5T33L

Crystal structure of strain-specific glycan-dependent cd4 binding site-directed neutralizing antibody cap257-rh1, in complex with hiv-1 strain rhpa gp120 core with an oligomannose n276 glycan.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
212
structure length
212
Chain Sequence
YELTQPPSVSVSPGQTARITCSGDTLSTKWSYWCQQKSGQAPVLVIYEGNKRFSGTPAKFSGFHSGTMATLTISGAQVDDEADYYCFSTDSSGQTWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP257-RH1 heavy chain
publication title Structure of an N276-Dependent HIV-1 Neutralizing Antibody Targeting a Rare V5 Glycan Hole Adjacent to the CD4 Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t33L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t33L01
5BMFH 2Q7NA 1ZLVH 2HT3D 1K9TA 2KUTA 2F5AL 3IJSB 4LVHB 4X6DF 4GRLB 2ZPKH 4RX4A 2FO4A 2DQUL 2BNRD 3MRKA 4BZ2L 3STLB 4YBHA 3SCMD 3GRWA 2YD8A 3BP4A 5FYJD 4AIZB 4XBEH 2GKIA 4LSPH 2NW3A 5ERWB 1CGXA 2EEAA 3ZTNL 4LSVH 3SJVB 2BY0A 2IH3A 4J23A 5IW6B 2EDLA 3C60B 3ULUL 4UV4H 5INCB 1FYTB 3EYSH 5GS2D 2I60H 2P4AB 4XAWL 3CXHJ 2MPAL 1MREL 5F7LB 1T21A 3SGEI 1ORSB 5F1IB 4N8CL 4B50A 4LSDA 4P2QB 1B88A 5D7KE 4RBPH 3QT2A 4LEOA 4RGNB 4OF0A 5F6IB 5HYQB 3GZKA 1JRHL 1UQSA 1DANT 4UIMB 1QFPA 4LOUD 2X4SB 4X4MA 4CU7A 1MF2H 1O0VA 4JHWH 1AY1H 2PTUA 3JWDC 4Y2DD 4HK0B 4QRQA 3FQNA 3MNZB 5TFSL 3BWAB 3DBXA 3WKMH 4L4TD 3RZWA 4NQDD 4EBQH 4UZGA 2QR0A 1TCRB 2F58L 5DD6A 4PJ9A 4ERSH 3ZE1F 5HGAA 1UZ8A 2Q86B 3QO1A 1KSRA 2X44D 1FCGA 4ZYKB 4JGJA 1KLGA 4JFEB 5FUOL 3CAFA 1MCNA 2BVPB 3L9RB 1IAOB 4I4WB 5DD1L 5FYKE 3ZMRA 3Q5OA 4M93B 5HGBA 3I85A 2R0ZL 3QPQC 4KI5D 3U4BH 1FGVL 1A9BA 1EZVX 3UAJC 3P0VH 5GRJL 4X7FC 1JGEA 4V1DE 1HSBB 3LOWA 3WLBB 1FL5B 4PJEF 1UACH 3O2VH 4JRXD 4MD0B 4O02H 4XCNB 3G5XA 2KKQA 4IRSB 1K5NB 2Z91B 1E6JH 1ZXQA 1DANU 1DEEB 3BO8B 1I8MB 4MAYD 4JFPA 3PGCB 4CL7A 3MV9B 3MV8E 4IIQC 1ZKAA 4Z7NE 3FQTB 2VDKL 1H3VA 5BV7H 3WE6B 4KAQL 3PHQA 1IM9A 4I3SL 4JB9L 3D0VA 1IC1A 4Q9QH 1ZHNB 4X99A 3QXDB 4G6FB 5T33L 3RWDA 2YPVH 5DEFA 4FMKA 2MTPA 3U0TA 1HXMA 4JRYB 1R5VB 3QEQE 5EBWB 1T03L 1GCFA 4H8WC 2J12B 4KKNA 5FM5O 4FQXD 5IJKA 4R0LB 1DDHB 4ESKA 5D7IF 1T0NA 4HXAH 5C9KA 4I5BB 4WY7H 5HD8C 3WIIL 1ZHLB 4XBGA 5J9PA 1VGKB 4X9HA 4XNZB 4ZMAT 1NEUA 2CDGB 1YMHB 5I1HL 5GRUH 4QF1A 5EU4A 1IQWL 5GS0L 1AQDA 4PJBF 4D9RD 4UBDD 3NCCB 5EO0A 4FZ8L 1OT1A 2IH1A 2HA1A 3TH3T 1P7QB 1Q9WA 3LIZL 1SM3H 1RZKC 4NHUB 4C56D 4ZS7H 4IDJH 3W9EB 5I1JL 3DIFB 2BSTB 3DURB 1IL1A 3FB7A 2SEBA 4NO0D 2G5BB 5F88B 3KLHC 2FL5A 3MOAL 5J12C 1J11A 2JIXB 2ICES 4J6RH 4Z76A 5DJAA 1GSMA 5I6XC 2GUOA 3P4OB 3D2UA 4RGND 1S78D 1TQBC 3BMWA 3T4AB 2DS4A 3WXWH 4ODSH 1MCBA 2CR3A 1KCKA 4OD1H 3Q3GA 2R0KL 3SDCC 4I3GA 4XXCC 2UWEA 1MFNA 1FVDB 32C2A 4CBPA 5FK9B 1GIGL 4H25A 3X11B 1FL3B 3HRZA 3L5XL 1KOAA 4HGKC 1A7PL 2NNAB 3FB5B 3D0LB 4J4PC 4XNUL 3VRJA 5KJRH 4FQQB 3RWJB 2AQ1A 3UBXI 2DI7A 1HKLH 4OZ4A 2XN9A 3W9DB 4JFED 2VQUA 1A6VL 3V79C 4TULH 1EXUB 3SGJC 4P3CH 1UH3A 4PJFF 5LQBH 5EPMA 4K23L 1H5BC 2HKHH 4K8RD 2NW2A 4G6KL 1NCBL 4Q2ZA 4X8JA 1WT5A 1UZ6F 5EU3A 3MJ6A 5D7JA 3QFDA 1PG7H 3ARRA 5EA0L 2CK0H 3MOQA 4HH9A 5CD3B 1L0QA 1U93B 2ZNXA 3HI1A 3CX2A 1D9KB 3WMSA 1G7QB 2VMFA 5HHOA 5IG7A 1INEL 3HE6D 1QFWM 4H20H 2HTKD 1PX4A 3UTSA 5C7XL 4IRSD 4MDJA 1KB5H 1MLCA 1NGZA 3VDCA 4NQCE 1PYWA 5BQ7A 3KPRA 1AP2A 1JPGA 5H2BB 1YMME 4M1CC 2ICCA 3FRPG 3OGOE 3ZKND 1Q94B 4UB0L 3L7FA 3EFDH 1IC7L 1T2XA 3QG7H 5DFVD 4JZJB 2VZUA 3W2DH 3RUGB 1NBYB 5GRXG 2F53E 3EYOA 1FNLA 3TIEA 3HZMA 4F2MA 3GM0A 4EXKA 2A6KB 3JV4B 5DEGA 3O6MH 4UAOB 3RWIB 4LSQL 1DUZA 2FWOB 2XQYG 4WFFE 4LU5L 1JZ6A 2P5ED 4Y16D 1OP5K 3T4YB 3CFIC 1I85A 1F6AB 1SBSH 3CK0L 5ELIA 1J86A 4GG8B 3S4SG 4KHXH 2F54D 5GIRA 3TBTB 1JWUB 4TPRH 4S10A 2GK0A 1IAKB 3OGCA 4JJHA 2DAVA 3PWNB 4G8FA 4MNHA 2ED7A 4NN5C 2M1KA 4HGWB 4R9HA 1VFOA 1KPUA 3QUMA 3MRPA 4HK3J 3E2HB 3FN0L 4O51B 4KWUA 4PR5B 4YZFF 3UCRA 5J4MA 5KSAB 5DVOA 1CLYL 1VADB 3ORJA 1FZMA 1K6QH 4CVXB 2Y23A 4OIBA 5DMYA 4BK4A 4PRBB 1BZ7A 4D9QE 1ZGLB 3F5WA 4UQ2A 1MY5A 1DFBH 4N1EA 4P3DB 5IMMB 4OZHA 1N3NA 4HZLB 1MCPH 2BHYA 3MROA 4D2NA 1ONQA 4XZUA 3M8OL 4Q0XH 1T66D 4YO0B 1RFDL 5JMRA 5KTEH 5DQDH 4G9DB 1NMCB 1GYAA 4WFED 2JB5L 4J3VA 1EEQA 1ZVHA 1GHFH 4I1NB 4OV5B 2HT4D 5CZVH 4OTXH 1YPZB 4JZNA 2KL6A 1XF3B 1RK0A 2Y72A 5DJZB 1U6AL 3RAJH 1LK2B 4PLJD 3JV6A 2QQQA 3TJHD 2R1YA 2C7UB 4RMWA 3QCVL 5CP3H 1INDL 1FO0L 4KH2A 3OMZA 4NBYB 3BQUC 3D48R 5EU7C 2WUBH 3GEWB 3DV4B 4OCMC 4Y5YC 5D7JD 4ELMB 5BVPL 1B0RB 5FYKU 5L88H 5E4EB 5EOQL 2VR4A 5C3TA 4PB9L 4F33B 5FGSA 1OAZL 5DK2B 5C07B 2QL1A 5JXAH 2BSRA 2IQ9L 2DQIH 5HHOD 3GSQB 1ZMYA 2MNUA 3UJTH 3B83A 4G7YL 3EUUA 1D9KD 3H3KA 4HF5H 3RKPA 4YDVA 2Y7QB 5IESL 1UWXH 1WAAE 5KVDH 3IVKA 1DBBH 3GSNA 4OB5L 3QUXB 5E95B 4DN4H 3LKRB 1AGCB 5J6GB 2VL5B 3UPRB 4MDIA 3SKJH 1QR1A 1UT9A 4P2OC 4YXLL 3WUWA 4JKPH 3T04D 4PP2B 3MJ9A 3MLRH 4QYOA 5KSVA 1A6UL 4YR6A 4ZSOA 4XNMB 4ZOAA 4WJ5B 5ICYB 1E28A 3GMPA 3MNWA 2XV6B 1H15B 2AAVA 3LHPL 4IOFC 3GK8L 4K9EH 4K71B 1HH6B 1LD9A 1NBVH 4WU5B 5HYSB 4ZO6A 3HLAB 2FEDC 4JAMB 3OJVC 5DQJB 4A6YB 3RIFF 2Z93A 2NX5A 2R2HA 5A2KH 1KCLA 4J3XA 3QWRA 1PY4A 4MS8C 2J5LC 2Y5TA 1G7MB 4YHZH 2JB6A 4PD4J 4KROB 4JFDE 2Z8SA 1CBVH 3OG6B 1C5CL 4PRAA 2WANA 4NQVA 3VFTA 2X4RB 3EYUH 4MQTB 3PXJA 5IEKB 5EZJA 4HCRA 5B3NA 5J13C 5MENE 4HSQA 3TBWA 4MCYB 4WFHE 5ITBL 2EDJA 5DJYB 3FN3A 3VFMB 3PQYB 3QJHB 1BQSA 1BZ9A 4HQQH 1F11B 2Z92A 1S5HB 4FG6C 5CZXD 1B2WH 1JMZA 2H26A 4ODHL 2DBLL 2XZZA 4X6CB 2RCSH 4NQSB 5DC4B 2EDQA 1OAYH 4PJXE 2XOTA 1TJGL 1T1XA 1T20A 1U8MA 2VSDA 3HC0A 4OZGE 4Z7UF 1G7LB 3MLZH 4F8QA 2CDFA 3DI3B 3AC0A 1NC4A 5EOCH 1CU4L 1P2CA 2IAMD 1BBJB 1HINL 3CVHL 4N0UB 5I1AB 1CD8A 2AXGA 3QDMA 2WBKA 3GSUB 1TITA 1NLDL 1BIIA 1A14H 4WUUA 2FEEI 4NUJA 4JGUA 1ZVSA 3BDBA 3RUGF 4ZPTA 1CGVA 3V5HA 3PABB 3EJYC 4WEBL 4HKZA 4RQQB 4YQXL 4F80A 5L2KA 1G7JA 2VLRD 2GJ6B 2BZDA 5I71C 4HKJA 1UJ3B 5C07D 5EO9A 4KRPB 3BPLB 4LVNB 3HR5B 4R7NA 3PJSA 4RAVA 3B6SB 3ZYIA 3SDDA 1M7IB 4POZC 4HPYL 2BHUA 4AEFA 15C8H 2VC2L 1YYLL 4Y88A 2A83A 2BP3A 2FJGA 3MLWH 4QOKE 4YHIA 5B8CB 5T1KD 3VXRE 3WJJC 3MRRA 1D3CA 3FT3B 5IB5A 2OR9L 4OCYH 2F19H 3RVTD 1IGTB 1MPAL 1U3HA 4K7PY 2NY5C 3GHEL 4Z0XB 1GOGA 3OJDB 3V4PL 5DUPL 5C0BE 4M7ZC 1JN6B 1NMBL 5HYJE 4OZHF 1HZHL 5E9DE 4Z7VA 2E27L 2ZUVA 3RIAF 3IFPB 4QTIL 4DK6A 2DLFH 2CKBB 4X0KA 3DUUA 1CTOA 5GS1A 1DLHB 1EGJH 2C3VB 4QRUA 3S5LB 1VACB 4LKCA 1PZ5A 3F7YA 3WFBH 3LZFH 4IRJC 4E0RB 1HDMA 4I0KA 2HJLB 1KT2A 3BHBA 3MA9H 4LP5A 4HLZH 1I7TA 3DX6A 2NTSP 4LPTA 1YPZF 2P8MA 3QI9C 3WNNA 5FDYA 1K4CB 3O81A 1QSEE 4GT7A 5BMFL 1DQMH 3T2QA 3V8OA 1OP9A 1KGCD 1NEZG 5B21A 1H8SA 1XF4A 3EHBD 2ZPKL 1KJ2A 2Q1EA 4Y1AD 1X4XA 5SWQB 4NKOB 3B2UD 3L6FB 1UVQB 2DWEA 4XBEL 4LSPL 1U8QB 4FQCH 4LSVL 5E2WH 2NY2B 3IDXH 3MUGA 3KPPB 5FGCE 4IM8A 3HZYA 4WO4C 5JXED 3EYSL 2I60L 3MRCA 1WWAX 3DOSA 5ECJE 2A0LC 4FFWD 4N8VB 4FN0A 5B4MD 3IAGC 4ZOEA 4X9IA 2XA3A 5AD0B 2AXJA 3SO5A 2FR4A 3VG9B 1VSCA 2FZ3B 4NRYB 1GC1L 4S0TD 5KW9H 3CVIH 1MF2L 4JHWL 5FFLA 2QSTA 5IROC 3V8CA 5L2KD 1DEDA 3BRDA 4C83B 3WKML 3E6FB 4EBQL 4KPHH 3CSPA 1JYVA 5EZOH 1BLNA 1ZS8B 4K7PH 1S7WA 2P8LA 4CMHC 4DEPC 2XZAH 2XWTB 5IEHA 5F1NA 1MNUH 2OK0L 2RIKA 3VXSE 2Z8WC 4E5XB 3QZWB 1HH9A 2P1YA 1NAMA 3IT8D 4EI5D 3U4BL 5J1SC 1NGXA 3PHOA 1RZIA 1U3HD 3P0VL 4P57A 1JWSA 3WUWG 4X7TA 2A6IB 1EV2E 4MJ4A 1U2CA 1WJ3A 4N5UA 1FLRH 1HEZB 1JZ8A 2ICWA 4PJ5A 5L8LB 3QUKB 1A7NL 2Z31B 4L3AA 3O2VL 4LCWA 2X4TB 3ULUE 4O02L 2C1PB 3RP1A 3T0WA 5HYFA 5A16B 1E6JL 1OLLA 4G6JH 4LIQH 4NO5A 4W6XB 5FV2A 5HGHB 1NUGA 5JOEA 3A0OA 3IDIB 5DHVH 3HAEA 2W9DL 5CFHA 4HWBH 4IMLA 5BV7L 1WC7B 4PJGB 2E9BA 2XNAB 4J3TA 4Q9QL 5I16A 1KIUA 3QDJB 1S7RB 2VNCA 2YPVL 5FYJH 4CVWA 2YK1H 4HKXB 5CIPB 1X5FA 3VI3E 4WVRA 1IGFH 1GPOH 3MRGA 4N9GA 3UTTE 2W0FA 1FZOB 3FB6B 3DHMA 4XVUD 3PWPE 5IB4B 4QWWD 3WJLA 1WUNT 3NABH 3T0XA 4L3ED 5GS2H 2DYPB 2P8PB 3SE3C 1MAJA 3P4LA 4WY7L 4TVPD 1NCAL 4JZOA 1RY7B 2EC8A 3MBXH 3WDJA 2YR3A 1R5IB 5GRUL 3VFRA 4O4YH 4PFEA 4U1SB 1JI2A 3MV8A 3O4OB 5T1LD 3BUYB 1B0GA 1Z5LB 3CCHA 5D72H 3WLWD 1SM3L 1F13A 4ZS7L 4IDJL 1X5YA 4Y5VC 3H7BB 4NM8H 4XP1H 5A2FA 2CIKA 4KK9D 5EZIL 3CGTA 1NFIA 3V6BR 4M61A 5F89A 4J6RL 1QPXA 1FN4B 2WMPA 3O6FA 5TF0A 3VWJB 1N59A 4LDEB 1HWGB 3HE7C 5GGRB 5GRWA 3WXWL 4ODSL 1ZLVK 1WWBX 4OD1L 2ADJA 4K3DH 3TEUA 1FL6A 4XVTH 4FA8A 5EBGA 1Y6KR 3D39D 4YDJA 2XWJA 1RZ8A 2WIIA 4HS6A 1RJLB 5ICZB 2BJMH 4PJ8B 2CRZA 3GIVB 4MNQD 4QNPF 5D5MA 2H2SC 4PJCB 4I18C 5KJRL 4QY8A 3S35H 2IF7A 2JE8A 1I3GH 2OR8A 2BNQD 2XTJE 1Q9OA 1LO0H 4P3CL 1A5FH 3P9MB 1BREA 5LQBL 5HTSA 2HKHL 4PB0H 2A6DB 4RMQA 3ELAT 5JPNA 1PG7X 4WDIB 4RBPK 1PG7L 1MVUA 2CK0L 5D7LE 4HIIA 5E5UB 4XCCH 3KYOA 12E8H 5IOPB 1P9MA 4EN3C 1IEBB 4M6OL 2AABH 1H0DA 2R1XA 1V05A 1AGBB 1ZSDB 4XCEA 4H20L 3T0BA 3U7AA 2YA0A 3GMOA 1TZHA 1FAIL 2OBGA 5CP7A 1KB5L 1O5DT 3EYQD 4RAUB 5C08B 5IQ9A 5JIIA 3OKEB 4HWEH 1MRDH 3WFHB 1I3RA 2DM4A 3B9VA 3GRWH 5MERA 3PDOA 1KN4H 3U9UB 1IAIM 3LEYH 1BD2E 4P46D 4EJ1C 3QUYB 4IMKC 3EFDL 5FOBA 1U2HA 3EO0A 3MRDB 3QG7L 1I4FB 3W2DL 4KRMB 2OX5A 2XQBH 3VFVA 1F3JA 2OTPA 4Y4KA 2X1PA 3IFNH 1LILA 5SWZA 3O6ML 2J2ZA 1T2QH 2DYPD 3ZE2F 4PRHD 1P7HL 2YSSB 4JEGB 4PJIB 3BYYA 4Y4FB 1CT8B 2HTLD 3ARBC 3TYGH 1SBSL 1UXWB 3RTQC 4KHXL 4HKBB 3GMNA 1XF5B 5C0RH 2F9BT 1JNHB 4TPRL 4M6ML 5JTWA 5IWLA 4N0RA 5HYIA 1S7QA 3MV11 3NFNA 5JQHC 3MTRA 1BWWA 1QFWH 2BVEA 3FOLA 3WCYA 1EHLH 1FDLH 4WFGD 3SKOA 4L8SA 3LEXA 4JM2B 5AWNH 4ZUTA 3DVFA 2QQKH 5T1DH 5A2IH 4L4VE 3BT2L 5I76B 4FFVD 1K6QL 1QLFB 2YRLA 3SY0B 2F53A 2VAAA 1A6TB 5DJDA 5CSZA 3WFEL 2JJSC 1T7VA 1DQLL 1DFBL 5FDWA 1XGPA 5D4QA 2HMID 2NY4C 1MCPL 4K8RH 4Y4HA 1AHWC 1NBZA 1UH4A 2PTTA 4F15B 4M03A 3BXNA 4QHLB 4PBXA 4Q0XL 3RWGA 4WTWA 5KTEL 5DQDL 1T1ZB 2OQJB 3KHOA 3MMEA 3WXVL 1GHFL 5CZVL 4OTXL 1ZWIB 1ED3A 1RHHB 4PLNC 1SYVA 1I1FB 1WLHA 3RAJL 4PS4H 1CDGA 2AXHA 4NZTH 2VDRH 1CICD 3DXAE 4QRTA 5JHDE 5BZWB 3T0EE 4TTGA 2W65A 5FA3A 2WUBL 2PKDA 5L88L 5E03A 2I26N 2IBBA 5LAXA 3KWWB 5GRYA 3TZVA 3KXFE 2NLJA 5KSBE 4WV1C 3GO1H 5F7DA 5JXAL 2DQIL 5B3JE 2VLKB 2YD9A 4I77H 4HF5L 1RZFH 5C0AA 1C16A 2MQ0A 3QNZB 5KVDL 3ABZA 1DBBL 1G6RB 1S9WA 3EO1A 1QO3A 2X1QA 1QRNB 4DN4L 5C08D 3KLAA 3RVXC 5IMOB 3CNKA 1F6FB 2FEEL 1FBIH 1W72H 3SKJL 2I07A 3RGVA 2YOCA 3VXNB 5BS0B 4JKPL 4C59B 4R4FH 3QUYD 3MLRL 4R7DB 1OW0C 4JDVA 3U0PA 2QBWA 2PNDA 4ZUVA 1F4WH 1OT2A 5GGTA 3G5ZB 4U31A 5EC1B 1AO7B 5EIIB 1D5ZB 4NWUH 4TUJB 4K9EL 1NBVL 3C5ZA 3D85A 1QSVA 3MBED 1WAAA 4X6BB 4UV7H 3Q2CA 3V6FA 3WHE0 5A43C 2HVKA 3TN0A 5KS9A 3P11H 3JUYA 2QHRH 4WTZG 3IXTA 1AXIB 4E9LA 5DRXB 4YHZL 3TO4C 1IC4H 3HG1D 2X4NA 2ZOKB 3W81A 1CBVL 1OAXH 1UM6H 3LEVH 3HMWH 1R3HB 2VTFA 1LO4H 3OAUH 3QDGA 4OGAC 3B43A 4JM2D 3AS0A 4XP5H 4ZXBB 4DW2H 2DI8A 1TNNA 4G8IA 3VGBA 3TBYB 3PGDB 5C9JA 2DDQH 4OAWB 4HQQL 4P2QE 1QBBA 4B7LA 5JW4Q 1B2WL 3K0WA 3C6LB 5D2LA 2XPGA 3VXME 2RCSL 5F7EH 1OAYL 3THMH 1CLZH 3BW9B 5HDLA 4P9HH 1O7SA 4CVUA 3BP4B 5EOCL 4XWOC 2NW3B 4H26A 3ZSSA 5FO8A 2IH3B 3LH2H 3CLEH 3LRHA 4UQ3A 1A14L 1OVZA 1FVEB 2UV3A 4TUOA 2EDOA 5T3ZD 1SBBA 5H35A 1SMAA 1J0YA 3IGAA 1X5JA 3IDGA 4QT5A 4MNGB 1UKSA 4CVZA 1AR1D 4LEOB 1S5IH 3STZA 3OJMB 2VZ1A 5C0AD 1A1OA 2YBRA 1UQSB 5DLMH 4DOHB 4ODVL 1EA9C 1YN6A 3SGDI 1DVFA 1KPRA 2G60L 5FHBL 3MLWL 3BN9D 4QRQB 4N1HB 3KYKH 1DSFH 4BUGA 3DBXB 1WWWX 2QR0B 3S88H 3U7WH 3QCTH 5DD6B 2V7NA 4OCYL 1ADQH 5HGAB 2F19L 5C6WH 1WZKA 3O4LE 4PLKC 3QO1B 1A7RH 1YEDB 2ATKA 3KPSD 4OKVA 5LG1A 2X05A 3MV9E 4JM2F 4F37F 2IBZX 5F9WB 5DI8A 1KLGB 5CAYB 3EGSB 2IAND 5GSRA 4ONHB 4LHUD 4FHBD 4JANA 5D70H 3FOMA 5E94A 4BSVA 2AJVH 3HN3A 4JKMA 1A9BB 4PGEA 1DBJH 5SWSA 1AO7D 3C5ZD 1JGEB 1EGJL 3KPMA 1OTSD 3H6JA 4U1KA 3G6JF 3VWKC 2D31A 3IU3A 3PDDA 5HVHB 3WFBL 1ZTXH 3LZFL 3MA9L 3G5XB 1DTUA 4YXKL 4QOKA 4MQXD 1PQZA 3VXRA 4PRDA 4JFPB 25C8H 3EIFA 1I8IB 2MWCA 5C09D 4YIQA 1DQML 4F9LC 3GNMH 1I1YA 3ULVC 1T5WB 1LO2H 3KDMA 3PHQB 1IM9B 2OL3A 2BOBB 3PGFH 3D0VB 5CEYB 4X99B 4U1HA 1ODAA 3RWDB 3CC5A 2CKNA 1M05B 3U0TB 1HXMB 3A67H 5E2VH 4FQCL 4ETQA 1HQ4A 1DBMH 1JV5B 4MA3B 3IDXL 3QQNA 4MCZB 5J1AA 3MV7B 3C6LD 4M7LH 2EXYD 4XNYH 2YRZA 2ZZUT 3B9KA 1VFAB 4XBGB 3VMPA 5J9PB 3V0VA 3FQRA 4QF1B 3HMXH 3GSXA 2OXGA 1AQDB 3BIBX 4F58H 4UU9A 1BFVH 5EO0B 4M6NH 3GSNH 4U05A 5KW9L 3CVIL 1Q9WB 4KZEH 4WHTA 3D69A 3QIUD 4JFXA 5IQ7H 5J56B 2XTJC 3V52H 1KBGH 1IL1B 3FB7B 2SEBB 4G7VH 4TUKH 3D3VA 4X7EC 3UP1A 3FHAA 3MJ9H 1GGBH 3NIFE 5EZOL 4K7PL 2F8OA 4HW6A 2A38A 1PD6A 2DM7A 4Z76B 5DJAB 2GUOB 3D2UB 2XZAL 4ZFOL 2VLME 2VWEC 3ILQC 3S36H 3AUVA 4N68A 1MNUL 4ZUUA 2F74B 4JO1H 4XTRC 3Q3GB 2VB5A 3O41B 1N5AA 4Z6AT 2UWEB 4GG6B 32C2B 4AYFA 3ZTJG 3TV3H 3IFLH 4H25B 2VITB 3HRZB 3P4NA 5IVXE 1G7HA 4MA8H 2EDKA 4QRPE 2ZCKH 2KQMA 1FLRL 3WN5C 4JREC 4QLRA 4PY7A 2K9UA 1N0LA 3T08A 4HBQA 2JJVA 1OD9A 3FQWA 4OZ4B 3H7LA 1ZA3A 3QIBD 2ARJA 4NO2A 5CCKL 5K93A 5EPMB 4G6JL 4O2FA 1OF2A 4FQLL 2NW2B 5DJ0B 2NQCA 5A1AA 4Q2ZB 4X8JB 4ZTPH 3DRTA 3BVNB 3GMMA 5EU3B 3RKDC 3DVNA 3NCEB 3GMLA 3QFDB 4HWBL 2HLFD 5F9AC 4HH9B 1KYOJ 2QHLA 3HI1B 5FYJL 1L4IA 3VXSA 2YK1L 2G5RA 1ZT1B 5IBLD 1IGFL 4PJ7F 1I75A 5H37G 5IG7B 2E7HA 2MJWA 3IRPX 3CXDH 3V4VH 3MJ7B 4MDJB 1U8HA 3HR6A 3QHZL 4NHCH 3MRIA 5AUMB 1PFCA 2OI9B 3NABL 3ZKMD 3SCMC 4KGLA 1C7TA 5BQ7B 3OX8A 1AP2B 1JPGB 3L3GA 1QACA 4ODWA 5HHMD 3MBXL 4U7MA 1Q1JH 1TJHH 1PEWA 1F4AA 3HTLX 3WDHA 4UT9H 3UTPE 2JJUA 3SDAD 4NN6B 3NIGF 1HNFA 2BK8A 3EYOB 5FO9A 3HZMB 4X6FA 4HPOH 1IBGH 5FO7B 4F2MB 2VQTA 3B9KD 5D72L 3LD8C 2NY1D 4J3OC 5DEGB 1G0XA 1ZOXA 5I74C 4WW2A 4K94H 4NM8L 2R9HC 4XP1L 1DUZB 5HGDA 3BP6A 1OCWL 4YE4H 1YNTA 1U8IB 3AS1A 2B1HH 3OXRA 2YA1A 3UTTA 1F5WA 1MUJA 1VHPA 5JOFA 1TQCC 2FGWH 4K2UH 3PWPA 5F8QC 1BF8A 3X17A 1RZGB 1CK0L 1FZJB 5C0CE 2GK0B 3OGCB 4K3DL 1JF6A 4G8FB 2ZCHH 1P84K 2EDHA 4MNHB 2EDRA 3X12B 5ALBH 3C5JA 4R96A 1KPUB 3QUMB 2V2WB 5I1KH 2BJML 3NFSH 5CGMA 3T0EC 1NEZB 1J12A 1F6LL 1FZMB 4NQEE 3ZKXB 1CQYA 5CEXB 1BZ7B 3S35X 4Z7WA 5E6IB 3B3IA 3F5WB 1CGYA 4WTXA 4JQVA 3S35L 3PIQB 2EE9A 4UQ2B 1IT9H 1LO0L 1N3NB 1A5FL 3MROB 5ESAA 2YD2A 3T0DA 1ONQB 4PB0L 3N1FC 3CFBA 1OOAA 5E6ZA 3NPSB 2HP4A 1FIEA 3HUJA 1I9EA 3L3KB 3BEVA 5EU6E 3REVB 3S7GA 1G9MH 2P44B 4XCCL 4F7CB 5HPMA 4JZNB 2LFGA 5B38A 1NCNA 2AABL 4OFYA 1FNEA 4LLQA 3VXQB 3LQAC 2R1YB 5ESVA 1ZT4A 4U3HA 4KTEH 4ZFFA 4AT6A 1MRDL 1NFDF 2ZUUA 1OPGH 2JELL 4HMEA 5AYUH 4TVPH 3GRWL 2EDYA 4P5TC 1EFQA 2BSRB 4HJGA 4L29A 4FQXC 1UWGH 3HZKB 2L4OA 3LEYL 1CF8H 3KS0J 1MCEA 2O5ZL 2DQDH 4P23C 4YDVB 2D9CA 4GUPA 1GL4B 3IXAA 2XQBL 3DO7A 4LVHC 3I84A 2OTUA 5T1MA 3TPUA 4GRLC 3F12A 3VFPA 3IFNL 3MA7A 1T2QL 1D6EA 1QR1B 1NSNH 2RFXA 2X9WA 1AGDA 4P5MA 1I8LA 3OKNA 2W60A 5J89A 2Q8AH 3WUWB 3FQXA 2DM2A 3TYGL 3CFKA 3C60C 3SBWC 4YR6B 5BO1L 2EH8L 4A2MA 2E7LC 1E28B 3GMPB 3SDCA 4P2YA 3MNWB 5C0RL 4FQ2H 4LMQI 1WFNA 4NGHH 5FM5M 2I9TA 1N7MH 1QFWL 3FO2B 4ENEC 3H9SB 1EHLL 3IRZA 1FDLL 3PQYE 1LD9B 5CILH 3K1DA 4RGNC 4GG6F 1SJVA 5DRNB 5AWNL 5F6IC 3VI4E 2QQKL 5T1DL 4NZJA 2ZCLH 3QPQD 3SGJA 5KVMC 5C0IB 1RU9H 3UAJD 1KTRL 4HUNB 1AQKH 2OMNA 3RVVC 3FFDA 3C8KA 4JRWA 3OAYK 1U8PA 4NO3A 4K8RL 4JPKH 2MFNA 4HIEA 1BMGA 1X6LA 5D93B 4PJHE 4DVBA 4OFVA 5EZJB 3I75A 1U92A 4NN7B 4YC2B 3TBWB 3AM8A 4PJAF 1N4XH 4AIOA 3CH1B 1E27B 1KEGH 2LAGB 5FKPA 4M93C 2VDNL 4CNIB 1BZ9B 2Z92B 4PS4L 5C8JA 3NACH 4GW4B 2VDRL 1KTDA 3W0WA 3ARGA 4NCC1 1RZJC 4LFHD 4EEEA 1T1XB 3HC0B 4YDIH 3VXTB 2BVOA 2CDFB 4S2SB 1JHKH 4O9HH 1P2CB 4ODUB 5KN5A 4M7JH 1TCMA 4IRSC 1BJ1J 2AXGB 3BGMA 4XWGH 4I77L 2EO1A 3CFDA 5CIPH 1CD0A 1RZFL 1PKQA 3OPZL 3FFCA 5HD8D 2VIRB 2VLJA 4WUUB 4PG9A 1ZVSB 1R24A 3V5HB 3ZKNC 4PRIE 1NGPH 4HKZB 1X6NA 1FFQA 4NZRH 1G7JB 5HJ3A 1FBIL 2ID5A 3FO9A 1W72L 2AV1B 4HKJB 4Q9BA 3MLTA 4TRPH 4JE4B 2AXFA 3LKSA 1JNJA 4R7NB 4EDWH 5ISZE 4NFDA 2H9GA 4RAVB 4R4FL 3DXAA 3SDDB 5JHDA 4R0LC 5GQBA 4NNPH 4FXGA 4G3YL 4MD4A 1VPOH 1VA9A 3O8XA 2A83B 1F4WL 2FJGB 4YHIB 3MRRB 2W38A 3KXFA 4XNZC 4NWUL 2VLLA 4OLYH 1JTPA 5EUOB 3SDXE 1CXLA 3SOBH 4NKIL 3MRQB 1ITCA 3VFOA 5TGBA 1ACYL 4Z7WF 1WTGT 4G8GD 1PY9A 1FC1A 4UV7L 3BJ91 4WHDA 2DQJL 1XCQB 4GS7B 1MFAH 3CFJA 3P11L 4HJJH 4Z7VB 5KOMC 5T3XD 5ESQA 4CADA 5E99H 2QHRL 3KLDA 1T5XA 1HHKA 3IKKA 3MLUH 4J4PD 1IC4L 4G9FD 4X0KB 2ESVE 1UM6L 1OAXL 5E8EB 2VJXA 5K9JH 1LO4L 3ZDYF 1QVOA 3HZVB 3DV6A 4LKCB 1W0VA 1PZ5B 3F7YB 4XP5L 4DW2L 2AJ3A 5F9OL 4EUPG 1HDMB 1WTLA 1KT2B 3BHBB 4P2RE 4JPIB 2DDQL 3DX6B 3BQUA 1OGAE 1LO3L 1XGTB 3P9LA 4JVPA 3TT3H 2VABA 5CEZD 4JCLA 5F7EL 3WHXB 4KMTH 1XF4B 1GVIA 5A40E 1KJ2B 3THML 1A2YA 1CLZL 4LPWA 4UDTA 2YN5A 1PGRB 3MODH 1L0XA 4JDZA 3WS6C 4H0IA 4P9HL 2R0WH 4PLJC 3TJHC 2DWEB 1J7VR 1Q0XH 1NMAL 1KJ3H 3FZUC 4X80H 1FCCA 5J6HB 4HLJA 5I1IH 3W0WD 3LH2L 3CLEL 4M1CD 4G8EA 4WGVB 3GHBL 3MUGB 4HT1H 3G6AA 5I1LA 1NAKL 3HZYB 1OSPH 4ALAH 4ZODA 2X5PA 2GCYA 1MLBA 2IJ0C 3MRCB 1VKXA 1GOFA 2R1WB 5F7HA 1D9KC 4Q74A 1S5IL 3AROA 3N1GC 1FFPB 2FR4B 2FD6H 4F9PC 3MRLB 4HUUA 5DLML 3KYMA 2C1OA 2Z0BA 2HFEB 3QJFA 2XRAH 2J6EH 4OBRA 4D0CA 3VXMA 4U6YA 5KANG 3T3ME 2ICEB 4F7MA 3IETA 2W92A 1W8NA 1DSFL 2HFFA 3KYKL 4PJDA 1OWRM 5J1TC 4PG2A 5AZ2H 1CLOH 4MHHI 3U7WL 3S88L 1BLNB 2IG2H 4F7PA 2P8LB 1A7RL 1RK1A 4JZJC 3N50A 3WSQH 5IEHB 1WBYB 4BM7A 3GBMH 1KIPA 1YY8A 4PJGE 2KQNA 3OF6A 5D70L 2DJSA 3QDJE 4UAOC 5D96B 3ZHKA 1NAMB 2AJVL 4OZIF 4MGXA 4EDXA 3PHOB 2EXWC 2L0DA 4QRSB 5L8KB 4P57B 1JWSB 4X7TB 5D1QA 2O61A 2VH5H 4HWNA 4X5XA 3RZCA 2AKRA 3SKNA 5CBEB 1ZTXL 3GFUA 1YA5A 4Z9KB 1A3RH 3O6KL 5E2JA 4OGZA 3MXWH 3HCVA 3RQ3A 3RWEA 2J1KA 3O11A 8FABA 3M07A 25C8L 4OD2A 3HS0A 3E2HC 2P5WD 5KSAC 4EI6A 3O4LA 2DL9A 3HAEB 2GY5A 3TC9A 4AEHH 3GNML 4BELD 2BERA 4IMLB 1LO2L 4LSSL 2DMKA 3PGFL 1CFSA 1LP9E 4PBVC 3TBVA 5I16B 3VW3H 2H6PA 2V9TA 4M62H 2X1WL 1HKFA 1MAKA 2HN7A 3EZ8A 3VFWA 3A67L 4N9GB 5E2VL 3WL9B 1DBML 5DD3L 3QISA 3IDNA 3CVHA 4OCLC 2CXGA 4Y19D 4V1DB 4FQIH 5T3ZH 1PBYA 3WNLA 4M7LL 1KULA 4KDTC 4XNYL 1LE9A 1H3WM 1I9JH 3UTOA 5CJXC 2PXYA 2FX8H 4FTVD 3ES6B 3VFRB 3HMXL 3BIAX 3KGRA 4NBXB 1X9QA 5DK0A 4F58L 1FGNL 1XIWB 3SKMA 1BFVL 2B4CC 5F3BA 4M6NL 3GSNL 3OBAA 1F45A 3MV8B 2W0KA 5I2IA 3GBLA 1B0GB 4P2OD 5E4EC 4KZEL 4D3CH 3I6KA 3R1GH 1CVSC 4MJIE 1KTLA 2IBGA 4ELKB 5IQ7L 4HV8A 3P77A 3I3DA 2VXTH 3GJEA 3RIFK 2GY7B 4JR9H 1KBGL 3ARFA 2CIKB 4G7VL 4TUKL 1T04A 3K7UA 3MNVA 5F7NC 4Z7QE 1SY6A 3MJ9L 3T09A 1NFIB 5EUOF 5BJTA 4NKDA 4OJFH 3O6FB 5IVNA 1PSKH 4IOFD 1K3ZA 3QUXC 3EJZC 2YPLA 5GGTH 5E56A 1VEMA 3EOYG 4JO1L 3TVMB 2ADJB 1FL6B 4G43A 2FEDD 2VERN 2FJFA 2JCCF 2B8OT 1U91A 1TJIH 4KI1A 4YDJB 1MVFA 2XWJB 1FNGA 1YQ2A 4HS6B 4MX7A 3TV3L 3ZKSD 2DQEH 3BWUC 1ZLWK 3IFLL 4MA8L 4MS8D 3QI9B 2ZCKL 2YKLH 4JN1H 4M9OA 5SX5H 3KPTA 5BW7C 3SHSA 43C9B 1F3DH 1FNSH 5E70A 4LL9A 4QY8B 4M8QB 1FHGA 1RSFA 1MIMH 3OTTA 1Q9OB 1RUQH 1MFCH 3QA3A 5DYOA 2A77H 2ADGB 1T3FB 4K71C 4D8PA 1JIBA 5BRZD 2XY2A 4BFBD 1D5BA 2CGRH 2IQAB 2KPNA 5D7KD 1MVUB 4HIIB 3KYOB 4FG6D 2AEWA 3QXVA 3EDJA 3W5MA 2MOVA 1H0DB 2R1XB 1CI5A 2I9LB 4GKZA 4C55A 4KJWC 4KROC 3MXVL 4XCEB 1ND0A 5B39A 3CXDL 3GMOB 4PJIE 1TZHB 3V4VL 2DN7A 5CP7B 5I8CB 3EHBC 4JFFA 4NHCL 1VERA 3GJFA 3MCG1 2DKUA 4QRPA 4R97B 4DGVH 1I3RB 2J8OA 5MERB 1NKRA 3PDOB 1NUFA 1QTYT 4JJ5B 4JQXA 2RAMA 1OAUL 3JWNC 3PL6A 1Q1JL 4ODXA 1TJHL 4PV9A 3EO0B 3RJQB 1V7NL 5C0GA 5FOBB 1CFTB 4UT9L 5FYKD 4QHMB 3EJYD 1UKQA 3V5KB 3OL2A 3K4DA 5GGSA 3ZE1E 2JJTC 3VFVB 4LP4A 4OCXH 4HPOL 1IBGL 4Y4KB 3ARVA 1J0JA 5EORH 1D5XA 5SWZB 1JPFB 4V1DD 4K94L 4AM0B 4YDKH 4LLUA 4POZD 4Y89A 4R4BA 4LRNH 1ACZA 2X6MA 5DK3A 3JUZA 4H5SA 1KIQB 4NCDA 3RNKA 2BOCA 1P1ZA 3ILPB 2ATPA 2FGWL 2ZOLA 3GMNB 3HA0A 1KN2H 4K2UL 4NP4H 1XIWD 1FSKB 3JSSA 2YXFA 3NFNB 1E6OH 3OXSB 1YMMB 3FOLB 2ZCHL 1VB9A 4YH6A 2I27N 1S9YB 2H2PC 5FYJE 1UJ3C 4MZ3A 5ALBL 3SKOB 2FHFA 2FYYA 3DETD 2YD6A 3LEXB 5I19H 5F70A 3NFSL 4KRPC 5I1KL 3BPLC 3K8MA 4LVNC 5IB3A 4ZUTB 1J05A 3QEQD 1A6AB 5LGKA 2WBJB 1QP1A 2F53B 5KZCD 2VAAB 5M7QA 2DD8H 5EC2A 2DQFA 1IT9L 2FHBA 5B8CC 1A3LH 3OJ2C 3JTSA 1XGPB 4WI7A 1XZ0B 4Y4HB 1FVCA 4IRJD 3BXNB 3WIFA 3ARXA 4P9MH 1KB9K 3RWGB 4GBXA 4I0PA 1CVRA 3WFCH 3UBXA 2QSVA 3MLSH 2Q3ZA 3HI5H 2DQTH 1G9ML 3MMEB 3QI9D 2E9IA 4ZAKA 3RDTB 1ED3B 1T1WA 1FORH 3MJGX 4WEMB 5ADOH 1CD9B 3MRBA 5INDA 4QRTB 2Q6WA 3SE3A 4YPGA 5BS0E 2VKWA 5FA3B 5CJBA 4KTEL 4NQEA 2ITDA 3I50H 3ARDB 5AYUL 3GKWH 3TZVB 5F7DB 3NFPA 1UWGL 5KBNC 4RFEA 4YHMH 3WYRA 4WO4D 4KI5E 3H9ZA 4E42B 2DQDL 1KFAH 1AGFA 1C16B 1S9WB 3EO1B 3T65B 1QO3B 1DQJA 4Q9CA 1RZ7H 3OKOA 3WNPA 3KLAB 3LKOA 4HXBL 3HE7B 3OKKA 4HUXA 1JYNA 1XCTA 1BQLH 1NSNL 2I07B 3RGVB 1CR9H 4PGBA 3D1MC 3NGBB 4LCIH 2Q8AL 2NY2C 4RISH 1TIUA 2XFXB 5IV2A 4JDVB 3U0PB 1ETZB 4ZUVB 4NGHL 4XXDB 1T6VN 1N7ML 3CSYA 3P4MA 5H8DA 3VD5A 3BX7C 3KPOA 4LCUA 2CUIA 4NPYA 1L0YA 5FCUH 3Q1SH 4QHNA 5CILL 1EUUA 4I18A 4R2GB 3IDJA 1J8HA 4PJFE 3VG9C 3D85B 5GGUB 4APQA 4JFOA 3RBGA 5JORA 1CE1H 2WUCH 1LK3H 1RV6X 3QULA 1RU9L 2HVKB 3TN0B 4YX2H 5KS9B 4M02A 1RUMH 3BZFA 1AQKL 2B1AH 3IXTB 1I1AA 4XPTH 4IOIA 4WENB 4NQCD 5J06A 2X4NB 2WM0A 4JPKL 1A7BA 2APVA 3O6LH 1BFTA 4FFZH 2BY3A 4J3UA 1N4XL 3T1FA 5C9JB 5DEZA 1KEGL 3C8DA 2GTWA 5I1DA 1OM3H 1J18A 3LKNA 3NACL 3BGFB 4WFFD 4WGWB 5ENWA 1J0HA 4X4ME 3U7YL 1JFQH 1S7SB 3T77A 4YDIL 2Z31C 2N7AA 2W9EH 1KB5A 4HFWA 1P4BH 5EU5B 4HUKB 1JHKL 1EVUA 4O9HL 4M7JL 4H26B 5FAAA 1G6VK 1LE5A 4XWGL 5FO8B 1JPSH 4MWFA 1N8ZA 2Y1VA 2H8PB 4JFDB 2VZVA 4UQ3B 4Q9RH 3CZFA 1INQA 4XMPH 4PJHA 1QSFA 5C0JA 2Q87A 1MCLA 3D5OF 2PUQT 3NBNA 4ONGH 5H35B 1NGPL 5DT1H 3ARBA 3IGAB 4NZRL 2VR9A 3IDGB 4J3SA 3VDAA 2J8UA 4CVZB 3JWDH 4D9QD 4TRPL 2QTEA 3STZB 3C6SA 4EDWL 5CD5C 2YBRB 5BZDA 1JP5A 4WI4A 1HQRA 2XZQH 5BVJB 1J5OH 4NNPL 1YN6B 2FRGP 1VPOL 4GAJL 1GGUA 4OZGB 3G04A 4NYLA 1X5XA 1NFKA 3PV6A 1E0OB 3V9FA 5DZNA 2R69H 4OLYL 1TTGA 3HE7D 2V7NB 1AXTH 4OKVB 2JJSA 3WD5L 5F71A 5GZNC 5DI8B 4JHAH 2NYYC 3O4OC 3AGVA 1MFAL 5GSRB 4HJJL 4JANB 4URTB 4YUEH 2YUVA 3FOMB 2X2YA 3ROOA 2G9HB 4PGEB 2H2SD 4U6TA 3QXTA 4LCYA 5SWSB 4JO4H 1MJ8L 3NCMA 5K9JL 2IFGA 5ISZA 4U1KB 5GS3A 2D31B 1FV1A 2B0SH 3VWJC 4AH2A 4PRPD 1XF1A 1SEBA 4X5WA 4QOKB 1FFOA 5E5RB 3VXRB 4PRDB 5I75C 4PJ8C 3TT3L 4NSKA 3AREA 4EN3D 3QEGH 2YWZA 1I1YB 4XP6L 4LKXA 5C86A 2OL3B 4KMTL 1MFDH 2PYEA 4H0HB 2Y06L 5CP3A 5C0BB 3JV5A 5FYJU 3MODL 3CC5B 1WEJH 3RY6C 5EH1A 4AEEA 3LDBB 4O5LH 1CXEA 1SVZA 1KJ3L 4JFYA 4X80L 4ETQB 1A7OH 5I1IL 2YUZA 5GJSH 3V6OA 2ESVA 4U6XA 4X7DC 4YBQC 4CJ0A 4U1JA 2FSEA 4HT1L 3W39A 2VZTA 5J1AB 4ZPVA 2PW2B 1OSPL 2M2DA 4ALAL 3HNVH 4CU6A 1NBQA 1REIA 3UTQA 5IFAL 2VRAA 4JY6A 3V0VB 2X4UA 3FQRB 1RZKH 2UWEE 1U58B 3GSXB 1OGAA 3MPCA 4UU9B 1TZIB 2FD6L 4RDQG 4X83A 1Y0LA 2XRAL 2J6EL 2HRPH 4WHTB 1KIRA 1M7DA 1IGMH 4JFDD 1NGQH 1HHGA 4C57C 1P4IH 4WFEE 3QFJA 4Z5RA 1FYHB 1QUNA 2XN9E 3RTQD 3MACH 5MEND 1BVZA 4W4NA 5AZ2L 3C9NA 3QUYC 4JQIH 2CLVA 1CLOL 2EECA 4QXTA 4UT7H 1G7IA 3VA2C 4WFHD 2IG2L 4H1LG 1F8TH 1CG9A 1RVFL 3CFCH 5GGVY 4OGYL 3HI6H 5D6DC 4IS6A 3WSQL 3GBML 3TO4A 1MCJA 3DSFL 1OGTA 3SEPA 5JDSA 3VXUA 3PWJA 2ADIB 5T3XH 1G0YR 1ULVA 3BPOB 1GGYA 4G5ZL 3S8WA 2O5XH 5TDOA 5TH2B 1N5AB 1WF5A 4KJQC 1N64H 4XPAH 2R2BA 5ETUA 2X40A 5HHOE 2VDOH 3P4NB 4Y4FC 2NY6B 4MA1B 4UOW1 3UTSE 4LLWA 3RPIA 4FXLA 2VH5L 2EE6A 2XI9A 2XXMB 4OQTH 1W2KT 5DFWH 4PY7B 2LABA 4XPHH 4MXWH 4KMQA 2HVJA 3KPRE 2X89A 2ZG1A 3FQWB 1ZA3B 1OHQA 1FC2D 2ARJB 3MXWL 1XGQA 4NO2B 4Z7UE 4O2FB 3U2SA 4LGSB 1OF2B 5C0FB 4JY5H 5CEZH 3DRTB 1WBZA 2R2CA 3GMMB 3MO1A 3DVNB 1F00I 4AEHL 1H3XA 1WV7T 5DQ9B 2GTZA 2FO1A 1OAKH 5HYSG 1ES0A 4LCCA 1C1EH 3LRGA 3VXSB 3BKMH 2GITA 5JHLH 4M62L 5D1ZB 4KY1H 4TSBL 3NCJH 4F15C 4QTHB 2GJZA 3DYPA 1U8HB 4W6WB 3AXLA 2CLZA 3W82A 5F93C 2PYED 1QYGH 5ADPH 5T3ZL 2AJSH 2EEBA 4RMUA 4NUGL 1EFXB 4JHZA 2Q8BH 1I9JL 2JK5A 1A4KA 1PX3A 5C0BD 2FX8L 3CFEA 5HYJD 1HCVA 5E9DD 4D0DA 3RVXD 2EDTA 3ZO0A 5FO9B 4X6FB 1U41A 1DL7H 4D3CL 3R1GL 4WW2B 4PJXF 1LP9A 2AERT 4YHNA 4JR9L 5HHQA 1IKNC 1JZ5A 3ZT5A 4OZGF 5HGDB 3VD3A 3BP6B 4BQ8A 2PTVA 4OZHE 5JDJA 4Y2OA 1MSPA 5GGVH 3HNSL 4MD5A 1EPFA 1YEEH 3UTTB 1MUJB 4OJFL 5JOFB 3ETBF 4U0QB 1X5HA 1PSKL 4LBEA 1K3IA 4JFHD 3PWPB 2AJUH 4XNXH 4RWHA 4GMSH 4EUPB 1TLKA 5FECB 5GGTL 1HSAA 2HJFA 1QSED 2XY1A 3N1MC 1G7PA 4BQCA 5I15H 3EO9H 1TJIL 4IHOA 3C5JB 2A2QT 4R96B 2DQEL 1V5JA 1MI5A 4I48A 2YKLL 4LHQB 7CGTA 3TO4D 1FNSL 5DDHB 3B3IB 3F7PC 1EGJA 1MIML 4MJIA 3FMGH 4XCFH 2XICA 3EOBA 1RUQL 1MFCL 2A77L 3RI5F 3HPJA 5ESAB 2B5IB 3O3DB 3QYCA 3UROR 5E2UH 3CFBB 3U79A 5ANMA 5T5NG 4GKSA 4S1RH 3HFMH 2CGRL 1RUPH 3TA3B 1LMKA 2D0FA 3EW3B 2XG5A 4RMVA 1H3UA 4RGMB 2KDGA 5HPMB 3QPXH 2CXKA 4RA3A 4JKLA 5B38B 1WISA 4U33A 1FNEB 4LLQB 3C2AH 2IALA 2EO9A 4OLEA 1QEWA 3FTGB 1ZT4B 3VFUA 4XWOD 4ZSOE 2NR6C 5EULV 4ZFFB 4W6YB 4ZXBC 3IDYB 3QH3A 4DGVL 2BCKA 4K3EH 3S5LG 4HJGB 4L29B 4X6DA 2XTJB 1G84A 3IXAB 3FCTA 1BFOB 3C6LC 4Y5XA 3BDXA 1KUMA 5E00A 2EXYC 5EN2A 3LKPA 3R0MA 3U0WH 3OSKA 5E8PA 5T1MB 2NX5E 5IFJA 3TPUB 1WWCA 3TJEH 5EORL 4TVSa 5D7LB 1TENA 1F90L 3CIQA 3J8F7 4YDKL 1D6EB 3I3BA 2RFXB 4MXQC 4RFNB 1VFBA 1AGDB 4P5MB 4G6MH 1NGWA 4XHJD 5L7XH 1EFXD 4LRNL 3FQXB 2DOCA 1WK0A 2E8YA 3CFKB 3U36A 2VSCA 3QUZA 4TNWK 3T0VA 1KN2L 4NP4L 5I1CH 4QRRD 1RD6A 5JMOC 1LNUB 2EE2A 4HH8A 4J7RA 4P4KA 3F6IA 5EG6C 3SDYH 2I9TB 4Y1AE 4ZFOA 1E6OL 5I0DA 1ZEAH 1T4KA 1DE4A 5D2NA 2C4XA 1NCDH 1KTKE 1BD2B 3MRFB 4XMKH 4DKEH 4NOFA 5FUZH 4OIIH 3JVGA 1VGEL 4UIKH 1XR9B 4MJ5B 2VISA 1FJ1B 4JKWA 4P99A 1YEHL 1GZPA 2AW2A 4MVBC 1C12A 5JW5B 2DD8L 3DECA 4NCC2 2JF1A 1A3LL 5IMKA 5DO2C 3FFDB 3EYVA 1CGUA 3T3PE 3VWKD 1A1NA 1U8PB 3GMQB 4NO3B 5IR1A 1KCSH 4PJ9C 5FM4A 1FFNA 5IMLB 3QDME 4P9ML 5TDPB 4DVBB 1I7ZA 3I75B 3WFCL 5F9WC 1U92B 2VQ1B 3MLSL 5F1KC 1PAMA 5MEQA 3HI5L 2DQTL 2P7TB 1A64A 5DHVA 4WWKB 1J1PH 2NXYB 4HIXH 5FKPB 3VGDA 3ULVD 5L2KE 2VXQH 1EEZA 2BNRA 4PJEA 3O9WB 5DURD 5IBUG 5C8JB 5ADOL 5DVNA 3SCMA 4UNUA 3ROLA 3QZWG 3VRLF 2EYSB 3ARGB 4AEIH 5JO5B 2DIBA 5I8EA 4OUOA 4RIRA 3K2MC 2AK4A 3AY4A 5HVHC 3I50L 4KTYA 3VD9A 5HHNA 3GKWL 2NXZB 1PW3A 1X4YA 3KYNA 5KN5B 2HJKB 2R4RH 4FP8H 4JPWH 3BGMB 4YHML 5FYKH 1JHTB 3CFDB 4O2CB 1FNAA 1PKQB 3FFCB 1KFAL 2VLJB 2BMKA 4Q97A 3HC3L 4PG9B 1AI1H 3VJ6A 1BOGB 4NFBA 2DM3A 5J11B 2NY3B 1M6OA 3OR7A 2UZIL 2IPTH 4OF7A 5HJ3B 3FO9B 5D7IA 3LRSA 1BQLL 2UY6A 1CR9L 2KZ1B 4L8BA 5DTFA 5JNYA 2AXFB 5IJKC 5DZOA 4L4TA 1UXSB 4NQDA 2H9GB 4RISL 2XTJD 3DXAB 5JHDB 2D7OA 2V17L 1M71A 1OQXA 4MD4B 3O8XB 2BXYA 4HIJA 4PJBA 3IB4A 3T0AA 2NY5H 5IHUH 3UJJL 5DXWA 1IGYB 3KXFB 4G42A 2L7JA 3GSWB 1SY6H 4X4XA 5LCVL 5D7LD 5FCUL 3E8UH 3ILQD 1BM3H 3Q1SL 3VFOB 4XTRD 5DS8B 5K9KA 5TGBB 1GOHA 3UJIH 4BSWB 5F7YC 4WIQA 3O45A 4OFKA 3MCKA 1CE1L 2WUCL 1LK3L 4L3EE 3MOBH 4YX2L 3ULVF 3CFJB 4N8PA 1RUML 1FNFA 5ESQB 4CADB 2B1AL 2MCG1 1HHKB 4XPTL 4ODTH 4JRXA 3O6LL 2QSCH 3LQZA 1QVOB 1BD2D 4MAYA 2XQYK 3DV6B 1W0VB 4I2XA 2J8HA 3V5DA 2WQ8A 5C2BH 1RI8A 3MREA 1JZ7A 2YMXH 3RKDD 5FGBA 5JW4M 2DWDB 1YECH 3P9LB 1OM3L 2CRMA 5EBMA 1KXTB 1MEXL 3KS0H 1E4KC 5E0QA 1WBXA 2X7LA 4PJFA 1LVEA 4FQXA 4OI7A 1JFQL 1FO0B 2ZSWA 4OZFG 2DIAA 4CMMB 1A2YB 2HKFH 4OLWH 4UDTB 3O2WH 5DMIL 4W4OA 1P4BL 2OJEA 4I9WE 1FFRA 1GGTA 4K7FA 3W5NA 3L3DA 1HE7A 3DMMB 1JPSL 3ZE2E 5JW3H 4UT6H 5IHZA 3GJFH 4HLZG 4R4NC 1FLTX 1WT5C 3STLA 3GMRA 3G6AB 4XMPL 2AK4D 1V8HA 4MNQE 3V2AR 4AIZA 4AMKH 4BQ6A 2GCYB 3QHFH 1MLBB 3KHQA 4Q6IB 1VKXB 1UJTA 3SJVA 5DT1L 4L4VD 3I6GB 4OLVH 5IW6A 5E1AA 3SBWA 3FRUB 3O2DH 3JWDL 3SE4A 4LGPB 1LDPH 4C56A 2NXZD 1CDBA 1FYTA 5DUMH 3Q6FA 4NO0A 3HB3C 1OP3H 5JW4R 4HBCH 3OAZH 4HUUB 3KYMB 2C1OB 3QJFB 2R9HD 2XZQL 5HGGS 1J5OL 2UUDH 4D0CB 5GGQL 1ORSA 3VXMB 2OI9C 5F1IA 4U6YB 1AKJD 1UM5L 4PJ5E 1AGEB 1H3PH 2MKWA 4CU8A 4LCWE 4F7MB 2NY3D 3IETB 2HFFB 2WBWB 5HYQA 3R06A 5LGHH 1U8KB 2R69L 3BPCB 4EVNA 4F7PB 2AV7A 2XWBA 3GI8H 1AXTL 1RK1B 3MRHA 2OM5A 2ZUQB 4NN6C 2R0LH 2RJMA 4OGXH 2BNUA 4XI5C 4JHAL 1KIPB 1T89C 1RMFH 1TCRA 1YY8B 5EO1B 4C54A 1SHMA 5C1MB 3UZVB 4KJYB 3T0ED 3GKZA 4YUEL 5E24E 4AG4H 4ZYKA 4EDXB 1R5WA 3IDUA 2NY0B 3ESUF 2W0LA 5E7BA 3ECBA 4JFEA 4LDLB 1QBAA 5EZLB 1I85C 4UINH 4JO4L 5D1QB 4WI2A 1KLFA 5E8NA 1A47A 2BVPA 4X5XB 1U3ZA 3VRIB 2CO6B 2YD7A 2AKRB 3RZCB 3EYFA 2B0SL 1H9VA 4RGOL 3SKNB 5IGXH 1RULH 3UZEA 3HCVB 1HSBA 2NTFB 5L8JB 3DO3A 3ZT7A 8FABB 3HS0B 3RWFB 2Y36H 3O4LB 3LS4H 3V0AC 3HE6A 3QEGL 2FB4H 1MWAH 4M5YH 3ZKXC 5J7CC 4H8WL 4IRSA 1MFDL 1K5NA 1QHOA 1CFSB 3TBVB 5E6IC 4D0BA 1DEEA 2FLBT 4KKAC 3V4UH 1AFVH 2H6PB 4GKNA 2J4WH 4BA8A 5C71A 4NRXB 2AP2A 4O5LL 5HHPB 3FQTA 5GJTH 3U48A 1A7OL 4HC1A 4YWGH 4P5TD 3NPSC 3CVHB 4E41D 4X7SH 1DZBA 1RUKH 1BX2B 4P23D 2VAJA 2EYTA 2V5MA 1LE9B 4R0LA 2GSGA 2PXYB 4OD3H 3BP5B 1S7XA 4GRLD 4PGCA 1RZKL 4LNRB 5DK0B 3TWCH 3GGWA 3SKMB 1W72A 2P5EA 4Y16A 4KTDH 3DMMD 5E8DH 5I2IB 3BIKB 2HRPL 5IFHH 3L3IA 1IGML 2ENYA 1NGQL 2CDGA 5CUSH 5D5ME 1KTLB 3SJVD 1P4IL 4H0GA 4HV8B 3P77B 2F54A 3GJEB 4M43H 4TNVF 3C60D 3ARFB 4GW1A 5FB8B 3MACL 3GI9H 5EUKB 3MNVB 4UUJA 1FYTD 4JQIL 4KUZH 5KSBF 2GIYA 1G1YA 5B3JF 3CFCL 4YHPA 3HI6L 2ARWA 4NKDB 4U6HA 3W9EA 3SO3B 4ENED 1JMXA 3DUSA 4P2QD 3VCLA 4ZG1A 4GAFB 1CL7I 2IPKA 5T3XL 1J0KA 2MCPH 1ZK9A 2FJFB 2FDBP 3B5TA 2O5XL 1N5YH 3P4OA 4XPAL 3QQ9C 1JGDB 4ETYA 2VDOL 4CW1A 1QFUH 2J7LA 3RVVD 3WEXA 5TQ0H 3KPQA 4XPHL 3GBNH 4MXWL 3WNOA 1S9XA 5DRWB 4NRZA 1UCBH 1U0QA 5L0QB 3TNNA 3X11A 4MLSA 1KELH 2D7TL 5I17A 1CWVA 4HDIA 3MFGB 5DYOB 2BXZA 1N2RA 1S7VA 4X6EB 3VA6A 5DUBA 3D0LA 3IJYA 1U8JA 5ACZA 1QBML 5H37H 4D8PB 3X14A 3FONB 3RWJA 5CEZL 1Q72H 1AXSB 1D5BB 4MSWA 4R3SA 1CXHA 1EXUA 3PDGA 4YK4B 1OAKL 4F8TA 3DX7A 4I8DA 4I0CC 4DZ8B 1NDGA 1C1EL 2XA8L 2NZIA 5SWZE 3VH8G 5JHLL 3UDWA 1JBJA 4GKZB 3ARTA 4KY1L 3NCJL 5B39B 4WRLA 3TH2T 1KXVC 4B5EA 4YAQA 5D93C 5IVXB 5J57B 3N0PB 1D9KA 4IOSD 4QRPB 1G7QA 1QYGL 4NN7C 4YC2C 4O58H 3FO1A 3MV9D 2Q8BL 5F7KC 3U4EA 3PL6B 2DQCL 4ODXB 4PV9B 5C0GB 4PLOB 4Z7UA 5AEAA 3BZ4A 1MH5A 1XT5A 4G6FD 4BH7B 4HAFA 3ZDZE 5GGSB 1S9KC 2VXSH 4JRYD 1DL7L 2H3NA 3E3QE 2N1KA 1QNZH 3OV6A 1D5XB 4JO3H 4NQTA 4EZMA 1R3LB 2DLGA 4LLUB 4X4ZA 3RUGA 5ID0A 2FX7H 2IEPA 4R4BB 5GGVL 2A6KA 2CMRH 5ID1A 1YEEL 3F7VA 5DHYA 2FIKB 3BISA 5EOCJ 2BOCB 1P1ZB 4Z78A 2ZOLB 3RWIA 1ADQA 2AJUL 4XNXL 4XPGH 4GMSL 5IK3A 2WLYA 5I15L 1HHIA 1P4LA 1DQTA 3EO9L 1QOKA 1P7QD 1C5DA 2FYYB 3L3HA 1T83A 3TBTA 2VZSA 5IB3B 1IKFH 5FUCC 3SDDC 1IAKA 4XC1L 2N7BA 1JVKA 2JIXD 5EC2B 4O51A 5T3ZE 4PR5A 3FMGL 4XCFL 3JTSB 3VGHA 2J88H 1EO8L 4CVXA 1FVCB 1S3KH 5E2UL 1XGUA 3X3GL 4GBXB 2D7QA 4I0PB 5C0AE 3UBXB 4S1RL 5DJ6B 5IMMA 1RUPL 3DYMA 3FO0H 4YNYA 3UX9B 4F7TB 4GS7C 2WZPD 4ZAKB 3QPXL 5C0CB 3UYRL 5BV7B 4YO0A 2BC4A 3C2AL 4M3JA 1AD0A 4WHCA 4J3WA 5INDB 4KK6C 3K80A 2Q6WB 2IAMA 4KDTA 3ZE0E 2EYRA 3HRPA 1YPZA 2DLEA 1LO5A 4NQEB 3DNKA 3FZUD 3OKDA 3CPLA 1LK2A 1B6UA 1DLFH 4K3EL 4OM1H 2LVEA 4RA0C 3B4NA 3NFPB 2VLMD 4LAJH 4ELMA 4RFEB 2R29H 1A9EA 1ZANH 2VLRA 3NN8B 4H1LB 5DJ8A 2HLAB 1AGFB 4XP4H 1EDQA 5C07A 1D6VH 1GH7A 4DKAA 3U0WL 5C0NC 3HMXA 1DQJB 3OKOB 1MCFA 5EU6B 3TJEL 1MIEH 3LKOB 1RIVL 4LSTH 3U9PL 2XYCA 3OKKB 5KS9E 1NANI 2Y7QA 2FECI 1G9EA 4PGBB 4X4YA 1P84J 5T1KA 4POUB 2Z4QA 3QUXA 4GSDH 5LXGH 1AGCA 2X41A 3FB8B 5J6GA 3ARSA 2VL5A 4JPVH 3FHQA 1YJDC 3UPRA 2VR5A 3QDGE 5IV2B 2Y9RT 3QQ4B 3QNYB 5ICXA 3EAKA 3SDYL 1NDMA 3CSYB 4POYA 4PP2A 5MHSD 3KPOB 4LCUB 1CYGA 3B9DA 4NPYB 4U2ZA 4DJMA 4WJ5A 1NCDL 4QCIA 1CQKA 4XMKL 4DKEL 3IDJB 1J8HB 5FUZL 3PUCA 4APQB 1WSST 4JFOB 4UIKL 2IGFL 5D2LE 3QULB 1S8DB 2EXWD 1R0AH 2EH7L 1HH6A 3BZFB 3HLAA 3JWOC 1I1AB 4JAMA 5A3IC 4IOIB 2ZSVA 5MP6H 1KCSL 4DWHA 4PJ7E 4GQPH 3RA7L 3NIFF 1G0DA 3QR2A 1P7KB 3PP4H 1MAMH 3T1FB 5D71H 4J8RA 5KSAD 1J1PL 4HJ0D 1K85A 2QEJA 4HIXL 1EZVY 5D96C 4Y1AA 3CX5K 2VXQL 2X4RA 4H88H 4X9BA 5I1DB 5IEKA 4LQFH 3LKNB 4MCYA 4N9OB 4AEIL 3AMLA 4F3FA 5DJYA 4Q7DA 2BHZA 4NNYA 5ENWB 4U7SA 3VFMA 5IVXF 3AS2A 3T77B 3BD4A 3NIGE 3QG6A 1KB5B 1S5HA 1IM3B 3M17A 4HFWB 4PGZA 5JXEA 2R4RL 4FP8L 1HXYB 3DI2B 4JPWL 4NQSA 2F5AH 5EOTB 1YEGH 5HHVH 1T2JA 4MWFB 5DA0B 1JL8A 5FYKL 1N8ZB 2COQA 2EIDA 1TNMA 1G7LA 5F7WC 3CZFB 4LLDA 4PJHB 1AI1L 2P42B 5A2JH 1QSFB 5C0JB 4AQ1B 2I5YH 4N0UA 3DTXB 5I1AA 5KOVC 5ITFB 4XAKD 5D8JH 2H32H 4M1GH 3GSRA 4XGZB 5BOZG 3DX9A 3C6SB 5L9DH 4NJAH 2P24A 5SWSE 5BZDB 1D7FA 1HQRB 4RQQA 3WJLC 2EIEA 2A9NH 3DROA 1A0QL 3TO2A 2QJDA 1E4XH 2NY5L 3O3AA 3QP3A 5IHUL 4QXWA 3G04B 3HR5A 4OM0L 4NYLB 3PV6B 1SY6L 1UA6H 3E8UL 1BM3L 3EJZD 3QUXD 5E5MA 1NC2B 2V7HB 4EI5A 1XIWC 3UJIL 5B8CA 5TFSH 4GRWH 2V5SA 2ITCA 1SVCP 4YFEA 3FT3A 5I66A 2CPCA 3MOBL 4PRIB 2P46B 1IGTA 4EUPH 2EKJA 3DETC 3ROOB 4ODTL 3OJDA 4KK5C 2APTA 4QXUH 1HYSD 1BECA 2QSCL 4GXVH 3ZDXE 5ISZB 1IEAA 1BFSA 3O6FC 1FV1B 4P59H 2R0ZH 3IFPA 3IF1B 1HILA 4J2XA 1FGVH 1T7YA 2X1OA 5C2BL 1SEBB 3TVMC 3ULVH 4OCWH 4NT6A 2YMXL 1FFOB 2OSLB 3OR6A 1X5LA 1YECL 4PIRF 1N0XH 2APFA 3SDXB 3AREB 3EBAA 2HJLA 4LKXB 2YUWA 3PNWA 3KPNA 1IVLA 4KJWD 4KROD 4ONFH 3TBSA 3MJ8A 4FNLH 4OLWL 3O2WL 4ELMF 4L3EA 1K4CA 35C8H 2CUHA 1D5MA 3BPNB 4WNQB 4UTAH 2ERJB 3WO3B 2Y6SC 4YHYB 3D3VE 4JFYB 1YNLH 4JB9H 4LVEA 5JW3L 4UT6L 5H94B 3INUH 5D6CB 2ESVB 4TYUA 4U6XB 5DGQA 3CSBA 4U1JB 2FSEB 4WCYH 4NKOA 3W39B 3L6FA 4ZPVB 1UVQA 4AMKL 3PQYD 3LQMA 2V5RA 3QHFL 1T03H 1U8QA 3UTQB 4UV4L 5E2TH 5A2LH 1P9MC 5T1LA 4OLVL 4JY6B 1G9NC 4P2RB 3KPPA 3O2DL 1EK3A 1LDPL 3PWVA 4BUHA 1OGAB 5DUML 4TSCH 3FKUS 4HBCL 5FCSH 1E4XI 4FRWA 4N8VA 1JRHI 4R97C 5BCAA 3P73A 1LEGA 1BJMA 2FBOJ 1IQWH 1H3PL 4Z5RB 1AY1L 2FZ3A 2CLRA 3C9NB 2CLVB 3RNQA 3CH8A 2CIIB 1NCUA 3D39A 2HG5B 3GI8L 3IS0X 4JDTH 3WO4B 1XFPA 3MGAA 4ERSL 2R0LL 4IS6B 2GJ6D 4BZ1H 4C83A 4OGXL 5AAMA 3E6FA 4YFLI 1ZT7A 2H2PD 1FZKB 1RMFL 3BYTA 4MNQA 4Y4KC 3VXUB 5JDSB 3PWJB 4KRPD 1ZS8A 1BJ8A 1UCTA 3AB0B 4S0SD 3VMOA 2BX5A 4PJAE 5IBUB 3U1SH 2R2BB 4K07A 2BNQA 5GSVB 4UINL 2YS4A 3RPIB 2X70A 2KZWA 2GFBB 2Q20A 4FQPA 4Z0BH 2HVJB 1FSKC 5IWLC 1X5KA 4Z8FH 1RULL 1UACL 2A6IA 4ZDHA 4PRID 3QIWB 2ZUTA 3QO0A 4OIAA 1RJYA 4N0YH 2X4TA 1MRCH 2Y36L 1WBZB 3LS4L 2FB4L 1A6VH 1MWAL 1U8OA 4M5YL 2WBJC 1R3JB 4LCCB 4K23H 1EERB 4X6CF 5HGHA 3O3EA 1AFVL 4J1UB 2J4WL 3IDIA 4Y0GA 5GJTL 4Y4HC 4G80A 1KC5H 2GJZB 2XNAA 4P46A 3AXLB 2BVYA 1S7RA 3DHJA 5KANI 4X7SL 3MRNB 3RX5A 2EKSA 5CIPA 4LAQH 1RUKL 4ONOA 4M48H 3RDTC 2JK5B 1A4KB 1MQKH 4HXAL 1JUFA 4OD3L 5IB4A 3RL1A 5F8RC 5HHXH 1B9ZA 2DYPA 4ORZC 4D0DB 2FJHA 4PRHA 3TWCL 2XACC 1UFUA 3LN5A 4KTDL 5E8DL 5IFHL 4XCYA 1EEUA 3H42H 1R5IA 1MCHA 4Z7WE 3ARDC 1WIOA 2NY2D 1LP9B 3TZVC 3VFSA 4L8DA 4M43L 3GI9L 1CGWA 4NDMA 4YXHH 3L7EA 4P2RD 4QEGA 4MAUH 4LPVA 3LVEA 1HHJA 4LBEB 3HUJE 1HCFX 3P0YH 4KQ3H 2E8ZA 3OQ3B 2Z8VC 3ZDYE 2HJFB 4RNRB 3MGTA 5DD5H 1G7PB 1UENA 2MCPL 1CZ8H 4LLYA 1F3RB 4S1SH 2BSSA 4LLVA 2E6JA 1N5YL 3RGVC 3QWOA 3VWJA 3NGBC 1AIFB 3FT4A 4XVJH 3BZDA 1QFUL 2F8XC 4I48B 5I75B 4N0FB 5TQ0L 4IJ3B 4OZFB 3GJFK 3GBNL 1DQQA 1Y18A 1CE6A 1T7WA 1UCBL 1EEYA 4MJIB 2PO6B 1AE6H 1SJHB 4U3CA 1KELL 4EKXA 1NCWH 3MSPA 3PV7A 1HKLL 4TULL 4R2GC 5HSFA 1Q72L 4U1MB 3SDXF 1CICA 3RWHA 3RY6A 3LQAH 3P9MA 3OAZK 1C8PA 2X4OB 1UB6A 3TN0C 5K59E 3BRGC 2UUDK 4AK1A 1GJIA 2A6DA 1TFHA 2NPLX 1WITA 2Z31D 4KQ4H 3VFUB 1GZQB 3N1PC 3I6LD 3QIWD 1IEBA 1EJOH 1N26A 4C4KT 4O58L 3QH3B 1AGBA 4MZ2A 3VXOA 1FO0H 1CDUA 5GXBB 4X6DB 5C08A 2FATH 5D7SH 3I2CH 5D9SA 3SE9H 3R0NA 1OAZH 3FCTB 3BGFC 1IC5H 3QDJD 4Y5XB 5EN2B 3RPKA 1BZQK 4FQJH 5IFJB 3QUYA 2HT2C 3IKCA 4JO3L 2N4IA 5CD5D 2J6EA 3K2UH 4BZYA 1I4FA 3VE0A 5EIVA 1VFBB 1OLZA 1NGWB 2FX7L 3SGKA 4ZFZB 3B2VH 2CMRL 4BKLA 3QUZB 3RGHA 5CEZE 4XPGL 1BVLA 4KHTH 1MJUH 2YSSA 3MBEA 4P4KB 4ZFOB 3NAAH 1A6ZA 4OLXH 2ARJQ 3G08B 2LU3A 3T2NH 3WS3B 1A6UH 1T4KB 5GZND 1OD7A 1DE4B 5D2NB 2X4PB 5E8OA 2NYYD 1UG9A 4HKBA 5FYLD 5CZKA 4PGDB 1HI6A 1IKFL 3D9AH 3HG1A 4LSUH 3W0WE 4ZUSA 2UVFA 4QKXB 5ACLA 2VISB 3MFFB 2ADFH 3ALPA 1GZPB 3H9HA 5DJXA 4JM2A 5IMKB 3CUPB 1MCCA 3EYVB 3T3MF 3VWJD 2J88L 1QLFA 3UTZA 5IR1B 2BVQA 4OLZH 1S3KL 1FFNB 2ED9A 1X7QB 1PKQE 3FFCE 2VLJE 3MYZA 4CN1A 3FO0L 3BESR 5MEQB 1RZJH 4PJ8D 5DHVB 2AQ3A 5FGRA 4QHLA 2P45B 3G6JA 4PJGF 1EEZB 2BNRB 2Y5EA 3J7HA 1J8KA 3MUHL 4M1DH 3ROLB 4W81A 4U1GB 5D1XB 5ITBH 3GSVA 4RIRB 1ZWIA 4B41A 5MEOA 1EHNA 4DVRH 1UC6A 3FT2A 3R8QA 1XGRA 3IDMA 3VXPA 5HHNB 1S9VA 2CH8A 5DJCA 1DLFL 4OM1L 3IS1X 4DKDC 1G1CA 1BPVA 4YBQD 4JG1H 3U4AA 3K3QA 4HC1H 2E3VA 2R29L 1ZANL 4JVUA 2GYSA 2BMKB 4XP4L 3UJTL 3VJ6B 1D6VL 1IKNA 1RUAH 1CFNB 1XGYH 3HAEG 1MIEL 4LSTL 3BDYH 5D7IB 4XHQA 4Y2DB 1UKTA 1WICA 2CJUH 3NOIA 4L8BB 3LDBC 3DX8B 5DTFB 1MY7A 1XR8A 5JNYB 3AAZA 3RFZC 1VCAA 4L4TB 4NQDB 4GSDL 1CXIA 1QRNA 4WEBH 4HMDA 3OB0H 4MB5A 1M71B 5I8KH 4XB7A 3KPSA 1JZ2A 2YD4A 5EBLA 4HIJB 1H3GA 1KG0A 5GGSY 4HG4K 4G42B 3RY5A 2RB8A 5F97E 2IANA 3RX7A 1EX0A 4LHUA 3JXAA 3SGDH 3FQUB 1J1OH 4RCAA 2QKIA 5EFIA 5K9KB 2WAHA 2VN7A 1MFEH 5MEPB 3O45B 1UWEH 5DJ2A 5EC1A 5GHWH 1KB9J 3S96B 1AO7A 4KJQD 3K74B 1R0AL 4RZCB 4FXKA 4U6VH 4Y4FD 1MPAH 3VH8B 4NM4H 1WZ1H 3QBTB 2QQNH 4PJCF 2E7BA 4JRXB 4J12A 4K3GA 1R3KA 5MP6L 2Z35A 1NL0H 4FTVE 1T22A 3LQZB 4Z7QF 4MAYB 4JY4A 3NZ8B 1TMCB 1JJUA 5C09A 4KZDH 3V5DB 1FRGH 3EYUL 3PP4L 1J1XH 1MAML 4ZO9A 3MRMB 3BPOC 5D71L 2VE6A 2B7DT 5C0EA 1R3HA 2YUXA 4H88L 3H9YA 5EBMB 3QRFM 1J9CT 4LQFL 5FIEA 3UPAA 4L3CA 5L6YH 2FLRT 2NY6C 4MA1C 1WBXB 2X7LB 3PGDA 4PJFB 1IQDB 2ZSWB 5E6YA 4OAWA 4XC3H 3U83A 4RRPA 5ALCH 5F1OB 3C6LA 2FO4B 2CR6A 3MLZL 3MRKB 3VMNA 5GZOC 4K7FB 4LRIA 4PJDE 3L3DB 1YEGL 5HHVL 5IHZB 4YEFA 3L95A 3BW9A 3DGGA 5TE7H 3GMRB 4PJ7A 2XXCB 5D1XD 3KLSA 2I5YL 3EFFA 2B20A 1KJVA 1B3JA 1YN7A 5E1AB 3S4SA 5D1ZC 3QIUA 5D8JL 4M1GL 1N6VA 3RY4A 3UEZA 4C56B 1FVEA 1T21B 4L9LA 5CSGA 3CJJA 4LK4A 3Q6FB 3MYJA 4NO0B 4MQ7A 4XP9H 5L9DL 4NJAL 4GAGH 3PHSA 1P6FA 5BRZE 4N90E 4PJIF 2A9NL 1QHPA 4MNGA 2VLKD 2RBLA 4UNVA 4XHJC 1E4XL 1YY9C 3ULUC 3UXFA 15C8L 3GUTA 3R06B 1GC1H 3PE9A 1UA6L 3FQNB 3NCYS 4EVNB 1QRND 2AV7B 2XWBB 3MRHB 6FABH 4PJ9B 3P40A 5SX4H 1UZ8B 2BNUB 3RI5K 1R3IH 4X8XA 1P53A 4NQUA 4AIXA 5LGJA 5BS0D 4WW2C 2YRPA 1YEDA 1IGIH 1R5WB 3JZ7A 3ECBB 2EDWA 3QIBA 5HGBB 2OK0H 3S3PA 4QXUL 5E8NB 3EGSA 1XMWA 2DLFL 4GXVL 4ONHA 3EYFB 4P59L 3ARPA 2WWMC 4C4KO 2O5YH 4WHYG 3ULVL 4OCWL 1UWXK 3U30B 4HGMA 1N0XL 1A7NH 5TF1H 3HE6B 1LEIA 5CHNA 2GJJA 1F2QA 3W11C 2VXUH 2R15A 3F62A 1EHXA 4WI8A 5F3HA 1KXQE 1K2DA 2WWKT 4ONFL 4RSVA 4D0BB 4FNLL 4JQVC 1I8IA 2CRYA 4GKNB 35C8L 2WINA 2EIZA 5CSBA 2W9DH 5DEFB 2NR6D 4UTAL 1T5WA 4ISVA 3RVUC 3MZTA 2YC1A 1YNLL 4ZXBD 4BFIA 2B5IC 3ESVF 2BOBA 4ORGA 2BY2A 5CEYA 3INUL 1F02I 5MI0B 1IRAY 1PDKA 3BKCH 4WCYL 5E2WL 5HDQH 1M05A 3TA3C 3SDAA 3DRQA 2OLDA 2KBGA 5IT2H 2YPLE 4RGMC 2B4CH 2VDPH 1OAQH 1JV5A 2EYTB 4MA3A 3KYAA 5E2TL 3MRJA 1IJ9A 3EOAA 5HI3D 1B90A 2GSGB 1T0NB 3MX0A 1NFDA 1Z3GH 1S7XB 4MCZA 4RX4D 4PGCB 5DMKA 5DFTA 1WQVT 3WFZA 3MV7A 3GGWB 4TSCL 4S1QH 1W72B 4LSRH 5EU4B 1VFAA 2E7MA 3C5SA 2P5EB 4Y16B 1HHHA 1NCAH 4H1LH 4MXQD 1XAUA 4KVNH 3L3IB 4JKKA 1BIHA 2W59A 3K46A 3IDYC 4A2LA 2IH1B 2F54B 1K4DA 4DFHA 4ZFGH 4GW1B 2YPKA 2EEDA 5IM7A 1Z9LA 4UUJB 1Z9OA 3E1F1 5SX4I 5KVFH 5CJQH 1BBDH 2KH2B 4KPHL 4YHPB 2QADB 2F5BH 4JDTL 4K7PX 2FL5B 4U6HB 1L7IH 4KI5F 2DKSA 4BZ1L 1A6PA 5GS0C 3DUSB 3VCLB 1Z2KA 5EZIH 2IPKB 3KJ4B 3LKQA 3NPZB 3MLVH 5FOJA 4RFNC 3IFOA 3V0WH 3U1SL 1I8LC 4R6UA 4CW1B 4MVBD 4HULB 2F74A 4ZO7A 1DQDH 2FIRT 4JGMA 5DO2D 3WEXB 4JFFE 3KPQB 3O41A 2OS7A 4Z0BL 4GG6A 1S9XB 4PJ9D 5HDBE 4NRZB 3TNNB 4Z8FL 1E4KA 4A6YH 4BSJA 2VITA 3VRJB 5I17B 1Q0YH 4HDIB 4KV5E 1N2RB 1S7VB 2WLZA 2XN9B 3D6GA 5DUBB 3IJYB 5ACZB 1U8JB 3GB7A 4YDLB 4LHUG 3X14B 3F7QA 4N0YL 1MRCL 3ZYZA 2LQRA 4LIQL 1GAFH 2C3HA 4MSWB 4R3SB 3QDAA 3Q48A 4FABH 2DB8A 3DX7B 5D7JB 2VL4A 1NDGB 5DJ0A 2O93L 3BVNA 5JOPE 1RHFA 4RMRA 4PJAA 4KKBC 5GRZA 4YAQB 1KC5L 5HHOB 1GPOL 2UYLA 1R6VA 3BD3A 3UTSB 4M6OH 1CGSH 1B4JH 1ZT1A 4LAQL 1TPXB 1MLCB 4KU1A 1NGZB 3AM8C 3FO1B 3MCLH 4AQOA 2XTLA 1PYWB 2ICWJ 4M48L 4M5ZH 3KPRB 1FAIH 3MJ7A 4WWKC 3U4EB 2C3WA 2NXYC 5AUMA 2WK2A 1MQKL 5C92A 1IM9D 4Z7UB 3O9WC 5HHXL 4UI2A 3DVIA 4CGTA 3BZ4B 1YC7A 1MH5B 3L7FB 1CD1A 3ARGC 4O4YL 2P43B 3H42L 5K9OA 2H3NB 2A74A 3UMTA 3TIEB 3VFNA 2EDXA 2XIDA 4RRPG 2NXZC 2CO7B 5ID0B 1TVBA 1C5BH 1FE8H 3MV7D 5LKNA 1T89A 4YXHL 5FO7A 5ID1B 4CAGA 3F7VB 5DHYB 4OF8A 4KVCH 1KV3A 3LSOA 4MAUL 4Z78B 4NC1E 5J11C 2NY3C 3P0YL 4KQ3L 3BJLA 2LE9A 3KR3H 3NVQA 3OKMA 5IK3B 4UDUA 1U8IA 5GIRB 5DD5L 2QSQA 1HHIB 1CZ8L 1CDIA 1P4LB 4S1SL 3M1BA 1C5DB 4OCSH 3L3HB 4XVTL 3NA9H 2VYRE 3EDDA 2LAAA 3BP7A 1RZGA 4M6MH 1QQDA 4XVJL 1FZJA 2OTWA 1MFBH 5E8OB 3MRPB 3DJ9A 2O26U 3UYOD 2QADD 3X12A 3O8XC 3ULSA 1DUYA 2V2WA 1AE6L 1NCWL 1NEZA 2I24N 1V7MH 3BT2H 3D2UD 4GXUM 1I3GL 1QLRA 4HX1A 5CEXA 4OZHB 1RQ5A 4IIQA 3M45A 5E6IA 2LU7A 3WFEH 1XGUB 1DQLH 3PIQA 2YEZA 3DARA 4XZUB 2A9MH 3GSOA 3LQAL 4YNYB 2CKBH 3MUY1 1NUDA 1ZE3C 2DJUA 5JW4N 2BC4B 1EH9A 12E8L 1AD0B 4MMZC 2DI9A 3L3KA 2P47B 1KACB 1RK0B 3REVA 4HFUH 4KQ4L 2IAMB 2MQ3A 3WXVH 2EYRB 3JV6B 2XN9D 2C26A 4F7CA 2X42A 3BD5A 3OKLA 1EJOL 1LO5B 2CK2A 3OKDB 3CPLB 5HI5C 3VXQA 2AEPH 1BOYA 4NJ9H 4HWEL 4R4ND 1VDGA 2ZNWA 1KNOA 2FATL 1A9EB 5D7SL 1KN4L 3I2CL 2VLRB 5DJ8B 4UILH 2DKMA 2Z9TA 3SE9L 2EE3A 2Y25A 1IC5L 5JQ6H 1J8HE 1DN0A 4N5EC 3HZKA 1EJ6A 4FQJL 2Y07H 1YEFH 3IVKB 5JZ7C 3GSNB 4PRPE 3HB3D 3UTSD 5F44A 3K2UL 3D25A 1ITBB 4X4YB 3WDIA 1RAMA 2FGZA 4PTTA 5T1KB 2Z4QB 3KPRD 3DMMC 3B2VL 4MDIB 5JIPA 4EQ3A 1LQSR 4WU7A 4QHKJ 4L5FH 4QYOB 5KSVB 5IIEA 1H8OA 4ZSOB 4KHTL 1MJUL 4Q6IC 5ICXB 1ZLSH 1NDMB 4G8GA 3LB6C 3NAAL 4OLXL 4XXCA 3T2NL 3RHWF 5F1SA 4XH2A 4XI5D 1OTUC 4QCIB 1FG9C 5LJYH 4J4PA 3D9AL 3PWLA 4LSUL 4UOW0 3S34H 2UWEF 4G9FA 3FO2A 2H45A 2ADFL 3H9SA 2Z93B 2NX5B 2WWKO 2R2HB 3LPGA 4IBLT 4OQTA 1IEHA 5DRNA 2QV2A 1H5BA 2ZSVB 4PG2C 1Z0NA 2LTQB 2Y5TB 2CUMA 5C0IA 4OLZL 3WIHA 5CMAA 2JB6B 3CU1A 5GGRY 2IBZY 2ZUQC 4OZIA 2AJZA 3PF2A 4PRAB 1MHCA 1V3LA 4PRNA 4NQVB 1QSFE 3VFTB 1X5IA 3LPWA 1RZJL 4KK8C 4J8RB 1IZJA 4P2CG 1BHGA 4PY8J 4V2BA 4Y1AB 2NY0C 2J8UE 4YGVA 5KAQG 4M1DL 5E6ID 3D87B 1D5IH 5D1QC 3VU2A 4KKAD 4WUKH 3CH1A 4F3FB 3H0TA