5T33L

Crystal structure of strain-specific glycan-dependent cd4 binding site-directed neutralizing antibody cap257-rh1, in complex with hiv-1 strain rhpa gp120 core with an oligomannose n276 glycan.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
212
structure length
212
Chain Sequence
YELTQPPSVSVSPGQTARITCSGDTLSTKWSYWCQQKSGQAPVLVIYEGNKRFSGTPAKFSGFHSGTMATLTISGAQVDDEADYYCFSTDSSGQTWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CAP257-RH1 heavy chain
publication title Structure of an N276-Dependent HIV-1 Neutralizing Antibody Targeting a Rare V5 Glycan Hole Adjacent to the CD4 Binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t33L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t33L01
5C0IA 5IBTL 5JQHC 4XP6H 4JFFD 5DD6B 3MC0A 2Z31D 4GRMA 1WWBX 4APQA 3BZ4A 4XX1E 5E70A 1M7DA 2NY5H 5IQ9A 2X4OA 3RTQD 2X4RB 5GSRA 2WBWB 3D39A 3GMNB 5CLTA 3UTSE 4OIBA 4XP4H 5GGTH 8CGTA 1JN6B 3AM8A 4LU5L 2VERN 4DGYH 2P5EB 3MOQA 2NXZB 4OQ1A 4UTBH 4PREB 4AEFA 2A83B 1F6AA 1PYWB 3IXTB 3BW9B 4J3OC 4XBGB 5F7LB 2J5LC 1FRGL 5F3BA 4FNLL 4KTEL 1DCLA 4MHHG 4NQSA 3TYFA 5DJ6B 5JLZB 4PGDA 2VXSL 1SVZA 3P40A 1A1MA 1D5BB 1G7HA 1R3KA 4LHUB 5FGRA 2J8UA 1NEUA 2W07A 2XN9B 4PJGA 4NNYA 1FYTB 3S37L 2IADA 1A3LH 1IGCL 1I1AB 1ZEAH 3D2UA 2YPVH 2NY2C 3O4OB 3WNLA 1NEZA 2YKLL 3CLEL 3SDXE 5IV2B 3KPNA 1MJUH 2EKJA 4ACPA 4PLOB 5E1AA 1AGCA 2VLMD 4G80B 4GMTL 2VC2L 3WHE1 3GMLB 3F5WB 4G7VL 3WUWG 4UIMB 2DQEL 5E56A 4Q6YA 1L6ZA 3DSFH 3MGTA 1TXKA 3JV5A 4PJ8B 4QRQB 3QQ3B 5CJQL 2A0LC 1JFQL 2MNUA 3AY4A 1XF5B 3LRSB 4U1IA 5IFHL 1SVCP 2DKMA 1A22B 1NBYA 1QBML 2QL1A 5HYQA 1Q1JH 1CFSB 1ITBB 1X6NA 2C3XA 3EOBA 4M02A 3KS0H 5ILTL 1ZKAA 3GEWB 1XIWA 4KK6D 2OR8A 5ELIA 4TSCH 5FF6B 4HS8H 1BEYH 4MJ5B 2EXYC 1T5WA 3FT3A 4HPOH 5FHBH 2MPAH 2XYCA 3CK0H 2NY6D 1UXSB 3MJ9L 1RUAL 4YJZL 2BY0A 4N0YL 4Y1AA 4CN6A 5CJOL 3DNKA 3WE6B 4DEPC 5CILL 3QI9A 1QSEB 1NL0H 3R1GL 4R7DB 3SGKA 3SKJH 5JDSB 3J7HA 4ZOCA 5LGHH 1QLFB 1NC4D 2CDFB 3G6JF 1JHLH 4PRPA 3IFPA 3QWRA 3BEVA 3WIIL 5J11B 1MHEA 4X9HA 1JZ2A 2NTFB 4QY8A 5D96C 4MQ7A 3EYFB 4U6HB 2P7TA 4XT1C 3TNNA 1X9QA 1QLEL 4G8EB 4OLWH 2Q7YB 5K93A 3OX8B 4MXWH 3X13B 4HXAH 3IAPA 2ZG3A 2EKSA 1MCLA 3VGGA 4X7DC 1ADQH 4Y19D 4FTVA 4KV5F 4MA1B 43CAA 1S8DA 2P43B 5FFLA 3AXLA 4MCYB 4Y4KC 1YPZE 5D7SH 5JW5A 3MJ7B 3WLWC 1MCSA 2R0WH 2ZP0T 5DUMH 5E2TL 2XPGA 1DQMH 2VAAB 1UA6H 2XTLA 5C0AA 4PBXA 2VDKH 4OLYH 2VABB 4ZUSA 5H35A 4PFEA 2PO6A 2Y6SC 5I2IB 4PJ9B 5CBAB 3O3DB 1WBXB 1U8MA 3MZTA 3T0EA 1A14H 4XH2A 4Q58C 5ERWA 5FB8A 3VXSE 3CFCH 3H3KA 3WJLC 4KQ3H 5J3HC 1BVZA 3F12B 1E27A 2RHEA 5MEPA 1Z9SA 1SY6H 3F6LA 3PWLB 4S1SL 4ODBD 1OTTC 2OL3L 1C7SA 5HI3C 4YIQA 3RJQB 3MROA 1N7MH 1KIUA 4K7FA 4LBEB 5GZND 5C0BE 5JW3L 1H8SA 2BNRA 1YN6A 3BZEB 3NFNA 1J5OL 5J0BA 2GITB 1VADA 3VWKD 2J6EL 4HWBA 1FZMA 2P5WB 4XC1H 5ICZA 6FABL 4K9EL 2Z8WC 4TNVK 4KGJA 4LSSH 5D71L 5A16B 1IC1A 4RNRA 2XWJB 4L5FL 5KSAA 2DYPD 1LE9B 1UVQA 4PP2B 4JY6B 3MLUH 5JOEA 1IGIL 4HHAB 4GUPB 2BVPA 3I2CH 2QJDA 4APQD 3CFDA 4AIZB 1QRNB 3D39D 3HE7C 4Z0BH 3TPKA 3BPOC 2HJKB 4MJ6B 2ATKB 1UM5H 1S5HB 3VWJB 3H0TA 3GNMH 4YHOH 3WIHA 5A40E 1IC5H 1RIUL 2X4UB 4Z78A 3QUYB 3WD5H 3HZMA 4JQIH 3SJVE 1KIQA 3MV11 5L6YH 2D4DA 1EHLL 3S36L 1QZ1A 4N8VG 3V6OC 2F53A 5HHNA 2UZXB 3NAAL 2BJMH 4UBDD 1NQBA 2M8XA 1OLZA 1K4DB 3HR5A 3MGOA 3D2UD 1JWSB 2GKIA 5GS1B 1G1YA 2R1WB 4XCCH 5E6YA 1D5ZA 4X99A 2FJFA 4LL9A 2IQ9L 5ANMB 3SDDA 3NFPB 5D70H 4ZAKD 4P46B 4PBWD 3DJ9A 2XACC 1R5VB 2C1PB 5FO9A 1RZKH 4QEGA 4WCYH 1OARL 5D1ZC 2CR3A 3H9HB 3B9KA 4P2QA 5ADOL 3C6LD 1VFMA 3EDFA 1MFAL 3QBTB 5AUMA 2XY2A 2J8UE 4PJGE 4WW2F 4JFDA 3T3PE 1UFUA 2NXYB 4PJ5D 5KS9F 5E03A 3UTOA 5I16A 1XIWD 1JGUH 2WK2A 3O6FC 5C2BL 4PJDF 1RIVL 1NBZB 4JO4H 4OCSL 3BOVA 3JWOH 4WU5B 1T2QH 3P30H 4NUJB 4QRPB 1NAKH 3WUWA 5IHUL 2ICWB 3O41A 2JB6A 3V7AE 1Z6JT 1CDCA 3S5LB 4HUVB 3VMPA 5KSBE 4Y1AD 4IMLA 1C1EL 1D5IH 2FIKA 3P0YH 1YJDH 5IR1A 1RQ5A 4XB8A 5I1IL 3G08A 3U4EB 3MBXL 1W72L 2EIZA 2RB8A 4PRPD 4R4BA 3VD5A 3QWRD 1S7VA 3GHBH 1DN0B 2AW2A 4OBSA 3HI6L 4CN4A 1RIHH 1UC6A 3F7YA 2CRIA 2A9MH 4IJ3B 2XZCL 5IMOA 3UBXI 4MJ2A 2IMNA 3RVVC 4TVPL 1SEBA 2VXUH 4TNWK 4Z7OE 2IAMB 2X4PB 1YY9D 4JHBA 2BVOA 1K4CB 3RNQB 3EOTL 1L7TH 1CL7H 3FQRB 1QBLL 4FTVD 2F5AL 5CHNA 3LVEA 4Y1AE 4GXVH 5DDHB 1RU9H 5EU3A 4M8QA 3MLZH 2EE2A 3RKPA 2XRAH 5FYLL 1WZKA 4V1DE 3VXMD 4EOWH 4E41B 1HCVA 5HDLA 5C0AD 4NZTL 4PRPE 2PO6D 4UUJB 4UINH 2CKBB 3DUSA 5T3XD 5IVZA 2DQTL 5FM8A 3T0ED 4AH2A 1U9KA 4LSQH 3PNWB 3IGAA 4U7MA 3TA3A 4D9QD 3CXDH 3O11A 2ICEA 3NPSB 2CDGB 4LCYB 1RUML 2UWEA 3QNYA 4MNQD 4F3FA 3VXOA 5IF0B 1WFNA 1UH4A 4I0CC 3L6FB 4D9RE 1UENA 3HZVB 1OM3H 2RJMA 4KK8D 1P9MC 2WINB 1QNZH 5CBEB 5T3ZH 3QSKB 2HJLB 3L1OL 3O9WC 3FT2A 3E1F1 4RFNB 4GKNA 5IT2H 4WWKA 5EC2B 5IB1B 4PY8J 4LNVA 1JGLL 2EIBA 5KSAD 4YAQB 4J4PA 4UT9L 4G7YH 2OXGA 3J8F7 3WN5B 5ADPH 2J1KA 3L3JB 1FE8L 4F15C 2EC9T 2ORBL 1LGVA 2XNAA 3MOAH 1NCNA 1GRWA 1I8MA 2NY6B 1PX3A 3EGSA 3U36B 4ZOAA 1MF2L 4XC3L 1CFQB 4RIRA 3KYKL 4OD1L 5BVJB 2BNRE 2UZIH 4JAMB 2Q86B 4BH8A 5GGQH 4JPVH 4M6MH 1XGRA 5J89A 2Y36H 2JKXA 4IDJL 4M7KL 5B4MD 2BSTB 4IS6A 3SDCB 3UYOD 2FO4B 4JQVC 2AXFA 4BQCA 2FD6H 1TZIB 1U8JB 5EWIH 4OIIH 3SBWC 4X4ZA 25C8H 3TZVB 3MLRL 1SJHA 3MFFA 5FDWA 2YEZB 2F53D 2DWDA 3FO0L 4GG8A 5LCVH 4CU6A 4MNHA 1KEML 5GSVA 5K59F 2D03L 5A3ID 4QHLB 5CEZD 2CIKB 3KR3H 2YD6A 4C83A 3AAZA 5HXMA 3SDDD 2AABH 3EKCA 2NNAB 3U1SH 4YK4C 3ZKNC 4GQ9L 3UTZA 3ARBA 3UTPD 2CR6A 5MERB 4HUUB 3JV4B 3QHFL 4LOUC 1D5XA 3V6ZB 3RI5K 2M1KA 3IDXH 3GKZA 4CMHB 4Z7NE 5C08B 3B9KD 2FJHB 4MXQD 4RMVA 4LVOC 2R2EB 1JWUA 2F53E 5D4QA 5IM7A 4OUUB 2DI7A 3TIEA 2BFVL 3WFDH 3ME0A 2CH8A 1R3HA 1AQKH 4FP8L 1A02N 3IB4A 1EHNA 4TSBL 4E9LA 1IRAY 5BW7A 3RWFA 4OD3H 5K9JH 1NANI 3O6KH 5D5MA 3QUMA 5I30H 5I75B 2DQHH 4YGVA 4UB0H 1G6RB 1S7WA 2HG5B 3MRCB 1P4BL 3DPBA 1GIGH 3UTPE 2A6IB 3PL6C 1G9NL 4ZO8A 1RAMA 3VFMA 4NPYA 3ULUL 1B6UA 3PWNB 2AK4B 2V2TA 3GSQB 5HGAB 2EH7L 3LD8C 3HC0A 3HB3D 2Q6WA 1HKLH 4P2QE 1YEIL 2UYLB 1ZE3C 5IW3A 3C08H 2VAJA 1YNTB 4JFZL 1T1XB 4FQXA 3LHPL 4JFDE 4G42B 4H1LB 5HYEA 1JHTA 4NFCA 5CAYB 3EJJX 3FN9A 1MHCA 1KPUB 2A77L 3RGVC 2CUHA 1BZ9B 1DL7H 1TZGL 3TBYB 1KTRL 5KVGL 4NNPH 2LU3A 3FN3A 3B9AA 3G04A 5FO8B 2H1PL 1JPFB 2X4SA 4ZUUA 2H9GA 2FGZA 2OZ4H 5I8OL 3OG6B 1DLFH 2I26N 4HMDA 4G8IA 4RGND 4U2ZA 5L9DL 4YLQT 1YMMB 1QPXA 4PJAB 2ERJC 5I1DA 1EMTL 3BVNB 1GGCL 2FYYB 5DVKA 3HZYA 1U6AH 1J1XH 2ZZUT 3WFCH 3F7QA 4ZS6C 2R0LH 1A47A 4ALAL 2NQCA 1CT8B 2Z0BA 4M6NL 3LB6D 3OGCA 5FYKL 5CGMA 3L3HB 1DBKL 2DQJH 3X3FH 3NGBB 2V7NB 3RVXC 4S2SB 4S0TD 5HHOB 1J18A 1OP5H 3UZQA 1S7TB 2VZSA 1RULH 4QXTB 4ZD3L 4ZAKB 3CSGA 5DJDA 3TA3D 4MQXC 2ZCLL 4I4WB 4IOFC 1IE5A 1IZJA 5TQ2H 1AJ7H 1EO5A 2NYYD 1LEGA 3GHEH 4X6DF 3S34H 1F3DH 3VRIA 1FGVH 2VUYA 3W11C 3BHBA 4MAYD 4LEXL 5I66B 5I0DA 1FL5A 2AKRA 3RNKA 4NT6B 4NP4L 5E9DA 3IDJB 4YX2H 1HH6A 1W0WB 4YHZL 5EORL 1IC4H 3EO0A 4JFXB 4OD2A 3L7EB 2Y07H 2W0LA 4YC2C 4XGZA 1A1OA 2E9JA 4HWZB 4PJ5B 4WWKD 4DCQA 1DFBL 4YNYB 4X7FC 4Y5XA 3MRRA 3OB8A 3ZDYF 1DANT 4OCLC 2VZ1A 1FVCB 4J3UA 2VDRH 4KJWD 2UWEE 3RDTB 2R2HB 3BP7B 4JN1L 3W0WA 1FGNH 3TM6A 2EIEA 3RWCB 4CNIB 2PN5A 2W0KA 1Q9OA 5DURD 5T5NF 2NMSA 2QSCH 2H6PA 1QYGH 2PKDA 3D6GA 1VEOA 1QSFB 1Q9LA 3V0VB 1S9VB 1S9KC 3C2AH 2D9CA 3SKNA 3MRJA 1KT2A 1I1CA 3CNKA 4OLZH 1MAMH 4PJBB 3MV8B 5MENA 2EEBA 2IAND 5E8PA 4Y4FB 2BDNH 3CUPB 5ACZA 1NDGB 3N50A 1B2WH 5DMIL 3PGCA 5IEKB 4JDZA 2AV1A 4PG9A 5JOPD 3PQYE 1HZHL 5HYIA 3MO1B 5EZIH 1KOAA 5J6HB 1WAAF 8FABB 4NM8H 1BFTA 3QQ9D 2HT2D 1VKXB 3C09B 2QKIB 3ARBD 4O02L 4HMEA 1T83A 5DA4A 5EIVA 1OAYL 4LLAA 3GSUA 3GJFH 2XQBH 3P2TA 1T66C 3LKQA 3V5KB 1OQOA 2FBJH 4PGEA 3VXMB 4YHPB 1IBGH 1IAOA 2C3WA 1MAKA 3QA3A 4M7LT 5EZLA 1UWXH 3LS4H 4YH6A 1XCTB 1UWGL 1YNKL 1Y0LA 4MDIB 1JGDB 3G5ZA 1IILE 2JCCE 4X8JA 3RHWF 2PETA 3IDNA 1SY6A 1XGTB 4RMWA 3SQOL 2DM7A 2J5LB 4CW1A 4FMFA 2DN7A 3VD7A 3U6RA 4F7TA 2IPKA 5TQ0H 3RGHA 3K74B 1MNUH 1DEEA 1JF6A 1RHHB 2F54A 3VI4F 2GQHA 2VWEE 1NAMB 2NW3B 2P42B 3U7AA 2NY2B 3BQUA 2UV3A 3HNSH 3X11B 5K9KB 4ERSH 4JHAH 3HLAB 3RU8H 1NFDA 2NR6C 1A7RL 4U3CA 3PWVB 1QFWM 3OKLB 5D5ME 5DEGB 2ZCKL 4XAWL 5DT1H 3SHSA 1FZJB 1YQVL 4F57L 2Z8RA 3KWWB 1OP5K 3GB7A 4XVSL 1KYOJ 3Q5OA 5FAAA 3TVMA 2AJYL 3MLSL 4KKAD 1CF8H 2DD8H 5I1LB 4G9DA 2ADIA 5EBLB 3TESA 5IROC 3QRGL 4LLUA 1U93A 1VCAA 1KNOA 4U6XB 1RPQA 5DK0B 3PUCA 4WGWB 3GMPB 3HPJB 3S3JA 4P59H 5I1EL 5EN2B 4C59B 3HRPA 5KSVA 4MD4B 3QIBD 1NMAL 2XG5A 4MMXC 5D72H 2W0PA 3UYRH 4ZXBC 2EYTB 4R96A 4RGOL 2EDYA 4BZ1L 1FFOA 2HKFH 3L9RA 5HDQL 1H15A 4O2CA 1CD1A 5BOZG 1FO0L 2VB5A 5IVXA 1LMKA 1UYWL 3F7RA 2VR4A 3FZUC 5FA4B 3U9UB 1S9XB 2E7LC 1KJVB 1TZHB 1U92B 4X6CB 5DS8A 3O2WL 4DEPB 3HG1B 3IKKA 3AREC 3ARSA 4PJ7F 4WUKH 4U49A 1J0YA 1L0QA 2R2CA 3K8LA 3BH9B 1TETH 4U1MA 3UJJH 4A6YH 4CBPA 3GSOB 5HHVL 4HMCA 3S6CA 3B6SB 5F7FA 3LEYL 4PG2C 5E9DD 3LKPA 2D31B 5D96B 1WZLA 3MUGB 4ZDHB 1LEIA 2DM4A 2PW1A 4PJIB 3QNZB 5AD0B 5E8DL 4JO2L 1J0IA 4ODWA 3P4OB 3G5YA 3FMGL 4XPHH 1HQRB 3NOIA 3F58H 1BP3B 2OMBA 1T89C 4P2YA 3QWOB 1VFAB 1FZOB 1VFUA 5F8RC 3ZE2E 4Y4KB 3REVA 1K6QL 1OAQH 2ADGA 3I6GB 1J1PH 2GSIB 1OTUC 1CFTB 5DHYB 1CD9B 4KY1L 5HYJB 1AO7A 4JCMA 5TF1H 4JY4A 1BVLB 4TNWF 4GRWF 1FC2D 1I8IA 4HIJB 5E9DE 3RVUD 2V2WA 4ONGL 5ICXB 3UZVB 3VD9A 3KDMA 1AXSB 3TO4A 3WFEL 4YXLL 3AS0A 1HHGA 5AYQA 5IKCB 2JIXD 3HCVA 4LAQL 5B8CB 1H9VA 1DQDH 3WKMH 4KTDH 3DMMC 3ZZ1A 2I60H 1F3JB 4JM2C 1JYWA 4QRTA 3ZKSD 4PJXB 4ZPVB 4N0UA 1MUJA 3W0WE 1LK3L 4OF7A 4D0BB 2ARJQ 3T2NL 2GJZB 1FNEA 4WO4C 3NZHL 4RGNB 2OL3B 4M00A 5DVNA 1LO5A 3TCLB 4R0LA 1NH6A 5DYOB 1RHFA 3CMOL 5DWUL 3L5WB 5HYSA 1YC7A 4XBPA 5MENE 5SWZA 5CSZA 4NKIL 4DKEL 1KULA 3GSNH 1A7OL 4ZS7L 4QNPF 4GAGH 5T1KA 2R0KH 1JF1B 4WDIA 1B4JH 4ELMF 1ITCA 3MRKA 3PDDA 3HE7B 5IK3B 3BPOB 1G7LB 2B20A 1CU4H 4WWID 4LSUH 5FIEA 2CIIB 5SX4H 4FQCL 5ETUB 1FZKA 3GO1L 1AGDA 4Y2DA 5ISZB 1MJ7L 2C9AA 3MCKA 3QXAB 5F71A 3GSVA 1NCAH 1S78D 2Z8VC 1JI1A 3QHZH 4E5XA 1J0HA 3LEVH 5J12C 1D9KB 4MAYB 3E0GA 3AM8C 1H3PH 3QDMD 4XMKH 1TFHA 4P2OA 2YPLA 5CIPH 1QFOA 3LV3A 5C0GA 2E7HA 1HI6B 1AGEB 2JK5B 4PGCA 2F54D 1CLYH 1DQLH 2R56L 5GRVL 1JTOA 3BQUD 3QEHB 4LHQB 3ZE0E 2VXTH 1K9TA 1INEH 4Z7WF 3QXVA 1F97A 1VFBA 3LZFL 2CUIA 32C2A 4OLXH 3EFFA 4YHML 2HWZH 1VEMA 5C0JA 4XPBH 3FO2B 3HI1B 4QTHA 5D1ZB 4XRCA 3VXUA 5I1AA 1ACZA 3C5JA 4KUCD 5SV3A 1KB5B 4ZUWB 4N0CD 2QLVB 1KBGH 1C7TA 4HK0B 4G5ZH 4NN6C 4U3XA 4G8GE 4L3ED 1LQSR 1CLZH 3VFOA 2EDJA 2MWCA 4NKMB 2F54E 2NY0D 1HCFX 2X7LB 4PJHE 5ID1B 1P6FA 2DQFA 5D2LB 1UKTA 1R6VA 2IANB 2HKHL 3D1MC 3O6FB 5HDBF 1G7MB 2I5YL 4HG4J 3BZDA 4F7CB 5CSGA 1BF8A 1YNLH 4ODTH 3ARFD 4W4NA 3PABB 5LAXB 1A6VL 4KMLB 1Z9OA 4OZHF 3MLYH 4G6KL 4AM0A 4JRYB 1CG9B 2NTSP 1AFVL 1V3JA 5DMKB 3ZDZE 1C08A 1FG2B 1G84A 4NYLB 2PNDA 4Q0XH 5C09D 5E99H 4QCIB 2VDML 3X14B 3RFZC 4U6YA 2AQ2A 3A67H 3PF2A 4PRHB 4Q7DA 1ZGLM 2J88L 3OXRB 3QI9C 5DJ2B 5J06A 3LIZH 4YWGL 3O6ML 4EIZC 3ZTNL 4LLYA 1KEGL 1H3WM 4I3RH 1CE6B 3HC4H 3RVWC 1BD2D 5DO2D 5IVXE 2AI0H 4NO0A 4HQQH 1C5DB 3WJJA 5E2JA 1NMBL 4L8CA 1XF2A 1HHIA 2JLLA 1NMCB 5I15L 5KVDL 1H3XA 3MLWH 4U6VL 1AO7D 3BDXA 4GOSA 4ONHA 3OKOB 4XPGH 5BV7H 2A1WL 3FKUS 1ZT1A 4NDMA 2Z92B 5DRWA 3V8CA 3ALXA 4BUHA 3IVKA 5SWSD 3S35L 5IB3A 1OT1A 1QA9A 3TIDB 4FXGB 5DC0A 1B6DA 3WLBB 2WM0A 1CDBA 2DLFL 2OXHA 1OB1A 3L3GB 4PV8B 4XNQB 4Y5YC 3KGRA 5FKAA 3GMMB 3WXVL 2B0SH 2UVEA 2VLRD 4JN2A 1CK0H 1U8QB 1NPUA 4Z18A 2XZZA 2EZ0D 3VFTA 3ZKMC 5F3HA 5I1GL 5TDNB 4G6ML 1AO7E 3NIDF 3TYGH 4MHHI 4UV4L 3LMJL 4PLNC 4QHKI 1ZHKA 1K2DB 2IC2A 2XWTB 3BP5B 4HWBL 1N6QH 5TE4L 4OBRA 3WHE0 1UM4H 1WICA 5F6IC 4M7JH 1IT9H 2BC4A 4YHIA 1J8KA 1BLNA 4NRXA 3WFHA 5CZXC 2IPTL 1RJYA 3BPCB 3CZFB 4F15B 5BS0D 1ZV5A 3BKCL 2K9UA 3G6DH 4FQIH 2Q8BL 2EDNA 4QOKD 4NQCD 3GSRA 2ZJSL 2MCPL 2QQKH 4XTRD 4RMUA 3BFOA 1YYMH 4N0UE 1KPRA 5D6CA 4I0KA 4Y2DD 4PS4L 3INUL 2I25N 1ED3B 3WIHL 1PVHA 4AYFA 4OZ4A 3U48A 3D3VB 1A6TB 3BT2H 1GXEA 3M8OL 4QRSB 4NHCL 4R90H 4J3TA 1CGWA 4P2OD 4BSVA 1AD0B 2YPLD 5SWZE 3FB6B 3KNBA 3FQTA 4TUOB 4KROC 4DZ8A 4XZUB 3FONB 5E6IC 3KXFA 2FZ3B 3DX9A 4LF3B 3RY4A 1F90H 1INQA 3O4LD 2F58H 4P5MB 4Y4HA 5TE7L 3QEQA 5CEYB 1DQQB 2Z93B 4YK4B 5F96H 1AR1D 3Q5YA 3P9MA 3PGDB 4GRLC 1T21A 2PXYA 2DRUA 4K23L 4C57C 2IFGA 5GGSB 2RFXA 3QIUA 4H88H 4LVOB 2YPLE 4ELKA 1J12A 3RBGA 5EOTB 5H37H 2BOBA 2LQRA 4YZFF 5ALCL 1EEQA 3Q3GB 1PY9A 4WHYH 4G6FB 5LGKA 1TMCB 4QWWC 1S7UA 2BSRB 3NMEA 1DBAH 1A3RH 1KJ2A 4NQXA 1Q0YH 3HN3A 3TBSA 3RUGB 2X89A 4PTUA 1TCRB 4WV1A 1QR1B 1UZ8A 4OZFG 4NJAH 4OJFL 5IGXH 3C5ZD 4RMSA 1MREL 1L4IA 2E6JA 3KJ4C 4M5ZL 4WW2A 3IDUA 3VXUE 4LMQE 4LRIA 1VPOH 3V79C 3QR2A 3LD8B 5F1NB 5KS9A 4X5WA 2QQLL 4OCXH 5JHLH 3HUJB 4PJDA 5EUKB 2CRZA 2MQ0A 2Z4QB 4HPYL 4EVNA 3GJFA 4FQ2H 2XICA 1WF5A 2YXMA 4F7PB 1UEYA 2VZUA 1S5IH 1IAIL 2OJEB 3WO4B 3FB8A 2P8MA 2VQUA 5HI4C 3IU4L 4WTZG 1GAFH 3CFKA 2HFEB 3B3IB 4R2GD 2WQRA 3FL7A 1I9RH 3SE4A 2CK2A 4XP9H 1BIIA 1QVOB 1LD9A 3T4AA 3DXAB 2CMRH 4M7LH 2E5EA 3DGGB 2EO1A 4N9OB 1NFIB 4ONFH 4ZTOH 3EJZC 4HJJH 3ARZA 3KYMA 4YUEH 4NO0D 1HE7A 2ERJB 4UZGA 1XR9A 2UZYB 3BGMA 4YQXH 2A9NH 5IJVA 1FFNB 1R24A 2WBKA 1MCRA 1GOGA 3CSPA 1MWAB 3NFSL 2ZSVA 3SE3C 4C56A 2WUCL 4MLSA 3K81A 4NQEB 5BO1L 3JV6A 1RVFL 1TTUA 1JYNA 1I3GL 4L9LB 4Y0GA 4ZUTB 3MX0A 4OLVL 3MRFB 1QFWH 5EDXA 1MFCL 5IBTH 3FHAA 1WTLA 5CP7A 3T0XA 1XF4A 4IRJA 4F2MB 2VH5L 1ORSA 4R4ND 1ZVHA 4YO0B 1WTGT 2L7UA 3LAFA 1A7PL 4LSVL 2JELH 2MHAA 3QQ4A 3KLAB 2V9QA 1YEDA 3EYVB 4N1CA 1NJ9B 3KPPA 1WBYA 2J8HA 4YXHL 5DRNB 3HZKB 3NZ8B 1FRGH 4FNLH 2BVQA 3H9YA 2WAHA 3WNOA 4IRZH 1NCBL 2VXSH 4KV5E 4NO2A 2B39A 4H0GA 4NN7C 4JHZA 1V7ML 1KFAL 5FGSA 5F89B 4XPAL 3S37H 3CDCA 1IGCH 3JTSA 3CLEH 3MJ6A 4QGYA 4X9GA 2QV2A 1P4LA 4PRIB 4R4FL 4HX1A 5AWNL 3DHMA 3ARFB 4HD9A 3IDGA 4P23A 3O8XA 5ACMA 4GMTH 3EW3B 4G7VH 2APXA 2VIRB 1XR8A 4J4PC 1AIFB 2DQEH 4AG4H 5MP6L 1SJEB 3TBWA 5IFAL 1CFNA 1FVDA 4LGSB 3N1GC 5D7IE 5CJQH 2VLLB 2D3VA 1JFQH 4M9OA 3ARGA 2UUDH 3CFJA 1RJZA 5IFHH 4XXDA 4ZFOB 3FQWA 5HGDB 3GSXA 4DFIA 1KCKA 1QBMH 1XGPA 1VACA 5KZCB 5ITBL 3OSKA 1GHFL 2VLJA 1CXEA 1EAPB 2NX5D 4DKFL 1ULVA 3QO1A 1MRDL 5GJTL 1JP5A 4MJID 4QF1B 3P9LA 1MLCB 4K3JH 4EUPB 1C16B 4ZSOA 1TDQA 5DRZA 1N2RA 3GIVA 1I1FA 4GJTB 5EPMA 4Z7VA 3QEQD 3CCHB 1N3NA 5E8EB 4XNZC 3MJ9H 4HH9B 1T1YA 1EXUA 1AD9B 4HIIB 3I50L 4N0YH 3MRMA 1DEDA 2KUTA 2PXYD 4PJFB 2R2BA 5CJOH 3HMXL 2A73A 3IETA 5CILH 5HHME 3QIUD 3R1GH 4PIRF 3L5XL 3SDAC 4LASL 5FM4A 1T6WA 4RFEA 5FCSH 3DYOA 2C3VB 3LKNB 1JL8A 1OCWL 4OFYA 3RWJA 4HV8B 3KXFE 2BOCA 5FK9A 3BMWA 5E8NA 1AGBB 4L9DA 5HVHC 2X44D 4HZLB 4D8PB 2ATPB 2VWEC 3QUML 4KMQA 1OW0C 3SDXB 2XFXB 1PEWA 3RL2A 3LN4A 4QHNB 4HUWB 4F7MA 5DQDL 1CN4A 1BIHA 4AMKL 2X9XA 4FQHB 3QJHA 3JVGA 5EU6A 2YRLA 1MH5B 1AHWB 2R39A 3O45B 1OSPL 2MKWA 1QSVA 3RPIA 2FEDD 5BZWA 4N8CL 1UKQA 4JO3L 2ZUUA 3OKNB 3QUXA 1T0PB 2OTWB 3T0VA 3TLRA 4FQJH 4UT6H 1M6OA 1GZQB 3VCLB 4QXGL 4NZJA 5BS0B 2FGWH 4FQXC 4JJ5B 3VH8B 3KAAA 4DGYL 3OKKA 4OZFA 5F7UA 4OSUL 4UTBL 4NQCB 2X4TA 4HKJB 4F7EB 3BGAA 4JDTL 3K8KA 2NY5C 4S1SH 2K7PA 5KS9E 4YFLI 5F1KC 43C9B 2PYEE 1PW3A 1GSMA 1WFTA 4N1EA 1A4JA 4PJDE 5JW3H 5GIRB 1C5BL 2AJXL 4S0SD 1J5OH 5CIPA 5H37G 3WDJA 1ZS8B 3BEWA 3TNMB 3QULB 4WHYG 6FABH 1XMWA 5A2KH 4P4KA 4K9EH 4ZXBB 1MRFL 5JUEL 1CDYA 1MQ8A 3RZWA 2IFFH 4C56D 5D71H 3U0TA 1RMFL 2YPVL 4L5FH 1J11A 5JIPA 2ICCA 1MJUL 1JK8A 4Z5RB 4BA8A 4TSAH 4FQQB 5M94B 1IGIH 3O4LB 2GJ6A 1P7QA 1WIPA 1PZ5A 4YEFA 5FO7B 3IAQA 3AREB 4W4OC 3LKOB 1DUYB 1S7RB 5DRXB 1K5NB 3WHXA 5CJXA 4Y16A 4CVXB 5F1IB 4XCNB 3UZEA 3UTTA 1YPZB 3VGFA 4TRPL 3ARRA 1RIUH 4Z7UA 3KPRA 4C56E 4ODUB 3VXTB 4TUKL 4Q9QH 2VXQH 4X6DA 4HKXB 3U83A 2UUDK 5C71A 3NAAH 1BEYL 4HS8L 1H8NA 3QFJD 3PWPD 4HPOL 4NC0B 2MPAL 2HJFB 5D7KD 5T5FL 1SJVA 3VXSB 1QQDA 2IQ9H 3Q2CA 5CKAA 2EDKA 5HGBA 4EI5D 4P23D 3OPZL 3O8XD 3QDAA 3M1BB 3PHOB 5JHDA 5IUSA 1I85C 1F2QA 5ESAA 3ZT5A 2HRLA 4LLDA 2HN7A 4KPHL 1OARH 2NLJA 3N0PB 3DTXA 5FGBA 1FAIL 4WNQA 2CXGA 3IRPX 1FJ1B 5IMLB 5C0BB 4XXCA 5ADOH 3QISA 2UY7A 2OCFD 4HJGA 1AKJB 3CDFA 5CEXB 3HMWL 3UX9B 1BFSA 3ECBB 3PWUB 4XWOD 2VLJD 4JM2B 1NGXB 4MSWB 4WFFE 3FAWA 4KRLB 1HHJA 1XCQB 3DROA 2YOCA 3NIGE 1IEAA 1RIVH 1U3HC 4OCSH 2XXMB 3O6LL 2OX5A 2IBGA 1WCBA 1AXTH 5IHUH 3G6JB 5IHZB 4PLJC 1XGUB 3BH8A 4HFWB 3PJSB 1N59B 1R3LA 4HUXB 4NO3B 4FOMA 1UB5B 4B7IA 5JPMB 2VDKL 1WEJL 3P73B 4OGYL 2I24N 3IDMA 1K8DB 4MWFB 1LO0L 1X7QB 3DV4B 5IBLC 4HWUA 3MRHB 4JG0L 1KJMA 3P11L 4WY7L 2VLJE 5I9QC 1W72H 3MRBB 1UXWA 3MJGX 3BD4A 5JORB 1LO2L 4F33B 4ZSOE 3HI6H 1R5IA 4L3CA 2XZCH 1SY6L 5DD1L 5IQ9B 2X4OB 4Z7VE 5GSRB 5J12B 4TVPH 1JNLL 3O3BA 4R8WL 3EOTH 4J3VA 1QBLH 4YBHA 3JWDL 3QCUL 3BWUC 5JXAL 4XC1L 2EEDA 4LSSL 3FB7B 4MZ3A 1ZXQA 3U4AA 3MPCA 4PGDB 3EOAB 4LCUB 4LCWB 2G5RA 4NZTH 1G7HB 4DGIH 4ZNEA 3P0GB 4P3DB 5MHSD 4HK3J 3QUXD 4YGAB 1TJHL 4QHKJ 3LH2L 4H26A 1BAFL 3ZYJA 1H0DB 3KPNB 5ESVB 5C9JA 3MOBH 4YXKH 4PUBL 4NRZA 3PV6A 2GK2A 5E1AB 1RUMH 5M7QA 4HIEB 4NN6B 3MRLA 1V05A 2Y7QB 3REWA 3SKOB 2GCYA 4URTB 4P99A 5EU6E 2C3HA 5GS0D 4TPRH 4OQTL 2HT4D 1GJIA 3WD5L 3TVMC 2BNQD 1RZ7H 5KSBB 1CYGA 3L1OH 2X6MA 2GW5A 4LSRL 1F4WL 5HYQB 1S9WB 4PV9A 4P4KD 1A4KA 2NX5B 1MI5D 4X0KA 3HE6D 3EOBB 4J1UA 4H8WL 4MJIB 4UT9H 1HH9B 3ELAT 1MSPA 3T4YA 5GS2H 1EJOL 3OJDB 1IMHC 2OR9L 4YBQC 2C7UB 1VESA 1P7QD 2ORBH 5D1QA 4OFVA 1RZKL 1IKNA 4U1GC 3KPLA 1MF2H 4FN0A 4XC3H 2NY4C 3KYKH 4OD1H 1A9EB 4Y16D 2W60B 1LP9E 2OQJB 1YQ2A 1ETZA 2YD1A 3HS0A 1RZKC 1GZPB 4IDJH 3QI9B 3FQNA 5E08H 3KPRD 1EBAA 4V1DB 1S7QA 4KMTL 2EIDA 3BUYA 4QRRB 5F7YC 3QDHA 3IFPB 2XIDA 3ZHDA 1WZ1L 3FO0H 1KEMH 2HLAB 5D7JA 4NSKA 4QY8B 5HPMA 3I85A 2GJ6E 3Q1SL 4WI4A 2XTJD 5DJYA 1W8OA 3I3DA 4Z0XA 4OF6A 1T22A 1CVRA 4ODVL 1QSZA 2BCKB 1FL6A 4R3SA 2EKSB 4M6OL 4GQ9H 1ZWIA 43CAB 3BP6A 4XBEL 3JWOC 3UTTE 3AXLB 1H3GA 3QHFH 5JW5B 3OR6A 4Z7UE 4CAGA 4LEOA 4L8SA 3KPRE 5J6GA 1V5JA 4GS7C 3T65B 5T1LD 3ISWA 4YDKL 3I6KB 4K07A 4RRPG 1JZ8A 5JZ7C 5JXEC 1YJDC 3OMZA 3GHBL 5I18L 2BFVH 4JFOB 1ZA3A 3C87A 4AQOA 4Y5YB 4MCZA 4EI6B 4FP8H 3CSBA 3TO4C 2FDBP 4LMQI 1IGTB 4LPTA 5BXFA 3VFRA 1LO4L 5H8DA 4WI2A 1L7TL 1G9NH 5JHDE 3ULUH 4GXVL 1UWEL 4J8RB 3ESUF 2HTLC 5IB2B 4GW4B 4I3SH 4YIQB 3CVHA 1PLGL 3MLZL 2EH7H 5F6IB 1YEIH 2BNRB 3GDBA 5E4EC 4JFZH 3OR7A 4U05A 4XMPL 5ICZB 1HXYA 5F1OB 3LHPH 4N9GB 4PJAF 3NCEB 2A74B 2OK0L 5DJ0B 5JNYA 5K9OB 3MV7D 3PG2A 2EC9U 3BRDA 1UVQB 2A77H 2J3SA 4PRAB 3JUZA 3UAJC 1DBBH 3QUZA 2F8XC 3RKDD 4P5TA 5KVGH 5I6XC 3CFDB 4AT6B 2H1PH 1HOCA 5I8OH 3PP3K 4X6EA 3QIWA 3UPRA 4WFGE 5L9DH 3D85A 3AGVA 4KROB 1EMTH 3BDBA 4K8RD 3SCMC 3CDGA 5KW9L 5E6IB 4Z78B 4ALAH 2BRQA 3HZMB 5FYKH 1DBKH 1NC2D 1FVEA 4IBLT 4Y8AA 1UT9A 4CADA 3VXPA 3QUKA 3OQ3B 3PWPB 4XPTL 4GRLB 4NIKB 1JVKA 2NW2A 4ZD3H 2K7QA 5IW1B 4ZUVA 1J0JA 1NANH 4ZODA 1OGAB 4KI5E 3U46B 2ZCLH 3C8DA 4EI5B 2BZDA 1NSNL 4KK9D 3A6OA 2UZIL 1N4XL 4XNMB 1J8HA 3E6FA 4JPVL 4M6ML 4JRXD 1KLGA 5C3LD 1XGYL 4NP4H 3V5HA 1GOHA 4OIIL 4P2QB 5IEHA 3PP4L 3ZYIA 4YHZH 4MNGB 5EORH 4ZNEE 4U1HA 5MI0C 4LLQA 5DJZA 3T1FA 3EO1A 4IOIA 5D7LD 5IB4A 5DUPH 1JBJA 1DFBH 4I2XA 3KJ4B 2H3NB 3HA0A 3KR3L 3IF1B 5BJTA 2YPKB 3BAEL 4UAOC 3RVTC 3C60D 2FR4A 3MJ9A 4JN1H 1HK6A 3LSOA 5D1QD 1NBQA 4Z9KB 3IDXL 3TP4A 2PTTB 2W65A 2R9HD 5D1XA 5E8OA 5C07B 3ZL4L 4DK6A 1RV6X 2DLGA 4MVBC 3N1FC 5DHVH 5H94A 1UM6L 5IR1B 3U7WL 2FATH 4I77H 3WFDL 5LJYH 3N1MC 3H9SE 1CTOA 3ROLB 5FECA 1KTLA 5DMIH 1FL3B 4GT7A 1RK0A 5I30L 2EIZB 2XZQH 1HXMA 1RZ8B 1CDUA 2EYSA 4O51B 4UB0L 1S7VB 4RQQA 1A6ZB 2APBA 4G6AD 1HZHH 3ARQA 1HHKA 2Y5TB 3K8MA 3MXWL 3NCJL 1PBYA 1I7TA 4LHUG 2MKLC 2ZOLB 2KBGA 5CHNB 3WJJC 1BQLL 3NCYP 4ENEC 3QNXB 1CTNA 3AB0C 4M4PA 3OAZH 1OAYH 5EU3B 3FB5A 3L95A 4M8QB 4OCWL 4MD0A 2WWKO 3CX5K 1A7NL 3PIQB 1EZVY 3EAKA 3MLPA 1AC0A 4HG4K 2D7NA 3OF6A 3T77B 1UWGH 1IAIM 2YK1L 3IT8D 3F65A 1G7PB 1F02I 1YNKH 3S8WA 1DL7L 4GMSL 2YZ8A 1IM9A 4WI3A 5FKPA 1BOGA 4CGTA 4NNPL 3I9GL 3VGBA 5CWSA 3CU7A 3UXFA 5IVNA 3O11B 4R9HA 1YEHH 3ARPA 2ICES 1I7UB 4K3EL 2UWEB 3QNYB 4IRSA 3T8XB 3VXOB 1FH5L 3LKSA 1LHZA 4F9PA 2AAVA 4YDJB 4NUGH 1HEZA 1UB6A 2DIAA 4WFED 2LTQC 5KSUB 2BNQB 4FXKB 3UDWC 1ZVSA 4OZGF 1OAZL 2P8PA 1I3RB 1RUQL 4JGMA 5C0EA 4S1RH 4O2EB 5D9SB 4RDQG 3FT2B 4X7TA 1CIDA 1A7RH 1VGEH 3HE6B 4Z77A 2GAZA 2DLHA 4NQVB 5EU5A 4XAWH 4KUZH 4JCLA 4E42A 1YQVH 5TQ2L 4F57H 4RAVA 4YHNA 3PQYB 3MUHL 4XVSH 5GQBA 3MA7B 3MLSH 4O58L 1NCDH 5KANI 3QRGH 4K3HA 12E8L 1XFPA 2E6QA 3UEZA 1T0MA 2ENSA 2MMXA 3QZWA 4RIRB 4YX2L 2G75B 3B2UD 3Q6FB 3HKFA 4I0PC 4X6CF 5I1EH 3EUUA 4H25B 1PQZA 2Y07L 4IS6B 1NMAH 1KTKE 1BQSA 1V7NL 3QDGA 4ZYKA 4RGOH 5DJXA 4XCYB 3MFFB 5FDWB 4XNZB 1FO0H 4JFEA 2JCCB 3U9PL 3K1KC 1EH9A 1UYWH 4PP1C 2X5PA 3MLTA 1BQHA 4DKDC 4C83B 3AAZB 1OL0A 2QSCL 3O2WH 4Y4HC 1QYGL 3KPSD 3EYQC 4FZEH 1RSFA 3UTZB 4K94L 3SDAB 3L5HA 1ZSDA 5EULV 1AC6A 4TOYL 4Q6IA 3OL2A 3LEYH 4AY0A 4JG1H 1F5WA 4BFIB 1KJ2L 2QEJA 5E8DH 4YE4L 5JTWA 5B38B 1P69B 2QADC 4RZCA 1TCMA 4MDJA 3FMGH 4N8VB 3VD4A 1KCLA 3WYRA 4DVRL 5EBMB 5CLWA 1U91B 3U82B 3RWFB 3CH1B 5D5MB 5FXCH 3QQNA 3S4SG 1K6QH 4YGVB 1S7WB 4WV1C 4KY1H 1J8HE 5IG7B 3EYOA 4LCIL 5F88A 2OSLA 4HUKB 2CLVA 3OKYA 2FBJL 3FOLB 4LRIC 4PJXF 4UU9A 3VMOA 1KCVL 3HC0B 1IBGL 5D1XD 4ONGH 1G0YR 3RL1B 1MVUA 2ZUYA 3VFWA 4U7SA 4YXLH 4WI8A 4TUJA 5DZOA 4FQXB 4JDVB 1S9YB 5J7CC 4K55A 3OG4B 1JHTB 4I2XE 4LHJB 1JPGA 1UEMA 3DRQB 4K7PY 3NPZB 2X4QB 2QR0B 1WIOA 2XOTA 3T2OA 3WCYA 2V2XA 3SE4C 1LK3H 1A6WL 4JKLA 1TNNA 3T2NH 2PF6A 4JR9L 1P7KA 4TQEL 4ZUUB 1I7RA 3DVGB 3S36X 4L4JA 4M48L 3HI5L 2DB8A 4G8IB 1B0GA 4KKBD 4KXZI 5DWUH 1KB9J 4ODHH 3LN5B 5F9WC 1X5FA 5I1DB 1CLCA 1EIBA 4ERSL 1L9MA 5D2NB 1IGYA 2W91A 2IQAB 2XKNA 5KOVC 4NKIH 4DKEH 4ZS7H 4UOJA 5TPWH 3FFCB 1U8PA 4F37F 35C8H 3P77B 4NKOA 5T33L 1X5KA 2P5EA 3OF6D 4PREA 3RA7L 2A83A 2VL5A 3IXTA 3BW9A 2EDXA 3DBXA 1OHQA 4FQCH 2D7TL 1IM9D 3GO1H 3G5XA 2DD8L 4X9BA 4IRJC 3ZTJG 3K2UL 5FOJA 5DJ6A 5JLZA 3CX2A 1LEGB 1NUDA 3SGDI 1D5BA 4LHUA 3MV01 4IRSD 3TCXA 3VRIB 4KZEL 2XN9A 2P47B 1QP1A 1FYTA 1HYSC 5T3ZD 1I1AA 2EDOA 1IM3B 5IV2A 5BMFL 4O2FA 4OGAD 4ORZC 4DOHB 2R56H 2YC1A 4Q2ZA 3EO0B 4Q9CA 2D7PA 3HHRB 4G80A 4OD2B 4Y88A 3GMLA 5IVOA 5IW6A 1A1OB 3QDJD 2COQA 4DCQB 4PJ8A 1DLHB 5DC9B 5D2LF 4QRQA 3QQ3A 3S5LG 1IEHA 1SBSL 4Z76B 1XF5A 3NIFF 3LRSA 1BECA 5F9AC 2E8ZA 3W0WB 3UJJL 4TULL 1CFSA 1U8NB 1JI2A 1FIGL 3ZE1F 1ODAA 3SE8L 5FF6A 2IEPA 3SKNB 3MRJB 4MJ5A 4NJ9L 3ARGC 3VXNB 5MENB 4RA0C 4XPHL 4I13B 3F58L 1U3HB 3B5TA 1SJXA 2ESVA 3QDGD 1UXSA 4WHDA 3PGCB 1Q9KA 4XCEA 1OAQL 4PLKC 2XT1B 4TTDD 2P8LB 5DD3H 2R29L 1QSEA 5TF1L 4R7DA 5L2KD 3QCTL 1AFVH 4B53A 4X7SL 5JDSA 2AV7A 5DQJA 1YEEL 1AR2A 5D93C 3MNWB 3ZO0A 2VDMH 1DVFC 2Z91B 2NTFA 3R4DA 5TGBB 2V9RA 3GSUB 2WV3A 1YEJL 4U6HA 4PGEB 3T2QA 4G8EA 2DJSA 2J88H 2Q7YA 3QDGE 1JTPA 3OX8A 4YWGH 3X13A 3QA3B 3JV0A 4LLMB 2I60L 1OY3B 3O6MH 5SWQB 1KEGH 3NA4A 4G8FB 2JJSA 3MJ7A 4JFEE 3L3IB 4X8JB 4EXKA 5IESL 5DMGD 1NMBH 3IDNB 2BY3A 3RBSA 2DBJA 1Q94A 2VABA 4HAFA 4KK5C 4LPWA 2EXWC 3MGAA 5I15H 1HSBB 3U7YH 5KVDH 4PJ9A 4HCRA 2EDBA 1JUFB 2NY1D 5CBAA 2GJJA 3O3DA 1NGWB 1WBXA 2JJTA 4KDWA 5CP3H 2IPKB 5C7XL 4G8GB 1U8LB 2A1WH 5DZLA 3TBTB 4PD4K 1FFQA 3BX7C 5DFWH 5T3XH 4AEIL 3TFKC 1DQJB 3AU1A 5KTEL 3F12A 4PJHB 1B4JL 4XVJL 4LKXA 3N85L 1IAKB 2FSEB 2ZUWA 2DLFH 3PWLA 4DUXA 4U1KB 5FCUH 4DKAA 4KAQL 4LBEA 4HSQA 2HLFC 1NCAL 3WXVH 4OAWB 3S4SA 3BZEA 3LEVL 5GS0L 3GB7B 5I1GH 3VI3F 3TVMB 2P5WA 3ABZA 3VU2A 5KN5B 3LMJH 2ADIB 3L7FB 4LLUB 5A16A 3MA9H 4HWBH 2XWJA 2GY5A 5TE4H 1LE9A 4ZQKB 4JY6A 2VRAA 1YUHB 1YEGH 1QR4A 3F6IA 5I0ZA 4HHAA 4UDTB 4GUPA 5E00A 4AIZA 1FNHA 2GT9B 2IPTH 5JO5A 4OLXL 3BKCH 4MJ6A 1CGUA 2HWZL 4YDVB 2P5ED 4U1GB 2Q8BH 1C5CH 2NXZD 1S5HA 3VWJA 2E6PA 2HFFA 1NUFA 3LQZB 2NY4B 1INDL 3TC9A 4X6BA 3QUYA 3AC0A 4AIOA 2V5SA 2Q76B 3L3KB 4A2MA 1L0YA 2YMXL 3B8YA 3IDYC 1ZANH 2LABA 3M8OH 3U0WL 4NHCH 4Z7WB 2BY2A 1BVKB 1LNUB 1IGMH 2CD0A 1CD8A 2EDTA 4U1MB 4EQ2A 2XN9D 4ZFZA 1FYTD 1K4DA 1Z0NA 4MA8H 1I1AD 3VDCA 1JWSA 5GS1A 2R1WA 3LKPB 3CPLA 3X3GL 3NFPA 4KZDL 4H20L 4Z95H 3H2WA 3B9EA 4P46A 2C4FU 1O0VA 1R5VA 2C1PA 5TE7H 1V3LA 4B5EA 4BFGA 4PJ8D 4EDXA 2XWBA 3H9HA 5D8JL 4K23H 4XVUD 1NCTA 5GRUL 3WS3B 3W5NA 3RUGF 3CLFL 2FECI 1K3IA 4GS7B 1TVHA 5K9QI 1FYTE 3A67L 3TWCL 1I8IB 2AEIT 4RCAA 5DHVA 2V2WB 4OZHB 5FGBC 2VDPL 3HUJF 2DMKA 3KDMB 3SKMB 4BKLB 4XXCC 1NBZA 4XHJD 3QJFA 3VXRD 4WU5A 1II4E 2AEWA 4I3RL 4NUJA 4QRPA 1T0NB 5EZOL 2AI0L 2ICWA 3HCVB 5I76A 5F44A 3VRJA 3QG6A 1MCIA 4HKZA 4QRUA 1MREH 1VFOA 2J7LA 3GJEB 4M5ZH 3S5LA 3GGWB 1JIBA 3OKMB 4D94A 3IKCB 4P9HL 2HMID 2LAAA 2BHZA 2QQLH 4N0UB 1OAXL 3DUHA 5CUSH 1D6EA 5E4EB 3TT1L 4XPGL 5HGHA 1BBJB 2G2RA 3U4EA 4HPYH 2R23A 4P57B 5ABDE 1R5WA 5C3TA 4NKQB 1IAIH 1DZBA 2Z31A 1DN0A 1EEUA 3IU4H 5SWZB 4D3CH 5CSZB 3IDIB 4XNXL 1KACB 5BV7C 4KJPC 1FP5A 4V2CB 4ETQA 2O93L 2XY1A 4M93C 2ESVE 5T1KB 4XAKE 2IAMA 1BZQK 2X4PA 5I6XB 5L8JB 2IPUG 1VDGA 3FQRA 2V17H 3BO8A 1CK0L 3LPGA 3BYYA 1XF3A 3IYLW 1AP2B 3ARTA 3D69B 3IRZA 1AGDB 1QSEE 3DYMA 4K8RL 4E41A 3SCMB 4JANB 4EEEA 1N6QL 4PY7B 2FECL 2NY3C 4KI5C 4JPKH 3RY6C 4M7JL 4PJ9D 1IT9L 2CKBA 2WUCH 3K1DA 5BO1H 5C0GB 5E7BA 2DLEA 5ID0B 4OLVH 3KYOB 3PNWA 2ADFL 2GSGB 1FSKB 1MFCH 2CDGA 4FQIL 3KLHD 1Q72L 5FUZL 1U8KB 3KJ6L 4WRLA 5EFIB 2VH5H 1RURL 1M71A 2D4FA 5A43C 32C2B 3HZVA 1LWRA 3EFFB 4LSVH 1KPVB 2W9DL 3ULUE 4PY8I 3RWIB 3VA2C 5CBEA 3H42H 2HJLA 1NGZB 3VXUB 5I1AB 4XP5H 5C0ND 3C5JB 4CMMB 5J1SC 2P45B 4OLUL 4R90L 4Z7QF 2DL2A 2P5WD 3ILPA 1NCBH 5IB1A 4LSTL 5MI0B 1V7MH 1KFAH 5EOCJ 1ZAGA 5C92A 1CDGA 4PYHA 3L3JA 1F90L 2P49B 2XG4A 3EYUH 2VLKB 2FL5A 5EO1B 1ZHNB 4UAOB 3U36A 1SYVB 3T0DA 1QRND 4LRNL 5F9DC 1BFVL 2EDWA 1CFQA 4FFVD 4WFHD 4R7NB 5BVJA 1F13A 5GHWL 4JZJC 1MY5A 1I9JL 3VWJD 4JAMA 2Q86A 5MP6H 4X98B 5IFAH 2P5WE 5L2KB 1FNSL 2BSTA 4JKWA 3P9WB 1KC5L 1Y18A 4FFYL 3SDCA 2FO4A 3QUYD 4MGXA 1TZIA 1U8JA 1IKNC 3H3PL 4LPXA 3TZVA 3CZJA 4ZNCD 3TN0D 3VG0L 4ETYA 2YEZA 5FYKE 3RWDA 5ITBH 2H2PC 2IH3B 2NY7L 4GAFB 5TJWK 4DKFH 1Q0YL 2HT3D 1MRDH 4QHLA 5GJTH 2CIKA 4NBYB 1GGBL 5TE6L 2X40A 4Q74A 4NJAL 3VDAA 4B7LA 3E3QE 4WFHE 4P46D 3LCYA 2WBJC 4HUUA 3MZGB 1VPOL 3V6ZA 5B3NA 3V52L 3LEXB 4BK4A 5D7JC 2F74B 2OJZH 3AB0B 3I50H 4L8CB 2OLDA 2F5BL 5C08A 3GMRA 3SDXF 2FJHA 5EIIA 1XF2B 4S1DD 1FNGB 3HMXH 4HS3B 4OM0L 4X4YB 3TPUB 2V7HA 5CS7A 4JZNB 5CINH 2V6HA 5EUOA 2IGFH 4ONHB 4LASH 1EA9C 1JGEB 1GAFL 2EO9A 5EB9A 1OCWH 3ZDXE 4NDMB 4JPWL 4NQUA 5DRWB 2E7CA 1I9RL 2EECA 4BH7B 5DFVC 4AJ0A 3MRCA 2A6KB 4M7LL 2CQVA 3BIAX 2A6IA 1U58B 4BJLA 3PGFL 3QUMH 5DA0B 4QRPD 3PWNA 4WEBL 1ORQB 2F8VA 4HJJL 1OB1B 1T2XA 1AGFB 2AK4A 4I5BA 3GSQA 4FFWC 5HGAA 3K0WA 4K7PL 3CXHJ 2A9NL 5DTFA 5DQDH 4X4XB 1RJLA 3VWKA 4MX7B 4AMKH 2LTQB 4PRDB 5C0CB 3CVHL 3VFTB 3RIAK 1YNTA 1EFXB 5F3HB 3VGAC 1T1XA 3AROA 1J87A 5D7IB 2BNUB 5IQ7L 1OSPH 4OI9A 3NABL 4PGZA 5LGJB 1ZHKB 4UILH 3ULVD 4N8CH 4LKCA 5L88L 5SX5K 4WW1B 1KPUA 4PJCA 4J12A 2WQ8A 4OF5A 3CFEA 3OHXB 5F7DB 1J7VR 3MUJA 3DIFA 1NBVL 2EH8L 3TBYA 4QRPE 4QXGH 3BMVA 5FO8A 2AVGA 1WSST 1GC1L 3JUYA 2D7QA 2FCBA 4L1DA 1JYXA 2IAMD 1A7QH 2JELL 4OSUH 2YUWA 1NFKA 3GSRB 4JDTH 3OJ2C 3DETC 4XNYH 4POYA 1FNAA 2FYYA 4MB4A 3ULVE 3QUZC 4I0PB 1LE5A 4IRZL 4P5TC 1CT8A 1C5BH 3L3HA 2AJXH 2DMCA 4FG6D 1KN4H 4E41D 4MMZC 2HH0L 2V7NA 4S2SA 2CGRL 5HHMB 4JFFE 5ICYB 5JUEH 1MRFH 3QIWC 2VL4A 1KELH 1S7TA 1YDPB 4Z8FH 4BSVB 1RMFH 1F6FB 4S1QH 1YPZF 3FQTB 1IL1A 4M1CD 4DZ8B 4JVUA 4ZAKA 3RAJL 2ADJB 4LGRB 5I73C 2FLRT 2WWKT 3KXFB 1ND0B 4QT5B 3TBVA 1IGFH 5GZOD 4Y4HB 4AG4L 3VE0B 2I9LA 5I66A 2YWZA 1U8OB 1OF2B 4NT6A 3IDJA 4H0IA 4IMKA 3C6LA 5IB5B 3ARWA 4E41E 1W0WA 4TRPH 3QXDB 4CVZA 1U3YA 3BZFB 3L7EA 4XNUH 2BHUA 4TUKH 5CMAB 4HWZA 2H2SD 1MELA 4PJ5A 4YNYA 2QADB 3EHBC 2FHBA 2YSSB 4DW2H 5F9OH 1FVCA 1T20B 4K3JL 2VLME 3VXRB 5C6PB 1GL4B 2R2HA 3CGTA 3BP7A 3EZJB 4HS6A 4NQXB 3D9AL 5T5FH 2YN5A 4PTUB 3RWCA 4CNIA 4WV1B 3TJHC 3D5OF 1ZLUK 1RI8A 1SEQH 2ZOKA 2BXZA 4EZMA 4JM2F 3OPZH 5L7XL 3C9NA 1QSFA 4WI9A 5I74C 1B0RB 3QCVL 3V0VA 3QH3A 2ZSWB 1FPTL 2WWMC 2OTPA 4KPHH 4X5WB 4KH2A 3KHOA 4PJBA 4IM8A 1FAIH 2PYEB 4L4TD 3SDCD 1OGTA 2YD8A 1IQWH 1GVIA 1P6AB 3CUPA 4PB9L 1NDGA 3DHJA 4EVNB 3GJFB 1IZKA 2X42A 3TZVD 4X9IA 2R4SL 3HMWH 4MS8D 3BSZH 4HXBH 4P0DA 3FB8B 2CUMA 5KAQG 4GAJH 1PJ9A 4BZ2H 2HTKC 1YY8A 4FABH 5J6HA 4LPVA 8FABA 1BIIB 1LD9B 3T4AB 3O6LH 2QKIA 3QPQD 5C9KA 4FXLA 2FBOJ 5HI5C 3KYMB 2DQIL 2NZ9C 3VXMA 4KFZC 1DSFH 2IG2L 1XR9B 1A7BA 4YHPA 2PYFB 1WEJH 5CP3A 5C08D 1R24B 2C3GA 1KIPB 1EHXA 3UP1A 4OGYH 1M4KA 1NLDL 5JW4N 4O4YL 1LO0H 4JLRA 4MDIA 1T1ZB 4JG0H 3P11H 3RWGB 4WY7H 4JFYA 5JMRA 1JGDA 3JV6B 4FQJL 4UT6L 3DX8B 5HD8C 5TH2B 3F8UB 3HRZA 3TO2A 4GXUN 2FGWL 1XGTA 1KIRB 4MNQA 1LO2H 1OWRM 4LSDA 4Y19E 5GGRB 2X1XR 5CP7B 5DD0L 1BBDL 4EBQL 4IRJB 5DD1H 4X6FB 5GISL 1HWGB 1T5XA 1H5BA 4PJGF 1J05B 1JNLH 2AK4D 4R8WH 1BMGA 1RHHA 3KYNB 4P5KA 1NAMA 3JWDH 3QCUH 3X11A 5JXAH 5K9KA 1WBYB 2VZVA 5EUOE 4N5EC 2IFFL 4XMLH 2BVQB 4KKLD 3WIFA 4F9PC 3MFGB 3PWVA 4WUUB 4LDOB 1UADC 3OKLA 5KVMC 3QXUA 4TSAL 1FZJA 3WKNA 4K9EC 3V9FA 1TJHH 5KSBF 4DZBB 3LH2H 1DQTA 3JTSB 3DX7A 1BAFH 3BN9D 3QXTA 4D0DB 5EBLA 5EC1B 4F58L 4MAUL 4HX1B 4PUBH 2BRRL 4U6XA 5C0FA 5DK0A 3EJYC 2B5IC 3L5IA 2H32H 3O3AA 1YMMD 4QXWA 3X12B 3HPJA 5ESQA 1O7SA 1E4JA 3FTGA 4Y2OA 3TBWB 1CFNB 1BZ7A 3BKYL 1BJ1J 4OQTH 3OAUL 3TJEL 4Q9QL 1WJ3A 3UPAA 2VXQL 4A6YB 2IH1A 2EYTA 4TN9A 5CD5D 4XXDB 3TN0B 1MCQA 1ZA6A 4PJCE 3FQWB 4Z7OF 4LSRH 1TVDA 1DE4B 1F4WH 1XGPB 5E5MB 5HHOD 3C8HA 4N90D 1ES0B 2DKSA 4HF5L 3ZSTA 4WHCA 4EN3B 2UVFA 5F21B 1Z3GH 3D18B 4JPIA 1BGXL 4H8WH 5FA4A 3VJ6A 5IIEB 3D39E 1S9XA 3U9UA 1KJVA 1UJ3C 1TZHA 2HRPH 2Z9TA 1EJOH 3MRQB 3ARXA 3GMOB 3HG1A 2OR9H 1BPVA 2ZNXA 5DRZB 3GIVB 3WNMA 3BH9A 4L4VB 4Z7VB 4U31A 4ZTPL 1N3NB 3B8SA 1JPTH 4HK3N 5BCAA 1DVFB 1EXUB 3S35X 1N6VA 2D31A 5DEZA 1M7IB 3MUGA 4ZDHA 1CXKA 1BOYA 1T1WB 2GTZB 4PJIA 3QNZA 3IETB 4GO6B 3VFUB 3V0WL 1D5MA 3P4OA 1T3FA 1HQRA 3EO9L 4A2LA 1YYLL 4BFEA 3MMEB 2YBRA 4KMTH 1VFAA 2RGSA 1RK1A 3RWJB 1EO8L 1WZ1H 2XZAL 2BOCB 4ZO6A 1BM3L 3FRUA 4S11A 5E8NB 3I6GA 2GSIA 3Q1SH 3RDTD 1I9IL 1HINL 1AY1L 1CFTA 1AXTL 5DHYA 4QKXB 3GFUA 4GG6B 5HYJA 1U95B 1VHPA 4ODVH 2VQ1B 1BVLA 5SV4A 3MR9B 4KRPC 2MOVA 3LN4B 3B4NA 4M6OH 2APTA 4RWYL 1T04B 5DK2B 4GLRI 2JTDA 4MQSB 4XBEH 1QSFD 5CCKL 5ICXA 4Q9RL 1JCKA 2HAZA 3I84A 1AXSA 4QGTA 5TDOA 5MEOB 5EU6B 3T3MF 2RR3A 3MV8D 5BZWB 4PJ5E 5B8CA 4Y4FD 4U6TA 2ITDB 4YDKH 4XI5D 3GBML 1F3JA 1YEFL 1X4XA 2CLZB 3TT3H 1CXLA 3BJ91 3GSNB 5I18H 2W9EL 4PJXA 5INCB 1KGCD 4K71C 4ESKA 2OM5A 1LO4H 3MXVL 1QSFE 5DYOA 2X4TB 4NC2B 3BE1L 1UWEH 2G60H 3WL9A 4PJBE 1QO3A 4QXUL 4F80A 1PLGH 1CIUA 4UI2A 1A4JB 1ZHLB 5JOFA 4PTTB 1LP9B 5CIPB 5F7HA 1JF1A 4DGIL 3BEWB 4U33A 4DUWA 1CD0A 4XMPH 1PY4A 4KJQC 1FCCA 3KPQB 1QBAA 3HR6A 2H26B 3U0TB 3WNKA 5ENWB 2OK0H 4RFOL 1OPGL 4HGWA 2DBLH 1KGCE 5ISZA 2AJVL 4IHOB 3QXAA 4X9FA 3MOBL 4YXKL 1JHKL 1I1YA 4W6WB 4Z7NF 4FTVE 4M5YL 2GJ6B 3MYZA 3AVEA 1D9KA 4MAYA 4KKCC 1IVLA 1VGKA 4TPRL 3IDYB 3VXME 4LQFL 1HI6A 2NZIA 4OKVA 5C0AE 1WV7T 2WP3O 2JK5A 1RZ7L 2VE6B 3MRNB 3UTTB 4JQXA 4NWTL 2NY2D 1VENA 2E9WA 5KW9H 4Z7UB 5T3XE 3MRPA 3T0EE 1KCSL 3PV7A 4ODSL 4D9QE 2GUOB 1LEKA 1RFDH 4IOSD 4MNQE 3O4OC 5DF0A 2W0FA 3FO2A 3HI1A 4XPTH 5E2UL 1U3ZA 4MA7H 3BDYH 1QQDB 1RZJL 3KPMB 3OTTA 4MXVE 1KV3A 1QHPA 3MBEC 4N1HB 1N6UA 5HGBB 1NSNH 5CZVL 5F1SA 1I3VA 1N4XH 2X7LA 3ES6B 5ID1A 4HKBB 4LLDB 5D2LA 4L4TB 1XGYH 2IANA 3DTXB 5E08L 3FFDB 2QHRL 4ZPTB 1EEYB 2XKUA 1G7MA 3PP4H 1RZGA 1L9NA 2EXYD 4F7CA 3U2SB 1N64L 3BKJL 4P4RA 1XT5A 4P2RD 3PABA 1KSRA 4EQ3A 4LAJH 2O61B 4I48A 4KHXL 4HJ0C 4YHKL 4JRYA 1CG9A 3AMKA 3LQMA 1YN7A 5CD3A 1IEAB 5K33A 4ZO7A 3BAEH 4NYLA 3HG1D 3TV3H 2VO5A 1EDQA 5TFSL 3X14A 4D9LL 1G6VK 3HMXA 1OTSC 2N1KA 2LU4A 2O5YL 2GI7A 3OXRA 4MA3B 5DJ2A 1QFUL 3NBNA 3RIAF 5BV7B 3ZL4H 1GGUA 2XA8H 1JNNH 4M93B 1UM6H 3U7WH 1IFHL 4KVNH 1CE6A 1IEBA 3RZCC 5CEZE 1C5DA 4M9PA 1UXWB 4JKMA 5DUBB 4Y4KD 1GGIH 5CGYC 3WLWD 3HG1E 3JZ7A 2YA2A 4J7RA 3T0BA 1OD9A 4L3CB 2MQCA 4JVPA 5J4MA 3D0VB 3GM8A 5HYJD 3AUVA 3MXWH 2GK0B 2NY3B 3NCJH 3OKOA 4I3SL 3NVQA 4KJYB 2Y6SD 2JJSC 3O3BB 1RZIB 4HCRL 5EO9A 2AJUL 1BQLH 1G9NC 5T1MB 1E4XI 2FIRT 3ULUC 3TIDA 4PJIE 4OF3A 4FXGA 2UWEF 4OCWH 3O0RL 1A7NH 4YR6B 5J3HD 4PJ9C 2CDEA 2N4IA 3L3GA 4XNQA 4JVWA 1CZ8L 2QTEA 3DO7B 3ARDC 2YK1H 3VFVA 4F9LC 1E4KA 4GBXC 1OSZA 4NZUH 1OTTD 4GMSH 1U8QA 4M3JA 5HI3D 1NCUA 1DBBL 4POZC 3T0WA 4H26B 1P9MA 5TDNA 3O3EB 5HYJE 4HBCL 3I9GH 5IMMB 1MCJA 3R06A 2X70B 2XWTA 3BP5A 3PV6B 4K3EH 3GIZL 1FH5H 4GAYA 5CJ8A 3HNVH 3REWB 4H5SA 3AFLA 3QIBA 1A2YB 3IFOA 4POUB 1IGJB 5CKGA 1MIEL 1OAZH 3LOWA 1RUQH 1U36A 1WFOA 2BHYA 2ICWI 4NWUH 4QLRA 5LVEA 3HE7D 1A4KB 1CICC 4PJXE 2DQCL 2IJ0C 4X0KB 3H9SB 2D7MA 4JZJB 4J1UB 3VFNA 5ISZD 2HVJA 1MCWW 1ED3A 2HFGL 4RGNE 4WHTA 1GGYA 5IMKB 1D9KD 4FFVC 3E3QC 4NN5B 2ED8A 4OCRL 3SBWA 3TGXA 4O58H 2IALB 1PG7W 12E8H 1AD0A 3FB6A 4TUOA 2JCCF 4QHUA 3ZYOA 2FZ3A 1E4XL 4LF3A 1TJGL 3SO3C 5F9JB 3FQNB 1X3DA 4I9WD 4MLIA 2CJUL 1CVSC 1DQQA 1V7NH 2P4AB 2Z93A 1S7QB 1P2CA 5DUPL 5CEYA 1DBJL 2MTPA 3PGDA 2WBJB 5ISZE 3QYCA 4CKVX 3SN6N 4AZ8A 3VXQB 5BRZB 1RZFH 4M1GL 5GS1C 5D7JB 1SMAA 4NSKB 3H7LA 5D1ZD 1EAJA 1Z9MA 3I6LD 3U9PH 4P46C 4KU1A 2YWYA 4Z0XB 5D6DC 1E6OL 4WI7A 1FL6B 5EOTA 1PG7L 5HYSG 1ZWIB 2HP4A 2IWGA 4K94H 3V8OA 5D5MF 1D7FA 4TOYH 4Q9BA 1JZ4A 1OAUL 4O00A 2BSRA 3F7VB 2BSSA 2JIXA 3OR6B 4KI1A 4S1DC 4LFHG 4HIHB 4LEOB 2P44B 2FATL 3MSPA 4I77L 3O6FD 3RUGA 1TCRA 2A6JA 3UO1L 3OJMB 2BY1A 3WSQH 2BMKB 1I75A 2Y23A 1KJ2H 1AQDB 4YE4H 2XZQL 2NXYC 1CFVL 2Y72A 4DVRH 3DURA 5HHPB 4MCZB 5F1NA 5I17B 4JRYD 2MSPA 3HUJA 2Q20A 5EUKA 2AXGB 2Z4QA 3VFRB 1Z2KA 3N9GL 3CC5A 4X5XA 3ULVL 2OJEA 2LFGA 4LCIH 3MV9B 3NCYS 4FA8A 2R8SL 4OB5L 2G5BA 3JBG7 2IANE 2RCSH 4PRHD 1KCVH 2HFEA 2X05A 5KG9B 4Q97A 1OP9A 3LKRA 5EZJA 3ULVC 3DXAA 1QHOA 3OR7B 3DGGA 4TNVF 3HFML 4ZFFA 5JOPE 4PRNB 1NFIA 3SGJC 3RVVD 3WFBL 2JE8A 2FHFA 1ZLWH 2NPLX 2Z31C 2I07B 3RTQC 4IJ3C 4AEHH 1YEHL 1FFNA 5EBWB 4W6YB 4PJEA 3JTTB 3QDMA 4P5TB 1MWAA 5J13C 1FLTX 1A6WH 1NGYA 3IJYB 4X7CC 4NUGL 4HFUH 4JR9H 3QP3A 4TQEH 4NQEA 2VUOA 4M48H 1TPXC 3HI5H 4L9LA 1I9EA 3FT4B 3UPRB 3MRFA 2CKBL 4EJ1C 3D85B 4QTIH 1XH3A 5FYLD 4S1RL 1I1RA 1N0XL 4G3YL 3CDGB 4M61A 5I73B 2HFTA 4F2MA 1VGEL 3T2PA 3FCTA 4LGPB 4YO0A 5T33H 4KUZL 1QFHA 2PW2B 3RA7H 3RWEB 3EYVA 5DR5H 3LRGA 4RAHA 3WEXA 1NJ9A 5MEQB 3DWTA 2D7TH 4OZGB 4AEEA 5DRNA 3W9DA 2H32A 3HZKA 3NZ8A 1NCDL 5F7NC 4L3EA 4KC3B 5HHQA 1FFPB 3CD4A 3K2UH 4HT1H 4NOBA 4WENB 3S7GA 3O9WD 4L1HA 4JFHD 4OQTA 4UV7L 1E0OB 2X1WL 4M43L 1J8HB 2GTWA 4KZEH 2A2QT 3V5HB 4LP5A 1IC7L 2W1NA 1F2XK 3DUUB 5BMFH 3B9VA 4KVCL 4CJ1A 3ARFA 1PZUB 2B1HH 5HYFA 3C8KB 4P2RB 4U1HB 2MFNA 1CGSL 4KK6C 2VIRA 4YFLF 4IOIB 1AIFA 3WMSA 1SJEA 5C86A 3STLA 4OFPA 5E2WL 2YZ1A 3NN8A 1CGVA 1SBSH 2VLLA 4HDIB 5I74B 3V0AC 5JMOC 1JPST 2VITA 5BJTB 5C09A 2NY6C 4FZEL 4ZFOA 2CLRB 1D3CA 5HGDA 3D3VD 3LSOB 4U1SB 4TULH 3QEGH 1EAPA 1FIGH 1MOEA 1NUGA 3SE8H 1HN1A 4KXZH 2CPCA 2QBWA 1I8KB 4JG1L 1U0QA 1PDKA 1C16A 4NJ9H 4UOW0 1ERNA 3MREA 1AI1L 4ZFGH 5J9PB 1BD2A 3HC3L 2Z35A 4MS8C 4LARL 1CGYA 3CCHA 3ZKND 1MJ8H 5FECB 5J1AA 2FEEI 1HHHA 4PJFA 1ZHBB 4LOUD 5FYJD 5E94A 3T0AA 4NNXB 3BP4A 4RQQB 2R29H 1MQKL 1HHKB 3QCTH 5ECJE 3ZE0F 4X7SH 2KKQA 3S96A 1CR9L 1FYHB 1HNGA 1P7HL 1YEEH 2C3VA 1I7TB 3LKNA 4MD5B 2DDQL 3SGDH 5SWSA 2X1QA 1AXIB 4HV8A 4KGLA 1SYSB 2EEAA 4G6FD 1YEJH 3FB5B 1F4XH 4HZLA 4WTXA 1A1NB 3GJFK 2EYRB 4MD0B 2PUQT 4L8DB 2XFXA 4YDIH 3PL6D 4QHNA 1UWXK 2VLRA 2EDEA 2OTUA 1QLRB 3L3OB 2B2XL 2G9HA 5B39B 5DI8A 5GJSL 4PJHF 1MH5A 1AHWA 3O45A 5IESH 1R3JA 1LK2B 5CWSB 2D0GA 4RMRA 3FOMB 4JHWH 1JWMA 2WNGA 3EZ8A 4ODHL 5GZNC 4UDUB 4HZAA 2OTWA 1DUZB 2PCPB 2AP2A 5DQ9B 3VWKC 5C7XH 1GZQA 3TH2T 1ZK9A 3RGVD 1M7XA 3RUGE 1ZVSB 2HVKB 5BS0A 5L8LB 4AEIH 5TPWL 3IFNL 1REIA 35C8L 3IFLL 1ZOXA 5C0EB 5KTEH 4XVJH 3ZDZF 3DXAD 1HSAA 3N85H 2JJWA 4QOKA 3BPNC 1S3KH 4NQCA 4HKJA 2Y06L 3FQUB 1R0AL 3STZA 5C8JB 1DBMH 4OFIA 4P49A 2B5IB 4OZFH 1KLFA 2GAZB 3ULSB 1S7XB 4Z77B 5EU5B 5I8EB 43C9A 4KAQH 2P48B 5L0QC 1MHHB 4APQC 5HSFA 2FEEL 5I8KL 4E42B 5GS0H 3ARUA 4ZOEA 4LCCA 1U8HA 1ZS8A 1MFBL 3TNMA 1F4YL 4ZS6D 4HLJA 4DVBB 4ZXBA 1KLUA 4NQED 5FYJU 3RVXD 4FHBD 3SPVB 4BQ9A 5LG1A 5KVEH 5TDPB 3DXAE 4FQQA 1ZLVH 2I9TB 3O4LA 2E7LA 5T1DL 1UJ3B 2Q7NA 2DF3A 4MQXD 5FO7A 4IOFD 3AREA 5J56B 3LKOA 4P3CH 1DUYA 4UBDC 1S7RA 5DRXA 3GBNL 4ZYKB 5AYUL 5DJXB 3L3DB 3W11D 1ZT4B 4NQDB 2BVUA 1UZ6E 4CVXA 3CXHK 3MNVB 5KJRH 1MFDL 4XCNA 2QQQA 3GM0A 4UQ3B 5EIQA 4ZAKC 4CVUA 1OVZA 2V9TA 4FZ8L 4PJEE 3QDME 5DC4B 1INDH 2VKXA 4ODUA 3VXTA 4UNTA 2E9IA 5IHLB 4NQEE 5KANG 3WV0A 4HKXA 7FABL 2YMXH 3U0WH 2FHCA 1ZGLB 1ZSDB 1T89A 4OCNC 3RI5F 4IMKC 3C6LC 1EFQA 3AY4C 4M6AA 5DJAB 2B4CL 4JFPB 1KTDA 5IOPB 1NFDE 2HJFA 3VXSA 1XZ0A 3KLDA 3X3GH 4PRID 4KZDH 4H20H 3C5ZA 5GGSY 3RWHB 1IAMA 4CU8A 1A6PA 4MDJB 3PHOA 1XIWC 4B50A 4K3GA 5DD3L 4V2BA 3HNTL 1WCQA 4NO5B 4L3EE 5D8JH 5IMLA 5C0BA 1W0VA 3HAEH 5GRUH 3PWJB 1J9CT 4M62L 3CLFH 1Z5LB 5HJ3A 1BWWA 3LQAL 3EYOB 5F88B 4JEGB 2OSLB 5KZCD 3ECBA 3PWUA 5INDA 4JM2A 3TWCH 4EDWL 4OI8A 3K4DA 3SGKC 1MVUB 2VDPH 1MRCL 1W72B 4K71B 3M17B 3PDOB 4DN3H 5EZOH 3G6JA 5IHZA 1XGUA 3T08A 1HQ4B 3PJSA 2E8YA 1ZT7B 1N59A 1BJ1H 2C4FT 1JPGB 2AJZA 3QWQB 4HUXA 1X5ZA 4NO3A 2YRPA 5GGUB 5JPMA 3BKML 5C09E 1T66D 3UMTA 1YY9C 5GRJH 4P9HH 1K8DA 3U7YL 2EDHA 2CO6B 4MWFA 4BQ6A 5C6WH 1OAXH 1NDMA 3MRHA 1P7KB 5BQ7A 3TT1H 4PB0L 2X10A 3MRBA 2YD3A 3H8NA 5T3XL 5EO0B 5JORA 4F33A 5FOBA 4PR5A 4GKZA 2A6DB 1IGYB 1BD2E 2PO6C 1XGQB 4XNXH 2XKNB 5IHBA 5FCUL 4K3DL 1WT5A 1CDIA 1U8PB 3G5VB 5HVFB 3FO1B 4NKOB 3T0EC 1U3JA 4PJFE 1NGPL 1F8TL 1GYAA 2VL5B 4YPJA 2VDNL 3FRPG 3DBXB 3G5XB 1PD6A 4AENA 3MCG1 3FB7A 1N5YL 3FJTA 2ZUQC 2CSPA 3O9WB 1NAML 3LDBC 1NCWL 1P84J 3MA9L 4K8RH 2GEEA 3EOAA 2EE6A 4LCUA 4LCWA 3EDJA 1H5BC 5SWSE 5BZDA 1B4RA 4P3DA 4KK8C 2X9YA 3D25B 1NKRA 2NR6D 1YEGL 4ODXB 3KHQA 2KQMA 1L0XA 4NOFA 4LFHD 1H0DA 2ADFH 5ESVA 4O2FB 5LXGH 2YC1B 3IJSB 2R1YB 4HIEA 3CSYB 2VLRE 4HW6A 4Q2ZB 4DK3A 1Q72H 1C5CL 5EH1A 1ZLVK 5FUZH 5KSAC 4X80L 4GH7B 3KJ6H 3MBEB 3VG9C 3H7BA 2Y7QA 5IW6B 1EVUA 1RURH 1BFOA 3SKOA 4OZIB 2WIIB 2W9DH 4DTGL 4OTXH 1N8ZB 3UBXB 3ROOB 2ICWJ 1XEDA 5KSBA 1IAII 1ZANL 2AJSH 4OLUH 1WWAX 1IGML 2XQYG 2J4WH 4UQ2A 1S9WA 4ZXBD 5I8CA 2NX5A 4LSTH 3V5DB 5DSCB 4MA8L 1ZMYA 2ZPKH 5B4MC 5BS0E 4MJIA 1HH9A 1KJ3H 4Z95L 2ITCA 3OJDA 3WXWL 1FLRH 5CEZL 4QOKE 2C7UA 3FZUD 1PKQB 4NQCE 5JPNA 2DM3A 1B88A 2ESVB 3ARED 4LRNH 1BFVH 1Z9LA 5A3IC 1Q9KB 1A9EA 5GHWH 4XCEB 2W60A 1I9JH 3OKEB 2OQJA 3SDDC 3IAGC 1X5JA 1GZPA 3ZT6A 1FNSH 4FFYH 1KC5H 5E95B 4UTAL 5LWYH 3SY0B 4V1DA 2AV7B 5DQJB 3H3BC 1W0YT 3H3PH 4QRRA 2OP4L 5IFJB 2DWEB 4OF0A 3VG0H 1PSKL 3RZCB 3B9KC 1UACL 2HLAA 2WP3T 3O4LE 4MXQC 2NY7H 3IU3B 3OXSB 5AAWA 4G9FB 2ILLA 3VXSD 3PL6B 1GGBH 5TE6H 2BCKA 1OTUD 4NBZB 4Y5VA 1Q9WB 4JM4L 4XCFH 1K8IB 3V52H 4U0QB 5CUSL 1KCRL 2F5BH 3T65A 5C0BD 3I6KA 4NM4L 1Q94B 2H45A 4OM0H 1A0QL 1AKJD 3PHQB 3SKUD 5J1TC 3HB3C 4RWHA 4OV5B 4R6UA 4JFOA 3UYPA 4XHQA 3ARDB 4Y5YA 3GUTA 4D3CL 4EI6A 3DMMD 4P48A 5AZ2L 3RGVB 4JM2D 4GBXB 4JPWH 2F19L 5D7IF 1IGTA 4GRWH 3AU1B 2BSED 4LKXB 5B8CC 1EEZB 4MZ2A 3G9AB 2V17L 2PR4L 4N0FA 3PGFH 1EGJA 3MNZB 4R97C 2DTMH 1FDLL 2YD4A 3FO9A 4WEBH 5E6ZA 1TITA 4J8RA 4WO4D 2HYMA 3VFSB 5IB2A 3P4MB 4GW4A 4K7PH 4JY5L 4NKDB 3U30C 1MPAL 3S4SB 1T7WA 1Y6MR 2VISA 5DFTA 4E0RB 3CVHH 4JPKL 1G7JB 4RGNC 5IQ7H 5JW4Q 1A6UL 4N9GA 3NABH 2A74A 2X41A 5DJ0A 4NRYB 5L88H 2DS4A 2X09A 5K9OA 3SJVD 4DN4L 3RHWK 1CICB 3GBLA 4LPUA 4LIQH 3LB6C 2DMBA 4PRAA 4CRPA 3CFIC 5FDYA 3U0PB 1MCFA 1NBVH 2EH8H 5DEFA 2L7JA 3BIKA 5E00B 4AT6A 3G6JE 1GC1H 5JO5B 3W39B 4KDVA 4I18A 2X4NB 2W59A 3HTLX 15C8L 1BF2A 3DOSA 3HAEG 1C12B 2DOCA 3H42L 3TA3C 2HFFB 4XP5L 3VFPA 2NYYC 1T80A 4O5LH 5E6IA 4X6BB 1X5GA 1D9KC 4MAYC 3BXNB 5DVMA 4HWNA 3SO3B 1TJIL 4JRWA 5JR1L 3P4NB 2HH0H 4LCWD 5B38G 4YC2B 5T5NG 2CGRH 4PGBB 3ORJA 1A9BB 3QFJA 3PWPA 4U1LB 2LU7A 4GRLA 2R0ZL 3DO3A 4ZFZB 3DRTA 5IBUG 4JQXC 3EYUL 3LS5L 5IW1A 4HBQA 4QYOA 3RAJH 5M95B 3CPLB 1OGAA 3U46A 1JNHB 1FN4B 4WWKC 4EI5A 3CFBB 4MQTB 1KB5L 1FNFA 4XNMA 1YA5A 4OT1H 4KHTH 4KJWC 3FRPA 4EDXB 2XWBB 4C58B 4LCWE 1JPSH 4MNGA 4X4MA 1V3KA 5C0DB 4GKSB 1TVHB 3T09A 4ORGB 5DHVB 2H3NA 2FX7L 3IF1A 3IXAB 2YPKA 3MJ8B 3QJFB 3D9AH 5I76B 2YS4A 5I1JH 2D0HA 3VRJB 3QG6B 3O3UN 4ISVB 4HKZB 3UTSB 2OJZL 2PTTA 4QRUB 4HWEH 5HPOA 5L7XH 1HDMB 1NCCH 5C07A 3QCVH 2LE9A 1MCWM 1FPTH 2MJWA 3VFGL 4OCMC 3QQ9C 2HT2C 3QO0B 3W2DL 2ARJB 2AJ3A 4W68A 5CINL 3QI9D 3ARBC 1U8IB 2IGFL 5DHXB 1D6EB 2NX5E 4LNRA 5K9QG 3TF7C 3UJTL 5HGHB 4V1DD 4PB9H 2G2RB 1DDHB 1MVFA 4MB3A 3ROLA 4X5LA 2R23B 4QRRD 1FL3A 4MJIE 1R5WB 2R4SH 3RVWD 4O51A 1RZ8A 4JFFB 5L2JB 2Z31B 4RAUA 1T7VA 1A6ZA 3RTQB 1IQDB 3QEQE 2Y5TA 4ETQB 1WC7A 5J13B 4D2NA 2ZOLA 3SE3A 5BW7C 3BO8B 3QNXA 2FB4L 1TPXB 4OI7A 1XF3B 4N68A 4GW1B 2DQIH 4D0CB 1CLOH 1K85A 4MB5A 2IG2H 1NMCC 2P24B 2CXKA 4D9RD 4UILL 3PIQA 4RX4A 3IJHA 5DMJB 4QRRE 2WMPA 1NLDH 3T77A 1TTGA 3HPLB 1PKOA 4O4YH 1G7PA 5F7KC 4XB7A 2F8OA 3E6HB 1FC1A 3NA9H 4TVSa 1EVTC 3ZKMD 1A7QL 1I7UA 3N1QC 5DD0H 3QFDA 1BBDH 3T8XA 4EBQH 3UPCA 4YDLC 1P4IL 4XNYL 5GISH 3K2MC 4YDJA 5EU4A 1MLBB 1E4KC 1M71B 5KSUA 2BNQA 4U1JB 4FXKA 4KKAC 1I7ZA 1I3RA 1KN4L 2BNRD 3NIGF 4K2UL 4O2EA 2C1OB 5D9SA 2X2YA 4LVEA 5CZXD 3ILPB 1MI5A 3GI9H 1KELL 4Z8FL 1JV5A 3HE6A 3V4VL 1P1ZA 4S1QL 4U0RC 1HWHB 2ZCHL 4NQVA 3SOBL 1G7QB 1OAKL 3QIBC 5ITFB 3A6CL 5FM5O 4UNUA 3T3ME 3PQYA 5GPRA 1IGFL 3GZKA 3MA7A 1HILA 2FL5B 1MFEH 4F58H 4MAUH 5CSBA 1FO0B 3MRIB 2SEBB 2Y4SA 2BRRH 1MCPL 2VSCA 1WBZA 4BSWB 1W8NA 2G75A 2YN3A 2EDRA 3Q6FA 1KG0A 2O5ZL 1CXHA 4KROD 3BKYH 4H25A 3C6SA 4XNUL 4BSJA 3OAUH 5J8OA 3E8UL 4DAGL 1Y18B 5AG8A 5E6ID 3TJEH 1NC4B 2IMMA 1AE6H