1NCHA

Structural basis of cell-cell adhesion by cadherins
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
98
Chain Sequence
b'GSDWVIPPINLPENSGPFPQELVRIRSGRDLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-CADHERIN
publication title Structural basis of cell-cell adhesion by cadherins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion protein
total genus 19
structure length 98
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1nchA00
4AXWA 2QVIA 1OP4A 2OMTB 4ZMTA 1WYJA 4APXA 4ZT1A 5JYMA 2WBXA 4ZMXA 3Q2VA 1NCGA 2OMYB 4NQQA 2WCPA 5CO1A 1ZXKA 3LNFA 4AQ8C 4ZMQA 3LNDA 3FF7A 4ZMVA 4AQAA 2OMZB 2OMVB 4ZMZA 4ZMLA 4ZMPA 4ZI8A 3PPEA 2WHVA 1SUHA 2YSTA 3K5RA 4NUMA 3LNEA 4QD2E 2O72A 4NUPA 1Q1PA 3UBHA 3K6DA 3QRBA 4NUQA 4XXWA 3LNGA 2YQGA 3Q2NA 5CZRA 4ZMNA 2A4CA 4ZMWA 3Q2WA 2QVFB 3K5SA 1NCHA 4AQ8A 4AQEB 4AXWB 3MVSA 4AK1A 3LNIA 4APXB 1WUZA 5KJ4A 1EDHA 1FF5A 2OMXB 2A4EA 2X2UA 2WD0A 3K6IA 2OMUB 5DZVA 1O6SB 2OMWB 4ZTEA 4OY9A 4AQAB 1NCJA 1L3WA 3UBGA 3UBFA 3Q2LA 3FF8A 2V37A 5JYLA 4ZMYA 4AQEA 1ZVNA 3LNHA 1NCIA 2EE0A 4ZMOA 3K6FA 4XXWC
chains in the Genus database with same CATH superfamily
3L1EA 3BUDA 4MJIA 4I48B 3RI5K 5TE7L 3KPRB 1B0GA 5IB1B 2UY6B 1OIOA 1G7LA 4JHBA 2PETA 3OWEA 5LWYL 3V0WL 1HQ4A 1XB3A 1D5BB 2ZTBA 4L0YA 3TC9A 3EFFA 4IGBC 5C7XH 1HDMA 2NZ1A 5FOBA 5CEYB 2WYIA 4CN1A 2Z4QB 4HXAH 2RCSH 3TBSB 2QKIA 3R8BB 1QA9A 1CTNA 1TF4A 1J1XL 2FYVA 4UOW1 2OULB 4PJAA 5C07E 2FX9L 3RGVD 5HYJD 3IPFA 2W9EH 4WEEA 5DD6B 4WGVB 4ZMPA 2K6YA 3RWGA 1FAKT 3OL2A 1BZ9A 1L9OA 1NL0H 3QQ3A 4GAGL 3DETC 1GOFA 5D7LB 4C56D 2DYSB 3O3EB 2EYSB 4YSSA 1T2JA 4CKVX 4QD2E 1EIBA 3SQRA 5C0FA 3ARFD 5C6TL 3T1FB 2JCCA 5F3HB 3SDCD 5IQ9B 2E0PA 2EACA 4ISVB 1ORQA 2B15A 3BN9C 4GQPH 4LPTA 5F6IB 5IBTH 1NUNB 1J8HB 4P2RB 4YHML 1FFPB 1DO5A 1QI4A 2YKLH 3QUYD 3DTXA 2P3YA 4NENB 1QLRB 3UABA 4WSJA 3UIYA 4BCXA 1QBML 2B2XL 4YZFF 5F7EL 5D96B 1RURL 3TEXA 2QADC 1G7IB 1QLEH 4I1NB 3RJQB 2E9BA 1QR1A 4OLUH 1ZVHA 1U36A 1NDMB 5IB2A 3H56A 3QIBA 3SIKA 2ESVE 1EHLH 3MRLA 5KSAD 3NCYS 4NJAL 3ARSA 3QXWA 4PJHB 3WFCL 2YPLE 3ME0B 4FHBD 2FHBA 2VMCA 4QTHB 2X42A 2ZPKL 1RIVH 5EA0L 3A22A 3K6IA 3DX7B 3GEFA 2PCPA 1J8SA 2WNXA 4F15C 2DLGA 3GBDA 4OCMC 4LQ1A 3GMQB 1RK1B 1TTBA 4J4PA 4ODUB 5FYLL 3P0VH 4C8XA 3CDZB 2VLKA 3WFHB 2V2WB 4X6FB 2YJLA 2N7SA 1AHMA 4MASA 5F9OL 3PF2A 4ES8A 3N3EA 3QIWB 3ZL4L 2I07B 3VXSB 5CEZH 3DROA 4TTGA 3GGWB 4NIYE 1QVOB 4A04A 2XLLA 1CFSA 3L2MA 5GRJH 4NBYB 2OTUA 1HILA 2P5PA 2M8XA 2WVTA 4F7TB 3A67H 3WS6A 1NIAA 4L8SC 1Y18B 5LDSA 5DC2A 1TJHL 1BBDH 4YDKH 1CDJA 5JNYA 1BGXL 1LO0L 3ZE0B 2YBRB 3PLYA 5EZJB 3DURA 5ETUA 3O6LH 3RKPA 3BPOC 4IDLA 1NSNL 2OJEA 2ZSVA 3E1ZA 2EYRA 4JFXA 3W2DL 5C0DB 1I3RA 2J6EL 5TK2A 1KIPA 8FABA 1ZXKA 4ZMQA 1TO5A 4WTZA 5I5JA 1WWAX 5DMKA 5GPRA 4HBCL 4NQDE 1UJ3B 4KOBA 1G7IA 4F20A 2D7OA 3ZO9A 1MFCL 2WC7A 3FQTA 1HEJC 4YR6B 1ZY9A 3AREC 5T1JA 2WVUA 4J1UA 3WTWA 2EADA 2X4PB 1V8HA 4HJGB 4IIQA 4WTWA 3FOMB 1S9XB 4MJIE 4GMTH 4UM9D 1ETA1 4JKMA 5HVFB 4Y9BA 5F1NA 5C0AB 4PGBB 1TMQA 3UYPA 4UIMA 5E70A 4G6MH 5CJOL 4Z7QE 1YMHB 2HLAA 3MV7E 2CJUH 2DQDL 3UTTB 3MA9L 4HS6A 1J5DA 4KVNL 4U31A 3BUBA 3TYGL 3VNZA 2XY2A 4P5TB 4ELME 3VGAC 2APBA 4FHKA 5C08E 4G70B 5F1IB 3IRPX 4OIIH 3MXWL 4UBDC 4B60A 4PRBA 3TS8A 3U9PL 3EADA 5JUEH 5KVGL 5M95B 1RZJL 1OAZH 2FYYA 2XWBB 3MRNA 3I6GA 5BRZA 1TKWA 4BKLB 1KCUH 1LO3H 1ZT7B 2BSSB 2WXHA 2Q8AH 2Z31A 3FH7A 4IBQA 4OZHB 1XGUA 1NWOA 2QSQA 3ISRA 5F88A 4WI7A 4NNYB 3WCYA 3QZWB 2PPEA 7FABH 4GSUA 4UNIA 1UM5L 2DQMA 5F7AA 2Z6FA 1HL8A 2J1YA 2WXLA 3K46A 5C0IA 1FV1A 3CDGA 4CILA 2DWDB 3QUGA 3SEPA 3K0YA 4NCC1 3F7QA 3GMOB 1A1OA 3US9A 1J9TA 3FQNA 1NPJA 4GSDL 4HH9A 2FECI 1NWPA 1KEMH 1QSFE 1OTUC 3ECUA 3NGBB 4UMGA 5LNDA 3BLPX 4PS4H 3O6FB 1OAYL 3NSCA 2P5WB 2XA8L 2VUKA 5CN2A 1GYUA 2XN9B 4FGMA 4PJ8C 3EW3B 3VTMA 4FX5A 1WDAA 4KROD 1KT2B 3Q0HA 1I85A 3KPRE 2RTTA 1DVFD 4WEBH 1T1YB 5DUBA 4WV1B 1PEWA 5D55A 1AZNA 4D9QE 4U3HA 3FB6A 3GXMA 1VZIA 5E6RB 1B0RB 5F21B 4JG1H 1OAUL 4D9LH 3BP4A 3H9SB 2LV4A 3PJSB 3VVWA 2ZUQB 1XXDC 3K6OA 4PS8A 5DD0L 2GAZA 1F58L 1G1OA 1UGNA 1AO7A 2A6IA 5DUPH 5I18H 4QLRA 3HUJA 2KPNA 1ZLVK 1SHXA 3PWUA 3S5LB 1IL1B 5D7LE 3SGDI 3T9WA 3KWXA 1JZ8A 1E2WA 1G0DA 3IDNA 4ORGA 4XPFL 3EOTL 2R29H 1MVUA 3PV6B 3T2NH 5AOMA 2W94A 4ABVA 3VG0L 1J8HE 4P2RE 4FABL 2YS4A 4JLRB 4DUVA 3HA0A 3NCFB 4XBMA 4OF0A 15C8H 4YFLI 2AJZB 3D69A 4KPHL 5EOCH 1WFMA 4JPVL 1ZDQA 2X6UA 1D6VH 1FYTD 2ENQA 3CLFL 3ABGA 4F92B 1F1AA 1MW1A 2AXFB 2BW5A 3QUZC 4P4KB 5E1IA 1XGYL 4WVRA 5DUMH 2F1AA 4GQRA 4X6CF 3T3PF 4HAKA 3A3YB 3WEAA 4U4IA 3WJJC 3H9HB 2F74A 3FTGB 4TLTA 5F7KC 5B39A 2YAPA 2OMBA 5J13C 3MUGB 4L8DB 3KPOA 1FNSH 3ILDA 4JFTA 1RJCA 4XVSL 4Y4HA 3FT0A 4PJHE 3CQPA 3C2AH 5KJ7E 1NGWB 1VJSA 2F08A 2JK5B 5C86A 4EUPA 4JY4A 1MI5B 1QSED 4IRZA 4N26A 5K5YA 1VFOA 1JGUH 5CD3A 2V2TA 1ZLVH 2O6PA 2VR5A 4FFYA 1T89C 1A1MA 2H32B 1G4RA 1RUPH 4ABWA 4U7KA 5I1HL 3LS5L 1JYVA 2AGJH 1IJ9A 5G5DB 4GXVH 4HK0B 5DEGB 3HPJA 3PJSA 4OD3L 3DUUA 3FU9A 1IKFL 1NCJA 4H8PA 1MY5A 4TSAL 5CIPH 2HVBA 1I8LC 1JWSA 2WIIA 5FLUA 1S7VA 3OLIA 5EUOB 3A4DA 1N9PA 4L8CA 1HXYA 2H1XA 5LAXA 4A55A 2WUBH 1GCYA 4N85A 1A3RL 4G5ZL 4WJ5B 3TNNA 4U1NA 4DKAA 1O9ZA 2G60L 4MCNA 2E9WA 4O51B 3FUFA 1ZSDA 1NBZB 2NLJB 1XVSA 4BA0A 1X4YA 1IGCL 3QJFB 4JRXA 3DIFA 1J7VR 5GGRY 3GMNB 3EYFB 3HR5A 4I0CC 1SDDB 1C16A 3BSZA 5HDBB 1PGRB 3ZGHA 2A3TA 2WO2B 2DJSA 4WHYH 4NHCL 3HMXH 3UTZB 1DBML 4PWJA 1NMAL 2OMXA 3EDKA 5E2TL 1J10A 3HE6B 3SYOA 4F3FA 4KRPD 4FQLL 1F90L 2KL6A 4DERA 4BZ2A 1TT6A 2MQ0A 5D7JA 3TEUA 2CBQA 2IPTL 2NT1A 4PIRF 3SSGA 5DJXB 3MLWH 2Q7YA 4N2GA 2XXMB 1UKSA 1OTSC 4OAWB 5C0AE 5HHVL 2DI8A 4L3ED 3OKLA 4NKDB 4X98B 1ACCA 1IAIH 1T1XA 3O2VL 2VSKB 3G7TA 1X5AA 3N85L 5JIHA 2XZQH 5T3ZL 3RRQA 1AKJB 3D87B 3WTUA 4LGPB 3HC4L 5CJXA 5ICXA 1IC5L 4NUPA 1FO0H 3KHOA 5F1OB 3UTTE 1YLBB 4ZUSA 4U1IB 2DBLH 2VO5A 2DIAA 4ZS7L 4N9GB 4QRRD 3SE9L 5D1QD 3M46A 3STBA 3TA3A 2HUEA 4GB9A 3MLYH 3TA4D 3UTSB 3F58H 3CUPA 3GLEA 5L0QB 3IS1X 4HK0A 5CGYD 1WT5A 4XZ4A 4X4XB 4JM2C 4XOCA 1NIFA 3EJZC 3GMRB 1BREA 4JHAL 1R1CA 4OZHE 4Z5RB 4J28A 1Z3GL 3I6LE 3N42F 2I7OA 3BZEB 1EFXA 1ETZB 3HZVB 4YXKH 3RBGA 1MCOL 3U6RB 3NACL 4HVBA 3UERA 3WHXA 2JKIS 2EYTA 4LDEB 4N2BA 3FCBA 4PJ6A 3LHPL 2Y7SA 4NN5C 4PR5B 1T6VN 3UYRL 1KWKA 1U8KB 3CSPA 4HLZG 4NWTL 3FO2A 5CP3H 1D7CA 2QGCA 5EH1A 2VXSL 2C7FA 5H37G 3ZGIA 1A21A 2KC0A 2GQHA 1AY1H 1QKZL 3BKCL 2A2QT 4R5TA 4G8EB 1D3CA 1FJ1B 4ZX3A 1UXMA 4ETYA 4OQ1A 2ICWJ 1X7TA 2XFXA 2P5WE 3SPJA 4ZQTA 2FL5A 2XN9E 3NN8A 4X7EC 1N5YL 1KXVA 3F85A 1JI2A 5GS2H 2X4RA 1B4LA 4F8NA 4GG8A 4FXTA 2IAMA 4U1GB 5B7MA 4ZPVA 3MLXH 2PYEB 1F2XK 1UWEL 3B5GA 4TVUA 1OO2A 1ZLDA 4HUXA 3LKPB 5MEOB 3GSVB 4KGLA 4M5SA 3BP6B 2D9CA 3H9SE 4GFTB 4MA7L 4ZFOB 3S2AA 2ZXAA 1NCTA 1XIWA 3CPLB 1EXGA 2ID5A 4ZNEE 2WLJA 3RWDB 4FXKA 3IDGB 1DL7L 2GW5A 4J6RH 3TEZA 4X5XA 4RRPM 4ZMAT 4XTRD 1ZEAL 3JWNH 4U49A 2J2ZB 3I84A 3H0TA 4IHBA 1H9VA 3LEVH 1FZOB 4MMXA 3WKNA 1LDSA 1HSBA 4DPAX 2N56A 4MNGB 4Q14A 1AC6A 3D51A 3Q1SL 4KC3B 4FEMA 3HAEA 3MOAL 3GMRA 5FECB 4NYLA 3I6KA 1BIIA 1SHWA 5EU5B 1DQLH 4OZFH 1DQQB 3QDHA 4PCTA 3WMSA 4YDLB 3HE7D 2AABL 4Y4FA 5DJ0B 4XXDB 4QRUB 3SOBL 2ZUTA 4QR7A 3IKKA 2Z4TA 1CE6B 1DN0A 3KPPB 1HYSC 3HHMA 5CBEB 4PB0L 4NDMA 3MU3A 1GZQB 3MJ9H 1E2ZA 4Z0BH 2J8UB 3LRLA 1Z9LA 2F7RA 1NCNA 2BY3A 1S7TB 1ACYH 2VN4A 4MCYA 1NICA 4I85A 5ES4B 4MHHI 2FJUB 1SEQL 2IDSA 3K7UA 4LIQL 3X12B 2RB8A 2WKLA 1FNGA 4HOXA 5I19H 3NFSL 1DBKH 2IG2L 3ARZA 4PJXA 1A9EB 1MI5E 1CGWA 1AYOA 3DX1A 5CXPA 3FMGH 2A7BA 5I66A 5IGXL 1YEHH 4XP5L 3MVSA 4P23A 4C83B 4NNPH 4V2BA 4PJ5D 1Z9SB 2JXMB 1Z5HA 2VKWA 5FAAA 3S36X 2E6PA 1M7DB 1R0AH 5B7EA 3H3PL 4LFHG 1DVYA 1D5IL 3BGMB 2K8QA 2PCFA 2R0WL 1I9IL 1N70A 4U6VL 4B9FA 2VSDA 4GYBA 3RZCB 3QEQB 4G9FB 4YUEL 2D3LA 1YEFL 1CXFA 1U8OB 2YFNA 4F7CA 2WVVB 1YUHB 2BVQB 3E7JA 5C0CA 2VUOA 5T1MB 5D7SH 3DXAA 3M86A 5EUOE 4EVNA 4GUCA 1RK0B 1YECL 3OX8A 2TRHA 3FQ1A 4ZFZB 3Q06A 2C3HA 3FUNA 3MCG1 3CMOL 4E41D 5FK9B 2V2XA 2ZNWA 4RGNC 3UDWC 3QJXA 2XRAL 4G1EA 2Q7NA 4O9HL 2BSDA 1KPRB 3GNMH 5EU5A 3TO2B 5ANMB 2QMKA 3VX0A 5EU4B 1K8DA 3LEXB 5AEAA 4QRUA 4PMFA 4UV7H 2X89D 1N59B 2GTWB 4AVKA 3VTAA 2NW2A 4HH8A 4U2YA 2YGPA 3P9MB 1EZSA 1XHHA 5EO1A 5JPMB 1WYJA 2I9LA 4X9FA 2GHWB 1AYRA 1URIA 1YJDL 3EKCA 2WINB 3MAWA 1G7QA 4LGSB 5JOPD 3VXTB 4OV6F 5F8QC 4K3JH 1UHVA 3BGAA 4HJJH 2CCWA 3TO4B 4MDRA 2EDBA 4RISL 4E68A 4JY6B 1RZ7H 2XWEA 5IG7A 1EFQA 2OYLA 2FUTA 3VWKD 4M1DL 2OSLB 2MHAB 1A9EA 1CFTB 4AQAA 5A7EA 4OVVA 5D96C 3MKKA 1I7RA 3ZQWA 4QOKB 4A2MA 3ATDA 4QGTA 2VKXA 2NDFA 3B7TA 5JHBA 3ETBF 3V4PA 4LOFA 3AT8A 3UTSE 4HLEA 4E5XG 5EU3B 1JGDA 5IP4A 3BGMA 5ECGA 3VXOA 4PWGA 5K9KA 5I5IA 4PLNC 1QSZA 2IGFH 3SDDD 1RSYA 2P80A 4XNYH 1S7XA 4BQCA 2MCPH 3VXQA 5E5RB 3MO1B 3KPSD 2CRYA 1NEPA 5AW1B 4AYSA 1NEZA 2FLBT 3GSXA 2Y1YA 3U4BH 2X28A 4BM7A 3QRGH 2VDKH 1RK0A 5FHBL 1YHPA 3VSUA 2WNGA 2WIMA 3F12A 2Q1EA 3IRZA 4NN6B 4KNTA 2R2HA 1DO6A 3NRPA 4CN4A 1BXVA 1NCHA 3LPWA 1XCWA 2NXZD 4IRSA 4ONFL 2EDWA 4QLWA 3F7LA 2BZDA 1NLDH 4JRYA 5IM7B 1EEQA 1YYLL 2TAAA 1ET7A 3MPCA 4UDUA 3FUMA 35C8H 4JDVB 5T3XH 4X4YA 2JKNA 3BAWA 3V4VH 1I1AA 3KDMB 2WKOA 4RAUA 1NFIB 1HZHH 1H3PL 4LOVA 4HXBH 2E46A 2YFOA 3VNYA 1SLVA 2Y2WA 4NQVB 3FH5A 4OKDA 5JORA 3U7WH 1WE5A 1BD2B 2VCOA 3OXSA 3TT3L 1VGEL 2F19L 1EO8L 2H6PB 4PCSA 4KI1A 5D2NB 1G9EA 3ZMRA 2PYEE 2A83B 1G9NH 1XF1A 1M1SA 2G0KA 2AMGA 3LEYL 4Z3HA 1XB6A 1U2HA 5AB9A 1XMWA 1MJUH 2QR0B 2IWKA 3QJQB 3QS3A 4JGMA 3TONA 4WUUD 5D4IA 3FQWB 1HSAB 2BMKB 4EE2A 1QYGH 1W72H 4A38A 3MRGA 1KY7A 2YRPA 2EIZB 4MRCA 2E27L 5IHZA 3FSVA 1RJZA 3GHEH 1UD6A 2WXJA 4K3DH 2OYPA 1FVDB 3X13A 4MNGE 2VAAA 2BNUB 2D7TH 3QA3B 4HUVA 2CHNA 3HI5H 3LZPA 2JB5H 2HN7B 1NC4B 1EAJA 4OW6A 4AV4A 2GG1A 1VA9A 2QV4A 3ZYIA 4NT6A 3Q3GA 2BNQB 4WDIA 4P5TC 3OLDA 1F4WH 3DK2A 4ZTPL 1ZLUK 5G55A 3WN5B 4HCFA 2J21A 3UZEA 5FM4A 1FPTH 1AGCB 1SY6A 1F4XH 3TVMC 2J8UE 1TZIA 2EIBA 3ARUA 3LH2H 4PJAF 4G7RB 4KOCA 4CVXA 3EJRA 2YAMA 1L9TA 4NFDA 1I53A 4O2FB 3SKMB 3WV0A 3HNTL 1OCWL 3QUMH 1D2PA 2V7NB 2F18A 4XE5B 1P4LB 1ZTXH 1FIEA 5I71B 5JW5A 5DFWH 1BZ7A 1RY7B 3QXDA 5C0GA 3QJVB 2DQTL 2JCCF 2XWTA 3A6BL 4OH2A 4A7QA 3WKQA 2CUIA 2YEZB 3ESMA 2DQUH 3F05A 3TBVB 4MB3A 1YRKA 4NC0B 5GJTH 1KJ3H 5AW7B 4JCMA 4WUKL 4HUWA 2V7HB 2R23B 5TTRA 4GMSL 3E8UH 3NGBC 2H2PD 4FZ8H 4BH8A 5JHLL 4HFWA 2F5AL 2UXVA 4QRPB 1VRSA 3D85A 1AR1B 1LQSR 3CHXA 3QEQE 4G9FE 4N5EC 3RIAF 6PCYA 2DQCL 1JWMB 1UWYA 3ABZA 3QJHA 1R5IB 3SE6A 4CMMA 3WE6B 1FNEA 3C08H 3FSOA 1EAOA 1ZLUH 5CSGA 4NZTL 3B2DC 3MFGB 3AABA 5D1ZC 3WYRA 5CEZD 1D7BA 5L8LB 3U0WH 3K81A 4QTIL 4RZCB 1DUYA 3VA6A 1IGIL 1OSPH 1BJ1H 2ZUQC 3AZUA 4IJTA 1P1ZA 5ANME 2BNQA 3SYQA 5I1LB 3HPLB 1XSKA 4NP4H 1WAEA 5D1XA 1RZ8A 4IS6A 5E6IC 2AEPL 2LR4A 1F6AB 1PY9A 1UFGA 2FZ3B 2BRRH 2MQGA 3O11B 4P5KB 5H2BB 5I0ZA 4K7FA 2BHZA 3T0DA 4HMDA 3EFDL 5E1GA 4HUMB 2VZSA 4M7KH 4KTDL 1WAAA 4O2FA 1WWWX 1Q8MA 4HLJA 1U3HA 3MRKA 4R7DB 4UOZA 4ZMTA 5I1EH 2MPAL 3CGTA 2A73A 3FPYA 4HJUA 3WUWG 5HBBA 1IGJB 2P42B 5E9NA 4ZPTB 1CLZL 5I8OL 1J5OH 3ARGA 1Q9WB 3HHSA 5CSBA 1W6LA 2IVFC 2Q86B 4DVBA 3LB6D 4LCVA 4XC1L 1UH4A 3H2QA 5IQ7H 1S9WA 1N5AB 2P48B 2VR4A 4NWUL 4HPYH 4QOKE 5DD3L 4DH2A 2Q3ZA 5E4EB 3FQUB 1WITA 5IHUH 2NY2D 3AB0B 2IDTA 1T03H 1BAFL 1OTTD 1FQ9C 5TJWK 4HKJB 4AQ1A 5E24E 1QUNA 4LLMB 1L4IA 5DGQA 3HN3A 5FM5M 4PREA 3LNEA 1VEOA 4AKOA 3W11D 1X6NA 1WBXB 4XMUA 3FOLB 4MAYD 3UZVB 2I26N 2KLRA 4MS8D 2A4ZA 1MW2A 2CNZA 1UB6B 4ZUTA 2XVGA 3CFDB 5C7XL 1AS8A 2Y6SD 3GSNH 3LXBA 3VRLF 5HYSB 5KSUB 1FG9C 1I3VA 4R2GB 1I8MB 5DMIH 1PQZB 2W38A 3O9WC 2EDFA 4XI5C 3T2LA 3OJMB 1Q9KA 3O2DL 5IHWA 1I7TB 1GS7A 2W9EL 4Z7WB 1SF5A 4PV1C 1NL0L 2WYTA 2AV7A 1D5ZA 2H9GB 4HMCA 5GGTH 2W07B 3WL9B 4H0IA 1KTLA 2WQAA 3JTTA 2YAHA 3IMTA 5DRZB 5F1KC 1GW6A 3EH2A 2VIRA 4MXVF 5EF0A 4QRSA 5DFTA 1JGEB 5H2BA 1M7UA 2IH3A 2YKLL 1TLKA 1M6UA 2XQYG 3B9AA 3MLUL 3MV9A 3NESA 1UM6H 1BD2E 4WCYH 4H1LG 2GVYA 1EAPB 3ZK0A 1QLEL 2NR6D 3OKKA 4OLUL 5DXWA 4DN3L 2NTFB 2FJSA 3QK0A 2EH8H 4NZFA 4HJ0C 1EHLL 4HX1B 3BMWA 4HKBB 3KYAA 2X44D 3KPLB 4LOUC 1ZT1A 3TPUA 2BC4B 3MX0A 3UIZA 5FPIA 4KGJA 4YEFA 3HE6C 2HMIC 3CDYA 1I8UA 2XG4A 4LLUA 3ULVD 4IMKA 2V4LA 3KLHD 4JPIB 1RIVL 2Y4SA 2DI9A 3L5JA 3QO0B 3AWGA 1JCVA 5BZWA 3FO0H 3STLA 1OP9A 3FB5B 2YQBA 4K4KA 5JOFA 2D0HA 3ARDA 4I2XB 4PRIA 3VGFA 2QQNL 4GS7B 5T1DH 2UXTA 4YLCA 5L7XH 2P8PB 3AM8A 1RP9A 4JFED 2D03H 1GA2A 2LTQC 3VGGA 3IMSA 2ARJA 3LTVA 5DQDH 1GMEA 1IM3B 1UGKA 4MWFB 4AMXA 3REVB 2UZIH 3C60B 2BNQE 3MR9A 4YHIB 4GKZA 2AXJA 5D1XE 5KYYB 3VI4A 1GJUA 3UTOA 5L0QC 1LK2B 3WIIH 3QDGD 3P02A 1HOCB 2HT2C 4Z8FH 3IMRA 2WBJC 2Y36H 2KYIA 1WAAE 1BBDL 2PCYA 3HUJF 4POUB 4YDKL 4K23H 5C6PB 1AG0A 1X5HA 3H4FA 4AL8H 3DI3B 4MBOA 2YMXH 4H8WH 3BAKA 4JPWL 2GBTA 4BFBD 2CH8A 5PCYA 4O58H 2A99A 5E1QA 4BKSC 2Q9OA 1D9KD 1G5GA 3P0YH 1LO5B 3NCEB 4YHKL 3CHPA 3JSSA 3KGUA 4N3TA 5CR1A 3S35X 1A8JH 4WHDA 1CU4H 5FWRA 4JUSA 1PEZA 4H20H 1E3FA 1MCDA 2AVFA 2ZSWB 5DC0A 5HHNA 4RX4D 4P2YA 5BS0B 4NOFA 5GGUA 2XPGA 1BLIA 4GMTL 2ZCLH 3RA7H 3ZQXA 5E4OA 1KTDA 2X7LB 4H25A 2BC4A 3DHJA 9CGTA 4XHJD 1CE1L 4NLAA 3WLBA 2Y06H 4ZFFA 3FL7A 4HHAB 4JPIA 5IV2B 2BHYA 4G6ML 3O6MH 3GPSA 3BC9A 4RMWA 2CJUL 3V6OE 5C09B 3GJFK 4U1GC 1N67A 1TJIH 5E6SB 4DP5X 2OMVA 4XOEA 4KZDL 3LKNB 3DYOA 1NA8A 1XXFC 2CIKA 3ESUF 4CNIB 3HB3C 1JV5B 4A2LA 4WSKA 1GYAA 1E4JA 4OIIL 3SGKC 3G08B 4GRLB 4QHKJ 4MWFA 1XX9C 5JUEL 3H7LA 1GR7A 1OAZL 1WFUA 4UQAA 4LRNH 2Q8AL 1GW0A 3T0VA 1JTPA 4OI9A 2X10A 3QXVA 1ZA3A 3HS9A 2WCGA 4RIRA 1AZBA 4OM0L 4QT5A 2EABA 1SJVA 2ZXEB 4PJIB 1KLFA 5EOCJ 2EDEA 3DHUA 1QI5A 5L2KB 3MV9E 4N8VG 1NZRA 3BVWA 2A9AA 4ZK8A 3RTQC 4NZRH 3O0RH 5J11B 2EO9A 1XV8A 7TAAA 2R69H 4GW1B 4WW2B 1AOHA 4IBWA 3FB8B 3OR6B 4MFHA 3VRIB 3QRFM 3TZVB 4GFXA 3L7FA 1UXSB 4OQTH 1EWHA 1KTKE 4KK6D 5FM5O 3H3BC 5HHQA 1HE8A 5KVDH 4PS4L 5DURB 4N6RB 4XPGH 4F93B 1WZLA 3QDMA 3REWB 1E9OB 4G8GD 3IVKB 4UZUA 1YDPA 3RNQA 1O6SA 1BSIA 1VSCA 3EHBD 4KK5C 1U8HA 2E86A 3FTVA 5FCSH 5AVUB 1GTNA 3NEOA 3MREA 3QQ9C 3U7AA 1HVXA 3L8QA 3SPHA 3QWQB 2IADA 2OSWA 3P11L 2J5WA 2JLPA 2D7PA 3EAKA 4Q6IB 1N2RB 1A6AB 2Z9TA 4H5SA 4YSDA 2DQEH 1THCA 5DUPL 5I18L 2X2JA 3UAJD 2OI9B 4Z7WE 4EXPX 4Z76A 4AIXA 3V5KA 4RQQB 3WY2A 4ADGA 3PL6B 1KLUA 1M1XA 2E7MA 4Q7DA 1SMDA 1HXMA 3MGAA 4YBLB 5DWPA 4UQ2B 2Y7NA 4GRMB 4U33A 3RGHA 3RZCC 3WO4B 2Y5EA 2KDYA 1L9QA 4URKA 3U79A 2R29L 2YPKA 1QD0A 4YGVB 3DOSB 4IMLA 1KYUA 1P5UB 2FEEI 2ZJSH 3L3OB 3T09A 3FT2A 4OR1A 1ZJBA 3B8YA 2VN6A 4L1LA 2CM5A 4QHNB 2GKIA 4CA4A 6TAAA 1DVXA 3HNVL 3Q01A 5L2KA 1MHEB 4L8BA 3QI9B 5EOCL 3WFBH 1UH2A 1E4KA 3PFQA 5HD8D 2F53A 2FH8A 3K91A 5SWSA 3I02A 3KZ8A 5FFOA 2PPDA 2J4WH 5DUML 2SODB 2YJQA 1J05B 4P46B 3ZUCA 5A2JH 1F02I 1SVBA 1ODAA 2NNFA 4BDVB 2ZYSA 4UNUA 5D93C 5GS2D 5GZNC 4NPJA 1ETJA 4ODVH 4PJ7B 3G5ZB 1G1CA 1NKOA 3COOA 3O8XA 4JVWA 3C2AL 4MLSA 5JPMC 1W15A 2MOGA 3F01A 4ZNCD 4FI8A 1DE4A 2BVPA 2VR6A 3KM1A 4PY7A 4WEUD 2O61A 2OJZH 3MXVH 4CADA 4FQXC 3N43B 1S3RA 3KPNA 2J71A 3J7HA 5BQ7A 3LS4H 2FX7L 3TO4C 4F9PA 4I2XE 4PP2B 2WKGA 5IUSA 4OFPA 1RUPL 3D05A 1I1YA 1XBDA 4QYOA 5GS1B 2PO6B 4NQXA 1RMFL 4GXVL 5E7BA 4DEWA 2BS71 2IWGA 4HZ1A 3GHBH 1A14H 1S7SB 2MTPA 2W65A 2ZKXA 3RQ3A 3FU5A 1ZGLA 3GBML 4QDGA 4YDVB 3NIGB 3ZE2F 1GXEA 2JCWA 2VQ1B 2GC7C 1YN7A 4PBXA 2X9ZA 2VGLM 4HJ1A 4PD4K 1OM3L 1K3IA 1S9VA 2QSCH 3IJSB 2WUBL 1M71A 4GRMA 5DWUL 3H54A 4XOBA 1AZRA 2ENJA 4GW5B 4HJIA 2MFNA 1MWAH 1F4YL 5D8JH 4W9HC 4AH2B 3W9EB 1E27B 1KJ2B 2VLJB 3QCVH 4ZMLA 1EA9C 3CZFA 4F5CA 1PZAA 3CVHH 3GXTA 4NN6C 1PAMA 3C8HA 4DP9X 4R4FH 4AIOA 3W3BA 1YN6A 3FAWA 5F0PB 3HIZA 4X0KB 3ZSSA 3CC5A 1V7NL 5BS0E 2ICCA 3A24A 3MLWL 1A6PA 1JN6B 5DJAA 4KKAC 1JXKA 2ZG3A 5AALA 4Y0GA 2FRGP 4WFED 2YWZA 2ZKWA 3GSRB 2NYZA 1GZHA 4KMTL 2YRZA 1IAIL 3MBXH 3L13A 4K9EH 3ZDYF 2EUVA 1R9FA 4HJSA 2VW4A 4L9LB 2VN7A 5T3XL 1TZHA 1FO0L 5C09E 1GJIA 3CFBB 5CHNA 5D2NC 4WWNA 2DBLL 2V5SA 2AQTA 3EO1B 5LBVA 1BG1A 1MELA 5F7DA 3CFUA 4YSTA 1CFQB 2EDHA 3MLYL 5JMOC 2YAQA 4IKIA 4MNHB 2PW2A 4PJXF 2FGZA 2JQZA 6CGTA 3RGVA 2OR7A 4KJWC 5HYJA 1ZKAA 1L7IH 3BKJH 3FB7B 4C56A 5BVJB 1BJ8A 2YAFA 3IM1A 4LCWB 1Q4NX 4OZ4A 4PY8I 4OFQA 3UJTL 2HKFL 2DV6A 3ARFA 5IOPB 3SDCA 4KQ4L 4LT7A 4YXKL 4PJIE 3SE4C 4ENED 4XWGH 4HIQA 5L2KE 1L0PA 3MRFB 3JTSA 3IN2A 4DGWC 3RFZC 2BVUA 4AGNA 4JN2B 1GS6X 1FNAA 3QUYA 3Q2LA 4PPTA 5SWSE 1FVEA 4FJYA 1TLMA 2D73A 4I3RH 3UTPD 1HL9A 3P3TA 3WFZA 4L3CB 3QUXB 4XBPB 5HGDB 4IBVA 4DT2A 3EH1A 3PDOA 3ULUL 2KKQA 3HVDA 1AY1L 4MD4A 2VXUL 1NMBH 3DVNB 5L2JA 1O5PA 3VYNA 2XWZA 5KSAA 4N2FA 4YWGH 3WU1A 1TMCB 2AZAA 3MBEC 3N91A 2D3VA 3FCTB 1W2KT 2Z3FA 5DS8B 2VRKA 3MLXL 4DZ8B 5IVXA 2EIDA 3QO1B 3NIFB 4A37A 5TK4A 1P7BA 1PLGH 1TVBA 5I71C 1G9ML 1IE4A 4WTXA 4X0NA 3DDGA 1B4JL 4WW1B 1QFWM 4K2UH 2CAKA 2MIZA 4RNRB 3KNBA 1TZGH 1AQKH 4XN8A 1ID5I 2IQ9L 3K8KA 2QGBA 3GMLB 4JQXA 3PNWB 5GRVL 1LP9B 4AC4A 4E9RA 1RZKH 4OFYD 1QFWI 4J6RL 3CCHA 3ORJA 3H7BA 1CLCA 1BZ8A 4PJEA 4MNHA 2WXQA 3B3IB 5DYFA 2HFTA 1UKTA 1X5YA 2ED6A 3PHAA 3LEVL 4PGCA 3ZQ9A 3I9PA 4ETQA 1CGVA 2YRBA 2R59A 1N7ML 3MCKA 1NGZA 4HEMA 1FNHA 4X5WB 3GLDA 2KHAA 3MUHL 1R5VB 1MG3C 5K69A 4A2DA 2L7QA 3V6OC 3M1CA 1UXWA 2QVMA 2X41A 1GY1A 4L4JA 2CJTA 4M4RB 2OZ4A 5BJTA 5T3XD 1HINH 3FFDB 1AIFB 3RY6C 1OARL 1L5GA 2Q2EB 3TN0B 3W0WD 3PWJA 1XR9B 4Y4KB 2B16A 4FQ1H 3MJ9L 3S0PA 3SYCA 2AITA 2DLEA 2OCFD 4Z0BL 3FN9A 1PKQA 3WFDH 3U2SA 1N10A 5G4NA 4YOKA 2OA9A 1FL5B 3IFOB 3OPZH 3F5WB 4HKZB 1MNUH 1ACYL 3LNIA 3D0LA 4B3VA 1USZA 5ESVA 3S8WA 4J3OD 4P07A 1H5BB 4PJ7E 2SEBA 5E2WH 1M7XA 1MKFA 3DRTA 5I19L 5MEQB 1XMEB 4UM9A 4WFHD 4GG6B 2VDNB 3GINA 1SJXA 4PTUB 1RZIB 2BHFA 2WKOF 3QWOB 2APTA 4J7RA 4Y7OC 4EKXA 5HI5C 4MQXC 2ZG2A 3QO1A 3GSQA 4NNPL 2QTEA 3HKFA 3Q8BA 1X5KA 3UX9B 1KLGA 1SJEB 1X7SA 4R96B 4IBZA 1J1OH 3CFTA 4FERA 3TTSA 2XWJB 1FGVH 2XN1A 4ZMYA 1EO5A 5T1KB 4HT1L 1CN4A 5E4EC 3PQYB 4EN3B 3GIVB 4F7MB 1S3KH 4ZYKB 5D7SL 3D2UD 4J3BA 1J8RA 3O4LD 1LE5B 3FPXA 1Y07A 4B27A 4LCCC 2AJUH 2VR7A 4P2QD 1MJJB 4KI5F 4YIQA 4O00A 2PR4H 2W92A 1QNZH 12E8H 1R5VA 2XJLA 3QDJB 3TP4A 3C8KB 3CBKB 1A9BB 1C08B 1CF1A 3LV3B 4CAGA 2N0MA 4BQ6A 4R7NB 5DO8A 3L1FA 4XVOA 3JUZA 3K71B 4G9DB 3FT9A 4D0BA 3IDXH 4NLHA 1ZD6A 4UV7L 3BZFA 5E4AA 1SYSA 1KENL 4ELKA 1CBVL 1KCSL 2P9RA 2FSEB 4BCZA 3EIFA 4NSKA 4CUCA 1QFUH 1AQ8A 2I9TB 4DEPB 5E95B 3PRZA 4LSVH 2O6DA 3IFOA 1PDKA 5IB3A 1UM4H 4ACPA 4OSUH 4B97A 1VFMA 2B39A 4JZJA 1FFTB 4HJJL 4J3UA 3KE0A 1KYOK 2VZUA 1OQOA 1QSEB 5HHMB 4H0HB 1DVFA 1NUGA 3TTYA 1IC4H 1BZEA 4R4BA 1JNNH 2ZWYA 3S48A 2EXYC 1A2YB 3TPKA 3U9UB 3ARRA 4JW3A 4L3FA 5JPNA 1FNFA 2LW3A 3G5XB 1H0DA 4ZZKA 2HFFA 3V9CA 2C3VA 4P48A 4JFFD 3IETA 4ODSH 1NC2B 2EDRA 1IGMH 4PJEE 4G42B 2HJLA 3ECBB 3U2JA 4NM4H 1GC1C 3NIDF 1CFVH 3K6SA 2NW3A 2IGFL 4CC4A 4OGYH 4ODTH 4G2AA 2MCPL 3IXTB 3PGDA 1MAJA 4N4YB 3U4BL 4LCWE 2VDKL 1E30A 1W0YT 1W0WB 5IROC 5HYQA 5LN8A 2YA2A 2BDNL 4AVJA 1ACXA 4PJBB 3ZN6A 5EBMA 1E28B 1XGQB 3EOYG 4GS7C 2XDHA 5EN2B 1MLCB 1YEKH 2HRPH 5LXGH 3RB5A 3W39A 4MZ2A 1VFAA 1SLXA 4PJ9C 3GB7A 2ENYA 2KI6A 2BVOA 1O6TA 4LHUG 3L95B 1FYTA 1E9PB 4G7YH 2V17H 2BIMA 35C8L 4NAMA 1JCKA 3V4VL 4S0HA 3E6FA 4JO3L 3AUVA 3AT9A 1A7RH 4ANUA 2FIRT 4GKNB 1FORL 3WMQA 1WK0A 4XVTL 1HHJA 2L0DA 4HXBL 5T5NF 5BXFB 2IV9A 3FT4B 1DLFH 1NJ9A 4P05A 1KWGA 3WD5H 5JO5B 3JVFC 4Z23A 4YQXH 5K59F 4ALAC 3QW9A 1TZOA 3KDPB 1OGPA 4HKXB 2GJZA 1RIUH 3DX2A 4LLAA 3X3FH 3W57A 3ZHFA 4EUPH 4IRZH 1BFTA 4FHJA 1QSEA 2R7EB 3NIFE 1J88A 2VXQL 4Y2LA 3S37H 2AZUA 3VMOA 4EIGB 3KEHA 3D33A 1P7QD 2QGDA 3NZ8B 4N68A 4OF3A 1WAAF 2H0JA 1A7OH 2VZTA 1AI1L 3VH8G 1X5JA 1PZSA 2RBLA 3D18A 3MMEB 4FKHA 3JWOH 2Z93A 4XMLH 2WPGA 5A2CA 2A74A 4Y5XB 1MCJA 3FBQA 4GUPA 1QYGL 3B9KB 5TD4A 5ICUA 4JQVC 4JPQA 5H94A 3GHEL 2FT6A 1LNUB 2WZAA 4K3DL 3UROR 2YGVA 2D7TL 1CGSH 2LFGA 4XPTH 3V0VB 3IN0A 2K78A 3HI5L 3INUL 3MRMB 2JB5L 5KBPA 1EEYB 3B34A 2ISDA 2F7QA 3VD0A 4PVNA 1BJ1J 1BZQK 2CDGA 5FF6A 5GISH 3F7PC 1NINA 4HZLB 3DBXB 2NXYC 4NO0B 2JVUA 3E6HA 4YSPA 1JDCA 1MH5A 2Z64C 5AD0B 2AK4B 3FUJA 3OR7A 4YHZL 1X5FA 4K7PY 4Y16B 4UV4L 2X1QA 1QBAA 2YMOA 2GJ6D 3ARED 5F89A 3X3GH 3QBTB 5BMFL 4GRLC 1FPTL 4H40A 4WHCA 1F4XL 1UD5A 7PAZA 3DV6A 3VU2A 2GFBA 5KJRH 3SGDH 3TJEH 3BAXA 4PJGA 4ODWA 4ZTOH 2F1BA 3EYOA 2EEFA 5FO9A 3QFDA 2HVJA 3MGOA 4JDEA 4F2EA 2WN2A 5IW3A 3IJ9A 4EQ2A 1HIMH 1TVDA 2IIJA 3OC5A 4XBGA 3F7YA 1CICC 2B1OA 3QUML 3PWVB 2D4DA 1ZTXL 5TDPB 5K9JH 4GG6E 3M07A 1HI6A 2JKTM 3CSBA 2BO0A 4LSRL 4U3XA 5IMLB 4LSTH 4L3EA 4G8AC 2PYFA 2DQUL 5C6WH 5J11C 1DVQA 2EIKB 1Y6MR 32C2A 4NI3A 1KJ3L 5GJTL 4WW2C 4KKQA 4WO4D 1KXTB 3CVBA 1E8YA 4UBDD 4ZTEA 1R3KA 2DIEA 2P8LA 3E8UL 4Y9CA 3TCXA 5HPMB 1ZHLB 3L6FB 2BS8A 4FZ8L 4QRRA 5D1QA 2AS5M 2H3NB 1PIGA 5CM1A 1T0MA 4XRCB 1GMIA 1MFBH 3D39D 4L1SA 1BQ5A 1UENA 1LD9B 5ACZA 3OGCA 5E8EB 3WDJA 4M3HA 2YEVB 1LEIB 4LLVA 4M8QB 3IGKA 5HY9A 1ZA6B 5B1JA 4LPCA 4K5NA 1GGYA 2EQDA 5MENB 3BP7A 1GGCH 2FLMA 2DEYX 2J20A 1DBJL 1PD1A 3QDJE 3TF4A 2W81C 1DBBH 3BRDA 4PRDA 2XX1A 4BGDA 2YKKA 3SZKC 4Q6IC 2QMJA 1S5IH 5J12C 1FYTE 1U8NA 1J9CT 2X4TB 4UU9B 4EDXA 1KBGH 1A5FL 4ES9A 3Q8FA 3PL6C 1PZ3A 2BRRL 4PWHA 2APFA 5I1JH 2IJ0C 4JREB 4NNXA 4AENB 1OCRB 2WYHA 3MA7A 4M7KL 3WO4C 3CZGA 5E8OB 1KJMA 4GNKB 3VI4F 1P5UC 2JJTA 5ITFB 4DN4H 5D70L 3SB3A 1BQHB 4BHUI 5MHSD 1E43A 1HJBC 4TLSA 5FO8B 1QSEE 5HHME 2CSPA 4DVRH 1G7MA 5CLXA 1TTFA 4J8RB 5A6IA 1UWXH 2B4CH 4UMSA 1JGIA 3QEUA 4R26H 3RPIA 5J3HD 4XMKH 3MV8D 5IHUL 2XV3A 2B1AH 2DY2A 5CSZA 4WHTB 4HCRA 1O7VA 5I16B 4JDTH 2Z91B 5CS7A 1G6RL 4G80A 1U8CB 5CN3A 4JVPA 1PU0A 3NJFA 1Y1UA 1R5WA 2H3NA 4QY8A 2UYLA 2ITEA 3ARBD 4FG6D 1KELH 3VJ6B 3TJPA 1HCVA 4PRHB 4Y5YA 3LH9A 1X7QA 3MRBA 3GSNL 4KUCF 3KVPA 4FE9A 3CLEL 3IJYA 1P5VB 5DMIL 2EILB 2VDQB 4GXUN 3CSYA 5AAWC 3NCWA 4GUOA 4BFKA 4PJBE 2ED7A 1QW8A 4XNMB 1ZA6A 1SVZA 5L6YH 1G94A 4KDTC 3B2UC 1J0JA 3QUZD 2DMHA 2ERJC 4X50A 5GS1C 2PO6C 1D5MA 4JR9H 2B59A 2GY7B 2WLIA 3LN9A 4F9LC 5GGTL 3HE7A 4Q4IA 4XNQB 3RL1B 2XG5B 4AV5A 1CZ8H 1A3QA 5C0BB 2QKIC 5FDWB 1TTAA 5B1CA 1B2YA 3VFSB 2PKDA 1N8ZA 2A1WH 4GKSB 4HIEB 4RMRA 1ZTMA 3U7YH 5I24A 2GK0B 5ID1B 1MAKA 3VI3B 1UM6L 3FT1A 4WCYL 4ZDHB 4NXSA 1PNDA 5DJ2A 3IJ8A 2P5ED 3BESR 2B1HL 5ESAA 4RWHA 3ZTJG 5A40E 4JQIL 5GS0C 1AGEB 4DPBX 3ZE1B 3AFLA 3PWNB 3KYOA 4X2UA 3UAEA 4DW2H 1NCAH 4C4UA 4CW1A 3B2VL 1BM3H 5TGBB 2EH8L 3UL4A 3HNSL 1BMWA 4RDQF 3G3LA 1QZNA 4Z7UB 4QRRE 4PJ5A 2QJDA 1CDBA 2XKNA 5IEHB 4MZIA 4AI7A 1KGUA 1OGAB 4KNSA 2DIJA 2NY0C 3G6DL 3IWUA 5EC2A 1UOWA 2XX0A 3QIBC 1FSKB 3ZRSA 1N0XL 5EFIA 3ZKMC 3O3AB 5T1DL 2YC1B 5L7XL 3X14B 2D03L 2O1AA 1PG7H 4R0LA 3S34H 5C07D 1IGYB 3HI1B 4FC3E 4E5XB 4JJOA 4E41A 2UZIL 3NFNA 4AIZB 1UZ8B 3EUUA 2AK4E 3HZ3A 1OSZA 3SE3A 3G5YB 1FVCB 2NRDA 1PY0A 5EWIL 2BNRB 2ITDA 2YR3A 3RX5A 3OMIB 1OAQH 3QHFH 2Q0ZX 2XVKA 4J4PC 4PG9A 1A9VA 4QPEA 2YD4A 1FH5L 4XNQA 1FZMB 2GBUA 2X89A 4OGAC 2X53A 5CLZA 4U1SB 4Z8FL 2X1OA 3ROLB 5E5LA 3VSQA 2Y36L 1RLBA 1OTSD 2IDUA 1PW3A 5B38G 4UAOB 1KYDA 3LOWA 4N9OB 3AAZA 4FTVB 4AL8L 3ZBMA 2PMZA 3ARXA 3CLWA 3MGTB 2YXVA 4H8WL 3HRZB 1H3TA 5LNEA 5IUCA 5ID1A 1WA1X 1T04B 2H8PB 4O58L 3OBAA 3NCYP 4TNEA 3P0YL 3BUTA 4MQ7A 5DEJA 3WS6C 3TASA 2YZ8A 5C8JA 1YPZB 4XNXL 1NGPL 1TZ8A 3OJDB 4P2CG 2ESVD 4LHJB 5DMJB 3VWKA 4H20L 3Q6FA 1MQ8A 3ETTA 2R1WA 4UM8B 3MLTA 3PHQA 2E9GA 5JHLA 5EBWA 1MQKL 1UQSB 3RA7L 1NOFA 3RWCB 4PLOB 3L7EA 2FO1A 4KO6A 1PMYA 3EJZD 3RY4A 2Y06L 1TEFA 5KS9B 2WYZA 1T4KB 2BJML 5DEZA 1NCBL 4K8RH 1OKEA 5EZLA 1WS8A 5AZEH 5AW3B 5I8CA 2CKBB 3NEXA 3SDDA 5C9JB 2W91A 3UBXI 1IAOB 4IIQC 2YLKA 1TJIL 5B7FA 3KPSA 5DC4B 1NMCB 4CSZA 1RHFA 3QZPA 4HUUB 1KULA 3V5DB 4F7EA 4RCAA 4WI0A 3GRWH 4ZO6A 2Y1AA 3GKZA 3QULA 5F6HJ 2C9RA 4Q9QH 5IKCA 2W59A 2NY7L 5L9DH 4LRNL 4O2EB 4GKOA 2VABB 1FVCA 5IWLA 2Z1KA 4U6HA 5DJDB 1W0VB 1ZS8B 5LDUA 2VJXA 3LQZA 4PGDA 3BW9A 4Z7VB 4A7TA 1BFVH 1FZMA 1FDLL 4W6WB 1V10A 3HG2A 1XGZA 4ATWA 4TYUA 5CO1A 5IQMA 2XV0A 3OZ9H 1ECZA 4JZNB 4G82A 3EOBA 3SCMB 4YDNA 1DJYA 5HGHB 3F7VB 4YHPA 4YDMA 4NQDD 3SHSA 4W9EC 3FUKA 4H88H 2JB6B 3ILQC 3CV5A 3TN0C 3O3BA 4PJ5E 4XPGL 5CLWA 3D4YA 4OCWH 5EEUA 2WNWA 1JVKA 4WUUA 3A21A 5CWSB 1JV2A 5HGBA 1V54B 2HPTA 2DKMA 4XVUC 2XFGB 4BH7B 4D0DB 3QJUB 3C9NA 1O75A 2QSTA 3FQXB 2DAVA 5D7HA 2BCKA 5KG9B 3MV7D 2CDEB 1PG7W 1XH0A 4X5RA 2UZXB 1NGXA 1R17A 2J25A 3QIUD 3B7YA 2EXWC 1WFJA 2XPYA 1GOGA 1NM4A 2H0EA 2YZ1A 1E6JH 3LZOA 5C08D 3QT2A 2DQEL 5I1IH 3FSZA 4CGUB 3D08A 1NAMB 3EYUL 2FEDC 1BX2B 3V5DA 1O9WA 3HFML 3UMTA 1FZJA 4FLOA 5IW6A 4G8FA 4ZQKA 3DGDA 4HYTB 1DQVA 1JUFA 4FP8H 3BWAB 5ALBL 3B9VA 4TL4A 3L3IA 4YHOH 5C0BE 3DGGB 2J1WA 4KMQA 3UBXA 3JV0A 5FM8A 2ZJSL 4XZUA 3VD9A 1S7RA 1MHPH 3DJZA 5IW1A 3TCLB 1RL1A 4PYGA 4YSEA 3AADB 1AANA 5JOPE 1WJ3A 3B7RL 1U8MB 1LVEA 3VI3E 4O02A 4XN1A 5HP5A 4XWOC 4RZKA 3UO1H 1EGJH 3FU3A 5ENWB 3IEAA 3RZWA 1AG6A 2J4WL 4MD5B 4XX1G 3TIEA 1BEYH 1OGSA 4X8GA 5GGSA 3FN3A 1QSFD 2O5XL 3ZE1E 4XMWA 4MAUL 4NB7A 1FE8H 3BSHA 2R1XB 4UTBH 4ZD3L 1O7SA 5G4MA 1ZS2A 2CO2A 2HG5A 2Y22A 1W16A 4Z7UE 1EHXA 1ZVNA 1TTRA 3EDFA 3OAZK 3RWJB 1T0NA 1M42A 4PEEA 2DL9A 3MLRL 1HWHB 4DEPC 2JJSC 2FIKA 1OGAE 2VZOA 3KPRD 3NYKA 3WUWB 3MXVL 3NCBB 4WWOA 4S0TD 1BQSA 4D9QD 3MRJA 3LS4L 1KPUA 4TPRH 1R24A 1OAXL 3CIAA 3GMMA 4PD4J 3BPLB 3BEVA 2XYCA 2E3VA 4Y4HC 1ZLEA 4E36A 1QPPA 3N9GH 2QELA 3I75B 3FNKA 5BRQA 3R4DA 4X4ZA 1KV7A 2IXQB 3KBFA 3MRHB 3BIBX 1A14L 5DVLA 1JPFA 1QFPA 3X1GA 2EE3A 5IVXF 3QFJB 2QQQA 3ESVF 5D7LD 2B0SH 3IGFA 4BFIB 5KYXB 1KFAH 1JXDA 2G2NA 4P4RA 3FCUB 3NAAH 4LE8A 1JSYA 3QQ4B 1QPXA 2EP6A 3KL3A 4EEEA 2YOAA 3EXJA 5A2KH 1J8HD 1EDYA 4OCSL 4KH9A 2WAQA 4P2RD 3QNZB 4HGWB 3S4SG 3OHXA 2EVHA 4B7LA 1MWAL 4PJEF 3C5ZB 3LRSB 4I5BB 4MZ3A 4FTVE 4YC2B 3OB0K 1PLCA 3CVHL 3KPMA 3B2MA 4AE1A 3OAZH 2IPKB 3CXDH 2XTJB 3LPFA 3T0AA 4JFYA 4YJZL 3SJVB 3BDXA 3CVIH 2GIMA 1CDCA 2CHXA 2PW1A 3MTRA 1F86A 4LKXB 4S1SH 1YPZE 2YQ2A 3DTDA 3KWWB 4HIHA 4XBEH 5EBGA 5ICYA 3C6LB 2VNCA 2CK0L 5JIIA 1XCTA 2P7TA 4KO5A 1TFHA 3S3CB 4X99A 1DR9A 2F54B 1FP5A 3T4AB 4B9GA 3CH1B 2OTPA 4H1LB 4N5UA 4V33A 3W9DB 4F37K 4BFGA 3C5XA 4JFHD 1MLBA 3MBXL 5KS9E 3ENEA 1S7QB 5KN5B 5IK3A 4K9EL 4L18A 2GB2A 4KY2A 5INDA 4I0PB 3MCLL 1RUMH 3HN8A 2VC2L 4JFDD 5D7JC 3IAPA 2APXA 4MAYA 4XNUH 3SQOH 5A2LH 1IGFL 1E8ZA 4PUBH 2WXOA 1L3WA 3GZOA 1E7VA 4FYQA 4NQCD 4NKIL 3VFUA 5FW8A 1AP2A 2A6JB 1I8KA 3QIWD 1LEGB 4KHTL 3I3EA 3FTYA 4F33A 5ITBH 3VXSD 4NJ9L 4K9JA 1L7IL 3AS0A 3M1OA 5CJXC 3ZLQC 2RFXA 3UC2A 4Y5XC 2ICEA 3BKJL 2HWZH 4YVUA 3MACH 2VQUA 1N68A 2CD0A 2YA0A 1U8LA 3ZTEA 3OB0H 1R34A 1UD8A 1WCBB 3ZDXB 1JZDC 2X3CA 4Z7VE 5GS0L 5TDOB 4XWGL 2FJGB 2Y9RT 4X6BA 3ARWA 4DFIA 4NPYA 4BIKA 4JFOB 1ZAGA 5TQ0L 3VRJB 2QBWA 3C5SB 4X8CA 5J1AA 1JGLH 3QP3A 2BIPA 4OTXL 1JNHA 1H15B 1AMXA 4K94C 3DHPA 3MOBH 4PM1A 4OZIB 4Y16C 3DKHA 1N6UA 2NR6A 4HDIB 1NMBL 3GFUA 5KYWB 1BF8A 2R4SH 4OBRA 4FA6A 5DHXB 5I1KH 3RB7A 2GT9A 5KYNA 1JHKL 3L9RB 2EUWA 4YWGL 1UA6H 2ZX9A 3CMGA 1I4FB 4ZAKB 3NTCL 1S5HB 1WVZA 3BEWA 5C0AD 2ICES 2E4TA 2C7UB 3LKOA 4F8PA 1KCWA 2VR3A 4G83A 3T2PA 1JFQH 3P73A 3T1WA 2ZOKB 5I75B 4CVWA 5B3NA 2WLZA 4PI0A 3UTTD 2ZKMX 5DJYB 3PE9A 3WENA 1T7ZA 3IGAB 1TETL 4HFUL 3FXIC 3RNKB 1TZGL 1AQKL 4P5TD 4IU2A 1OSYA 1EEZB 2OR9H 4JFEA 4QYAA 3L4YA 3S88L 1RZKL 2IAMC 1ZT4A 4OZGF 3TEYA 3R06B 4ZUWB 5K39A 4N0CC 1JAEA 1KOAA 4G1MB 4AUJA 4YBQD 1R3HB 3NFPB 2ZIDA 8PAZA 1LEGA 5BV7B 2HXAA 2FATH 4NXKA 1BXUA 3WXWH 1T4WA 3T04D 3I6LD 4HF5H 2C34A 5FKAA 2ZOLB 1BVLA 3EDJA 3LKSB 1BQLH 3QNYA 4IYKA 4DKTA 2CUAA 2J7LA 3QDGA 2Q76A 4QO1A 2CO4A 4KKPA 3RWEA 1EX0A 3CE1A 3D34A 3FRUA 3VE0B 2IQAA 2ADJA 4BFFA 4MMXC 4BGLA 1AACA 4APQB 4JFOA 1WD8A 3MZGB 4FQ1L 3B56A 2NUTB 2YO3A 1RZGA 3Q5OA 3NZSA 3WFDL 1D9KA 2GIXA 4PRAB 1IMHC 3OPZL 3UJJL 1OLLA 2VL5B 5KWYC 3O6FD 3B6SA 1DZ0A 1E8XA 4N8VB 2P5WD 4Y4FC 2DJUA 2VLRD 2XN9D 4BSWB 4YGAB 4RX4A 4BK4A 5SWQA 4MMZA 4JREC 2AKRB 2BVTA 5ANHA 1GC1H 3P9LA 4M48H 4HD5A 3TBYB 1RUQH 2ZYIA 3VFPB 4XHQA 2OTWB 2DH2A 4M1CC 2C7UA 1ITCA 3GTVA 3NA9H 4QUOA 5T1LB 4WNJA 3V0EA 1TTCA 2ODHA 2EC8A 1EHKB 3BVTA 3N50A 4Y1TA 1UD3A 2WWKO 1JK9A 3H9SD 3V9FA 3H9YA 6FABH 2KQMA 4MMYA 1ZE3C 3G04A 1A4JA 1B4TA 4A2EA 2HLFC 1FGVL 4JZOB 3WEXB 3BGFB 3MSPA 2JQAA 3QFJE 3ZL2A 3A23A 3EUDA 4P23C 1S3KL 2OXHA 2MOQA 3WNKA 3PNRB 3DSNA 4ZMVA 1HZLA 5E1HB 5CBAA 3QAQA 2AJUL 3H6AA 3O45B 4AV0A 1HHHA 4X8JB 3PXHA 4IHOB 2UWEA 2EVJA 2X4UA 2FJHB 5E8DL 1KBWA 2PR4L 1QNZL 3NQIA 1AMYA 4QEGA 3MRDB 5C0RH 5FYJD 3EGDB 1FL6A 3AMLA 4KQ3H 1YEJL 3HMXA 1KYOJ 3IDXL 3HCVA 3KYNA 4Y19B 5E9AA 3GK8H 3HZYA 4P4KD 2WZPD 2XTJE 3T6XA 1PLBA 1KCVL 5IJKC 3BDBA 3GBNH 2N1KA 3IDJA 2NZ9D 3OKNA 4HS3B 1QFUL 5DA0B 5TH2B 4WO0A 3HBQA 2WY3B 4LSVL 1F4HA 2XQBH 3QYCA 1B0IA 2QVFB 2ZXWB 4XE0A 2HJFB 1H8OA 4OSUL 4G8GA 1CCZA 2Z35B 3ULVE 2ED9A 1GGBH 4LP8A 4S1DC 1YNKH 1HN1A 1MI5D 2GEEA 4HK3N 4PJGF 4OGZA 4RMBA 4I18A 2CO7A 1IC4L 4XI5D 2NYKA 4N20A 4TVPH 5KJ4A 2GJPA 1IKOP 3VFRA 5J1SC 3U36A 4JFEE 3DJRA 3U9WA 5AVXB 2A38A 2A0LD 2DM3A 2BOBB 2QQLH 4M43H 2R56H 3ZHDA 1U8QA 4ODSL 1WEJH 1IGML 5JXED 1HEZB 3UAJA 1CFVL 3MJ8B 5K1VA 1FG2A 4Z3IA 4GIAA 1BBJA 1K4CA 4GBXB 3DO7A 5JOEA 1OM9A 1BFOA 1DJXA 4LLDA 2GBAA 4ODTL 2O4EA 1I3GH 5EORL 3V6ZB 2HT3D 3VXNA 1SOKA 1IB5A 1NBVH 2A6KA 3RWHA 3WAKA 3QB7C 1J5HA 2AQSA 2IWFA 1XCQA 4NQSA 4YEEA 1Z5LB 3ZT7A 1BP3B 2WNKA 2NYYC 3JVGA 3FCSA 1OGTA 1RP8A 3UP1A 3NJHA 3NVQA 3VMPA 1YEKL 4GRWB 3IDIB 2HRPL 4WF7A 1G7PA 5LXGL 5CP3A 1DQIA 5DI8B 3TWYA 3IU3A 2VTFA 4DCQB 2AQRA 3PGFH 4HJ0D 1OF0A 3UG5A 3OKOA 1BVKA 3DX9B 3KH4A 3RVUC 4OZIE 1SBSH 2P26A 5E1AA 1A7RL 3HE6D 4QRBA 2E8YA 1EZVY 2EDTA 4UTAH 1ADWA 5BO1H 2K6WA 3VG9B 4W68A 4W4OA 3NP4A 3V5HB 2P43B 4FTDA 4IRSC 2J8OA 3WD5L 3ZMEA 4QHUB 1FFNB 4FMFA 4AYBA 1YNLL 3IXAB 4IJ3B 1NEUA 3GXIA 4UAOC 1BMGA 5AL8A 3S98A 1RIUL 4OBSA 3HI6H 2X70A 3QJZA 1AKJD 4IRZL 4O2CA 4UUJB 3T4YB 4EMZA 4YX2H 1I7UB 3S37L 4TF4A 2W0FA 1X4ZA 4Z0XA 3CFNA 4FFYL 1A7OL 4HWZA 2FECL 4WU7B 3QZOA 1A22B 1TYEB 1U8PB 5DDHA 3JWOL 3N41F 4XMLL 1DQDH 5IB5B 3UTSD 5C70A 5JHMA 4L5FE 1E5ZA 1TNMA 2GITB 4IIZA 4TUKH 2HT2D 1C9SA 3O6KL 4PTTB 1ICTA 1V5JA 5HI3C 5BCAA 3BT0A 3N44B 2G3ZA 5T5FH 4WAFA 3VFGH 1TENA 3L3DB 4QCIA 4FNLH 4OZFA 5DQ9A 5BOZG 3WBDA 1NMCC 1IV8A 5EUKB 3MJ9A 3X3GL 1TU2A 3BSZL 5FHAH 1PSKH 4XP1L 3LZFH 5KJRL 5JLZB 2AJ3B 3ZYZA 5L4FA 1GY2A 25C8L 3VWJB 1ZHKB 2TRYA 4LEOA 4RFOH 2CLZA 4XCNB 1E9QB 4RA0C 1DCLA 2BP8B 3P69A 1HIML 5AVYB 3CWGA 2KPWA 2IALB 3V5HA 5DJZA 1JHTB 3UZEC 2PTTB 2ZAGA 4JG0H 1ITBB 1CDIA 4PIBA 5AW9B 1JD7A 4LSTL 2PYED 1IBFA 2CU9A 2MCG1 4FQIL 1YQVH 1MRCH 3IF1A 3UJIH 3BKML 2W9DL 2FNBA 3JV6B 1PJWA 4LCIH 4YNYA 5JIQA 4Y5VB 3MBWA 4GW4B 5F9JB 2EE0A 2YUZA 3BPNC 1H9DA 1TQBB 3M7FB 1CTOA 1A0QH 3BUYB 1B0WA 4ONGH 2TSBA 2CGZA 5ICZA 4OLVH 2QZQA 1WC7B 4N2LA 4TUOB 4XPAH 1KIQB 3MRRB 2VWEE 4U1JA 1AE6L 1ZXQA 3D07A 3FZUD 3NA4A 5FGRA 4OVUA 2HTLC 5HHPB 1ZIAA 3FRPA 2A6DA 1LEKB 3GDCA 4QKXB 1U33A 1Q1JH 3LRMA 2Q3XA 2X4OB 5GRWA 1DBBL 4Z18A 4B9ZA 5DT1H 3ZL1A 4XODA 1JI1A 1CMOA 1HKLH 1EXUB 4MDJA 4E2OA 4X7DC 3BP5A 1KBGL 4NZJA 4Y19E 1NDTA 1VIWA 4WI6A 1ED3A 5DRWB 3UPRB 1G9HA 2I69A 2OS7A 5I1JL 5I6PA 5CJQH 3QRBA 4X9YA 4PN6A 2K1MA 1MHHB 2XT1B 1FFOA 4G43B 4KK5D 4RGMB 4HUCA 4Q2ZB 5I6NA 3QVAA 1RIHL 4Y2DB 5AL0A 2LQRA 3L3JB 3QQ9D 1MXDA 2PWFA 2X6CA 4HGMA 3H6JA 4IDJH 4PSPA 4KXAA 5FYKD 2VERN 2G75A 2G2RA 2IFFH 3Q48A 2R15A 1U3NA 4W9ZA 1INQA 5DYOB 4NHUB 3Q5TA 2B4CL 4R26L 1GL4B 5DEFB 1T5WB 2EEXA 3FQ4A 5LG1A 3TGXA 3PHOB 5DK3A 4XMKL 5DZ9A 4OCYH 2FWSA 4EI5B 2AF2A 4JDTL 4K8RD 1JPGA 1T5XB 1I9JH 3RZCD 3QEQD 4G9FD 3BAJA 4OFYA 3S9DB 5CFHA 1AQMA 1QEWA 2AQ2A 2G0LA 1IGTB 2AEQL 4OD1H 2HH0H 1KELL 1VENA 3HBPA 3OHMB 2VO8A 5AUMA 1KIRB 1AZZC 1YEIL 5I8EB 2ZE0A 2ZCHL 5GGQL 5L6YL 2MCAA 5GSVB 1TJMA 5I9QC 3II1A 3W82A 5A2BA 1N26A 1RHHA 2M2DA 4PWKA 2QPEB 1MUJB 4LBAA 4HWBH 4GRWE 4JR9L 3WEOA 3RDJA 1XF3B 3DOIA 1Q0YH 2HJKA 1WUNT 4MJ5A 5ISZD 3L3KA 3W0WA 4LSSH 1MCWW 2WN3A 4HUKB 1NCOA 1UATA 2ITCA 2A1WL 1NCCH 2CBPA 3CH8A 3U7YL 3VDBA 5BPPA 2DB8A 1DHKA 4ZSOA 3MNZB 3TESA 5K9OB 4PV9B 4G43A 5A16A 2OX5B 1NIBA 1PZUB 1XH3B 4IOFC 1KGCE 5AW4B 3CZEA 1DLHB 2VDML 3IFPB 4NO2B 3TO4D 4IGBB 5D7IB 3MN8A 4P9MH 2X4SA 4YHNB 3C5ZC 5KSBA 3U46A 3WS3A 1T21B 4YC2C 2OYKA 4G3YL 1BAGA 1H3UA 1BM3L 1ORSB 1WA2X 2IC2A 5D6CA 2A9ML 4OZGB 3WLWC 4QOKD 2XTJC 3ALWA 3WTVA 3BPCA 4P2OB 5DEFA 2NY4C 1ZWIA 2DMKA 3IU4H 1W72A 3G5VA 3SY0A 3STZB 2NQ3A 3PP3K 1X9RA 1KF9B 5HI4C 5ECJE 2OQJA 3C6LC 1JS4A 3TBWB 3C75A 1WP6A 5JA8B 3T4AC 3OJ2C 4QHLA 3CN1A 2C8NA 4ZFGL 3D2UA 3IDMB 2VUYA 2P28B 1JTTA 3O4LA 2JJWA 4ODXA 1SYVA 5GGSY 3RIFK 5ACMA 4P2QA 4KJPC 2QADB 1FYHB 4QNPE 1E4XI 4AYMC 1JDDA 4Q6YA 3WAJA 1ZHNB 1MFDH 2J56A 5C3LD 1QFWH 4AT6B 1OAQL 3QHFL 4I7ZC 4K5LA 2UVEA 4PFEA 1WZ1L 4AK1A 5J5EA 3AGWA 3IFLH 4OM1L 4U6XA 4BK5A 2XBZA 4YAQB 4FKEA 4F80A 1XGTA 4H8UA 2EDMA 3EO0B 1XF5B 4PG2A 1KTJA 3G9AB 3GJEA 2KUTA 4TQIA 5FB8B 3M1BA 4EKJA 2VMDA 4A6YA 5BVPH 2H45A 4QRTB 5ABAA 3FYIB 3MRCB 5F9WB 1BD2D 4F15B 3MI6A 5E6YA 2DQJL 4UTCA 2NCMA 5EBLB 5PAZA 5IVZB 4X6EA 3EOAA 3BZ5A 3TBTB 4LHUB 1MFEH 3SDAB 1DLHA 2XTLA 2EVGA 3F6LA 3LPGA 5GQBA 1LK3H 1INEL 4R97B 2VDNH 1DZBA 1T21A 1CFNA 3BHBA 3OZKA 3KLAA 3BO8A 1RU9H 1MCIA 3KCPB 3QR1A 4AM0Q 4WWKB 4OIAA 3NK4A 1HH9A 1JZGA 2DLFL 1YY9C 1A6ZB 2X4QB 3CFEA 4JFFA 1UB5A 3RI5F 3V4PL 2FLRT 4HEPA 4P0DA 1IJNA 1CXHA 2HZHA 4Z7NB 3LNHA 1OD7A 3IK2A 4EXKA 1J18A 1PY4A 3MRQB 5AZEL 1WG3A 3ZPDA 4CVUA 2WXGA 4LLQA 4AKQA 4NZUL 2HAZA 5C0JB 4PU2A 3EDDA 2QDVA 3NT0A 3DSFH 1MJ7H 1AGFA 1IFHL 1NC4D 3BQUB 2E7HA 2F7PA 3SOTA 3BPOB 3Q8EA 3VH8B 4QXUH 3BUPA 3T8VA 3KCWA 4ZRGA 3UC0H 2DPKA 5L8KB 2HLEB 4Q9QL 5G2NA 4BZ1H 3LRHA 5DK0B 5DK2B 2QPFA 1NPUA 4DK5A 5IFAH 4L29A 2R51A 3VD7A 3WTYA 3C2SA 2AV1A 4NC1E 1F97A 3IMWA 1AFVL 4MTMA 2UXFA 2VW7A 1BFVL 1RZFH 4WEMB 1F13A 3DBSA 3ZTNH 1L7TH 4IBSA 4NP9A 5IF0A 3DYPA 4QXGL 3IKCA 5KSBE 3MV11 2BW4A 2Q87A 4H88L 3U0PA 3VGAB 4J27A 4APQC 3C6SA 4H44C 1I1FA 4P2AA 1TQWA 2QQKL 5DVOA 3TM6A 1KXQE 3MRIA 1RERA 4ONHB 3WGVB 4WNQA 1P7QA 4D94A 4EZLA 2WMPA 4JN1H 3T71A 1KTCA 2BSTB 1QR4A 5JZ7D 2PTVA 3P3SA 3U6XA 4L37B 1FH2A 2DWYA 3PUCA 4QRPD 4KTEH 1AR1D 4X6DA 4R7VA 5EOTB 5J9PA 2ZOTA 1MCPH 2NY5C 1DBAH 3EFOB 3OMAB 1VACB 5J6GB 3N55A 2WLKA 1HXKA 3GSNA 5CP7B 4XNDA 2EDNA 5IMMB 2NQCA 2A4EA 4W6YB 2BOLA 4L8SA 4KKCC 4NRZA 3L4ZA 3S6CA 3IMVA 1E6JL 3LVEA 2UZPA 5EF3A 1EJOH 4OF8A 1DFBH 4OI7A 2LLNA 3VQLA 1SXNA 4XCCH 4TMPA 1RJYA 1XAUA 2W60A 1HCYA 1ADQH 4W93A 4OJFL 1F41A 1R33A 4FP8L 4U3SB 2W95A 5BRPA 1RUKH 3EGSB 2AVGA 2GJ6A 3AREA 4YHOL 5HXMA 1JK8A 2C4FT 1SY6L 4PJ8B 1TCRB 2UZYA 2XXCB 4WK4B 2XWRA 5E00B 1MHPL 4JM4L 3T0WA 2BERA 1XD0A 1DQJB 4X4ME 5KBDA 1QHOA 4YPGB 1I8IB 4KAQH 5FUCC 2OFQA 2AQNA 4IU3B 5D2LA 2X12A 5HI5D 3CDFA 3CG8A 4ZZFA 5I30H 4MYPA 2R9HC 4APXA 5D7IE 1BEYL 4KJQC 4LQFL 3W38A 3D5OF 2EO1A 3S7GA 4GAJH 5CN1A 3U1PA 3GSWB 1FE8L 5H4ZA 4U1LB 3ISYA 4WO4A 3TJHC 4HD9A 2DLTA 1WHOA 3K2IA 3NZHL 1M05A 3MUJA 2BZCA 1MRFH 2LABA 5F7FA 1LO4H 3CIQA 2L7JA 5TE4L 5JW4N 1K5NB 1SGKA 2WM0A 4KJYA 3DUSA 4HG4K 2R1YA 4QRAA 1CG9B 2NQDA 3SDXA 4OKVB 3D39A 1R3IH 4TPRL 5EIIG 2RQEA 1UZGA 1C5DB 1OT1A 1M9SA 3APFA 4J3VA 4R2GD 5CP7A 3QEHB 4MXQC 4XCEA 4I9XA 3SDYL 5AVTB 1MXGA 4N2MA 5E8NB 3ULVF 1WIUA 1MFAL 1RVFL 2WCSA 4F2MB 1WPCA 2OZNA 3LQAH 3OJVC 3MNWB 1BOGB 3UYOD 4ORZC 3L3HB 2B0SL 1OPOA 3NMEA 1XFPA 2VSCA 2QHLA 2VITA 4NRYB 4F9PC 3H53A 4K94H 1SRDA 1A6TA 4EIZC 3KR3L 5CKGA 1KFAL 3LMJL 3Q44A 1QMUA 4K3EL 4Y9GA 1QFOA 5ESQB 5KAQF 2DRUA 3GO1H 1WLHA 3ZR5A 4LBEA 3D52A 4TUJB 1UACH 2H26B 3IJEA 3PGCA 4QHMA 3QNFA 5DRXB 4DZBB 4EAEA 3RKDD 4NO5B 5DS2A 4I0KA 2XICA 2E9IA 2PPAA 1Y0LA 5H4YA 3KXFB 3RJDA 3SBWC 1JMXA 1KGYE 2BPBA 3CXDL 5J1TC 2JF1A 3QWRD 1L9NA 2ORBH 1UA7A 5C3TA 4PJDA 3CVIL 4B5EA 5IFJA 5FCUH 4Z7OF 5EZPA 4S1SL 4FI6A 4J6IA 3F62A 3KAAA 4XBEL 1M7IA 4NQEB 2XZCH 2FWLB 3N1MC 4AYGA 5KVEL 5LUMA 3MV8A 1DDHA 3GKWH 2UXGA 3VXPB 3OXRB 3J8F7 4JHUA 2Y7QB 4Z7NE 1HWWA 4UINH 1RZQA 2GSIA 2X1PA 1RXLA 5I1DB 5E2JA 5IROD 4OI8A 4FCHA 3TYFB 1RUML 2AK1L 4IJ3C 2GHZA 3ARBA 4XNUL 3SQOL 1JVLA 2RR3A 3QPQC 3D3VB 2V3FA 1HEHC 3LKRA 4CU8A 1IM3D 4PJ9D 5JW4R 1D6EA 3C60D 1A65A 2WLLA 5EO9A 3WJMB 1UT2A 2NY3B 5MEPB 5ITBL 5A3IC 3QUZA 2VDRB 5DSCB 3ZU8A 3NCMA 2HWZL 2ZKHH 3GMPB 3WJJA 3RVTD 2ADGB 1BVZA 4JPKL 4NUGH 4KDVA 2DWSA 4MSWA 3JZ7A 5IMKB 3GLAA 2AJVL 1RZPA 4FKKA 4JDZA 1HHIA 3KGRA 4NUJA 2R69A 4JFZH 2OW6A 3D0VA 5SWZB 4XN5A 5IESL 5CGMA 2NCEA 5EZIH 5JR1H 5IR1B 4OQTA 3E9TA 3R0MA 3ARFC 1ZGLP 3HC3L 4W9GC 2DQHH 2UWEF 3SDCC 3LKQB 2P5EA 4F58H 1UJTA 1M3IA 3TBCA 5E2UH 2N1TE 2R4SL 3WDHA 5I28A 3GJFA 5BS0D 3U4EA 5B38B 4MX7A 4C58B 3C6EA 2OKMA 3BCDA 2OMTA 1M6OA 4GAYA 4JM2B 4WI9A 1EBPA 3INOA 4NQEA 1Q0XH 2CZNA 5IEKA 1X5XA 1JFQL 1H8LA 2N4IA 4JCLA 5DRNB 4FLQA 4ZO7A 1PF3A 5C09D 5KW9L 1DDTA 2F7OA 4FQ2L 3EGXA 5JHDB 2WO3B 2CIIB 5KSAC 4N2NA 2QZ5A 1QLFA 1QRKA 4NN5B 3KYMB 2FBOJ 4AMKH 1SJHB 3U2IA 4FQHB 3VW3L 2OR9L 4Q4EA 1VDGA 3F2LA 1ZVSA 4OCXL 2L4OA 2X40A 2VDQH 3BXNA 4GRLD 5C07A 3SKNA 3CX5K 4HPOH 2WQSA 1DEEB 1QX1A 4Q52A 4N28A 1A4BA 4U7SA 3QG6A 3MLZH 3IS0X 3WXWL 3FO9B 4HF5L 1QW9A 1YY8A 1BQLL 1RSFA 4JQXC 1NUDA 1XGPA 1YCSA 3QCUH 5LB1A 4L4TB 3RU8H 4M7JH 4TQEL 4FQCL 4GAFB 5AOJA 3JZYA 2BSRA 3ALPA 2CUMA 3TZVD 43C9B 5HDLA 1PZ5A 2D31B 3VXRB 4MXWL 2YD9A 4OV5A 1MW0A 3JV4B 3JWDH 1KG0A 3LX9A 4RAVA 3V0AC 2BOCB 4AYFA 4NO3B 5DURD 3ZDZB 5IT2H 2ESVA 4MD0B 3MV8E 5DJCB 4AITA 4NC1C 5SX5K 4HV8A 3DPDA 3U0TA 4K5PA 5FKPB 4LPUA 3EBAA 4FNPA 4M48L 2BLFA 2OP4H 1RUQL 1SFHA 4W9IC 4CMHC 1KN4H 1M2VA 2OCJA 4JCWA 4MA1C 4XMTA 1VKXB 3NA9L 4NKMB 4NFBA 1UVQA 1PBYA 3SO5A 3PABA 3VDCA 1AXSA 5GHWH 2AI0H 1AGBA 1SUHA 1WTLA 2Y7LA 4ZODA 5F3FA 5FA3B 3T6ZA 1MJ8H 4UIKH 5B3JF 6FABL 3WEBA 1P84K 3TOPA 2E7CA 4FMVA 1MCKA 2X2HA 1T1WB 1A3LL 4JJ5B 4OUUA 3PL6D 4IKJA 4EI5C 4KVPA 4XGZB 2EDLA 1TVHB 4GXUM 3I3BA 5JMRA 4AYEC 1DEEA 4M1GH 4PRNB 4LRIA 4S2SB 1U3JA 2AXGA 4JAMB 1CD1B 5INCA 1BM7A 1TPXC 1D7DA 5KYUA 3FO1B 3VFWA 1E2VA 3EG9A 1QI3A 2C9QA 4ZMWA 1VLXA 5F7UA 4FQQB 3FW6A 3TIDA 3PWPB 3QI9D 1MCQA 4OLXL 5JXAL 3QUKA 3MFFB 3KXFE 5DQJA 2CBOA 4EI6B 3GSOA 4ZUVB 4MKTA 1ONQA 1WFIA 4M7LT 4YSRA 3FU7A 5DUJA 1ZV2A 2VXTH 2AEOA 3ATBA 4JHZA 3V0GA 5JIDA 3HZKB 4P46D 3FUIA 1QLEB 4NQDA 3UPCA 4BSVB 1GKOA 3S37X 2XWDA 1R3JB 2NY5L 2ATKA 2WTRB 3CN2A 4XH2B 3RUGF 3K4AA 3JV4A 2XQBL 4NQEE 2ADIB 5IIEB 3UEZA 3PIQA 1OCOB 4U1HA 3IAQA 4YXLH 2NDGA 1GGBL 2QPUA 4JHWH 1YNKL 4GQ9H 4MNQB 1CB4A 4WKXA 4TLKA 4JKKA 5JDSA 5AB1A 4C55A 4TVPL 3OG6B 3MV7A 4JANB 3HG3A 4RGNB 4E9TA 3B2UD 3VXUB 3QIUA 1LO2H 2FJFB 3D3VE 4LVOB 4OD2A 4XT1C 1IM9B 2QQLL 4KU1A 1MHCA 2PO6D 1ILUA 4CVZB 2R56L 4JZJC 5LGJB 1WEJL 4TNWK 4ELMA 2OR8A 3ZJAA 5C08A 1NDGB 1IIIA 5I1AA 1HHKB 1CLYH 3O41B 1H3XA 2FQEA 2XZZA 3DJ9A 3FONB 4P2OC 4TTDC 1CQKA 5FX3A 5I76B 1I1CA 2LLGA 1I3GL 1G7HB 5JPNC 3F7RA 1Z32X 4IOIB 4FADA 7CGTA 1NAKH 2BRQA 1XBRA 1NBVL 5IY5B 3Q2VA 1A66A 1HNGA 1F11A 3BLKA 3DJSA 3QPXL 4LNRA 1J0KA 5DR5L 4BFRA 2Z7WA 4LCUB 2DQGH 3P4NB 1DQKA 1F6LL 3SQBB 3AMKA 3VD2A 4P5MB 3ZDWA 1Q72H 3MTXA 2VDOL 2VLJD 5SWZE 1SDAB 3G6JB 4O02H 1LWHA 3AU1A 3PGFL 1GS8A 2H7WA 3EJCA 2C1OB 4M61B 5CLTA 2FGWL 4LPXA 1XF2B 2B9BA 4TSCH 1SBSL 1TCMA 1WBYB 1IBYA 1JF5A 4ADJA 1RJLB 1QSFA 2X0WA 3AS2A 4ZW5A 3G6AA 5BO1L 4G6KH 4YDJB 5TDNA 3S4SB 3ZW3A 3VFNA 3BLBA 1T1ZB 3WGUB 2OK0H 2HFEA 3OM3B 4KHXH 3GDBA 1A4KB 5GRYA 2C1PA 5DLLA 1IEAA 2XOTA 4I48A 4NN7C 4JMNA 3PWLB 2M1KA 3HI6L 4TRPH 3KPRA 4WI3A 5F9WC 5TFSH 2AEWA 3KM2A 2UY6A 5IB1A 1GZPB 3RVVD 4AYDC 3LJ3A 2DD8H 2DKUA 4BRVA 4JFDB 4RETB 1XGRB 1HTYA 3MYJB 1D5BA 5JHDE 3SDAC 1ND0B 3QR0A 3WJLA 4OJEH 5DD1L 2ENPA 2WTPA 3QCTH 5CEYA 3FQRB 1AS6A 3QORB 1S9KC 4R97C 2CLVB 3UDWA 4OFKA 4AEIH 1IBGH 2Z4QA 4KV5F 3TBSA 1TJGH 1CGTA 4NQCB 2JWYA 4Y2NA 5FDYA 4OU3A 1N4XL 1S8DB 1FZKB 1XWVA 4P49A 4MYWB 4WWKC 4TUKL 5DD6A 3T0EC 4JKNA 1YA5A 2FO4B 4LLYB 1D5XB 2FVNA 5D7LA 2OXGB 2C9XA 3O3EA 1KBPA 2EYSA 4GI6A 4ZBJA 4JY5L 5T5FL 3VFGL 4LCWD 2ZXCA 3GI8H 3T1FA 2DQFB 3KVQA 5F3HA 5GIRB 4Z77B 2A74C 5IQ9A 4H26B 1DUZB 4QXTB 4ISVA 2ADYA 3VDAA 4WTZG 2E74C 2JH2A 2VDPB 4L4TE 1J8HA 1GIGL 4P2RA 1P2CB 3TX4A 1FFPA 3BQUC 4KX9A 1NGYB 3LY6A 5IB4B 4NENA 1QLRA 3LH8A 1JOIA 4N2EA 3FAXA 2FBJH 3F83A 3QUXD 5FHAL 1PSKL 3MLVH 1R3LB 1N64L 3VXRE 3X2QB 2R83A 1LM8V 5F96H 4RFOL 1Z6JT 1HNYA 1NDMA 4GXFA 5ILTH 1AC0A 3ZDZE 3RG1C 3K6FA 3OSKA 4L1DA 2ARWA 3GI9L 2CO6B 1QABA 1Q94B 4MVBD 4PJHA 5GRZA 3ME0A 3UZQB 2B20A 3AWFA 3VTTA 2VMFA 4YE4L 4QTHA 5TQ2L 1JMZA 2Y07H 2G5BB 1YQVL 2AQ3A 4PLJC 3DX7A 3UJIL 2JI2A 2FB4H 4NQQA 4EQ3A 1J9RA 1CXLA 1E42A 4LCIL 2YN3A 4RSVA 3GMQA 4M5YH 1RK1A 2X09A 4JFDA 1A4AA 1EHNA 1UG9A 1XGRA 4ODUA 4PJFB 4J3OF 5F7BA 3ERXA 3CDZA 4HC1H 2O5YH 2ETWA 2OMZB 3WFHA 2CHWA 2V2WA 4X6FA 4ONGL 2ZOWA 4OT1L 3TVMB 5KSBF 1R4XA 2FHFA 3S36H 4NQCA 3H2WA 4OLVL 1XQ4A 1U21A 2Z7ZA 3CXFA 1FZKA 1KB5B 3QIWA 4H8VA 1ZV5A 4XPAL 5AYUH 2I07A 3QXUA 5H35B 3LYRA 3VXSA 3GGWA 1QVOA 3VX1A 4GIOA 2FO4A 4LVHB 3A47A 2V8MA 2D2OA 5FA4B 5D1QC 2Y2TA 3P4OB 5HDOA 4F7TA 5BO0D 1Q1JL 4D8PB 5CNHA 4XMXA 3KBPA 1Y18A 1X9QA 2M83A 4Q89A 2VDLB 4JL2A 1V3KA 1U6AH 2X2IA 5CGYC 3BKYL 3PWPE 4XP6H 5DT1L 3B1UA 3BE1L 2YBRA 5EZJA 3ILQD 5EO0B 3BVXA 3ES6B 3TN0D 1QTSA 3HZMB 2L8AA 1P7HL 1XH2A 2COVD 5DHEA 3KWUA 1P7KB 4Y4KD 5IB4A 1IEHA 1QHPA 3OMZA 5C0DA 4LEXL 4PY8J 4F7PB 5D1ZI 1HH6B 4OF5A 5CJQL 3DJTA 3SPGA 1QHQA 2HP4A 1R3LA 1UJ3A 2VQ4A 4AXWB 1QZ1A 4XVUD 2I60H 4YR6A 2VLRB 5AZ2L 1AHWB 2Y7MA 3GS4A 3HLAB 2X1XR 2X4PA 3LN5B 4HJGA 1OOAA 4S1RH 2NSMA 3FOMA 1S9XA 4FRWA 4IDJL 1M4KA 5EPMB 5C0AA