1NCHA

Structural basis of cell-cell adhesion by cadherins
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
98
Chain Sequence
GSDWVIPPINLPENSGPFPQELVRIRSGRDLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of cell-cell adhesion by cadherins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion protein
molecule keywords N-CADHERIN
total genus 19
structure length 98
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1nchA00
3LNHA 4NUMA 3K6DA 1EDHA 1NCIA 3Q2WA 4AK1A 5KJ4A 4AQ8C 5CZRA 4ZT1A 4QD2E 3PPEA 4ZMLA 3LNIA 2YSTA 2A4EA 1L3WA 5CO1A 3Q2VA 2OMZB 2OMTB 3K6FA 4APXA 4NUQA 2WD0A 3K5RA 4XXWA 3K6IA 2OMXB 2WHVA 4ZMPA 2O72A 3UBFA 3Q2NA 4ZMXA 4ZMOA 3Q2LA 4ZMVA 4ZTEA 4NUPA 4AQEA 1ZXKA 2OMWB 4AQEB 3LNDA 5JYLA 1NCHA 1O6SB 2YQGA 1ZVNA 4AQ8A 4ZMYA 3MVSA 2V37A 4NQQA 1OP4A 3LNEA 4ZI8A 1SUHA 2WBXA 2OMUB 2OMVB 4ZMWA 4ZMQA 1FF5A 4OY9A 3UBHA 2X2UA 4AQAB 3FF7A 2WCPA 4XXWC 5DZVA 4AXWB 1WYJA 2EE0A 1NCJA 4ZMNA 2A4CA 4AQAA 4ZMTA 3FF8A 1NCGA 2OMYB 5JYMA 3K5SA 2QVIA 3UBGA 3LNFA 1WUZA 2QVFB 3QRBA 4ZMZA 3LNGA 4APXB 1Q1PA 4AXWA
chains in the Genus database with same CATH superfamily
1D9KD 1SRDA 2EC9U 4FXTA 2NY7L 3ABMB 2B59B 2ZP0T 3WMPA 2EAEA 3FOLB 2WVVB 4C54A 1CXEA 1XXDC 3WE6B 1S6NA 3WO4C 5IMLB 1UWEL 4IU3A 4Z8FH 1FNHA 2A2QT 2A9BA 4IKIA 2Y7NA 3RDJA 4NWTL 3QJUB 3VTMA 2OI9C 2CDFB 2HLAB 4LSPL 1XCTB 4ZQKB 2JLPA 3W37A 3EXLA 3EUDA 3BKCH 1OOWA 4NYLA 1WPCA 5E6UB 1HWGB 1PMYA 4FA6A 4KKCD 1G0XA 3OX8A 4N0YH 4MX7A 5C0AA 3HI6L 1FO0L 1DN0A 5C0NC 5CLYA 5F0JB 1CN4A 1KCRH 3QDHA 4D9RD 1MFUA 2HA1A 1PW3A 2CUIA 3QORB 1PEWA 2XVGA 4JW3A 2WD0A 3M7FB 4FA8A 4JDZB 2D4FA 1QSFB 2YMXH 3LHPH 4M62L 3H3KA 1WFJA 4J3SA 5EIIG 3UEQA 2YD4A 4U6HB 4YHNA 1A4KB 2AJYL 3MROB 3O3DA 5T1KD 2X1WL 4F15B 2JH2A 4PGDB 5AVSB 5C0EA 2YAQA 4Y8AA 3HG5A 1D5IH 4EDWH 4ZQTA 3CPLA 4Z76A 1DE4A 2EYTB 2OSLA 1I3RA 3AMLA 3U7AA 4E9WA 3TEZA 2EUVA 4AQEA 5DHDA 4DP9X 3WFHA 4Q9CA 3KYOA 2V9RA 4PWHA 3I9GL 4GKZA 3AXLB 3IJ7A 2WBJB 4FTVD 3US0A 5KTEH 4F7PB 1AGEB 1O0VA 1XF5A 1KXQA 1NDTA 2AEPL 4X5XB 4XXCC 1YNTF 1WC7A 1IGFL 2GIMA 2J8OA 3CH8A 4H8UA 7PAZA 1AZNA 1DLFL 3EZ8A 4O2FB 3DX9B 3EGDA 4PJGF 5CKAA 5D5MF 4APQB 1JZFA 2J88L 4ZTOL 3HHSB 3A24A 1ZT4A 1AKJD 1EH9A 1G9MH 2ZKHL 1J5HA 2PCFB 4YHOL 4D7PA 5D7LB 2QKSA 4ZAKD 4HLEA 3BRGC 4MHHG 4GUQA 1BGXH 3MBEB 1QP1A 5JORA 2XBTA 2J72A 2BSBA 3IKCA 3QHZL 4TULH 1OPOA 4S1RL 1VGKB 3THMH 3D3VE 3UGXA 3PJLA 1MNNA 5I76A 4A7GF 5IIEB 5GRUL 5TTRA 4MASA 5MHSD 4NI6A 1Q94B 2I07B 2OZNA 2Y1YA 4HS3A 2FBJL 3T3ME 5F3BB 3L3OA 2AC0A 3EJPA 4CVXA 4FAAB 3E8UL 4FNTA 4HOWA 1LEIA 5FWQA 3SB3A 2ZAHA 1JI1A 3OXSB 1FG9C 3IDXL 3L4TA 2GCYA 3P0VL 2HT2D 3C75A 4Y4HA 4EI5B 1WTGT 2LGNA 5DHVB 3ULVH 4BGLA 2MNUA 2OR7A 5D1XE 3SPVB 4QR7A 1ZHBB 1II4E 1KGYE 2ZX5A 4F5CA 5C0RL 3GHPA 5EN3A 1R9FA 3NCMA 4JY4A 4Q6IC 4ANVA 4OZGB 2P49B 1NMAL 3QJVB 3CDZB 3GXTA 4RFEB 3VXQB 2NX5D 4LNRB 4XWGL 2AMUA 4GRMA 4K9EH 1NCOA 1MIEL 3V4PB 5JA9A 1QHQA 1J86A 5EG6C 5DHVA 1RJYA 4KTGA 5HDOA 4YDNA 1RPKA 5C08E 3AWEA 1B6UA 3DV6B 3TEUA 5JQIB 1T2QL 2A9CA 3BQVA 1YPZE 4OCYL 4XPHH 2H41A 2VXQH 5AALA 3TN0B 5MERA 3TF4A 1M05A 3QUZA 3KPRD 4FQQA 5F1KC 5FYJL 4OD2A 2KDYA 3BPLC 1I1AD 3LXAA 4MRBA 1B3IA 3OBAA 2AGJH 1BEYH 2B5IC 3L3OC 3C08L 3RX7A 3KYNA 4DFHA 3SGKC 3TO2B 2EE3A 3NGBB 3KPRB 1FVCB 2LW3A 3Q48A 5D1QC 3UPCA 4LEXL 3PWVA 5J1AA 3D8MA 4JVWA 3K4AA 1S5IH 4AENA 4HHAA 1ADQL 4HAFA 2C1OB 4FFVC 3O8XD 5EOCJ 2GG1A 4IU3B 1S7QB 1UFGA 1C8PA 3QDJA 2MOGA 4NHCH 4X50A 3VFOA 3IU4H 1KYUA 2KZBA 4O51A 2LOEA 2I26N 4WTQA 2A74B 1KIRB 4NO5B 3FTZA 4PW9A 3D39A 4Z7WA 4LE8A 3IMUA 3L3JB 4A37A 4JHAH 1WZAA 1KTKE 3BT2L 4I89A 4M1DL 1YQVL 3B9KD 3KS0J 2VL5A 3OSKA 4YHYC 1KJMB 1IFHL 3FB6B 2YLHA 1PYWB 4NO0D 2ATAA 1WBXA 1IQDB 5J0BA 3LS4L 5DRZA 5D9SB 1S5HB 3RWEB 1KBKA 2LQRA 4P49A 4RRPG 2OM5A 4Z7OF 3JV0A 1XF5B 3W0WA 5C9JA 5HP5A 4F2MA 3EFOB 5D1QA 2ZF9A 1HXMA 3X2QB 3F7YB 3B7RL 1YEWA 4HSCX 4AL8C 4OVVA 2WGXA 5E1IA 4APXB 3SDXA 2FSEA 3U4EA 3LEYH 3I50H 3Q2WA 2EE6A 3DX4A 4XNYL 2F53B 1CGVA 4R2GC 1ZXQA 15C8L 4HWBL 5D2LA 5I1GL 4GRLC 5KVGL 1YEJL 4AIZA 3V5KA 2A5UA 1ZRUA 3MBXH 1IM9B 3L3GB 1G43A 3P54A 3Q8FA 5CZRA 4FQXD 1CL7H 1JERA 4LFHD 3S37X 2E4FA 3FO9B 1SXBA 3PCYA 4ZUWA 1IC5L 4ECNA 5GS1B 4E5XB 8FABB 4U1SA 1OTUD 3BMVA 2BIHA 2C8NA 2PP8A 4K3DH 3W3BA 5IQ7H 4W1TA 1H6TA 2Y7LA 3UERA 4B5ZA 2CALA 1TQWA 3QDGD 1H8OA 2GSIA 2J8UB 3VM5A 1OAUH 5A7BA 4GMSH 4N2DA 5DJ2A 1WO2A 5IROD 3CFDA 4DP7X 3MSPA 3VXNB 5IEKB 1LLAA 1V7NL 1URLA 2DJ4A 2H8PB 3MNWA 3U79A 1QEWA 4F24A 3ISYA 4ZS7L 3OAZK 4LCVA 3VXTB 1IE5A 4C56A 3JZ7A 1KLGA 4CC4C 4E42B 4F9LA 1UEMA 2XACC 4AGQA 2BK8A 1TTGA 2APSA 2MCMA 2Q2LA 1L5GA 4JQIH 4P23B 1CE6B 2RD0A 3NZHH 2AEQL 3MJWA 4UINL 4Z6AT 2JJWA 3HE6B 5CEYA 3KLKA 4XVUD 1RZKC 3NOIA 3K6NA 2DWSA 3QUZB 1OP3K 1BOGA 4DAGH 3UAFA 1UT2A 1O6SA 5T5NF 3GGWA 2KHAA 4G8GE 3EGXB 1QSFD 2Q87A 3D33A 3ES6B 4WI4A 4Z7UF 4QRRD 1BQHA 4AZ8B 1FG2B 4G6AC 2KYIA 3ARXA 5LBGA 3LRSA 4WO4A 3NG5A 4AV4A 4IRSA 2I9LB 1U8KB 1UFUA 5A1AA 2I9LA 5AUMA 2J7LA 1DVFA 3APCA 4K23L 4LASL 4KTYA 4QRQA 1M56B 1I7TA 4RFNC 4JKPH 5E8PA 4OJCA 2LABA 4B0MM 4NQDD 5KZCD 1MHPL 2Q1EA 4UNIA 5L2JA 2Q86B 5E4IA 3A6BL 2DMGA 3L4YA 4Z1PA 4CMHB 2C9SA 4ZMNA 1BD2A 4RMRA 4TRPH 1NGWB 4PYGA 4MA1B 1VDGA 2NPLX 3CN0A 3H2WA 3QULB 4QRFA 4RRPA 3PP4H 1OAQH 4N22A 1QACA 3W5NA 1JE6A 5I6NA 3EIFA 3PGFL 3BQUA 2BY2A 3UOAB 1KF9B 4DESA 4NQCB 3TYFA 4F7EA 3EJCA 4UM9D 1F58H 3GIVB 5E9DE 2K6ZA 4KROB 5JXAH 2EDBA 2QHRL 3QFGA 3E1ZA 3FQRA 4HJTA 4FDWA 4JE4B 4XXDA 3GM0A 2B2XH 2KT6A 3MI6A 4LGRB 4RSVA 1FE8H 3QR0A 3RKDC 4QRTB 2R0ZL 2KLSA 5F44A 1PLGL 3FRUB 2PXYC 5TGBB 3OJVC 1DSWA 2BFGA 1OF0A 4Q6IB 4YR6B 4PRBB 4GAJH 4BFRA 2DZEA 3L3GA 5EF1A 2XKSA 3HMWL 3ZTNL 4HCRL 2YK1H 1F1DA 1RZIA 3UIYA 3U46A 4W93A 2ZUTA 1GOHA 3REVA 2GBVA 1H15A 4TYUA 3ZIMA 3E8VA 1P69B 5CCHE 6TAAA 1OQXA 4OCMC 5MEPA 4NN6C 1DJWA 1CLYH 1IVTA 3LZLA 5MENB 4G8AC 2DQUL 1R47A 2YSSB 5SWSD 3MUGA 4NQDB 5G4OA 3IE9A 2K7QA 5EO1A 1M71A 1KGJA 2X44D 2WXNA 4LSVH 1T0NB 3MJ9A 1QTPA 5D1QB 3FT3B 4AQOA 1BFOB 4Y5YC 3L9YA 1ND0A 4EIUA 1IGCH 2EO7A 3PNRB 3P02A 2BCMA 3VCLA 4LZKA 2M83A 4UMGA 5LWYH 1QTSA 2HJKB 2NY6D 1JNNH 3HN5A 4I5BB 5FM5O 2AEPH 3ARGC 3P73B 1F3JA 2HG5A 3N42F 4BRJA 2W81C 4WENB 5I1KL 2IDSA 2XXGA 3H9SB 2UYLA 3GMRB 1NICA 2UZYA 2Q8AH 1YYML 2OL3H 3T8XA 3UTSA 1RH8A 1JHLL 2YPKB 1T7WA 2AHIA 3ECQA 4XX5A 4CILA 5ISZE 1LL1A 3GIZL 3Q3GA 4LCUB 5PAZA 3LIUA 4JANA 1KTRL 2WXKA 1UENA 2XPGB 2YKLH 2AQPA 3TCXA 2Y1VA 1S9YA 1NSNL 1QBML 4WV1B 4EAEA 2EDQA 4NRYB 1OGAE 4QAWA 4YL9A 1NQBA 5FECB 4XVSL 3EUUA 1RZKL 3SGDI 2ZUVA 1JGEB 2HFFB 2VLRE 3CVDA 2V9UA 5DU7A 4U7KA 2F5AH 4M43L 3C09B 4RH4A 4GQPH 1IBGL 4AQ1B 1G87A 3BGMB 1TTAA 3A4EA 1CK0L 1X5JA 3GTVA 2Z34A 4JZOA 2ARWA 2LHAA 2N7SA 5F7UA 1N5AA 4XP9H 2VQTA 2GK0A 4WI5A 3GXDA 1NH6A 5KSVA 1WCBA 4JKLA 1U8QB 3DO7A 3MCLH 3QXDB 5KVFE 4KNUA 4QT5A 4RWYH 1YO4A 3LN4A 3E7JA 5LNGA 3FQRB 4LNVA 3LRHA 4KK9C 2Q76A 1DBKH 1KBPA 3X11B 2O5XH 2OLDA 2L4OA 2WNKA 4OLVL 3V4PL 4Q9BA 3TA3C 2YGVA 2PYEE 4QTHA 2GK0B 4XP4L 5A6IA 4K73A 1WF5A 1MVYA 1Q9WA 1IGMH 3ARYA 2AXGA 4LPUA 2IV8A 5FFLA 4JRWA 5I26A 1CBJA 2AJVL 1X7SA 2PLTA 4O2CB 4QRUA 5KSAA 1ZHNA 2CUHA 1PZ5B 2HJFA 4GKNB 3HBPA 2IAMB 3QJXA 3FNKA 2CAKA 1R0AL 2BOLA 4WU5B 3UJTH 1F3RB 3Q43A 1EXUB 2N3JA 3EGSB 2DW5A 2R4SH 1U58B 4JHWH 3AJ7A 1D5XA 3INUH 3P9MB 1CXHA 1JNLH 2CKBH 1SM3L 2OCFD 3QDGA 2Z7YA 3QO0B 1CFTB 2MCG1 1ETB1 5AB2A 1F56A 4UZSA 1F00I 1RVFL 3QWRA 1DEEB 2B9BA 2R2HB 4RGNC 3TP4A 2JKJA 1DBJH 2ADIB 4JN1H 2VMCA 4JQXA 5HD8C 4TTDD 1LO5B 4HC1L 1Q9OB 1FFRA 1GIGH 4L5FL 5D2LB 1NBCA 4BFOA 1PAMA 2G5RA 1XMWA 2ZXBA 1MF2L 4G8GA 4LEEA 3K74B 2CLZA 5EWIH 5C2UB 1B9KA 2FECL 1DBBL 3FSWA 3RVXC 1I1AB 4FEIA 3LTVA 1FBIH 1LWJA 5ISZD 5AVWB 3X1GA 5IHZA 5EOCL 3AAZA 5SV3A 2CRYA 1YYLL 2WUBH 3T2LA 1R24A 2BSCA 3IMBA 1CMOA 3LKQB 1J10A 1RZJC 2XZQH 4X99A 5BCAA 3O3BA 1ZGLM 2I9TA 1T89A 1VCBC 3HE7A 3SBWA 4ATTA 2HWZL 6FABH 2XG4A 3E6FB 4NHUB 5GGUA 3HG4A 3AMKA 3GMOB 2G2PA 1ZA3B 3MNVA 1IBFA 2QQKL 1KTJA 1IX2A 4B7LA 2VM9A 4W9LC 3MLUH 4MNHB 5E5UB 2XX0A 2V8LA 5I1GH 1SJHA 4K7PX 5HTSA 1SJHB 3C60A 1L0YA 4TQPA 3DHUA 1IAKA 5CGYC 3V0DA 4JM2D 3VE0B 3Q06A 4HUVB 1CPUA 3PAYA 4PU2A 1N64H 1RSYA 3ZQXA 3MNVB 4BM7A 4HJ1A 5JPNB 3J8F7 2B8OT 4XO5A 1AVAA 4FQPA 5BQ7A 1QA9A 4A1RA 4DTGL 3GZKA 5GSVA 3VFRA 2PTVA 4HMCA 3BPOC 5B1JA 5JIIA 5GJTL 5C71A 3OR7B 2CCWA 2CHNA 2P5WB 1ZCRA 2X4TA 3ISRA 3GS7A 3B9VA 3TESA 2P3YA 1HSBB 3EFFB 1HIML 1KCBA 3RBGA 3BVTA 3N85H 2VABA 1Q72H 3RWJA 4WUKL 1HINH 4ZOCA 3C6LB 1ZVSB 1G5AA 1A14L 3SOBL 3FQYA 5JHBA 3SPHA 2XV3A 3DX0A 4HZLB 5I5JA 4PYHA 4UIKH 1RHHB 1BD2D 4YVNA 3AY2A 5E8EA 5CHNA 1BYNA 5DRNB 3KJ4C 3GSRA 4GG8B 1EHLL 2H1PL 4M03A 5J9PA 4ELKB 5CP7B 4CBPA 1Q8MA 4XO8A 4X6CB 1XXFC 1IIKA 2BX5A 3D39E 3JSSA 4JO5A 4Z7WE 3U36B 1CFMA 3DX3A 3FCUB 5IW3A 2OMUA 2CDGA 2B5IB 3RA7H 1M7IB 4W9EC 3N0AA 2PWHA 3FPYA 2CMRL 4OZ4A 4WGVB 5J1TC 4TNFA 3FT2B 1ZHNB 3SDDA 1XQ4A 2ITCB 1G9NC 5KJ7E 4CNIA 3FB8B 3A4FA 3IS1X 4NNYA 1LO2L 3QUML 2Q9OA 4OM1L 3QEHB 1FFQA 5DJYB 1G6RB 3V0WL 1VPOL 2WSDA 5BV7L 3R4DA 3D08A 3FRPG 5J6GA 4JJ5A 4P4RB 5HYIA 1I3UA 2DPKA 1YJDC 4M62H 4MS8C 4M93C 5C0IB 1WZMA 3MU3A 2MOVA 1KLGB 1ZJAA 3B1UA 2BRQA 1F4YH 3IU3A 4XAKD 3QORD 1OZUA 4Y4FA 1OAQL 4PJGB 3L5XH 1MXDA 1TIUA 2EDEA 4MXWL 4MDRA 4PP1C 1MWAL 3BP5A 5HGBB 4NQTA 2SODB 3VWKC 4YHYB 1UA3A 3SDAC 1OTUC 3D39D 1S78C 4AGNA 1G7IA 2VJXA 2H32A 2WLKA 4NZJA 5AZEL 5I6XB 1KXTA 2DLGA 2V2TB 1A1OA 2ITEA 4L4TD 3P2DA 3ILDA 5HYJA 1ZWIA 4FXKC 5F2FA 5IESL 4XAWL 4PVBA 2YAMA 1JHKH 2R2EA 3QIWC 4DK5A 4U1IA 5D71L 4FYTA 2Y3NA 4PG9B 3VO0A 1SBSH 5EIIA 2YA2A 4PV8B 4UBDC 1JF5A 1UYWH 2XZAH 3D0LB 1P9MA 4BXVA 4G72B 4X4MA 1BVLB 2CR6A 3HG1D 4ZNEA 4KNTA 3RZWA 1LMKA 3ZO9A 5IEHA 1F3DH 3RI5K 2ZX6A 2IGFH 3DV4B 5F3BA 3NQKA 4YNYA 1R3HB 3SN6N 3OKEB 4WDIB 3BAJA 2CDFA 2HLAA 2OJZL 4JZJB 1KDIA 1JGVL 5T3ZL 1I7TB 1IRAY 4I13B 3ZRCC 3FSZA 4X6DA 2V17H 3QI9B 3SY0A 2YD8A 4TTGA 4XODA 2H4EA 5J12B 2YKKA 4LCUA 2BP8A 3ARBB 4PB0L 4YHMH 5HHXL 1HDMB 5HYSB 2NY5L 3LQAH 5E2JA 4N8CH 3OXRB 3B9KC 3KGRA 5D7KE 2WWMD 3VFMA 2V0AA 4FGMA 1QSFA 2WNWA 2OYMA 3VGDA 4DQOH 2J2ZB 5C1MB 5D8JL 5AKSA 3S88L 2C1PA 5E1GA 4H20L 3E8UH 5EO9B 2A3TA 3A3YB 3EOTH 4U6VH 2B3RA 4OQTA 3IMSA 3JUZA 1C08B 4MZ3A 2H2PC 3DRTA 2EDNA 4XN5A 5IK3B 4PRHA 2NY3C 1B90A 4L29A 2G3ZA 4R96A 4P23C 3CVHH 1P9MC 3OR7A 4KV5F 1KUMA 2VXSL 4KKNA 3RDTD 2VDOB 1FNGA 2V37A 3QDJE 3G7TA 4KNQA 2AAVA 4X8JB 2KDGA 2NY1D 3O6LH 1H5BB 4U6XA 2DBJA 1BZQK 1FH5L 5J1AB 4Y9BA 2W5PA 1AD9B 3GRBA 3U9UA 2ZXEB 4QTIL 1FF5A 3P4LA 2X2UA 2JXMA 1KLFB 5CSBA 1JNHB 4N3UA 5FCUH 3TA4D 1EVTC 4PR5A 5CIPA 3ZMRA 5I5IA 4P4KD 3CLEH 3C5SB 1RZKH 1BQKA 4AITA 1W0WB 3B8SA 1CFNB 1SN2A 5JHDE 1IEHA 3FBKA 1G7PB 2AGJL 2ZOWA 4EDXA 4HEPA 3FZUC 4Z7VE 3B34A 2CRMA 1FIGL 3MRKB 4PSPA 2XA8L 3QAZB 4JM2A 4A7QA 3HC3L 2H2SD 1YEDA 2C34A 1IAMA 5KVDL 3WJLA 4FHBD 4B0MB 1DQLH 4X7FC 4MA3A 4FFZH 1Z7JA 5FFGA 3SKJL 4CGTA 2AJUH 1H3PH 4KK5C 4HG4J 5SWZA 4I0PD 3V6OE 2YRLA 1IILE 3IAPA 4KOBA 2VLME 4WFGE 1D9KA 1SDDB 4R7LA 4NHCL 1V05A 3VUAA 5ID0A 4G82A 1S9KC 2CSPA 2ZCHH 5JTWA 2GCYB 1JGDB 2Y6TE 3IYLW 1Q9KA 1SMAA 4AQ8C 2ICWJ 3GBDA 3I9AA 1TXKA 5BZZA 1JMXA 2A6KA 2FE0A 3QG7L 3LIZL 4GRWB 4Q14A 2X6MA 3TO4B 5LG6A 3BAXA 1S9YB 1FVEA 2G75A 3CZGA 3MJ7A 4IBVA 4YL4A 2R7EB 1Z9SA 2R7EA 4KKLD 2MCPH 4CMHC 4KKQA 2Y24A 1G0DA 3PLYA 3Q3GB 1N8ZA 1CF8L 1GR7A 4IMLA 4MKMA 4N90E 5E6IA 4DK3A 1BQHB 2IIJA 3N1MC 4PJGA 4IBWA 1UGKA 5TD4A 1HJBC 4BKLA 3ARED 4QXGL 2G60H 4JZOB 5I71B 1BAWA 4Z5RB 1XF2A 2DWDA 4J1UA 4WHTA 5IOPA 2DLTA 3MOQA 3CZFB 2DDQH 4FLOA 1A7OL 3RGBA 3PWLA 3RFZA 4LSUL 4YXKH 1A6WL 1BBDL 3G08B 1I9IH 3B9DA 3IMTA 4JRXB 1C16B 4F8PA 4LVHC 3WEXA 5EWIL 2VLJD 1DBAH 4NQSB 1X5GA 3MRCB 4HIHB 4RVBA 25C8H 1IEAA 4Z78A 3FU5A 3V0HA 5CGBA 1HT6A 4NRXB 5DD3L 3VXQA 1CUOA 1QNZL 1DHKA 2J1ZA 1ZA6B 3ROLA 3VH8B 5CJ5A 4ZW7A 3HPJA 1A5FH 3F7LA 3WKML 3D1MC 2JXMB 1U95B 3POHA 4N2EA 5KYYB 4NQEB 1E4KC 1CS6A 5FW8A 1MCCA 4GIAA 1KWGA 1R5WB 3DSFL 1E28B 1T5WA 4ONFH 5AZ2H 2VXVH 3OAWA 4LCWD 3IRZA 3FUNA 5AW8B 3ESUF 2JKTM 4LB8A 4LEOA 5EPMB 1WCQA 3TEXA 1JCKA 3EJYC 1R3JA 4BYHA 5GZNC 1VZGA 1A3RL 1QFWH 3R1GH 2MKLC 1UXWA 3C09C 1Y1DA 2DKSA 3MBWA 3QQDA 4JFPB 3CSFA 4GBXB 3RQ3A 1FYTE 1OSYA 1AC0A 4F80A 5ESVB 5JOFA 2ICEC 3ZW3A 1UVQB 4W81A 1SMDA 4LHUD 4U05A 1QO3A 4UANA 4WK0B 3D7PA 4J3OH 4LL1A 3S7GA 3EYOA 3DLQR 2K45A 4IIQB 1XGQA 4Q9QL 2ESVB 4JG5A 1GA2A 3I02B 1VERA 5CJXA 2IBBA 1NC4B 2EKSB 1D5RA 3SY6A 4WFFE 3ASOB 3G5WA 2F1BA 3WJMB 4XRCB 1F41A 3MODH 4PP2A 5LGHL 4I5BA 4MWFB 2K9FB 3PJSB 3WFDL 1JXKA 2XYBA 4PUBL 5DWPA 2NX5A 4W9FC 5HGHA 3GUTB 3N85L 2XI9A 3KE0A 4X5RA 4XOCA 1H6UA 3KJ6H 4G7SB 5TPWL 3L1EA 4NLHA 3N2JA 3CD4A 1KGCD 1EJ6A 1M2OA 2IO5A 1AHWA 4GEIA 1MCQA 2L0DA 3DROA 4GT7A 4E9LA 5IHWA 1J8KA 1H15B 4H88H 3VXMA 1J0JA 4KKAD 1A7RH 4GW1B 4N0UB 4C58B 2AMGA 5GGVL 1T83C 2JKSA 1QVOB 3RVWC 3SGDH 1AJ7L 2X5PA 3EO9L 2ZKYA 4GQQA 1N9PA 3UZEA 4EVNA 4BFIB 3CWGA 4FZ8H 1E27A 4MZ2A 5HPOA 1A65A 3V0AC 5I0WA 3O6FB 4HBCL 3LV3A 1VFBA 3QZOA 4JO4H 4KY1L 43CAB 1A7QH 1Q4NX 4J3OD 1UWEH 5EH1A 3AREA 2EEFA 3ZKXB 4I1NB 1FZKA 4DKAA 3HVNA 5L6YH 3N1PC 2XOTA 4PJCE 3POCA 5DJ2B 4N25A 5MEQA 3QZNA 3L4CA 4KI5F 5FFOA 5F3HB 2QZQA 3SJVD 4EN3B 1CF1A 1KB5A 2QQQA 4HAKA 5F3HA 2EJ1A 5GS0L 3V8CA 1QLEL 4FJ6A 2JE8A 1UACL 1CT8A 2K78A 4QT5B 4TTDC 1BF5A 4M7JH 4BH7A 4U49A 4WUUA 2GTQA 1XB3A 2CHXA 4LCYA 3RDTA 5SWSB 3ZTCC 3VRLE 4A6YA 4OQTH 4RGND 4JFSA 3O0LA 4AQAA 4JJOA 5FKAA 2X0VA 3UPAA 4FFZA 2KH2B 3L5IA 4DVRL 5E9DA 1UASA 4G8FB 3U83A 4P2QA 4DP8X 1OE3A 1XR9A 3QUYA 3ULUF 1F1AA 1JZIA 1EJ8A 3K46A 1DTUA 5C0CD 7FABL 1G6RL 1HHGB 2HB0A 2AXHA 4JVUA 4LPTA 4DGIL 5DSCA 1J0KA 3LS5L 1ORSA 5CHNB 4EUPH 4YSEA 4AYID 4PJXB 2WXFA 4NAMA 1C5BH 4RDBA 1WDAA 5AW0B 3KLHD 4EE2A 4N90D 4IBYA 1XX9C 3H6AA 5IREA 2WO4A 4RX4D 1CVRA 3CFBA 1KCKA 5C86A 5EBGA 2XIBA 3VWJA 4KK6C 2CLVA 5CCJA 4GG6E 1X5ZA 3BKYH 2UXFA 4UDTA 1PZ5A 3TA3D 3DX9A 3EGDB 3HG3A 5FS5A 3TT1H 1U8OA 1SEQH 5ETUB 2OZ4L 2X53A 4I18B 4NAQA 4ZUTB 3VXRE 1EDQA 1PD0A 1QMUA 4M6ML 5TDOB 5K69A 4I1RA 4XN9A 4BFNA 4QWWD 2EZ0C 5KOVC 3QVAA 3S88H 5E8OA 4OKVB 2XQYA 2CRZA 1Z0MA 4XCFH 1PZAA 1UVQA 4D94A 3DXAB 5DK0B 1ID5I 3SGEI 2VLRB 1Q0EA 4GG6F 4OLXH 5K9OB 3N42B 1S7TB 3S8GB 3DX1A 3UYOD 1QZ1A 4TVPE 3VG0H 3SBQA 1LD9A 4BK5A 1GW6A 3HHRB 4P99A 3SJVB 4A66A 4BFKA 4EN3D 1UD2A 4NB7A 2YO3A 4AMKL 3BO8B 2NNXA 1PIGA 4FKHA 3FT4B 1OAKL 2AQ2A 3QQNA 2YQGA 4ZFFA 3RL2A 1MHEA 5F9JA 1EX0A 1UQSB 3MVSA 2X38A 2J43A 5GZOA 5CF3A 1BVNP 2D7NA 2ARJQ 3D34A 3W1ZA 3RB5A 3W11D 1RY7B 3DVGB 4DNLA 1A9VA 4DCQA 4H7VA 4JX0A 3RWDB 1Y7VA 5FYKU 2BZDA 4MA8H 1BQRA 1PKQA 1RK0A 3FHQA 4PY7B 5KN5A 3ZYZA 2WXPA 4X99B 4YMPA 3JYBA 3TIEB 4U3SB 5I75B 1U93B 3KPSD 1TJMA 4HPOL 1PF3A 3MGOA 1DJGA 5IFAL 1XFPA 3EJQA 4ISVA 3QEGL 4MBRA 4LF3B 4X6CF 3UGEA 3EAKA 3HMXA 1ES0A 1GSKA 4KQ3H 4LLMA 4V1DB 4IOIA 4G8IB 4WFED 5MHSE 4AGPA 1FGVL 1T7ZA 1G9EA 1K72A 2O93L 1E5ZA 1QFOA 3ZHFA 1MJ8L 3HNTL 1KNOB 2ZSWA 2X28A 3EG9B 5ALCL 5AVXB 3RWGB 3HJ0A 1HH9A 4QOKE 2XIIA 2FNWA 4HUXB 1BQUA 4G59C 3Q8CA 1R3KA 4GO9A 2VDKH 3B5GA 1B2YA 5FHAH 2ZIDA 3F2LA 5CBEA 5KYUB 2JJTA 5E95B 3U9PL 3N04A 3OMZA 3OKYA 4HHGA 4KHXH 3KM1A 4CN1A 5D7JD 5EZJB 4YDJA 5FDWA 3VGAB 2YGQA 4OLYH 1VRSA 5C09D 4NBZB 2OV0A 1V5JA 4IKNA 4N87A 3MR9B 4NWUH 2H6UA 4Z8FL 2O1AA 1JMZA 1F90L 3ARDC 4RMWA 3MLRH 4U1HA 3QQ4B 1XGRB 2V5MA 1JYWA 4K7FA 3NIGB 5I73C 5KYUA 3ZTDC 1MCSA 1N5YH 3BWUC 3TNMB 2BSED 5B8CB 4JREC 3RL1A 1OXYA 5BS0E 5IQMA 5C0GA 1E0OB 3O9WC 1GC1H 1G7MB 1NUDA 1WWCA 2OMTB 3D0VB 4NQCE 4L9DA 4N2LA 5DT1H 4XCYB 3RWIB 3DX7B 1AIZA 2IEPA 1FPTH 3F7VA 5E23A 1RZ8B 3Q44A 3WIHH 3CLFH 2D9QB 4Y16B 1A6PA 2FWOA 2IDFA 1TZOA 4NQEA 3AXLA 5KAQF 5ITBH 4M6OH 4E9VA 3RFRA 3QDMD 4IRJB 4QO1A 1MAKA 3ZR6A 5JOEA 4WI9A 3QIBB 2JJTC 5I16B 4CSSA 1ZY9A 2G0KA 3CFTA 5J06A 2L7EA 4XNYH 1DBAL 4RFOL 3STLB 4DN4H 4Y1AD 1ZVNA 4HCFA 4MMYA 3PDOA 4JM4H 3WXVH 2XZZA 5IJCC 3ARDA 1U2CA 4HJIA 5IB3A 4L8SA 5ELIA 3J7HA 3DJRA 4L37B 1FIEA 3EYVA 3NESA 4TUOB 3B6SA 4NXSA 4PSRA 1DVQA 5J12C 4E9SA 3K8LA 1IZKA 1S7XA 4XPAL 1JGDA 1D5ZA 5FKPA 4PJIF 1I7ZA 4DOHB 3CPUA 1WUNT 2E74C 3QS3A 4N86A 4YDKL 4GMSL 2GJ6E 1KPUA 3IXAB 4IBQA 3WY3A 1QLFA 4TNWF 1O9WA 3PGDA 3WOVA 4B9GA 4U33A 3NAAH 5DJ0A 3OLEA 2B4CC 4U3SA 1M2VA 3VFGL 4JFYB 1W8EA 2LV4A 2OMYA 4J3UA 1F45A 4Q7DA 5HDBF 2HRHA 3FUFA 4GP4B 4HHWA 4HK0B 4BWTA 4DPAX 5MEOB 4AT6A 3TEWA 5KG9A 3THML 4LLQB 5FYLD 4HX1A 3PIQB 5IQNA 1XIWD 3RVVC 4ETYA 3RY5A 1YLBB 4KV5E 5K1VA 5DJ8A 2E9WA 4YAQA 3U0PA 3WEAA 2JMRA 1IMHC 2HJKA 3GJFA 3M8OH 2WCSA 3TPUB 5CN3A 5SX5H 4W68A 2ZCLL 3NGBC 4NHUA 4Z3TA 2DI9A 3QUYD 4MAYD 5DEJA 2P45B 5C0BA 4LF3A 1A7PL 1IVLA 1E9PB 2HAZA 3TZVA 1UXSA 4XP5H 2OL3L 1RUQH 3AG4B 5C0RH 5GS0C 5CMAB 1N10A 1ZPLA 4PBVC 4YDVB 3D12B 2PPAA 2IBZX 2R15A 4U7SA 4FQXC 1R3HA 3NH7L 4ODTH 3S36X 4N1CA 5IMMA 2F54B 2EDRA 4K9EL 3ZVVA 2YC1A 4IEFB 1GGCL 1P1ZA 4FQCL 5EUOB 3LPPA 3QWOB 4QHNA 2WXHA 4W6YB 4PRHE 1D5IL 4EDWL 2WO2B 2WZPD 1SBSL 2Y2TA 2EDDA 2P8MB 2F5AL 2Y1AA 4QLWA 1ITCA 1J1XH 1S3RA 3QORA 4AKQA 2NUPB 5C3TA 2V8MA 4KTEL 2ZXQA 3H2QA 3L9RB 2WCGA 3NCWA 1EGJL 1BFTA 3VM7A 4NYLB 4WCYH 5GRXG 1JWUB 2OMWB 4KXZI 5ALBL 1L6PA 3JV6B 5C0DB 2FQEA 1F86A 3QXDA 1NCCH 5I74C 4AZUA 3HS0C 2OJZH 4W9GC 5D96B 1RZJL 4WHCA 1E3ZA 4DZ8A 3TFBA 3V4UL 3OR6A 4KJQD 3SCMD 2GBAA 5C8JB 2C3WA 1T0OA 1KYAA 1PPIA 4JFXB 3LKPA 1H3GA 3VGGA 4KTDH 4LKCA 3QUKB 1HYSC 5DD5L 1UXLA 2VDRB 4WWKB 3KPRE 2FRGP 4JG0H 1RKRA 3EBIA 4KKBD 4X6DE 4B9ZA 5IWLA 3ZTNH 5K9JH 3FJTA 4PB9H 4MLSA 2GPZA 2BERA 3GJEB 1YJDH 4JKWA 1G7MA 1ZVHA 2OMTA 1T0MA 1KB9J 2ROYA 3D0VA 3MRGB 1BWMA 3TBTA 1TZHB 3TWCL 1UCTA 2J5WA 2VXTL 2CA3A 2YPLA 3HS8A 3G5ZA 1XVSA 2IDTA 1TZIA 4EIGB 1I8AA 2JK5B 4M4RB 4YDIH 3G9AB 2VDPH 3K5SA 5AW5B 1FVEB 2PWFA 1TDQA 5MI0C 1ETJA 3O41B 4PCKA 5FLUA 4PJ8A 4N1HB 5FGCB 1NBYB 1DVTA 1V55B 2APXA 3A67L 3K72A 1C5BL 5TE4L 3S3PA 3FQXA 1ZLSL 1ZKAA 4KO9A 1NEPA 5IW6A 4KVNH 4IIZA 4IRSC 2MWCA 4PJFB 4QTIH 4YHZL 4QI3A 1K4DB 1ED3B 4MGXA 1BVLA 4W4OC 5BRQA 3LVTA 5IB5B 2XXMB 4O00A 4HIPA 4GSDL 2VDOH 5SWZB 3O2VL 4TUKL 1WBYA 2GJPA 3D6GA 1AY1H 4TUOA 4W9DC 1D9KB 3IT8D 5T33H 3MACH 2VIRB 3BVDB 4C56B 3O4LE 5FUCC 2J8HA 3JWDC 2PPFA 4LRNL 3HJEA 4PCTA 2DWEA 3D30A 3ZDZF 5LN8A 2YWYA 1B0WA 1UXSB 3SGJC 5JUEL 4BQ9A 1CGTA 4Y8DC 3ROOB 5IIEA 1T03L 4Q9RH 4KO5A 5IJVA 3K6SB 3EYFA 3TPKA 3QCVL 2GSIB 2B4CH 3HNVL 2GJ6B 4HCGA 5DJCB 3PNWB 1CDGA 4MMZB 3C5ZC 3TVMD 1RLWA 2VQ4A 2ZOLA 3D3VB 5A43C 3IJYA 5A6MA 5CCKH 2Y69B 1I3VA 4NCDA 4E2OA 3TBSA 1QI5A 3ZDZE 3UACA 3FU3A 4HDIB 3VRIB 1G1OA 1L0XA 3SE3C 3HPJB 2P80A 4NP4L 3SD5A 5BUAA 1QPPA 2GW5A 3GSVB 4HEME 2EXWD 3CXDL 4ANKA 2AQRA 4IDJL 1KNOA 4YDVA 2W60B 3K1KC 3LN5B 2R39A 5TJWK 4NQSA 5M7QA 2YRZA 2I27N 4N8UA 1JPST 1U4EA 4Y19B 3KVDD 1BQSA 3GKWL 2YQ3A 3NTCH 2HVBA 5C0BB 1HNYA 3VVVA 1RIVH 1GGIL 2DTML 4PMEA 4XVJH 2N59A 5D1XC 3PWLB 4HKJB 2W0FA 5D4QA 5JIHA 3MR9A 1GKEA 3IF1A 3WE6A 4H8QA 4DP1X 5GGQH 1VLXA 3UAEA 3B3IA 1XCXA 3ZZSA 4AXWB 2WLIA 4P5TB 3NSYA 4YHLL 5AFAA 1U0QA 2DKUA 5C9KA 5GGSY 4Q6IA 5C07E 3CZKA 3AFLA 1Z3GH 4XPFL 5AW4B 3VX1A 4LSQL 5EBWB 4Z7AA 3F5WA 5C08A 3FTVA 3L6FA 4JHWL 3RY6A 1A14H 1ZK5A 1XH3A 4OLWH 1S7QA 4MJIA 1A6WH 4JB9L 5CSZA 3QWRD 5C7XL 1RPUA 2VSMB 3II2A 4QEGA 4ANWA 1H3XA 1TNNA 3ARTA 4IKLA 2VDMB 5JXAL 3MRPA 3NIDF 1M7DB 4L3ED 7TAAA 5D6DC 1EFXD 3QB7C 4POZD 3RB7A 5IM7B 2W9EL 3C12A 3WFCL 4NKMB 2R2CA 2RTTA 5F0MB 5D1XA 3V7AG 5KAQG 1JZ5A 4OT1H 1IC5H 5CD5C 1PX3A 3OAZH 3ZXAC 3BGFB 1HL9A 4Y9EA 2W38A 3GC3A 2J5LC 1YEHL 1FRGH 3CSYA 4KKCC 4MQXD 1BLNA 5DI8A 1WIUA 4AJ0A 3RNQA 4KVCL 5ACMA 3IVKB 2C3XA 2YK1L 1SYVB 3V0WH 3IDGA 4Y19E 1P0SE 2HFGH 4JAMB 4QRPA 3E9UA 3CZNA 3WEOA 2EZ0D 3MRKA 3ECBA 3QHFH 4LSTH 5HI3C 2HVJA 4GT0A 5C6TL 4ZSOB 2GHWB 1JSYA 1TJIH 2YQ2A 4PLJD 5CZVL 2W59A 3IAQA 5DEFA 2NYYD 3U4KA 2C4FU 4KQ0A 3NT0A 2E7CA 5FR3A 3FU9A 3CDCA 4UV4H 5DD1H 2FIKA 4XNXH 4FRWA 3BRDA 4TN9A 1AACA 2DMBA 4FERA 4AEIH 1AR2A 1UB6A 2B59A 2MHAA 2CO6A 5DO8A 4BHUI 3KPOB 4QYAA 4AEFA 1JGIA 3GRWH 1NFDE 1ET5A 4GQZA 2VLKE 4P8QA 1Q9LB 4PJEE 2X89A 5DYFA 3ZZLA 5CFHA 5J5EA 2MNJB 1HSAB 1L6ZA 4K7FB 1C12A 5AUMB 3CFUA 3G6DH 1ET8A 1MQKL 2RCSH 2C9UA 5F1IA 2DQFA 3GIZH 2XN2A 3O81A 4BGDA 3SBPA 2R69A 3CIAA 4TQEL 2GTWA 2F8IA 5DJAB 1M42A 4IBTA 4B53A 4HJGB 2XWJB 3AU0A 1FNEB 2EE2A 5HHQB 4A7GA 2JI1A 1DO5A 4N2OA 1NM4A 1ZT1B 2EEBA 3MRQB 3ZK0A 1NFKA 4JM2F 1FAKT 3A22A 3MV9E 1JPTL 4JPVH 1QWHA 1P5UA 3AY4A 1ZAGA 2CJUL 4M48L 3IJ9A 3RIKA 3BT0A 3CG8A 2IAMC 1MFBH 3GSNH 5HHVH 3VFVB 5A2CA 2D2OA 4J6RL 5LCVH 1CICD 5FCSH 5EEYA 5FOJA 4HU8A 2IQAB 1ZLEA 5SWQA 3DVNA 1CLOL 2YD9A 3MJ8B 1GGBH 2LLNA 3VA2C 4ESKA 1ZSDA 1U8HA 3B43A 3OJ2C 2JQAA 4FQLH 2AJZA 1CG9B 1H0DA 1QNIA 4P5KB 3KYNB 1G0YR 5IW1A 5DJ6B 4RCAA 3MRJB 1ACZA 1MFDL 2L7UA 5IMKB 3N40F 1QLEH 2X2HA 2H5UA 4ONGL 1VB9A 5EORH 2YGPA 4UDUA 1AQ8A 1DZBA 5J89A 2NNFA 3IDMB 4XVOA 1K5NA 2PPEA 4ZD3L 1ZV2A 1GZQB 1RSFA 2XTSA 5JIMA 2X6UA 3RX9A 3NA9H 1FCCA 3ARDB 3BJ91 4XO9A 3BKCL 3ULVL 4I1PA 1VFAA 1O6TA 1WE5A 4Z7NB 3GXUB 3Q6FB 1CG9A 1H0DB 4YN3A 4J2QA 2VH5L 4X9YA 4OUUA 1GYAA 1JV5A 1CU4L 1HTYA 3EYOB 3O9WB 3VFPA 3P4OA 4G6FD 35C8L 4JEGB 3FDWA 4HXAH 2VLKA 3DURB 1XSJA 4Y4FB 2BSEA 3EFDH 5F7LB 5D5ME 2CUAA 1WHOA 3C60C 2Z1KA 2F15A 3MLWH 4MVBC 9CGTA 3T5WA 2X2JA 5T1LD 4YO0A 4YSUA 1WBXB 1NCCL 3A47A 2LFEA 5F71A 2PYED 3DX8A 4J4PD 5MENE 4GSQA 2W80C 4PRPE 4PJ8B 5HYFA 1YYMH 2H26B 2HCZX 1HHHB 2QADC 4C55A 4F37K 1FZOA 4X7TA 2CXKA 4WHYH 5TH2B 3V79C 2YPVL 4PJCA 4B96A 4FHKA 3BGAA 3E3QE 1IC4L 3VXPA 2HTLD 1SEQL 1VFUA 2OMBA 3PF2A 5J3HD 4ZSOA 5TK2A 3FSAA 1NKGA 4U1KA 5MEQB 1YJDL 4EI6A 3N9GH 4RFEA 1KIPB 2H7WA 5B39A 3ETTA 3GMPB 4L1LA 1OSPL 3H9HA 4NP9A 2M26A 5J6HB 2QEJA 2P5ED 4PRPA 4AKPA 5F96L 3WFBH 3P9WB 4UYQA 2CQVA 4EZMA 4YSAA 1NOLA 3ZE0E 1M6OA 2QSCH 1TLKA 3NYKA 5BUGA 2PWGA 4KHTL 3CCHA 5I66A 4ZMTA 2YD7A 5HVHC 4FABL 1U8CA 3OKDB 4N2MA 4R4BA 4EXKA 3BX7C 5E9DB 4H20H 1AOZA 3MA7A 4IKKA 2F18A 2NZ9D 2K1MA 4MB4A 5FECA 4BFJA 2DQIH 4O5LH 5FA3B 3D09A 1YZZA 2FATL 5GSVB 2Q76B 2E75C 3O2DH 4K3EL 5GGTH 4Y5YA 4HZ1A 5CLXA 4ZZFA 2BH0A 4TUKH 3GD1C 1IAOA 2B1OA 2A6DA 3MO1B 4JO2H 3BGFC 1IJNA 4PRNA 1NOFA 3S98A 4HF5L 4EN3A 4JQVA 1IB5A 1UD3A 4LLYA 5EDSA 1P5VA 1J8HA 4XNMB 1D3CA 5DJDB 4PREA 4Z78B 5EZJA 1YNTB 4IOFC 4FFWC 1SXCA 3D2TA 4A2MA 1JRHH 4E68A 4L2LA 5JW4R 3PL6C 3BWAA 1LILA 1FC2D 1I8IA 1UJTA 1SXZA 4LVOC 2BO0A 3F7VB 3Q1SL 2Z7ZA 5CWSA 3VWKA 4JO3L 4WUUD 4DP5X 2OMZB 4NQEE 2HTKD 3FB8A 3QCTH 4AX3A 3L7FA 1YN6B 3WFZA 3IGLA 2ZYSA 1C7SA 5KVDE 3HVDA 4GINA 4UOJA 4X6EB 4WUKH 5D4IA 4NUQA 2AJZB 4ZX6A 3VVWA 2H9GA 3NRFA 4KHXL 1W8OA 5EZLA 2CO4A 3P2BA 5K9OA 4PJAA 3QBTB 2G2NA 1V10A 3HZYB 4JFDA 2HN7A 4U3XA 1B4JH 1W6LA 4IK7A 2BVYA 4NFBA 1RVFH 1KXHA 3KPQA 4MJ5B 2MQGA 1UATA 2OMZA 2Q3ZA 4BDVA 4CU7A 1BXXA 3H54A 3PP3K 2HKFH 4C56E 5KVMC 3KJ4B 2QKIC 1MH5B 1XZWA 5E4AA 1NWOA 2XC8A 1MN4A 3NZ8B 4BWUA 2C9VA 3NZ8A 3HR5B 2CMRH 4JY5H 5G5DB 4ZZKA 3S4SA 3RZCB 3P4NA 1OW0C 5IBLD 4NN7B 2R2HA 4KKZA 3SQOL 2ZG3A 4NKMA 1KIQA 1HILB 5DR5H 5CR1A 3PL6D 4RAVA 1QLFB 5F1NB 3WHXA 5I0YA 2VL4A 4NQUA 4HYTB 1KYOK 2Y9RT 5D6CB 5MENA 1IARB 1SFDA 2W9DL 2NZ1A 3H55A 1NGYB 3QFDB 2ZWNA 3AS2A 1DL7H 3RUGF 1VEMA 3GXPA 2YAFA 1IAII 3KDMA 1Y6MR 1TNMA 3BQUD 3HN3A 4DO4A 4GQ9L 1SF3A 4NJAH 3RWFB 3FONB 2X4NA 1UD4A 4QF1B 2A9MH 4P4KC 1T2JA 3NFNB 4LOUC 1EO8L 1N4XH 1NAKL 2DB8A 4MCYB 4X6BB 3MLUL 4E41A 2CJ3A 1GYUA 3QXWA 2QSVA 1A6UH 2YUWA 5T8IA 5HYQA 1VADA 3NACH 3UBGA 1Y1UA 3RGVB 2W88A 4M3HA 1F18A 3DO4A 4WFHD 5DVPA 4D9QE 3HOGA 3VFNA 2NY1C 4KZCA 4F15C 3FT3A 3UTSD 1TEFA 3IDYC 3BDYH 4FP8L 2HFTA 1F58L 3C8DA 2XTJB 3CFKB 2DIEA 3L81A 2DIBA 3BCDA 2GC7C 4G6MH 4KY1H 2FQGA 3OZLA 4DTGH 2F53D 1LE9B 3BXNA 5ABDE 1UG9A 1J5CA 2VITA 1Z9OA 2EH8H 1CL7L 1HSAA 3MOBH 1CO1A 4OZGA 5K5YA 4NIKB 4CJ1A 5JW3H 5L0QB 2XY1A 3NJLA 3NJMA 4MAUL 1Z9LA 4JZJC 5DGQA 2R1XA 4LAJH 5D7IB 1MWAA 1XH2A 2DIAA 3T6QC 2EQDA 3B7SA 4HGWB 1NGWA 5AB9A 5GXBB 4GAJL 1OE2A 2QMKA 3Q8AA 2HTLC 2YMOA 4PRHB 3DO3A 4APQC 4GI8A 3VD9A 3BZ4B 1J05B 4PVLA 4NO0B 1TVBB 3RURA 1MZZA 1FAIL 2PTTA 1U8MA 3BH4A 2BS9A 3G6AA 3IDJA 4D0DB 5I6XC 2KPWA 3K5RA 2ZJSH 5BZXA 4LLYB 3U6RA 3O45A 4UWQB 2Z0UA 5F7EH 1R4XA 1JZHA 5BS0D 1HEHC 4NO5A 4NS0A 4YHKL 4GB9A 4IQHA 5DMGD 1XBRA 3KGSA 4ODSL 5F8RC 1L3NA 2EDYA 1AG0A 2AEQH 2YR3A 4PJ6A 4P2OB 3C60D 5FYLE 4CVZB 3L6FB 1O9VA 1FL6A 2ZKMX 3LZNA 2BP5M 2CU9A 1NFIA 3JWOC 4DGIH 5DQDL 1NZRA 1S7SB 3RNKB 1UA7A 1IGTB 5IQOA 3CSYB 5CEZE 1MHCB 1NMCB 1ZS2A 2ZG2A 5JR1L 3VSUA 2B1AL 2UY7B 2VRQA 3GRGA 4HWNA 4GG6B 1MI5D 2F68X 3U0WH 3BD4A 5E8DH 5T5NG 1BM3H 3DETD 2Z93A 3IEAA 1RU9H 3II1A 4YE4L 4UTAH 3LZPA 5FO8B 4FN0A 4EUPG 4MXQC 5D1XB 2V3EA 3DX7A 4YK4C 2TRYA 1FN4A 1QW8A 1WD9A 3QE5A 1BG1A 2BHZA 3BZFB 4JPIB 4AEHH 3L54A 5LNEA 3P0YL 1KZYA 4PS4L 5K33A 3BVWA 4FZEH 3X13B 3HBZA 4OBSA 4HEMA 2B15A 4EBQL 1EFXA 1VGEL 2A4CA 4OGZA 4MA7H 1Z9PA 4XOAA 3V6FA 3Q6FA 4NNPH 3PWPD 4OCWL 3PWNA 1UOWA 4Y4KA 5CS7A 1LGVA 2GEQA 1NKOA 4DGWC 1SJMA 1T21A 3QNZB 2GI0A 4QOKD 4DF9A 1BFVL 2BDNH 4RZKA 4NZRH 2X0WA 1QWNA 1NCWL 2HKHH 3DGDA 5IBTL 4F58H 2PO6D 3D2UD 1VADB 3H6JA 2BOCB 4RMBA 2VRAA 2Z92B 4Z7QB 4JJ5B 1U4FA 4MDJB 1IM9A 4WI2A 1MLCA 3OPZL 4ZAKA 3UTTB 4HV8A 5F1IB 3ZE2F 5KG9B 3MJ9H 5ERWB 1JF1A 3N40P 5AOZA 1EZVY 1KN4L 4JDEA 3RX8A 4NXKA 5J6SA 4DK6A 1HHJA 4N2CA 3LIZH 5CLZA 3EYFB 3NCJL 4NLAA 2HFEB 1IKNC 3BXNB 3CFMA 3DV4A 3FFCD 4OF0A 1U33A 1E8XA 2ZXAA 5IEHB 4YBHA 2TRHA 4JKMA 3N55A 1R5VB 3TBBA 4B3VA 3LD8C 4MZIA 1UJ3B 4DQOL 4XI5D 4Z18A 4HDIA 3VRIA 3W81A 3PWPA 3VYNA 3BT2H 1BX2A 1E5BA 2E5EA 2EYRA 4K0OA 5EIIB 3ZX1A 2YRPA 1CQKA 1K6QH 2IG2H 4JDTL 2X10A 2WXMA 1E30A 3VXOA 1TQCB 1I8MB 4GS7C 4Y1SA 3GBEA 2Z31C 1RD6A 3QJZA 1IGYA 2CO7A 4KKPA 3ZDXB 7FABH 3ZE1B 1N2RB 3QNXB 1OHQA 4AL8L 1BW8A 3P1VA 3FCGA 2ITFA 1KENH 2NYYC 3OPUA 3VD5A 1HVXA 4R4NC 2VXUH 2EDMA 4AENB 2FLBT 5CXPA 2WXIA 4UT6H 1MREH 3DIDA 4YE0A 4MSWA 4OU3A 3HG0A 2ICEB 3KYOB 1RIUL 3OZ9H 4NWUL 1OSPH 5BMFL 4KMLB 4FQQB 4N26A 1FFPA 2GSGA 2VAAA 4P48A 4PJAF 2AXJA 2ESVE 2FWSA 1KJ3H 2AS5M 4PRAA 5IP4A 3G5XA 4L5FH 1B0RA 5IQ7L 1HK6A 5FK9A 3QUMB 3UROR 4R26L 4L3AA 3PV6B 2VR4A 5LKNA 4PY8J 4TUJB 1N0XL 3GNMH 4H25B 1J48A 4GW5A 1QFWM 1HXYA 4G3YH 4POZC 2YUXA 3EJSA 5FA4B 2DQIL 3QSKB 2WZPA 3HMXL 5CP7A 3WJJA 2MSPA 4IK6A 3IDIB 4HS8L 5E70A 3RNQB 1JWUA 4UAOB 3MBEA 3U48A 2HUHA 1ERNA 2EILB 3BPNB 1I8LA 3OMNB 4M6OL 3BWUF 1DQKA 1G7PA 3MRGA 5GSRA 3VXUE 4A2HA 4WF7A 5TH2A 5IUCA 4HF5H 2X3AA 5DMKA 2Z6FA 4Y2DA 3T6XA 1KTLB 3BZFA 2A6KB 4RGMB 4YFLI 4XC3H 5KSBA 4CNIB 4R9HA 4R4FH 1X3DA 1ITBB 3B8YA 3SDCD 4L8SB 2A4ZA 2CGZA 3FFCB 3OQ3B 1OV8A 2HT4D 3QJSB 1AHWB 3QUGA 1MCEA 4JREB 4XPTL 2V2WA 5DRXB 5I6PA 4FQHA 4GAGL 3ECBB 2D8KA 3C8KB 2HRPL 3EYSH 3FTXA 4XP4H 3PABB 4UOQA 3BUYA 3REWB 2ADGB 2R0WL 1YEDB 5LXVA 4OAWA 4JRXE 4FTVE 2FJUB 3ARPA 2XQ0A 1GZHC 1BZEA 3CFDB 3O4LB 1X5IA 1T66D 5AKRA 5IB2B 4KI5E 3LQAC 1J11A 1KB5B 4MQSB 5JQHC 2WLZA 1A22B 3FHEA 5DQ9B 1HL4A 2DMHA 5I19L 4ZS6C 2IANE 4XNQA 3RAJL 1V7MH 5F9WB 3KYKL 3E2HB 2WHVA 1YYCA 5KUMA 1HIMH 2ZE0A 3SDDD 4PJ9C 3RIAF 2D4DA 3MV01 4JPWL 4Z7IA 2EXWC 1AZZC 2W9EH 3WFCH 3GF8A 3J07A 5I8CA 5KS9F 4ZW6A 1YEKH 2D0HA 5L88L 1F3JB 2HG5B 4Y2DC 4HQQH 4NKIH 2L04A 1GGUA 4DVBB 1PZSA 3ULAB 1QYGL 1X4YA 2XN1A 4PTTB 2P5EA 4CDGC 2XN0A 3LNDA 4JFEA 3EADA 5JO5B 3WS3B 4EVNB 1BSIA 1KGCE 1U92A 3F6IA 5C0JB 5IVNA 4ADIA 1NUGA 3C5ZD 3UTTE 1QNZH 3QR1A 2WLNA 3TZVB 3ZDYE 1SN5A 3FO1B 4PEEA 5E1AB 2DD8H 2HFGL 4F93B 4GMTL 3F05A 5EFIB 1HHKA 3L7EB 1OCCB 3AUVA 1OAZH 1E4XL 2Z65C 3QNYB 4I8DA 3S36L 1CC3A 1GC1L 2FBOJ 2WLIB 3HAEB 4P3WA 3SDYH 5JA8B 1INDH 2LAGB 2IPKB 1TLMA 2I5YH 3COOA 4XE0A 2FX9L 4QHKI 3ROLB 1GS6X 5IHUL 1UM6H 4YDLC 1VFOA 2Y6SC 4GW4A 4JFOA 3T6WA 4CMMB 4UDUB 2F7IA 1GGTA 4OTXH 2NOYA 5DZOA 3R1GL 4H2CA 3LX9A 5AYTA 4MJ5A 2GBTA 3N44F 3V0VB 1MCHA 5HVHB 1AP2A 1ZGLB 4BFEA 5IKCB 1QOKA 4U1LB 3KHOA 5C0FA 1SJXA 4P46D 2A7BA 2EVFA 5E2VL 3UBXG 1I53A 3MCYA 4PJAB 3VFPB 4EI0A 4PGDA 3D4YA 3DMMA 3AG2B 4HU2A 5IK3A 5B7FA 1JNNL 4ZX5A 1AGFB 3QIUA 1USQA 4ODXA 4Q6YA 4JUTA 4V2CB 5AEAA 3OLGA 1XSOA 4N3TA 1SHSA 3EYVB 1TJHL 4L0ZA 2R0KL 2FJSA 3BKYL 4HH8A 5GS2D 3CVIH 4AYFA 1KIRA 4UQIM 4NPYA 4JCWA 2FR4B 4LLDB 3OAYH 3DJSA 2WN3A 1HYSD 1OE1A 2CHDA 5MP6H 1OGAB 3S3JA 1LHZA 2GITA 3JT2A 3IMRA 2JKNA 3M46A 1MDTA 1ZLUK 3KAAA 3RPBA 1GVIA 2ADGA 1TQCC 4RMSA 5FA4A 1U58A 4KJYB 4M5TA 4U1KB 4AJYV 4RA3A 3NJIA 4Z95L 3KZ8A 1FFNB 4NQDA 4PGCB 3KYMB 2NZIA 1JDAA 4OLZL 4W9JC 3FB7B 2W8CA 2DTSA 3PFQA 5C0AD 3PREA 1OWRM 3BH8B 3NIFE 4LLWA 3QEUB 4H0HB 3GPEA 1BGXL 2QPEB 1MCPH 4U1GC 1TTRA 2H3NA 1CK0H 3NFNA 5EU6A 3K72B 1XAKA 3REVB 2C3VA 4NUPA 1PZBA 4TNWK 2IH1B 4N2GA 4F3FB 2DQTH 1G7JB 1RMFH 1FFNA 2Y7OA 1B6DA 1OAXH 1S3KH 4NQXB 5DFWH 5T1KA 1PCSA 4A68A 3T4YB 2N01B 5K93A 2VDNH 1S7UB 3GPSA 3UTZB 1HH6B 2OMNA 3GLDA 2XJKA 5EZIH 5DLLA 1DVUA 3CFKA 4TVPD 1EEQA 3VFSB 3QQ3A 2EYSB 3WIFA 1J0YA 4R90H 2KBGA 4PS4H 4C4KO 5EC1B 2VW4A 5KN5B 1NBVH 4GXVH 1FH5H 4MD0B 4MNGE 3QZWB 4BELD 1Z5LA 3FRPA 3LSOA 4WO4B 2GHZA 2AZUA 2J8UA 4LFHG 5IJKC 1AQKH 4LCIH 2HVKA 4IGBB 2M1KA 3X12A 4DKTA 4PLNC 1FCGA 1ETZB 4FS0A 1MAMH 2IADB 1YG9A 1UB5B 4KPHL 4OZIB 1N26A 1AZCA 2D03H 4CN6A 5A7EA 1ES0B 1KULA 1R33A 3AQDA 4M8QB 1R1CA 5JW4N 5GIRA 3FQNA 4X8GA 4F7MB 3G9VA 4NCC2 1CE6A 3LH2L 1UWGH 2RR3A 2KL6A 5BXFA 1XIWC 1JPGB 2ZUUA 3BFWA 3RVVD 4NRYA 1I7RB 3HB3C 4ACTA 3S48A 3VH8G 4ZMZA 4KZ0A 1NGQH 3C5XA 3FUJA 1D6VL 2WM0A 4LRIA 4QRQB 3RTQC 3RZCC 4L4VA 1XF4A 2WLMA 1EDHA 5JPNA 1LEGA 5FYJH 5EIVA 1CYGA 3KEHA 2NNAA 4NT6B 4OZHF 1AHMA 4QHUA 4OH2A 1U3JA 4ICXA 4QRRA 4LMQI 3ZU8A 4LEXH 3FT9A 4XVJL 2OZ4H 1U95A 4P2YA 1S5IL 3MRNA 5DS1A 3ZKND 5BJTB 1C5DA 4X4YA 3BHBB 3WLBA 1KCVH 3B3IB 1A0QL 4Q52A 1L7IL 3HAEA 1WH0A 3KLDA 3LAFA 4JR9L 3EFFA 3VWJB 5BV7C 4PBXA 2VSKB 3ZHDA 4I0KA 3F64A 5IW1B 3BLPX 1YQ2A 3CC5A 3VD7A 2A74A 3F83A 4S1SL 5LXGH 1D2OA 1DJYA 1G4RA 5IROC 2GY5A 4ZPTA 5SX4I 1NFDA 5EC2B 4K3EH 3DVNB 4LSQH 4GIPD 4GYBA 4LGSB 1XH3B 2ZUQC 5IJDC 5T5FA 1UH4A 1IJ9A 4KRLB 4HGKC 2VR6A 1B4TA 3G5VA 1R3IH 4EF3A 2CJSA 4R84A 4UT6A 2QQKH 4BA0A 2IOOA 3RTQA 2E86A 2NT1A 3NCYP 5H37H 1JL8A 3MLZH 3RZCA 2UXTA 4BWWA 3OGCB 1OB1B 4H1LB 4YSOA 4Z9KB 3STLA 5LNDA 3QXAA 3BAEH 1VEPA 2ENPA 4K7PH 2P5WE 3NABL 1A3QA 4MS6A 3WUWG 1NGXB 1WK0A 2Y25A 5A3ID 2OCCB 1LO4H 3FAWA 1EHNA 2BP0B 3D25A 2XG4B 3E6FA 5IFAH 3GSWB 3QO0A 3OJDB 4OZIF 1T3FA 4HKZA 1BREA 2VZTA 3H85A 4AG4H 1DQIA 2NYKA 1Y18B 3QCVH 3B5TA 1LP9F 3ZE1F 4YSDA 3CBJB 32C2A 5GJTH 5J7CC 2AQSA 4ABWA 5B22A 3AAZB 2YAEA 3INOA 1CICA 2QZ5A 3KWXA 5IMLA 5HDWA 5SX4H 1NAMH 3NFSH 2WQXA 2ILLA 2Z8VC 5LBVA 3T0WA 4GSUA 1ICTA 2BIMA 5H94B 3DOHA 1SY6L 3PUUA 1PJ9A 4JVPA 1KB3A 4MNQD 2WP3T 5AG8A 3N41B 4P2QD 2G4EA 4LIQH 2CPCA 3DSFH 2CA4A 4XZ4A 5E56A 4UIKL 3AT8A 5I6LA 4AMWA 2CZNA 3WUWA 3SKJH 2F53E 3FT1A 4YXHL 1T7YA 5DK2B 2BNUB 1FFOA 3FN0L 3JWNC 4RAHA 4B9YA 5I23A 3MRIB 1B4LA 3V0GA 2EDTA 2BM3A 1KT2B 2VITB 1QQDA 3BIKA 4X6FA 1IEAB 1P4LA 5EO0B 4XPTH 1BVKB 1KYFA 1WWBX 4I2XE 4LT7A 5KJRL 2HT3D 4ALAC 2EVJA 4FXGC 5CBEB 3V5DB 3OC5A 3ATDA 1ONQB 4PN6A 4P46C 4XMPL 5FA3A 3FC8A 4D0BA 1KXVA 4G83A 2BCKB 1JAEA 5AAMA 2Y2YA 3ARSA 4I3GA 5D2LE 2HYMA 3FXIC 3AVEA 1EEZB 1YMHB 2IBZY 4X4KA 4LHQB 2IPTH 1J05A 4LQFL 3W11C 2NY4B 4EJ1C 3ULVD 5I19H 4ZTPL 1J1OL 2H32H 4P5TA 3FSVA 4WI0B 4BK8A 2GSGB 2VAAB 2IWKA 5IMMB 2ETWA 4WY7H 2D31B 4HH9B 3TH4T 4ABUA 1E67A 2VLKD 3T0ED 4PMFA 3W0WE 2A83A 3BSHA 4XNUH 5ENWB 1WC7B 1NLDL 4L05A 5I8OH 2BCKA 4YLBA 1LK2B 2XX1A 3EFOA 1AKJA 4Y5XB 4EKJA 3KPTA 4WZ9A 3RWCB 4Z77B 3DVIA 4Z7NE 2Z4TA 5TQ0H 1D7CA 2QR0B 1ACYL 5EC2A 1F4HA 1MVUB 3SDAA 3HC0A 2JK5A 2DKMA 1FUNA 2HT2C 1IC0A 3D52A 2OL3A 3CK0H 1HNGA 2EEXA 1DSYA 2V2XB 1A6TA 3WAJA 1EEYA 5DEZA 2MEJB 2DQEH 1XGYH 4LSPH 3P9LA 5CM1A 4QWWC 2NNRA 4FQIH 1QPXA 3R19A 4P9MH 4KXAA 3PGFH 4J8RB 1IT9L 4LCCC 3ZZQA 4X4XA 1XEDA 4YX2H 2EKSA 4I4WA 1YEHH 1RJCA 1K2DA 4YZWA 3EYUH 1I8KA 2QPUA 1UZGA 1CBVL 1R75A 2F74B 3QRGL 3HHSA 2ICWA 1G7QA 1LJMA 4OIIH 2X6BA 4L8BB 4PJ9D 4WWKC 4K5PA 2WCPA 5LGJA 2FO4A 3IFLH 1NCAL 5F6IC 4CVXB 3VFUB 3OZKA 3TBCA 2DLHA 4WEMB 1P4BL 3MRDA 4R3SB 4P3CH 5E2TH 3O9WA 3MGAA 2GJZA 2ZAIA 4XBMA 1NDGA 4ZPTB 3GZPA 5DC0A 4I18A 5DUML 3ELAT 1NCGA 2JQMA 4ONFL 3CC1A 3FUKA 3PUCA 3OWRA 5DVKA 3VXSA 4BFFA 1GJWA 4CGUB 2HH0H 4L37A 1S8DA 4LOVA 1E8WA 3HFML 4UQBA 1EZVX 12E8H 3MXVL 2FTAA 2WZ6A 3U2IA 1I82A 4AGMA 2X70A 3TJEL 1FNSH 1OB1A 1YUHA 1HQ4A 2JJVA 4YE4H 3SODB 2BP8B 4XN4A 3RX5A 4UTAL 3BP5B 3A6CL 3D06A 1UUNA 4XBGA 5HGBA 1B0GB 1TZ8A 2PP7A 5KYXA 2RHEA 3PNWA 2OI9B 3BN9C 2YGNA 4IRSB 4QNPE 2JKRM 3ARQA 2CIKB 5K9KA 1ZLVK 1WFTA 2WBJC 1KIUA 3O6LL 4Q9QH 3VTAA 4L8SC 2B3IA 4HJEA 1JV2B 2I60L 5F89A 4YLCA 3TU6A 1S7UA 3T8MA 4Y9CA 5ACZA 3TO2A 3FCTB 1G9HA 2AJ3A 4BQCA 4OCWH 3C6SB 3STZA 1AANA 5E7FA 3MZTA 4JPVL 3IMVA 3DHJA 4NZTL 3QS2A 3FUDA 3ME0B 4ABVA 3G6JB 4G9FB 2IMMA 4FKKA 2GT9B 3X12B 3VFWA 5D6DA 1AO7B 2ADFH 2W95A 2YFNA 1EZSA 3RVWD 3PWJA 4BK4A 3JTSB 1ZDQA 2XN9A 2XA8H 3QISA 3U2JA 2BINA 4UILH 4HFWB 5IVZB 3F5WB 4XTRD 1FGNL 4XMVA 3M6DA 2QVTA 3IJHB 5I18L 1VESA 2WGNB 3VG0L 5DRWB 5KUKA 4FJYA 2W65B 5BRZB 3H4FA 1ZHKB 1QPKA 4L1HA 2FX8L 3LPOA 3CN1A 3V4VL 1D9KC 2OP4H 2JIXA 1GGIH 1CFNA 1OM3H 4PB9L 3DX6A 5ICXA 2BVPB 1JPSL 1T0MB 4FNUA 2Q8BL 5HHOE 3TZVC 3RY4A 2WTRB 1Z5HA 2W0FB 2Y07L 4IBSA 1PCXA 1KLFA 4NO0A 2J6WA 3TZVD 4RMTA 4F8TA 4XC1H 1ML0A 1PG7W 4JDTH 3PS6A 1DVYA 3C8HA 4MA3B 1QBBA 2BIOA 2PMZA 4GKZB 4J39A 35C8H 3HNSH 3ULUL 1YAZA 1YEEH 2BXYA 3GSXA 2Z8RA 3WIAA 2Y36L 2XN9E 2OW7A 3OKOB 4I3RH 5C0DA 1KGWA 3VFUA 4A6YL 4EOWH 1XSIA 5DHEA 5IB4A 1GS8A 4RGNE 1IBBA 4YDLB 3CPLB 4Z76B 4S1DC 1UWGL 1W0VB 4XHQA 5GRVL 4DVRH 4OI8A 1GAFH 2OBGA 3UYPA 4XTRC 3LVEA 4QXGH 5TE4H 1YEIL 1MXGA 4P9HC 4KQ3L 5IOKA 4WSGA 1P4UA 3EJYD 1FGVH 1NCBH 1PZDA 4N5EC 1I3GL 3NN8A 2PR4L 1XDTT 1XT5A 1UQSA 1G6RA 3NPSC 2DMKA 2A77L 2C9XA 1MG2C 2J44A 3GJEA 3BE1H 4F5CE 4WI8A 1NCUA 4JY6A 2JI2A 1WD8A 4HJJH 3S2AA 5I30H 5F7MC 3IS0X 2P5EE 4XMKL 1KCVL 4Y4HD 1TU2A 2IBGA 4LVOB 2VN3A 4M1DH 3UTPE 3FQ4A 1U93A 2VDRH 3TV3H 1W80A 4N28A 3X13A 1L9MA 3E6HB 5KVEL 4MKTA 3WNMA 1KN2L 2NR6C 3JWNH 4PTTA 5J13B 3GMPA 1WBYB 3FYEB 4GPVA 4ODWA 1HS6A 3QFDA 4HS8H 4Y5VC 4G8GB 2XIDA 1HOCA 2AI0H 3BN9D 5F7AA 2PW2A 3L4ZA 3CFIC 5D4HA 1WICA 1JOIA 4BHUA 4M6MH 1E4KA 1UKTA 1GCYA 4HSAC 5DJ8B 4ZO9A 1AHKA 4MMZA 3FK3A 4OM0H 3MLZL 2DN7A 3DETC 3I2CH 4XMUA 5JIQA 2VDQH 1R5VA 4R83A 5CUSH 5HI5C 5I9QC 2ZUXA 3KHQA 1T5XB 5ID1A 4M8VA 3S3DB 5AD0B 3WY1A 5D1ZB 3IBEA 1P7BA 2G9HA 1CLCA 4N6RB 4U1GB 2GBUA 3VNYA 5AL0A 5EUKA 2YZ1A 4NKOB 3O3AB 4Y2NA 3RFZB 4W4NA 4M1GH 3EDJA 4UNUA 5DURD 2IQAA 1A4JA 3L9BA 4A7VA 2W60A 4B5EA 2BY0A 1EGJA 2J55A 2NY0D 4PJFE 5AQ0A 5HYEA 4O9HH 1KPRA 4RDQG 2DWDB 2NMSA 4KJWC 4KAQH 5DMGC 3SO3C 4WWKD 5FGCE 1QFPA 4XCEB 1YY9C 5K1JA 5IVXA 5JPMC 3VJ6A 6PCYA 4FQ2L 3PQYA 1TETH 5BVPL 2YQBA 1MWAB 5E0FA 4UDTB 3RAJH 1N64L 3L95A 4P5SA 1NAML 4F9LC 3NSJA 2AJXH 4XPAH 2EXYC 3FTYA 3L5HA 4OKDA 5EU7C 2OYKA 5HHQA 1Y0LA 2OTUA 1P4IL 3P77B 4JFDE 4F2EA 2G5BA 4KNSA 1LVEA 3BAYA 3FUEA 1X5MA 2D0FA 1MCBA 3F04A 3LQMA 3B83A 5E51A 3TVMA 3GJFH 3T0EA 3DIVA 4WW2F 5D2NC 1ET7A 3VX0A 4N8PA 4H88L 2KKQA 4HFWA 4DZBB 2H2SC 1KC5H 4IDLA 5L9DH 1SMOA 3UBXA 5A40E 4TUJA 3EF4A 4ODSH 1JNHA 3FZUD 1R46A 3B2VH 4W6WB 3TT3L 4JY5L 3UZEC 1K4CA 5ANMB 2VE6B 4N5UA 1LO5A 4F7EB 1U42A 7PCYA 4KXZH 3O4OC 3C6EA 4JO4L 3RTQB 2VN5A 4LCWA 1H5BA 3A5VA 1M53A 2BVPA 3ULVC 2VWEC 3V0FA 4TSAH 4WTXA 2R8SL 3UAAA 2HX9A 4X4ME 3DBXA 1CCZA 1MRFL 3MNZA 2AANA 3FT2A 1J1OH 2E8YA 4EQ2A 4HKBB 2GITB 1FVDB 4CBZA 2XTJE 1GS7A 5L7XL 2YPLD 4NRZA 4IGBC 4L5FE 2IVFC 1NMBH 1V27A 4MAYA 5BZWB 4NQVB 1ODAA 2EIZB 1COBA 3UTTD 1UACH 2G75B 1KPVA 1I4FA 4GQ9H 4QGYA 3BQUC 4M7JL 3IFNL 4HALA 3RDTC 1TFPA 2LTQB 4OCXH 4N2BA 5IQLA 1YY8B 1BV8A 4ZK8A 1W91A 43CAA 4NNPL 5FPIA 3QYNA 1NC4A 4A7SA 5CR8A 3QRLA 2H2PD 5DDHB 4P2OC 4QXTB 4QHMA 3RI5F 3P11L 3BKMH 4FQIL 1T22A 3DX8B 1CFQA 1G9MC 1LK3L 4MD4A 5IBLC 1K85A 2Z8WC 3W0WD 4GNKB 3S5ZA 4GRLB 4MMXA 1M71B 2BNRB 5CJOH 4JN2B 2YXWA 1F6AB 2X4PB 4MJ6A 2UY6A 4WCYL 4FQJH 3GSQB 5D1ZA 3VXRA 3WU1A 4X0KB 1BZDA 2E6JA 5FYKL 5EUKB 2WIMA 2BWIA 1LXMA 3D0LA 1NIBA 2IFFH 4AYMC 3VE0A 3U4BL 1TQSA 1EJOH 4GLRH 4MD4B 2YMTA 3L3DA 2PXYB 4P3CL 5E2TL 1JZ6A 4NNXB 1YMME 4DQAA 4HKXB 1IC7H 1FYHB 1T7VA 2RBLA 1OF2A 2Z35A 2SEBB 1VFBB 3M17A 4FG0A 3VDAA 4M48H 1ZTXH 3AXHA 4NAJA 2CGRH 3BW9A 3CBKB 1S9XB 1IEBB 3QZWA 2HTKC 1BMWA 3L4WA 4J6RH 3EJJX 2QKIA 3ET9F 4LU5H 4JFHD 4BKTC 4HIJA 3F7QA 1MELA 1WBZB 3LRMA 1RJZA 4F33A 3PAZA 4H1LH 4KDVA 4NIYE 4HJ0D 4ODHL 5DJXB 4IRJA 4QO1B 4OLXL 1RZGB 4OF6A 4FFWD 3ZOAA 1FL3A 4RETB 2E59A 2VUKA 3T3PE 4P57B 1KXQE 5D8JH 3MFGB 4PP1D 5CJQL 4QKTA 4WGKA 4AMKH 3L4UA 4JO2L 4KRPD 4AK1A 4D3CL 1DJHA 4PGEA 1LEKA 1G7QB 1MREL 4G8FA 3BHBA 5I1HL 3TNMA 5B8CA 1J8HE 1QBMH 5HJ3A 2AXGB 4GQRA 2VMDA 3V95A 5KSAD 2CLVB 1ESOA 1M7IA 5CO1A 3V52L 2FJFB 2EVHA 4MDIB 1AY1L 1FQ9C 4DGYL 3QZWG 4GFXA 1U3HA 2X09A 3LMJH 2KMWA 4N0CD 3IF1B 1SVBA 2NTFB 5IB1A 2RGSA 3KPPB 3OLIA 4WAFA 3F12B 5C08D 3ZYJA 3WELA 4NO3A 3ENEA 4N4YB 4Q56A 2G5BB 3D4ZA 1F4AA 1U8PB 2Z7WA 1HX0A 4RNRB 3MLSL 2GUOA 4X6EA 1IGJA 3QPXL 2W92A 1X7TA 3GSXB 4R3SA 4OJDH 5DEGA 2Z1PA 4C4UA 2EDFA 3D48R 4WW1B 4KXCA 4KROC 5E1HB 3VACA 3C2SA 3EDEA 5E8NA 3TBWA 1MJ8H 3HNTH 1U8LB 3T1WA 2IAMA 5DF0A 3U46B 2H3NB 2DM3A 4FYSA 5EU6B 3V4VB 1W15A 4HEPG 2FHBA 1RP8A 2YBRA 5FUZL 1Q94A 2ZICA 2VZOA 3DMMD 4JFUA 1FIGH 2X89D 5KSBB 2AAAA 4C83A 4FXGB 2QQNH 1QVOA 2BJML 2QADD 1KN4H 3N43F 1E65A 2PABA 2V7NA 3VXRD 1REIA 3FTGB 4JR9H 1CR9H 3CBRA 2CCLA 4GIOA 1KYDA 4HIIA 3PL6B 3L48A 4H44C 4S1SH 5IJVB 5LXGL 2RB8A 2CKNA 1BJ8A 2ADYA 3VXPB 3ZKSD 2PCPA 2Y36H 2XV0A 3MRIA 4EOWL 1TUPA 1SLXA 5IVOA 4V1DE 3LIZA 4CADA 3HW7A 5AVTB 3VFWB 4MYWB 3IXTB 3GBNL 5CGYD 3GZOA 3QARA 3HAEG 4TSCH 4U6TA 4LLMB 2OA9A 2J71A 3LV3B 1EO8H 1N4XL 3ZT5A 4X9IA 2ATPA 5DO2D 3VFRB 3VI3E 5ESAA 2Y7QA 1R24B 2VQUA 2X42A 3PWUA 3X1NA 1BQLH 2FCBA 1IE4A 3K3QA 3H0TB 4L8CB 3S4SG 3BE1L 4O58H 1WUZA 3R0NA 3EDKA 4HC1H 5JXED 2P42B 2MPVA 4Z7UE 3MROA 4ZFGH 1QRKA 1QWUA 1T5XA 5ID1B 4G6ML 2A6IA 2GIXA 4M5ZL 1RIUH 4PAZA 1QSEA 4LDOB 4JM4L 3TA3B 3TIDA 1F6FB 1XCQB 4ZFZB 5C92A 5J4MA 1KN2H 3ECUA 3MRHA 4TOYL 4HUXA 4PCSA 2WY3B 4OFYA 3SJVE 5BJTA 2WUBL 4F2FA 1J12A 3CFCH 1N5AB 1BMGA 2D7PA 3L1OH 2ZUWA 1DDHB 4NZDA 4KU1A 3WNPA 4XPGL 1SY6H 1CD8A 1E4XI 1OCOB 1RIHH 1WFOA 1ZEAH 2N1TE 1QA9B 5DD3H 2B4CL 3HNVH 3VMNA 4G3YL 3HZYA 4JFDB 2ZX9A 4MB1A 1J0ZA 1FAIH 1TO5A 3ARFC 1B4JL 3AXIA 3CN3A 3L3IB 2QSTA 1JPGA 3BP4A 3QHFL 2F19H 5F8QC 5CUSL 4KMTL 3VYPA 3IPEA 3QH3B 4P2QB 3KLLA 1H3TA 1FO0B 2AJYH 4KFMA 4RNRA 3UO1L 1WFUA 1WWAX 1WT5C 3EJUA 4DUVA 1FWXA 3QP3A 1MEXH 4M7KL 4AGOA 4YSTA 3MV8D 4AQEB 4RX4A 1URIA 4PCYA 1T1WB 1CFSB 3S5LG 4P9HH 2IQ9H 3BFQG 4AYSA 4LVNC 3K4DA 3GKWH 3GRWL 5CU9A 2CIIB 1AZVA 1RIVL 3D85B 3FBQA 4JKNA 2Q7AA 3O11A 1A1OB 4YXLH 2B0SH 2OMVB 3HZVA 4L3EE 1BM3L 2AK4A 3HUJB 1SDAB 4QLRA 1CXKA 4UZUA 1LNUB 5DZJA 3BVNA 4G43B 5JDJA 3HBGA 4FA7B 4CW1B 1KJ2B 3L5JA 4YPGB 4BCYA 1BA9A 4I0CC 2CH8A 1W72L 4ZUVB 1CYXA 2GTZB 2Z31A 2EDKA 3K6SA 4R7XA 1KPUB 4TQEH 4TUUA 1NAKH 2WANA 1Q38A 2VOTA 1GGYA 4NRZB 1M1XA 3K71B 1MAJA 1JK9B 1T80A 1CGYA 4U6YA 5AB0A 3W2DL 2ZSVA 2JKWA 3LD8B 2JSFA 2ZPKL 5GJSH 4WUUE 4XH2B 2XYCA 1VSCA 3MUUA 4N9GB 2ZYRA 3CZFA 1BFVH 2BDNL 1PD1A 5L88H 5HGGS 2BRRL 2FK9A 1X5FA 3O3UN 1NCWH 2HKHL 3OMAB 1IT9H 4KY2A 2Z31B 1HCVA 1ANUA 1ZJBA 4PRIB 2VR9A 3BAIA 3LKRB 5LQBH 3SDDC 3WHE0 3ZL4L 4NUGL 3K71A 2X0UA 4ZSOE 5ES4B 2XZCH 4JFDD 1QQDB 4ZS6D 3MRMB 1MFCL 1OD7A 3CDZA 3NPSB 1DR9A 2IV9A 5KW9H 2A73B 4OCRL 3S37L 1L0PA 4ELDA 3QI9A 2ZOKB 3QA3A 1SOKA 1NBZB 4PHXA 3EJRA 1OW0A 5D4JA 1K5WA 4WU7B 3W5MA 4LL9A 1C16A 4OFKA 1XGTA 2LU7A 3ZYIA 3ME0A 1BZ7A 3IFNH 1BQHG 1QEXA 3PE9A 4OD2B 2QTVA 4OCXL 1FFPB 2W0PA 5CGTA 5B1BB 4G8GD 4U0RC 3PQYB 4OZIA 2LU4A 2IH9A 2R69H 5D7IA 4R97B 3Q8BA 3QIWA 1EZLA 4PV1C 1RUAL 1M6OB 2ALWA 3R7QA 4WU7A 2ARJB 1DQJA 3D07A 3SZKC 1WAEA 4HXAL 3R18A 2X1XR 3EFDL 4BINA 4ELKA 2X88A 3ZRFC 1N2RA 1INEL 2QVKA 3QNXA 1NIEA 3JV6A 3EH5B 3OM3B 3RWEA 3O3DB 1QX1A 2J12B 2IGLA 3P0GB 4LCWE 5EBLA 4YHNB 2DIJA 4FFTA 3GK8H 4QXUH 4EDXB 2ESVA 1MPAH 2PO6B 1ASOA 1QFHA 2O6CA 4HFUL 2ICWI 5C07D 1B0IA 5HJBA 2VLMD 4WFGD 3TBVB 1RFDH 2M2DA 5B21A 4Y2OB 5CIPB 4D8PB 4BFBD 1NTDA 1A1NB 1PNCA 2C9AA 3LHAA 5EA0L 3KCPA 3KGTA 2K7PA 4FMFA 4NGHH 2DEXX 1A0QH 1BBJA 3LPGA 1E6OL 3G6JE 4G9FE 1SYSB 3TCTA 1KB9K 5BPPA 2BC4B 4G42A 2XWBB 1JFQL 2O6PA 4WV1C 1WFNA 5DMYA 3O6KH 1PD6A 3PJSA 5TE7H 3T2QA 4JFQA 5EU6D 3ZDZB 2DM2A 2CJUH 2ICWB 2IXQA 2PPDA 3BD5A 3BISA 3TOPA 4NC2B 2OX5A 5DRZB 4J27A 2FZ3A 3D85A 3L1FA 3DYPA 4H1LG 4ERSL 2M8XA 1J8HD 2VO8A 2OTWA 4J8RA 5DD0H 4Q0XH 5EOQL 2F2HA 4ZUWB 5I74B 5E08L 2Z31D 5IGXH 3PHQB 3BPNC 1I7UB 4Q6KA 4Z3FA 2Z91B 2FUTA 3FO2B 4G5ZL 4RIRB 1IO4C 1JPFA 1DEEA 3LEYL 1L7TL 2XWTA 3N44B 4OSUH 4ZYKA 2NY3B 2Y5EA 3O4LA 4XI5C 4PJIA 5LDSA 5F7DB 1FL5A 1G7LB 2XKNA 3T04D 3CLWA 4ONGH 1QLRA 5EORL 5JPMB 5T1MB 2V7NB 8PAZA 3WNJA 4XXCA 4WTZG 2H6PB 3CH1A 1OLZA 4XZUB 1LO0L 4XO4A 4JDEB 1C1EL 1PJWA 4JHVA 2NDFA 2FAUA 3QWQB 3EJZD 1A66A 4G6AD 1HCZA 1KGIA 2BS8A 1IBZA 4PRHD 1NC2A 5HJDA 3N1FC 1QD0A 3BEVB 2X4QA 3LEVL 2D03L 4L3FA 5DFVC 2X6AA 1TT6A 3T71A 3IJYB 1V7ML 1UB5A 3KL5A 4M5SA 3UZQA 3D3VA 1IAIH 3LXCA 4PJ7F 3WGUB 2GKIA 3GDCA 2A77H 4HPOH 1NM9A 2FGWH 4XVUC 5ICYA 1HNFA 3P30H 5CCGE 4QTFA 4Y1TA 3V4PA 2D3NA 4NO2B 1RJYB 4K2UL 5FO7B 2YN5A 5E5LA 3WN5A 4UT6L 4J12A 4E36A 3WEXB </