1NCHA

Structural basis of cell-cell adhesion by cadherins
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
98
Chain Sequence
GSDWVIPPINLPENSGPFPQELVRIRSGRDLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion protein
molecule keywords N-CADHERIN
publication title Structural basis of cell-cell adhesion by cadherins.
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 98
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1nchA00
4NQQA 3LNGA 1SUHA 1EDHA 3K6FA 3K5RA 2OMTB 3LNIA 2OMWB 3Q2WA 4ZI8A 4ZMYA 1ZVNA 2OMZB 4AQAA 3Q2NA 2YQGA 2OMVB 3UBFA 4ZTEA 4AQEB 2OMUB 1FF5A 3K6IA 4APXA 4AK1A 3LNEA 2QVFB 4ZT1A 5CZRA 3LNHA 1OP4A 2V37A 5JYLA 2OMXB 2WHVA 4NUMA 3K5SA 4ZMQA 4XXWA 2YSTA 3UBHA 4NUQA 3FF7A 4AXWA 3LNFA 4ZMVA 4AQ8A 2X2UA 1WUZA 2WCPA 1ZXKA 1Q1PA 1O6SB 2A4EA 3MVSA 3FF8A 1WYJA 4NUPA 4ZMPA 4ZMNA 2OMYB 2O72A 4AQAB 3Q2LA 4AQ8C 3K6DA 4AQEA 3PPEA 5KJ4A 4ZMZA 5CO1A 4ZMXA 4APXB 3QRBA 4XXWC 3LNDA 1NCHA 3UBGA 4OY9A 5JYMA 1NCJA 5DZVA 4ZMLA 2QVIA 2WD0A 4ZMOA 2WBXA 4AXWB 2A4CA 3Q2VA 1L3WA 1NCIA 2EE0A 4ZMWA 1NCGA 4QD2E 4ZMTA
chains in the Genus database with same CATH superfamily
1E4XL 2YKKA 1A5FH 3OR7B 2MQ0A 1HOEA 3SBRA 1RJCA 5LGJA 4MX7A 4QXUH 5DMGC 1SUHA 4N1CA 3NK4A 3LQZA 3QO0A 2CGZA 3Q1EA 3MBEC 3L7EA 3VFNB 1X9QA 4S1QH 5JHLH 4PJCB 2KQNA 2NUPB 5HXMA 3OGCB 5CJQH 1DDHB 1LXMA 1YQVH 2VMCA 1CE6B 2XN9A 3EDJA 4PW9A 5BUPA 3AXLB 4JPVL 1IGJA 3WUWA 4BCZA 3RU8H 3QZWG 5IK3A 2XCMC 3WU1A 1JXGA 3FT0A 1IEBA 3GHEL 2FK9A 3FQTB 4XWOC 3L3OC 3ULUH 3SDDD 2X70A 1TCMA 4YVNA 3D08A 4Y8AA 1CICA 1DQVA 2GJ6B 5HYQA 1IC5L 3IE9A 3U4AA 2VM4A 2G0KA 5JIIA 2CCVA 1QSFE 1KC5L 3D4GA 4RRPM 2WVVB 3WDHA 2E56A 2MHAB 3AROA 1ILUA 1EFXD 5D2NE 5GZNC 1CDIA 3MTRA 4BUGA 2XG5B 2KT6A 4EZMA 3ZO0A 3MRNB 2K3TA 3K2KA 4EI5A 1OE3A 2VUKA 1WV7T 5HI3C 4QRTA 1Q9WA 2ICES 1YDPB 2P47B 4PJBB 4P5KB 3F6IA 3TXAA 1BREA 5FCUL 4OD3L 1PX8A 1WS7A 2VRKA 3F00A 4M1GH 4C58B 1OSPH 4W68A 1J0IA 3SE6A 1D5MA 2DL2A 4KO5A 3RVXC 2HPOA 4LLUA 2OMWA 3HPLA 4M7LT 2J1XA 4Z0XB 5EZIL 4G9FD 1OVZA 3IYLW 1MIEH 5DGQA 4NQDD 2J8UB 1BF2A 5JXED 3FYIB 1WTGT 4GUPA 2PR4H 2X4TA 1F8TL 5E6IA 2XETA 4Q9RL 3SQBA 3NJKA 4MYWB 4UT9A 1NC2A 5T1MA 5IEKA 5L4FA 3LRGA 2AJXH 4U0QB 2FO4B 3T3PE 1AH1A 2B39A 1OK0A 4JZNB 4HIJB 3O2DL 5HGAA 4OJFH 3AWGA 3G9AB 2AV7A 4OQ1A 5I15H 3W0WA 2Y7SA 2CRMA 5IVNA 5DR5H 1VZIA 2AEPH 1OARH 3IU4H 5EIIG 1EHXA 3HZVA 4ZFOA 3AQXA 4NRYB 5DMKA 3QIBA 1AGEA 2R9HC 5KBKA 3GMNB 1OAUL 2YSSB 4LBEA 3NGBC 1BFTA 2DQFA 2Y2WA 5D55A 4PQXA 1QI4A 1UC6A 3CSYA 1YEHL 1HN1A 5JNYB 2N7BA 1UWGL 3PIQB 4ZXBB 4TF4A 4U3CA 3HR6A 3VE0B 4X8JA 2GCYA 4NQCE 1DBBH 4UBDD 3MNMA 3FU9A 1RHHA 3GI8H 5DEFB 2Z0UA 4EN2A 4AYBA 3OKOA 4MQTB 3BISA 1AGBB 3MZTA 3KVPA 1PIFA 2GI0A 3F6JA 4HIEB 3ZDYE 1T1WA 5EN3A 3P54A 2XUWA 4MMZC 3KH4A 4XVSL 5FYLH 4U6TA 3MRLB 3FU3A 1FL5B 1UASA 2BY2A 4KXDA 2D3VA 5E9DE 2DI9A 3GXIA 4H25B 1NGQL 3JTSB 2ROYA 1RERA 3EFOA 4P2AA 2BC4B 2K3HA 3C6LB 3BIAX 4O02L 5F6IB 1ZTMA 5EEYA 2X40A 2RBLA 3X12B 4KDTA 1VFUA 1MCSA 2C4FT 2PP8A 4PV8A 3FS9A 2XN1A 1XD0A 1OW0C 2XTJB 5HHOD 1DR9A 4P07A 3B4NA 3QRFM 5K39B 3WEOA 3AG3B 2Q9OA 3MLRL 4L1SA 2P5EB 4A39A 2OSLA 2D2OA 1G9NH 5FOBB 1H8OA 1IRAY 1GL4B 2VR4A 5BMFH 4HQQH 2WTPA 4YAQB 4PRIB 4WTZG 2VN4A 1A6WL 2DMBA 2X2UA 1BZQK 4GUCA 1A22B 4JB9L 5D4HA 2VLKA 3QNFA 3HG2A 2W81C 5I1DA 1D9KB 1JWMB 5D2LE 3VGEA 1B4LA 2Q1EA 1DANU 1VB9A 6PCYA 3FSAA 2F8VA 1IL1A 3L81A 3DX7A 4WO4B 3WKMH 3TA3B 4ZW7A 2XKNA 4KV5F 4AKOA 4S1SL 4MQSB 5F7YC 4V1DD 4LCUA 3OAUL 5TH2A 4BQ9A 1XH3A 2I85A 3SE9L 5INDA 5JW4R 3MUGB 2ENYA 4LSVL 4H88L 4LIQH 5E1AB 3VI3F 2YS4A 1ZA6B 4U1GC 4OGXL 1HL8A 5F8QC 4OVUA 3UYPA 1I8KA 2Y7NA 4OSUL 1FE8H 1JHKL 3ZYZA 3IDJA 1YECH 4XXWC 3T8XA 3PXLA 3POHA 3GJEB 4XNQA 1FZJA 3VD1A 2DTMH 2H6OA 3H2QA 4PSRA 3OKEA 5JORB 4DP4X 4YSOA 4GYBA 2V7NA 4J3UA 1ZTXH 1Y7VA 1XCQA 3NSDA 3P11L 2R1WB 5BOZG 1OM3L 1GGBL 1MI5E 3VCLB 4JY5L 1G9MC 2P7TB 2QHRH 3F7QA 4QRQB 5FO8B 2K8QA 2QGEA 5JLZA 1VFBA 5EBLB 3MLUL 2JSFA 1VDGA 1G5AA 5I1LA 2CO3A 4HSQA 3VRJA 5K9QI 1WAAF 3BGMA 3AS0A 4MNGB 4NZTL 2IIJA 2VLJD 4EIZC 4ZODA 1GTFA 1TUPA 4WWKD 1EEUA 3FTYA 3BRGC 5AVQB 5HHPA 1Y07A 1CI3M 3OKMA 4MXWL 3KNBB 2H9GB 4JFZH 4PJHF 1F2XK 5FKPA 2OSYA 1MEXL 1ZMYA 2EABA 2NMSA 2DW5A 3V6BR 2VDMB 2MTAA 2FB4H 2NY7H 4OLVH 2HT2C 4A6YB 1I7RB 2M26A 4AJWA 4ELKB 5DFVC 4LPXA 2W95A 2ZWSA 2NXZB 5EUOE 3PFQA 1UA6L 3EJJX 2Z0BA 1MJ7H 4D8PA 1UTDA 5AAMC 2B2XL 3SB3A 3WMSA 2J5LB 4ZUUB 4BWTA 2HLAB 1JWUA 1F4AA 2AQNA 2V5TA 4FZ8H 1S7WA 1I9RL 4H1LH 1RFDH 1PQZA 1QPXA 1HHGA 3Q8BA 5DUBB 3WFHB 1D5XB 4QRUB 5IVXE 5JYLA 3CU1A 4N8CH 3PREA 2XA3A 1KN2L 1OE1A 1RP9A 3HAEH 3NZHL 4MMXC 4P2YA 1A66A 2WINA 2ISDA 1A9EA 2ZJSL 2Z92A 1OAQL 2NDGA 5F9WC 2XPGB 1OTTD 3G6JB 3QZOA 3ZX1A 2XIDA 4HJ0C 1XGUB 5I8EB 2FLMA 4U2ZA 4FA7B 5FEBA 4JM4H 3V5KA 4GSUA 2CO7A 5DZ9A 2W07B 4YHKL 3C60B 5DHVH 2DKSA 4LL1A 1XZ0A 4I1RA 1D5ZB 4QTIL 3D25B 2ZAIA 5FK9B 1EH9A 2XQYK 4NZUH 4QR7A 3GBLA 1LE5B 3VUAA 1AFVL 1NCWL 5DK2B 1E5BA 2ENQA 3ZRCC 1UJTA 3MJGX 3TM6A 4QCIB 3UJIL 2VE6B 1MWAA 5CSZB 3GKWL 1HHIA 4R4FL 3FYEB 3CN1A 1XXDC 5E1QA 3HC4H 2BY3A 2WO2B 4F7PA 4N2GA 4BK5C 3GNMH 2ERJC 4E0RA 4RAVA 1N0XH 5TDOB 1IX2A 4ZMZA 3DV6B 4MMZA 1XTMA 2HFTA 3P3SA 3IGKA 4ZO8A 1NQBA 5BZDB 4PRNA 5IMLB 1KGIA 3V79C 4LO9A 5KYWB 1AQDA 2ICWJ 4ODHH 3K6NA 3IPFA 1MAMH 1ADQH 3QI9B 4HUMB 3RGBA 3KH3A 4BSVA 4XNMB 4A04A 2JI1A 5F2FA 3UC2A 4P23B 1OW0A 4FNSA 2MPAH 5J11C 4G7SB 3Q6FB 3ESUF 2JQAA 2V33A 4LKXB 3MUY1 3T2OA 4LASL 4MB5A 4GW4B 4PJ5E 4ICXA 3BFOA 4JZOB 2EKSA 3S5LG 4E5XG 4F8NA 2XKSA 3DJTA 3MKGA 1KPRA 5KVFH 3QXUA 3N1FC 3LKQB 4PMFA 3LQAC 5GGQL 1A2YB 5K93A 2W9EH 4QGYA 4QRFA 4G42B 2Z91B 2GTQA 3MJ8A 1F56A 2X4UA 2IOMA 1F1DA 4PRPE 1O9VA 3DC0A 4ZTOL 3P9MB 4B9IA 1NUGA 2IANB 5FGBC 5AYTA 2JB5L 5CGMA 1UKQA 4WZ9A 1F02I 3BAEL 4LAQH 1O5DT 5EA0H 4E9SA 4X4MA 4WCYH 5EU3A 4RMSA 1RZKH 4MA7L 3TBSA 3ZDZF 4XCEA 5JIMA 1I7UA 4K2UL 1HDMA 2UVEA 5EEWA 4LCCB 4BGDA 2VYRE 2XTLA 2JXMA 3JWDL 2ZKHL 3K5SA 5HHNA 5DWPA 4XXWA 3KW7A 3VXNA 2R0LH 4PLNC 5AVSB 4WFFD 3VB9A 3BN9C 3KYOB 4DEUA 5ADOH 4UTAL 1BV8A 2F5AH 4XN7A 4KZEL 1Z9NA 3WXVL 1TPXB 3RY4A 3CZJA 3NIGE 5GIRB 1HQ4B 2JLLA 4E41D 2XYCA 1GZPA 3U2SB 1MW3A 4KO9A 1AHKA 4ODWA 4PCYA 1SEQH 4M93B 1KSRA 2VISA 1SM3H 1AD9B 3FRUA 1U8HB 1ZLUK 2QSCH 3TBWA 5AB2A 3KLLA 5GPRA 4ALAL 3ULAB 2YLKA 1FZOB 1X5IA 2WGXA 3BW9A 4HWUA 5D93C 3CBKB 3IFLL 2V7HA 1A1NA 4HD5A 4QIRA 4RMWA 3V55A 3OB0K 2MPVA 3UTSA 5HGDA 1KIRA 1U91B 4PTTB 1G7JA 3T2LA 3AGVA 1GGCH 1N9PA 2EDMA 2K7QA 5HP5A 2VSCA 5AAMA 3CSBA 4B5EA 4J2XA 3FN0H 2O6DA 3D51A 1EXUB 1R9FA 2YUVA 3BAYA 2PPEA 1CDHA 3AAZA 1CLZH 4UV7H 4J12A 1V5JA 5ELIA 1ZK9A 2OTWB 4FQLL 2CXKA 3OXRB 4MMXA 3OL2A 2I32A 3GTTA 5LGKA 4MJIA 5I8OL 1BXAA 4AYSA 5IMKB 2ZAHA 4N9GB 3WTTA 1LILA 2B1HH 3OAWA 4XI5C 1MQKL 3ABGA 2ZICA 3D8MA 5DVKA 3BZEB 3L5WA 4KZ0A 2CUMA 2AEOA 4JDZB 4GMSH 2XA8H 5GRVL 3SPGA 5MENA 4AENA 2R2BB 2JB6A 2HVKA 2V2TB 1U8OB 4YGAB 3PWNB 4WJ5B 3H1ZA 3MV7B 3GGWB 4XPBL 1J5OH 1WJ3A 3MACH 4J28A 2CLRA 4OLEA 4QHLB 4DAGL 1LWHA 1WAEA 4CSTA 4GXVL 4RAHA 4IQHA 5J12B 3RZWA 1A9VA 3S35L 5I1HL 1HL5A 1A4JB 4EOWL 4N5UA 4G1EB 3AU1B 4ZK8A 1KZQA 2KMWA 4HPOH 4BK5A 2G9KA 3Q13A 5CEZE 3BH8A 3C75A 4WSKA 2B7DT 3L4XA 4IJTA 4YHOH 5IVOA 3VWJD 3JUYA 1WC7B 2L7UA 4WFGD 5TE4L 2X6AA 4F15B 1X9LA 4KK9D 3OSKA 3IMRA 5E99L 5F96H 3ARGC 1L9SA 2Q3AA 5FYKU 2OULB 4FNUA 5GSRA 3L9RB 7FABL 4C83B 3AG1B 4BSWB 3SO3B 4ZD3H 3CLFL 4AQ8A 3WUWG 5CJOH 1YVLA 1WBXA 3NCYS 2CDFB 1M1XB 4FG6D 3UTQB 4R26H 4KDVA 4DZ8A 3MJ9L 2IAAC 4TUJA 1C8QA 4WLCA 3NCYP 4DCQA 3BT2H 5D1XE 4M3KB 1QSFA 4PU2A 3O0LA 1FIEA 1KGWA 5DD5H 5DSCA 4CRPA 3RX9A 1OOWA 3APDA 2E27L 3PV7A 4MMYA 5ESAB 2VZOA 3DRTB 4CC0A 3K6DA 5EUKB 3WNPA 2WYTA 4JJHA 1GOGA 4J6RH 5DUPL 3DIFB 5I0XA 3M1BA 1CXHA 5FGBA 3IM1A 1K2DA 1SY6A 4FXGC 3RQ3A 1TZIB 3CFTA 3CZEA 3RDJA 4AQ1C 1I9JL 3PNRB 3LHPL 4N0UE 1LEIA 3V7MA 3ULVH 2WY3B 2JVUA 2H4EA 1JZGA 4R4NC 3VXPA 3V6ZA 4DPRA 2Z9TA 5EO1B 3HC2A 3OF6D 4YBLC 1BVNP 4OLYL 3KMDA 4P05A 1W2KT 1NEUA 4I1PA 5T5FA 1Q72L 2D8KA 4UDUA 3MLYL 1KYUA 1M2OA 3A67L 3SEPA 1FFTB 1CFNA 1AI1H 1CDGA 1JUFB 2E0PA 2WOYA 3N5AA 2F7RA 5AOLA 3HC0A 2C9PA 1NGPH 2NY2C 3JV0A 2WSDA 1RUPH 2HRHA 2WKGA 3FB6A 5ICXB 1QLEH 2Y7LA 1JGUL 4UT6L 5DZJA 4ZNEE 2EE2A 4L3EB 4TSCH 5F93C 2CGYA 3GMRA 3CSTA 4Y5VB 2OBGA 2PCPB 1M9SA 1WFIA 3LN5A 3IJYA 1H9VA 2RCSL 2VDLH 3FZUC 3VFSB 3RFZC 4NQXA 5EZLB 3RB7A 4ZMYA 4HGKC 2BMKA 2BNRB 4YBQD 3VTTA 1BZDA 1QFHA 1HH9B 3BEWA 1OB1A 5LB1A 1KT2A 3GSUB 4MD5A 1EO7A 3GFUA 1CWVA 1X7TA 1NCAL 3KWWB 4G3YL 1Q0EA 1V7ML 1TEFA 2X4SB 3W9DB 2VSKB 4GAJH 4EKJA 3ZIMA 5AVUB 4F37F 4NQCA 3LNHA 5D96B 1OWWA 1IMHC 2V37A 1DL7H 2XHNA 1F58L 1B9ZA 1DSWA 1T7YA 2A3TA 3TIEB 4OGZA 3ZSSA 3GJFA 3QQ9C 4NQUA 3RA7H 2DQCH 1T2XA 3IXTA 3CG8A 3G5YB 3O6MH 4AQOA 5BOJA 4RRPA 1NGWA 4U1HA 3D33A 1NPUA 1BHGA 2EVFA 4MXVE 4PJ8A 1XX9C 2CO6B 4ZW3A 3HMXH 4AYFB 2UUDK 5CZKA 1WUZA 1XGQA 5TFSH 3JV4A 3ZN6A 4XNXL 1VACB 1RIHH 2IV9A 3GBEA 3ZQWA 1IC7H 5DJXA 1RKRA 3ZT7A 3L4ZA 1A7QH 1TQBB 2A4EA 5FGCE 4OZIB 1MCHA 4CMHC 3L1EA 4YE4H 1S7UB 4X8GA 5B38A 5LXVA 1G9ML 2AXHA 1GR7A 1P1ZB 1OT1A 1CG9A 1OCWL 5HJ3A 1Z0NA 3T3ME 1B3JA 1NDMA 3HI6H 1AACA 3LKSA 1ZLWH 3TT1H 4TVPH 3SKNB 3EYOA 3O6FB 4GSRA 1OSYA 4KGJA 2A6DA 3LEVL 3K72B 5ALCH 1QABA 1S9YA 35C8H 3S96A 5AVVB 3B56A 4IHOA 4ES9A 1BZOA 3K8MA 4NAQA 3O3DB 4OFYA 1JK8B 3GIZH 3KXFA 4F8LA 2DI7A 2NTFA 3ARFB 3ILQC 3LAFA 4K23L 4QO1B 4RETB 4YHLH 5JOPD 1HTYA 3ARGA 4L8BA 5T1LB 3OBAA 4RFNB 4RBPH 4IKIA 4JRLA 1GSKA 4UIKH 4QRSA 4XCFL 1VEPA 3TEXA 4V2CB 1K4DB 2CK0H 4LSSL 4Z7OB 2JTYA 4ZMAT 4HHAB 4XMKL 1F3DH 5KJRH 1Z9PA 4FNTA 5I1KL 2WIIB 1RPKA 2BPBA 5DDHA 1GA2A 3L3IB 1FO0H 2J8HA 1RZPA 4X80H 4X6CA 2YQGA 2XDHA 1TZGH 1HIMH 1WFJA 1XH1A 3VQLA 2NLJB 4LSPL 4HJGA 4BFNA 5GRZA 2ENPA 4WI5A 5HHQA 2Z4TA 4U1NA 5BXFB 2BJML 3RGHA 5I2IA 2E7LC 2X89D 1LD9A 2BWIA 1YA5A 4LEOB 4LP5A 4OQTH 5I76A 4XN9A 5DYOB 3GB7A 3MLTB 4KX7A 3NZUA 4LL9A 3ZKXC 5K9QG 4FXGA 5D7JC 4AQ1A 1KTLB 3P0VH 2JLPA 1E9OB 3L3DB 1A1OB 2BP0A 2P5WB 4K4KA 2ICEC 1F3RB 5BS0E 4DGUA 1FFNA 2BS9A 3KHOA 4Q6YA 2DLFH 3P2BA 4AEHH 3GBML 2WJ7A 5GGUA 3TN0B 5E2UL 4LLDB 5DTFA 1G7LA 1KIPB 2QQKH 4ORGB 1EZLA 1GC1C 1N3NA 3V0HA 4ZOEA 4EUPH 5IHHA 3ZGIA 5JXAL 1QNIA 3T4YA 3KR3H 4AGOA 1JF1B 2ZP9A 3N0AA 4RMUA 3QZWB 1FN4A 4PG2C 4L5FH 1RZJH 5IVXA 1BQRA 1O6SB 3O0RH 4NFBA 4TYUA 4JFUA 2VERN 5CIPB 1ETZA 3KGSA 2NX5B 1CL7L 1U8LB 2GBTA 4PJFF 4F58H 1J88A 1VAHA 3B5GA 5BZWA 2KDGA 1YMME 2KLSA 4C56E 1H3UA 3IGAB 4JHWL 3VGAC 2EH7H 3WKPA 2A73B 1IC0A 2CO2A 2NY0C 4X5WB 3RFZA 5BW7C 2QQNH 3T4AB 4F5CE 2X0VA 5KJ4A 4X6EA 4CN1A 3MBWA 1S7SB 4YFEA 3MAWA 1R5IB 3QZLA 4JPKH 3GHBH 1ZA3A 4N0FB 1I31A 2P1YA 1IVTA 5ERWA 2HKFL 3FFDB 2H8PA 1XFPA 1M05A 2BCMA 3NIDF 4LOVA 5E5MA 4W9ZA 1MVUA 4MDJA 4WEUD 1T89C 2AABL 3EBGA 3CH1B 2R51A 2IADA 1JGDA 1KCVL 1U41A 1ZHBB 1A64A 2Q8BH 2FIKA 2IWGA 3FQUB 3QAZB 3SDXE 1I3VA 1IAKB 3DNKA 3KPOB 1PG7L 1BXUA 2FX7H 4FFWD 3AG2B 4XOCA 2VR9A 2MOQA 3QUKB 4LIQE 5ETUB 3WTYA 2AK4E 3UDWA 1RK7A 2QHLA 1A1MB 5EIIB 3WKYA 5GJSH 2YEZB 2VDRB 4AV0A 4QTHA 5BJTA 3QARA 2XNAA 5ENWB 4XVTH 4ZXBD 4PJ5A 3RIFF 1GVIA 3OQRA 2HFGH 1WUNT 4WJG3 5FOJA 3HBGA 3WN5C 4KK5D 1ZTXE 2CBPA 4KHTH 5D1XC 3QIWD 4KOCA 2VLMD 2VITA 2C3HA 5JHDB 1K8DA 2EYTB 4LFHD 1J1PL 3FCTB 3FULA 1I3GH 2Y1YA 4JJ5A 2PCFB 5J6SA 3TO4C 3VFPB 1N0LA 2NZ9C 4PRPA 4KQ3L 5LNDA 4JRWA 1RHFA 2H5UA 3MI6A 3FU7A 1DVUA 2BFGA 2IWKA 4U1IA 2G75A 3UZEC 3C6LD 3FUEA 5MEPA 2W0KA 4J3VA 4XMPH 2VC2B 1EGJA 5CD5C 2LU7A 2A77H 2GUOA 2XTJD 1LO3H 2UY7B 1A4KA 1B0GB 2R59A 3MLWH 1F4HA 4PYHA 4DVBB 4FLQA 1IT9L 3K4ZA 2BSSB 3HRZC 4NC2B 5LG1A 3UP1A 3GXMA 3UG4A 3ZE1E 1RJLB 5CNHA 2YXVA 2OCCB 4YZWA 1YRKA 4NZFA 3ARDB 4GW1B 2DMKA 1ODAA 5KYUB 1N68A 4M6NL 3MLSL 4FE9A 1RZFH 4PRID 5IP4A 3HR5B 4MSWB 1FZMA 1A6ZB 1MXDA 1P4IL 4IKJA 4CSPA 1AZRA 1J86A 3WSQL 3FUKA 3BVUA 1HJCA 1LDPH 3LRSA 4JGMA 4U1MB 4PYGA 1KCRL 1D9KD 4MQ7A 4NKDA 2Z7UA 5HDOA 4R3SB 4WO4D 3WO4C 4OZHB 5D7SL 5F88B 3TA3D 3MRMB 5C0EA 1E2ZA 3E6FB 2VDQL 5FLUA 3W37A 4ICWA 1JMXA 4EMZA 4UINL 2YKLL 4CJ1A 5FYJD 4PGBA 5G5DA 3U0TA 1N2RA 3I9GH 3RG1C 5D7JA 1LQBC 5DD1L 5L4IA 4NN5B 2ICEA 1NCTA 2ZONA 3CIQA 4F2ME 1ORSA 2WUBL 1AGFA 3JQOB 3KPTA 4XPAL 4OGAC 2WQRA 3MU3A 1ZT7B 3LQMA 1VCAA 4JFEB 4QHNA 4WEMB 4ELDA 4MJ6A 2DLEA 5C2BL 1G1OA 3QWRA 1HILA 2FLRT 4LQFL 4XAWL 5FW8A 3RL1A 3DOSA 4OW6A 1E8XA 2F7IA 5CLZA 2VW6A 1RUAL 3EYQD 4S10A 4PG2A 4PSPA 3VFTB 1Q9OB 3GZOA 4LEEA 1I1YA 2ID5A 3N42B 4WI6A 3UTPE 2ZP0T 3DX3A 4HS8H 4MAUL 1S2EA 4Z23A 2WGNB 1U3YA 4GP8B 1U2HA 1NCDL 3QAQA 4ZPVB 2DWDA 4XMTA 3DJSA 4OF7A 1RULH 4I0PC 4OJAA 3O6KH 2ZZUT 2R2EB 4YDZA 2VXTH 2ESVE 4JG0L 1CPUA 5IUSA 1I9IH 2G4EA 4X0KA 4RGNB 4PEEA 2DWEA 2NXZD 4UB0H 2FSEA 4YUEH 4YEFA 1DEEB 1DUYA 4P3CH 2VXQH 4ZMQA 1HSBB 4PRAB 1RPUA 3NCXA 4K7PX 5AYUH 1MHEA 2ZKMX 3IFNH 3QDGE 4EXPX 3VQMA 4NSKA 4TXVB 3STLA 2X6CA 4K55A 5I1JH 3GMMA 1ZD6A 2XWBB 3CLEL 4N5EC 2Y69B 5GGSB 1TZHA 2V3FA 3CE1A 1AR1C 3N44F 4JZJB 1FL6B 1E5ZA 1A8JH 1VGKA 2DJSA 5BUGA 3JTTA 4R96A 5KYYB 1IKNA 4PS4L 3QDJE 4LVOC 3QZMA 1PKQB 2ORBH 3FFCE 4GBXC 5HVWA 4Y9FA 5SX4I 15C8L 4OCSH 1TXKA 3QE5A 3NIDB 4R7LA 5EU6B 2YFNA 3ES6A 3KJ4B 4H8VA 3C60D 4I8DA 4M8QA 4UUJB 4OF6A 1CBVH 1F4XH 3I6LE 4IRSC 4G6FB 5DC9B 3WY4A 2C1OA 5JHMA 3SGEI 2RIKA 2UX6A 5T3ZL 4CVXB 2R69A 3MUUA 1N4XL 1AANA 3GT6A 5I5RA 1I8AA 3EJSA 5IVZB 1NKRA 2VLRB 3KS0J 2YMXH 1NL0L 2R39A 5AEAA 2DYRB 4G8EB 5DS8A 2FJHA 2VDMH 3L6FA 4M5YL 3CCHB 2VABB 5D1XA 3CAFA 2L3BA 1VSCA 3U4EB 1BX2B 3BKJL 4A6YH 4DUVA 3B8SA 2NY5L 4IK7A 2VAAB 3HE6C 2YQBA 3ZMEA 5KSBF 3G5XA 5AZEL 4G7YH 4N2OA 4Y4KC 1UCBL 1KBBA 2N0KA 3U1SH 3VRLE 1HEZA 5EWIL 4Z3JA 4HXBH 5A40E 4V33A 3I9IA 1ZGLB 3BDXA 5DI8A 3UZEA 4B7IA 3J7HA 3VFOB 1G6RB 3FTWA 4LSRH 1T04B 4N0UA 3RTLA 5DJAB 4FQCL 1KWKA 3EYUL 4E9RA 4RGMC 4P23D 5MERA 1UOKA 1DQJA 1OF2A 3LV3A 5IMMA 5I6OA 3HRZA 5T1DH 3Q8EA 2FUTA 1H19A 4PH8A 1MNUL 2ED9A 3SODB 4F3FA 1JDAA 1RK0A 2Q3ZA 4ODVL 4ZRGA 1C1EL 2BOCB 2DF3A 5E2VH 1BM7A 3RX5A 2YPKA 4X4ZA 4PVBA 4OLXL 3CWGA 4Y1AB 1GPOH 3EOAB 1UZ6E 2Z4QB 5MEQB 4WWOA 1BXVA 4GRMA 5J3HD 1U8CA 3RWHB 4F7MB 3S5LB 4E5XB 2VUYA 1JYNA 2FYYB 3OWRA 3NEXA 4FFZL 2LV4A 4MA8L 3CVCA 2IAND 4ONHA 3RTQC 4KVCH 4O4YL 4ZNEA 1HKFA 2FEEI 3TURA 1XL4A 4RMRA 4XAKE 3MQIA 4BFIA 2BHFA 3VA2C 4AEIH 4IYKA 4FHJA 4B27A 4QF1B 1EMTL 2CLZB 4RCAA 2JQZA 1G9NC 3EBHA 1H5BC 1T5XA 4ANWA 4DKEH 2P80D 4H26B 1ET8A 2AXFA 1BG1A 2CDEB 1L5GA 1E2VA 2ZYIA 43C9A 4MD0A 5AOJA 2WAQA 1YPZF 2BS71 3MXVH 4UTBL 3TJEL 1JZJA 2ADFH 4K3JL 1F6AA 2WCPA 4U7SA 4BYHA 1LTXA 1PW3A 4FMVA 4NT6A 2AJSH 3T04D 3TN0D 2EXWC 2OR7A 3DX8A 4O51A 5DZOA 5J1SC 4DWHA 2IBZX 3B6SB 1SNRA 1UB5B 1XMEB 2XPZA 1DVQA 1DUZA 2IH1A 2ZPKL 4QXWA 1JK9A 3ZE2E 1ET5A 3ECQA 2EDXA 4PV9A 4F37K 3B2VL 2GC7C 1DQML 4K5PA 1CQKA 2F2HA 1S5HB 2K9UA 4RRPG 5D6DC 5DXWA 4AY0A 4AYDC 2GPZA 1OAZH 4NNYA 1A7OL 4Y19A 1VJSA 3RWDA 1NTDA 1HHJB 2XQ0A 4XPHH 5CO1A 3HG5A 1SOXA 1DBMH 2EEDA 4GAYA 3O4OC 4ODSH 1CN4A 1U8PB 5C6WH 1VCBC 2J57A 1XD1A 1CLOH 1I75A 4HS3B 2AANA 1QFUL 4I0PA 1KEMH 3ML9A 3FOMA 2YRPA 4NEHB 4DVRL 4GY4A 5DGRA 4G43B 5HVGB 4BWUA 4R83A 1OAXH 3X1FA 1KV7A 1RVFH 1WEJL 3VNYA 5IB3B 2BY1A 3EF4A 2J2ZA 1MY5A 3DOHA 1FNGA 1XSIA 3QQ3A 2VDKL 5IHZA 1WGOA 2G60H 1CLYL 3WIHL 4ZMWA 2OL3H 4HAGA 4HK0A 2WYIA 2AQTA 3C5ZC 5LGYA 3H55A 3OC5A 3P1VA 4XCCH 1UCTA 2X3BA 5HVHB 4DP6X 4G59C 2P24A 3IDUA 2CA4A 2YXMA 4GT7A 2WP3O 4DN4H 2WBJB 4P4RA 4GAAA 3VNZA 3CHPA 3ULVE 1SVZA 3I6KA 1I1AC 4GBXA 1XR9B 3ABMB 1H3PH 1ZRUA 3QGVA 2EDQA 5HDBF 5KVEE 5J06A 5E94A 5A16B 3U2JA 2A9NH 4AIEA 4XCNA 1TETH 1ROWA 4XPTL 2HJKB 4IRSA 2CE6A 1RZGA 4AG4H 1YEDA 1CGUA 2YAMA 3D3VD 4S1DD 3MV7D 4W93A 3KPLB 3N44B 2WKOF 2GSMB 2J55A 4AUJA 5T1KB 1LO2L 3OMZA 2ENSA 4NDMA 3HKFA 4E9QA 4MGXA 3D85A 1E6OH 4YC2C 3EHBC 3EYVA 3JWOL 2W60A 2DQ6A 3ASWA 2WANA 2DH2A 2WUCH 3L9BA 1C8PA 3J2PA 3GRWL 1KBGL 5L8JB 1NFDE 2Z93B 3HE6A 3RJDA 3UGUA 4K94H 3V52L 1ZSDA 2FTAA 1HYRC 1T0OA 4NZRH 4X9BA 4Y4KA 1ZEAL 1BGXL 2Y24A 3PHOA 5DK0A 4F57H 1HHKA 2CHXA 3G6AB 1HXKA 2IDUA 3GSQB 3RVTC 4MB3A 1ANUA 1A6UH 4OCMC 4TUKL 5LGJB 5BS0A 4DGVH 2ZSWB 4MX7B 4NQSA 4LF3A 3D0LA 3MV11 4JDTL 4CUCA 2O5YL 3LQZB 3QO0B 4JLRA 3ZKQD 2R4SH 4Y16B 2BNQB 2BVOA 2V9RA 3X3FL 4GUOA 5CEZL 4K8RC 4F27A 1RIVL 3N1GC 2YXFA 1KJ2L 5T3XL 5TDNB 2XN9B 4XTRC 3RL2A 5LKNA 3LPOA 4JPIA 1IGJB 5EOCL 4PJXF 2FEJA 3WUWB 2ADGA 2GY5A 2CRYA 5I30H 5IK3B 1D5IL 5JMRA 5KWYC 1YEJL 4UOZA 4WFEE 1XSJA 1IEBB 1N6QL 3HS0C 2X70B 2MNWA 5KSUB 4ILDA 5TE7H 5GHWL 3VFWA 4UDTA 1IC4L 1Q8MA 4IOFD 4OZ4A 1U6AH 2AV1A 1TEGA 4WWPA 1V3LA 3GS0A 3RTQA 2O6FA 5LGHL 3WTVA 2VJ0A 4KI1A 1T3FA 1I8LC 4ZUSA 1OAYH 2FWOA 2ALAA 2VJ8A 5F7MC 2EDFA 2R1XA 5HDQH 1W16A 1X5ZA 2B4CH 2DQHL 4EI5B 3DSFH 4F5CA 1NBYA 4A68A 4TV3A 1KN4H 1H5BA 3I50H 2ATKA 5SWSA 4QD2E 1BVLA 5FXCH 3FONB 1CD8A 1EJOH 1JPGA 2K45A 3H42L 4LPTA 2CU9A 4TVPE 3JBG7 4NPYA 1EHAA 4FXKC 5DD3L 2PYEA 2DIEA 1D5MB 3ERXA 4M62L 1CLVA 1CUOA 2OMWB 3Q01A 5C09E 2A1WL 4KQ4L 2D2CC 4G5ZH 4U4BA 5I1JL 5EZOH 4GUPB 1QYGL 5E6IB 2IXQA 2J25A 1KCWA 2KLRA 3NSJA 2HUHA 3HN8A 3QUMH 3SDCD 3SQBB 2AS5M 3SDXA 1OZTG 4FS0A 2R8SL 5DHMC 1RZKC 5IEKB 1UZ8A 2JK5B 1LM8V 3PY9A 5F7NC 5HGAB 3BOVA 4FFVD 4HJSA 2AV7B 2OCJA 4PIRF 3VGDA 2BNRD 1OAKL 3W0WB 3PAVA 5L9DH 1JFQL 3QCUH 4TL4A 4IGBC 1IKFL 1FLRL 1BAFL 4K9EH 4QHKI 3HZVB 2V4LA 1KB9J 2D7NA 2BVPA 2HH0H 3BMVA 4ZFOB 3U36A 4QLRA 5J6GA 3U7WH 4GXUN 1DLHB 3NTCL 4OM0H 1SXAA 2O4EA 2FRGP 4MVBD 4LBEB 4PJDE 1L6PA 5C0AE 2Q8AL 3CSYB 4Y4HC 4LGSB 2FEEL 4B7LA 2G5UA 5JA8B 2HT3D 5KW9H 2FX8L 4PPTA 1NFIA 4FQXC 5AG9A 5DWUL 1R3LA 3RIFK 4Z76A 3VU1A 4X8JB 2GCYB 4AK2A 1RHHB 1UENA 3C5ZA 2UXVA 1I1RA 3MRPA 5HJGA 3TBCA 2BWDA 2EYSA 2XQBH 2YO3A 2E6JA 4LHJB 2EIMB 4P2QE 1T1WB 1YEKH 2E9GA 1MPAH 4DO5A 3WE1A 3C87A 1CLCA 3EO0A 3ZR5A 5DVLA 1I1AA 4G9DA 3T0AA 5SX5H 4FLHA 3EFOB 4X6DF 1A5FL 3X2QB 2W91A 2X9WA 4PGDA 4PJGE 4QXUL 4PV8B 1OAJA 4K71B 3CFJA 4FOMA 1F2QA 3KPRE 4YPGB 5I73C 5DEJA 3RUGE 3QS2A 3KBEA 4IBZA 1GJUA 4NO0A 5INCA 1XB6A 3UG5A 4S1QL 4BQBA 5IMOA 1VEMA 5CMAA 5JHLL 3O6FD 5E8PB 3WNKA 3DDFA 4MWFB 5CJQL 2WQXA 2OSLB 4LP4A 1YQVL 2CKBA 3D12B 3EFFB 3GS7A 4E9XA 4N6RA 4PGJA 4ZAKC 2UXFA 3RU8L 1MCQA 1AY1H 3H7LA 3VG0H 2XC8A 2Z1PA 2AXJA 5I5IA 1QWNA 1WDAA 2KHAA 2NXYC 3ULUL 5F9DC 3B3BA 2VLKB 3MRBA 4QYOA 4ZUWA 5CKAA 3IF1A 5I1DB 4J3OC 1S8DA 4A55A 3FQYA 3ARFD 5F1SA 2BSEA 1ID2A 1KJ3H 3JWNE 4PP1C 3MTXA 1Q4NX 3VVWA 4LOUC 3VU2A 3ARRA 5T1LD 3VVVA 5B3JF 2DRUA 4LCUB 4GRLA 3FH8A 4PVLA 3LEXB 5TH2B 1XH3B 1G4MA 3QEHA 4FQQA 3SN6N 4F2MA 4P48A 5HGHB 1KGXA 2G9HB 3CVHA 2WXMA 1UUSA 3MBEB 4UWQB 4F1SA 5INDB 4R5XA 3PAUA 3HBQA 5FUZH 1J9QA 4ODUA 2W0LA 1DBJH 3NP4A 2JCCF 3L13A 3UYPB 1QD0A 2YUWA 4M1GL 1PDKB 1OSPL 3IDJB 3T8XB 4BH7A 1OSZB 2W80C 4XNQB 1FZJB 1X9UA 1JZHA 2WTRA 4BQ6A 1MIEL 3H9YA 4Z7NB 5AZUA 3L3OB 3HS0A 4HIPA 2PR4L 2V7NB 1BMWA 2SEBA 2FEDD 3Q9PA 4N2KA 1ZKAA 4L0YA 1RJZA 3HB3D 5I6XC 2ZTBA 3D2UA 2GT9B 1VFBB 2AJXL 3FUMA 3HHMA 4KDWA 1CXLA 2P5WD 4OJFL 3BGMB 2XFGB 3LKRA 4GEJA 3NFPA 5L0QB 3VD9A 4GPVA 5I15L 3OWEA 2BIOA 2XWDA 4E9WA 2C3XA 3L4UA 4JEGB 5DR5L 2ESVA 1SPDA 4PJXB 3SZ6A 1V27A 1MFCH 1OARL 2AEPL 3IU4L 1IM3B 5E08H 1E9PA 4K15A 5C0CA 3Q0HA 4ELMF 1GGUA 2DZEA 2V6HA 4X99B 1T7ZA 5FKPB 3MRJA 4X2UA 1Y6NR 3T0DA 3J8F7 4HUXA 5F7LB 2YIHA 3GXFA 4FXKA 1U8JA 3E8UH 2H32A 2XWZA 2YN5A 1WA1X 2RMNA 1TQSA 1BVKA 1KXQE 4D8PB 3K6SA 2COQA 4JM2F 1H6TA 4AZ8A 2NX5D 3EH5B 2OAAA 2X88A 1G84A 2WNGA 1JWUB 2NCMA 3DECA 4QKTA 4KJQD 4QRAA 3U1PA 5ICYA 5I0WA 3PJSB 1CGXA 4HKJA 3GI8L 1PQZB 1HHGB 4K5LA 1N7MH 5JR1H 1XSOA 1V54B 3OKYA 1XB3A 2KPNA 1OCCB 1PVHA 5IBLC 1A9EB 5FYLL 2V2XA 2FDBP 4IGBA 3ABZA 3PG2A 3QZPA 2E9IA 3U7YH 4BK8A 3MGOA 1OSEA 4EIUA 2NY1C 3V5KB 3S3JA 1P4LB 2QVMA 5TE6H 3ZQXA 1NA8A 3VFUA 1MW0A 1XZ0B 3OG4B 4ZW8A 3RY5A 3NGBB 1ILSA 3PWPE 4WHCA 4JFOA 4Y4HA 4B9ZA 3M7OA 5KUMA 4DN3H 4JQIH 4PJIE 4TVSa 4KKLD 2HJLA 1DYZA 1CFTA 4FQXA 3MV8E 4OLUH 3ESVF 1G9NL 1MWAB 5FS5A 3K71A 4C57C 2AF2A 3IJHA 2E6PA 5BMFL 5AW5B 4HQQL 5JDSA 3V2AR 2GJZB 4Q4EA 2V9TA 4F7PB 3ASNB 4E0RB 3VXSE 4RAVB 1KYOJ 1MF2H 2HN7A 4X42A 3TBYA 2JJVA 5C0ND 4MMZB 1CZ8H 1GAFH 1QFOA 2X4RA 4GP4B 5CIPH 4PRNB 3WKML 1QX1A 3OLDA 5KVGH 3P9LB 1NBCA 4UU9B 4M9OA 4XXCC 3QDME 5DJDA 3RPBA 4BSVB 4ZW5A 3X3GH 1U8IA 4YNYA 3QUXD 1Z6JT 4ANUA 4LIQL 4A2EA 5ESVB 2VDNH 5JHDD 1BMGA 1N59B 3KYMA 4U0RC 3RLSA 2EKSB 2HFEB 4F7EA 1FE8L 4HAFA 3PUCA 3MYZA 2HTKD 2QV2A 1YECL 4Z7IA 1KPRB 1MCRA 1KPUB 4OFDA 2DTML 1DVZA 1AZBA 2H6PA 2XY1A 5E00B 1WLHA 1D3CA 4ABQA 3ZBMA 1IEAB 3QYMA 1URLA 3HS8A 1ZTXL 4X0NA 4UM8B 1JNHA 2QHRL 1FDLH 4U1SA 5FO7A 1TNNA 4XN2A 3DJZA 4QRRE 5EU3B 3L7FA 4AQEA 3TBSB 5JW4Q 3QO1A 3LHAA 2Z7YA 4XCEB 4L9LC 1FH5H 1AR2A 3H4FA 2IV8A 3QHTC 1P7HL 1NKOA 4JFZL 5IJCC 3NA9H 1QRNE 2VDRH 5I6PA 1BQKA 3OKLA 4U1GB 3QWQB 4KK8C 4QWWD 3MCYA 2JXMB 1EEZA 2FQEA 2FB4L 2NY7L 3MNWA 4OLVL 4XNYH 4XP6H 5HHNB 2RFXA 4KVPA 3BYTA 3VXNB 4R7NA 1XAKA 1TKWA 4XNUH 4NFCA 5CINH 1MJ7L 1AKPA 4POUB 2XWJA 2JMRA 4POYA 3ROLA 3SPHA 4FZ8L 1A7RH 1RFDL 2V0AA 2XPYA 4FJYA 1QPPA 4N8CL 4X4KA 4ODWB 3RDTB 3RKPA 3ZDYF 4OKVA 3BPOC 3CC5B 1L4IA 3VXUD 3FU5A 5E51A 1HK6A 1MIMH 3F5WA 5IJVA 2VISB 2WZPD 5DYFA 3FRUB 3QP3A 4JFED 5M95B 3TBWB 2BHZA 4JM4L 3KPQA 5KSAC 1WTLA 4KJWD 1P53A 1JZIA 3GSNA 4LQ1A 4LARH 3PWLA 1WCBB 2V7HB 5E1GA 2BIIA 5F0MB 1A1NB 4NZUL 3GSOA 2FQGA 4WTQA 3UTSB 3WUZA 2OCFD 4C4KO 5HGDB 1KIRB 3UH8A 1G7JB 3S35X 5I1GH 1C5BH 2FJUB 5BVJA 4X7EC 2AC0A 3EGSA 2IALA 3H6AA 2IQAA 1ITBB 2WLIA 2ZWLT 5EBMA 4KRPC 4UM9B 1FVDA 3HC4L 1OP3K 5IF0A 4W4NA 3GNML 1MW2A 3FSVA 1JYXA 2HRLA 1N0XL 3KYNA 4MMXB 5DEGA 3DLQR 3BH9A 1WFNA 3V95A 4HOZA 1I3RB 1M7UA 3B9KB 4MJIB 3TYFA 4R2GC 3LX9A 5D2LF 2RALA 5F9WB 2HSIA 1BJ1H 3CJJA 4RGND 4OFVA 1OTSC 4BQCA 5D7IE 4ODHL 1T21A 3BXNA 3L5WB 4OD1H 1MAML 4JM2B 4WKZA 5AUMA 1VFAB 1ADQL 3MV9A 4CKQA 2E74C 1FGNH 2FJFA 1ZXQA 3TOPA 1NGYA 4AENB 2XZCH 4KUZH 2MPAL 2HVKB 4MNQE 1TU2A 1T1ZA 1NEZA 1EUTA 2IPUG 2ITCA 4AMWA 5IOPA 4LHUA 1NFDA 4PR5A 3UP6A 5DQ9A 1TQTA 4JS7A 4EJ1C 4ZFGH 1PAZA 2XV0A 4YBHA 1BIIB 1KG0A 3F62A 4JY4A 2WQ8A 5KVFL 1T2QH 3JWNC 4HC1A 4HK3N 4JFDE 4C55A 2W9EL 1ZWIA 1K4CA 2O6PA 1MY7A 2ERJB 2Z8VC 3PJLA 4FL4C 1ECZA 4LLWA 3VMNA 2APWA 1OGSA 1EBPA 3BDYH 2GABA 3F7YA 4G6FD 2WLJA 5I16A 5BO1H 1TNMA 4JFQA 5ICZA 3QQ4A 2AAAA 1S3RA 3KL0A 4B9KC 5EA0L 1P84J 3NRPA 1YYLH 4WCYL 2VLRD 3MNZA 3N40P 4XXCA 2FQDA 4PUBH 1RZKL 1VPOH 5MEOB 4E9LA 4TTGA 2QR0A 3O8XC 4PJAE 4NS0A 4O2CA 5JHBA 1SXZA 1R19A 3HE7A 5J11B 4UT7H 3GBDA 2PLTA 5E6YA 1U21A 3C6SA 1WBXB 4LEXH 2YPVA 1URIA 1M71B 2ZCKH 5FYKH 2RR3A 1E5YA 4MS6A 4DZ8B 1BSIA 3P4OA 4WW2C 4UILH 4DCQB 4AMKH 1T0NB 1QSFB 4M43H 2R0LL 3ABKB 2DWTA 5DSCB 3QC6X 4CVZB 4P5TD 1SEBB 5EUOF 4MMYB 5D2NB 5ADOL 3MN8A 1BVZA 2F5AL 3VSTA 2X44D 3D2TA 1T7WA 3M1BB 3N2JA 4B9FA 3NJMA 1K2DB 3CDZB 2OMUB 5ANHA 2DYPA 5FFGA 4KTDH 5GGTH 5ITFA 1KF9B 2YD7A 2A9CA 2BP3A 1MELA 1LEKB 1A25A 3DSNA 4H0IA 1SEQL 5KVMC 2EDEA 4Y1AD 4PJ9C 2WO3B 1CK0H 1O7DC 3VA6A 4L9LA 1SM3L 3IWUA 3VXPB 2AEQH 2LTQC 4XVOA 5EOCJ 4HP5A 3V6ZB 2QSCL 1CGYA 2FWSA 3LS5H 3C5SB 4N1HB 4YLCA 5DHYA 1MDTA 4AM0Q 5AWNL 1WBYA 4F80A 2BRRH 2X2IA 4HKXB 2YD8A 1OTUD 3ATBA 3BZDA 1CFNB 1WRFA 8FABA 3U4BH 3T3PB 4XR8C 2HKHH 2X6BA 3HC0B 4LLAA 4JW3A 1GGCL 4MHHG 3V0IA 1SFHA 3UYOD 3WDIA 3PAYA 3FN0L 4B41A 3BSHA 5EO0A 2A2QT 3TFBA 1E9QA 4AYGA 5IJKC 2NT1A 5KUKA 1CLZL 4UV7L 3U9UA 3CQQA 1E50A 3IJYB 3TJHC 1RV6X 4IIQB 4TTDD 2RD0A 1PS3A 3PWVA 2VZ1A 1G6RH 1BP3B 4JPQA 4IBYA 4CA4A 3BEWB 4PJDA 2L4OA 4MD5B 2B1HL 2RTTA 2CBOA 1JF5A 4XE0A 5KSAA 4LB8A 3HUJE 2N7AA 4GMSL 2WNKA 2XA8L 4NQCB 3QXVA 5A7EA 3G04B 2AHIA 4KY1H 1SUJA 4G6MH 3D39E 3ZQ9A 1NCJA 4CU6A 4L9DA 1K5NB 3GJFB 3S6CA 4P2QA 3MACL 2Y3AA 3ZDYB 1DJGA 1J5OL 1DDTA 3IXTB 3KYAA 2HLEB 3Q44A 2A4CA 2ZT9C 4TPRH 1NGWB 4U1HB 5E9DB 3C5XA 2C26A 1OP5H 1ACXA 3FHEA 4HPOL 2X10A 5J13C 2PCXA 2P4AB 3GSRA 1XGQB 3JV4B 4N0CC 4PJGA 4WI9A 4TRPL 3VYPA 2HXAA 5DJXB 4PRDA 3IDMA 4LOEA 1YUKB 2ROXA 1NMAH 4YHOL 5CU9A 2P49B 2ZG2A 3MCG1 3RUGA 2LAAA 2J6EA 3BSZH 5GJTH 5F96L 2IAMC 3SE4C 1XDTT 3CZFB 4H1LG 1MCWW 4BD4A 1YYMH 3BQUC 5EBWA 1MRCH 1MFNA 4JFFD 1BLIA 3PNWA 4OCLC 5E0FA 5EOQH 5HJ3B 1C5DB 4AUUA 5FCSH 3EJYD 4NKMA 4XH2A 4ZD3L 3CFBA 3LKSB 3GUTA 5CJOL 2ZD0A 3UXFA 5HJBA 4FADA 2A6DB 3L45A 4QTFA 4R26L 1S5IH 1FQ9C 2WBJD 1DQKA 5D2LB 3T2QA 5JPNC 4P3WA 3BT2L 5ECGA 4R4BB 3S96B 4BJLA 4X50A 3D18A 5DD5L 5IROC 3EG9A 4FQIH 4IHOB 2GBVA 3R4RA 4Z7VE 3UZQB 3VJ6A 1INQB 1R47A 1ZV9A 3ARBD 4KZDH 2IOOA 2FHFA 3IU3A 2NTFB 4J6RL 5D4IA 2CKNA 3L3HA 1X9RA 1EWHA 3FTXA 5DRZB 3NIGF 1NC4D 3VWKA 4L8BB 3ARGB 3LKOB 2BOLA 1ZVSA 3QORC 4E42A 5T1KD 3RBGA 4LDLB 3ULVL 4QRSB 2KYIA 2ZOKA 1UEMA 4FTVD 3KAAA 4N25A 5DHEA 3FTZA 1Z66A 1AGDB 1FIGH 3ARQA 3II3A 4P49A 5I17A 1YO4A 2XN0A 4JFXA 4MD4A 2WQUA 3LPPA 4ZO7A 4DQOH 4X4YA 2ADYA 4GSDH 5JDJA 1QUNB 3SJVA 2XIIA 1L9QA 1MI5B 4G83A 4FYTA 1AI1L 4OLWH 5BRQA 4U6YA 1ZVHA 4LE8A 1KLUA 1NGPL 1RUPL 5I2IB 2UXTA 5HHQB 4U1NB 1QLEL 4RX4A 4Y8DC 1J10A 2WVUA 4XPFH 5HYSA 5I76B 4Y16D 2BNQD 1X5KA 3IWVA 4TSCL 5ABAA 4FXGB 4YQXH 4AQ1B 4LNRA 2BP0B 1PEZA 2P26A 2VDLL 3SGJC 1WH0A 1FFNB 2PW2A 4OZFA 1DTUA 5H94A 4P5RA 5BVPH 2XN9D 1O6TA 1P69B 2IWEA 4KKBD 3VM7A 5C2UB 2VKXA 1G7LB 5EUOB 1UVQA 1Q9LA 3FHQA 1CO1A 2YAFA 1N3NB 1D5BA 4YBLB 4U6VH 4GAJL 4GKLA 4I18B 4NRXB 3T4YB 2Z31C 2F1BA 3REWA 4OCXH 1HWWA 1FN4B 4YPJA 4D8OA 4FG0A 3D5OF 1DL7L 2A6JB 4G9FE 4S0SD 5IVXB 2NY2B 4ECNA 1KDIA 1PG7X 4Z9KB 3NCBB 1P6AB 1UT1A 2UV3A 2DQCL 3RA7L 1EDHA 1SLWA 1KLFA 4BHUA 3BRDA 2E76C 5C08D 3O6ML 2WBKA 1QLFA 4EI5D 4B9GA 1R75A 1CTNA 5CCKH 5IJKA 4FI8A 1CXIA 1QSVA 4PW3A 3L1FA 1NIFA 1DVFC 3HMXL 1P0SE 1UUNA 1QATA 2DOCA 4FFYH 5TFSL 4N90D 3QJZA 1WHPA 1RIHL 2Z7ZA 2LT9A 5IB2A 1IC7L 3T71A 4X6EB 1IBYA 3CMGA 1A7QL 1T66D 3PWPA 5E8EA 3UAFA 5D5MF 4LLQA 4IBLT 3EIFA 3BUIA 1U3HC 3CD4A 1HU8A 2IDSA 1PAMA 1D6EA 1QQDA 3MGTA 5GS0H 4OF3A 4PJIA 4YE4L 5E5MB 3DPBA 5E6ID 4JK0D 4WEBH 3MV8A 3P3YA 1UXMA 1SYVB 3C8KA 4Y2DC 4HSAC 3NCCB 1ACCA 3HI6L 4G8AC 1ZSHA 4GG8A 1K8IA 4I77H 3CN0A 3TT1L 1JGDB 5C8JA 4L48A 3VXSA 1QBLH 2FIKB 5IG7A 4R9HA 4DTGH 5ABZA 3T6WA 3VDCA 3W0WD 2W88A 1W72A 3HG1A 5ALCL 5I8KH 35C8L 4NYLA 1JOIA 2WBWB 4KVNH 5BRZA 2KS0A 2QL1A 5CR1A 3PL6C 3QDMA 4GUQA 4HWZA 4P46C 4BRJA 4YSAA 2QPSA 3GIZL 4Y0GA 1MHHA 1WO2A 3DJ9A 3GI9H 4LRIC 2WWNA 3PV6B 4OTXL 1I7ZA 4FZEH 4YHLL 4JO3H 1BQ5A 1E7UA 4JRYE 5BJTB 5D70H 1JNJA 2XNAB 4Z78B 2IAMA 2BWQA 4PJ5B 3SE4A 4CMHB 1E5AA 2EP6A 1KB9K 3QB7C 3APCA 5FA4A 1CD1A 3SCMD 4UIKL 3BQUA 5CEYA 4BGLA 4XN8A 1JZ6A 4IKKA 2ZSVB 3ILDA 1KGJA 4J2QA 1L7IH 4OZGA 1FNHA 2CK0L 4DP5X 4QY8A 4URTB 1K8DB 2ZKXA 4WI0A 1LJMA 4JJ5B 5KJRL 3D52A 2C8NA 1N0LB 2D0FA 4PRPB 2PXYC 3V4VA 5JPNA 3VGHA 3KVQA 4X80L 1FO0L 3FU7B 4J3OG 5FA3B 1TZGL 1HIML 1KUMA 1LP9E 2G75B 4UT9H 5IROA 4JREC 2AJ3A 5MEPB 3PLYA 4LHQB 3VMOA 2WM0A 2GUOB 3P77A 4HDIA 2C3VA 2ZIDA 3VRIA 3WFCH 1PZ2A 4CL7A 4IRJD 4OQTL 4CN4A 3VMPA 1S7RA 5I5MA 5TQ0H 2EXTA 5ISZE 1S7VA 3P0VL 4V1DE 1JF6A 3KE0A 3QEQE 5J4MA 2DLFL 4AEHL 5EORH 4XNAA 5E9NA 1WFOA 3JT2A 2GK0A 1ADWA 1FZMB 3L4VA 3WFEH 4WDIA 4WU5B 1CGVA 2QQKL 4QHKJ 2VL5A 4AQAA 3LRSB 4LPWA 1EO5A 1U9KA 2VQ1A 5E6SB 4NPKA 1NZRA 3KR3L 2IEPA 4ZS6C 3T6VA 4MQ7B 4NKDB 5IKCA 4L5FL 4NENA 3NIGB 3ZTEA 4BBWA 1RZJL 5AW7B 5C0EB 4I2XE 3O0RL 1AC6A 2CBQA 3VI4E 4F58L 1SBBA 5A43C 5DMGD 4ZFZA 3BPCA 1GZQA 5G5DB 5SWZE 3RB5A 2VDKB 3U0TB 3TTSA 3MBED 3K2IA 4N68A 5DD0H 3HJEA 3ZKXB 4HJUA 1D7DA 3EOYG 2EH7L 5SWQB 3LIZA 1YHPA 2ICEB 4W9DC 3HS9A 3SGJA 5IHLB 4IBUA 1E0OB 2QQNL 1ORSB 1AGFB 5KSVA 4GRWE 4JPKL 1WA2X 3GHBL 5IW1A 1Z2KA 4UIMA 4HZAA 5DRNA 3FB5B 1L0PA 1OCZB 2N0MA 4MJ6B 4QXTA 4B96A 4XWOD 4KROC 3RL1B 4GKZA 1HILB 2I69A 5HD8C 2OS7A 2H45A 3DOSB 3ZO9A 2YOCA 2Z31A 4O9HH 3O2WH 3ULUF 2WLYA 2I26N 3FMGH 1KXVC 2F19H 1XXFC 3T3MF 4X8XA 2J7LA 2FECL 2C7UB 1J11A 4F2EA 3N9GH 2Q8BL 5GZND 3FSZA 3ASOB 2YK1H 3HRPA 3N1PC 4A7SA 2C3WA 1DANT 4XVUC 3B9VA 5HI3D 4DKTA 4FA8A 1IM3D 3MV01 4FQHA 4WFHD 1B3IA 2FX7L 1A0QH 5T8IA 3VGAB 5D7IA 1FZKA 2AQRA 2C9UA 2NY0B 2R23B 2ZXDA 3EDFA 5C0IA 1FCCA 4NPJA 2O93L 2D3JA 2V17H 5GJSL 3RVXD 1QBAA 4LLMA 1H0DA 2DWEB 3DURA 2EUVA 5A3IC 2J4WH 1U3HA 5BQDA 3FOLA 1NEZG 4NM4H 4XVTL 2BIQA 1UEYA 4L8CB 1BF5A 4URKA 4LHUG 1MHEB 4HWBA 3E8VA 4NSKB 3STLB 4KHTL 3GMMB 4U6XB 1ITCA 2YEQA 4Y2DA 1H8NA 2EE9A 2BZDA 4JFDA 1TZHB 1RSFA 4WU7B 3FCBA 4ATTA 1OGTA 4NLAA 4Q9QH 5F1KC 1VGKB 3KLKA 3JTTB 3TS8A 4R96B 4C4KT 1KJ2B 2IC2A 5KEZA 2ICCA 2R9HD 3C2SA 3ES6B 1QTPA 4QHUB 4MLSA 3PL6A 2A77L 2DMCA 4P4KA 4QOKE 3D69B 4P46A 3ALXA 1DQLH 1LO3L 4ETQA 2HMIC 3MLWL 4PJAA 1HCVA 4LRIA 1HXYA 1BD2D 4H44C 2UY6A 3BIKA 5LAXA 1TZOA 4JFHD 3NCJH 3PXJA 2FZ3B 3AFLA 1F00I 1AQKH 2VQUA 5CAYB 3ZLQC 1MLBA 3WN5B 5DS8B 2FJHB 3L6FB 1MH5A 3NSXA 5D1ZC 5D1XB 1RZFL 4EVNA 5CKGA 3FQ4A 3IDYC 4K9EC 1F90H 3TO4B 1M9WA 1LDPL 2VT0A 2YSTA 3G5XB 1NJ9B 2PXYA 3QJTB 1D7BA 1TOXA 1HEZB 4APQC 4MKMA 5HYFA 4I4WA 4WVRA 5DI8B 2GHWB 4N28A 1GCYA 3DHMA 5I0VA 4N0UB 2EXSA 2B59A 4R8WH 1OT4A 4DFIA 1P5VA 1QHQA 1FYHB 3QG7H 3KDMB 1KYOK 1AZZC 1DQJB 2FWUA 1OF2B 3LV3B 4FQ2H 4HSCX 5IMMB 3HRZB 3I9GL 5AOIA 1F18A 3ZYOA 4J3TA 4F3FB 1N6VA 1J18A 1RK0B 3SYOA 3RIKA 1MCNA 2EAEA 2VOTA 4NKIH 4TLSA 2YPKB 1B88A 3SE3A 3RILA 2OMVA 1JMZA 1DCLA 4GRMB 1U8CB 4XO3A 5CM1A 2YD2A 3T0ED 4PI0A 1JPFA 5JA9A 3LSOA 3P9WB 1MWAH 4FLOA 3S98A 3WO4B 5HDRA 2VNCA 4K3HA 2ADIB 3I6GA 4J1UB 4QRPD 4BFIB 4Q58C 1IFHH 4BUQA 4F8OA 2WD0A 4XBPB 1C7TA 4N2CA 4HS8L 5JW4N 1U8KB 1BEXA 3DV4A 1T5XB 2GFBA 4RFEA 3BWUF 4YXKH 1TYEB 2E4FA 2AXFB 5C9JB 1RULL 2QQLH 1LO4H 1MG3C 2BY0A 3IJSB 5F3FA 1L5GB 1ZLVK 4MD0B 3WKNA 3GLZA 3HUJA 4JN2A 3O6KL 1CQYA 5AL8A 2VXTL 1IE4A 4RQQA 2X3AA 3CZKA 2X12A 1I9IL 4YUEL 4UB0L 5KS9E 2TAAA 3D39A 2V3DA 2VXQL 3DX8B 3L08A 4P3CL 4WK4B 4WV1C 5EEZA 1AG6A 4HJTA 3FQRA 2UUDH 1IC1A 1PJWA 2IH1B 3FQXA 4UBDC 3ARSA 3IFNL 5E2TH 3FB7B 1JK9B 1T5KA 3IAQA 5EOTB 1BAGA 4HJ1A 1KXVA 2OM5A 3B3IA 4PV9B 4WI2A 2FHBA 3FO0H 1ZGLM 4DO6A 1ZANH 4NNYB 3RDTD 2VL4A 1SYSA 3UADA 3GYRA 4J5VA 2VSDA 3BP6B 3RWDB 4GW5B 3NUKA 3HMWL 3WN6A 3HLKA 2WXOA 2ORBL 4L29A 1FHGA 4DZBA 4EUPG 5FGCB 4OUUA 1MG2C 4OCSL 5IW6A 4YH6A 3R0NA 1HAWA 5HGBA 1NICA 3FOMB 2NSXA 2HKAA 1CBVL 4F9LC 1F4XL 1PFOA 4KGLA 4XO5A 2ZCHH 5FYKE 2J12B 1OY3B 5DFVD 1IGTA 2FX9H 2NNAA 3T3MB 1JZ2A 2R29A 5AOKA 2J2ZB 3IAGC 2QGBA 1FNGB 3N40F 3MLPA 3EYFB 1EJ6A 3BKCH 4HPYL 3QQ3B 5IHZB 2YMXL 5JIPA 1L9OA 2QKSA 3S3PA 1QSEA 2VDML 1UURA 1JPTH 4HK0B 4UM9D 3F7VA 3VO0A 4A63A 5HYJE 4PJ7A 4A6YL 3CV5A 3JWNG 1JVLA 3GRGA 3UAJC 3FBQA 2P24B 1AR1B 4X5LA 4CILA 4G7YL 5KOVC 3B9KD 4MJID 4DW2H 3U1SL 1WP6A 3QBTB 4LVOB 4HXBL 3CXFA 4GBXB 1ZLDA 4IBSA 5J5EA 4AGLA 4JM2D 3FRPA 1YY9C 4LSRL 2CGRH 1XIWC 4XP1H 2YA2A 4XCNB 4XMWA 4RDQF 2VIRA 4ISVB 1RZGB 3OZKA 4H8WH 3ARYA 4JX0A 1PY0A 1YEDB 3PP4H 5IQ7H 4CSSA 2CXGA 5T1DL 2WK2A 3RZCB 5EU4A 4GG6A 2BIPA 4X9IA 3FH5A 3QPQC 3L16A 5LVEA 3B9DA 5D1ZI 5E8DH 3TL5A 2B0SH 4NDMB 5E2VL 4NLHA 3SKMA 3EOBB 2CWRA 3D85B 2MEJB 5D1ZA 4TQ8A 1PD6A 1GPOL 4M7LH 3EYVB 2W60B 1PEWA 2CPCA 1AS6A 3NOIA 5FM4A 5AAWC 2MCMA 1AMXA 4EO5A 4KNTA 4Q0XH 5GZOC 5C97A 3BUBA 2H0JA 1OKEA 1MCPH 1ZSDB 4YXLH 2RA1A 4Y4KB 2IDTA 1OT2A 4WNQA 3OLGA 4APQA 1KTJA 5DK0B 4KVCL 5HYSG 3BP5B 4AEIL 3OAZK 3LNGA 4X5PA 5BS0B 2XXCB 3SY0B 4LF3B 1XCTA 3DUSA 4RGMB 3K5RA 4OZFG 1EJ8A 1NLDH 4K7FA 4G6JH 1QACA 5E0QA 4JKWA 3BVNA 4JCMA 4NFDA 4DKEL 5JW4M 2Y06H 2MCPH 2QBWA 3QNZB 3V6FA 2F8IA 2W1NA 3MXVL 2KQMA 4FXLA 3LXCA 3QJSB 2ADFL 1Z1WA 1C7SA 1FLTX 1QSFD 3CUPB 3FO9A 2ADGB 2AJSL 4G9FA 4JRFA 1PIGA 2BNUB 3FB8B 3P4NB 1SFDA 3MBXH 5PAZA 1OB0A 3IPBA 2XICA 3VFWB 4PJEA 5CXPA 4UDTB 4OZ4B 2AV1B 1SDYA 3LKPA 3RTQB 3AWFA 1YMMB 5DU7A 4C56B 1T3FB 1LK2B 1WD9A 3U7AA 4ZUSB 1OAZL 2FWOB 4P5SA 1JN6A 2X4PA 1DO5A 4XPHL 1NBYB 1DBML 3EUDA 4GKSB 2APSA 3MRKA 1H5BB 4ODSL 2ATKB 4Z3IA 4BE5A 3AC0A 5DVMA 1JI1A 1CLOL 1BVLB 1M4KA 5AQ0A 3ESNA 1KEML 1JPGB 4GQPH 4NPYB 2YGVA 4KRMB 4LSQH 1OAXL 1O6VA 4A2FA 1RVFL 4XC1H 1XGPA 4GI9A 3L95A 4N22A 4WV1A 2NYKA 3S3CB 1EDQA 4OIIH 3ZMNA 2O26U 2Q7YA 1CR9H 2PPFA 2G60L 4L2LA 4YWGH 3SDXB 3TFKD 2OL3L 1OQOA 3DK0A 4YL4A 2YJLA 4XCCL 4ZMXA 1DCEA 1OXYA 3LD8C 1EERB 2B1AH 2XZZA 3LQAH 2VUOA 1FG9C 4DN4L 2XWXA 4JE0A 1S7QA 2AK4B 5FO9A 5H8DA 4PS8A 1YJDH 4LU5H 2X87A 2HCZX 3O4OB 3TZVC 1L3NA 2BVPB 3U36B 2ETWA 4IW4C 1H3PL 5J6GB 1T0PB 2PMZA 3E9UA 5DQJB 1SY6H 2GJRA 1P4UA 1LL1A 3AUVA 4NN7C 4OT1H 1TETL 5HHOA 3PHAA 1LDSA 4NQCD 2W38A 4AG4L 1ZJBA 1S78C 4WENB 3HG0A 5L2KE 2CRIA 1NFIB 1QP1A 2BIMA 5IFAH 4Q89A 2NZIA 1CXEA 5D71H 1D2PA 1ZY9A 5T5FH 4UOQA 2V2WB 2DEXX 5E9DD 1E6OL 3ZPDA 3C5ZB 3BCDA 2E86A 1UZ6F 3MRFB 2WUCL 1HOCA 4UCFA 1HJBC 5EPMA 3Q3GB 2V5MA 5TPWH 1RP8A 4K94L 4OCYH 5K69A 4NZRL 2WXLA 3EO0B 5H2BA 4H20H 4F57L 1I1AB 3I3EA 4XI5D 2J1KA 3IDIA 5ISZA 3ZE1B 3NN8A 3OR6A 4V1DA 4PGDB 1KYAA 1A6UL 2NNXA 3GPEA 4DGVL 1XIWA 3QFJD 4OH2A 3WXWH 3QEQA 3CFJB 3LH8A 3Q8FA 1J0JA 4YS4A 2R4SL 2WYZA 3LYRA 3Q05A 4NO0B 1UQSB 3U2IA 4TM9A 4S1RH 5HGGS 4H1LB 3UTZA 4K5MA 5CMAB 2WZAA 4PS3A 4MXQC 1F3DJ 1IQDA 3V7AE 5AD0B 3WCYA 1B2YA 4FG2A 4N6RB 4DQAA 4B9YA 4YDMA 5KBPA 1N64H 4YC2B 1QO3A 3FUDA 3EHBB 5I30L 2CIIB 1BFOA 5AAWA 2E5EA 2XIBA 4I2XA 5EC1A 3MRBB 5GZOA 4G7VH 4QYOB 4ZUWB 3IF1B 5TE7L 3GJFH 4OFYD 3WFZA 3ZVVA 3EJPA 1BZ7B 1KTRL 2Y3NA 3KWTA 1U6AL 5SWZA 3QS3A 4Z7UE 5DHVB 5TF1H 1L9PA 2K4AA 4A7QA 3ARGD 1AZVA 1OAYL 1OGAE 3QUGA 2H0PA 1R24A 1W0VA 1QVOB 1XF1A 2H26A 4TNFA 4XHQA 3X14A 4L1LA 4F2MB 3QEHB 4FQQB 3J27A 2B4CL 5HDQL 2IMNA 5IB1B 3DSFL 3VM5A 1HZHH 3CVHB 4K07A 1KN4L 3I50L 3RWCA 4PJCE 3B2UD 1I8MA 1EJOL 2YMOA 1XF2B 4M7ZC 2VCOA 3NK3A 5CD3A 3WJJC 1MI5D 1Z9OA 3HVNA 2OXGA 4E9VA 3LDBC 1KY6A 2WV3A 4G5ZL 2E75C 5EZOL 3MJWA 4TNEA 4M1DH 2SEBB 1UD3A 3QUML 1CVRA 2QLVB 3NYKA 1A65A 1RJZB 3CXHJ 4U2YA 3FSOA 3MA7B 4Q2ZA 2AQ1A 1FVCB 4G8GE 4M5ZH 4D9RE 2JKRM 3LKRB 4FYSA 4XBEH 3NFPB 1NPJA 1NSNH 5L9DL 5DJ6A 3QCUL 2Z65C 2ESVB 3BGAA 3SBQA 4NQQA 3LVEA 3ULVF 4R4ND 4J27A 4XCYA 1E9PB 3NP3A 4CC4A 2HH0L 3DX1A 5CHNA 2JI2A 3IETA 3U7WL 3NIFE 3WJLC 1BBDH 4HUXB 4L1TA 2EDJA 1G7QB 1WBZA 1LO5A 1IGCH 3QDGB 4FXKB 5HSFA 2H32B 1U93A 3DETC 2GW5A 1BVKB 3OXSA 4Y1TA 5I66A 3L2NA 2NY2D 5KW9L 3ZHNA 3G08A 3TO2A 2B15A 4AZ8B 1WWWX 1ZCRA 3H9SD 2YBRB 1TQUA 4O2EA 4X7TA 3SYCA 2BW4A 5ICYB 4Z8FH 4IMKA 3QDJB 4X9GA 4DF9A 3T8VA 3FFCB 2XQBL 3FZUD 2DLIA 2HPTA 1YEKL 1MPAL 2VXUH 3BPNB 2NNFA 2V2XB 3W1ZA 4IGBB 3MRGA 2XZQH 5ID0A 3ATFA 4AW4A 2UWEF 1UJ3C 3DYPA 3TZVA 3MGOB 4I48A 4N8VA 3VD4A 4UQBA 2EDTA 4HLEA 2WXJA 4M48H 4Z77A 1JBJA 3E3QE 4U1KA 3FTSA 3NBNA 5CZXC 1WFMA 3F83A 5HPOA 2BSBA 1T0MA 3QJOA 4JFOB 4N2HA 4PTUB 4XP4H 4Y4HB 2OZNA 3HOGA 4Y5YC 3WYRA 3QJUB 5F1OB 3U9WA 1V8HA 4G1MB 1I4FA 2HJLB 4FG6C 3K46A 3B7SA 4FQXB 4G8FA 4QXVA 4HCRA 3K71B 3X1GA 1Z3RA 1LK3H 1UXLA 3D4CA 4B0MM 5JDSB 2JKWA 2VLME 2FHCA 2WZ6A 1YEIH 3OHMB 1Y6KR 4DP2X 4F92B 1AY1L 3VG0L 2KDYA 3FQWA 2HN7B 1LNUB 5LN4A 3CFNA 3GS4A 3B1TA 2X05A 2EDDA 4ZSOA 2X4RB 5FPIA 3JTBA 2YZ1A 3B2XA 1KJ3L 5GS1C 2ZE0A 3KLSA 2EXYC 3IVKB 4LVNC 3K8LA 3QA3A 4PJ5D 4U49A 2DQGH 3TGXA 4BH8A 4IM8A 5LBSA 5TK2A 1NAMA 1U8IB 3KBFA 4Z7WF 5I73B 4M3JA 3ZKMC 4N8UA 3KWVA 2F7PA 2ZYHA 3FT3B 5FUZL 3KYMB 2OA9A 3QIUC 1DBJL 2ADJA 3PWJB 5B1BB 5J56B 4PRPD 1RLBA 3LKNA 3U48A 2VDOB 3KDPB 5LBGA 4ZAKB 2NY6C 2A9MH 3FO1A 1CTMA 2H6PB 3IFPA 4PWGA 2Q76A 3BC9A 3FXIC 2NXYB 3AB0C 3TH3T 2XFXB 5K5YA 2Y25A 3K0WA 5JIHA 4G80B 2FVNA 3TV8A 3WO3B 2PYFA 5IOKA 1NM9A 2XJLA 4A7GA 1JNHB 3LRLA 1HXMA 3C9NA 1RUQH 4ORZC 4U1SB 2MCG1 4HLZG 4BZ1A 5FO7B 3EBAA 1T1YA 1MHCA 1IB5A 1Z5LA 2R7EA 4J8QA 3L7FB 4OFKA 3SDYH 4OV5B 3HZMA 1F45A 4AQEB 3VAEA 3QO1B 4M5TA 3WAJA 4IBVA 2ZUVA 2F61A 3A22A 2KLTA 2OJ1A 1MFCL 1F11A 2X42A 5KS9A 2LGNA 4MJ5A 4LPUA 3HZYB 4POZC 1EEZB 1OIOA 2DQTH 3ZTJH 3MNWB 1KPVB 4Z6AT 3E8UL 3WJJA 5IJBC 1HWGB 2RFXB 1I3UA 2EZ0C 3ZE2B 4HOXA 4X83A 4R7NB 2D4DA 4HKBA 4XN1A 1TKWB 4GOSA 3OSVA 4JRXD 1GH7A 3M17B 1JS4A 1EAQA 3AWEA 4XO4A 2XWJB 3ROLB 3RWJA 4X98A 5GRUH 4B9CA 3LPFA 3LNFA 4JFYA 5I6XB 3FQNA 1WT5C 2EDRA 2DWXA 1N7ML 3QEGH 3L3KA 5JR1L 2H3KA 3G6DH 1KCKA 4RLDA 4OR1A 4OKVB 1EGJH 5CP7A 4YFDB 3F5WB 1KCBA 4UAHA 4IJ3C 3WNJA 4CNIB 1NKGA 3C2AH 3U7YL 3H9HA 3VQ1C 3GMOA 3T1FB 3G9VA 1LE9B 3Q2LA 5GSVA 1HQRA 3KPQB 5EU5B 5FDYA 3GSNB 5TE6L 3WJLA 3PWLB 1WZ1H 2Q5BA 3FT2A 4HFUH 3R18A 4PG9A 3PABA 5HYJA 2GSIA 3GSOB 4ZUVB 2TSAA 3TJPA 4UMGA 3KL3A 4JG5A 2KZ1B 4DN3L 1M1SA 2IOIA 1GYWA 4HH8A 4JQIL 4OLUL 4U3SA 5BVJB 3EGSB 4DK3A 2ZF9A 3ATAA 2IQAB 1AOHA 1ZDSA 2WLIB 2GBAA 5EBMB 5I0DA 4HEME 1I82A 1FVDB 5IF0B 3S9DB 1WK0A 2H41A 3ATDA 5LWYH 4HW6A 1QLRB 3OKKA 1MF2L 4IU2A 5DEGB 3BH9B 2IJ0C 2MOVA 3FRPG 1CZ8L 1CGSH 1GAFL 2Y2TA 4HGWA 4Z18A 3TYFB 2CO4A 1G9EA 3CSFA 2BM3A 4H2CA 4XOEA 4FNPA 1N8OE 5FFLA 1YN7A 4NRZA 2NNRA 1UJ3A 1BECA 5KVGL 2EO1A 5DVOA 4HV8A 1QPKA 2VO8A 3BXNB 4WKZB 5AUMB 1J9CT 1GGYA 3MRDA 2L0DA 2FJFB 3X3GL 1NGYB 4PB9H 2WWOA 1QLEB 5EDXA 2N7SA 1UA7A 1TU2B 4RA3A 5F7EH 4JUSA 1NEZB 4P2CG 4Y5YA 3SDAB 2VDNL 1YN6A 1KB5A 2ITCB 3MREA 4LHUB 5CEZD 1MAJA 5IOPB 1NFDB 4PR5B 3L54A 2VDLB 4LP8A 5DQ9B 3HVDA 1GC1H 4BQ8A 2V3EA 1BYPA 4JY4B 4P3DB 3HI1A 3MA9H 2E8YA 1ZWIB 1K4CB 4M8RA 1KV3A 1OHQA 1T4KA 2CUIA 2EDBA 2LE9A 4MCYA 3SKUD 4MDRA 4LLWB 3QFGA 4PWEA 5CBEB 2Z8WC 5GS0C 3KBHE 2DTSA 1HHHA 3WNMA 5I16B 2GG1A 4WW2F 4XNZC 4JFQB 1D7CA 5ICZB 1FDLL 5GS1A 4KI5F 3FBKA 4TSAH 4NJ9H 2WVTA 2Q6WA 4N86A 3IXAA 2QVKA 3EH3B 3P3TA 4NO2A 5GRYA 4OI7A 2NYZA 5D4JA 4PJBF 3DX6B 3NJIA 5D1XD 1GGIH 1Y0LA 2F54D 5DJZA 1FH5L 1XF4A 3RVWC 5BV7C 1FYTE 1ED3A 4OF8A 3GDBA 3OF6A 4X6BB 3NA9L 2VDRL 3TO4D 3X13B 3QIUA 1YSOA 4U0RB 1ZXKA 3MYJA 4XNYL 4XP6L 4HJEA 2AXGA 4MZ2A 2J8UF 4DP9X 1BZ9A 4ODTH 4XNUL 5CINL 3U9PH 3AY4C 4FI7A 1SN5A 4N8PA 5DD6B 5CD5D 1R3HB 5F7HA 4UYQA 3IRZA 3L8QA 5F7UA 5M94B 1M57B 2VR7A 2D03H 1A7RL 1P7QB 1PKOA 1PLGH 1UFGA 5EEUA 1KBWA 2BSTA 3ZTCC 2DYPB 3AJ7A 5ITFB 3LY6A 3MRIA 2JCWA 5IHBA 1I8IA 5IV2A 4HCFA 3HLAA 1C08A 1MIML 3LZOA 4L9LB 3A5VA 3CIAA 5C09B 1YCSA 1ZIBA 4BKLB 4NAJA 3ZE0E 3DO7A 4LCYA 2WNXA 2ZUSA 1DVSA 2R69H 3AS2A 4NWUH 2D31A 1QBMH 1WQVT 4LARL 4HUVB 5DHYB 1RJYB 1WBYB 1MFAH 4RA0C 1JD9A 2DD8H 4AGNA 5F7WC 5JO5A 4KV5E 4L4VE 8FABB 3QK0A 2CSPA 1H8SA 2Q10A 2KKQA 5F21B 5I1GL 1C5BL 1Q9KA 1MNNA 2BP8A 5EO0B 3GMPA 4OI8A 1E9QB 5EF2A 3KL5A 3QIBC 1Q1JH 1WT5A 32C2B 3H53A 5AL0A 3U9UB 3VI3E 2WLZA 2PWFA 3JYCA 5HY9A 3PWVB 1SGKA 3WI9A 3H85A 1HFUA 3BPOB 3E3QC 5BZXA 2AMUA 3GWJA 2EDWA 2Y07H 4PJDB 1ETB1 5C0AB 2ZCLH 5CEXA 5KAQF 3U0WH 1N5AA 2EYRA 3WTWA 1YEGH 1CDCA 1FO0B 5L2KA 2YXWA 2YZ8A 5KSAB 4OD1L 1HCFX 5F0PB 3ECWA 2WZ5A 1UH2A 1FGNL 1XL6A 3IDNA 4KC3B 4W9FC 1CTOA 2CIKA 4KK5C 2IFFH 1CI5A 2XZCL 4KUZL 3QIWC 2BOBA 3FUIA 3LXUX 5CWSA 4CMMA 1X5JA 5IR1A 1WAAE 2P8LA 3N55A 5HI4C 4P2QB 5FB8A 4YSEA 1AP2A 4QHMA 4P2RD 5DRXA 3ECBA 1RAMA 4B9PA 5C0RH 2JJSC 4ZFGL 5AW8B 2XVBA 3WHE0 4KRPB 4XHJD 1T2QL 4PJHE 2IH9A 2HB0A 2XV2A 3O3AA 4KDTC 3SPVA 1E27A 3P3UA 4PFEA 3CDCA 3GSRB 1KGCE 4K3EH 4PJGB 2BRQA 1U2YA 3ULUD 3BDYL 3IDMB 4PRDB 4BKTC 5BO1L 1LEGA 3KPRB 4R2GB 2DKUA 4EUPB 4CADB 3RUGB 3MRHA 3NZ8A 5MENE 3B37A 1EFQA 1YYLL 4WKXA 5MI0C 1R5WB 3AVEA 3W5MA 4RNRA 2VMFA 4PUBL 1VPOL 2OYMA 4E9YA 3PNWB 4PLJC 5C07D 3D3VE 4NKMB 4XH2B 4UT7L 4D0CA 3MV7E 4N5ED 4QPEA 1HC1A 3P4MA 1AR1D 5CCHE 4ZYKA 4LEXL 1L0QA 5CCGE 2ZCKL 5FYKL 2XQYA 2W9LA 4GINA 4HD9A 3ZK0A 4UILL 4AMKL 1LHZA 4JO1H 4WO4C 3DK2A 4W9GC 1ORQB 4M43L 4Z7UA 3D18B 5HYEA 2WXGA 2BXYA 1FFRA 3OR7A 1BVOA 1OGAA 3VJ6B 1GY1A 4FL4B 4RMVA 4YHYC 4BA8A 4S2SB 2X89A 2LLLA 4Z7QE 3IU3B 4FQJH 1IM9A 3R06A 2VR6A 2W0FA 2WQSA 2Y72A 4HS6A 1FNFA 1VLXA 3AT0A 3RZCD 4PJCA 2NUPA 1ZVSB 3OGCA 4G6AD 4HBQA 4KTDL 5GGTL 1XCWA 2A74C 3FUJA 4E42B 3VFRB 2JQMA 3D4YA 4B9JA 2LAGB 3PU7A 2ZOKB 3O8XB 3D85D 1CK0L 1DSFL 4IDLA 5I74C 2AEQL 3NH7H 2Y4SA 1LWRA 2FBOJ 2MOGA 3DXAD 3FQTA 3LS5L 5KVDH 5I17B 4MD4B 4X4YB 4R90H 1AJ7H 4Y4KD 2BRRL 4WW2B 2KERA 3I02A 3QULB 2WVVA 4GQRA 4JQVC 4P5MA 3U4BL 1U4FA 2YUZA 2HKHL 1KLUB 5L8KB 1JZ8A 4G8GA 1OQXA 3AY4A 4AL8C 3HPJA 2C34A 5HYSB 2D7MA 2H1PH 1JXFA 3RPIA 2Q2LA 1FAKT 5GISH 4XPGH 3G5VA 4TQEH 3EO9H 3MNVA 1HL4A 1IBHA 2PN5A 4LNRB 4HMEA 3RX8A 4H2AA 4XN5A 4D9LH 4PLKC 5IM7A 5H94B 3G6JF 4OZFB 4WNJA 5KJ7E 1G6RL 1HI6B 2YC1A 3H54A 4PJ9B 5FYLD 1E6JH 2EINB 4AE0A 3LN4A 3FF7A 1OANA 2LTQB 2J8UA 2XYBA 4L37A 1UVQB 1Q9LB 5KOMC 1QW9A 2R0KH 2CM6A 3ZU8A 4WJKB 4KQ0A 1U92A 4PRHE 3REWB 4TLUA 5C0BE 1INDH 3RTQD 1YMMD 4C56D 4KY1L 4G6ML 3HC3H 2DI8A 4JY6B 3OMNB 2KBGA 3D9AH 1EHNA 3CN4A 3ZDZE 3TEYA 3ZZLA 1QLFB 1FAIH 2VLLA 2JELH 3KLQA 4I3GA 4PRBB 4TPRL 1RLWA 5E23A 2QADD 5I9QC 3WY3A 5CBAA 3ETSA 4R5TA 1IAOA 2I9LB 4ZPTA 4N8VG 5IB2B 2I24N 3FTGB 1NMAL 3PWPB 3ZGHA 3A6BL 3E6HB 3EDEA 3VXME 1X6LA 4C4BA 4LLQB 2EXWD 5AFAA 1F3JA 3BSZL 4ZXBA 4KAQH 3MGTB 4PJIB 3DPBB 2XWTA 3M7FB 3MV8B 1YYML 5IQOA 1MRCL 2ZX6A 3CFIC 5EOQL 1L9MA 3C8KB 3QIWA 1W91A 3I75A 5DLLA 4GG8B 4AM0A 1U58A 1K8IB 5C8JB 2LVCA 2B1OA 2I07A 4FJ6A 5IG7B 2I60H 5IB5B 2B14A 3MRLA 2AK4D 1S5IL 3MRRA 5IT2H 2PW1A 2JJSA 2H47C 5HI5D 3JUZA 4NAMA 4R0LB 4NYLB 5DJCB 3NJNA 3JTSA 4FQIL 1ES0A 4M03A 1ACZA 5I71C 3EJRA 4PV1C 3TVMC 4J6IA 5J13B 4FYRA 1H3XA 3QDMB 4HWZB 3V0VB 4KZDL 4JDVA 5B1AB 5L7XH 5LHDA 2IAMB 5DMIH 2D9QB 3PXHA 5FOBA 1VKXB 5FA4B 3V6OE 4F1ZA 1JNNH 3BQUB 5CEYB 1PLCA 1EZUA 1A21A 3D1MC 1QFWH 1DSYA 5LCVA 4ADIA 3VTMA 3C5ZD 2P8MA 3OPUA 1FIGL 3UAEA 5FUCE 4AK1A 3DVGA 2C9AA 3NA4A 3P0YH 3VD3A 1NCOA 4DQOL 1JWMA 4GSDL 2QKIC 3V4VB 1ZLWK 5JPNB 3KLHC 4WO4A 1BW8A 1KTBA 3F84A 5EFIB 4BFJA 1I1AD 3CHQA