3W38A 1MAMH 3QHZH 3LZRA 3QUZA 2FO4B 4HLJA 4PTUA 2WUCH 2J43A 4LF3B 4X6DA 3VWJC 4ANWA 4Z7UF 4X5WB 5FHAH 1LEKA 3OG4B 4R8WL 4GQRA 5BOJA 1M2OA 3BHBB 3FSVA 4WAFA 5I9QB 4XNUH 4P2QB 2V2WA 5B1BB 1F90H 1T04B 2MQGA 3RAJH 1YYLH 3SGEI 4BELD 1IZKA 4PYHA 3ABZA 1R34A 1N18A 5EZPA 4X7EC 1WBXA 2YPKA 1NGZB 5D7JB 4OF5A 5HHVH 4H8WL 3I3EA 3V7AE 4OFPA 4OCXH 1CIUA 2B1HL 4YXKH 2EEDA 4EN3D 4LSSL 2NR6A 4JRFA 2ZTBA 4U0QB 4BDVB 2ADIA 1PPIA 4LNVA 3RVUD 4GKSB 4MA7H 5BO0D 2VDOH 2ZT9C 3W2DL 1P7QD 4NAMA 4LFHD 4JCMA 4HPOL 3D12B 1SXAA 5I16B 5AW1B 3RFRA 2AAVA 4ZODA 3BP5B 1YEIL 1E7UA 3PWVB 2DL9A 2WBJB 4IS6B 1XCQA 3D06A 1XTLA 3MUHL 4UZGA 4JW3A 1WBYB 3OKDB 4OV6F 3T0EE 4ZDHA 4TTDC 5J3HC 3TNNB 4AT6B 4QR7A 3UTOA 3GMRB 4K3JL 3GRGA 4JUSA 3DYMA 2FZ3B 1E27B 4V11A 5DD0H 3BAJA 4XMUA 2X3BA 3HW7A 3GMNA 2A6JB 3SDDA 3AJ7A 1YMHA 1WO2A 3CAFA 4K7PX 1DVFD 2H8PB 4XGZB 1AZVA 1FL6B 3PHQA 3TA3D 2FO1A 1RSYA 3PXHA 1VJSA 2QSTA 1B4LA 2WV3A 2Z1PA 2J56A 1OCZB 5DVMA 3VTTA 1JNJA 3LZFH 3D6GA 4G9FD 3SEPA 1YEKL 5TPWH 1NL0L 1QEWB 1T0NB 2RJMA 2WQSA 4EOWL 3EJRA 5L0QB 4OUUB 3L3KA 3T2PA 4QF1B 5CCJA 2PXYA 5L8LB 2EXYD 2WSPA 1XCWA 3BN9C 3ARED 3PLYA 1M9WA 1FUNA 5BS0E 4IGBD 3BPLC 4KKAD 3JTTB 2D03H 3V79C 4JX0A 2EC8A 3KJ6L 3D0AA 2C34A 2WXGA 5DWUH 1Q4NX 4HVBA 3TN0C 1PY9A 1KYDA 3EADA 1JJUA 4WW1B 3IKCB 2I07B 3QJFB 1J0YA 3G6AB 2EDHA 2DQCL 1ADQH 3UCQA 2JI3A 4Y4HD 1OE1A 3QIWB 5IESL 1AGDB 1CI3M 3N1QC 1F5WA 3EBHA 1GKEA 2GPZA 4WQOA 3RUGF 2Y5TA 1V7NH 2EXWD 3UO1L 1ZLSH 4LSRH 4N24A 2MQCA 3QUMB 2IGFL 2HVJA 1LWRA 4POZC 4UCFA 3L5HA 4UT6H 2D31B 3ZRFC 1QHOA 1JWSB 1CDJA 1P84K 3STLA 2FECL 4RGND 4KXCA 1IZJA 1FN4A 2DQGH 1WPCA 4OIFA 3WTVA 4JFQA 5CP3A 3IJYA 3VU1A 2A4CA 5A7EA 4HKXB 4BGLA 5F89A 1TKWB 5EDXA 4DN4L 3D85A 4HWEH 1MI5A 4U0RC 4IKLA 1YEFL 3F7RA 5D7IF 1M7IB 5I1JL 2F1BA 5HHPA 5FV2A 3CDFA 1KCKA 2AXJA 3PG2A 5AB2A 1V3LA 2BNUA 1IGFL 2AXWA 2ZUVA 2JXMB 1VB9A 1AG0A 1T1XB 2Y36H 3I6LE 1XMEB 4JFWA 4UBDD 4XNYL 3GS4A 3T4YB 3R18A 3VFOB 3VXMA 2Q6WB 3FAXA 3OHXA 4KUZH 3P3YA 5HHXL 1UH4A 4AQ8A 2VSKB 4PJEF 4DTGH 4PJDE 4OFYD 2VM3A 2WSKA 5DJ2B 2R9HD 5IR1B 3FT4A 3CLEL 3EYOA 3QRGH 1FFNB 4KTYA 3BAEL 5E7BA 4DOHB 5DZJA 4DJMA 5I71C 1NGQL 1PIGA 5AW7B 1I53A 1AACA 3QG6B 3SBRA 1UM4H 3TO4B 4ADJA 3HFFA 1H6FA 1QMUA 4MB5A 1YPZF 3G6DH 3V0AC 2WO3B 4C4KO 3ULUH 5CD5D 1R17A 4JPSA 1YQVH 2GK2A 1U8MB 3MLYL 1HWHB 4FI7A 1WWWX 2WD0A 4PV8A 1H5BB 4IEFA 4AYDC 1FGVH 2MPAL 5FF6A 4XNAA 2BCKB 3ZUNC 1WCQA 4TYUA 5J11B 1KXTA 2AJYL 3NABH 5EU6D 3NZHL 1UYWH 1YEGL 4NQXB 1NDGB 2Y22A 2JB5L 5EO0A 2AEIT 5F93C 4PJ9A 3IDYB 3NCYP 4KGJA 1WUNT 4DEUA 3T2NL 2EICA 3EYSH 3WEBA 5SV4A 3V4VB 4OD1H 4PJFE 5L2KE 4XMKH 3L6FA 2JJWA 4X7SH 4RAUB 4NWTL 1JHKL 5I1KL 5CILL 3EOBB 1MCJA 4I3SL 2EKSA 5HDBE 5J3HD 1BVZA 3QARA 3KD4A 1T66D 4R4ND 2APBA 4MJ6A 3NP3A 3CXDH 2ENJA 1ZHLB 1KYOJ 2MOQA 4CSZA 3H2PA 3MCYA 1AKJD 5H35A 4HG4J 1A4BA 4KY1L 5IFHH 3KH4A 2NZ9C 1QFUL 5DTFA 3ZTJH 4P59L 3ZL4H 1K85A 4JY5L 1QTYT 1QSFE 4D2NA 4X4YB 2YA2A 3OKLB 4NSKA 5CMAB 1KYAA 3RWEB 4Z6AT 2V2TA 5DO2C 5E8DH 3VXSE 2AITA 5EBGA 3RX7A 3DXAB 3UFIA 2A83B 2X12A 1JDCA 4OLYL 2P9RA 1XXDC 4X7CC 2R51A 2X10A 4FTVE 4N2AA 3ZOAA 2EEXA 1O9ZA 4ODHL 2EIZB 1HH9A 2QHLA 2YSSB 5IHBA 2APWA 3VQMA 2Y1VA 3UYRL 4G1EA 3WJMA 4QO1B 5JUEL 5D7JA 1OTTC 4KH9A 3NCFB 4F91B 3IS0X 1LLAA 2FQFA 5C0CB 3ELQA 4QPEA 4MJ4A 2EIKB 2QKIA 3ESUF 1JP5A 2N0KA 3REWB 3F7PC 1CF8L 1WFJA 3QJQB 3N3EA 1WFOA 3O6LL 3C5SB 5EF1A 3DMMA 3MRIA 3RTLA 1ZAGA 4DGIH 3QNXA 4B5ZA 5IJKC 2WVTA 1ZK9A 3CSTA 2CQVA 2QGDA 1JF1B 5I16A 4GG6B 5GS0H 3OLGA 3ROLA 4PBXA 4QRTB 2OJZH 2O5YL 1HVXA 3JUYA 5HYSG 3L2MA 1PW3A 5HGDA 5CLXA 2V9RA 4JVWA 2Y9RT 1WBYA 3LV3A 4QXWA 3KYKH 1QBMH 5HJGA 1N0XH 1E8WA 4Y4FC 4KDVA 3MV11 2XHNA 4YZFE 5D6DA 2DRUA 2ZIDA 4NQED 4X8JB 4KMTH 4MNHA 5HD8D 1FG2B 3QO0B 4GQQA 3ECWA 4NO5B 2IAMA 1CXIA 4P48A 4QHLB 4ODTH 4HFUL 3LSOB 3QULB 2YFNA 4YC2B 3PL6D 5EOTA 4GAYB 4FQIL 5GGUB 2VTFA 3L9YA 4ESKA 3V5KB 1OWRM 3QIUD 2WXQA 2H8PA 3MJ8A 5DEFB 5JO5B 3DHJA 3FK3A 3MMEA 2DL2A 4UOQA 3MRBB 5MEQA 4P5MA 3C5ZB 4G43A 2QTEA 4WCYH 4NRXA 2R0LL 1X44A 4MJ2A 5DJ8B 4XP5H 2JB5H 2NRDA 1WP6A 3QORB 1MJUL 3LHAA 3MC0A 4Y16D 1QEWA 1BPLB 4WFHD 1RK7A 4JPKL 3OMNB 1BBJB 3HVNA 1FP5A 3JVGC 1T22A 4M93B 1XAKA 4Y7MA 3GSNA 2E9JA 3D9AL 3SDCB 3ECUA 4JHAL 3UYOD 1F42A 1YYML 4M6OL 5D8JH 3RE0A 1BQUA 5HJDA 1A1MB 2DM2A 1IBFA 2NY1B 2H32B 2DYRB 4N86A 1LEGA 3SKMA 4FKKA 4M4PA 3FUEA 1RUKH 2D9CA 3MROA 1RUPH 3F64A 1BF2A 1JPFA 2VABA 3WNOA 2YK1H 2JKWA 4FYQA 2VWEE 4X99B 4BHUA 3U4BH 3HG1A 3QFJA 3WFDH 4L3EB 5FKAA 1KCRL 1PMYA 1OPOA 5SX5H 3QDGB 3B2UC 3MRCA 4ZUUA 3V55A 2CLRA 4UAHA 4M7KL 2F7PA 1FO0L 3VA2C 1JGEA 1JWSA 4LE8A 1JZ6A 4ODVH 1BCIA 3IN0A 4HS3B 1PZSA 4UQCA 4AQZA 5KSBF 4JN1H 3VXRB 3THML 3MNVB 4P4RB 5F0MB 2WZPA 4Y5YB 2Q8BL 1A6AB 5IW6A 1TKWA 1S9YA 2CMRH 4YHZH 5FYKE 1CK0H 1J9RA 5F1IA 3S35H 2O61A 4WV1B 1HZHH 3NRQA 4QXUH 4UI2A 2KI6A 5FO2A 2G4GA 2Z7WA 2NZ9D 3AM8C 3D0VA 4G5ZL 4RFOH 2GK0A 4N0UB 1Q9LA 4LGSB 2MHAA 3CU1A 1K4CB 5T3XH 4L29B 1UXSA 3I75A 5DO2D 3V5HA 1MIEH 5J6SA 4Y5XA 1JD9A 4FXTA 5LNEA 4YGVA 1RZFH 1ZSDA 3GIVB 1UA6L 3WIIH 3Q8AA 3LHPH 2BMKA 5I6XB 3NA4A 3I3BA 1NMBH 3ABLB 3M1BB 3N44F 4K3DH 1NA8A 4ZSOE 3FQWB 2ZKMX 4A7TA 2HLEB 2OX5A 1FFNA 5CP3H 1JGUH 4FI8A 4PHZA 2SODB 5JLZB 4FHBD 3P9MB 2BC4B 1OTTD 1DUZB 1PAMA 2GJ6A 4N20A 4UT9L 4TUUA 1PCXA 1SOQA 1UCBH 2KQNA 4AQAB 1Q72H 1DJXA 2VLRA 3ZTCC 2I25N 3MLXH 3INOA 3ZTDC 3ARFA 5EBLB 4WIQA 1U8LA 2NCMA 1LWJA 1CD8A 5KS9E 4NQDB 3OKKA 4F8TA 4L4VA 3CFNA 1J0KA 3WIHL 4M4RA 4XPFL 1UVQB 3G5VA 3LKNB 2EC9T 4LB8A 1EEYB 2FIRT 3GHBH 3QQ3B 2HFEA 5DVLA 2ADJB 3PGFH 4ELDA 5EN2B 3HI1B 3UAEA 4UM8A 3D08A 4OIIH 3SQOH 5LXGL 2R2HB 3H53A 4ZPVA 4G8EB 3AS1A 3ZK0A 4AIZB 3NFSH 3EJYC 4W9GC 5GZOD 5J13B 2G75B 5CUSL 3RZCA 2HT3C 5AW3B 2XYCA 3HNSL 1ZE3C 4FYSA 4PLNC 1SYVA 3MA9L 2JKIS 4APXA 1CGXA 1HXYA 4EN2A 4ZD3H 4TLTA 2WVUA 3AGVA 1DCEA 3OKLA 4HX1A 5CMAA 1DE4B 3ASNB 1YN7B 3AC0A 4DIXA 1LO5A 4AI7A 4JGJA 4LVOC 5ICXB 1V55B 3ARDD 3DXAA 1GRWA 2BSRA 2ZP8A 5JW5B 5EWIL 3T3ME 4J6IA 5IOPB 3KPRE 1QQDA 5LBSA 3SE6A 5CR1A 2BY3A 4B7IA 1MCDA 3BW9B 3O2VH 5IVXE 4JRLA 2AV7B 2X4UA 3C5JA 3HR5A 1YYCA 4Y5VC 1JYNA 2WNWA 4XBPB 2P8MA 3CH8A 5T3ZH 5SWQA 2DH3A 4EIZC 3TFKC 1AR2A 1W91A 2I7SA 3AXIA 1PLBA 1SOXA 5EV7A 5KW9L 2E6QA 3QHFH 2KKQA 4W68A 5EBMB 4PREB 3HJEA 1P7BA 3F8UB 3QUKB 2XTJE 5BRQA 1A0QH 2J8HA 5L4FA 2Z31A 3FU3A 3MSPA 4LDLB 4PMFA 2FO8A 3MLSH 3QUML 3AZUA 2ZKXA 2HRPL 3CZGA 1FHNA 3GXNA 4Z0BH 2EO7A 3U9WA 1Z3GH 3F7LA 1PZCA 1QSVA 4MDRA 2BW4A 4TTGA 3WJLC 1VCAA 3LRKA 3BWAB 1HKLL 5DF0A 3WLWD 1KXVC 4G1MA 4WKZA 1FNAA 1F4YH 5B3NA 3D05A 3LS5H 5A16B 5TE4L 1YEJL 4X6CE 1MPAH 4EE2A 4XVSH 1U2CA 2H3KA 2YGQA 4HSAC 5E0QA 3UADA 4RNRB 1UHVA 4QHLA 2QQNH 2NX5D 4QTIH 4OM0H 3SYPA 5MI0C 1TQVA 3ZDZB 2VC2H 1DQIA 2FX9H 2WXPA 4RQQB 4GXVH 4JY6B 3VJ6A 3PPSA 3RIFF 4R97B 5FGBC 3GKWH 4QOKE 5DCCA 1VIWA 4WRLA 4B9CA 4GMSH 2P5PA 3QC6X 4X7FC 4JK0D 3N1PC 4IKNA 2NY4D 4PJCE 5FYKL 7PAZA 4YEEA 1NC2A 2BOBA 1A47A 3LRLA 4XO5A 3GBEA 1ZTXL 3VFMA 4Q9BA 4OCSH 1Q0XL 1HAWA 3BEVA 5IBLC 4X5XB 4YUEL 1GZQB 3KM2A 1M1SA 5CR8A 5DSCA 4M61A 4AV4A 1S7RA 3DX9B 4JVUA 4OLZH 4EZLA 5TK2A 5LAXB 1IGTA 1P4BH 4PWGA 3VXNB 2X4SB 3JWDC 2MOVA 3S0PA 4XN5A 4WJ5B 3C6LC 5EC1B 4L4TE 1Y6MR 3DA0A 3BPOC 1F4WH 4F9LC 1NICA 4FG0A 1R3HB 3O2DL 3ZYZA 4Q2ZA 1IUZA 1N64L 1OLZA 2H32A 4IOFD 4U1HA 3KYMB 4GMTH 5AB0A 1P7KB 1A1OB 3FCBA 3WMQA 4ZAKC 3ALXA 2EO9A 5I1IL 1CFSB 4N3UA 4RGMC 5AW9B 4AM0A 2QZ5A 3V4VL 4L3EA 1MQ8A 4OI9A 4JJHA 4H25A 2AJUH 4MHHI 3GFUA 4NDMA 5IJBC 3BWSA 3F12B 4QD2E 4XMPH 2QQKH 4OLEA 3TJPA 1JRHL 5MEOB 2VDKB 3IF1B 4EQ2A 1JZ3A 1WYJA 3GSNH 3TJEH 4NC2B 4NJ9H 4HHAA 3T6WA 4UIKH 1JWMB 1C1EH 2IPKB 3MNVA 4QYAA 3QEHA 3EJYD 4RH4A 1CU4L 3IJHA 3LQAL 3K1DA 2AJXL 5ITFB 3V7MA 3MI6A 3DLQR 1Z32X 4H5SA 5DGRA 3X13B 1KWKA 1J5DA 1ACCA 4IRSB 1QHPA 2CXGA 4JQIA 4XO9A 3OMAB 2OYPA 1U3HB 2PW2A 3LDBC 4WI0A 4XPAH 4L0ZA 1QFWH 3GSVB 2CBPA 1KJ3H 3GUTB 2YD4A 5E6YA 3N06B 2OXHA 1DVSA 3OXRB 2VXQL 1XGYL 5FK9B 4K9EC 2ICWJ 2F19H 3FUFA 5ABDE 1RZKC 4ZS7H 3GIVA 3W5MA 4CU6A 3V2AR 3GTVA 2NNAB 4CRPA 4BXSV 3KNBB 4HH9A 3QHTC 2AJ3B 5LGJB 3FQXB 4XN2A 3EYUL 1AMYA 1AR1C 4N2LA 4C58B 3IDNB 3JTBA 5JLZA 4PJ8C 1YEJH 4FULA 1B6UA 1ZEAH 3TBWB 3SJVE 5C2BL 4RDQF 4ONFL 2WTPA 5INDA 3O0RH 1CL7H 2Q5BA 4JJ5B 4PLOB 4YVUA 5D1QB 3FUKA 2BW5A 1N4XL 4RISH 1XO8A 4ZO8A 3RGVC 5C0DA 4JFZL 3VM7A 1D5BB 2D8KA 4PV9A 3LKNA 2EDKA 1HOEA 4YFDB 2ZG1A 1GCFA 3U1PA 3VO0A 1JGVL 3I84A 3IDMB 4HXAL 3ZYIA 3WLBB 5A2LH 3VSUA 2JKXA 3PREA 3QQ9C 4Y4KC 3AQXA 3RI5F 4A2MA 2GY5A 5DR5L 5TE6L 3HE7A 4L3CA 2J7LA 2WO2B 3PWNA 4BZ2A 1H6UA 1BVKB 1I9JL 1YAZA 4NIKB 4R26H 4HOZA 3V0VA 5TQ2L 2UY7A 5C9JA 3L48A 3K2IA 1HCVA 1OP3K 3TLRA 1IGCL 3CX2A 4Q9RH 3HZYB 4L8SA 3SIKA 7FABL 1A2YB 5KBNC 4WUUB 1BQHA 2CJUH 1QRND 2OA9A 2WHVA 3POHA 2X4RA 4Q4IA 4BH8B 4DGVH 5ILTH 1ZV2A 5IT2H 3FUHA 4KTGA 4MDJB 4NYLA 5F7MC 5FKPA 4U4IA 2D3LA 2EDBA 2GAZB 3NJLA 4X5RA 3BT0A 3MRFA 3IFOA 2BVQB 5T1DL 5IBLD 1S9VA 2LFGA 3WAJA 1T20B 1FNEA 2ZX5A 3LYRA 1JYXA 3RRQA 2H5UA 1PKQA 4MCYA 3UO8B 4L9LB 1RY7B 3MLZH 1S7UB 3C6LD 2ZNXA 5I0DA 2F53D 5DJCB 1WS7A 1ORQA 3LQAH 1DQJB 4HWNA 4WWNA 1JXKA 2EDXA 3C12A 1TJIH 4X4XB 5I8KL 1U2YA 1QA9B 2QTVA 2XVGA 1NC4B 5HDQL 2G3NA 1PZ5A 4C8XA 1MDTA 5INCB 3UTTE 5ISZD 3PWPD 1T2XA 1JAEA 3H3PL 2Y5QA 3NJJA 3SDXF 2XN9A 3VGAB 2JMRA 4JFFB 2VDPH 1R5WB 4ADGA 4CC4C 4JZOA 4A2GA 3UJIH 3TH4T 4M48H 2DQHH 2CIKB 4G7YL 3GJEA 5LBSH 5J89A 4FG4A 3F6JA 4NO0A 4U1LA 2CO3A 1WAAA 3KYOA 3KCPB 3QRLA 4FA7B 5DEGB 3D3VA 4K5MA 5D93C 5LGHL 3MV9A 5I1CH 3KLHD 1T03L 1D5XA 2PWFA 1BW8A 2X41A 1A6ZA 4ZW5A 3K71B 1NMCB 4J8RB 2OMNA 3GMPB 4J1UA 4TVPL 4I4WA 1KTBA 4NZDA 1KJ2A 2P7TB 1FNGB 4KXAA 4Q6IB 3UTSD 4YQXH 5TF1L 4JRWA 1XR8B 3C5XA 2YPVL 4LL4A 1AQKL 1Q9WB 1RPKA 5AYTA 4DF9A 3DHMA 2OJ1A 4XRCB 4PJ5D 3CZFA 4DEPB 1T0OA 3L08A 4YEFA 2VSDA 3BIKB 3N42F 4IJ3C 4R0LC 1GZQA 4A39A 3IVKA 1A4JB 1FL3A 3MBWB 5TDPA 1U95B 4CSPA 4K2UL 1LP9E 3I6GA 4Z7WF 5DR5H 4Z5RB 5A6LA 1E90A 1I9JH 1AR1D 1AY1L 2IBZY 4WU7B 2W81C 3ECBB 3P4MA 4PJ8D 2N1TE 1NOFA 2ZAHA 2HFGH 1FV1B 3MNZA 1UKSA 3LKPA 1IM9D 4N8CL 1L9RA 1RIHL 1QFWI 2UZIL 4PJGA 3T65B 4YDJA 2Q7YA 5F7NC 2VXUH 4BHUI 4MJIE 2ICEC 4HBCH 3VFWA 2WWKO 5DK2A 3HC3L 2W38A 4Z95L 3EO9L 1GMIA 4YIQB 4ZNCD 4TSAH 2VUOA 4W9EC 1SM3L 5I8EA 3SY6A 1WFUA 1PNCA 2NY2D 3RDTA 5IJCC 1IE4A 4OVVA 4WO4B 1N68A 2HPOA 2YD6A 4AVHA 2DD8L 4I3RH 5I1HH 3IF1A 5ICYB 3HNVH 2X38A 1NQBA 1VEMA 1JK8A 3MR9A 4QAWA 1F18A 2A9BA 3VRJB 3U0TA 5DUPH 2C4FT 3EUUA 4FE9A 2YXFA 2VR6A 3W1ZA 1KIQA 2Y1AA 3TWYA 4PJHB 1CL7I 2H32H 2XWXA 1ZTMA 4KKBD 3RL2A 2F1AA 2MIZA 5A3IC 2B4CC 4MASA 1DEEB 4M7JL 1QSED 4PRIA 2XACC 2HA1A 5FW8A 2WINB 4NUGL 3GUTA 3ME0A 2MOGA 5HHOA 2GITA 3OXRA 4TNVK 5J12C 3F6LA 4JFOB 3VI3B 4E9XA 1QI3A 2TSAA 4KVCH 3H42L 1HKFA 3DX3A 5E2UH 2DH2A 3NUKA 2CK2A 1KTLA 3OL2A 5I0VA 5KBLA 3BWZA 2BCMA 5EIVA 4F3FB 4W9KC 2KPNA 4KUCF 3GSRB 1E3XA 3QJVB 2XOTA 4ZXBD 1X5JA 5HI4C 1NMAL 1JPTH 2AXGB 1O6VA 1RL1A 2K6YA 4KHXL 2BIMA 2P5EA 1AGCA 3S3PA 1OQOA 3BEWA 4JQIH 2YAHA 3MRMA 3KWWA 4KK6C 4Z7NF 2VISA 2FJGB 1NIBA 5CINL 5JORA 3ZZ1A 3L5IA 4OZHB 1QRKA 2CDGA 4LCCB 1ZHNB 4X98B 5I76A 1N2RB 5I6PA 4KV5F 4L23A 2Y72A 2Z8WC 1OEZW 3AS0A 2WXRA 2GYSA 1M1XA 2J5LC 3QR0A 1I3GL 4JBSA 3UC0L 4J2QA 1QNZH 5KVFL 3B2XA 3VVVA 2ZP9A 2A6IA 2FWOB 4KKLC 1MHCA 5HVFB 1D2OA 2XCMC 3OKYA 2Y7MA 3MRPB 5AEAA 1W8EA 3HBZA 3CV5A 1KLGB 4U6TA 1GMEA 4YL4A 5JPNB 1RZJC 3X3GH 4E41A 4JAMA 3K7UA 3AY4C 4FQXC 2A74B 4ORZC 1BEXA 4IYKA 5DHDA 4E9SA 3ZUCA 1TU2B 4HDIB 2QV2A 1XL6A 2I26N 4NBZB 3ZKSD 4PJ7E 1EFXB 5AWNH 2ZXBA 1J5CA 4H20H 4H0GA 2IADB 1AQ8A 4Y2LA 4M6AA 4WUUA 3BCDA 4M1GL 4P2RB 3WKML 1TPXC 2LFEA 3Q8CA 1CLOH 5ETUA 2EQDA 5EIIG 3BQUA 1BFVH 1TT6A 1MH5B 5DD3L 2BH0A 3H2QA 5ENWB 3ZTEA 1E5BA 3CH1A 3KPOB 4MB4A 1GPOL 2A38A 4BZ2H 1C16B 1AS8A 2MMXA 5EC2A 5JHDA 4NN7B 3IMRA 1ZDSA 1HSAA 3UTPD 1DLFH 1WIOA 1XSJA 1S7UA 2X87A 5ANHA 5A1AA 4U33A 1E9OA 4C55A 4MNGE 4H0HB 1IGIH 4PWEA 3DSNB 4NNXB 4J8QA 1NFDE 1N70A 3IBEA 3WTWA 2OKMA 2GT9B 5TD4A 4XPGL 4FFZA 4NNPL 3F84A 1OT2A 1JSYA 6FABH 3CUPA 2ENYA 1F3JA 1Q9KA 3AADB 3GTNA 4GRLA 5HI3D 1AYRA 4PBWD 1A22B 2OSWA 4LRIC 3TVMA 3ZMEA 3HRZA 3GGWB 5J8OA 1TR7A 2B8OT 1P5UC 1R5WA 3TBYA 3DUUB 2IFFL 4JFED 2KH2B 4P5TB 2VDKL 5EUOE 4N2NA 2JK5B 3DKHA 5F7BA 2J73A 3VQLA 1OO2A 1LK3L 2PO6C 1O7DC 1U92A 2X4QA 2R27A 3ARSA 3KCPA 1PLGL 5KJ7E 1MF2L 3KPQA 1AO7A 3QS3A 5LG6A 4ZTOH 4KRPC 3FO1B 4KK9D 1BX2B 3O45B 3BZEB 5HVGB 2A2QT 2NT1A 4N9OB 5IQ9B 3TL5A 1JPSH 2IWEA 2VH5H 4XXDA 3IGUA 5C0AE 4MX7A 3HZVA 4Y2NA 4J8RA 1CICA 3LZNA 4Q89A 2ZKHH 1FSKB 1QTPA 4ZPTB 1R0AH 4NT6B 4S1SL 5KEZA 4DK5A 1XR8A 3RGHA 1UJ3C 5CGTA 4F27A 2XWTB 1AE6L 4DQAA 1VZGA 3DDGA 4OF8A 3UTZA 2FT7A 3S4SA 3CGTA 2C5DC 2ATKA 4UQ2B 4QJ5B 4GI9A 1P53A 3T0XA 1ACZA 1T83C 5IJVA 1C08B 4N0YL 4ZUSB 3RWFA 1I7UA 1DSFH 5HI4D 1AJ7H 3SKJH 3PYCA 3MJGX 3IFPA 3MUY1 3LRGA 4MMZA 1TOXA 2FB4H 1EWHA 3NIGE 1FV1A 3CFCH 4FCAA 4WNQA 2XVLA 4A1RA 3WE1A 3BP4A 1KCBA 3BVWA 4EN3B 2HTLD 1IC1A 4QXTA 5B38A 1JDAA 1KJ2H 2VDMB 3EH1A 1KLFA 4ZS6D 5E2JA 2NW2B 3TCXA 2J8UE 4AEIH 1R33A 4F58H 1MFAH 1GGIL 3RTQB 4AUJA 3SCMC 1KY7A 4HKZB 3QYMA 4QNPF 4V33A 2TRHA 4HWBL 1RLWA 4JZJC 2K7PA 3LKQB 5DD3H 1L7IL 5LNDA 4LIQE 4C4BA 2GHZA 4LRNL 4JDZA 1ID5I 4NPYA 3VI4E 2C1PB 1WCBB 2XV3A 3NP4A 1BBDL 4AL8C 1TZGH 4FQXD 2DZEA 4MS6A 2G60L 4TQHA 5FA3B 4M29A 4OTXH 1B0IA 3S34L 2QVMA 5FM8A 4D7BA 4PG2C 1GGTA 3PQYE 2CCLA 4TLSA 2KBGA 4U1NA 4P4KA 3WMPA 3E9UA 4WHYH 2EECA 1NAMA 1DVFB 4KJPC 1XGTB 1K2DB 4O5LH 3TA3B 1BLNB 5CM1A 1G0YR 4P46D 1S3RA 1NFAA 4JG5A 4FF9A 1FC1A 1NLBH 1O9VA 4IBLT 4JFOA 4G9FB 4CC0A 4UTCA 3F2LA 1BAFL 5E6UB 1KGWA 3HBPA 3DVGB 4MMYB 1AYOA 2VMCA 4OGYH 5GS1B 4YXLL 1AGEA 3CQQA 3ULSB 5A6IA 3ZHKA 1W0YT 1U8PA 3K5SA 5DWPA 2QDVA 3AREB 5ADPH 3APNA 2Z1KA 4XNBA 4IGBB 4PS4L 3DV4A 3FHQA 3MV7E 1TZHA 1IC7H 2Q20A 3F83A 2LT9A 5EA0H 4AJVA 1DQML 3B9KA 2DQMA 2H3XC 4U6HA 3QO1B 3VCLB 5KYYB 1ZHNA 3T8XB 5CJQL 4Y4HB 3KVDD 1JZ5A 5HYJE 3WFBH 3KZ8A 5CFHA 1IAIL 4ACPA 4WTZG 4P2OD 3FN9A 1B4JH 5E8OA 1NEZA 2RCSH 2XUWA 3JT2A 3ULVE 3NACH 3CQPA 3HKFA 3MRPA 4N2DA 5ID1A 1PSKH 5F1OB 1GAFL 1QASA 3L3IA 4GKLA 1RK0B 2A4EA 3P4OA 4HC1A 4P2RE 4RGNB 2DBJA 2A4ZA 5IB5A 1YEDB 4EUPA 2ZUQB 1CE6B 4KRPD 1XH3A 5SWZA 1HX0A 4TUOB 1IT9H 2HLAB 1HS6A 4OD2B 1EFXA 4UTBL 3RVXD 5J1TC 3NTCL 4DVRL 2GJJA 4MWFB 4XBEH 4WFEE 3I6KA 5JXEA 2P8LA 4HF5L 4XAKE 2EDMA 4W9DC 2E5EA 2QLYA 3FFDB 1IAKB 2ZWZA 1MNNA 3FUMA 4MD5B 4QT5A 3RA7H 2TRYA 4KX7A 5C09A 1FZMB 3AQZA 2PYEA 2ZCHL 3CPUA 4WFGD 3VWJB 1SVCP 4LHUA 3VMPA 5IK3B 5IMMB 1G0XA 4LMQE 4KNQA 3JQOB 4PUBL 2F5BH 5IFAL 1UWFA 2BO0A 4EDXB 5AG8A 2EDQA 3L1EA 5MENE 3R7QA 5CWSA 3ZQWA 2DQJL 4ZRGA 3WUWB 4HKBB 2JFCA 2CO6A 1CE1L 2QVFB 5DUJA 2M8XA 1AAJA 1GOGA 1QWUA 5TH2A 1KMGA 3ZQ9A 4EMZA 2L7QA 3VWKD 3WFZA 3LPWA 5AAPA 1BM7A 1GW6A 1PL3A 4PJXF 2AK4D 3BSHA 4WVRA 1IARB 4C56D 5D2LE 4A2HA 3N40F 5H2BB 1CBJA 3A67L 4MD4B 1D6VH 2EYTB 3BT2L 3QUXC 4K55A 2WWMD 3ARVA 3UC2A 3AABA 5ADOL 1ZIBA 2G30A 2BP8A 3GM8A 5EU6B 4DP1X 1LL1A 1Y1DA 1BD2D 3SCMD 5CEXA 2WJ5A 4HUWB 3ARGC 5PCYA 3V8OA 2NY5L 1JUFA 5HPOA 4F2ME 4ERSL 1UASA 1KCSH 5CCHE 5HYQB 4OGXL 3RU8L 3WO3B 5FUZL 4EDWH 4MA3B 1J18A 1KGCD 4JCWA 1VRSA 3DRTB 2Y7SA 4MD0B 1Y7VA 3H56A 5IQ9A 3RWDA 2CHDA 1AKJB 1LHZA 1J7VR 2N7SA 4GKOA 8CGTA 4FFZH 3ZE0E 4U1MB 2O6EA 2WLYA 4ELMF 3RWCB 5HHMD 4XVTL 5D7EA 5IEKB 4LLYB 3U2SB 1WHOA 3MGTB 3N9GH 5KANG 1OCCB 2X1OA 3D30A 4ZPTA 1ITBB 4HIJB 1TJXA 1BD2E 2XWTA 3DV6B 2P44B 3NIFB 4ZFOB 3U0PB 2VZTA 1IU1A 1EXHA 5IJDC 2AHIA 3WHE0 2AABH 3AU0A 5EU5A 2A5UA 4URKA 5IHZA 1BMWA 4EF3A 5C0BE 4MBOA 3QZWB 5JIPA 1CXEA 5I17B 3OSKA 5G4NA 2EIDA 3TASA 1KGCE 1KTKE 3ELAT 2KERA 1P9MA 4WUKL 3D48R 5J06A 2YHGA 1ND0B 4LCIL 3CK0L 1TFHA 4KX8A 3AG1B 5AVWB 2EVIA 3EOAA 2QQQA 3KDPB 5F7YC 2ZYIA 2EEBA 4TQEL 3OM3B 4WWKC 4EN3A 5I1DA 4DVRH 1XD0A 4OJEH 4S11A 4IBUA 2RACA 4JG0H 3DBXB 4Y7OC 3NZ8B 5MEPA 2VLJE 1P7QA 1EAQA 1MREL 4CSTA 1SF3A 1TZ8A 2ICCA 4OZGE 3Q7JA 4IKKA 4Z7UB 3P30L 2CRMA 4KZEL 3HUJF 2A6DB 4N2GA 2J6EA 3LKQA 1JZHA 1D7CA 4PGEB 3C09B 4LXFA 3V6FA 3T5WA 5FV1L 7TAAA 4XVJH 3SE9L 1N0LB 4HLZG 1W0VA 4UZSA 5IIEB 4NQEB 5DJDA 1INEL 1KNOB 2ZCKH 5BS0A 3IDIA 3SZKC 5F44A 1OP9A 1SJHB 3BIAX 4U0RB 4PWHA 3FQNA 5IROD 3PL6B 3K6FA 4E9RA 2CLVA 5CZXC 1OAKH 3F01A 4RRPM 3QIUB 1D5IH 5K9JH 1FFPB 1CD0A 2VZUA 2XA3A 2VXSH 1F6FB 1HHGB 3B7RL 2CAKA 2YMTA 4PW4A 2BVOB 1T4WA 4Q8BA 4JHUA 4N28A 1UACH 3V5DA 1I1AD 1G9NH 4J23A 5CGMA 2ZAIA 4RAHA 3ARBC 1KF9B 3Q2CA 2W0PA 4G9FA 4AYSA 1ASQA 4Y16B 1T0MA 3FT1A 2IOOA 3CSBA 1OTUC 5SX4H 3S3CB 5GS1A 1FQ9C 4F7TA 4QRRE 1KZYA 4OGXH 3BN3B 4TVUA 5C0IB 5I71B 4FNUA 1TNNA 4P23C 3QP3A 3ORJA 4ANKA 2VZOA 4CW1A 2XFGB 1KDIA 3E1ZA 5L6YL 2DYPD 2CHWA 4L8BA 5F9AC 5A6MA 4S1QL 1NAMH 2JV6A 4HIEB 5CIPB 2PW1B 3IDUA 3EOTH 3QO1A 4L9DA 2KQMA 5AOJA 2XWJB 2X0WA 4KXDA 1QLFA 1M57B 1L5GB 3G5ZA 2IF7A 5D7KD 5GJTH 2H26A 3H1ZA 1FVCA 5FECB 4XVUC 2FL5B 3W57A 4YDLB 4RFNB 2Z64C 5IGXH 4FL4B 3U1QA 4PJDA 3UACA 3DGDA 1BWWA 3CN4A 4JZNA 4IOIA 1J48A 5I82A 4NQSA 3L5WA 3II3A 5E9DB 4BFIB 2E7LA 5FWRA 5HGHA 1J1PL 2EP6A 4R7DB 1Z9SA 2FJFB 5A2FA 4CNIB 4EI5A 3D8MA 4H8QA 4PCKA 4X6BB 4OD2A 4PP1D 1VKXA 2WKOF 2R2EA 4N0CD 4PGBB 1DR9A 5D96C 2Y07H 4RWHA 4OR1A 3OAZK 3UXFA 1RD6A 3DHUA 1KDJA 3L95B 4NO2A 4LOEA 4EKXA 3WKNA 3C8KA 3DGGA 3WUZA 5D7KE 3W0WB 1E3FA 4XXCA 3R06A 3O3BB 1NLDH 3LMJL 3LZPA 5E1QA 4XNXH 2BJMH 4PJFA 5L2KA 3QA3B 5GRUL 5BCAA 1HINH 2AXFB 1YY9C 5HHQB 4HC1H 4DO4A 2JJSA 3UIZA 4FQHA 4EDXA 2XZQL 3ULUF 2LTQC 2V7HB 2D7NA 4OFYA 5GRYA 3WOVA 5CCKH 1NANH 1J9SA 3QUYC 1AXIB 4H88L 3NN8B 4EUPH 4PY7B 1E2ZA 3DX6B 3GXFA 4BKSC 5MHSD 2WO4A 5EMYA 1ONQB 3TO2B 5D7IB 2L7EA 2NY0C 6CGTA 2K8MA 4YBQC 4YK4C 3AU1A 4G8GD 1GGYA 1MJJB 2YWZA 4KKQA 1OP5K 2YEZB 4WJKB 1GYUA 4MJ5B 3WGVB 4Y1AE 1IL1A 5CF3A 2Y06H 1CFVH 3UIYA 5H2BA 2HTKC 1QSFA 1RMFH 5E99L 1FORL 5EU6A 4XPBL 5KYXB 1YNTA 3ARZA 1MJ8H 5DLLA 3E6HB 2X9WA 1IEHA 4WSJA 3N85H 3ZTJG 1CGSH 1GIGH 1BOGB 3U9UA 1MWAB 4Q0XL 3TURA 3LQMA 2YPLD 2M2DA 4D0BB 4BUQA 2C1OA 2JKLA 1AD0B 4JM2F 4FTVA 4P5KA 5DHVA 1YC8A 1G7LA 1ZT1A 4J3OG 4KNUA 5JTWA 3HPLA 1ZPUA 3LZOA 4KHTH 4GAFB 1HQ4A 3B2VL 1YPZB 1BYPA 8FABA 3LQZB 4MD0A 4QTFA 2WIIA 5C08E 4DKEL 2VZVA 1QVOB 4G8GE 1B6DA 4XWOD 4RWYH 4AGPA 2C7UB 3RDJA 3B37A 1D5ZB 3MRLB 3RWCA 5F2FA 5IEKA 2PCFB 1WAPA 2JCCE 2VLME 3WFEL 1KIRA 3EGSA 4F9PC 3CFMA 5GGTA 3A6BL 3EYVB 4J4PC 1EEZB 3B3IB 4LP8A 3CDZB 2QR0B 1I3RA 2DWDA 2P24A 3SY0A 1GKOA 4LLWB 2ZZUT 5L9DL 3ARDB 1R24A 2IPTL 1O9WA 1NUNB 1QFHA 3K4DA 2YPLE 1H3PH 1OAJA 1X9QA 1HOCB 1LK2B 2UY6B 2CGZA 2AEQL 2G5RA 4X9BA 1EUUA 1F1GA 4XH2A 1B0GA 1WA0X 3BFQG 4U1KB 3HS9A 1EHLH 3MOBL 1GC1L 4DHLA 1KCUH 3M7OA 2XXFA 4QEGA 2YQBA 1DVZA 2OMVA 1SRDA 1LQBC 3FF8A 2XVBA 5ANME 1IM3B 4X6DF 4R3SA 3JWOL 4OM1H 1UZ8A 4LO9A 3BJLA 3BAKA 5GJSH 1DJSA 4AEHH 5F96H 2APSA 2K9UA 5G5DB 1G1OA 3WHXA 1FZKB 4OB5H 4DO6A 3QJHB 4MBRA 4NHCH 4YNYB 1E5AA 2C3XA 2G5BA 1YVLA 1VGKB 4UB0H 1TLKA 1IC5L 3MRHA 5DLMH 3ULUC 4LK4A 3JT0A 3GHPA 5CSZB 3QEQE 5SX4I 3SB3A 2BFVL 1FA4A 3OKMB 1FGNL 2A9MH 2LVEA 2YZ8A 4XCCL 4DN3H 1KWGA 3TEWA 4ZFGH 1XZ0A 3DIDA 1EHXA 2JSFA 5I6MA 4P5SA 1NWPA 3GWJA 4GAJL 4MQTB 1J05B 2NX5B 3GBNH 2EYSB 4KKCD 1RZ7L 3PL6A 3Q6FB 1HEJC 1NM9A 2ITDB 3OB8A 4PU2A 5AVQB 2VDMH 4ALAH 3NBNA 1A6VL 4PTTA 1CFBA 4WNJA 2NZ1A 2X44D 3LEXA 4TUKH 1X5ZA 3K1KC 3KPMB 4X6EA 2XWRA 4HJGA 5E99H 1FORH 5ACZA 5TFSL 2VN7A 2ALAA 2D4FA 3NPZB 4JM2C 1FAIH 2J6EH 2FYYB 3VYNA 1DBKH 3HMXL 3NJFA 4G83A 2FATL 3HG5A 4LLUA 3BGFC 4O00A 1TCRA 3ML8A 1CZ8H 2PCPB 4UQ3B 1ET7A 2LW3A 4OLWH 1L9NA 2XXCB 5L8JB 2H47C 1TIUA 3HBQA 1RU9H 4Y88A 2Q86B 3FCGA 3AB0C 3ILPB 3HAEB 5DJZA 1DQLL 3HE6A 2QGEA 5FHBL 1PZUB 1MJ7H 1NBYA 1RZQA 3PDDA 5GGRY 1PEZA 3U7YL 4AXWA 4XNMB 4N25A 2BY2A 2HTKD 1TJGL 4CVWA 5FO9A 2FGWH 3U83A 3S8FB 3W39A 3QQ4A 2Z35A 3S8WA 3CX5J 3EFOB 1EXGA 4NQVA 5B1KA 5JQIB 2WANA 3GBLA 4U4BA 4HUUA 3KPNA 3V4PA 5AUMA 4EPSA 1MCNA 3FTUA 1NDMB 5C6TH 3DTUB 3MKKA 2QQLH 4NERA 5D2NB 3BH4A 1KENL 1NANI 1E2WA 5DZAA 3RUGE 2B20A 4ZSOA 5L4IA 1KCLA 3RVWD 3QUZC 4R4BB 4GRWE 4R7DA 3GJFK 1CO1A 4FEIA 3HG4A 2XX1A 3UX9B 5FO7A 4MB1A 4HHGA 4FZEH 1PZDA 3RFZC 5F9OH 2XT1B 5BZDB 1XH2A 4JDVB 4HJUA 1N6UA 3DVNB 1CBVL 1MLCA 5HSFA 3IU4H 5KS9A 2IANE 5F7KC 4BFJA 1T1YB 4ZFOL 1URLA 2R29L 3UBGA 2XKNA 1KTRL 4YDKL 3TS8A 1BXVA 3O3BA 4LVOB 3CVHB 3NSDA 2NR6C 1CGUA 3SE3A 3VXOB 5IBUB 1RK1B 4GUCA 2OMWB 4UNTA 2JB6A 1OCRB 1JHLH 4LSTH 3CFDB 4M3HA 2ZXAA 4L37B 25C8L 4PY7A 4WHTB 4Y5VB 1CQKA 1I4FA 4ZZKA 1OCWL 1QW9A 2YKLH 3OGCB 1KZQA 2DQEH 4PJEE 4F7KA 1EANA 4P0DA 2W80C 5G4OA 2MCPH 2Q0ZX 3ZKXB 3VXUD 2DIJA 5C97A 1HHJB 1J0JA 2X4TB 4QRPE 3PIQB 1RZ7H 3BMVA 3LNEA 3ZN6A 2JF1A 1A6VH 4FQ2L 1S7SA 2VLLA 3O2WH 4DGUA 3PWLB 4MXQC 4G6AC 2DBLH 2H1PH 4OJDH 2XPGB 2AC0A 2IOMA 2W0FA 2YWYA 4FNSA 4PCYA 4PI2A 2J6WA 1IBGH 1MHHB 2HKHL 3N44B 3PNRB 1VFAB 2ADFL 2HSIA 4ZOCA 3SDDC 1GH7A 2H2SC 3L13A 3DO3A 4EXKA 1MCPH 1OL0A 2D7QA 2H3NB 2F74B 5TQ0L 4XCEA 5AVXB 3KPRA 1G87A 1A6WL 5IUSA 5IVXA 3S3BB 3SGDH 3T4AB 2BFGA 2IALA 4B0MB 4NAJA 4QTHA 1RJZA 1CDIA 1MCOL 1TEFA 2AEPL 4G6FB 4W70A 2NZIA 1EFQA 1TVBA 5AD0B 4HUVA 4TNWF 5IW1A 1J9TA 4GKZA 5MI0B 3LPFA 2HVKA 3VXUE 4DKFH 1XF2B 1X5FA 2PXYC 5LNGA 3TPUA 3P4NA 2PLTA 3MFGB 4D0CB 4E68A 1QRNB 2IQAA 4UOW1 4MAZA 2X09A 4XNQA 2H6UA 2QR0A 4K7PY 4WDIB 4LPCA 2VQTA 4LLWA 4LKCB 4QWWC 4XODA 3VMOA 3ARDA 1OAXH 3EZ8A 2HX7A 4LEXH 1RFDL 2IWGA 5DHVH 1ZLUH 1UWXH 1HOCA 4FXLA 2NY7H 1TJHH 1OAQH 2FHCA 1FZOB 4J3TA 1ML0A 4U1KA 1V7ML 3GSWB 4Z7IA 3W9DA 4X6CA 5BRZE 1ES0A 3KEHA 3C6LB 1UXWB 2FH6A 3REVB 1MCQA 1MEXL 1GOHA 2EUZA 4J3OD 5T8IA 4ZMZA 3BKYH 4UV4L 2BDNH 3QIBD 4L5FE 2D7OA 4UTAA 1TUPA 2IQ9L 4BCZA 4ILDA 2E9BA 1UGKA 4DCQB 3ZDXF 3NEEA 5EU3B 1ASPA 3HFML 3GMQA 4F7EB 5JW3H 5GGTH 4ZAKB 2LLGA 4QOKA 3PWPB 5EEWA 1UOLA 2ORBH 1JWUB 4E36A 15C8L 4PJCA 4FGMA 1TZAA 3WS3A 2PR9A 3NSCA 4GKNB 1G4RA 4AQ1A 1G84A 1BPVA 2EDOA 4V1DD 4JO1L 1M7DB 3I9GL 4MAUL 4YO0B 4NZ8A 1HN1A 4IMLB 5DXWA 3BLKA 2ADGA 4RBPH 3VDBA 5IW3A 5CEZD 1KPVA 2ESVD 2VAJA 4TPRL 5DHYA 1ZVYA 2FLRT 3FN0H 1S46A 3BMWA 4NKMB 3ZMNA 2JKJA 3OHXC 4MJJA 4C83B 2J20A 5GS0D 3EYFB 3NJHA 4TUJB 4APQA 2EDEA 1G1KA 3UMTA 1NIFA 4FKHA 4ES9A 1YMMD 1NEPA 2Y2TA 4XP1H 2M83A 1WICA 4IK7A 4KJYB 3UTSB 3MRKA 2CK0L 4KTDL 1XGQB 3QW9A 3FB5A 2BWIA 2YA1A 3L7EA 3L4TA 4PJ5B 4GW5A 3UPAA 4BZ1A 1KLUB 2QADD 4G3YL 5E8EB 2NR6D 1NAKL 5I23A 3IRZA 5IB1A 4NM4H 3SPGA 3H9ZA 3H54A 5CEZE 3QQDB 4J6RH 4O58H 1G4MA 1A6WH 4BD4A 4PJ9C 5HYSA 3X3FL 3O4LD 4ZBJA 1AR1B 3PV6A 1WIUA 4PJ8B 1ETA1 3R4DA 2XIBA 3ARRA 4JEGB 1L6XA 2GI0A 5BV7H 1ZDQA 4OFIA 2FR4B 2ZSWB 5CO1A 5D5MA 4YMPA 4FZ8H 2F58L 1YMME 5C0GB 1FBIH 3ROOA 4MDIB 3BUYB 1XB6A 2OR8A 2XZAL 3FOMB 3MODL 1EHKB 3NMEA 3RGVB 2VIRB 4HGKC 4R7LA 5CHNA 3S5LG 3S48A 2ZD0A 3D52A 2L3BA 4KKNA 4Z7QE 1MWAL 3TBTB 5ITBH 1AKPA 4JFPA 4NZRH 1IFHH 4TSBL 4YDZA 1WZMA 1E5YA 3ATDA 3SDDD 2NY2B 5I75B 2ENQA 1OB0A 4UM9D 1BJ1H 3N43F 3OXSB 5HHNA 2OLDA 4WK0B 3PGCA 4YHKH 3OBAA 3MV8E 2I60H 1DL7L 3B7UX 2X7LA 2Z4TA 3JSSA 3QJXA 1J8HB 4ICWA 1X7QB 2WXOA 4A55A 4CGUB 3VRLE 2VR4A 2APFA 5FUCE 3TWCL 3SJVA 2FEEL 4WK2B 3V4LA 5KSBE 3BVDB 4YAQB 4JDVA 4WSKA 5E4IA 3ETTA 2C9PA 4U7MA 1QSEB 3UP1A 4UU9B 1JPST 1NTDA 2E27H 4GEJA 1MLBA 4PGCA 3HFMH 1I8KA 5D7JC 5ESAA 5F8QC 1AQDB 4DZBB 1XB3A 2OXGA 1QPKA 2A77L 4GQ9L 3V4PH 2QKIC 2IMMA 4PWIA 4YPGA 4EBQH 5EB9A 2ETWA 1G43A 4MJHA 3DO7A 4F7MA 5A40E 1EZVX 4QHNA 1GJIA 1LO2L 3TPKA 3B2MA 5JW4Q 4LLAA 1AC6A 3SGDI 2I9LA 2K6ZA 4U6VL 4ZXBB 3RIKA 1OSZA 2R0ZH 5CZVH 2R7EA 4ZW6A 3TYFA 2CLZB 3FH7A 3P0YL 4GBXD 3IJ7A 2DEWX 3KL0A 3NSFA 3L9RB 3PE9A 2DQTH 1WA1X 2EDRA 2V17L 3V9FA 2F5AL 3IXAB 3AQDA 4M3JA 1S7WB 1D7FA 3DUSA 4NUPA 3WL9B 1T6WA 2IAAC 1SY6A 2CIIA 4LQFL 4PJIE 3BAWA 5H94B 2P5WB 4R96A 4XN7A 3Q3GA 1ZOXA 2IAMC 3PWLA 2FAUA 3L9EA 3D85D 2UVFA 1L6PA 4PJBE 3AWEA 2XPGA 3CC1A 5AYUL 1VHPA 2P28B 2VYRE 3CNKA 3FU9A 2BP3A 1MFVA 3KS0J 5GGSY 5IVNA 4HJIA 4EXPX 4PJ6A 2HN7B 3LCYA 2QBWA 3GNML 3NZSA 1HHKB 3Q0HA 3ARQA 1H9DA 3GO1H 3T4AA 2EACA 1JF5A 1MN4A 4PRNB 1Q38A 4YHYC 3VXMD 1TTAA 4X0KA 12E8L 1M6OA 2DQ6A 1TSHA 3FTSA 4G9DB 5L0QC 1RJYB 2BERA 5DD1H 3FQ1A 5E03A 4G42B 1QKZH 3LRSA 2XZAH 3Q5YA 3O9WD 3GSOA 1DBBL 3DX7B 3UTTA 5EORL 4NZUH 1Q1PA 4YXHL 4R4FL 1IC4L 1XGPB 4CMMB 4KI5F 2YBRB 4JKLA 4NP4H 1NCTA 2YS4A 2CR0A 3AROA 3C60A 3IJEB 5AVZB 1EAJA 1FJ1B 2X1PA 3M6DA 5FYLL 1JFQL 1IV8A 4NB7A 4B9PA 2CZNA 3WGUB 3QIWC 5MP6H 1XIWD 4KX9A 4PR5B 3QDME 5KYNA 3QQXA 1XMWA 2B77A 4OZFG 5AAWA 3WXWL 3P77A 3U0WH 3AVEA 3EYQD 4PJ9D 5AW4B 3GIZH 5IMKB 2F53A 3BGMB 2D7TH 4JY4A 1JNHA 3G5XA 2XWZA 1VERA 4N6QA 4O2CA 1AMXA 1JN6B 4KITB 4JHWL 1KB9K 3CHQA 3OPZH 5JZ7C 3NFPA 5DMYA 4YLQT 5I1LA 2TSBA 3QFDB 2RR3A 2OZ4A 2ICEB 3MLRH 1F3RB 5DHXB 4LSUH 5ISZA 1VDGA 3PWPA 3RJQB 4HCFA 2UZXB 5I0YA 2MCG1 3CFBB 2DMGA 1UB6B 4JFEB 3FNKA 3M7FB 2PWHA 1QACA 3QNZB 5DS8B 3HG3A 1GSMA 4N8PA 5HGBB 1F1DA 3BQVA 1YO4A 2VZSA 2UZYB 5JIIA 3SDYH 1LP9A 1JCVA 2ITFA 5J1SC 3PNWA 1CFNB 1NBVL 2GHWB 1I85A 1REIA 3NEXA 5I18H 1ETZB 5EZOL 3PJLA 4C83A 4F80A 5CKAA 4JG9A 4DZ8A 4JFDE 4UTAH 4IMKA 2YD8A 3FKUS 1K8IA 3BPNC 3WV0A 4KQ3H 2D0HA 2V17H 2LVCA 3EO0B 2VAAB 1JYWA 3TBSB 1RKRA 4CDGC 4RLDA 1CDHA 3FU7A 4MSWA 3SDXB 1E6JH 4BRVA 4KTEH 4W81A 1UH3A 1ECYA 3CVHL 3LB6D 2YOAA 3N1GC 4G72B 2B1AH 5JHLL 2AJVL 5J12B 4PM1A 2CKBA 3PDOA 2CBMA 3X11A 4MAYA 3ARFC 4V2BA 4UNVA 3IFLL 4I8DA 4WI6A 4JO5A 4JGMA 2XU9A 1H5BC 3UJJH 3DMMD 2DLFH 4GPVA 5J11C 1OF0A 1PKOA 2V3DA 4HFWA 5K39B 3SYCA 5FO8A 3NCBB 3IDYC 1VEOA 1XCTB 2Z93B 3QGVA 4F8LA 3HKZA 4UV7H 1UATA 1EH9A 4PBVC 1S3KH 3MBXH 1RIUL 1N5YL 4ZMXA 1CGVA 1ZT7A 2O5XH 5FC9A 2WWKT 3BE1H 1H19A 1IM9A 2WTRA 2X40A 3L8QA 2GTQA 2VR5A 4FFWC 4JKNA 3QR2A 4M1DL 4I3GA 4MQXC 4N2CA 1KN2L 2XDHA 5IG7B 4D0DB 3O11B 4HOXA 2VN6A 3FOMA 2G2NA 1I9RL 2F54D 3Q44A 4KI5C 2ZCLL 3FO0L 4OGAC 2VIRA 4TS6A 4YHPB 5E2TL 3RZCC 2J5LB 3EAKA 3RY4A 4FXKA 4BEIA 1FWXA 2IAMD 3IPEA 4LCWE 3RLSA 3LQAC 3KLAB 1ZMYA 2QLVB 4ZMAT 4BZ1H 4JN2B 4HIQA 5D1ZA 1JTTA 4J12A 3BP6B 4LU5L 1CMOA 4Z7WB 5E00B 4S0SD 4TRPL 1H8LA 1UWGL 1KJMB 4MA8H 1Y18B 5H8DA 3WELA 2YKKA 4G6KL 5IKCB 4Z8FH 3FTGB 2ED6A 3G6JE 4FQXB 5M7QA 4G6JL 1MHEB 1B3IA 2ZUUA 2BNQB 4KY2A 2W1NA 5AQ0A 5L7XH 3E6FB 2O26U 5KZCD 2X70B 1AXTH 1FYTD 1EMTH 2D3NA 1JNLL 3FZUD 2F54E 1HDMB 3CDGB 3WNLA 4N1HB 3L3OB 4P46B 4NNYB 3IPFA 2VJXA 3BZ5A 2BHYA 2LU4A 2V8MA 3DURB 1I7TB 2EE6A 3OJDA 1RZ8A 3POCA 2VMJA 4Y2DD 2GSIB 2MH4A 3LKSA 4NBYB 1NGXA 1T2QH 2Z31C 3L17A 1L9PA 1FRGL 2GABA 4F37K 3JWDL 2J21A 2OTWA 2A73A 4BSVA 4OCNC 4PRPE 3L7FA 4LASL 5DQDH 4UT7H 3HB3D 4I1PA 2PKDA 4NHUA 2J55A 4HCGA 1YJDL 2R4SH 4K23H 5F7DB 4NZFA 3VH8A 5IQ7H 5TGBB 4AKPA 3WTXA 1QYGH 4W9IC 5ICUA 1H3XA 3VGDA 1PG7H 4PJ7A 1BMGA 5AW6B 2F7RA 2XFXB 1FYTE 3T6ZA 1ET8A 3L3GB 3RB5A 3KPTA 5T1MA 1DVXA 3NCJH 4FFYL 3U46B 5IMLB 1TF4A 1RUAL 1MRDL 5H94A 1UCTA 4U6XB 3W37A 1CN4A 4P2OB 4RESB 2CWRA 4E0RA 1Y0LA 2BINA 3NA9H 4Y9BA 5DRZA 4FOMA 3WTUA 1K5NA 4RMRA 3PXJA 1MW1A 3LS4H 4HALA 4QRQB 2CO7B 3H9YA 4AV5A 3MCG1 3FB6B 5I66A 3E2HC 3OAYH 4L1TA 2R0KL 4G70B 5DU7A 5B1JA 3ATAA 4KRPB 3QXAB 5K9OB 1ZVSA 1JYVA 2C7FA 4MNGA 3WN6A 5HY9A 1UA7A 1L3NA 4M02A 1NFDA 1YNLL 1BFTA 5I0ZA 3BLBA 1OAYH 4BWTA 2YXVA 3P69A 1KIPB 3ZIYA 1SY6H 3DPBB<