1NCHA

Structural basis of cell-cell adhesion by cadherins
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
98
Chain Sequence
b'GSDWVIPPINLPENSGPFPQELVRIRSGRDLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-CADHERIN
molecule tags Cell adhesion protein
source organism Mus musculus
publication title Structural basis of cell-cell adhesion by cadherins.
pubmed doi rcsb
total genus 19
structure length 98
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1nchA00
2QVIA 2OMWB 2WHVA 1NCGA 2WCPA 2OMUB 3LNHA 4XXWA 2A4EA 4QD2E 5DZVA 1ZVNA 2WBXA 3Q2LA 2X2UA 2O72A 4XXWC 1Q1PA 4ZI8A 4AQ8C 4ZMZA 2YSTA 4ZMTA 1EDHA 2OMTB 2OMZB 5CO1A 4AXWA 4APXA 3K6IA 3LNDA 4AQEA 4ZMYA 4AQ8A 4ZMPA 2OMXB 4ZMQA 2QVFB 4ZMLA 4ZMWA 1FF5A 4NUQA 5JYLA 4AQEB 4ZMNA 4AXWB 3Q2WA 3K6FA 3K5RA 4AQAB 4OY9A 3FF7A 4ZMVA 1OP4A 3UBHA 5CZRA 3Q2NA 2YQGA 4ZTEA 4AK1A 4ZMOA 1NCHA 3LNFA 1ZXKA 4ZT1A 2V37A 3UBGA 5KJ4A 1WUZA 1WYJA 4AQAA 3MVSA 3UBFA 4NUPA 2WD0A 3K5SA 2OMYB 3LNEA 3LNIA 3Q2VA 1L3WA 4NQQA 4APXB 2EE0A 5JYMA 1O6SB 3K6DA 4NUMA 3QRBA 3PPEA 2OMVB 4ZMXA 3FF8A 1NCIA 1SUHA 3LNGA 2A4CA 1NCJA
chains in the Genus database with same CATH superfamily
1GKEA 5FWRA 5DMYA 3MGTB 1XEDA 4E9QA 2YRBA 1HS6A 1SPDA 3AS1A 3IDMB 2ISDA 3SDXE 1X3DA 1TIUA 3HVDA 5T1KA 3DROA 4LAQL 2GFBA 3JV6A 2DWYA 2XKNA 3AY4A 5J1SC 2JVUA 3F62A 2QSQA 1MZZA 2ZNWA 5I1KH 3HAEA 4DERA 1JF5A 3Q6FA 4TNEA 2CKBH 4MQTB 4U1GB 4MMZB 4UT6A 1E5CA 2WKGA 4XNDA 3CTTA 5CJ8A 1QSFA 2CLZB 2OSXA 1HDMA 1USZA 4H88H 1ZIBA 1NDTA 3GZOA 3UAJD 2TAAA 3Q13A 3ZDXF 1WQVT 4JVPA 5D5MF 4HIQA 2P43B 2CGZA 3UC2A 2ZX5A 4OZFH 4AQEB 5FM8A 1M6UA 1A4BA 1QSZA 1KEML 1TZAA 1RK7A 2Y1ZA 4HIEB 1JDCA 3N9GH 4HDIB 4TVPH 3RAJH 1LL1A 2D7TL 2DQJL 3ZKXB 2ZXQA 2WWNA 2GJ6E 2NXYD 4PBDA 3E2HB 3OAZH 2J1XA 2BP0A 3A4FA 4LCUB 2Q10A 2YD1A 3F5WA 4PJDF 5B7EA 5ICZA 4JW3A 5BVPL 4DPCX 4KHXL 4Y1TA 4HUXA 2WLMA 1I1RA 2J25A 1MJ7L 4ZTEA 3T71A 1N6QL 2FTAA 4CBPA 2E7BA 3EJYC 4EDXB 1NEZG 2E9IA 3IVKA 1IVLA 3MROA 2Q86B 3SZKC 4W9GC 2FX8L 4N8PA 1DDHA 2J88L 1JGEB 1KLUB 1RQ5A 1T5KA 3BKCL 3MV8E 4N5EC 3RY4A 4YDKH 4W68A 5CCJA 3D07A 4OCSL 4YHZL 3OKYA 5I6NA 1HKLL 2V3EA 2AVFA 2HLAB 1TYJA 1NFDF 4W9JC 4UV7L 2UWEE 3NK4A 2FSDA 3HR5A 1ZPLA 1FL3B 3WO4C 2WP3O 4OLXH 2C5DC 2YARA 4L4TD 4FNPA 3ETBJ 2NY0C 5EO0B 2ZCHH 3O2WL 2VRKA 3GPSA 3MLZH 2IAMD 1CJYA 3L2MA 3DTDA 3RUGE 2OSYA 3AREA 5DO8A 4AH2A 3QZNA 5IWLC 1NKGA 1RAMA 3QRBA 3CNKA 4QTIH 2B1HL 1NANI 1FFNA 2XU9A 3AU1B 3PHQA 4LE8A 3V4VL 4MJ5A 4XOEA 4DPBX 4DVBB 5ID0A 1JI2A 3DIDA 3T4YA 4ONOA 4DGIH 4FD0A 4IEFB 2A4CA 4F7MB 5GISH 4HEPA 5EU7E 1QRND 2GBUA 2HN7A 3CPLB 5IHZA 2Z31D 3FT9A 4ACPA 5KVFL 2KH2B 1CFQA 3VDAA 3T6QC 4ZUSA 2WYHA 5A1AA 3QBTB 2A99A 1I1AB 3GSVB 1S2EA 5GHWL 1LEIA 5I1AA 1ZAGA 2N3JA 5GZND 5J9PA 3OJVC 4Z7OF 1IAIM 3NPSB 4B7IA 1RV6X 3DSNB 4X8JB 4FQIL 4I0PC 1TEGA 4TNVF 5D8JH 1BLNA 4YEEA 3ZTEA 5I8CA 4D9LH 5DRZA 4M5YL 2CA4A 5FHAL 5EA0H 2D9CA 4F1ZA 1XCXA 1HX0A 1LEKB 3M7OA 3RWJB 2C34A 4OD2B 3RL1A 2YK1H 5I1LA 1AG0A 4JO4H 3OC8A 3FRUB 4BDVB 2VLKB 5J1TC 5T1LD 3AUWB 4AEFA 4MNQE 3VGBA 4MXQD 1R3JB 2W65B 1MZYA 2WJ7A 1HHJA 3M8OH 3SOTA 2F1EA 3O41B 4LFHG 4G3YL 5ICUA 2QGDA 2X4PA 1K4DB 4R7XA 1BD2D 1N5YH 1L5GA 2CO1A 5EEUA 1RJYB 3CFNA 4AT6B 4DQOL 4KKAC 5D9SA 2EUWA 4LLVB 5ACMA 1CDUA 3BVTA 1QATA 4HKZB 3G7TA 1BF8A 4JZNA 3GXPA 3VWJC 5EUOF 4JM0A 3JTSA 4BV1A 5HHQB 3O3DB 2CG9X 5TH2B 3DUUB 1V3MA 3QWNA 3SKOB 3VGGA 2DQUH 4LSUH 4BHUI 1TO4A 1AG6A 2BVOB 2P80D 4JKWA 4JVUA 3OKEB 4I8DA 3HNSH 1FG2B 5JXED 1LO3H 3OSKA 1TCRA 1JHKH 2W91A 4RNRB 2A4ZA 2VH5H 4JFDE 5AAMA 1X5YA 2KKQA 1XBDA 1HEHC 4UINL 4XXCA 3I9GH 5JIHA 2ITCA 3ATFA 2BVQB 3D0VA 2HA1A 3K71B 2OSLB 3QA3A 2IAMB 2WOYA 3WKNA 2NCEA 1ZVHA 3BD4A 4HCGA 4NOBA 1N7MH 5E1HB 2WN2A 3CBRA 5DD5L 1CLVA 3B7TA 3ZTNL 3OJDA 4PFEA 2E47A 3OLIA 3C12A 3BO8B 3QUYB 4OJEH 4AUUA 2W9EL 1IQDB 5E6SB 3KPOB 4U6HA 3CZGA 5C0CB 1JV2B 1ZA6A 3NCFB 3GXMA 3VACA 5CFAA 1S3KL 4PRDB 1INEH 1AZZC 4MNQA 1XGUA 1G7IB 1D5RA 3BUYB 1J0HA 5MEPB 4B9ZA 4IOIA 3T0ED 1UB6A 2X4RB 3FT2A 2IPKA 2WBXA 1AE6L 4BKLB 3O6FC 4IHOA 3MRBB 4OJCA 2B16A 1V05A 3MRJA 4IK7A 1OARH 2WMPA 1JF6A 3O45A 4TQIA 4Y2DA 2AQTA 3RWEA 2KDYA 4HUVB 3SGJC 4PJAE 1MAKA 1L9NA 2YSTA 3DI3B 5DD6B 3NCEB 4YE4H 5J5EA 2F7PA 5LO7A 4NUJA 2VDNL 1KJ2B 3DGGB 3ISWA 1E4XL 1X4ZA 4KKQA 2WKLA 4Z95H 1UYWH 3MRPA 4RMTA 3FOMB 3OGOE 5DK3A 4P57A 4AIOA 5HYFA 2AK4E 3AWGA 3IDMA 4PRID 1CE1L 1H3GA 3DTUB 3QJSB 4EI0A 1MCHA 3GLDA 2R0ZL 4NM8H 4P4KD 3TT1L 3UBXA 3KDMA 2O5XH 2OM5A 3EJUA 3DGCR 4R7VA 4ABWA 4HUNB 1T20B 2X2HA 3M1BA 3AADB 5EEZA 3CSYB 5C9JA 1A7OL 4FI7A 4MJID 1EDYA 1JGDB 3K3QA 5AYUH 4FG2A 4PCKA 2EILB 3IKKA 3MXWH 3QDJD 2I5YL 3B2MA 5J7CC 3S35L 1E4XI 2JTDA 4XHJD 3K2UL 3D3VD 1U8PB 4KFMA 4XMPH 3D9AL 4A2HA 3VTAA 2VT0A 1OM3H 2E4TA 3QDGD 5DJ8B 1Y6KR 2NY6D 1UWYA 3UBGA 5F6HJ 1WO2A 5IFJB 1CFSB 5T1KD 1L9MA 1PL3A 4B0MB 1WZKA 4DTGH 1DZ0A 2FL5B 2UY6B 4NNPH 1NFKA 4MBOA 4NKOA 3BIAX 3C75A 3CDGA 3GINA 1DQML 4H7VA 3IDXH 3M17B 4HUXB 2RGSA 4RISL 2F1AA 1YEIL 1ACXA 1TETL 4JPIA 1U41A 4LVOB 1ZVSA 2GG1A 2ILLA 4HWZB 3V4LA 5HYJE 1HL9A 4PRPD 3TTYA 1WT5C 2ADGA 3DECA 1N2RA 5GS0D 1UACL 4OT1H 3TCXA 4EQ2A 4PJ6A 3DMMA 2EH7L 1R3IH 1K8IB 3N1MC 2VDMH 3QUZC 2ADIB 4G1EA 5CJOH 1TU2B 4IIQC 5IMMB 2AP2A 4CN1A 4CW1B 2C1PB 5AB0A 1WWBX 3TEXA 4O02H 5MI0B 3X3FL 3ECWA 4EDWH 43CAB 5DRXB 3WFEH 2GC7C 4WI9A 1KELH 2AJ3A 2HSIA 3BDYH 5JIIA 2ESVA 4V1DE 1IGIH 2B1AH 2CDFB 3I75B 3ZKMD 5IIEB 1JZJA 1EFQA 2CKNA 1WE5A 3QQ4B 3PFUA 4BZ1A 1XSIA 1EEUA 4K73A 1BX2A 2MHAA 3DHPA 5CEZD 3L7EA 4BFJA 1F11B 2ZKYA 3G9VA 5IMOB 3ARZA 2A9DA 1OIOA 4RWYL 4KDVA 5J3HC 5IHBA 1W0YT 4JFFB 4NNYB 3ZL4L 3MCLH 4NKIH 3WAJA 2X4QA 4L8DA 1THAA 1EWHA 2R2CA 4IEFA 3SN6N 4GP5B 4LBEA 3KBHE 1Q1JL 4HIJB 4NWTL 5E00B 4HUKB 4DK5A 4DCQB 1T03L 3FMGH 3V95A 5K9QG 4RRPG 4XN5A 4MJ2A 5DJCA 3CC5A 4H0GA 1CN4A 1ZANH 4M1GL 5IVXB 1SJHA 2PR9A 3WJLC 3GZKA 4PRNA 5GGTA 5KUMA 4J3BA 3Q3GA 5B1KA 3TA3A 1OSPH 2MNUA 4LCWD 3HE6D 1UXSB 1F3DJ 4YXLH 2AKRB 1MVUA 3VCLA 3S2AA 5I16A 3FT1A 1EAJA 4GRWH 1B90A 2K8MA 2P52A 1DO5A 3ML8A 4ORGA 4OI8A 5E5LA 3LN9A 5IQNA 1NGZA 1VFBA 2APSA 2EYRA 3W39B 3RY6C 3ZDZE 3G6AA 3MLZL 3UTQA 1N5AB 3N50A 4N0FA 2EVGA 4WO0A 3SOBH 1C16A 4WF7A 1KIUB 2P26A 1AACA 4NO5B 3KLHD 4K94L 4NPKA 3UTSA 3GMPA 3WO4B 5MERB 5L7XH 4PREB 5KSVA 1J87A 1RZ8A 1IM3B 4NJAL 4LVHB 5ALBH 3N06B 3MLRH 1MLCA 3QORC 1A6UH 5LXVA 5BMFL 1VRSA 1BJMA 1D7CA 2ZSVA 4I88A 3PHOA 2JCCA 3TFKC 3NCYP 4M61A 4HKZA 3JTBA 4IMLA 3O0RH 4YIQA 1RJZB 2BNQD 4WV1A 3VD5A 4TUOB 1I7TA 1B4RA 3MTXA 2WO3B 4LHUB 3S88H 5GS0C 2WQRA 2WPGA 2VIRA 4AUJA 1QFUL 1QA9A 2OL3L 2WM0A 3S37L 1TKWB 1DLHA 3KBEA 3RILA 1XB3A 2CUMA 1KT2B 1PKQE 3LQMA 4XMZA 5DJZB 4L29B 4X7FC 2VDPL 3EBIA 5AVXB 3UYOD 3IF1A 4L3EA 1G7QB 4NP9A 2ZICA 2E0PA 1WCBB 4NZUH 4XNZC 5C0BA 5SWSB 1PLGL 3D0VB 3DV4B 4JQXA 4HJ0C 4MAYA 3OX8B 2OMZA 2R0KL 4HPYH 4JZOA 4FFZA 4G8FA 3AACA 4OR1A 3L3JA 1JNNL 4XXDA 3WE1A 1ZGLA 4YC2B 1ECZA 3MA7A 1DR9A 4FFYL 4F8OA 4X7TA 1IGMH 4A7SA 2IQ9H 2VUOA 3MRGA 4L8BB 3DUSB 3MLYL 1IBYA 4NS0A 1OM3L 4YUEH 3SE3A 1OP3K 2QSCH 1D9KB 3DIFA 4XNXL 4Y0GA 2JKLA 1BZ8A 3VI4E 4HIHB 5IB2B 5F8QC 1G7IA 1X7TA 5KUKA 5CN1A 3MLSH 4BSWB 4EQ3A 1P2CB 2KLRA 4JFFE 4NAMA 1FL5A 1J05B 2YPVH 3KL0A 2OMXB 5D5ME 1KXTA 1DQDL 3IGAB 2C7UA 2DDQH 1XR9A 2OJ1A 4OQTA 4DZ8B 1EFXB 3JTTB 2ICEC 3VI4F 3BKJL 3IU4H 5DMKA 3KPSB 3HRZA 3D39A 4Z3IA 1QSVA 3DO7A 3HHSA 4AYGA 3G6DH 1GGCL 3T6VA 2NDGA 4S11A 3APCA 4FP8L 1ETZA 4MS8D 4PGEB 5FO7B 3RB7A 2DV6A 3QI9B 3CE1A 5E5UB 4I0CC 3AJ7A 2I9LB 3MJ7B 2OFQA 5INDA 1UYWL 1KGXA 5CZKA 5JNYA 4QHKI 4Y7OC 3TBTB 4E42A 1FZMA 1BAFH 4QR7A 2QKIC 5IVXF 1DBBL 2I9TB 3FH5A 3QUGA 3H9HB 3O8XB 2ERJB 3T8VA 4TF4A 3K2KA 4RAUA 4OLUH 4XVTH 2J6EL 1Z3RA 2CO2A 3AT0A 3L9BA 3MACL 3SGEI 3EFFB 3IDNA 1Q94B 2BOCA 5GS2H 2NR6C 5CUSL 3IRPX 3CFEB 4TVPE 1UEMA 3UX9B 4WI3A 1QD0A 2JELL 4MQXC 5KYWB 4JFSA 1QPKA 1S7UB 2EXWC 4ENED 1UQSA 3SCMC 3DDGA 1NFAA 4OD3L 2FSEB 3L7FA 4QKTA 5F0LB 3ZX1A 1DQIA 5B1JC 4KHTL 2P24B 2R9HD 1I7RB 3PWUB 3MRRA 4FJYA 4LL4A 4X5XB 2BC4A 1LE5B 3KCPA 2ZUXA 5F1IB 3T0EB 5IFJA 3PPEA 2RD0A 2K4WA 5TE7H 2ITFA 2XWJA 4IHBA 3NIDE 4HWUA 4JG0H 2Z35A 4Y1AD 1LMKA 3RDTA 1MRCH 4QRPA 2BIHA 2B8OT 5GS1B 1ZT4A 3NRQA 2CHZA 5AW5B 2DMBA 4JPIB 4JB9H 1IL1B 4N6RA 5DS1A 4DVRH 3UP6A 4P59L 1B88A 1DQLH 1FZOA 3WMPA 2EDOA 1A2YB 1JXGA 4TYUA 3NSCA 4D0DA 5CINH 2OTWB 5BZWA 2BSCA 3PWNA 3QJXA 3IMRA 4HZ1A 5IMMA 1HFUA 1E2ZA 3GEFA 1OP3H 3IMWA 3V0WH 5CU5A 1A7QH 1I31A 1J8HB 4I1RA 2J88H 1GC1C 1NL0L 2HKHL 5DRXA 1HIMH 4PRHB 1KPVA 4AKQA 1AO7A 1YLBB 2VLJD 1VKXB 2YZ1A 3D2UD 4YK4B 5KG9B 5J11B 2DPKA 5LAXA 1X7SA 2Q20A 4HXAH 1S5HB 2XCMC 4ZMPA 3JVGA 4MDJB 2YRZA 1LHZA 2VABA 4R9HA 2WNGA 4XHJC 1VJSA 5B39B 2VRAA 4WDIB 4G1MB 5KWYC 2E9GA 3BN9D 2YUXA 2QQLH 2LTQB 1L9TA 5ANHA 2WANA 3V7AE 2V2TA 2R0LL 3POCA 4NQUA 1U58A 2B59A 3DPBB 3NIGE 1QUPA 5I73B 3FO1B 5L2JB 3A4EA 1U8CA 3UDWA 3D2TA 3MCKA 3L5XL 3WFDL 4HWEL 2AK1H 4QHKJ 15C8L 2WJ5A 5EF1A 1JWMA 4K7PL 2X41A 3VAEA 3QP3A 3W57A 5HYJD 1BZ9B 1LDPH 1SBSL 1QFWI 1CYWA 3DNKA 3H9SD 1BM3L 4HUUB 4KRPB 3TT3L 2VXVL 4FQXD 4OLZH 4PGCA 2B4CH 5K9KB 1EEYB 1NCAL 4X4MA 4JVWA 2NMSA 4M8RA 3UTOA 1ASPA 4XPBL 1YN6B 3D6GA 1UJ3C 1ASOA 2W9EH 3ILDA 3IPFA 4F8TA 5A16A 3T8XA 3KPTA 2YPLB 1Q9OB 4R0LB 3IMSA 3UTTA 2XV2A 4PJBF 1MQKH 4LVOC 5GHWH 4G71B 1RIVL 5FB8B 3ARYA 4XX5A 1CD1B 1SZNA 4P9MH 1WFJA 2CXKA 4OD1H 5GGVY 3RTQA 1MLBB 4K8RH 1URIA 4XTRC 4PJ9D 3RFZB 1NGZB 1OK0A 3A22A 5K1VA 1NEZA 4AYMC 4JY4B 1FZJB 1TZGH 2A6KB 2YHGA 4B9CA 32C2A 3RZCA 3I50L 3G5YB 1EXGA 1T7WA 1L0XA 3H53A 3LKNB 3SJVD 2V2XB 2DD8L 2ZWLT 3DBXA 3ELAT 1TJGL 5KSVB 1H3TA 1PX8A 3KYAA 2R0WH 5I19L 3RWIB 4Q9RL 1ET8A 1GJIA 4OF3A 4P5TA 3BKCH 3HG1D 2P8LA 4IDJL 5IFHL 4HP5A 2G3XA 1TYRA 3BH4A 3GMOA 4GI8A 5HHMD 1A6AB 1GSKA 1G9NH 3V0DA 3SD2A 3PHOB 2HRHA 1B6UA 1UXWA 2P5WB 1RJCA 8FABB 5GRZA 2XG5A 4LRNH 3SB3A 3W2DH 5GSRA 2GY5A 3MBXL 4NN6B 5D1XB 3GMLB 2P5ED 3KPRB 3NRFA 4G6AC 4MXVE 4WV1B 4G82A 4KH9A 2HWZL 1TTCA 3Q8EA 3S34L 2HG5A 1E4JA 1QLEB 5GGRB 4LLAA 2PXYD 4M3HA 3CSGA 1XXDC 3KCWA 4PP1D 2WVVA 4OGYH 2E86A 5CZVH 1E5BA 4O9HL 1MJ8H 3EH2A 1BXAA 3QGVA 4GMTL 1LE9A 3Q8AA 4XNYL 5CO1A 3NYKA 4HIIB 4ZS7H 2FLRT 3HB3D 5JXEC 5KVDH 1G7QA 4YLBA 1Z7JA 4XCCH 2VSCA 2AQQA 1WCBA 5C0BB 5C09E 1ZHKA 4ODBD 1J9CT 1YECH 4N6QA 4PQXA 4FULA 3LIZH 4MZ3A 1QWHA 4GSXA 3QEQB 3UTTE 3VUAA 3N2JA 3DSFH 1Q9WA 1ZLSH 4FQCL 1HCZA 2E3VA 5HYSB 1EEZA 3T4AA 2CCWA 3ZDZB 2AAVA 1A3LL 3K8LA 1I3GL 4YL9A 5JHLL 4Y7MA 4NQSB 1GGUA 1QLEH 2VLLB 4FQHB 3DUSA 5D2LA 1HSAB 4N1EA 5EBWA 5KSAA 3H4HA 4RZCA 1D5MB 1D9KA 4PJ7A 3AGVA 2APXA 4J3WA 1T1WB 3CVIL 3D0LA 2EJ1A 4GG8A 1QHOA 3WFBL 1RSFA 3RDJA 2J8OA 5BW7C 3MRIA 3PGDA 5IB5A 5F7HA 1KXTB 4DO4A 5HVWA 5HYJB 3WXWH 1U8LB 3D25A 2R4SL 4DKDC 3QORB 4K7FB 3S88L 4W9CC 3ENEA 1HZHH 1MCOL 1A7PH 2WXNA 1ZXKA 3G5WA 4K55A 4WTZG 3K72B 5HI5D 3SKMB 3SKJL 4N1CA 1RK1B 2B1AL 2ITDB 3GXIA 4S1RL 4WO4D 3BGFB 3C5JB 3KM1A 4BZ2A 2IAND 1ETZB 3WFEL 2VLRB 4JPVH 4YO0B 1C8QA 1J9TA 4B6ZA 5JORA 3AWFA 2X3BA 3H3BC 4QXWA 1KN4L 4UAOC 3TBTA 4E42B 4FX5A 5BV7C 1NWPA 3GJEA 4BWUA 4D9QD 5JOPE 1GGTA 4ONGH 1GTFA 1IKNC 4FTVB 3QI9D 5JQ6L 2XQBH 3V6OC 3QT2A 1SDAB 5JYMA 3FQRB 1J8HD 5D7LD 2QT6A 2PR4H 4DN4L 1QQDA 3IGKA 1QX1A 1T2XA 3DOSA 3U0WH 2HFTA 5KVDE 2R23A 4OQTL 3MGTA 5EZIL 5AOZA 3U6XS 3LXBA 5AKRA 1K2DB 1KGIA 2DWEB 4G9DA 2XZCL 3SQRA 4X8XA 3CBKB 4IU3A 1V8HA 3JV6B 4X7SH 5ESQA 4HIXH 3GHBL 3U82B 2WHVA 3ZKSD 4ZX3A 4M6AA 5D2LE 4Q2ZB 1IEAA 2F54E 2VITB 3QXDB 3VE0A 5AZUA 4YXLL 3MRRB 4Q6KA 4ZTPH 1QRNE 3T77B 1OSPL 1E8ZA 5DD5H 2QMKA 2GJ6A 1TMQA 1WAAF 5DMIL 1KEMH 1SQ2N 5DK0A 3TNNB 1EJOH 5AVZB 2RFXA 2BWQA 5I30H 4ZFOL 5FYJU 1JSYA 1JGVL 4H8PA 4U6XB 4QXGL 4DKTA 2G9HA 2MCPL 3CJJA 3KNBA 4FJ6A 1SMOA 3PIQA 3FO0H 5E08H 1YQVH 1AZVA 3QHTC 4AQEA 5H94A 1D9KD 2ICEB 3KLAA 5I0VA 3IN2A 1BQHG 3BKML 2JXMA 1OTSC 4OCYH 1M2VA 2WXFA 4LSRL 3GMQA 4KOBA 3OHXB 3IFLL 4OZHA 4MX7A 2YO3A 4QRQA 2FGWL 1JWSB 2EIJB 2OR9L 3PWNB 4LSPL 4MNHB 5D7LB 4UYQA 5J89A 1SN0A 4Q14A 4RQQA 5JIMA 2EVJA 4G6KH 2X1OA 2WLKA 3BDYL 3PWPD 4FZ8H 4NWUL 2FH6A 3B83A 4F2EA 5I8OH 5IQMA 3ULAB 1AO7B 2XPYA 5FEBA 3DK2A 1CC3A 3A4AA 3RWFA 2WWMD 1NC4A 3D48R 5H8DA 2CUHA 3IPBA 2Y7NA 3ZDZF 4MDJA 3ZDXB 5E9DD 5A7EA 1DBAH 4HEMA 5LLIC 5JTWA 3A3YB 3G6JB 1HNGA 5DJ2B 4MKMA 5ITBL 3HZKB 4CSSA 3VJ6B 1XCTB 1WAAA 3HR5B 1JHTA 4L3EE 3ZHDA 3B3IA 3HG1E 5D7JC 3FSZA 4X83A 4WU5B 2VN5A 2J1ZA 1E27B 4PGDA 1TTBA 1MCOH 4G8GB 5I5RA 1JE6A 3WLBB 5ID1B 4LU5L 3AREB 3CVHB 5C07E 1B9ZA 3WN5B 1TVHA 4AH2B 5CD5D 4BK5A 4QGTA 2ZWZA 3KLQA 4NN7C 2GT9A 2V5MA 4DEUA 2PPEA 3NOIA 1RZIA 4Y8DC 3GMRB 4XP6L 3UZQB 5F7DA 1FNLA 2BY3A 1FNEB 3FT3B 3QZWG 4MVBD 1ACYH 1FUNA 2BIMA 3ABGA 4XN1A 4URTB 3FO0L 3BLKA 5E08L 1CBVH 3OAUL 2YPLA 2CO6A 4XNUH 2G60L 5D2LF 3JXAA 3QO1A 3CX5J 2WINA 2EXYC 5C0AA 2JKSA 4PJCE 4YHYC 1OSZA 2BWIA 4UINH 3C5ZA 4X5QA 1JZHA 4A2MA 1D5ZB 1IGJB 2JQZA 3QUZA 2QVIA 5GGSB 3N04A 1NMBH 1O5PA 2L8AA 2VO8A 3CMGA 3U4AA 1OPGH 4PGBB 3T2OA 5I8CB 3SYCA 3P30L 1C1EL 5IP4A 3T2NL 4KK5D 1H8OA 1WIPA 2J72A 2UX7A 3SDYH 4PG9B 5FUOL 4FNLL 2F54B 2OZ4H 4JFFD 3CZNA 2HX9A 4OV5B 1A4KA 5F70A 3KLSA 4DJMA 2D8KA 1AGFB 1K3IA 4DN3L 3NJVA 1QNIA 4DQOH 4ZQKA 1KCLA 2OJEA 1ORQB 4DW2H 2BXZA 3G04A 1CGXA 1IKOP 5I73C 1BVZA 3GQFA 1IAIL 5KZCB 4GINA 3VU1A 2A9MH 5L2KD 1WZMA 5I74C 2X4PB 1VFOA 1ZK9A 2OX5A 3MNZB 3TBWB 1MY5A 5LCVH 2GEEA 2YMXH 4HKJA 4JFDA 2NY0D 1V7ML 3QE5A 1AQKL 1WZLA 4LLVA 4P48A 2BHYA 3FU5A 3HI1B 1NGPH 2XRAL 4Y4HD 4M8UA 4WTZA 4KRPC 1G9NC 1ZV2A 3TX4A 4GKSB 1J5IA 3BIKA 2EO1A 3O3DA 3BC9A 2FGWH 5AWNH 3ULUD 2G5UA 2XZQL 5FKPB 1QPXA 1ZHKB 4BH8B 4CSTA 1XZ0B 3AG1B 4R0LC 2HFEA 4OM1H 4ZFGL 4V2BA 1DBMH 2BSRA 3OXRB 5CILH 4ONFH 1N59A 1FHNA 1JMXA 1ZGLP 2BCMA 4NQDB 4C54A 3F00A 4PR5B 1RPQA 5CFHA 2UWEA 3FU0A 1OK8A 3ARFC 5I66B 3RVVC 1P69B 1OAYH 2ZX9A 4ZX4A 5IFAL 4RGOH 1LEGA 2YEVB 1I75A 4FQXB 1EJOL 3VXUA 4XPBH 3GTVA 4YVUA 1RJLB 2GC4C 5K9JH 4NHCH 4PJ5E 3KPOA 4U6HB 5LB1A 1N8ZB 1KWGA 3VXPB 5E8PA 1F86A 1AHMA 4PRDA 4UB0L 4WJG3 4DO5A 1DEEA 4MNQB 1N68A 1RUQH 2DH2A 1AO7E 1QBLH 2EZ0C 1GS6X 3VXMD 1AS7A 1J0KA 1SHXA 2HFGH 3KVQA 1FVCA 1Z9SA 2A9NH 2JF1A 5D7IB 5KJRL 4NN6C 3AS3A 4FFTA 4ZZFA 3SDXB 3NDZE 1WCQA 4GKZB 4WTWA 2F58H 2VE6B 1A3RH 2XJKA 3BPLB 4NPYB 4WCYL 3S3DB 3NDYE 4NQCB 1O6SA 2TSAA 3EUUA 3MR9A 4FMVA 5ADOL 3GJEB 4XCFL 2BSDA 4GKOA 1DN0A 3QQDB 5AVYB 4QXVA 2FX9L 4AM0B 4ZUVA 2KDGA 3ZTJG 1R0AH 1KJ2A 3GI9H 4IRJB 2ZWNA 4U1NA 1ERNA 2OULB 1TQCC 3B2VH 1DJZA 1D5BB 2WN3A 1ND0B 1KULA 2BMKA 2PYEA 4FL4B 4NGHL 1JN6B 4P2AA 3VXOB 2HLFD 2M83A 3DVNB 1UCBL 3ARFD 4IU2A 2JJUA 1P7QD 3S97C 3FFCB 3QZWB 2RHEA 2AFNA 4PJEB 3SPJA 3MV7E 3KBPA 5KYXA 3RL2A 1OD7A 3N1FC 1DJGA 3MRCA 4P2QE 1Z66A 4EZLA 3IFPB 4P8QA 4P5RA 4PHZA 3TASA 3BVNB 2W60B 1JS4A 3UJIH 4NIKB 3WFCH 2V7HA 3QQ9D 3D69A 4CVUA 3VXUE 4Y9CA 2RH0A 3VFSB 1WS8A 1FYTD 4XCYA 3FPXA 4ZS6C 4JE0A 3WOVA 1IFGA 4M5TA 25C8H 1OF0A 3TONA 3Q2WA 3ES6A 4QHMA 5D7JD 3CX5K 5EU6D 3L1FA 3QPQC 2WB7A 1UZ8B 4J3OC 3V55A 1NOAA 4Z7VF 4NN5C 1S7QA 5HDBB 3QDJB 4O02B 5GGUA 4OCXL 4HWBH 2OZ4L 2SEBA 1MCPH 3ZT6A 4H2AA 3MJ9L 5TE4H 2ZKHH 5F1SA 4I1NB 1SVBA 4S1SH 2JJTC 3GLEA 1FH5H 4M7LT 5BZXA 5D96C 1RD6A 3LKPB 1WFNA 4UAOB 2WAHA 3WTWA 4H0IA 1O7SA 1MCWW 1N2RB 4NZJA 1MHCB 1BQHB 4EVNB 2EUXA 5D1QA 4Y2NA 5J0BA 4KO7A 4WFFD 1QVOB 5FYLD 3VXSD 4GG6B 1W91A 1FJ1A 2V9RA 5CEZL 1IBFA 4XRCB 4QF1A 4E41A 3S0PA 2ARJQ 3WIFB 3MV7A 5GJTL 1T1XA 3CVDA 5IB1A 1A7RL 3B3IB 4E9TA 4NJAH 1KCSL 2BNQA 1KXVC 4N2NA 5MENB 4OVUA 2ZAIA 2FJHB 4G8GA 4J2QA 1LK2B 2IBZY 1OALA 1G4MA 2WLHA 4JR9H 2DD8H 5CINL 3V0EA 3VMOA 4JFDD 3TCTA 5ACZA 4I2XE 5KJRH 1BD2B 2YEZB 4BYHA 4NBXB 5CWSA 4XP9L 4AQ1C 4G11A 4UT9L 2XWXA 4NQEE 2BNRB 3QW9A 5HHNA 3C6EA 2DYPB 5IESL 3ARBB 4LARL 1RIVH 1HI6B 2X88A 2WINB 4LLWB 1RP8A 4YDLC 1B0WA 1TEFA 5C0AB 1AJ7L 2HFFB 3CHSA 4P0DA 3S98A 1OSZB 1W8NA 1SJHB 1ZK5A 3B43A 3EFDL 4HS6A 4RGMB 3S96A 3V6BR 4PJBE 3RWDB 4DOHB 1KPUB 1YMHA 1C08B 3UAFA 1CPUA 1D6VL 3HC0B 3N55A 1PFOA 1DQQB 2XICA 4G9FB 4X5WA 2BPBA 5L4MA 1PLGH 1G7HA 4L4VA 3WY4A 5I16B 3BT0A 3CDFA 1UD3A 1M3JA 1IEBA 2NY2B 5EU5B 3O9WD 1IU1A 2YKLL 4D0BA 5BVJB 1ITBB 5D2NC 1CR9L 2GHWB 3ZRSA 3QXUA 4JFPA 2BJML 1AGFA 4K7PX 1H9VA 1EDQA 3BAWA 1J48A 4LOUD 5KSBA 4C83B 1KY6A 5E8DL 3X14B 4UV7H 1KIUA 3CHPA 4ZFOB 1KACB 2AQ1A 4OZFB 1XGPB 3VRJB 4TUJB 1E5AA 1I3RB 3PV6B 1M7DB 4KI5F 4PJHA 4X2UA 1QHQA 4DGVL 1SJEB 2H5UA 5E5RB 4G8GE 4ZPTA 5LJYH 5C0FB 2NXZD 2VR3A 1NL0H 2CHDA 1QFWH 2KLSA 3HI1A 1E5ZA 3QNYA 4Y4FA 3BRDA 4NN7B 1U8MB 2R59A 4M62L 5HD8C 3M6DA 5I1HL 3VFRB 1BYOA 5MHSE 4TUOA 3GHBH 4A6YL 4W81A 4JREB 1E4WL 1SXBA 4FXGC 4Z78A 4JFHD 2XFXB 4QNPE 2NQCA 3FRPB 4XVJL 4DP8X 2XY1A 2P7TA 3SDAA 2H6PA 1EJ8A 1NICA 3HS8A 3LEYL 4OKVB 2EE0A 3MKKA 4NHUB 4OGXH 2FLMA 2UZXA 1UXLA 5F3BB 3DJZA 3D52A 1B9KA 3TBYA 2BRRL 3WU1A 3VD3A 4XR8C 5IQ9B 2B1OA 1AY1L 43C9A 3RVVD 1Z32X 5JIPA 1YQVL 1EHLL 2PPDA 1QI5A 3RJOA 2DQFB 4UQ2B 4TUKL 1T5XA 1WVZA 5DTFA 5I1KL 3QH3B 1XCWA 2XT1B 1SOQA 3MRLB 2Q2EB 4XB7A 3DI2B 4K5PA 3DYOA 5F71A 4NC1C 2CAKA 3KPQB 5T1DH 2WXMA 1IGYA 3QNXA 4NC1E 5K69A 4FTDA 4BSWA 3NCWA 1ROCA 4XZ4A 2UYLA 4L2YA 3KAAA 4Z7VA 4WO4C 1FVCB 1DP0A 1XX9C 4MZIA 3IGAA 3NZHL 4JKLA 4P46C 4RFEA 3VGHA 3FULA 4UZGA 1AHKA 2H1XA 4YWGL 2CRZA 1RH8A 4MJIA 3RPIB 1QFWL 3CG8A 5CCKH 1OGAA 1F0LA 2A83A 5TFSH 4UDUB 3T2QA 1M05B 3R4DA 1V3JA 5TF1H 2PR4L 2QSTA 4FRWA 1X5HA 3CIQA 1IAOB 4B97A 1U36A 1E40A 4EDWL 1TYEB 1Z9LA 3B56A 1IE5A 2B2XL 1ED3B 2CR6A 2Q76B 3CIAA 3EYOA 4IRSA 1TPXC 3HBPA 4O5LL 4R8WH 4XCFH 4ZPVB 5G4MA 2EIKB 5BOZG 1YYLH 4K94H 4HT1L 3STZB 4NQVA 4RAUB 3AXLB 5KVDL 4AQAB 4QOKB 3FF7A 4Y2LA 3SE6A 2W8CA 3EDJA 5HGAA 1BDYA 2W60A 3ULUH 3ARFB 3UACA 1T0NA 3DC0A 4IKJA 1MJ8L 4PWIA 4B9PA 4KXZI 1L3NA 1M1SA 1U92B 3MXVL 4QHUB 3RVTC 5ISZD 1GTNA 1Z3GL 4G5ZL 4JKKA 4XP5L 2IANA 1PG7W 3C8DA 1G7MA 1ZT1A 4OFYA 4FI6A 3LVEA 5JW4R 1OAZL 3RWHA 4P2QD 3EXLA 1AZRA 3ES6B 4MNQD 4YHML 3ESPA 3ZZQA 5AENA 3D9AH 5T1KB 5CHNB 1OL0A 3VSQA 2X12A 1QLEL 4RGOL 1KCKA 5GGUB 1XH1A 3IB4A 4XZUA 1U2CA 3QDJE 4FQPA 1KCWA 3IAQA 4OFVA 1D3CA 4LDEB 4O58H 4IOFD 5BOJA 3FU9A 3Q6FB 4FLOA 4NQDE 1AXTL 1YNTA 3AG2B 4UQ9A 2NDFA 1AGBA 1BV8A 3QJHB 2M26A 1JDAA 4FHJA 3TC9A 4GAJH 4JFOA 2A5UA 1HDMB 4LHJB 2Z4QA 1QR1B 3ROOA 5ESAB 1PX4A 1NLBL 5C3LD 1DJIA 1EANA 2PMZA 1QVOA 3VA2C 4A2EA 1OGSA 4TM9A 2FHBA 5T33H 3IJHA 2VM9A 3BH8A 1QRNB 2BINA 4WK4B 2EDBA 3NSYA 3WIFA 1C5BH 1HJCA 4NQDD 4PRHA 1KPVB 3ELQA 3RGBA 4L5FH 4LRNL 2XTJD 2FJHA 4TV3A 2MCMA 2ZXBA 3P9MA 4WFGD 1INQA 4O2FB 1RIHL 4M9OA 4UQ3B 2Y5EA 1EO8H 5IFHH 3KR3L 2K3TA 3LNDA 4YX2H 2CCLA 1A6ZA 4UT6H 3DPBA 4LSVH 1P0SE 2H3XC 5HDOA 2OXHB 3L3IB 3SBRA 4XP9H 4OJFH 5DVNA 1G7PB 2XJLA 3K1DA 5DYOB 3MV11 5C0CD 3G6JF 3IU3B 3UC0L 4GRWE 4WU7A 5CP7A 3QYNA 1JWMB 2VZSA 3RLSA 1NBVH 9PCYA 2W07B 4YSTA 5FKAA 1TT6A 4KJYB 1FL3A 2HFFA 4GAAA 1HEZA 3SBQA 2X6CA 1NAMA 3PP3K 4NN5B 3S36H 3VXRB 4AG4L 2UZIL 3MV8D 3EIFA 1SHWA 4JM2B 4KQ0A 1MHPL 2O6CA 1ZCRA 3N5AA 3ILPB 1NIFA 1RZ7H 2LOEA 3U0TB 3VRLE 1W0WB 2OTUA 4N1HB 4NRYA 5EN2A 3K2UH 1ZANL 4KKZA 4P3DA 5PAZA 1GKOA 1PF3A 1RMFL 4PJ9A 5DT1L 3TFBA 4I9WD 1P1ZB 4RMSA 1FO0B 1IC7L 5C0GB 2Z93A 5F1NA 3PDOB 1RZKL 1BVKA 1GY2A 3O9WA 4ZSOA 4FKEA 1BZ7A 5GRWA 2R51A 3PP4L 4GP4B 2Y36L 3WUWA 4OLZL 4K71B 3CZFB 4DVRL 3N41B 4UTBH 3M46A 4R3SA 4IKKA 3HLAA 3MRQA 3NCJH 3L9RA 4HGWB 3GKWH 1UD4A 2JKWA 1A4CA 4HBCL 2F9BT 5JOEA 1QFWM 1D5XB 3PNRB 3D33A 4Q6IA 3WJJC 2ALAA 1YAIA 2F68X 2Y1VA 4RMRA 3LNEA 4P05A 1CXLA 2I7SA 1CLZH 2AEPH 2EACA 4LSQH 1J1XL 1XHHA 2X4TB 3E7JA 4DF9A 3GSQB 3OL2A 4HPHA 1UXWB 3TVMD 1SXZA 2VLME 2WLIB 3NIGB 4Y4FB 3UZVB 4URKA 4MB3A 3BWAB 4AEEA 4L4TA 4OZIB 2FVNA 3RY5A 5IEHA 2ED7A 4AOFA 2H1LM 1JK8A 2G2NA 2UVEA 1Z2KA 3KM2A 3GSWB 3MYJB 3CFKA 5I1LB 3FB6B 1R3IL 4WFEE 3NJNA 2WSKA 5DQ9A 2GJZA 4ZX6A 3FYIB 1PZAA 1IGCH 1WGOA 5CJXC 5I19H 1QI4A 2JELH 4R2GC 4UQEA 3VU2A 1MFBL 4AMKL 1NBCA 1KTDB 3ULVL 4JY5H 3T0AA 4NHUA 3GK8H 5I1CL 3MV7D 4PLJD 3Q2LA 3Q9QA 1IT9L 4BQBA 1J1PH 5IQ9A 1HZKA 3V0GA 1B3JA 2VMDA 2DZEA 2NUPB 4GOSA 5AW2B 3FQ1A 1FAIL 4KXCA 4XB8A 4Y5YA 2ZUSA 3JTSB 4W6XB 4XC3H 5FIEA 3P69A 2C7FA 4G9FD 1BD2E 1LILA 5C08B 1TLMA 5D7HA 2F7IA 1BXXA 4TQEL 1NUDA 2V6HA 4H88L 4YHOH 5G4OA 4DKFL 4Q56A 1EAQA 4GRMA 4S1QH 1A6VL 4NP4H 2NY2D 4NDMA 4BGDA 5ICZB 1TCRB 2YXFA 2CKBL 2I5YH 3DKHA 1IT9H 2WUBH 3FQUB 3HC2A 2OV0A 4MAUL 4NC0B 1KFAL 2XN0A 4DAGL 2OYMA 1MH5A 4AITA 2H45A 3FTSA 5LGYA 3VFPA 5KEZA 1PNCA 1JPSH 2KT6A 2JKJA 1HT6A 2W0KA 3GUTA 5E95B 1NC2D 2W5PA 4LCVA 1U3JA 2QL1A 1OLLA 3IAPA 3FCSB 5JDJA 1ZA3A 4WFHE 4FZEH 2VLRA 4MWFB 4RIRB 5C0CA 4B53A 2X9XA 2R83A 3KPNA 4QO1B 4DN4H 2B9BA 5IGXH 1EERB 1S7XA 1TTAA 4Z7WA 5EIIB 1HU8A 3LNFA 1N26A 4BWTA 3CMOH 2CH8A 1ADQA 1UD5A 2O1AA 4G3YH 4KRMB 5LWYH 4YHPB 5B8CC 4NKDB 2IEPA 3WHE1 2DOCA 2F8OA 1XCQA 3STZA 3U9PH 1AAJA 2TRYA 3FQRA 1BBDH 2A38A 2G3NA 3LKSA 3H9ZA 3V6FA 3FN3A 1M71B 4FP8H 1QQDB 2JQMA 4MA8H 2LQRA 3WIAA 4X80L 3GSNA 3QEQE 1YJDH 1BG1A 3A67L 5BRZA 1JG9A 3QCUH 1SYVA 5IV2A 1I85A 2CRYA 2Z7ZA 3CPLA 4KVNL 4NUJB 2PWHA 1IX2A 2ZJSL 4TVPL 3I02B 5IHUL 2GTZB 3TTSA 4AV4A 4RMWA 4P57B 2ATKA 2AJVH 2M2DA 4DOHE 4JN2A 1SEBB 2XQ0A 3U9UA 3SY0B 4WZ9A 3E8UL 4PRBA 4XBMA 1NFIB 5L9DL 5JZ7D 4GQ9L 5AB2A 1X5FA 4ONHA 1CT8B 4PWHA 5ESVA 1LQBC 4P46B 1IV8A 1ANUA 3CZJA 3SO5A 4TRPL 3TF4A 2J3SA 1QASA 3DARA 2ICEA 2OR8A 3BRGC 2XZZA 3X12B 5TDNB 1G5AA 3ML9A 2R0KH 4HPYL 1T0PB 4J3OF 4BDVA 3O11A 5DD3H 3N1QC 4LOUC 3LRKA 3R8QA 1R3JA 1NJ9A 4UU9B 3GSUB 5GSVB 3QUXD 5IT2H 5AD0A 5IB3A 1V3LA 4HLZG 3QIUD 5DJ8A 1XVSA 3I9IA 3V4UH 5BV7L 2MOVA 1FLRL 4RX4A 5E1AA 3MRNA 2WXKA 3CZLA 4OM1L 5DCCA 4ZFGH 4ZNEE 1DTUA 2DLFL 5LBSL 4XPAL 2COVD 3NVQA 1RURH 2K9UA 4WW2C 4Y89A 4M5ZL 3H42H 1BBJB 4GXVH 5DA4A 5JHMA 1QMUA 5AL0A 1JVKA 4J3VA 4F9LC 4LASL 4NGHH 3D85D 3B2DC 3FHEA 3U2JA 3WMSA 3EJPA 5T33L 4RDBA 4F33B 3SQBB 1XCTA 2D7NA 5B3SB 1R0AL 1BMWA 2V7NA 3DMMB 4KDWA 4KTDL 3O2DA 2FJGB 5ALBL 4OF0A 3IRCA 3ZOAA 2QTVA 4FKKA 1BXVA 3CXFA 4RWYH 4IMKA 3IBOA 5GGVH 3RWCB 2F5AH 4KUCD 2CD0A 5C1MB 4M93B 1WITA 2OSLA 3QA3B 1VEPA 3T8MA 3D0AA 3PGFL 5L8LB 2AW2A 3I9AA 3KPPB 3CV5A 3L4ZA 5KTEL 3QCTH 3U2SB 1BVNP 4GRLC 4QAMB 2B20A 5BJTA 1BX2B 2MHAB 4YQXH 2F7QA 1XTLA 2LR4A 3RUGA 1OD9A 3RIAK 2QGBA 1CK0H 1DE4B 2VXTH 5EEYA 4G42B 3F7YB 3MUUA 4IOIB 1NSNH 2WLLA 2EDFA 3VSVA 3AW5A 1IGJA 4HKBB 4PVBA 4G6KL 4XP4L 4DEPC 2K1MA 5I1IH 1BFVL 3MRJB 4AZ8A 1G6RA 3L9RB 4GO8A 5EC1B 3MRFB 1HESA 1WISA 1IQWL 4TLKA 3LKOA 6FABH 3P40A 2PLTA 5IK3A 4HS8L 3RX8A 1I8LC 5AVVB 5EEWA 5CLXA 3H7LA 3CXDH 5CMAA 1K3ZA 3RKPA 4LEOA 5DHMC 2BP8B 1VZHA 5FO9B 4Q89A 2FJUB 4OV5A 1GW6A 3EH1A 3QUKA 4RCAA 5C71A 3V4PH 1NCGA 2WCPA 3FQTB 1SDDA 1QWUA 2J4WL 3KYMB 5L0QB 1OCWL 1NGQH 1NCNA 1VGEH 4ODTH 1NFDE 3AM8A 2XIIA 4GMSH 2P44B 4IRZL 2BNUA 5TDPA 1H3XA 4YE0A 5L88H 4X6BA 3ZE0E 2ALWA 1VFBB 5K59F 2JI3A 2E8ZA 5FS5A 5B4MD 3BFWA 3NJHA 3BP5A 1GL4B 3LIUA 4K5LA 3UTQB 2H2PD 3JVGC 3O6FB 4O02L 1EAPB 2IH1A 2OR7A 1C16B 3P3SA 5JW4N 1IE4A 3PL6B 4CDGC 3IKCB 3V0WL 4KK9C 3P9WB 3GBDA 3PNWA 3QAZB 5DHVB 2X0VA 1E5YA 4DW2L 5DJAB 2R0ZH 4L37A 4NM8L 2AXHA 2X42A 3POHA 4Q52A 5L2KB 5FYKU 4IKIA 4N3TA 5AW7B 4Y4KB 5FOBB 3K2IA 2HFEB 1S7VA 3WGVB 5H2BA 2O5ZH 5SWQB 1CBJA 2IV8A 3P0VH 1WH0A 3QEQD 4WWID 1DANU 3DMMD 3LMJL 4HEME 4XPHL 1RULL 4M7KH 4N2HA 4NQDA 5AYQA 2KERA 4GW4A 4KDTA 2OZNA 3EZJB 3BMWA 4KROB 2BZDA 4E2OA 4ZMAT 4I87A 3KWWA 3B5HA 2GABA 3ISRA 4P2OA 3SDCA 2XDHA 2H32H 1VESA 3KHQA 4GXUN 1ZVSB 2MCPH 1JDDA 3NIFE 4HETA 4PRAB 4D0CB 1BWMA 5C07A 2HCZX 4NERA 3KDPB 5ECJE 5B7FA 1YUKB 2FGZA 5DURB 4JRYA 4HMEA 3MOBL 5CJ5A 2H26B 4K8RD 1K8IA 1BQRA 1Z6JT 5DC9B 3P0VL 1WYJA 3OAUH 5EUKA 3UYPB 5CCKL 1A5FL 2ADIA 3QDGA 3QIUB 3GUTB 5ILTH 3BWZA 3X13A 2C1PA 4MXQC 5D7LE 4Y4FC 4KGJA 4X7TB 3WXWL 43CAA 1OCZB 3LPFA 2C3VB 5DRNB 5I8EA 1Z9NA 4UOW1 3ZKQD 4NENA 2B08A 4PBXA 2W0LA 4LEXH 3I6LE 4HLZH 2ICWJ 2VXTL 1NAML 3VSTA 3RBSA 1O6SB 2W0FA 3W9EB 5LQBH 2KZKA 4P2QA 1QNZL 2LFEA 2EDYA 4PD4J 3JV5A 4OFYD 2Y23A 4YSCA 3HG3A 1Y6NR 1BQ5A 4GSRA 2IDSA 4HUMB 4HF5H 5EZJA 2VM3A 4K3HA 5D7EA 5JQ6H 1GR7A 2RR3A 5F7KC 1HNYA 4F24A 1JN6A 2C9PA 5T1MB 4J2XA 3QJFB 4GW1A 2PW2B 4LKCA 4E41D 5EC2A 5C3TA 5A2JH 5JHDE 3F58H 1KYFA 1NCDH 3RL2B 3CU7A 4UQDA 4PGEA 1DFXA 2GHZA 3MRCB 4PB9H 4H8WH 3QI9A 4HXBL 5AZEL 4GG6F 4MA8L 5E56A 1KGCE 4PRNB 5JNYB 4Z8FL 4IRSD 3FTZA 1U8NA 4PJHF 5EB9A 2ATKB 3V5KA 3D69B 3NZSA 5D1XE 3F04A 4YFLI 5FXCH 1S9YA 3H9HA 1EDHA 2LGNA 2FT6A 3HPJB 3O8XA 4QCIA 5DUPL 3BEVB 4S0HA 3Q43A 1CL7H 3T3MB 3VWJD 5JW3L 4JBSA 1UUNA 4PJIA 4ANUA 4IBTA 4P5MA 4JDEB 1SQMA 2VQ1A 1BP3B 3WIIL 4JGMA 1YDPA 1DHKA 2CRIA 4U3HA 1TMCB 1U3YA 3C9NA 1R17A 4EN3B 4JN1L 4LCCC 4KX8A 3C08H 3T3PE 2AZUA 1OWRM 2ENYA 4D8PA 5IESH 5C0RH 1S7QB 3ME0A 2Q3XA 4K07A 4LLUA 4C57C 3GMPB 1GZQB 5K9OA 2ARWA 4CSPA 1ZDQA 3BX7C 5TK4A 2FHCA 4F15B 2H3KA 2BC4B 3K5RA 4I3RL 1MPAH 4NUGL 3HUJF 4L8CB 5GJSL 3HG1B 4FKHA 4XO4A 1KWKA 3RVUC 1UFUA 1YEDB 1DZBA 3GTTA 3JYCA 5FCUL 3CFQA 3RUGF 5B39G 1ZD6A 5FA4B 3EDKA 3CD4A 4OD1L 1GH7A 3GRBA 1HE7A 3B9DA 4DP2X 4HXAL 3N42B 5L4JA 4ABQA 3PXLA 4W9LC 4AIZA 4GG6A 1HIML 2DJUA 1ZT4B 2DQEL 1AI1H 1KLGB 4DKEH 2CKBB 3ZPDA 2P8MA 2M8XA 3IE9A 4E9VA 2EXYD 1XXFC 1TKWA 5DZ9A 1R3KA 3F2LA 3NJGA 5BRZD 1MFMA 4HK0A 2NY1D 5DJXA 2DL9A 4H1LA 1T3FA 5AB9A 3ULUC 3SDAD 5DFVD 4F7PA 1B2WL 1A7NL 2OTWA 1DJSA 4RDQG 1QO3A 1N8OE 2XNAA 2PXYA 3I3DA 5ACZB 5HBBA 2F2HA 1BD2A 2YEZA 4DGWC 1LP9A 4EXPX 3UADA 3J2PA 2UVFA 2VMJA 3MA7B 4PJIE 5J4MA 1HE8A 5C2UB 3J07A 1HHKA 2CLVA 3EOAA 4BA0A 2XWTB 4BWWA 3FTYA 4BEIA 2VABB 3EYQC 1C5DB 1UKQA 1Q0EA 1I82A 3VXMA 5D1ZB 1L4IA 3NJJA 3V0VA 3QYCA 4HF5L 2XPGA 3FU8A 4G42A 4UMGA 3S48A 2XTJE 3JT2A 3QHFH 5AFAA 3R0MA 3H3PH 4P9HC 4DK3A 3K6NA 3FOLA 3U1QA 2VXSL 2IMMA 5GS0H 5I71B 5KVFH 4M1GH 4U4IA 2YXVA 1GMEA 3MRFA 1AHWA 3FUIA 2MJWA 3FT4B 3EOTL 4UT7L 1A3LH 5DMKB 1IEBB 1QSFE 5C0CE 1T5WA 2DJ4A 2YPKB 3FCTB 2OMTB 4WW1B 3QEUA 2IADA 4I77H 4A2LA 4F7MA 5A16B 3QNZA 3HAEG 4JFPB 3KD4A 4AQ8A 1BFTA 3HR6A 3UAEA 3BXNB 1OTSD 4CAGA 3IFNL 4ZMQA 3OPZL 5DEZA 4ZQTA 2AABH 4OLWL 2ZPKH 4P2RA 1GPOH 4DKFH 1D9KC 4OCLC 4HAFA 3WS6A 5DQDH 3RTQB 3V0AC 3V0IA 3GI9L 3TA4D 3JWNC 3O4OC 3US9A 3DSNA 3HMWH 4X8JA 2AQRA 1A3ZA 1Q94A 4MRBA 1E4XH 3RZCB 4M93C 3KXFD 4NXKA 2Q8AL 4KO5A 5GS2D 4Y1AB 1A4JA 4LSTL 3CH8A 3S3JA 1S7UA 1KYOJ 3SE3C 2KQNA 2CO7B 4GRLB 4D7PA 4MA1B 3UTZB 4P5TB 4R7NA 3NJMA 3BFQG 4ZUTA 4V11A 2CMRH 3E6FA 4ISVB 4OZGB 8FABA 2A6IB 1NCDL 1U4EA 1S78C 1TJGH 5ICYA 4O4YH 5F1IA 4WWOA 1SOKA 3SDDA 2UZXB 5GGRA 2ERJC 5FHBL 2JKIS 4GQPH 4P2RD 4QRPB 4DEPB 3SDCB 2CHNA 1J1OH 2VZTA 4U7MA 2D31A 1FNFA 3Q9PA 3O6MH 5CEZE 4JQVC 1JZ8A 5DJ0B 1QRKA 2H47C 4WHDA 3LQZB 5JPNB 1T5XB 3U46B 2KZWA 3SE8L 3GJFK 3AS2A 3UYPA 2ZD0A 3GTNA 4PWEA 3T6WA 4RNRA 4FABH 1OW0C 4ZMXA 3NESA 2ZXEB 4IIQA 4EI6A 5HVHC 4QHLB 1PU0A 2D9QB 4Z0BH 3IJ7A 5DWPA 5HDBF 4KJQD 4IS6A 2OJZL 5L8JB 2YPLD 3LNGA 1YAZA 4FYTA 2Q86A 2PABA 1PZ2A 3MROB 2GIXA 5D2LB 4YSOA 3QNFA 4YJZL 1DDHB 4RMVA 5E8OB 4AL8C 1TFPA 2FZ3B 5KG9A 1YY8B 4AJWA 5FUCC 3R06B 3MLSL 1W2KT 1OCOB 1CQKA 3O2WH 4UB0H 3OLGA 4XNXH 4UM9A 3HA0A 3LY6A 1X5IA 3VVVA 3FUEA 1YZZA 4ODSL 1IQDA 4Q58C 4Y19A 2MQGA 3IMTA 3BP4A 2B59B 3X1EA 5A2LH 4LSTH 1FBIL 4YBQD 4K7FA 2EE3A 5LGHH 1QBBA 3UZEA 1MG3C 1XGUB 1X5ZA 4E0RB 1ED3A 2X1WL 4LQFL 5T1MA 3REWA 1E4HA 4HZAA 1MI5A 2LVEA 4NQVB 2VM4A 3MRBA 3MUJA 4JO8A 2DEWX 3VNYA 4PGCB 3D3VE 2OMYA 4XN7A 5K9KA 5AVQB 5ID0B 2IV9A 3ARFA 3JWNH 1NQBA 1T0NB 1WIUA 3RWEB 4PRHD 2NNAA 5FF6A 4FMFA 1J86A 4JRFA 4LHUG 1WK0A 1MNUL 3EFOB 5E6YA 1TZ8A 4ZAKA 5D1QC 4XO5A 1I1AA 2LTQC 3WTYA 5KSUB 3WEMA 1TENA 1WC7B 3OXSB 2VL4A 1YDPB 1MFUA 4QHPA 5HDQL 1GYVA 5EZPA 3DJSA 2GB2A 5ETUA 4IU3B 4DP0X 1FSKC 5LBGA 1BEYL 2QLYA 2RIKA 3CDZB 3EKCA 3UBXB 5C92A 3H3PL 1J5OH 2V37A 3UGEA 1E2WA 1G9MC 3QR1A 2UZIH 4IYKA 5E2JA 3T77A 2NYYC 2DICA 2ENJA 4HJGA 4KOCA 3D5OF 2AXGA 1NBYB 3QPQD 5FFOA 1PYWB 1H6UA 1UJ3B 1YYML 2VR5A 2PYEE 3QDHA 1N10A 2WKOA 4FEMA 2AMUA 3UTSE 1ITCA 4ZFZA 2HT4C 2P5WA 5C0AE 1DN2A 4OFKA 4ODXB 5AW8B 4A04A 5HPOA 2FWLB 2K6ZA 4N8CH 5HHMB 2ZCLH 1N4XH 3BEWA 2PWDA 2ZX7A 1IGFH 2A1WH 4FG6C 3GKWL 4N4YB 5IQ7H 4H0HB 4DGUA 2HG5B 1H5BA 2YMTA 3X3FH 4UTBL 3MBED 4E9XA 6PAZA 1MW3A 4BXVA 3WDJA 1R47A 1HN1A 3AG4B 4A38A 1HINH 4LOFA 3AITA 2NX5B 3M17A 3L1GA 2PWFA 5EZLA 1KIQB 2OMWB 3MXVH 1S7TA 1ZT7B 4KNSA 2WNXA 5AW9B 4MD5A 5GRYA 4Q9QH 4WFFE 4W6WB 4ZG1A 3WCYA 5E9NA 2GI7A 2BY0A 2Z7WA 1CLOL 1DJHA 4NAJA 3EH4B 3WL9A 1U42A 4A63A 3ECUA 1P5VB 3ESUF 1NFDB 4KVNH 1EEZB 4G1EB 3GM8A 3H7BA 3PAUA 4Y4HA 3IU4L 1G4RA 5C0ND 3EAKA 1JGLH 3DRQB 3IU3A 4CW1A 1KBPA 1I53A 4XN2A 1PKQB 3QCVL 4X98B 2XV3A 5DMGC 4E5XG 5KSAB 4BCYA 1JHTB 4LPWA 3U7WH 4DSYA 2YAEA 4CU7A 2WNKA 1L9SA 4Y5XC 5HHOD 3G9AB 3BDXA 2XWBB 3WENA 2XYCA 3MUGA 1E6JL 1W0WA 2OTUB 4X6FB 1JV2A 1U8LA 1IM9D 1FGNH 1RHHA 4Y16C 5FGBC 4O2EB 3HN5A 2YOCA 4PJDB 3UPCA 1I8UA 4JFFA 1SY6L 2LHAA 1SJVA 3X2QB 1ZLVK 5E5MA 1GCFA 4XAKD 3V4PL 1MVYA 2FBOJ 1PSKH 3COOA 3TIDB 2CO6B 5C07D 3ZQWA 4CN6A 3IJYB 5DJ6A 2IG2L 3BXNA 4GSQA 3TJEL 5E94B 1NBQA 3OR6B 4NLAA 1XF3B 4JHAL 3MU3A 3C5ZB 3U4BH 5IG7B 3ECBB 3ZL2A 1S4IA 1WG3A 3Q3GB 5DUJA 3ESMA 4OLYH 2HLFC 2X9ZA 2X3CA 3QHZL 4IMKC 4P4RA 3GLZA 2R23B 1WSST 3ARQA 5GQBA 3LD8B 4QRRD 4U6YB 1ZHBB 4JHBA 6CGTA 1OAKL 3FU3A 2CO7A 4GRLA 3DV6A 4NKQB 4ABVA 3S35H 1RZGB 1KEGL 4HAGA 3CFKB 4R7NB 2Y06H 1XF4A 3BGFC 3Q2VA 5AG8A 1IEAB 3EJCA 2WZAA 3ECQA 1J1PL 5B1JA 3VE0B 1PG7H 3LS5H 4Y4FD 5JR1H 1ORQA 3U7WL 3G04B 2A6IA 1L0YA 4XVSH 3TN0A 2JIXD 1TITA 4H20L 4MMXA 3KWTA 2V9UA 3IGUA 3MLWH 2E7LA 4AEHH 5B8CA 1KYDA 3C6SA 2DWSA 2Z3FA 4W9IC 5EWIH 3ZTNH 3HBQA 5EZIH 5SX4I 3TVMB 1H9DA 4YFDB 3X1GA 5IBTH 3OD3A 1MFDH 5FKPA 2D03L 3IK2A 5IZ7A 3M1CA 3NABH 4FDWA 4ELDA 4TUKH 4RGNC 1N19A 1MWAL 1EBAA 2OYLA 3VFUA 2G2RB 2EIDA 4BM7A 1EHLH 1NGXB 4OZHB 2B2XH 3HMWL 1CB4A 5LCVA 1RU9L 2OA9A 3HRPA 1KSRA 2HTLC 2GIYA 2PWGA 3QIWD 2PYFA 2GVYA 4JO3L 1NH6A 3O4OB 1ZJBA 2GTWA 3QJTB 4ICWA 4FQXA 1U9KA 4HU2A 4HPOH 1FO0H 3H9SA 1DVZA 3L16A 3FQNA 4JFEB 5E2TL 3J8F7 2W9DH 3MX0A 4HU8A 3BP4B 4HJTA 3B7UX 3W2DL 4HJEA 3QIBA 2MKLC 2ZG1A 1DEEB 4OGAD 5AZ2H 4XX1E 1O9VA 3LH2L 4LGPB 1DVFC 1RZFH 2JJTA 3WN5A 1J05A 2KZBA 3WNMA 1NUNB 3VH8G 1QTPA 4AYBA 2AEWA 2DJMA 1PZDA 2FYVA 3ZTJH 4NNYA 3EO0B 5F7DB 3UIZA 1UD6A 1FNEA 1XAKA 3I3BA 4OZIF 4Q0XL 3UC0H 4BZ1H 4HIJA 5E00A 1ZS2A 1KCBA 5A2BA 1MY7A 4DCQA 4J5VA 3PQYE 3S3BB 1SGKA 4JHWL 4PJCF 2X4SA 4YGAB 4EI5C 2LT9A 1II4E 4PBVC 5G55A 5M7QA 3WD5H 3CZUB 3NUKA 5B3NA 4R4FL 3VFTB 3O4LE 3L1OL 3QQNA 1IKFL 2FD6L 1AC0A 2ED6A 4Z7VE 5HHXH 1MQ8A 3S4SG 4YDVB 4HCFA 2V2WB 3LPOA 1L3WA 4NQQA 1B2WH 1MVUB 2HWZH 3BCFA 2UXFA 1NFIA 3EXJA 4WO4A 3VRLF 1I7UB 3QUXA 1RZJC 3MSPA 2BSSB 4NCC2 4ZJ9A 3U6RA 4NIYE 4HWNA 3GS4A 1VERA 1W72H 2X9WA 4CVXB 2H32A 1J88A 3GGWB 4H26B 2VN6A 3KLHC 5BS0B 3G6AB 4ANWA 5EU7C 3IWVA 1FH5L 1F3JA 2CA3A 5GRXG 4EIZC 3FH7A 4O00A 3WTTA 5IMKA 3W37A 5MEND 3HUJE 4AKPA 5FHAH 3ATEA 4X5XA 4YZFF 3IFOB 3JV0A 3MRNB 1PZ5B 3BT2H 1MLCB 4JL1A 4K2UH 1A9VA 1K5WA 3DX4A 5I15H 1DJWA 5TE6H 1G6VK 3GXNA 4YIQB 3V2AR 5HDRA 3KPLB 4W93A 2YAMA 1RZ7L 3APMA 5GJTH 5EZLB 3QFJB 3ZYIA 2YD2A 3Q7JA 1GS8A 4AGMA 4OU3A 2P80A 3EDDA 3O3BB 4Z3FA 1UZGA 2EUVA 2R8SL 1O9ZA 1S7WA 2Q87A 5JIQA 2VDNH 4FYRA 2R29L 3LHAA 3UG3A 1FZOB 3WL9B 1WA0X 3SYOA 2X6BA 2FJGA 1FDLL 5J6SA 3PWVB 3S5YA 3FYEB 3K4DA 3VG9B 3PFQA 1CLYH 3O4LA 3QG7H 4JE4B 2EH8H 4WI0A 1L0PA 4PJHE 3L5HA 3NQKA 5AOIA 3TU6A 1X4YA 3NSXA 3IDJB 4DP4X 3ULVH 4R4FH 4MAYB 4F7EA 2XX0A 1ZGLB 3KZ8A 3CVBA 1Q9KA 1NGPL 2XRAH 3DX9A 2XACC 4H8WL 1VKXA 2JCWA 1KOAA 4EN3D 1WAAE 4NPJA 5AOLA 3SE9L 3X1FA 1S7SB 5BJTB 1KIPB 2YAHA 5CGBA 3LN4A 1CQYA 1OTUC 3DIFB 1U58B 2BP3A 4B9IA 1N64H 2GITB 3BPOB 4U3SA 2K7PA 1M1XB 2YC1B 4YDJA 5ERWA 2C7UB 3RIKA 5F0JB 1AGDA 3FB5B 1D7BA 3UG4A 1EFXA 1CXIA 1SY6A 1NMCB 2YPVA 3HNVL 3JTTA 2PF6A 2PCXA 4LLWA 4OIBA 4WRLA 4WSKA 3I6KA 4ODUB 4PEEA 4XMLH 3CVHH 5DLLA 4ELME 4F5CA 2NY7L 3HC0A 3US1A 5T3XH 3T8XB 1DQQA 3QJUB 5EG6C 4ESKA 4R0LA 1I8IA 1S7RA 1QTYT 2WLNA 3CQPA 2H2SC 2ARJA 1D5BA 1SXAA 3S37X 3H55A 4Z9KB 2ENPA 4NKMA 2J2ZB 1X6NA 2VSMB 4NM4H 4U6YA 1ETB1 3VW3L 1I9JH 3V5DA 1MLBA 1T6BX 2DMHA 4X6BB 3ARRA 1XGYL 4MS6A 3IFPA 5LWYL 4F3FB 4KVCL 4Z1PA 5D72H 3DVFA 2F5BH 1ZVNA 4PJXA 1X5JA 3QULA 4PP1C 3VMNA 4IBLT 4OZFA 4WK0B 3BPLC 3O0LA 4RAVA 3SGKA 4MCZA 1NWOA 5CXPA 1DVYA 3SPGA 3WGUB 1SJEA 4JG1L 2QDVA 4A39A 3MLPA 5E7BA 5B3JE 4WUKL 4ZW6A 2EICA 2BDNH 5L2KA 4ZDHA 4W4NA 3SE9H 4Y9GA 2D7QA 3E9UA 4HXBH 4JJOA 2R9HC 5DVOA 3TVMA 2H2PC 4C55A 5H2BB 1AQKH 4JHWH 2GBVA 4LKXB 3F58L 1AQDB 4X7EC 3ABMB 5F9JA 2Y2WA 4UV4H 4EUPA 3TBBA 5I6PA 4PY7B 3ULUF 1OE2A 5T3ZD 4R8WL 5E6ID 4EZMA 5I0WA 1CYGA 5D8JL 4ABUA 4KROD 2SEBB 4XPGH 5GXBB 4OBRA 4AL8H 2DTSA 3C5XA 1AR1D 2ATPA 4P2OB 1V10A 2AI0L 2AJZA 3K91A 3LKRB 3ZMNA 5C2BH 1Y6MR 3LKPA 3Q1SH 2DM7A 5C07B 3A47A 2NY3D 2ZCZA 5C6PB 4I3SH 4JRYB 5F3BA 3N85L 1OCWH 2F19L 4YWGH 5AVRB 2OSWA 3C5ZD 4ATTA 3BKYH 4WFED 3WV0A 4I48A 4MQ7B 3IFNH 4K5MA 4Z7UB 3CU1A 4A37A 1TZHA 5FO8B 3OG6B 3VWKD 3H1ZA 3UAJA 1MPAL 2ZIDA 4NUGH 2I07A 3V10A 1IC4L 4NQSA 1YEKL 3ARVA 1OTUD 2C3VA 5I8EB 1KJ3H 4KV5E 1G1CA 1JNHA 4LSSH 5F0PB 1G84A 3IAGC 4BUQA 1CTOA 2DB8A 3KPQA 2LLNA 3QWRA 2W0FB 3IETB 1U3NA 2ORBL 1WWAX 3QEGH 2F53A 3SJVB 3WNIA 3WS3A 1KTLA 3TCLB 4I4WB 4KMQA 3B7SA 3ALXA 3QHFL 3MJWA 3CLFL 1OM9A 2ZE0A 3ULSA 3VTTA 5DVMA 2YUVA 2CGRL 3KH3A 3DO4A 3NABL 4LLYA 2EDXA 4XP5H 4YZWA 1G1KA 3LMJH 1UH3A 1LTXA 1WIOA 4YPGA 4AJVA 2BP5M 4NNXB 2DL2A 1IAOA 2VYRE 2WO4A 5KBNC 4WEEA 4RGND 1AGEB 3FF8A 5DEFB 3JZYA 4IBSA 3UJJH 3S96B 4KJWC 3U0WL 3WXVL 1U8NB 1A64A 1YN6A 3ETSA 3V5KB 4NT6B 5C09B 4JZJB 4U1LB 1EPFA 4QRTA 4PRPA 3E80A 2V2WA 4YR6B 3CK0H 3SPCA 4EUPH 4PJCA 2B7DT 4LAJH 3U7YL 3O3EB 4BIKA 1P9MA 2P45B 3AXLA 4DGYL 2CRMA 5J6GB 3EGDA 3NA9H 4PWJA 3FO9A 5JQIB 2I26N 3HW7A 2FEEL 3U6RB 2APBA 1FL6B 4PLJC 1MKFA 1UC6A 5J1AA 3MLTA 1NEZB 5C0IA 2IANB 4MCYB 5BQ7B 4NI6A 3ARBC 2YUWA 1TZOA 4I5BB 1KCUH 3C6LC 5LXGL 1DDTA 4ZFOA 1Y0LB 3B3BA 3DBXB 3AFLA 3P1VA 4AG4H 3L4WA 4ILDA 3ERXA 3AQYA 3MKGA 5CGYD 1GS7A 1PD6A 1UEYA 4J7RA 2X70B 3BT2L 1CCZA 2VXQL 4L3CA 2KQMA 4L1HA 3QRLA 4UQIM 5BRZE 5T5NG 3TH3T 4HQQL 4U6XA 3C6LD 1U8MA 1XBRA 1XFPA 4PN6A 3MOBH 3LIZA 4G7YL 4AIZB 2DQIH 1AGBB 3UO1L 3EYSH 3VI3B 1CFTB 2YN5A 2EEDA 4UIMA 1RIHH 5D2NB 2DWDB 3CZKA 3S8FB 1EZSA 3GS0A 3QFDB 1RSYA 4EI5D 1R3KB 5C7ZA 1WAEA 3QDAA 4FADA 2ZOWA 5FV1L 1UWEH 1UZ6E 2WXPA 1Y18B 3SDAB 3VXME 4PCTA 3O4LB 4TTGA 4OT1L 3IWUA 1QO3B 1CVRA 5D7LA 4HD9A 1N5YL 4Q8BA 4N24A 4GQRA 2UY7B 3UJJL 3P11H 1T21A 1E43A 2EDEA 3FZUD 3IEAA 3NIDF 3ZUNC 2ROYA 4OQTH 5BUGA 4Y2DD 2G5RA 1YPZF 3LJ3A 3MREB 4K9EC 1P7HL 1MNUH 5EU3B 3T4AB 3P3YA 3A21A 4UQ2A 5CJQH 2WZ6A 3CN4A 5I8KH 1EJFA 4M29A 3GXDA 2VZUA 1Y1UA 4X80H 4TQPA 1T66C 4I85A 4NFDA 4G7VL 3K6DA 5D93C 3SPHA 4FXGB 2F74B 4X5RA 5F21B 4FN0A 1E27A 4LP5A 2J5LB 1HYSC 4F7CB 3WLBA 1D7FA 5ID1A 2YC1A 4KQ3L 3D25B 4BFRA 1EHKB 4Q9CA 2GT9B 1AHWB 2YD9A 4QJ4B 3TGXA 1X6LA 2EDDA 5CP3H 3VXRA 2HUHA 1M7IA 3L4UA 1NGYA 1GZHC 3BIBX 5JXAL 3QUML 3I84A 4TTDC 1YMMB 4UDUA 5HHVL 2B3RA 4CC4C 3UGXA 3ILPA 2DQIL 4OLVH 3QNZB 5GRUL 4AYFB 2YQBA 4Y5YC 1FIGH 1JOIA 4NRYB 5LDUA 4PU2A 1X7QB 3U4BL 4HS8H 4LCWA 1X4XA 1S46A 4JPSA 2YGVA 4NKMB 3SYAA 2D2CC 4OTXH 1IC4H 1PD0A 2XN9D 4X5PA 5KYNA 2B4CC 3I6SA 4M1CC 1BZ7B 4OCYL 2Y5TA 4M3JA 3DX0A 1OTTD 5GGSA 4C56B 4A6YA 4HK3J 5MP6L 3DOSB 5F88A 3FK3A 5ICXB 4UNVA 5EUOB 5BZDA 4PJEF 4L1SA 5E1QA 1L7TH 4ADGA 1LD9A 2ZXWB 1NC2B 2BFVH 3T2LA 4X4YB 2DWEA 5I17B 4ODWB 4I0KA 3AMLA 1AE6H 5B1AB 5DZOA 1ZSHA 5EOQL 4R26H 4YOKA 4GT0A 4CJ0A 1UA3A 3TFKD 4F57L 2LU4A 4OZGA 4WHYG 5JA9A 3UZVA 4LKXA 4LNVA 1CLYL 4JKPH 5T1LA 4BE5A 4EUPB 3U6XA 4GG6E 4PY7A 4P5TD 3F01A 2YFNA 3OMIB 3RGVA 4C47A 4HJSA 1YSOA 1AKJA 1I3UA 3SBPA 5D7IF 3FAXA 2YMOA 1RUPH 3RX5A 4U1HA 3EJYD 3APFA 3OLDA 2ATPB 5IBLD 3RZCD 4MA7L 3MGOA 4IGBA 4OUUB 1K5NA 3EJRA 4FEIA 4WEBH 2PO6A 3F64A 5H94B 2NSQA 4ALAC 1A6TB 3X17A 1P4BL 3ABZA 3L3OA 4I3GA 2FEDC 4JFOB 2WQSA 2O5YH 4N85A 5DRWA 3OMZA 1SDYA 4H5SB 4MLIA 2MFNA 3CQFA 1G7JB 1RK0B 3PY9A 5FYLL 3ZE2E 2CBMA 2K45A 3HI6L 1NGQL 4I48B 4MQ7A 4JCMA 1IAKA 2BSRB 3OXRA 4Z7UA 4HULB 3HNTH 1PAMA 4PWFA 5C70A 1DQJA 2GK0A 4RQQB 4F20A 5HDLA 4JPVL 5MI0C 4K8RL 1OVZA 4F2FA 4S1RH 2AHIA 5FFLA 3PE9A 2JJVA 3RWFB 4XOBA 1C7TA 1YEKH 3VXUB 4LCIL 5D55A 2KBGA 3MBWB 3D3VA 4LL9A 3PP3H 3G6JA 1ESOA 1RP9A 1KTRL 3HZKA 4FABL 4TSCH 1MHHA 1QLRB 1VFUA 4Y19B 2GTQA 2BVPB 3CN2A 5EDXA 1ACZA 4YDZA 3AMKA 4GUPB 3TWCH 3EJZC 4QRFA 3GRWL 3OAWA 3RP1A 1UA7A 2QBWA 3S3PA 2WWOA 2BHZA 5AOJA 1T04B 4P46D 5SX4H 2Y1YA 2BZ7A 2RMNA 1OQXA 5EBGA 3QPXH 2R29A 4QXUL 3A5VA 1MIEH 3FCSA 3HAEH 5D7IA 3QR2A 5GGTH 2GUOB 3H56A 5ADPL 1CGUA 2V9TA 4L18A 4YH6A 1JMZA 3GMRA 3GZQA 3LPWA 4PI2A 4NQEA 4XH2B 1N9PA 4OIFA 5EIIA 1BVNT 4F1SA 4TSBH 3B9KA 3CCHB 1WHOA 3NPZB 4JY5L 4P2OC 3EO1B 3FSOA 4FOMA 5HI3C 4BRVA 1DBBH 4J1UA 2JKRM 1XCQB 3KG5A 2VMEA 4ZAKB 4P3DB 2WWKT 3LN5B 3U83A 1NMAL 1FO0A 2BLFA 1CLOH 4QT5B 1FNAA 3N1GC 4OZHF 1D5ZA 12E8L 3CFUA 4N2BA 2IGTA 2N59A 1MQKL 4R3SB 4ZW7A 3MRQB 4FERA 5KYXB 4PUBL 3CDZA 3PPSA 2O6PA 3TL5A 2JE8A 1W0VA 2XKUA 4U7SA 3EGSB 1OZTG 3EYFB 3NTCH 2WAQA 4X6DE 1OP9A 2Z65C 3IDIB 2XA8L 1BZQK 4X4XB 4KKAD 4KVPA 5LBSH 5TPWL 4JM2C 2VN7A 3FN0L 2YAFA 5KSBE 2WIIA 3PQYB 3D05A 4N26A 1AZUA 4QY8A 4PRBB 1OXYA 3IXAB 2J56A 2E7DA 3HMXL 3GB7B 3OPZH 1QSED 4Y16A 3FRPG 4AEIL 4N2OA 5T3ZH 1HOCB 1MCPL 1E9PB 1OT1A 5TPWH 5CGMA 3THMH 1U95A 2NXZC 3BRFA 5BQDA 4N2EA 2BFGA 4N9GA 1TVDA 4A7GF 4QMEA 1RL1A 3HS0A 3O11B 4JDZA 1JGVH 3HFMH 2KLTA 5HJBA 4KNTA 1KTDA 4LQ1A 5A6IA 3C60C 4L4JA 1M6OA 3F7RA 1I8LA 4GFTB 4Z7IA 2HKHH 1KLFA 3LS4L 4OZFG 3BGMB 1A7QL 3MBEC 3OKMA 2A3TA 4YDIL 3BPCB 4U0QB 4DGIL 3O9WC 4LPYA 2NTFB 2ZOUA 4U1JB 3MV9D 5CEXA 1OF2A 2QGEA 5TJWK 3U4EB 1O75A 1SUJA 2CZNA 4LF3B 5I1CH 3WIHA 4F57H 3LS5L 2OCCB 3ARDA 2IPTL 1DQVA 1CFBA 1LO0L 4MXWH 3WYRA 3LB6C 1RUAH 1RZJH 4NQXB 3OR7B 3WTVA 3R0NA 2MRYA 3GJFH 5GGQH 1LK2A 4NRZB 2WTOA 4M4RB 1N8ZA 3D50A 2ADYA 3Q48A 4ZMTA 5E24E 1Q0XH 3PCYA 4O2EA 4BZ2H 3TESA 4FQLH 3SBWA 3ZSTA 4PW9A 3KPPA 3R4RA 1HH9B 5L6YH 4G8IB 4LCCA 5KANI 1MJUH 5MEQB 1CDBA 4HGKC 2FWUA 4GP8B 4DN3H 3DX3A 4OFPA 4QDGA 3UO8B 4BQ9A 1CDYA 4F8PA 5KYYA 3KPNB 3WKPA 4XE0A 2I32A 3CZEA 1J9QA 4TNFA 1UOKA 5E94A 3UL4A 1DE4A 3H2PA 4U1GC 1OWWA 1PX3A 3M86A 5GRUH 3RB5A 2AF2A 2AQSA 1RERA 3QIWC 2L0DA 1MF2L 4P4KC 3JWNE 1XMEB 1BJ8A 3QUMH 2GK2A 1DN0B 3QQDA 5A2FA 1JZGA 2WUBL 1HHHB 1TVBA 1U2HA 3GKZA 2WQVA 3F05A 2FR4A 4G9FA 4IRJA 3T65B 5C6TL 4R7LA 1A5FH 2D3VA 5D6CA 5FGSA 2LV4A 1G7HB 3GBEA 1ND0A 4G6FD 4JO3H 4XMKL 4APQD 2JB6A 2VUYA 5DHEA 1FFTB 1BM7A 3PXHA 1YUHB 1ZHBA 2B14A 2A77L 3EH5B 3W9DA 2DN7A 4IU2B 3ESOA 2BP8A 5E70A 4JQIL 2FBJH 2G75B 3ZKXC 4BFEA 1R33A 5E2VH 4CA4A 4G6JL 3SCMB 3KLKA 4FG6D 3NIGF 4JRLA 5AYTA 5JW3H 1W80A 5J13C 1OB0A 3RPBA 1MN4A 2BCKA 1PG7X 1QFUH 1UB5A 1Z3GH 2D3JA 4PJ5D 4JKPL 1NBVL 4UUJA 1HL5A 3CN0A 5DS2A 1A6WH 4FQJH 3NSJA 4ZPTB 2MQ3A 4EJ1C 5B8CB 1AIZA 4JG5A 3KS0J 1CT8A 1U0QA 3GSOA 4OIIH 3ASWA 2WVUA 4UTAL 2CMRL 3MGOB 1F58H 3B5GA 4G7QB 4JRXB 1AHWC 4OUUA 3N41F 5T1JA 4QLWA 1SN5A 1UZ8A 2A73A 1PZBA 1NDGB 4FQQA 4WJ5A 5DJAA 3ZU8A 1OOWA 1UZ6F 4Y8AA 4ORZC 2OS7A 3K4AA 3IDUA 1X9RA 2JK5A 1M53A 2R2EB 3VH8B 3V6ZA 4EO5A 2IWFA 3ZRCC 4LIQE 5SWQA 3S3SA 1BYNA 8PAZA 1BQLH 1BECA 4JM2F 2ZG3A 4B0MM 4N2LA 4BFOA 1MHCA 2ZOLB 1OOAA 2Z9TA 4DTGL 3SYPA 5SWSE 3GSXB 1S78D 4D94A 5HHVH 3H9SB 1CR9H 3MMEB 5CS7A 4XRCA 1G9ML 4GIOA 1I1AC 1QSFD 3ZIMA 5E6IB 3GDBA 1AGCB 2VDLB 1R5VA 2BNQB 5JPMB 4CN4A 1OT4A 1U8HB 1BG9A 1IGYB 3QNXB 4HUWB 3DVIA 1T04A 4Y16D 1ZDSA 3V6OE 3HE7C 1U8IB 4QRRB 2R4RL 2H0EA 1GCYA 1PY0A 2MQ0A 1SXCA 1TNNA 2VR8A 5DFAA 5IF0A 4KUZH 4K8RC 2D4DA 2W1NA 3ZHLA 1GZPB 2EO7A 5I9QC 3H0TB 2WW8A 4MJIB 4P2CG 3RPIA 4AV5A 3BZ4A 1ZLUK 1H0DB 1PIFA 5K39B 2BNRA 3B37A 1VIWA 1MCRA 2VDQH 2AANA 5DUBA 2NX5D 1FWXA 1FV1B 4J1UB 4LFHD 3QXAA 5HYQB 3RI5K 1A0QH 4X9BA 5GRJH 5C09D 3FTGB 2YZ8A 2K4AA 4HS6B 3C8KA 1NAKH 3N43F 4A68A 1AQHA 3D30A 2VLJB 1UURA 3DMMC 4ANXA 1C08A 3WNLA 4O51A 5FX3A 1OHZA 2ZXCA 2DI8A 4YDVA 2WYTA 3RFZC 1YN7A 1PBYA 5F96L 1CTNA 1UD8A 4WW2A 5SWSD 5GZNC 1CG9B 4MD0A 3G5XB 1G6RB 5EC1A 1KXQA 4AQAA 1HQRB 5F9WC 1KMGA 2PXYC 1CE6A 4HS3A 5FDWA 3LDBC 3Q6GL 3U1PA 1OP5K 5IK3B 1L9QA 1T7YA 1H3PH 1EXHA 1AC6A 1WTLA 2BNRD 3MRKA 4DUWA 3RFRA 4LEOB 5FO9A 3BAIA 4JFEE 2AVGA 3IYLW 4LLDB 1S9VB 4YS4A 5HPMB 3HCVB 2ZUQC 2WCGA 4UAHA 4UOJA 3JWOC 2DLTA 1NANH 3WEAA 2CQVA 2LAAA 1OW0A 5LGJB 2NNFA 1YYMH 1ZT1B 3CGTA 1S3KH 1YJDC 2FNWA 4Y4HC 5E9AA 3P3RA 4JM2D 2E9WA 4Y4KD 4Z0BL 3KYNA 5FCUH 1NOLA 3IFOA 4YXKL 3GUFA 2IAMC 1JP5A 1MIMH 1N4XL 3TEZA 4LEBA 3VD7A 2DKUA 1IB5A 1D6EB 3O3AA 2CDGA 5SX5H 4NCC1 5IT2L 1UTDA 1IARB 3VWKA 4XZUB 3QS2A 1XQ4A 3QNYB 3QUYC 5DD3L 5ANME 1IZJA 3DO3A 2GJRA 4RRPM 1HKFA 3BQUC 3KPSE 1CXEA 1M6OB 5DGRA 1YNTB 2WXJA 1YMME 4KKNA 1QYGL 2HLEB 4L8CA 5HDWA 1MDAA 1AFVL 2KUTA 4Z76B 1YEDA 5ES4B 1RLWA 2Z4QB 5FOBA 3BPCA 4JFVA 1QR1A 5I2IA 4Z3GA 2NTFA 2JKXA 4WY7L 1IKFH 4FF9A 4KX9A 2O5XL 2MKWA 4X9YA 2GYSA 2EDHA 2NUTA 2HVKA 4HWEH 4QTHA 3T2PA 3JWNG 4XNYH 2EINB 1GMIA 1JV5B 1ES0A 3DURA 3RVUD 4B7LA 4JFYA 2E75C 4JG1H 3M88A 5FYJH 2R7EA 4LHQB 2DQFA 3VI4A 4ZD3H 3HAEB 1NCCL 3QJZA 3MLXL 1VDGA 1A9EB 2QPSA 3P9MB 3QCUL 1TF4A 3QAZC 4MMZA 4O2FA 4M4RA 1T7XA 5BS0D 1JNLH 2ZCKH 3CSPA 4KZ0A 1YEGH 2XN1A 4KUZL 4KI5D 2QQQA 2PTTA 3LPPA 1GGIH 5DLMH 3TEWA 3GYRA 2COQA 2PCFA 4S0TD 5C7XH 2X5PA 3IBEA 1YNKH 1VPOL 2V17H 4J6RH 3X1BA 5DYOA