1NCHA

Structural basis of cell-cell adhesion by cadherins
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
98
Chain Sequence
GSDWVIPPINLPENSGPFPQELVRIRSGRDLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-CADHERIN
publication title Structural basis of cell-cell adhesion by cadherins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion protein
total genus 19
structure length 98
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1nchA00
1EDHA 1SUHA 5JYLA 4ZMOA 2OMXB 3LNFA 4AQ8A 4ZMNA 2OMWB 4ZMZA 2A4CA 2OMYB 3Q2WA 4ZTEA 2OMZB 2QVFB 4ZMQA 3LNEA 3Q2LA 3LNDA 3LNIA 4ZMXA 1NCJA 1NCIA 1FF5A 4NQQA 4APXB 4AQAB 3K6DA 2YSTA 2WBXA 5CZRA 2YQGA 1ZVNA 2OMVB 4OY9A 3K6IA 2WD0A 3PPEA 2O72A 4APXA 4NUPA 4AQAA 1WUZA 4ZMTA 2QVIA 3UBHA 4NUQA 3MVSA 2WCPA 2A4EA 4ZMLA 3Q2VA 1OP4A 4ZT1A 5JYMA 1L3WA 4XXWC 2EE0A 5CO1A 4AK1A 3LNHA 4ZMYA 3K6FA 4AQ8C 3UBGA 2X2UA 1NCGA 3K5SA 2OMUB 1NCHA 3FF7A 4ZMPA 4XXWA 3Q2NA 1Q1PA 5DZVA 4ZMVA 2WHVA 4AQEA 4QD2E 4ZMWA 5KJ4A 3K5RA 4AQEB 1O6SB 3FF8A 4AXWA 3LNGA 2OMTB 3UBFA 2V37A 3QRBA 1ZXKA 1WYJA 4NUMA 4AXWB 4ZI8A
chains in the Genus database with same CATH superfamily
3LKOA 4DKFL 3PIQA 4DKTA 1A5FH 4N2GA 3MLYL 4PG9A 4PJCB 5B1JA 1DJSA 2QELA 3CSTA 3C8DA 1DQJB 2C1OA 1NA8A 4I3RL 4YXKL 4WO4D 2Y3AA 2YSSB 4P46B 4PGDB 3BZ4A 4UNIA 1EK3A 1CXFA 2JJUA 4BXSV 3CGTA 1HK6A 4F15C 3W11C 2KMWA 5ICYA 2E27L 3MOBH 2DQUL 2X0VA 3P02A 4P5MB 2E9BA 5IMOA 1NGYA 3UJJL 2DEWX 2MMXA 2Y06L 3BFWA 5KTEL 4P99A 5MEND 3OXRA 4GS7B 1UCBL 3WOVA 3K6SA 2ZKHH 1NMAH 4Q74A 1H0DA 3KYMB 4M1CD 4UB0H 5AW5B 5C0AB 3UTTA 1AGDA 3CH1B 5KVEE 2A74B 1TPXC 5KVEH 2GI0A 1GZHC 5ICZB 4LRNH 4UTAA 2VQ1A 1AQKH 4JO1H 3QUML 4WWKC 1YJDC 2VL5B 1NMCB 3QPQD 1MCEA 3H42L 3T0VA 3LX9A 3GDCA 4YR6A 2I07B 3UTQB 1V3JA 3DV6A 3QHZH 5IB2B 5D4HA 1XF3A 3QA3B 2OI9C 4MMZC 2QLYA 5ID0A 4JK0D 1KY7A 3IJ9A 1SDDA 5FGRA 2GB2A 3P69A 4AIXA 15C8H 5C92A 2JV6A 4JDZB 3WS3B 1VZIA 3NZHH 4M3KB 3SDXB 1BZ7B 5KZCD 1SJMA 1KDIA 3GPSA 5B8CB 5GGSB 5ADOH 3KPQA 1WE5A 1SPDA 4YK4B 3M1BB 1V7ML 3CTTA 3TWCH 3X1NA 3QS3A 3FPYA 1NBQA 1VGKB 3RVTD 2BS8A 1JRHL 3DBXB 1ZHLB 4L4VE 2QMJA 4Y16B 1D9KC 3VXSA 5BVJA 1AXTH 2AEOA 5EN3A 3ULVL 3G6JB 3R06B 4GBXD 4PJBA 4JFDB 5A2KH 1DJWA 2W9LA 5AVSB 1I8AA 3GXFA 1UD3A 2EKJA 5DUMH 4L3CB 3QFJA 4DN4H 4AYSA 1M4KA 3VXUD 4Q4IA 2XNAA 3VD3A 2JKSA 4ADGA 2LU3A 3MFFB 4NQEB 4KZEL 5AVTB 1PIFA 3TFBA 4NQCB 2QBWA 1GW6A 2PR9A 1LDPH 1TJGL 3H6AA 5CU5A 1Q8MA 1KENL 5DDHA 1KIQA 4L1HA 3LQMA 4MA8L 4HOWA 4QYAA 1QEWB 1GGUA 3TYFA 1UJ3C 1ZY9A 3D12B 5HHME 3UXFA 2VUKA 2VABA 2SEBA 2H9GA 1QFHA 5GJSH 5I1AB 2VERN 2Y1VA 1FFPB 4QI3A 4CC0A 3UIZA 4RGMC 2X44D 1YDPA 1EFXD 2MQCA 1PD0A 3V6BR 2E76C 3IBEA 4L8SA 4CMMA 3HB3C 4YPGA 1A4AA 1JNNL 3BP5B 5M95B 1U91B 5GRXG 3BZEB 3E6HA 2A9CA 1H8LA 4IOIB 2TRYA 5E1HB 5E5MA 2YRPA 3K8KA 4U1HB 1AZUA 1W9XA 5IFHH 3Q8BA 1AG0A 2A83A 2J44A 1YAZA 1EHNA 5KVGL 4NAMA 3RWHB 5HPMA 3VTMA 3ZDYF 2P80D 3MBWB 2WZPA 4QXVA 3Q8CA 4HIIA 1S5HB 3VXMD 4X80H 4NO5B 1A9EB 4XTRD 2WCGA 3CFDB 4NHCL 2Y1AA 4DKEL 2ZOKA 1UVQA 1A6ZB 2XWCA 3D48R 3E8UH 5FFOA 1D5BA 4H8QA 4UILH 1EEZA 1KPRB 4J3OF 2AJ3B 5DHXB 4UDUB 4MDIB 1LHZA 2VSKB 5KUMA 1U8HB 4IGBA 5FOBB 1YPZE 1HX0A 1FYTE 4OZHE 5LBGA 1E28A 3EIFA 3MCLH 4O2FB 3NDYE 4Y1SA 1U93B 2F08A 3LCYA 4ZMYA 2X1QA 2COVD 1TYRA 2XN0A 4ZO9A 2JK5B 5EBWB 2F68X 2DEYX 1G7PB 2P1YA 5F3HA 4CBZA 3CN0A 1XGYL 3B43A 3CC5B 2CLVB 3KAAA 4M43H 7TAAA 2J5WA 3U2IA 1URZA 4JZOA 2PWEA 4YDJA 3MRMB 2XTJC 4KQ3H 5FKPB 3LKOB 1UATA 3PWNA 1FNEA 3CDGA 3PIQB 4PG9B 5I1JL 2C1OB 4O02H 4GSXA 3BKMH 2OW6A 4ZOBA 4KXCA 3A4EA 1CGUA 1V7NH 5DMJB 3BZ4B 5T3ZL 1I31A 3D0VA 1IT9H 1S2EA 3CFQA 5ICYB 5IMOB 2GJRA 2DMKA 1NGYB 2Q10A 4X83A 5EC2B 1W8EA 1FN4A 2Y22A 1SF3A 1LEIA 4JRYD 1JXJA 3K6SB 3PP4L 2JKJA 1H0DB 3UTTB 3IGAA 3HUJE 2IAMC 3TO4B 2J8UE 1T5KA 1CL7L 2H6OA 2PTTA 2QKIB 4ZMZA 1GOFA 2VQ1B 3KNBB 4H1LG 4A1RA 1SQ2N 2HXAA 4JDVA 3VWKD 2NNXA 1INEH 1C8QA 1CVRA 1HEZB 1MH5A 1X4YA 3EOBB 4YR6B 3DV6B 4X99A 2VB5A 3QR2A 4HUMB 2QHRL 1XF3B 1DDHA 5L4IA 3WFBL 4ZNCD 2EXYC 2W80C 4WLCA 4LCWD 5F2FA 1AD0B 4HC1A 1GKOA 1JZFA 4OCRL 1QBLL 1SDDB 2L3BA 1P4UA 5EA0H 3G08A 6PAZA 5F3BA 2ZX5A 1BOYA 3MOAH 3RY5A 4YHYB 3ZYJA 2J57A 1EJOH 1AS7A 3QFGA 4YDIH 1BFTA 5K93A 4M61A 3KPQB 1PTZA 2ILLA 5TE6L 1BD2D 4L37A 4Y19E 4XMUA 7CGTA 1NLDH 1H3PH 1I8MA 2H8PB 2X5PA 3QUGA 2W59A 1BAGA 4HDIA 4K7PH 4NQXA 3LN4A 3RIAK 1WFMA 1S7TA 3BWUF 4BM7A 3KPRA 5CZXC 3VXSB 5BVJB 1Q1JL 5AW3B 3V9EA 5I6KA 1DHKA 2HJFA 5C08D 4PJBB 1T7WA 1XR9B 3BN9D 2YUWA 2RD0A 3Q8AA 1T0NA 3ARZA 1B4JL 3I50L 1V3KA 4NHUA 1T2JA 4K3DH 4HFUL 5CP7B 4CN4A 1SNRA 2BNRD 1JF5A 3WHE1 1NLBL 2NX5D 2HRPL 3BLPX 3MRNA 3IPBA 4PD4K 3U7WH 2XNAB 2VMEA 1ZJAA 5IEHA 2CCVA 3TT3L 1WZKA 4K23L 2J6WA 3SQOH 1QLEH 4CJ0A 1ODAA 4I1PA 3B3IA 2R0KL 5F7AA 5CILL 3RA7H 4QRRB 3C60D 3NVQA 3WJMB 3DHUA 4D9RE 4UAOB 4YQXH 2ZAGA 5DDHB 2CM6A 3TBSA 1IBGL 2FRGP 3TYFB 1NC2A 1JHLL 1NC4A 4JNXA 1MRFL 5F1NA 2NR6A 4J2XA 1S5IL 3QBTB 2VABB 2SEBB 1FHNA 3D08A 3VXTB 3EADA 1T21A 1XGTA 4I9WD 3ECVA 4KV5E 4FNLL 3UAJD 1LD9B 1W72H 4P05A 1PY9A 2CRMA 4NEHB 1I9JL 1YDPB 5GJTL 1IGJA 2BW5A 5D1ZD 2VKXA 4L8SB 5JW4N 5CJQH 5D1QE 5KYWB 3QUKA 1DBAH 1Y1UA 2XA8L 3CFCL 1N18A 3E6HB 4MYWB 4OZGF 5MHSD 3UERA 2ZX6A 4JW3A 5E5MB 5C70A 5C0EB 1Z3RA 1XSIA 4NC2B 1BJ1H 2CUIA 3ILDA 2A83B 3KJ4C 4A63A 3W39A 2UY6A 3MRCA 1R19A 3OR6A 3T3PF 4HIIB 3DTXB 3QC6X 2ZCKL 1JL8A 1T03H 1A7NH 1QSFD 3EJTA 4HAGA 3QFDA 1QFOA 2ZOKB 1UVQB 4LLVA 4HK0A 3N55A 1T3FB 1M9SA 4IRSA 5D1XB 5EPMA 3FTXA 1JERA 1EEZB 4UQDA 4MJ6A 4QRSA 5HI4C 1BF5A 2WLLA 3TO2A 1P2CA 4HKZA 1LNUA 2DLTA 4IGBB 1N26A 4TULL 1IRAY 4XWGL 1T89C 1ZANH 1FV1A 1E5BA 5D2NC 1E28B 3NCCB 4OCWH 2CIKA 4P5KA 2WIIA 4JDTL 2XZAL 4RVBA 4PR5A 4GSDL 4ZMTA 3FS9A 3WGUB 4FJZA 1EDYA 1MCNA 2ATKA 2DQTH 3F6IA 2OR9H 3BZDA 5HGAB 3UDWA 4R97B 2DWTA 2GTZA 1WIOA 3NIDB 5FA4A 5F3HB 5EBGA 4GRMB 2X42A 4KFMA 43C9A 3TBBA 4M7LH 3LKSA 4JZOB 1IX2A 3JWOC 4X6CE 3C6SB 4LOUD 5A3IC 1N10A 1PW3A 5HVFB 4NQUA 1E4HA 3BUYA 4NUGH 3V4PL 3ATEA 5JXAH 3FMGL 2L8AA 1ORQB 3RU8H 4P4KD 2EH7H 3APMA 2AQTA 1MFVA 4PM1A 2LE9A 4KKQA 2H45A 2R4SL 1U3HA 2BOLA 3GMNA 1UD4A 4MXQD 1QQDA 3BDBA 4PLKD 4JVUA 1LEIB 4KMTH 3EYOA 2YXFA 5DUBA 1GGCH 4KRLB 2FB4L 2Y69B 4WGVB 3I9IA 1ZSDB 3IGAB 4U1LA 4Y2DC 2PTTB 4OH2A 5I1HH 2WLHA 3CFNA 2DI9A 4R5TA 2WSKA 4LSRH 4N4YB 1R5IA 3LZFH 4TYUA 4FZEL 4YLQT 4Z7OB 4KKCC 3CZSA 3IMUA 1Z9NA 3BMVA 3H9SE 3WLWD 2BOCA 1RZKC 5JA8B 2L7JA 4X99B 4LCCA 1NIBA 1DDHB 1OPOA 1TKWA 1EEUA 2YPVH 1H9VA 1JE6A 4FGMA 4PS4L 5EO0A 4BH7A 4CVZA 4M1DL 2VDNL 2QJDA 3G08B 2F1BA 2V8LA 3KPOB 1ETB1 3DC0A 4FTVE 4Z3GA 3QDMD 5F3BB 3NAAL 5AZ2L 2EDHA 1XIWA 4ZUSA 4FQXC 2WINA 3FUDA 3MLVH 4FJYA 4WFHE 2VZOA 5H4ZA 4MB3A 1Y18A 2G60L 4L37B 4XWOC 1I8MB 3U4AA 1YUHA 4P2CG 4HDIB 2MCAA 2IGTA 2G2RA 3CVHA 1HINL 1CG9A 1J0JA 3B56A 1U2YA 3LN4B 4NQXB 4P9HC 3CVCA 1S7TB 1XV8A 3LRLA 3NZ8B 3KPRB 3N06B 4I0PA 4NP4H 2G5BA 4BD4A 2ADYA 2HJFB 4BSVB 3H85A 5DMGC 3HN3A 4HEPG 2H26B 4KTDL 1T0NB 4OGAC 1A65A 2NY1D 4NHUB 1W0WA 2MOQA 1U8NA 1NEZB 5DMKA 5EZIH 4LSSH 2IPKA 3EFFA 5GSRA 3E2HC 1A1MA 2WNXA 3CVIL 2AJVL 1AY1L 1HWWA 5ISZA 2Y7LA 4M6MH 1XSJA 3A22A 2Z8VC 5HJBA 2FD6L 3F6LA 4N2KA 2WLIA 3SODB 4ODWA 5B3JE 4J3OC 4QJ4B 4GEJA 3TBSB 2D3LA 1NC2B 4PY7A 1NC4B 5IW3A 2V5RA 5F1NB 1NH6A 5I74B 4LP4A 3ZXAC 4G6FB 3MYJB 3SGJA 4ZS6C 1T21B 4NP9A 1XGTB 3FUFA 3OAWA 1R33A 3C9NB 2FT6A 4JREC 3HEIB 3AUWB 3O3AA 2VH5L 1FL5B 1W15A 5EFIB 3B9EA 2LV4A 1KCUL 3ARSA 4XPHH 2IXQA 4JPIB 4NERA 1IGJB 5I6NA 1HCFX 3B7UX 3ZZSA 1CFVL 2NY5L 2ENPA 3NGBB 3JV5A 5BRQA 5KVDE 5KVDH 2BVPA 1ANUA 1EAPB 3IFOB 3P73A 5H37H 1UXMA 5DC0A 1DZ0A 4WI5A 3TCXA 1ZVHA 1T1XA 2ZCLL 4KQ4L 2WWNA 1J1PL 1UT2A 3TYGL 3W39B 3L3JA 2UY6B 4H8WL 2FO8A 3MRCB 4YSTA 5DEJA 3BW9A 3OR6B 5HHOE 3AMKA 4OLEA 2FT7A 3L3KA 1A3RH 4K7PX 4RGNB 3WL9A 2XIBA 4LF3A 4P2RA 3QFDB 1VPOL 2P5PA 4HPOL 4LLVB 3RZCD 1I3GL 4XMTA 4DPAX 4HK0B 4IRSB 3NDZE 3QQNA 2IEPA 4QRSB 3WNIA 2WLLB 4YWGH 1ASOA 1P2CB 4HKZB 5DD5H 1CTNA 3MXWH 1RKRA 3L1OL 1N64H 2EO9A 2QQKH 5JOFA 1SLXA 2NTSP 1Q9OA 1FV1B 3ASWA 3DMMA 2OAAA 3PL6A 4P5KB 5TDPB 3BDYH 4K94L 5DUJA 2J1WA 3HFFA 2WQVA 1RZ7H 4PGZA 2WC7A 5I18L 3NJGA 2NSQA 1ETZA 3P9LA 1UEYA 2AERT 2GTZB 4AM0Q 4FI7A 5FA4B 2BERA 3N3EA 2JKIS 1HI6A 4TSCL 2V9QA 4B97A 3EHBC 3LKSB 3K8MA 3KYNA 3OAZH 3UAFA 5AZUA 1NWOA 4B9ZA 3NCMA 2KLSA 4I3SL 1WEJH 2HLAA 3UCQA 5GGVL 3HG1E 1X5YA 4PJ8A 1HZHL 2O5YH 4HLEA 4PY8J 3BUYB 2ITFA 3T4AC 3TBVB 5AVRB 1IJNA 2NY2B 4G72B 3DSFL 1NGQL 1JZ2A 3SE3A 5EU6E 3QJHA 5AZEH 1L9PA 3QS2A 3QULA 3GSWA 3KW8A 3SN6N 4K7PY 1U3HB 3CZNA 3GMNB 1QQDB 3K3QA 4G3YH 1PFOA 5F8QC 3V4VL 5E24E 4KI5F 3EYOB 5E4AA 5DUBB 3BWUC 2YS4A 1DANU 4OIFA 4QHMA 1T20A 1BM3L 4NO0D 3H9YA 4HLZH 2CKBH 2HFEA 5FDYA 2XZQL 3D0LA 1LO5A 3REWA 4YDLB 5I23A 4E5XA 1R5IB 4NQDE 4XN5A 1DQQA 1F6FB 2Y06H 2JKWA 4Z7WE 5T5FA 4CMHB 3ZKSD 1OY3B 1SDAB 2BOCB 5DZVA 3U9UB 2I60H 2PMZA 5DS8A 2EECA 1JAEA 5CJOL 1ZXQA 1TT6A 2HT3C 1KXQE 5LG1A 3MBEC 2GT9A 2Z35A 4J6RH 3BGFB 4LAQH 5EO0B 4BH7B 5JHAA 2WNGA 1XZWA 4XNUH 3O0RL 3HZVA 2WAQA 1AZRA 2CHNA 3LAFA 1RJYA 5B7MA 3HC4H 1T1YA 2DQMA 1RIUL 2IPTL 2QVMA 1P7BA 4E41D 2IV8A 3A21A 4ZFZA 1XIWB 4DVRL 2D4FA 2WINB 3QEHA 1DVSA 1PS3A 1NCBH 4OZFA 5BRPA 1TZIA 3MN8A 2ZPKH 4LSUL 2VTFA 5C3LD 1GMIA 4X6BA 4HX1A 5E56A 3CBJB 4NYLB 2NY4B 2XX0A 4KK9D 4UQCA 1YUHB 4FMKA 3H1ZA 4MJIE 4OGZA 2G2RB 1YJDH 5HP5A 4HXBH 1CG9B 3FT3A 2Z9TA 4YXLH 1UZ6E 2OXGA 5FO9A 4N2HA 2XN9D 4UOW1 1WBXA 3DUUA 3B5GA 2G5BB 4XZ4A 4HVBA 5IP4A 5ABDE 2AABH 3DARA 4R0LA 2GY5A 2F74A 3Q3GB 5CEYA 5IFJA 1U8NB 3O9WD 5DMKB 5KBKA 2IPKB 5GSRB 1GYUA 4M9OA 1A1MB 2C7UA 4XPAH 2AK4E 3J27A 2SODB 5FECA 1PCXA 3BPNB 3MGOA 4JFXB 3QJUB 3B83A 4ZX6A 2J1ZA 4RZCA 1CT8A 5D7SH 1G94A 1LK3H 2C3HA 3HUJA 2J8UA 2XPYA 4MVBC 4K9EL 2WLIB 2Z4QA 2XXMB 1PCSA 4H8PA 4ODWB 4IKKA 3QDGA 5IROD 1WWCA 4U1GC 5J13C 2Q7YA 2VJ0A 4PY7B 4OTXL 4XVJH 4CADB 3SO5A 3EH4B 3UJTL 4KHTL 1N6QL 1E67A 2XWJA 5MP6L 3D85D 3PGFH 1AGBB 1QRNE 4K71B 3U7YL 4MQTB 1JGLH 4LP5A 5FO7B 3O3AB 4A2GA 1LVEA 1CFTA 1LO2L 4F33B 4N6RB 4C4BA 2ESVD 4AMKL 2IXQB 1JVKA 3DWTA 3FZUC 1PIGA 1TZGH 4N3TA 4R7DA 4YSCA 1G6RL 5DJ8A 5I8KL 3DX7A 3B6SA 1WZ1H 2BVPB 4NUJA 2B14A 3QIBD 3H2QA 4UT6L 2NQ3A 1OEZW 1EERB 1EZVY 3ROOA 1SOXA 2R1XB 3HA0A 3P0VH 4H7VA 5D4IA 3PF2A 4ONOA 2H32A 2ATAA 5LXVA 3FOMA 4HCFA 4LU5H 3LH9A 4XNAA 5TJWK 3HNTL 4PRID 3FCBA 5C7XL 4JFZH 1WBYA 3BW9B 2AK1H 3AY4C 2F0CA 2ZKXA 3L3KB 4M7ZB 4Z6AT 4ONFL 1CK0H 3H7BA 3WL9B 3BKYH 1DBKL 4Y4FA 4LF3B 5CP3H 1QSEB 4JO4H 5DMYA 3SCMD 4P2RB 1AD9A 1FH2A 3L5JA 5AW4B 3N1MC 3VFGL 4YUEL 3IK2A 3F83A 2VXQA 3L5XL 1KPUA 2VSMB 3OWEA 4FFYA 3UBFA 3E1ZA 2AANA 2XKSA 4H20H 3SGEH 1MCWM 3IXTA 3HE6A 2F54A 2DDQL 2HT2C 3V4UL 4HT1H 1ROWA 1ZT4A 4Z8FH 2CDFA 4BQBA 1JFQL 1NCWL 8CGTA 2CCLA 2XZZA 3BIKA 4QAMB 4D9LL 1XF2B 1YQVH 2ED9A 1BZ9A 2PWDA 1Q9OB 1J8HA 1L7IL 2FEJA 2IALA 3DMMB 3NCJH 1A7RL 1NZRA 4B0MM 4X4ZA 3TV3H 3OB0K 2HRGA 3FB6B 2GY7B 2I7OA 5BOJA 2VR9A 5I26A 5EEXA 1RPQA 3R18A 3FOLB 3IMTA 4P46D 1HI6B 4HOMA 3KYNB 2QGCA 3TNMA 3INUH 1ZA3B 3FK3A 5GS0L 1MXDA 1MAML 2HLAB 4DGYL 1TIUA 3VMPA 3DX4A 4UAHA 4JZJC 4JQVA 3UG5A 3VFRB 2P45B 2P3YA 4PJ8B 5HHNA 4WJKB 4AEIH 1F4YH 4WK0B 4N26A 4KK8C 3S5LG 5C0AD 2OS7A 1B0IA 3FCGA 3QJHB 4PG2C 4Q9BA 3QULB 1OAYL 3GSWB 4CA4A 5E4EB 5I1JH 3ECQA 5C0BE 4NZ8A 4UT9L 3CHQA 2CDEB 4PS7A 5C0FA 2DD8L 5JHDE 1JGDA 2KHAA 4WJG3 4QHMB 3OJMB 1XF4B 2Y7MA 1WRFA 4K5MA 5IREA 1CXEA 4E5XB 4YSOA 3FAXA 3UC2A 5EDSA 1FPTH 1DQQB 4CSSA 2OL3A 2H41A 3NP4A 3BVVA 1OSPL 1OW0A 2UWEF 3F2LA 5DD3L 3CCHA 5DS8B 2XHNA 5EG6C 2A73B 1ZEAL 5E6ZA 4KPHL 4F7EA 3MLRH 1AO7D 5AW0B 2XXCB 1NBYA 1BPLB 3SJVE 2DQJH 2KKQA 3K6FA 5BOZG 4TLKA 2GT9B 2Z35B 2DIBA 4HIHA 1AXIB 2CO3A 3ETBJ 3AWEA 3HZVB 8FABA 1IC7L 3MUHL 2CNYA 3GHBH 1T1YB 4Q6IC 1A6VL 4BEIA 2DYPB 4ZFZB 3JZ7A 1YHPA 1SF5A 5EOQL 3QEHB 3DXAA 4OZFB 4R4FL 4WO4C 4Y16D 3EG9A 1VRSA 4ORGA 4E9VA 3TZVB 2P7TA 4JFDD 4HX1B 4JG1L 4RNRA 4X6BB 4A7UA 2IPUG 3JVGC 3MNVA 5EO9A 3QZBA 3TCLA 2Y25A 3U79A 4BBWA 2VISA 4LHUG 3AUVA 3ULVF 3FT3B 1LEGB 2EVJA 1JGEA 2OXGB 2WBJD 3DUUB 1QLFB 4GMTL 2J1KA 4YC2B 4IBTA 9CGTA 3CXHJ 3IMRA 3LEYL 5KVFE 4R0LB 2YZ8A 3WIHA 4NQCD 1W91A 5CEYB 3QPQC 5TF1L 1MW3A 2OSYA 5T1LA 1Z9LA 4Z7VA 2C7UB 1H9DA 1OAUL 2V17H 3C09B 4LDOB 5FECB 2GIMA 1AHWA 3MGOB 4KKNA 5EF0A 2YAOA 3QRLA 2ZNXA 4XMKH 2FSDA 4RZCB 1CT8B 1SYVA 4K73A 2VDRH 2BSTA 4ZMXA 1NLBH 2AJSL 1G7LB 3QDGB 3UTSA 2MFNA 3MRQA 4BSWB 5EU4A 3C5ZA 4R4NC 3TT3H 1HN1A 4PBXA 2XWEA 2Q7YB 4ODVL 4AENA 3GZQA 1OB1A 3GSOA 4DO5A 2JB5L 4QKTA 1IAIM 2IANA 1VEPA 2XWJB 3LHAA 4B9YA 3ULSA 2XC8A 1KYOK 4PRDB 3NZSA 3P30L 1CFTB 1FFRA 3OGCA 3LKRB 4N2CA 3LH8A 3MJ9H 2VXTL 4R7DB 3RVTC 4FXTA 3EJZC 1MRFH 4L2LA 5EUOB 4I1RA 5IW6A 4NUPA 4NUJB 4FTVA 3GM0A 1FL3A 1WTLA 4EVNA 1OGAA 2ADIA 3HLKA 4GBXC 1J11A 1CIUA 5A2AA 3VD7A 3NCFB 3ROOB 2E7HA 2QGBA 2YQBA 4PHZA 4CL7A 3CIQA 3EYVA 2H32B 1R4XA 2IIJA 4C4KO 4XN2A 2WCSA 2OULB 3FOMB 4UOJA 1X44A 3SEPA 4CDGC 1SLWA 1UA6L 4NZTH 1WBYB 4N0YH 3ZBMA 2E7LA 1XGRA 1N3NA 3L3HA 4PW3A 3VVWA 1NIFA 3TESA 3H7BB 3QZOA 4U4IA 1UACL 4G1EB 3OB0H 4G8FB 4MQXD 4PFEA 1ZVYA 1AD9B 1TENA 2H2SD 2N56A 4XOEA 5KYUA 1KPUB 3HKZA 1AYOA 3GMRA 2F15A 1FVDA 5F7UA 2F54B 5KJRH 2WZ0A 3QZWG 1ZT4B 3FQ4A 1KN2H 2XIDA 1P6FA 4UV4L 2ZWKA 4XXCA 2PYFB 3BIKB 1HL9A 2Y6SD 2RBLA 1E3FA 2YUZA 3C12A 5GZNA 1BZ9B 3X14B 1KTDA 2IALB 1J0ZA 2WVTA 5C0ND 2GC7C 3WFEH 5TQ2L 2VMDA 1BZ8A 2G0KA 1I9IL 4YHZH 5C3IA 2G75A 3U6RB 3OKMA 4DGIH 1A7QH 3ILEA 2W1NA 1FDLL 4R7XA 4XP9H 5EH1A 3LZNA 3L5IA 4K55A 2GUYA 1AGEA 3FB7A 4DWHA 1CF8H 3TNMB 1EV2E 4JB9L 1UGKA 4GSDH 5IVXE 1KELL 4PJ7A 3E1F1 4RETB 4PRBA 2FL5A 3DGGA 3BQUA 4FULA 5HHNB 1S9WA 4OLYH 5A2FA 1CN4A 5TGBA 5B38G 3SKNA 3HN5A 3UTTD 4XTRC 2JELL 3U0WH 1UD6A 5FM4A 3LKQB 5ENWA 5G4OA 5CUSL 5BZDA 5D2NE 5AOKA 5JW3L 1TMQA 1DQIA 1RMFL 4KTYA 3TBYA 3FQYA 4PCTA 3RUGA 5C0FB 4RWHA 4JFTA 2YFOA 1Y0LB 1B4RA 1L9QA 2N7AA 4Z18A 1URLA 4LASL 3VGGA 3D25A 1CFBA 1KCBA 3JTSA 2DJMA 2N3JA 5CF3A 1KEML 2WB1A 5C8JB 2X6MA 1QASA 3GNMH 3F85A 3OZ9H 4WV1C 3CCHB 5IB3A 3NSFA 1ZWIA 3PAYA 3THML 2NMSA 5SX5K 2IGFL 1NBYB 2FTAA 3S37L 5D71H 3RI5F 5H35A 2Z34A 4Z95H 3MVSA 1MVUA 2X7LA 4Y8AA 3PGDA 3WHXB 8FABB 2F5AL 4JCLA 2GFBA 3ZKMD 5EEUA 2NYKA 4ELME 2N01B 1RL1A 2FE0A 4HMDA 4UZUA 4KUZL 2QHLA 5E95B 4PRHB 3DXAB 3VXSD 1MAJA 3SDXA 1NSNL 1RIVL 2GITA 3EG9B 4ORGB 4XXWC 4Z7UE 2P5WE 2P7TB 5FGCB 5ALBL 5B1AB 4RNRB 2J5LC 1U8KA 1NCNA 3MNVB 2O1AA 5EO9B 4HWBL 4BZ1L 3ILQD 3TCLB 3EOTH 4X6DE 4XI5D 2O6FA 5KYXA 1E9QA 1IC4L 1IE4A 3DJ9A 4JO2L 1JGEB 3LHPH 3MNWA 1CD1A 1WVZA 3U0PB 1U41A 4L0YA 4EI5C 4NWTL 4H25A 3TTYA 4IHBA 2DLFL 2ITDA 2Z91A 4Y2LA 4G8IB 4UQIM 3VWKC 1GPOL 4WI4A 5T1LB 2TRHA 1PD6A 5TE7L 3MRHA 1AHWB 1FNHA 4YHNA 1NWPA 1Q72L 4XN7A 4DP7X 3H7LA 3NA4A 2Z0UA 5KANG 3QEQA 4XR8C 1SYVB 2EEAA 3AB0C 3ZK0A 2BSTB 1NFDE 4MJ5A 2NY3D 2APBA 1A6TB 1JZEA 3LD8B 1SLVA 3P3YA 4JFEB 5FUZH 3MRQB 5EU4B 5E94B 5DT1L 4PUBH 4J28A 4MZRA 1OB1B 3GSOB 3EDFA 4KDTA 4M03A 1ACZA 2IANB 2OYLA 2LAAA 3MJGX 4OCYL 2VW7A 1Q94A 1PL3A 3MV7A 3ULSB 3VCLA 3B34A 2IWEA 2QVFB 4XVSH 4URKA 1XXDC 1DQTA 3PWJA 4IM8A 4OKVA 2UXVA 1M2OA 3OG6B 1NCIA 4JRLA 5DR5H 3GJFK 3IDXL 4YVNA 5IW6B 2XFGB 3OLIA 1E4KC 2WZPD 5BZWA 1FL3B 4S1QH 4EVNB 1OGAB 2ADIB 3AY2A 3GXMA 1MELA 1Q9LA 1MEXH 2XVGA 2B5IB 3UC0H 5DHYA 4UIKH 1RZJL 1IM9A 1G43A 1XBDA 1YEFL 5LNGA 3EYVB 3WJLC 5BUAA 1DN2A 1GZHA 2VNCA 3KJ6H 4WWKA 5AOLA 3IGUA 1XGRB 1N3NB 3L3HB 4GKLA 1RZQA 1Z9MA 2A9MH 2WQUA 4ADJA 2Z8WC 4F57L 4IGBD 4JMXA 3P0YL 5DC9B 3FUNA 3II1A 3EDEA 4JL1A 2ZWSA 1L6PA 2QR0B 4MMZA 2P5EA 3OJVC 1YEKL 3AACA 5KYUB 4OW6A 1C5DA 3FYIB 1YUKB 3GMRB 1FVDB 4NLHA 1ONQA 2NY7L 4GKOA 4DVBA 1MCQA 4OGYL 5ILTL 5KSBA 5HDOA 5KSVA 5T5NG 1U8JB 3JYCA 4HPOH 4ZPTA 4X4ME 2AQRA 3UAJC 1KTDB 1KYUA 2FIKA 3HR5B 4BFIA 4HBCL 3HZYA 1I82A 1AIFB 4KO7A 3TVMC 4PJXB 4ZUVA 5D1ZC 3OKMB 5TDOA 2UZXA 5EOTA 2H47C 5KANI 3L1OH 4Z23A 4GW1B 4M7KL 3BAEH 1EO8H 3L2LA 2WXHA 5CCKL 1B0RB 4KK5C 5DQDL 3EYSL 4HD9A 3QG6A 1AGEB 4H88L 3FB7B 4ABWA 2GYSA 3QNYA 1JTTA 1RU9H 2DQFB 2AP2A 1OF2A 2G9HA 2D7TL 1OSZA 3BVTA 3TIEA 5IEKA 2MOGA 1GYAA 5F7BA 2FL5B 4AYDC 3DGGB 1FSKC 3BQUB 1QFWL 2GJZA 1S9WB 1KJ2A 3F84A 1DCEA 3QCVH 1SVCP 4AJYV 5TGBB 4I77H 3SKNB 1CE1H 3ARYA 3BUPA 3GMLA 4UT7H 4WSGA 4POZD 4DFIA 3ARGA 1VIWA 4B3EA 1DQMH 2JCCA 1BM7A 5BZDB 5JHLL 1AOZA 5SX5H 3ZTJG 2QTEA 4K07A 4U6TA 3RUGB 4FP8H 3TBYB 2VR4A 4LP8A 3IMBA 1TSRA 5FM8A 2VZTA 3PCYA 5BVPH 1JZDC 4EN3B 3D25B 3IM1A 4MCNA 2YC1A 5C0GA 4NPJA 2BVEA 2D7MA 2FJGA 2E7CA 2ZP8A 1ZT1A 3CE1A 4Y1AA 5SX4I 5IJCC 4F7MA 1P7QA 4Y5XC 1FF5A 1GRWA 5F1KC 4KITB 1ZWIB 2KZWA 2ZUYA 1OK8A 4F58H 1IFHH 4F7KA 1YECH 1BOGA 5JIIA 3VXNA 2V9RA 5H35B 1F58L 3HMWL 4TNWF 2PPCA 2A77L 5ESQA 4HOXA 1IQDA 2X7LB 1LM8V 1S9YA 1N68A 3PGDB 3RL1B 3V6OC 4JANA 4LOUC 2ODHA 2CR6A 1ZLVK 2GFBB 2LR4A 3CFBA 4K3GA 3QDHA 4Q2ZA 4PW9A 1CFNA 4G80A 5FXCH 4QGYA 3KPRD 4OIIL 4P4KC 2LGNA 5DD1L 5IHBA 2WXIA 6FABH 5KSAA 1FIEA 2BS9A 3QARA 1Z66A 1U8KB 3GO1H 5CEZE 1X5LA 2V6HA 5CEZH 2PN5A 3MLXL 2OSWA 2H6UA 3AT9A 2BNQA 5KYXB 1E9QB 4M48H 4DVRH 1BX2B 4JGJA 3MNWB 2KS0A 4MNGE 3RHWK 4ZOCA 1N6VA 5IR1B 4H25B 4YHKH 5GZNC 4G9FA 1KBPA 1NAMA 2ITDB 2Z91B 1M3JA 2X2JA 3DGDA 4ISVB 2DI7A 2IBZY 5KBLA 3DPDA 1FAKT 4NKOA 3WLWC 3SDCA 4TVPE 3EFOA 2YRBA 1HJBC 3VFVA 1HZLA 1NC2D 2PWGA 5AWNL 1NC4D 5EHFA 4YHNB 2NR6D 4H1LH 3CHOA 2XOTA 3QEQB 1IU1A 1HWHB 1M56B 1LO4H 3C87A 4FERA 4G6FD 4E2OA 1ZJBA 5I75B 4U1JB 3GJFH 4FNTA 5DK3A 3BSZL 4WHCA 5AW1B 2FBJL 1TFHA 2OMTA 1BWMA 3V0AC 1EHLL 3MREA 3GRWL 2GW5A 3LS4L 3HG4A 3WO4B 3BPOB 1WHOA 3LJ3A 3SDAB 4FABL 3ULUE 1F42A 1B9KA 1HZKA 3ULUH 3QSKB 2BRRL 1DSYA 4ODTH 1Q94B 3VCLB 3MV7B 4AC2A 4ODSL 1ZGLA 3DETD 2EC8A 4GUCA 2AGJH 1F1AA 2X3BA 3PWJB 4GAYA 5I0ZA 4OKVB 1DZBA 2OQJA 1RURH 2FSEB 1KV7A 4QTIL 1A9VA 3D06A 3V9FA 2R2BA 1EAJA 1HESA 5BZWB 3JTTB 4AM0A 1Q9LB 4RGND 5FYLD 4ANKA 1IM9B 2ZXGA 4Y9BA 2CE6A 2EABA 3T08A 2GSMB 4XNYL 1NDGA 2NY1C 2OKMA 3KVDD 1TPXB 4ANVA 1UURA 3AG4B 4IRSD 1AR2A 1E6JH 2Z7WA 5I1IL 4UT6H 4OT1H 2AQ3A 2WSDA 5FO8B 5F3FA 4JFYA 1FG2B 1F4XL 3BKJL 4IRZA 1GOGA 3KH3A 5HGHA 3GB7B 1C1EH 5FOJA 3NEXA 4TUOB 4XVOA 2P5EB 5D7IF 3AMLA 5LBVA 3D51A 3ARUA 5B1CA 8PAZA 2DAVA 1MCBA 5JTWA 3X11A 5CIPA 4TOYH 4DVBB 1VHPA 3HCVA 4ONFH 1RUQH 3KW7A 5KSBB 5KSVB 4GB9A 1E2WA 4LHQB 4HSAC 4ZPTB 1CIDA 3C8KA 1TEYA 3HMXH 4YUEH 2IDUA 4X9IA 5I6XC 2FIKB 4BFIB 2NSXA 3ZKXB 2CBTA 4ZUVB 2BP0A 1VFAB 1VCBC 1I9RL 3QIWC 5EOTB 4L4TA 5SWZA 3TF4A 2Q3ZA 3RFRA 2NY2D 1OLLA 3F65A 3VTAA 3T0EC 5KS9F 2NW3A 3O4LE 3QNYB 3TIEB 1OSZB 2FUQA 1U3HD 3IYLW 1J1OH 2FAUA 3VI3E 5J3HD 3LKNA 1KJ2B 2YXWA 5I6OA 2GPZA 3FF7A 1E50A 5LBSH 4CNIA 2GUOA 3UZVB 3F58L 3VTTA 3WDIA 1RIHH 2F1EA 1TEGA 4OD3L 5IVOA 3ARGB 4U3CA 1CTOA 5EUKA 3EJYD 5I15H 1AQDA 3HC0A 1R0AL 4LSPH 1DQLH 1PGRB 2J8OA 2GABA 1OPGH 3W56A 4K3HA 1C16A 1FAIH 4PJIE 3HFML 3GJEA 4PJEE 5TPWL 4P48A 5J5EA 5DQ9A 5C6TH 3QRBA 3VI4E 5ALCL 4KNSA 2D0FA 5C0GB 2BVOB 3VXRA 2FJGB 4G8EB 2AJUH 4NFBA 2D03L 1UM5L 3F7YA 3KPPA 2DWDB 1ZT1B 1UXLA 5F0MB 3NJKA 4Y1AB 3U25A 4HXAH 4HUXA 4UI2A 1P7QB 3O2DL 4XBEH 5E2VL 4F7MB 2MSPA 3W3BA 3P4NA 5IM7A 1U30A 1XIWD 3ETSA 3LH2L 3QWNA 1BOGB 4YHLL 1PAZA 2VM4A 3G5YA 1MWAH 4WUUA 3VXNB 2YQ2A 3QQXA 4GP4B 4J1UA 3GTNA 1WC7A 3MRBA 1IQDB 3SKJH 5AFAA 2NY4D 4HS8L 1NGWA 1S9YB 3X1EA 1XGUA 1X5JA 5JUEH 4JANB 5CKAA 4HJEA 1C8PA 4XGZB 1LWHA 4FMFA 1OM3H 3LPGA 1JCVA 4RMUA 1ZEAH 3E3QC 3WO3B 1SHWA 2A9BA 4LXFA 1CFNB 1K3IA 4QKXB 4XMLL 5I6PA 3C2AH 4NNYA 4AE0A 1FUNA 4F3FA 5EORH 4KJWC 3ZKQD 2WKGA 1CLVA 1JDDA 5KSAB 2WQXA 3MUUA 4MCYA 4F9LC 2X3CA 2VLRB 3SQBA 1TEFA 1OD7A 3HI5L 3RKDD 4WWOA 3RX8A 2HAZA 1AE6H 5K39A 5FEBA 5IVXA 5TE4L 1U3ZA 2E9JA 2CGRL 3D5OF 3HVDA 1EXGA 3KL5A 5DUPH 4LCIH 1MI5A 3IETA 3WUWA 3H3PL 4G9FB 1CCZA 1NAMB 1PZBA 3PV6A 2J56A 4TQEL 3S96B 1R3KA 1F00I 1T89A 3N42B 4NKOB 4Q9RH 3ESNA 3QHFL 5H8DA 3SDCB 3T1WA 3EFOB 4JHBA 3CHRA 3ULUF 3VFVB 5L6YH 3G04A 3APDA 1NEUA 4PSPA 1I7RB 3OF6A 3VFOB 2CBPA 1OT4A 1OD9A 4PJHB 5BRZA 3MRKA 3MREB 1OQXA 1JSYA 3DKHA 1O7DE 3L4ZA 5J1TC 5MENE 3NIGB 2G5RA 1X6NA 4OCXH 3BUBA 3RGVC 2XTJB 2B15A 1DYZA 1RK0A 1G7QA 2APWA 2VOTA 1MFNA 4BFRA 3BJLA 3QGVA 3FTUA 4HJ1A 2WO3B 4G7VH 4J8RA 1R46A 4KK9C 4TVSa 4UINH 3ZE0F 4BK8A 1MIML 2OQJB 1P1ZA 3STZA 1N5YH 1BFSA 2R2BB 5G5DA 4TUKL 4DERA 1LMIA 4WI2A 3QO0A 1T83C 4AM0B 1FIGL 1ZT7A 5I73B 4RGOH 5ESVA 4MDRA 4P2RD 1MCRA 2QQLL 4Y2DA 4AXWB 4P07A 3US0A 4CVUA 3QQDA 2VDQH 2RQEA 3LXBA 3BE1L 3M7OA 3TLRA 3ZDXE 3NJNA 4HS6A 1DL7L 2CALA 4ELDA 2Y23A 3P40A 3PP3K 4O9HH 4R90H 2NZ9D 2WQAA 4KAQH 5EV7A 3CLFH 5FX3A 5HGHB 5FKAB 5GGVY 5IESL 3ROLA 4M4RB 4RMRA 1NAKH 3HVNA 4XN4A 3DMMD 3WKQA 1RUPL 2RB8A 4WFFD 1MQ8A 1NUNB 3QEGH 5CIPB 1Z3GH 4HFWA 1O75A 3X11B 4C83A 3BEWA 3NJJA 5GZOC 1FH5L 2VE6A 3QRGL 2BZ7A 4E36A 2IO5A 1J9TA 2AQ1A 3OM3B 4QXUL 3WIAA 4LVNC 2XVLA 4POUB 2WW8A 3SPCA 1U6AH 4NN7B 1NFDA 2GK0A 2X3AA 3VXUE 1Z1WA 4FQ1H 4KVNL 4XN1A 5SWZB 4PJ8D 1DO5A 3SPGA 1ASQA 3QQ4B 1PX4A 4XO4A 1HE7A 1X4ZA 2APTA 1FLRH 2F9BT 4RA0C 3H0TA 4H40A 1BQKA 2NW3B 2FO4A 3M1OA 1XTMA 4YL4A 2EIDA 1JPEA 2WBWB 4RX4A 3HAEA 4TPRH 1UYWL 2Y7OA 2DQ6A 2VLKA 2PETA 5B7EA 4G1MB 4UCFA 4CNIB 2GUOB 1HNFA 3SCMC 3ZR6A 5MEQA 3EDJA 1KLGA 1TZHB 2L04A 3V0WH 5I8EB 4KJQD 3UJIH 5CGMA 1DQDH 2E6PA 4JLRA 2G4GA 3SPVA 4LVOB 3HC0B 4NRYA 4XNMA 3IRZA 1JJUA 3ZTEA 1DUZA 3BD4A 4CBPA 3GJEB 2E8ZA 1NCCH 3RX5A 1YMMB 1ZGLM 4P5TB 5IMKA 3X1GA 4MB4A 3QWQB 3VXRB 1MPAL 3BQVA 2E7DA 1L0QA 5HHXL 3F7YB 4BZ2A 5BS0E 4JY5H 3KPPB 2VZSA 1KB5H 4KXAA 1IBDA 3N41B 2IFGA 4J4PC 3QXVA 4DAGH 1UOLA 4N2MA 3P4NB 1EZLA 1PKQA 2K70A 1NANI 5IM7B 5CSBA 1CLYL 3K46A 3NCWA 4HF5H 4PI0A 1XSKA 3VXME 3G5YB 4HJGA 4WUUB 1P84J 3WAKA 1SJHA 4P46C 4HCRL 1MHPL 2J43A 4G8GB 3TZVD 3MRBB 2KI6A 3MLZL 1NGWB 1XGUB 2VQUA 5FA3B 1D6VH 3ZKND 2NW2A 4HJTA 1QSZA 3GIVB 4PW4A 4GS7C 5IW1B 1H3XA 3L9EA 1AQ8A 4WI9A 1GMEA 4MQ7A 4H0GA 2P8PA 1MJ8H 4IRJB 4MMYA 4MCYB 4NDMB 2NY5C 5T8IA 2F5AH 3Q2WA 3SQBB 1HVXA 1NMCC 3EDDA 3IFNL 3K74B 4U7KA 5K39B 1M3IA 3B37A 4J3BA 5C0DA 1UUSA 4MBRA 3HC2A 1BCIA 3NACH 1FRGH 3TBCA 3CJJA 2C4FT 3DTUB 1MI5B 3WUWB 1UC6A 1CU4H 4H8WC 1C12A 1CFMA 3PV6B 2FX8H 4DUXA 5L8LB 4WTQA 1R3KB 5F0JB 1G5AA 5LHDA 1BJ8A 1WLHA 2C9RA 2B08A 4Y5VC 4DP5X 3QDGD 3K1DA 1FO0H 1HT6A 3VX1A 3G04B 2N0KA 5L88H 4X5XB 2ZOTA 2HLEB 4L5FE 3GRGA 4OCSL 4UUJA 5B8CC 4B5ZA 4BZYA 4Z7AA 1NCAH 4YK4C 2CA4A 2LHAA 3MRKB 5BW7C 1CPUA 5T1MA 4KY1H 4XHJC 2EEDA 3UBHA 2W88A 1CD9B 3QXAA 4WWID 4A04A 4HV8A 4JRYE 4QIRA 3KMDA 4DGVH 1OE3A 2JKTM 1OCWH 4HIQA 1RK0B 1G7QB 2MPAL 4W4NA 5DJZB 2PTUA 3WDHA 3ZJAA 1QO3B 1GXEA 3T4AA 1HHKA 4J8RB 4X6FB 1RZGA 1X5XA 4X0KB 2PW1B 1YNLH 4HWNA 4IBVA 5FHBH 4QXTA 4GO8A 1P1ZB 3T2NH 4Z7OF 5G5DB 4G6KH 2GC4C 3EO1A 4LEXL 4E9WA 4OCYH 1IEAA 3Q6FA 3QO0B 1AI1L 1W80A 1VFUA 5DYFA 4NO3A 3FFDA 1KG0A 1ZT7B 4LCWE 5AAMC 3QDJA 1KBGL 1JNHA 4Y2DB 4BHUA 4L1DA 1S3KL 1LQBC 3QQDB 3JWDC 3B9DA 25C8L 2VR6A 4Y4HB 2F54D 3IKCA 1U3JA 1VACB 4HHAA 1J0HA 2J88H 5J06A 2OTWB 2C4FU 2VXUH 3LIZA 2V37A 1BGXL 1KB9J 3ROLB 1JZIA 2DTSA 4IOSA 5GGTH 4HU8A 1BD2E 2AQPA 3QAZC 4CC1A 3LZRA 4YE4H 2IPUK 3MBEA 1I1FA 5KN5A 1XCTA 3BT0A 4C83B 1T5WA 4HFWB 2EVGA 3OKLA 3WFCL 1WF5A 3BEWB 4K9JA 3EJSA 2VE6B 5FDWB 1L5GB 3MLUL 4GY4A 4G43A 4ODUA 1N70A 4ONHB 3ESVF 4F57H 3IDGA 4FEMA 1SY6L 4NOBA 1PG7L 2C9AA 4KRMB 3IVKA 2KZKA 3MRFB 5C08E 4LMQE 1R6VA 3LV3A 4FNQA 2RQ8A 5E8DH 3WU1A 3I6SA 3VYPA 2GK0B 2BNRE 3L7EA 1JXFA 3DSNA 4OGYH 2NX5E 2VN5A 2ZWZA 4D0CA 1L7TH 5LCVL 2OCCB 2BDNL 1I8KA 4YSQA 3BUDA 1JS4A 1UFGA 2OV0A 4QF1B 4UBDD 5GS1B 1F3JA 4NENB 5F9OH 1PEWA 4N0CD 3DVNB 2OMWA 4HISA 4MD4A 4I2XB 4PTUB 5IK3A 2K1MA 5LN4A 5IY5B 1AR1D 4OZGA 4EMZA 1BBDH 4NC1C 3HAEB 2OMYA 3D4ZA 2QPDB 2VLKB 1HL5A 1TETL 5JIPA 2ICES 4OY9A 5CU9A 3ZDYB 5A7BA 4DCQA 5FR3A 2DTMH 3CFMA 5IGXL 5DMIL 4F93B 3W0WA 1KPVA 4LQFH 5MEQB 2RAMA 1KLGB 2D7TH 4I9WE 4MQXC 5IUCA 5K1NA 4ZTOL 2H2SC 4K5OA 4FS0A 5EEYA 1CXIA 1UGNA 1X5AA 4NRYB 1KXTB 4PGEB 5E7BA 3SPVB 2FDBP 4GAGH 4DOHE 4KKBC 4HZLB 1GZQA 1DUZB 3DOSB 3WE6A 2DWYA 3D4CA 1MLCA 5E7FA 4XC1H 3UTZB 5K59E 2XKNA 3VFSA 2Y6SC 3S34H 4IDLA 1GIGH 3EOAB 4FQCL 1JVLA 5IMKB 3UAEA 2A0LC 4P59L 4JQIH 5MHSE 1DUYA 3VYNA 1BVNP 5C0NC 3I74A 2E74C 2JIXB 1W6WA 3T3ME 2HX8A 1FC2D 1FGVL 5EEWA 4XPTH 1VADA 2G3ZA 1TTGA 4I48A 1D5MA 1XEUA 1TTCA 1PKQB 2V3FA 1WAAE 2VC2B 2VMJA 4K9EC 4W9EC 4PRHD 3DXAD 4HJGB 3VW3H 1QSFE 1SJHB 1WWAX 2MOVA 5HYQA 1R5VA 4LCVA 4E9YA 2DBLL 1V5JA 1EFQA 1KC5L 5TFSL 1A1OA 4E9SA 3TEWA 3CIAA 2NW2B 3TU6A 3MQIA 2R2EA 3II2A 3UADA 1GS8A 4XMXA 3ZQ9A 2QFRA 4MQ7B 4OQTL 3TO4C 1XB8A 4AJVA 2QKIC 3AY4A 4F8LA 5IJVA 4CU8A 4WAFA 5GXBB 2FGWH 1WD8A 5CINH 3UTOA 2DMBA 3IN0A 5T1LD 4HUCA 1MG3C 1LO3H 1ZHKA 2MQ0A 5C0DB 3VE0A 3NPSB 2D3NA 4PU2A 1JNLH 2FUTA 1A6AA 3FRPA 2AJXL 2HWZL 5T33H 1O6SA 1C12B 4N8PA 1CVSC 4A2LA 4GG6F 1TMCB 4PJFF 3ZE1F 3V6OE 4JFED 5FK9A 2EDYA 2CK0H 2V33A 2RH0A 5JW4Q 2HT4D 3LNDA 1G9MC 4ATTA 4DFHA 4N2NA 5C7ZA 2IAND 3FC8A 2R27A 2AS5M 4UUJB 2IMMA 3FSWA 4LFHD 3N85L 5DJAA 1ZPUA 1R5WB 1MWOA 1DVQA 7FABL 3KCPA 3ECWA 1MW2A 5T1MB 2XQYK 5B22A 3ZKMC 4Q6YA 5DWUH 3QXAB 1YC7A 5F1IA 1SRDA 4GIPD 4HV8B 1INDL 3BYTA 4KUCF 1OO2A 3NCBB 1UASA 3LN5B 3Q0HA 5IMLB 1OGAD 3SGDI 2VLLB 1BLNA 2OMNA 1OTSC 3PWPE 3W5NA 4UTBA 1U8OA 3T4AB 1HHKB 4X8GA 4UYPA 1RZGB 1LXMA 3GEFA 2MCPH 4TL4A 5IVNA 2B0SH 4QXTB 4JFOB 4XI5C 4PMEA 4PG2A 1G1YA 1GCYA 2N59A 2MCMA 1MW1A 3EO1B 4CUCA 1A7OL 1YEGL 2G3NA 3CVDA 1QHQA 4EQ3A 4NO3B 1K5NA 3EFDL 1W16A 1KG0B 3FFDB 4ZO7A 2Q2LA 4XCYB 5T1DH 1A0QL 1QWNA 5CBAB 4EUPA 1JNHB 2FHFA 1BV8A 3QJTB 4GKZA 4HQQL 2WM0A 5IQLA 4RFOH 5IBTH 1X5MA 4UAOC 1CB4A 3REVB 3C5JA 1FFNA 4JKKA 3QDME 3IKCB 1BAWA 3NSDA 43CAA 3MJWA 4N0UA 1D5IH 4WU7A 4HHAB 2F7IA 2J4WH 1R3LB 4HIJB 1NCGA 1KTRL 2F58H 5A40E 3ISRA 5GZND 1HXYA 1P4LA 3VSUA 2CBMA 3GI9H 1KCLA 4FNSA 3MBEB 1I1FB 4C54A 3WLBA 4AQEA 1XCTB 3IFLH 4JKPH 5I2IA 5KN5B 3DO7A 1T5WB 3MX0B 4KX8A 3OKLB 3BLBA 3F7VB 4L8SC 3QI9A 2WXNA 3T6VA 3IDGB 3T6XA 3TJHD 2ICEA 2K9FB 4OLZL 3IVKB 3LPWA 3VRLF 2AJYH 3UBXA 4PIBA 2BIMA 4CAGA 4WO4A 3I3BA 1H3UA 1A6WH 1P9MC 4KFZC 5D5MA 4U6VL 5B1KA 3KPMB 4OLVH 2IWFA 3L7EB 3DSNB 3JVGA 4D0CB 1I8KB 3BQUD 4PJDF 3ERXA 1URIA 1AXSB 1NUFA 4BCXA 4GKNA 1F3JB 4M9PA 2OMWB 1UOKA 1PLGH 1X5HA 4OZGB 3SKUD 4M3HA 1I9RH 4YHMH 2OMYB 4FHKA 3LMJL 4MXVF 5D1XC 4ZSOA 1TVBA 4AV5A 3FO0H 1VENA 1ASPA 2UX7A 3Q05A 1NIDA 1C5BL 3U4BH 4EZJA 2BMKA 3D2UA 1A4KA 4L23A 4ZXBC 1N5AA 3S5ZA 3T3PB 1RV6X 4LPXA 4OF8A 3MZGB 1KPVB 3W0WB 2JKLA 3TCTA 2AF2A 1F11A 1D3CA 2PNDA 3A4FA 2Z64C 4UU9B 1Q9KA 1GZQB 1NINA 3WE6B 4F2EA 2OX5A 3P11L 4ZO6A 4Z7NF 5AYQA 1MLCB 1QFUH 1N4XL 4PMFA 3I2CL 1WAAF 2XKNB 4R97C 3VFSB 1O6VA 2YGVA 3QJQB 4HWZA 4P9MH 1U3YA 3QCTH 4WCYH 1DUYB 1KCVH 1LMKA 3L7FB 4ZG1A 4AMWA 1AACA 4X4YA 5DQJA 3N5AA 5D8JH 3WNLA 1VADB 4GAFB 4I48B 4S1DC 1SXCA 1D5MB 2QADB 1K8IA 4I3GA 5FF6A 1INQA 3QISA 2W95A 4PB0H 5IOPB 1R47A 2LVEA 4BCZA 4JRWA 3P0GB 2WJ5A 2F7QA 2HB0A 1XO8A 1R5VB 5D2LF 3PJLA 3BSGA 4YDKH 1DJHA 4TRPL 4PQXA 1A1OB 1BVZA 3CPUA 4NPYA 5JYMA 1DBJL 2GTWA 3H9HA 1U92A 2D2OA 5C0RL 3D0AA 3VXUA 3JQOB 3LH2H 1CGSH 3RKPA 4G6AD 4XVTH 2E7BA 1WAEA 3DK0A 4NT6A 1N0XH 3MRGB 3N0AA 1HH6A 3EGDB 4UQ3B 3LB6C 4POZC 4I1NB 4IBUA 1NJ9B 1TXKA 4KTEL 5EMYA 3WNMA 1WCBA 3AG1B 1ZV2A 3RWIA 2DQHH 3O6LH 4FZ8H 2X4RA 4FFZH 1BVLA 2YKLH 1PDKA 4PJ6A 2H6PB 3WKML 4D7PA 1EHKB 1ZHKB 3RP1A 2LU5A 4ZMWA 1LK2B 4DO6A 1LP9E 2H3XC 1WP6A 1H8OA 1A6AB 3FRPB 2YPVA 1F4AA 1T66C 3QEQD 2BWQA 1O6SB 2W60A 1N7MH 3QEUA 4EOWL 1BAFH 2IMNA 4JO5A 4LPWA 5D70L 3L9BA 3BP7A 5FK9B 4N90D 1GA2A 1MCPH 4E9XA 1A3LL 2DPKA 5CKGA 3SDAD 3E3QE 4DQOL 5DEGA 1KCSH 3ZE2E 2NUTA 4MASA 4Z76B 5F7WC 4S2SA 3MV7D 1DFBL 2EUZA 5DJAB 1EGJL 1XDTT 2WAHA 3RIFF 1IAII 2YAPA 4BCYA 4IEFA 3KCPB 2R0WL 4MRCA 5CBEA 4Y19B 4XP5L 1TFPA 3FBKA 5F1IB 2BP3A 2D9CA 4DKAA 3GSUA 4DZ8A 2W9DL 5KJ7E 4KZDL 1NL0L 1LDSA 1BREA 1BQHB 2P80A 2VL4A 4ACPA 4Z77A 1DQVA 3VH8A 1OARL 3QH3A 4ZOEA 4A6YL 4GRWE 1U8OB 5GQBA 1IM9D 3DHJA 4GRWH 3RPIA 1RULH 1A21A 4U0QB 2DQEL 2VDOH 3GK8L 4FHBD 2DKUA 3MXVH 2KDYA 2FH8A 4HUUA 2WBXA 3VSTA 1X7TA 3MKGA 3ELQA 4HJUA 4JR9H 3O2VH 2XV3A 3GSNH 2BOBA 2YXVA 3A6CL 1E7UA 4YZFF 1K5NB 1SVBA 1QNZH 2AZUA 3CMOH 2VZUA 5IV2B 4XMPL 3BO8A 5DFAA 5DHMC 3PPEA 4YZWA 2P5ED 2XQBL 3Q9QA 4LARL 1WFUA 1JPSL 4GKZB 4O00A 4N2FA 5KW9L 3G6DH 3PLYA 4HJJL 3CQQA 3SO3B 1A6UH 4PJ5A 4PRPA 4H0HB 2C1PA 3V52L 2N4IA 2A7BA 1AFVL 4WV1A 43CAB 2DIJA 3U9PL 2NR6C 4WU7B 4GRLC 5I74C 4OV5A 2FR4A 1YN6A 3LXCA 1I9EA 1E5YA 4JG5A 1HXYB 1P4LB 2WXPA 1MRDL 1AC0A 3DNKA 1D2PA 1MREH 2HCZX 5I2IB 3DO7B 1YN7A 1BQHG 5D7JB 1FI8C 1UT9A 2B1AL 4WNQB 3O6KH 3CXDH 1OSEA 1E4XL 4R6UA 3U48A 4E0RA 3NGBC 2CK2A 3QI9B 2EDMA 2EC9T 3DO4A 4YHIA 2XN9E 5D1QB 3UH8A 5LXGL 2ICEB 1BMZA 4FG6D 1IC5L 4NJAH 3UBXB 1RUPH 2F7PA 2YGQA 1G0XA 3DETC 3FKUS 3RYMA 1VGEH 3NOIA 2GEQA 1J87A 4XXWA 3CQPA 1Q1PA 3NABL 5EF2A 1IQWH 1KIUA 3NFPB 5TQ0H 5DVMA 4U1MA 1QBAA 2A6DA 1DLHB 1F90L 1WA0X 3WS6C 5IOKA 1ZTXL 2WK2A 1M7IA 5F9JA 4GKNB 4N6QA 1WS8A 5EOCH 1FVEA 1S78C 4P3CH 4EI5A 3ARGD 2JF1A 5FHBL 1XX9C 4MKMA 1HSBB 5ID1A 5DC2A 5JDSA 1CFSA 1GYWA 1TVBB 1PZ5B 2H1PH 1M2VB 2Q1EA 2OR8A 3D2UB 1A4KB 4LVEA 4NXKA 2MQGA 3LNFA 2JLPA 1CZ8L 4AZUA 4AQ8A 2CA3A 1RFDL 5BJTA 1F11B 4W9LC 3QUXA 3X2QB 2M8XA 4LCWA 5HDBE 3P2TA 3OR7A 2ESVE 4M62H 5SX4H 4DZBA 2NDGA 3CMGA 4Y1AD 3AREA 3BZFA 1P7QD 2OX5B 2BM3A 3NT0A 4AE1A 5CM1A 1AZNA 1QHOA 4LEOA 3UDWC 3ZY7A 3T6QC 4G82A 2WMPA 3HNSH 3S4SB 4NM8H 3FN0L 4JFFA 4HWZB 5C97A 1WUNT 2LAGB 2XIIA 4Z3FA 4X4YB 1CTMA 5DQJB 1T1ZB 2QSCL 4EQ2A 1HIMH 4UYQA 3B2UD 4X7CC 4PRIE 2VN6A 5FF6B 1INQB 5T3XE 1VB9A 3Q5YA 5T3XH 2PWFA 3X1FA 2EC9U 4YBLB 3S88L 3X3GH 2IDFA 4OM1H 1E4KA 5KSAD 4HWEL 1NPJA 5IQ9A 2VLRD 2Q86A 4NPYB 5GGQL 1IAOA 2GTWB 3H9HB 3IJ8A 3WJLA 1U92B 1NM4A 1TUPA 5J3HC 3NCEB 5ICXA 2ROYA 2NX5A 1JHKL 3W2DH 4OGQC 5EU5B 5FUCC 4NT6B 5M7QA 2WGNB 3MLZH 4YDLC 4G9FD 3D07A 1WCBB 2DQCL 3W1ZA 3SY6A 3RWIB 2XBZA 4CMHC 3ZL2A 2WJ7A 4OJCA 3SDCD 3H9SB 1BVLB 1PDKB 1RZJC 4PJCE 4U2YA 1GC1C 2FNBA 3MGTB 4AYGA 5HHQA 1KYFA 3ZYOA 3FYEB 4JN1L 2OZ4L 1KGJA 2X9ZA 3QUMA 1F4HA 2P28B 3MCKA 1PY4A 2Y0SA 3UAJA 1FNAA 1YG9A 2IDSA 5IQ7L 4ZNEE 3KDPB 4GQZA 3TVMA 3OPUA 4MJJA 2UWEA 1VFBA 4UQAA 1TTRA 2XTJD 5AVWB 1ITBB 1XIWC 3VFUA 1E42A 3KLQA 2ICWI 1HC1A 3F7QA 4S2SB 1TJMA 1YY8A 4GRWF 5F1OB 1HHIA 1F45A 3CXHK 3V8OA 2NY4C 3U46B 1YEIL 5CBEB 2CD0A 4H4NA 5F44A 3T8XA 1JGUH 1CI5A 4N1CA 5HDWA 3CFIC 4XAKE 5GS3A 2J6EH 4GQ9L 5IQOA 1IJ9A 2FVNA 4DZ8B 1QBMH 5CZVL 2WUCH 1FGNL 1V05A 4Z77B 4FQLL 3VH8B 1JYNA 3L08A 1J8KA 3MRIA 5I9QC 2JFCA 4FFTA 4AQ1A 4GEIA 1KNOA 1F3DJ 4D8PA 4FJ6A 5AB9A 2K6WA 3OLGA 3ME0A 3RKDC 5LQBL 3RDTB 4WKZA 3S3BB 3OJDA 3FUIA 4HUUB 1E40A 3DROA 2Q8AL 3AS1A 4JGUA 4LOEA 1JHTB 4K8RD 5D7KD 2BOBB 4NRXA 4KXDA 2E4FA 3SDXE 1P5UC 2YD9A 4BE6A 1AO7E 1SHXA 3KD4A 4KZ0A 3JBG7 1OAQL 2H3NA 1A5FL 1KXVC 3BO8B 3DJZA 3UP1A 1KGXA 1YY9D 3GSVA 5I5MA 1DVFC 5DRXA 1Q4NX 1C08A 4IDJH 1WG3A 1P5VA 4PJ5B 3DOHA 4PRPB 2C1PB 3MV9E 1IAKA 2YQGA 2B59A 3MOBL 4CJ1A 1WA2X 4I9XA 4OV5B 4Y5XA 4JJ5A 1YN6B 3SGJC 2FR4B 5DLMH 3P54A 3QORA 1BIIA 4JFDE 4GQRA 5AUMB 1KWGA 2ZKHL 1NMAL 4UB0L 35C8H 1OZUA 2J7LA 1YN7B 2OW7A 2WYZA 4ORZC 1LE5A 2G4EA 3DIFA 3N1QC 3TNNA 5KVEL 1XF1A 3CX2A 1EXHA 4E0RB 3DV4A 4LRNL 1AQKL 5SWZD 2DICA 3QCUH 1UM4H 4YHIB 3FT0A 3Q8FA 1CE6A 4PWJA 1JNJA 5IFAH 4YPJA 4XXDA 3C5XA 4TUUA 4AL8H 3QHZL 4NQCE 1A02N 2WCPA 4APQA 4PVMA 2VM3A 4PVNA 3KS0J 3UMNA 5JIMA 4QY8A 3Q2VA 4U1MB 3OKNA 1PG7H 1TCRA 4X7SH 1DVUA 4CU7A 4M7ZC 15C8L 1M7IB 5F9JB 1RP9A 4BYHA 1X3DA 1M05A 1SMAA 3NZHL 5H94B 4YLBA 2VDMB 4EI5B 4QHNB 1IKNC 3BVXA 5ID1B 4KXBA 3LPFA 3PAUA 5JDSB 5FCUH 2H1LM 5ADOL 5ELIA 2NZ9C 3MODH 3TWCL 2X1WL 4HETA 5EIQA 3ZO0A 1YMMD 4P5TD 1RAMA 4F37K 2FJHB 2MNWA 5BJTB 3VXRD 3QUXB 2GTQA 2YBRA 5T5NF 3OR7B 3N91A 3HR6A 3T65A 1AXTL 1SZNA 2X2IA 2C8NA 3BFOA 3DRTA 4LLAA 3AREB 3BZFB 3RLSA 3ARRA 1ID2A 4LEOB 5HHPB 1ZLWK 2JQMA 5DUML 5E6IA 4JMNA 2WMPB 2OYPA 3C75A 3U4EA 3T8VA 4JFFB 3FCSA 5CGYC 3CN4A 3B2XA 3FO2A 4WUUD 5IBLD 4KX7A 1NPNA 2VERA 4LPTA 1KACB 4NC1E 3CNKA 2VW6A 2GEEA 3AW5A 4QRPA 4ZW8A 4PJ8C 1MHHA 5ADPL 3D87B 3NK3A 4Y0GA 1CYXA 5F0PB 3S35H 2ZAIA 3FTZA 4XC3H 2RALA 1LDPL 3SZ6A 3V7MA 4UQBA 4CC4A 3HG2A 1TR7A 4IRJD 1ADQH 5DFTA 3G5WA 1T5XA 4OJFH 2BWDA 2GAZA 5IQ9B 2N7BA 2Q86B 2W0PA 5GJSL 1IAOB 3PGCA 4XB8A 4HEMA 5ICXB 4TLSA 1I7TA 1Y6NR 2FWOA 5HSFA 1KCKA 4XO5A 4LLQA 5IT2H 1BA9A 4PV9A 1MI5D 4M6OH 4BIKA 4Y4KC 3F7RA 2R29A 3IF1A 2B20A 4OF5A 3RNKA 3K72A 4DIXA 3BUTA 1M6OA 3EYFB 5EZPA 2I9LA 3EJUA 4J3TA 4MTMA 4PJXF 4UMSA 3IAQA 4QCIA 4WI0B 12E8L 1PX3A 1ZS8A 3WNJA 5IFHL 2ED8A 5IQMA 1A22B 1N9PA 2QVIA 3Q2CA 5HHQB 3UG3A 2CNZA 3OF6D 4N5ED 3QUMB 2JVUA 3ARBA 1N8ZA 1AMXA 3MSPA 3MCKB 2XV0A 1MFUA 1HDMB 4YBQD 4X80L 2BNUB 4W9ZA 3CAFA 4WW2B 3CU1A 3KVPA 3TVMB 2UWEB 1VFBB 1TU2A 3E8UL 3VFUB 3QIWA 5C09A 3VD2A 4K3EH 1X9QA 3UTTE 1NMBH 1PZCA 1XSOA 1YY8B 1IGMH 4ONGH 4UILL 3K4ZA 3TZVC 5CSGA 4XNQB 1P7HL 1QTPA 4UTAH 5HYSG 3ZKNC 3T0EA 1A6PA 1PG7W 1QRKA 3QJOA 4DT2A 3T4YA 1U8LA 5INDA 1CICB 3ARVA 5FGBA 2CRZA 3MCLL 4YNYA 3MR9B 3MRIB 1L6ZA 4AQ1B 1UWGH 1MFAH 1KNOB 3KLHD 4GYBA 4D8PB 4R0LC 4KXZH 3SDYH 3FB5A 4Y2DD 4A7QA 4G11A 4HLJA 4WKZB 3E7JA 2XPGA 2ZSVA 3PNWB 2Y4SA 3NESA 2X6AA 5FGSA 3DROB 2E9IA 4Y4HD 2O5ZL 3C09C 4KKCD 1FL6A 3MFGB 4M43L 1F8TH 2AK4B 1YC8A 1B6DA 3WKYA 3TONA 1G9MH 1IAMA 4F7TB 5FO2A 1G84A 4FX5A 4KQ3L 4LSVH 2H3NB 3O3DA 3GMPA 4KX9A 5A6IA 2BCMA 4JM2F 2UYLB 4O02L 3BKML 4M5TA 5DRXB 1MZYA 5K9JH 3JYBA 1E0OB 1PPIA 2CHWA 1C08B 1V7NL 2EDOA 1P5VB 1IT9L 1YEEH 2C7FA 1IAKB 4FQHA 4XPBH 1NCUA 3PNRB 4IK7A 2X4OA 3VXSE 4JJ5B 3L4XA 4H8HA 3QORB 1BIIB 4PJBE 1QRNB 5L7XH 3WYRA 3EH2A 3L2MA 3KYAA 3QFJE 3DIFB 4RQQA 3DV4B 2HFTA 3OLEA 3PQYA 1A14H 2F5BH 3L1GA 4UF7C 2BSED 1CE6B 4B96A 1BQUA 2CDGA 4MA1B 1INEL 1EXUA 5C9JB 5DRWB 1PLCA 4XXDB 1K5WA 2GSIA 1T1WB 4APQB 4JFPA 2D8KA 5DMGD 1P69B 2LW3A 2YO3A 3HBGA 4F9LA 2HUEA 2K0RA 2OR7A 2VLKD 3NYKA 4QY8B 3U2SB 3N2JA 1I4FA 4AQAA 1QNIA 3ABKB 3BSHA 1L9NA 5EA0L 1RI8A 2ZE0A 4FD0A 4HMCA 3F5WA 5B3NA 3FB8B 3MOAL 3FTGA 1ZLWH 1ZE3H 1EJOL 3J7HA 4YDIL 3UX9B 2ERJB 3RBSA 4XBPA 4GSQA 1S7UA 1CDUA 2ZXBA 5E1GA 5GRVK 1T04A 1H3PL 4J3OD 4YHOH 1AGFA 2HN7A 2X38A 3EO0B 3Q9PA 4K7PL 5G4MA 3DX6A 4U1IA 3COOA 3B5HA 2HMID 2BZCA 2YBRB 3CFEA 4ZS6D 3FBQA 3CLWA 2JIXD 2EZ0C 3AABA 3T65B 4ZYKA 3DRTB 1Y6KR 2IFFH 5D7LA 3RPBA 4MYPA 4WTXA 1IC0A 4LZKA 5E6IB 1NANH 2NY0C 3U4EB 4K3DL 3AROA 2OTPA 2EINB 1E2VA 3AU1A 3RGVA 4RAUB 3FCSB 4OJEH 3U7WL 3FO2B 5D4QA 4ZFQA 2BHUA 4IHOA 2MNJB 4U7SA 3ZRSA 1CO1A 1IUZA 5AEAA 3SQOL 4HH8A 1QLEL 2CIIB 1N4XH 4U0RB 4QRPB 5F6HJ 4N8VG 1MHHB 3LEXA 4QXGH 4IKJA 3RA7L 4NJ9H 3VFMA 5JIQA 4UBDC 3MUZ1 1E4JA 4YQXL 3KL0A 2FATH 4N0CC 4AG4H 1T83A 1QABA 2KERA 1XVSA 1ODUA 2HTKD 1OANA 1N67A 2FQGA 4AK2A 2KLTA 3RWEB 1HH9A 3PGCB 3A4AA 4G9DA 5C0BB 3V4PA 1AANA 4IU3B 3NP3A 3MROB 2FWOB 1W72L 2DMCA 2FEEI 1DFXA 3GSRA 4LLQB 4OLXL 3NIDE 3SBRA 3JUYA 4BFEA 1J05B 5CJQL 3TS8A 3IF1B 5IHZB 1DBAL 4OGXH 3B7YA 3K72B 3N1PC 1RHFA 1ZLUH 3VDAA 1WT5C 5HHVH 2HJLA 2I9LB 3VWJA 1OW0C 4A7TA 1VESA 2LFGA 2FYYA 1WZAA 2ZUXA 3DURA 4QCIB 1ZS8B 2CMRH 3FUHA 4HIEA 3MUY1 4BE5A 2PCFA 5T1KB 1GY2A 2YUXA 5ECJE 3IRCA 5GZOA 5L2JB 3VQMA 3ARBB 1RZ8A 1UWXK 1XH3A 4ES9A 1T03L 1A7NL 3CHXA 4LBAA 4FQ2H 3IGLA 4HGKC 4QRUA 5J7CC 3HJ0A 5B3SB 1V54B 4OZIF 3QIWB 4PJGF 2VO5A 1ECYA 4UNUA 2EDQA 4FLSA 4BRVA 2PYEA 3T0EB 2NY6B 4G59C 4WEMB 3T4YB 1U8LB 2Y5EA 5INDB 1IGFH 1IEBA 1ZANL 2VZ3A 1DEDA 3DOIA 3B7RL 4RMQA 3SIKA 4OCWL 1MZZA 1NBVH 3TA3A 4Q7DA 2DQTL 3QDJD 3S35X 2OR9L 4HC1H 4ZAKB 1I7ZA 4L3EA 3SCMA 2Y3NA 3NJLA 3F01A 1FNFA 4P57A 2DLHA 4K5PA 5F93C 4M7LL 4BQ8A 2VQ4A 1RXLA 4XPGH 4XNZC 1AHWC 3SGEI 5HYEA 5HI5D 1G7MA 3GBMH 2J55A 4DPCX 5IB4B 3O3DB 3GMPB 4IOSD 4NUGL 4PV1C 5JXAL 1CURA 1DJGA 3U9WA 3DI2B 2HT3D 3NMEA 1GY1A 3RU8L 1I1YA 3MBED 2EH7L 5DGQA 4EZMA 5HGGS 2DQDH 4F2MB 3ESUF 2HT4C 5DA4A 2AI0H 4FQHB 2CJTA 1FFOA 4J4PA 5ANMA 3KPRE 2OJZH 2WYIA 4W9HC 1OCOB 4KMTL 1GGCL 1BFVH 5EIIG 4X0NA 1NGPH 4P46A 4QJ3B 4PGDA 3V5KA 4NI6A 3CK0H 5I1HL 2YWYA 1HWGB 4AJWA 4RQQB 2WTPA 2VDPH 4LSRL 3PQYB 3LZFL 1U8QB 1SJEA 1JCKA 3WXVH 1UJTA 4PYHA 4AGOA 2CDGB 1SFDA 4NKMB 1EXUB 1HYRC 4HHWA 3ZDZF 2GSIB 3KYMA 1OP5K 5C0AA 2W94A 3MLSH 3ZIYA 4DF9A 3QAQA 2YOAA 3BAKA 4JFPB 1OAXL 5TDNA 2FCBA 2AEPH 3KEHA 3VMNA 3ZQXA 3A24A 3AC0A 4ENED 1Q0YH 4LRIA 4W4OA 1KJ3H 1I4FB 3CHSA 3NIFF 4AQAB 4AKPA 4BUGA 1UEMA 2V2XA 3G6AB 1JG9A 2C9SA 1MIEH 5GGRY 1JXGA 3FTSA 3W0WD 4R4BA 2RJMA 4QHUB 2X41A 4M1GH 4PJHF 2C3VA 2X0WA 3R8BB 5FFLA 2ARWA 4JVPA 1A9BA 3MLVL 3QWRA 4XBPB 1T7XA 5EDXA 4MVBD 2KPNA 5D6DA 4Y5VA 1TVHA 3EJRA 4JDZA 2VMCA 5FIEA 4CSZA 1AGFB 2HN7B 1DBML 1RVFH 4A2EA 4FFWC 3DX6B 4X9GA 3GIZH 4ZD3H 2R0ZH 3CFEB 1IKFH 3CH8A 2QQQA 3ZHLA 4NP4L 4LB8A 1RUAL 5D7IA 4HSQA 5IMMA 5D7LB 1MUJB 2CRIA 5BW7A 1B4TA 2QADD 3DYPA 2CPCA 3NA9H 3RGVB 1RFDH 5EZIL 4LSSL 4RGNE 5FYLE 5FYLH 1HAWA 4IHOB 4FA8A 2AVFA 2JJSA 3G6JA 3GLDA 4WKXA 1PJ9A 3V0JA 1W0YT 3GQFA 2DJSA 4YEFA 2YAEA 1RZFH 4M6ML 1ICTA 4AV4A 2X2UA 3K0YA 4PIRF 5DVKA 1IZKA 1WQVT 3MNMA 2QGDA 4L3CA 2N1TE 3BQUC 4OJYA 3DX8A 2VWEC 3VFMB 2RR3A 4RIRB 3TEZA 1THCA 1P1VA 5JDJA 1F13A 5JHMA 2AMGA 4H2CA 3S2AA 2ICWJ 4AKOA 1QI3A 2XG4A 3MV8A 2QSCH 4NQEA 2JCWA 5D7HA 4GW5A 1VF5C 3FO9A 3NTCH 1HH9B 1RZPA 4HMEA 4XP4H 5AAMA 4G9DB 3VGFA 1FG9C 4WI8A 5AAWA 2ALAA 3V4PB 2IOIA 3GZKA 3ZZQA 4N0RA 3S36H 2CGZA 3GSRB 4XPHL 1BJ1J 1AHKA 2HT2D 3EJCA 4EN3C 4DP6X 1X7SA 3QYNA 2EUXA 4TKWA 5AW7B 5KVDL 4X9FA 3O6FB 5I1AA 3V4VA 1P7KB 2HX7A 1UQSA 2M83A 2HJLB 3VWJB 1TTUA 1JHKH 1FFPA 2R0LH 4V1DA 2FYYB 4H0LC 1CLOH 3GWJA 2PCFB 1HQ4A 1ET8A 4MFHA 3SKOA 4M00A 1T2XA 3BP5A 3FQRB 1RZ8B 1X9RA 4JM2C 4U3SA 1A3RL 4Y19D 2LU4A 3H3BC 3EXLA 2WVSA 1D6EB 2J12B 3ZOAA 3MBXH 1GKEA 3I6LD 1DLFH 2IC2A 3D09A 5DRZA 3S8WA 1S5HA 4H13C 4JPWH 2P5WB 1M6UA 4Z7UB 4GXVL 4YWGL 5DD5L 1NIEA 5JOEA 3MXWL 2PYEB 1N64L 4BKTC 3QXDB 1YAIA 3RRQA 4E9LA 1IEBB 3C6LB 4PB9H 4PRAA 3BRGC 3NJVA 4FCAA 4OSUH 4G83A 1AQMA 3TT1H 3BDYL 3TA3B 4WGKA 1Z5YD 1QPKA 3RX7A 1RZ7L 5I19H 1ACCA 1TO4A 2AXWA 1OM9A 3LS5H 1I7ZB 4L3EB 5IHUH 3WY3A 4HUVA 4WWNA 2YEVB 3TPUA 1TNNA 2DBJA 4LESA 4JDEA 4D9RD 1U93A 1GW0A 2APFA 2A4EA 5DK0B 1G7MB 1WEJL 3R7QA 5I75C 4I8DA 3RWJA 3VU1A 2O5YL 4G42B 2VR3A 1MY5A 3QDAA 5B7FA 3KBEA 3V7AE 2DLIA 4B53A 2Q8AH 3WFDH 2YRZA 1KCWA 2CLVA 5D7JD 3WO4C 5JW4M 3BPOC 1EWHA 3CVHH 3K5SA 3SDAC 5BV7L 2EQDA 3ZT6A 1WTGT 1I1AA 3QI9D 4KDTC 1FFOB 5AZEL 1WAPA 5ANMB 1ACYH 1OAQH 1QMUA 5D1QD 3ENEA 2BIHA 3LDBB 3T77A 2BS71 4G3YL 1A3ZA 5EZLB 2YMTA 3F8UB 1U9KA 4HUWA 1L0XA 1XH0A 3V5KB 3PG2A 3EDKA 4QUOA 2X2YA 2CKBL 1OGTA 2P47B 1O9VA 4L05A 5HDLA 1EHXA 2R9HD 5EC2A 1NCDH 1SJEB 3PS6A 3M8OH 1G87A 5ISZE 3OL2A 2I60L 3QYCA 4WTWA 4JY4A 3TO4A 1N8OE 3M86A 4EDWH 3QC5X 2QKIA 4D0BA 1G6RA 5TDNB 3D3VA 3KNBA 4NO2A 1F5WA 2J72A 3L16A 4J6RL 4WEEA 4UT6A 4LAQL 2YKKA 1KN4H 3EOBA 1HEZA 2ARJQ 4XNUL 2V2XB 3D2UD 2A4CA 4AUYA 4H5SA 3CD4A 3HC4L 4R4BB 1GOHA 2BP8B 2C3VB 4TL5A 2ENSA 2I25N 5F88A 3HZMA 3JT0A 3IPFA 1AD0A 1NCBL 2NYYC 3NH7H 1A9BB 3OGOE 2ZPKL 4AITA 4Y5VB 1TVHB 3U83A 3U30B 3MZTA 4JEGB 1TYJA 4R4ND 5KWYC 1YJDL 4HXBL 1F1GA 3RB5A 2YN3A 4YXLL 4RBPK 4POYA 2X9XA 1RERA 4EIZC 4WY7H 3ZKXC 2XICA 2BFGA 2BSSA 5D7IB 2G0LA 1VZHA 5IMMB 1CGTA 2J2ZA 4PEEA 1PLAA 2H8PA 2AABL 3IU3B 3V0VB 4X9BA 1CDGA 4ZTPH 2HVKB 4FG6C 3EJZD 3QQ9D 1IO4C 2K3HA 2FEEL 4OB5L 4D2NA 4XPAL 4PJ9A 4P2RE 2MPVA 2YD1A 3PUUA 2ZYRA 2ZYHA 3U1PA 1BHGA 1FC1A 3P77B 1XR9A 3B2VH 3K1KC 4M4PA 2I85A 4YVUA 3S8FB 5D7SL 1LK3L 5CP7A 3DX8B 1TQTA 3AXLA 4MD5A 3OAUH 4PJAF 3SYQA 1HKFA 1AH1A 3VJ6A 5I28A 1FWXA 2QPEB 2WBKA 4HBQA 2AFNA 4NRZA 2DH2A 2ENYA 3BP4A 2BH0A 3UROR 4CSPA 1GGIH 2XG4B 3ARGC 1H6UA 3MV8B 2RTTA 1I53A 4XVJL 3H3KA 5KS9B 4GW5B 4WFFE 3FO9B 2Q3AA 5ADPH 2A6KA 2A6JB 2ZUSA 3PGFL 4ZK8A 1E65A 3IDJB 3H9SD 1JGLL 1L0PA 2Y2YA 1JGVH 3WJMA 4QRRA 4TXVB 4AIEA 3NFNA 1MCSA 4KI5D 4LDCA 3F7PC 1TZGL 1ZMYA 3OZLA 5IG7A 3UP6A 4B60A 3GYRA 1XZ0B 1ZDQA 1P84K 1QHPA 3VXTA 4XRCB 1WZ1L 2PW2B 3V4VB 4QNPE 4UT9A 2YA2A 2GKIA 1UQSB 3QAZB 3KHQA 1LD9A 4V1DB 3P0VL 2ZXDA 3MRRA 3Q44A 1HQ4B 2Z4TA 4OD1H 2PR4H 1VKXB 4LU5L 3SKOB 5KYWA 2ZG1A 4JFZL 1IAIH 4U3SB 1B0WA 2AK1L 5I76B 2LVCA 3WEAA 4CN1A 3FT4A 1CK0L 2XBDA 3B2UC 1Y6MR 12E8H 3BKYL 2R15A 4K3JH 5C0EA 1P9MA 4JO4L 1PZAA 1Z5LA 3OKEA 4NZJA 2P8LB 1AMYA 4H20L 1IBYA 5KSAC 2BVTA 5DRZB 2X4NB 3DTXA 4HT1L 4QPEA 1ZAGA 3DBSA 4X4KA 5DJ0A 4Z8FL 1D2OA 4WTZG 5FYJD 3BHBA 3DX9B 3BIBX 4ZPVB 3QB7C 3RDTD 2ZYSA 1YQVL 5T5FH 5I1EH 5C0CA 3D30A 4Q89A 4NBZB 4R8WH 3HE7C 3NCJL 1T3FA 2YD8A 4PRAB 4YSDA 4CRPA 5D1XA 4TQIA 1MFCH 5EZOH 4YJZL 5KYNA 1QFPA 3SKMA 3TV3L 2HRHA 1CI3M 4ZXBA 2C9XA 1U3NA 2Y1ZA 3SYOA 1KYAA 3KLLA 4HUVB 3A67H 1ILSA 4KU1A 2WLKA 3SDCC 3TPUB 1CF1A 1H6FA 4JDEB 5A2JH 5CS7A 1FVCA 5BO1H 4P2YA 4PJ5D 4PRPD 1Z5HA 2WQSA 3WNOA 3INUL 3QPXH 3MCYA 4H1LB 4P2QB 5A2BA 5HGAA 1PNCA 4YO0A 2C5DC 3VG0H 4OZFH 3S36X 3RWJB 3OMZA 4P49A 1JZ6A 4AEIL 1F4YL 2BWIA 3CHPA 5D9SA 1L9OA 4GRMA 4UQ9A 1XF5A 1KUMA 2O5ZH 3AJ7A 5FLVA 3U2JA 5I6MA 1J12A 5E6UB 1I1AB 3C6SA 4IIQA 1IMHC 3T77B 5E2TL 3BRFA 3GINA 1G9NH 4N68A 4ZMLA 2LLLA 1ORQA 2CJSA 2D31A 1FZJA 3I6GB 4AEHH 4HUWB 4U1NA 4WSJA 1NOAA 1OGTB 4LDEB 4QXWA 2FQDA 1KEGH 1FPTL 3D4YA 5E5RB 3VA6A 3FT2B 2W5PA 5HTSA 2DB8A 2A9NH 3IMVA 4Z3JA 5BNXD 4W9CC 5I73C 2DM4A 4OM0H 2CM5A 1B9ZA 1KB3A 1ZSDA 3L5WA 4JY4B 5F7EH 4EI5D 4EKJA 4D0BB 1G6RB 4UQEA 1G0DA 3MLRL 5HJDA 3ZE0B 2VIRA 3D3V