4M1GH

Structure of murine igg2a a27d7-fab in complex with vaccinia antigen a33r at the resolution of 1.6 angstroms
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
216
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFSLTDYGVSWIRQPPGKGLEWLGVTWGGGTTYYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAKHKASYNGLDYWGQGTTLTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Anti-A33 Antibodies Reveal a Potent Cross-Species Orthopoxviruses Neutralizer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Murine IgG2a A27D7 Light chain Fab domain
total genus 43
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2013-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1gH01
3U83A 5FECB 4JAMB 4JN1L 1WF5A 2P48B 2I60L 5D2NE 2HT3C 1MHEA 1MSPA 4F7EB 2G5RA 5LGHH 4PRBB 5I8CB 3SQOL 5DQJB 1B4JL 1CFNB 1GGCL 4G6JL 1DBMH 1HWGB 3T1FB 1GC1H 4JRYA 4AQ1B 4CVXB 3MV7E 1W0YT 3UBXA 4M1DL 1RZFH 4Y4KB 3FMGH 5DRZB 1JPFA 1BAFH 4FXLA 2GTZA 3HAEH 4F57L 3TLRA 3WUZA 4NQEE 4U6YB 5JR1H 4KRLB 4QOKE 1YEDA 1L0QA 3IJSA 3BX7C 2HLFD 4FQPA 3C08H 2R9HD 4QF1A 3PP3K 4JRYD 4XPAL 1RHFA 1IC7H 2P43B 3B8SA 4B53A 1ZVSB 1OAUL 3IF1A 2NY7H 3D9AL 1ETZA 1RY7B 1J87A 2L0DA 1NMCC 1WLHA 5D1ZA 1LO5B 2FGZA 4X5WB 3VXTA 4Z8FH 4GQ9L 1A7OL 3GSRB 4P4KD 2ZOKA 5BS0D 4WUUA 2QQNL 2R0KH 4LVOC 3VDAA 2I9TB 1MWAL 3BAEL 4UAOC 4X7DC 3SBWA 3TO2B 4OD3H 1KOAA 3HC4H 5I75B 5C0RL 4WFEE 5D93C 3C60B 3WSQL 2VXQH 1GC1C 2R0ZH 2J4WL 3O4OC 4L4VD 1KIRA 3AREC 3O6FD 2NLJB 4OZ4B 1AH1A 3I2CH 1MJ8H 1PBYA 3QQ9C 5HY9B 1FRGL 1JZ4A 1PX3A 1IGIL 3PHSA 2EC9T 1LEIA 3MLPA 1WWAX 3O6LH 2XRAH 4L3EB 2SEBB 1I85C 4JDTL 2EE2A 1YJDH 3I75B 3L3KA 3LSOB 5I30H 2R8SH 3K4ZA 1YQ2A 3ZKMD 4HS6A 1TDQA 5D7SH 1KB5B 1Y18B 4OLUH 4OTXH 1BVLB 3TA3B 4BH8B 4GAGH 2PO6C 2B5IC 3VWJA 5FA4A 3U1SL 1FZJB 2PYFB 2HKFL 5I76A 4BK5A 4LGSB 1ZXQA 3KJ6H 3MRMB 2J88L 1W8NA 2PW2B 1UH4A 4QRSA 1NSNL 1FG9C 4EN3B 2UV3A 1CFQA 5HDQL 5FUZL 2QQKL 1G9EA 4WEUD 5CP3H 1BD2A 1MCFA 2VR4A 4HJ0D 3IDXH 1BECA 3FB8A 1DCLA 2HAZA 1ZGLP 3RWJB 5MEPA 1G6RL 2X4OA 5EWIL 3RUGA 5HVFB 3WNMA 3RAJL 2DWDA 1IE5A 2V5TA 4WVRA 4D9QE 5GZND 5FYLD 5C07A 1A6AA 4FQCL 4XVJH 2K7PA 3SE9H 3G5VB 1Y0LB 1UB5A 3CLFH 4GMSL 3WIFA 1N0LA 2W0FA 2PYED 2X4TB 3VXRA 1CGWA 3T0EA 4PJIA 4ZFFB 2EKJA 3OKKB 1NFDA 3OKNA 4K3GA 4YIQB 4Z0BH 1S7SA 1AGBA 3V79C 4L8BB 4G6AD 2FX7L 3DO3A 3PQYB 4GS7C 3HZMA 1MCKA 5IFJA 4MGXA 1LD9A 4DVBB 2JJTC 2FSEA 1AI1L 2H2SD 5KSBB 4J6RL 1ORQA 3BXNA 5IHZB 3D0VB 4LOUD 3VG0H 1W72H 5C0ND 1IBGH 4OUUA 4P23C 3QR2A 4Y4FC 4QXGH 4UZGA 1I1AA 2H2PD 5A2KH 2VL5A 5DS8B 4PJHF 4B5EA 4ELME 2QQLH 4CMMA 4MMZC 3OGOE 3BPLC 3QUZC 1MAKA 4HG4K 1N3NB 4HJJL 3TNMB 4JE4B 1CGTA 2VTFA 1H5BC 1RZJL 2P5WD 3P0VH 2RBLA 2OQJA 3VFWB 5HPMB 3LKPB 5IJKC 3QUYC 1CXEA 4MXQD 4CDHA 1ZANL 1KT2B 3P4NA 5DA4A 5F9WC 3NPZB 4ZFZB 1GPOL 5KZCB 1IGTB 1PYWB 3NFSH 2Z92B 5JNYB 1ZHNA 2GCYB 3UDWA 1FCCA 5C08D 3Q6FB 5DUMH 3T8XA 3S6CA 4GKOA 5LAXB 2P8MB 4LCWD 4NO3B 1TQCC 3OKEA 2X7LA 1QO3B 4JLRB 4Q2ZA 5JIHA 5ESVB 1RJYB 1VACA 5B22A 3RX8A 4EDWH 3EGSB 1BJ1H 2UWEB 3EFDL 5E8PA 3LZFH 3DMMB 3GSNL 4GBXD 1F6AA 4PJCA 2BMKA 2GJ6B 1UZ8B 3FJTA 4FMKA 3L3JA 4LASH 4M1GL 1PZ5B 4YHOH 3OJDB 1KB5H 1DVFA 4O2EA 2BNRD 1EBPA 4JR9H 1BFOB 2E8YA 1JGUH 2GHWB 2P45B 3P3YA 2IALA 1MI5E 1Z9MA 2NYYD 3BHBA 3QISA 4OQTH 3GJEB 1L7IL 3ALWA 2X4NB 4P5MB 4YE4L 4UTBH 2JIXA 3LPWA 3IGAB 4HIHA 5DGRA 3X17A 2B0SH 2CIKA 4NOBA 2BVQB 2O5ZH 3E1F1 2RFXB 4I3SL 4N90E 1IGCH 4ODUA 1ZGLA 3OZ9H 4J4PA 5GIRB 1AE6H 5JLZA 4FFWD 3GHEL 4JVWA 5BRZB 1U91B 2DTML 4HS8H 1BGXL 3DX7B 4ZUTB 4Y4HD 5DRXA 3MLVL 3IU3A 5IJKA 5HHOA 1ZTXH 2BHZA 3DI3B 5IBTH 5ICXA 3K8LA 4WO4A 3CPLA 3EJZC 5FYKL 4QTIL 4K8RC 4KK9D 4HZAA 4LARH 1KPVA 1UACL 1SJHB 3IRPX 4JO4L 1JFQH 4OCXH 4HK3J 5T1DL 2WP3O 1AY1L 5IBUB 4XXDA 1TTFA 2VZVA 5F7DB 1UM4H 2WWMD 3HN3A 1KENL 4OCWH 1J0KA 1Q1JH 1WISA 5CEXA 3LKOB 5IESH 5IHLB 4WI9A 3RJQB 1CICC 1S5IH 4KKCC 4CAGA 1E4XI 4JPIA 4Z76A 2XZQH 1TQBC 4ESKA 4GRLC 5MP6L 4M9PA 4NNYA 1LK2A 4RWYH 3I6LD 1GGYA 5TFSH 2FX8L 5MI0B 3O41A 3PL6D 2QR0B 2VZ1A 4Y16B 4MNQB 1AO7D 1SM3H 3JWOH 5DMYA 3VFRB 4YH6A 1DL7L 1NBYB 3W81A 2OXHA 3TJHD 1INDH 4MQ7B 5IBUG 1CDGA 3ZLQC 2AERT 2FJHB 2WWKO 2J8UA 1VFBA 1XCQB 4YGAB 5EA0H 2YC1A 1OCWH 1U93A 4XP1H 1BZ9A 4CU6A 1FH5H 5I8EB 1RU9H 4AIZB 4ZS7H 3ZL4L 4R7DA 4HZLA 5AYQA 3F6LA 1JNNH 2NY4C 1KCVH 1A2YA 1GOFA 3ZZ1A 1BFSA 5I1DB 4FS0A 1QTYT 4PGEA 4ZNEA 4JM2F 4P2RA 4PJXB 5DMGD 3QUML 3UMTA 1NANH 4M1DH 4P49A 3WN5C 1FZOA 4U2YA 4S1SL 1VB9A 5D1XB 2Z91B 5IROA 1JPGA 4FFYL 4MQSB 3BKCL 3PV6B 1NMCB 3U9PL 5KANG 2Q1EA 3HNVL 4HWBL 1NH6A 2VLLB 2OL3A 1FAIH 4UAOB 4G7VH 3ROLB 1NCBH 3ULSB 5C08B 2ERJC 4JFXB 1Z3GL 4ELKA 3OGCA 4PBXA 5I75C 3BZEB 4U0QB 3DBXA 3HKFA 4UT6H 3HUJF 3D9AH 5E8OA 5DJYA 3O4OB 4HMCA 2WSKA 2X4SB 3U4EB 4XB7A 1MCHA 2ICWJ 4G6MH 1I9IH 1WEJH 4M6AA 2QQNH 3AB0C 3MGOA 4K55A 4MCYB 4OJFL 1U8PB 3KPMA 2EXWD 3TBSA 3MACL 5LVEA 4QCIB 1MFEL 2QSCH 3DXAB 4Q7DA 1K5NA 3MBXL 5T1LA 4WI6A 3EIFA 5F88B 2CLRA 4HHAB 4EKXA 5JHDD 3BUTA 4LCYA 1AKJB 1MFCL 1FL5B 1RUKH 4NQSB 2HVKA 4OT1H 1SJEA 4PBWD 2HMID 5BW7C 3GI9H 2AK4E 3TA3C 4OV5B 5F7EH 2B5IB 3GBMH 4UT9L 5FDYA 1EV2E 3P9LA 4ZG1A 4HD9A 1R3IL 2LU7A 3D48R 1T1XA 3OMZA 2Y72A 4K2UL 4KRMB 3RY5A 2BRQA 1OTTC 1VSCA 3O2VL 4LCCC 4KDTC 1JWSB 5E6IC 4QNPF 4EN3C 1P4BH 5C7XL 4M4RA 3X3FH 1LE9B 4WJ5B 3UJJH 4AH2A 2V7HA 3TM6A 3U1SH 3LEXA 5DC0A 1A3RH 5E6ID 2E7HA 5J1AA 3LB6D 5CEYB 4JFDB 4R7NB 5FGRA 5GISL 1YMMB 5ICZA 1XH3A 5ICXB 3VGFA 5IT2H 2A83B 3EJZD 3SE8L 2ZOLB 3Q3GB 1LK3L 4MJID 4AT6A 5CZVL 1PG7W 3QEUA 3WE6A 4PJDA 1F6FB 1U91A 3GBNH 1ACYL 1FNSL 3RWCB 1EHNA 1MJJA 3OHXB 1YEKH 4NQCB 3WS6A 5IVXB 1MHPH 3QUKB 5MHSE 5I1AB 2YD8A 5KAQF 3WFCH 1YUHB 1VGKB 4MJIA 3MBEB 3PP4H 3IRZA 4LSQL 3RUGE 4CL7A 4GS7B 1P6FA 3A0OA 4HIHB 1W0VA 2JIXB 2V7NB 3B5TA 4FQCH 4PLKC 5LGJB 4TSCL 2FHBA 4GFTB 1T20B 1MVUB 2BOCA 2ZCHH 4PG2A 4IOFC 3HCVB 4Y4FB 4ACPA 1LDPL 2E6PA 1RUQL 2X44D 5BXFA 1X4YA 5DJCB 2AABL 2I9LA 1RULH 1WIUA 3MNZA 3O6FA 1UZ8A 4LF3B 3BPLB 3QUZB 4LPTA 1RHHB 2A77L 5DR5H 3U6RA 2IADA 4XNXL 4Q0XH 3DMMA 1I9JL 2Y06L 5E8PB 4JFQA 5C08E 3U4AA 3ILPB 2FNBA 1LP9B 1XEDA 3FQUB 3G6AB 4HFWB 1VACB 4I18C 5DMGC 5DT1H 5LXGH 4PJ7E 3R1GL 2MQ0A 4LLUA 3VXNA 1K4DB 5EDXA 3VFPA 5BS0A 1FLTX 1TZHA 4NN7B 5C9JB 5LAXA 5GGSB 3FOMB 4Z6AT 5GSRA 4EI5C 2H32A 2WINA 1X5LA 3MRHB 3T3PE 2VDPH 1A7NH 1MPAL 3K8KA 4LRNL 4TRPH 4F37F 1IKFH 2F5BL 2APVA 3TZVB 4ZFZA 1C1EL 5JIPA 2CKBL 1WFNA 1A6PA 2FO1A 2XWTA 3HI1B 2VH5L 3H3KA 1X5JA 4P48A 1U95A 2P8PA 3GMLB 1UJ3B 4L4VB 3REVB 3C60D 3GJFA 4P3WA 2N56A 3EYFB 5I66A 5AUMA 1YNLH 3D39B 4D9LL 5C0JB 3D3VE 5E9DE 4R26L 5E94A 1IEBB 2C7UA 1BJMA 4ZAKB 4WTXA 2OI9B 1ZHBB 1IAIM 2PXYD 4L4TB 3T2NH 2E6JA 5EULV 2OJZL 3BE1H 3BDBA 1J10A 1KEML 4NRYB 4IRZL 3MV7D 1EEZA 1FDLL 1TETH 3ARGD 1G7IB 3CDYA 5FV2A 4KI5F 4LP4A 1MLBA 4F7CB 1X7QA 3D3VA 2P4AB 1S7WA 5DHYA 3VXUA 1J5OL 3MODH 4UUJB 2GJZB 4QXTA 1BEYH 2Q3AA 5F3HA 2JELL 1T04B 3QQ3B 2VLJD 3QO1A 5HD8D 3ARGA 3O11A 2MQ3A 3RTQC 3RHWF 3VWKA 3MV9D 1RZGB 1L7IH 1MIEL 5L88H 4PIRF 3CDCA 3WFBL 4PP2B 1ZK9A 4BM7A 5LQBL 3ARDB 1JK8B 5JW3L 4LCUB 3KYNA 1EH9A 4MJ6B 3WFDL 1OAYL 3ZDZF 4PJGE 1AE6L 4YFLF 3TH3T 3ZE0F 3B2UD 4Z0XB 1JZ8A 2H9GB 1BJ8A 3H0TB 2DICA 4GW5B 1CD0A 2F74A 4LEXH 1CFQB 1REIA 1C7TA 4QRSB 2E9IA 4PRPB 5GPRA 3RWDA 3PHQB 3QNZB 4FQHB 5AG9A 3B2UC 2EZ0D 2HJLB 1KEGH 4K3EL 5KSVB 1A0QH 2ZUXA 4V2BA 4CW1B 3OKDB 4GRLB 3OL2A 3QEQE 5J9PA 1Q9LA 4DOHE 4WY7H 2Y6SC 3ARQA 3S37L 5F1OB 1EMTL 1I1FA 3KPRB 3CFDB 5DMIL 3KLAA 3W5MA 4CNIA 1M05A 1W0WA 4OGXH 2VDRL 3V5HA 1D9KC 5E24E 2FB4H 1S78C 5SWZA 5C09A 4NQEB 5I1KL 3GSNB 1MCNA 4OF3A 4IOFD 5ALBH 1WC7A 5A2IH 4QRPD 3ARGB 2ATPB 5DWUL 2CK0H 1HILB 1BMGA 2B2XH 5GS2D 4H1LH 1FE8H 1VEMA 4JFED 4YBQD 3V5KA 3V6OE 1KLUB 1OLLA 2Y5EA 3WN5B 2NZ9C 1FZMB 5D1XC 4HG4J 1TVHB 1OCWL 5I1EL 1I4FA 2ZNXA 2Q7YA 4NHCL 4YC2B 1EPFA 2HKFH 1Z0NA 4PD4J 1K8IB 5D2LE 1CF8H 5JA9A 5DTFB 1YMHA 2W92A 5C8JB 1PSKL 1UFUA 1I8MA 5C2UB 1LO0H 4HCRA 1GGIH 3EYFA 5I66B 1S9YB 2FIKA 4HKJA 2P8PB 3GMLA 1BWWA 4NKDB 4YDKH 2YD4A 4FQ1H 4QT5A 2DKMA 5HHXH 5IMOB 3LKRB 5CGTA 4NP4L 2GUOB 3DURB 4WI4A 1DBKH 1CG9B 1URLA 1XF1A 5JW4R 4N0CD 1S9WB 3MRLB 3TC9A 2E9WA 4UTAL 1OAKL 3GRWA 4MJ6A 5J6GB 4JGUA 5DJZB 4XMLL 3U30C 3NACL 3QDGE 3QG7L 3BW9A 2APTA 4JRYB 1B2WH 2BSED 3QCUL 4H0GA 4QRTB 4R4ND 3B9DA 3BP7A 4JM2D 2J8UE 3ILPA 5F8QC 2AKRB 1VFUA 2ZPKH 4GKZA 5DD6A 3R0MA 3BIKB 2MCG1 2W0KA 5JZ7D 3CXHK 1NFDF 3SDCC 4Y2OA 4TUKL 3EO0A 5IMLA 2O93L 2GQHA 3QQ3A 4LCCB 5ALCL 3KLSA 4ELMA 3C5ZA 2C9AA 1T6VN 2GJZA 3HC4L 1YECL 3L3HB 3UTTD 3OTTA 3NCJL 5I1CH 2JLLA 3RVVC 4LU5H 4YDVB 4AEIH 4F7CA 4LSPL 3WSQH 1CR9H 2MHAB 5J11C 2JB6B 4Y5XC 1TIUA 4O5LH 2YWYA 3EO1B 2JJTA 3PXHA 3CFBA 1MJ8L 3J8F7 3R06A 4WU5A 4D0CA 2LFGA 3OSKA 3GO1L 4L4TE 4NKIL 3STLA 1TTUA 3MLSH 4P2OB 3QUKA 4OI9A 5IVXA 3HS0B 4S1DD 4XCEB 1YPZA 2F15A 2DKUA 3MRQA 4Z7WA 2DMCA 3FOLB 3D39A 1I3RB 3FCTB 1G7JA 2KQNA 3WE6B 2P5ED 1HQRA 3DV6A 3HZYB 3QUXD 4M6ML 4MHHI 2NY3D 1UJ3A 5DVLA 1Y6KR 2A83A 4GG6B 5J4MA 4WV1B 3MBEC 2E7LC 1YEHH 2VJXA 2RJMA 1V5JA 1JWUA 3KPLA 5FB8B 5DUML 5EBLA 5C2BH 1UKQA 1A4KB 2Z4QA 4JPVL 3RZCD 2F19H 3I6KB 4LIQE 4MMXC 2AJXL 2H32B 3MRHA 4BFIB 4HUXB 5J1TC 4WI3A 1TZHB 5LBSH 1UYWH 2VABA 2ZP0T 3T65A 2OTWB 5HVWA 2BVYA 3MRPB 5D7IF 1BF2A 4CN1A 3LMJH 5MENE 4MXQC 4C54A 2ITCA 4G8GA 3ULUL 4LHJB 4PJFE 4QHMB 3WFHA 3QUZA 4JVPA 1OAXH 4LL9A 5FF6B 1FQ9C 3QWOB 4JR9L 1ZLUH 1YEFL 2OS7A 3MTRA 5GS0D 1IT9H 3UROR 5J13B 4LSSL 2HTKC 4WHCA 2WBJC 3MXVH 4NN7C 3T04D 1DBJL 4NRXB 3SE9L 4EI5B 4NNXB 3LIZH 4YDIL 5EZOL 2QV2A 5DR5L 4RX4A 4XNXH 5LGJA 1GHFL 1MEXH 3MUJA 1UEYA 2O5XL 3TZVC 4PJ5A 4PJ9B 3KPMB 1QSED 3TBSB 5KVDL 3RDTB 3IDYB 3JV6A 1AXTL 2A9NL 1UJ3C 3HG1D 3M07A 4U1NA 1N2RB 5DMJB 2AJSL 1HSAA 2IAMA 2QLVB 2NPLX 1L9MA 1A7NL 4ODHL 5EU6A 4PJFB 1FG2A 3BRDA 1U9KA 1YYML 4HIEA 5IB4B 4X4ME 4NT6A 5DQDL 3EZJB 4F7MB 2EDTA 3KPTA 2YXFA 3TPKA 1K4CB 4WO4C 1UM4L 2H32H 5C3TA 4HF5L 4RQQB 2J2ZA 5EOCL 1LEKB 4P2RD 5GJSH 4CDGC 4PD4K 3QNXB 4PGEB 5M95B 4Y1AE 2BP3A 5GRZA 4XH2A 3TCXA 4N9OB 4EUPH 2R1XA 4OZHF 1IQWH 4I9WE 3BE1L 5F93C 4YPJA 3ZE2F 1U8IA 2YPKB 4LRIC 3ARDD 4OCMC 5J6HA 3OAUL 4JFFE 3RTQB 4Y4HC 4FQIH 4WW1B 1R5WA 3IXAA 3KPOA 5EBMB 1QBLL 2EEAA 1H3GA 3KLHC 1TJIH 3UDWC 1YEJH 5DZNA 2FO4A 1IC1A 3NN8B 1CZ8L 1SJEB 1KPRA 1NC2B 5CWSB 5EN2A 3AAZB 5KVEH 2FO4B 3ARDC 5GQBA 1NCDH 4L9LB 3TWCL 3O41B 2DLFH 4BQBA 2F54B 3MGTA 4ZS7L 3ZL4H 1XR8A 1JNNL 2D0GA 2G75B 4JPIB 2VDQH 2YPKA 3BN9C 4RNRB 1NAMA 1U8JA 3BMVA 2R29H 4KVNL 2HFTA 4KKCD 4EI6B 2JCCF 3KPQA 3DUUA 3I50H 4QTHA 3P73B 4S0SD 3K8MA 3BKCH 1BZ7B 1FVCA 2FRGP 4JRYE 5K9OB 1S5HB 1ITCA 3RDTD 2I24N 1FAIL 2Y07L 4TTGA 1NBQA 2HVJA 4U49A 1Z3GH 1NUDA 1Q9OB 2UY7A 1A9BA 2PETA 2FH6A 2JKXA 1OGAE 2CKBB 4RDQG 1KJMA 4RRPA 5I1JL 2Z9TA 4WI5A 3VW3L 4X6DA 3CLEH 3JWDC 1BPVA 3BZ4B 1D9KB 1A7RH 5FYKD 2YD5A 3RIFF 1KELH 3HFMH 3L5XL 3WLWD 1DUZA 1I9IL 3B2VL 5JLZB 4IRSA 4OSUL 4IOIB 4JZOB 5L6YH 4BSJA 4JFOA 2HFEA 1JUFB 5HHNA 5DEZA 5I19H 1HZHL 4PJ9A 1JF1B 2CIKB 3I02B 2ARJA 2AI0L 3L1OH 4HZLB 1U2HA 1DDHA 3ZYOA 1A1NA 4OLWL 3GSQB 3V7MA 1CBVH 5EUOE 5HYQA 1I7UB 1ZGLM 1L0YA 3GMRB 4J8RA 3WBDA 4ZDHB 4JO2L 4M62L 5ANMA 5BZWA 4NFCA 1XCQA 1X5IA 2ZJSH 3DGCR 1VFAA 3QUYD 2X4UB 1QOKA 1PZ5A 4JFYA 1MCRA 5T3XD 5EO9A 3VXOA 5GS0H 4OD1H 5GGUB 2EYSA 3TT1H 2BMKB 2GJ6A 5TE6H 1YY9C 1WFOA 2CJUL 5IW1B 5E0QA 3MYJA 3B4NA 1D9KA 4LQFL 3T0AA 4CMHC 3QIBB 5HYSA 1R3LA 5EZJA 1GSMA 5TFSL 2JJSC 4GAJH 1RJYA 3QQ9D 2YSSA 3CVHL 1SM3L 3QZWB 3O6KL 2CKBA 4NO3A 3STBA 1B4RA 4Y2DC 4P5KB 5LGKA 3DX6A 3FT3B 4Q9BA 5D7JA 4KJYA 1MJUH 3SKOA 3QXDB 4HLZG 3F7QA 4GRWH 4HK0B 3SKMB 4FABH 4WUUD 2A73B 4H8WC 3KR3H 2C4FT 3B6SB 5DVOA 1HH9A 3U30B 1C12B 3Q5TA 3PHOA 4LLDA 2IH1B 2YUZA 3SGKC 2J1KA 2BVPB 2YS4A 3CSYA 1MCPL 5SWZE 4JQXA 3TF7C 3PWJB 4HUNB 3QDJE 5DD0L 3CAFA 4WIQA 1IM9A 4EN3D 4HK3N 4NZTL 4IMLA 1DUYA 1OY3B 4RFEB 4ODUB 4JHBA 4ZS6C 5D2LB 3CFCH 3GNMH 1KN2L 3U82B 4XMLH 4BKLB 3QIWC 4G8IB 1BQHG 1JGLL 4XMPH 1WVZA 5AYUL 2VAJA 1B2WL 5CEZD 2X9YA 5I8KL 4DN3H 2Q20A 1XCTB 5GGRB 1OHQA 2X4NA 2WWMC 1J8HA 3W0WD 3W0WE 5DD3L 4XMKL 2P44B 4XH2B 2H3NA 1DVFB 4O2EB 4RGNB 4D0BA 2A77H 3ORJA 5TPWL 4ELMB 5ALCH 1IGFH 3ILQD 1F45A 3S7GA 4NN5B 4U6VH 1F11B 2HLAB 1O7VA 5TE4H 5B8CC 3CNKA 4MD0A 4NQVB 1ZLVK 1XGRB 4MHHG 1U8LA 3MV01 1N6UA 4GKZB 1JTOA 2VISB 1XF3B 1Y0LA 1ZLSH 3UBXG 1QQDA 5D1QA 2AV1A 1KYOJ 2FBOJ 3OX8A 3F12B 5IK3A 4YWGH 1IQDA 2E7MA 4KY1L 1CQYA 4Y1AB 5DJZA 4WV1C 2HFFA 4G9DB 3O6ML 4XPTH 4U1IA 1QSFE 5DJXB 4OKDA 3V9FA 1A14H 1V05A 3LKRA 4J12A 4JQIL 4RA3A 5ID0B 5LJYH 4MB5A 5FYLL 1EHLL 3DIFB 5MEQA 4M7JL 4XNUH 3PWLB 2D9CA 2FL5B 1U3JA 2YWZA 2B1HH 3TNMA 1Z6JT 5DTFA 4YJZL 3F7VB 3D87B 5JXAL 3JUYA 1KB5A 5IT2L 4KROB 3BUYB 1I3GH 1G84A 4Y7MA 3KPSB 3L3KB 1M1SA 2ITDB 3NGBB 5IHZA 5FM4A 2CH8A 1IAKA 4G9FB 4O58L 1LEIB 3GSWA 5HTSA 3M1BA 3MV9E 1N7ML 1I1AD 3C6SA 2EDBA 1I9RL 3HC0A 3K4DA 2J7LA 2FWOA 3JVGA 4PJ9C 4Y16D 2KZ1B 1PDKA 1FCGA 4XCFH 1T7WA 4JO3L 3VJ6B 3NA9L 4C58B 3S36L 2LU3A 3MXVL 3PWNB 3T0EB 2EDOA 3WCYA 3LQAH 3D39E 4N5ED 1CL7I 4YDIH 5DA0B 5EZOH 1QFUL 3TBYA 3BH8A 3W9EA 1D3CA 3RP1A 4N1HB 1LDPH 1OAYH 4IJ3B 5ISZD 3HNSH 3T2PA 5FO9B 5SWSE 1G7JB 4PYGA 2ZOKB 2X4OB 3OKOA 4MAYA 3QXAB 1DFBH 2WUBH 4JM2A 4JG1H 1AC6A 2HJLA 1EIBA 3MV11 4OV6F 2AW2A 4KQ4L 1ZVSA 5DT1L 3MJGX 1FYTE 4JRWA 4K3DH 3VXQB 3S4SB 4ZD3L 5I18L 3MRCA 5T3ZL 4HPYH 1QFWL 2MHAA 2AJYH 2VXTL 5BQ7B 2BNUB 1GVIA 4Y4HB 1JGDB 5ADPH 5E8EA 5KTEH 4BH8A 5GRUL 5DK2B 5CJ5A 2B4CH 2IPKB 4YDJB 2AXGA 3MUY1 1FYTA 3MRRA 4F3FB 2Y7QB 1ADQL 2PTUA 5GS1B 2Q8BL 3I75A 3LSOA 4XWGL 4GW4A 4I77H 1G7MB 3KYAA 5D70L 5CZXC 3OAUH 4L3EA 5IF0A 4OFPA 2E5EA 3EKCA 5ESQA 3QB7C 1LILA 3IVKB 1M6OB 4XXCA 1GOHA 4PJBB 3QIBD 1N64L 2OJZH 3QHZL 1UENA 4XC1H 4GBXB 4POUB 5E6YA 2YN3A 1FHGA 2J6EH 4CBPA 4OCSH 3CX5J 3AMLA 2YD2A 3L5IA 1KTKE 2F8VA 4K8RL 3O3EB 2GKIA 1KNOA 3PL6C 4L3CB 4KJQC 4F2MA 3TO4B 1S78D 2PCPB 4JB9L 5FA3B 3TJHC 2JJSA 4EIGB 3UTSD 1MHHA 2V5MA 3C5ZD 5D1ZB 5C0RH 3U36B 3N9GH 5HHXL 3IDMB 1MCLA 2FJGA 3OJVC 2DQDH 1HHHA 4ZUWA 4WUUE 3CFKB 4FQXC 2NY6B 1BOYA 2VZUA 4U1HB 3DETD 4AEFA 3PUCA 1I75A 1SEQL 3WMSA 3WFDH 4GG6F 4PGZA 3L5XH 1JL8A 1QHPA 3DSFH 3QCUH 1R5IB 4M1CC 4Q6IC 4QRRE 4QXUH 5GGSA 3W11D 3IS0X 3QJFB 5BS0B 1JBJA 4APQA 3VXNB 3LY6A 1A4JB 1IARB 5ESQB 2AXHA 3U0TA 5T5NG 3PNWA 3EZ8A 3VMNA 3RBSA 4TTDC 4NQEA 3CJJA 4OLWH 1LO3H 1CBVL 2Y7QA 1MWAB 3HE6B 4H25B 4Y5VA 4LF3A 4M5ZH 1HH6B 4WTWA 4XRCA 1HDMB 3P4OA 3OXSA 1ZV5A 5I6XC 4I0CC 3RZCA 3HE6A 43C9B 2DQFB 4EDXA 1YPZE 4Z7WE 3NZ8B 3F7PC 5I1KH 2FECL 3EO9H 3PHQA 1A3LL 2VSDA 3T0VA 1OM3L 5FUZH 4O2CB 4NNPL 4KJWC 2QHRH 4S10A 4G43B 1FORH 1KGCD 5HGBB 4XBPA 4JM2B 4O4YL 3KYOB 5A43C 3QXAA 3H7BB 1JHLL 3WIHL 1R3HA 4YR6A 1BD2E 1KPUB 4FG6D 1BQHA 3WO3B 1A7BA 4JANB 2EO1A 4PRDA 5IP4A 3U36A 1ZVHA 1H3VA 1BFTA 5EORH 4ZFOA 2F19L 5DDHA 4ZUUB 3WYRA 1RZGA 2VIRA 4Z0BL 3TJEL 1PSKH 5F7LB 4P9ML 3VFGH 4AH2B 4QNPE 5I71C 4Z18A 2AVGA 3FHQA 4HUVB 4UB0L 2HA1A 4QXTB 1AI1H 5CUSL 4HUWA 3SOBH 3N06B 1KNOB 3I3DA 2V9QA 1DVFC 3EFFB 1FNGB 2BRRL 3VG0L 3CFCL 1UGNA 3LAFA 2AJZB 1KN2H 3BPNC 1RZKH 1SBSH 5DD1H 1G7IA 5FYLE 3S96B 4X99B 1T1WA 1EEZB 1ZHKB 4NC1E 4NP4H 5B8CB 1KIPA 1G6RB 4KKBD 1AXSB 1YEEH 4FTVE 4XMKH 5DF0A 3CMGA 1DBJH 1FNAA 1HNFA 3QG7H 3BD3A 3P0VL 5FAAA 1IEBA 4KFZC 4GW4B 2E7CA 3D0LA 1PEWA 4WU7A 2PR4L 4HHAA 4HMDA 3PXJA 2VQUA 5D7KE 1WZLA 4FP8L 1WFTA 3C8KB 2X09A 3IKKA 5DK2A 3HI1A 4Y1AD 5DJAB 5JXEA 4UU9A 4FTVA 4FQXA 5HHPB 3BQUB 25C8H 5D8JL 1JGDA 2OR9H 1WCBB 2EDWA 1D9KD 4ODHH 5HI5C 3GB7B 1T1ZA 4LPUA 4KPHH 4RISH 4U1IB 1TPXC 4NDMB 1TTGA 1YN7A 3VXRE 4Z7VA 1Q9WB 5T1MB 3T0EE 4X7FC 5C9JA 2XY1A 5GS0C 2CIIA 1GH7A 4XAWL 4Y1AA 2YK1L 5HBBA 3EFDH 3BZEA 4XPGH 4JFXA 4LEOA 1SEBA 1S7QA 2EYRA 1T3FB 5HGAA 4DUXA 3H9YA 1YQVH 2DBLH 5I1IL 3PP3H 1FFNA 2VN7A 1C16B 3V7AG 1EHLH 3A6CH 4YNYB 3HE7D 2Z91A 2HT2C 2HLAA 1ZS8A 3NGBC 4XVUC 3F5WA 2UYLB 1KB5L 3UPCA 4KK5C 2X4PB 1PGRB 2NY3B 3VGAC 2P5EB 5I1DA 3LHPL 4Y4FA 1S3KH 2HT4D 1FJ1B 3I9GH 4M43L 1NMAL 3G9VA 4XNMB 4D3CH 3T0EC 1W0VB 1JNHB 4LSRH 3RIAK 5FGBC 3C6SB 3HC0B 3LS5L 4L4JA 2J8UB 4YXLL 3T3ME 2FJHA 4R4NC 2R0WH 1IAKB 3NABH 4G9FA 4QEGA 4MQ7A 2OSLA 3KPSE 4J1UA 2PXYC 5EU7E 3T08A 5KN5B 1EJOH 4IJ3C 1T80A 5FKAB 4MNQA 2PO6D 3RGVD 5IEKB 1CK0H 2YBRB 3MA7B 3BD4A 1MQKL 3SY0B 1OP3K 2AXFA 3ULUH 2NW3B 4ORGA 4AG4L 3PHOB 4IOSD 1JPTH 5GRVK 1YMMA 5ICZB 4X6CA 4PRPE 1T22A 4LSSH 3AROA 4XXDB 2FL5A 2XI9A 5IIEB 5MEQB 4YUEH 3SKOB 5EOCJ 1H8OA 1KPVB 3P2TA 2D31B 1OT2A 4KK6D 1A7RL 1JWSA 4LVOB 4P0DA 1FO0H 1RK0B 4XP4H 1F3DH 1F5WA 1F4HA 2IPTL 1A02N 2QADB 4ODVH 4R2GC 4OSUH 4K3DL 5LCVH 4QY8B 1UWGH 2H6PB 3L3OA 4LLVA 3RVTC 1FIGH 5GGUA 4DZ8B 4N0UE 2AV1B 2Z8VC 2YPLE 4JHAH 5T5NF 2DLGA 1QSVA 1QNZL 5FHBL 2F58H 1YN6A 2DL2A 1L4IA 5EA0L 1PLGL 5FYJH 4NKMB 1RVFL 2A6IA 3S5LB 5INDB 4KMTL 5JIIA 2BNQD 5BZWB 3RVTD 4PRIB 3QI9D 1ND0A 5FUCC 1CDBA 2R56H 5D70H 3PWPA 4JM4H 4OD1L 3L3IB 3RWIB 1QR1B 2H3NB 2VLME 5D1ZD 3PL6B 4I2XA 4FQJL 3MCG1 2C3WA 1BOGA 3GSVB 2PYEA 1CLOL 2AK1H 3E2HB 2VKXA 5SWSA 3E8UL 1N64H 4XB8A 4DCQA 1IQWL 4UT7H 3ZHKA 2OP4H 2WQRA 1LDSA 4X6BB 2H8PB 5D1ZC 3DBXB 4FQIL 3RZCC 4PLJC 1T5WB 2CUIA 4H0HB 5C6PB 3RVUC 1MF2L 3SBWC 3SDYH 2IJ0C 2OCFD 4IHOA 1Q72L 5IQ7H 2R9HC 2NY6C 3EYQD 4P4RB 4LIQH 5E2JA 4DK3A 1ZSDB 2ADFH 1L7TH 2DLFL 4XZUB 5KSBE 5E5RB 4C83A 4FOMA 1IILE 3LH2H 4JDVA 2BERA 4ZOCA 1A2YB 4EI6A 4YHLH 1MCDA 4AIZA 5C0IB 2PW1B 2I27N 1JPSL 1WZMA 2YA1A 2MSPA 3FT3A 1S8DB 7CGTA 4X8JA 3UPRA 4DKFL 3LCYA 4PV8B 4KXZI 3HE6C 5BZDB 5I1JH 3JV5A 3EDEA 5I6XB 1QA9B 2CD0A 1J1PL 3CMOL 2DQEH 3DNKA 1QFOA 3RWFA 1IL1A 1E4KA 1T21A 1QHOA 4J3SA 5CEZE 5CMAA 4NNYB 4H88H 1WSST 5E7BA 5CP3A 4U7SA 5J6HB 1LP9F 3FKUS 3UTQA 1NBVL 1NGQL 5M94B 1V7NL 1GL4B 1NDGB 5EZIH 5CJ8A 1YDPB 3H9SB 4JDZB 3SKJL 4P23B 1NQBA 3L3GA 3MLXH 5DRNA 3L3IA 1AKJD 3UJJL 5ISZB 1Q8MA 2ICWI 1S7SB 4V2CB 1NGWA 3QDHA 4U1MB 4JM2C 4RQQA 3GIZH 1MCWM 2FGWH 1K85A 3BPOB 4JRXD 3MCKA 2YD6A 3EYUL 4CVWA 1T7YA 4KY1H 2A6KB 1PKQA 1LK3H 5CZVH 1A3LH 1A6TA 1N0XH 5C0CD 3SCMA 2X9WA 3C5JB 4YZFF 2AGJL 3OJ2C 3RUGB 4G7YL 5F9WB 5BRZA 1L6XA 5MEPB 1U6AH 5KVFL 5JQ6L 2IPUK 4UV7L 1G1YA 2R2BA 4PREB 2YN5A 5D9SB 2VZTA 4PJXE 5C0CA 1XAUA 5I71B 1WICA 3JV6B 4HJ0C 3TN0D 2VITA 1RUAL 4L3ED 4LQ1A 3IJYA 5L8JB 4I18A 2F8XC 5IMKA 2OK0H 5LWYL 5IIEA 1EA9C 4EXKA 5K9OA 4MB3A 4RAVA 2ZUQB 4ZYKB 5GRJH 5ISZA 2UUDH 5E95B 3MV8D 3NOIA 4OZHB 3KPQB 2VAAA 4P23A 3HRZA 1AR2A 1NAMB 4NO0D 4PJAF 1MFDH 4YXHH 2RB8A 4QO1A 3FFDB 4G42B 3MA7A 1JPST 1A7PL 1K3ZA 2IGFL 2F54A 3MGTB 3MC0A 5ACLA 4JHWL 3FO9A 4N8VA 1E4JA 1T21B 3D85D 3RWFB 3BISA 4WWKD 2D7MA 4LLQB 1I9RH 4MNGB 4WRLA 2VABB 5CWSA 1R24B 5JW5B 4P2CG 4JFPA 2OR8A 2DQJL 4KTDL 2LV4A 1UWXK 3MJ9H 4X8JB 1QVOB 2MOVA 3KPOB 3T8XB 1OAQH 4N0FA 4XNMA 3RRQA 3QULA 4H8WH 1SQ2N 2PW1A 1C1EH 2CGRL 4UDUB 4M7LT 1HHGA 1IGTA 2CRIA 3Q1SH 1JWUB 3MJ6A 5DD3H 3FQXB 5D5MF 2P5EA 5DMKA 5SX5K 4C83B 3LRSA 2D7TL 4E9LA 3F5WB 1LEKA 3ZYJA 4GRWE 1D6VL 2OQJB 5H35A 5DYOB 3CK0H 1A1OB 1MRCH 4ALAH 2AEPL 1D7FA 3A6OA 3WD5L 5B38G 1DN0A 1T0MB 3V2AR 5HGAB 5ACZB 1SEBB 4IRZH 2P42B 5TDNA 4E0RA 4ONGL 1I1AB 1BREA 4D0CB 3HPJA 3S37X 3VGAB 5EU6B 4XPFL 4MZ3A 4B7IA 1NCWH 4QF1B 3AVEA 43CAB 2Q3ZA 1VA9A 2OZ4A 3IDGA 4U1NB 1ORQB 3HE6D 1WCBA 2PYEB 2LAAA 4DQOH 1BEYL 4OM0L 5EIIB 1QR1A 5DJAA 3P9MB 1ADQH 5D5MB 5CFHA 3GM8A 5ICYB 4KKNA 3PDGA 1CE6B 3ARBA 4HWZA 4L8CA 4D94A 5C0GA 1RZ7H 2M2DA 4KKLD 5FHAH 3QHFL 1A9EA 3DYMA 1J86A 3G6JB 2W0FB 4YXKL 4WO4D 1UM5L 1OTTD 5DK0A 3QHZH 5EIQA 1D5XA 5KZCD 2DWDB 5HYFA 5HHMD 3DHMA 4UMGA 1EK3A 2NY4B 2R0WL 5JXAH 4JO1L 5D2NA 3SDAA 3A67L 4FZ8H 4JFFB 3IDNA 3MRPA 2E9JA 3S96A 3EOTL 4MNQE 3GMOA 1NGZB 4LAQL 5ENWB 2XTJC 1KN4L 1CK0L 4F9LC 1A5FL 3UJIL 5E5MB 4HUXA 5GZOC 2OZ4H 3W39A 4MAUH 3O8XD 2IANA 2QADC 1HKLH 1A4KA 4W68A 2XTJD 4R2GB 4XCFL 2NR6D 4I0KA 2K1MA 3V52H 4MVBD 4Y88A 5E5UB 1QRKA 3ELAT 3NH7L 2XOTA 4KTYA 1A6VH 2P24B 3O8XC 3ZKSD 2FB4L 2AXFB 3E6FB 1U8QA 3N1PC 4M5YL 4XP4L 4LDEB 1KPUA 2NR6C 2UZIL 1TVHA 3IAGC 2ENSA 2IANE 3CX5K 4XCEA 4XP6L 2VMFA 3PE9A 2DMKA 4CN6A 3WN5A 4PB9H 5LCVL 1K8DB 4P2OA 1N4XH 1C08B 4Q9RL 3VD7A 5CJQL 1OVZA 1YZZA 1C8PA 1FBIH 4Z77A 4NBXB 5ID1B 5HY9A 4KMLB 2JB6A 3KPRD 1JE6A 1FJ1A 4WCYL 4FTVD 1KIRB 2GITB 4NSKB 3TBTB 5SWZB 3ULVE 1KXVC 3RZCB 3FAXA 4V1DB 1DLFH 5EB9A 1KTLA 2GFBA 2ZSWA 2VLKB 3K1DA 1H15A 3JUZA 4U33A 1DSFH 2NNAA 4Y5VB 2C3XA 3KPRA 1QR4A 3LN4A 3BIKA 3PABB 3LEYH 5FYKE 4I1NB 3U0TB 3WDJA 4NM4L 2OTUA 1UZ6F 5IHUL 4HQQL 4HJGA 4BH7B 4JCMA 1MCJA 2CDEB 1OW0A 1S7VA 4JFZL 1MRDL 4GW5A 1R0AH 4FFZH 1QPXA 5F7FA 3ZHLA 5JHDA 4FQLL 1S9WA 5I8OL 4N5EC 3GB7A 2W59A 3BP6A 1Q72H 2LTQC 4IDJL 4EIZC 2GUOA 3DURA 4LK4A 4MXVE 5GHWH 3BKMH 2J6EL 5E2WL 1VESA 3CXDL 4UU9B 1RURH 5HHPA 3LPGA 3KDMB 1G7QB 1YMMD 4Z95H 4Y4KA 2GK2A 3N1QC 1QSZA 3ARWA 4HKJB 2OTUB 2FIKB 4PJ9D 5C0BE 3RVWC 4PRAA 3V0VB 2XA8H 3BH9B 1MHHB 2YPLB 1DQLL 4IRJD 4UB0H 3VWKB 4BZ1L 1YMHB 2MMXA 2MTPA 1H15B 1EGJH 2HH0L 3PG2A 1F90L 1FYHB 5IB2B 2LU4A 2Z93B 1UC6A 2R1YA 1J1XL 3MFGB 3B43A 1P53A 4O5LL 4OCRL 1P4LB 1KLUA 4L4VE 3K2UH 3SO5A 3BPOC 3EFFA 3G5YA 2Z93A 2DDQH 3X13A 3DSFL 3IVKA 2Q7NA 4HUVA 2YKLH 4FFWC 4KGLA 2ATPA 3VFNB 4JKMA 1OP9A 4ZAKA 4PRAB 1UA6H 3MUHL 2DM3A 2ESVD 4Y5YA 2Z35B 3GMPB 2D7NA 3UTZB 1FZKB 1R6VA 3V6ZB 4L4VA 3REVA 1T83C 2VUYA 2DYPA 4JY5L 4K71B 3A6BL 2H45A 4JZJC 3CFDA 4MJ2A 5JUEL 3S9DB 4KUZH 2CMRH 2KQMA 2YPVH 4CW1A 2ADGA 3O9WB 5BQ7A 4WFHE 1NLDL 2UWEE 2ZSVB 4GXUN 2ZUQC 4XNQA 5GSRB 2UZYB 4LLWB 5DC9B 2F74B 2VLMD 4W70A 2MNUA 4R0LA 5BVPL 4M8VA 3BKJL 4HJGB 4BH7A 2E9BA 1CT8B 1ZWIB 3DGGA 2B39A 1FNFA 4KKAD 2AS5M 1T89C 2FD6L 1DQDL 4I5BB 4P99A 3JTSA 5IVNA 1EFQA 2VLRE 3VWJD 1JNJA 3W0WA 5FO9A 1JK8A 1YJDC 4G9FE 1D5XB 2R0LL 4DVRH 3PF2A 2FCBA 3RGHA 5MENA 1W72A 1MWAA 4S1RH 5FUCE 4UDTB 3I9GL 3HCVA 1A9EB 3G6JA 4QRRB 4R90L 5DJ0A 4I4WB 2ICES 1MREH 5ICYA 3VGGA 3JTTA 4I3GA 2A9NH 3W9DB 4MJIB 2CDFB 5EIIA 1T2QL 4QWWD 4P5TC 4K07A 4ZPTA 4ZO7A 3OB0H 2ZUSA 1F2QA 3HI6L 1N8ZB 2AEWA 3QFJE 2WWKT 5CSGA 3BMWA 4U1HA 5IB3B 5SX5H 3LN9A 2YMXL 3KHOA 4H8WL 4NRYA 3HPJB 1JPTL 1KTRL 4P2QB 2XNAB 4RGND 3E6FA 5HHVL 3BUYA 4S0TD 1QFHA 1DTUA 5DZLA 1G7PB 1LMKA 4EI5D 3VFTB 4RAUA 4M3JA 3NFPA 3W11C 2JJVA 4HWBA 4PGBA 2P5EE 1UQSB 1I1AC 1TCRA 2BSTA 4AENB 1HINL 1D5BA 3ZSSA 1QSFD 4FA8A 3I84A 1MRCL 1S9XB 2WP3T 5FA3A 1RUPL 1FO0L 4WJ5A 3RX7A 4K7FA 2RIKA 3F7YA 4ODVL 5E5MA 3INUH 3QCTL 1N26A 3ZT6A 3G6DH 5JQHC 1QBLH 1T1XB 1NCWL 3P9LB 2KZWA 2B1AL 4G6KH 1JHKL 1W8OA 2AP2A 4WNQB 1RIHH 1NEZA 4XVSL 4MNGA 4M48L 4M3KB 3H9HA 4XCNA 2I07A 4U0RB 4V1DE 5IJVB 5EFIB 5C0GB 1RHHA 5I1IH 5DEFB 4KVNH 5ESAA 2CQVA 1F11A 3CZFA 1J0IA 1B90A 5F1SA 3ET9F 1JYXA 4MDJA 1CLOH 2AK1L 4GQPH 5T3XE 2VAAB 1MNUH 3PGFL 3WLBB 4RGMC 1AQKH 5FK9B 2OP4L 4Y4HA 4OZHE 4YC2C 4RAVB 5DUBB 4LVNB 2ZCLH 4JJ5A 3S97C 4JO1H 1F00I 4U6XA 43CAA 1MF2H 3DVIA 1HWHB 4URTB 1MCEA 3EOTH 1HK6A 2EIBA 1CD1A 1XF4B 2EYTA 2VERN 5HI4D 3UTTA 2A6DB 5TDNB 3O8XB 1QYGH 2IF7A 5IMMA 1KELL 4GQ9H 4OZFA 5K33A 3FFCE 1EXUB 2VQ1B 4HXBH 1GCFA 1AFVH 1T7VA 3DXAE 4AYFA 5L6YL 5H35B 1RZ8B 4HH8A 4X6FA 4XBEH 2V5YA 1KCRL 2NY5C 4LLDB 5KANI 4KKBC 2EZ0C 1HSBB 3H3PH 1LO4L 2W9EH 1RZIA 4QHKJ 3LEXB 5E56A 3B83A 5J8OA 4LHUB 5IKCB 5C0AD 1N5AB 4P59L 1LE9A 4KRNA 3L3GB 4J3WA 3GSWB 3N85L 2DRUA 2FR4A 5CKGA 3HHRB 2NXZD 1PEZA 2QJDA 2CDGB 3HUJE 4XBGB 3QIBA 5HYSB 3BGFB 3WNLA 3DYOA 5HHOD 1KB9J 4ZTPH 4QYOA 3ROOA 4YHNB 3BGMB 4GAJL 4NO5B 5J57B 3JWNC 1EHAA 1RMFL 4N8CH 4K23L 2NXZC 1IAOB 5J11B 4Y5XB 4NQXB 3OQ3B 2H26A 2IQAB 5DQ9B 1OGAA 5CEXB 4GAYA 3IYLW 4S1QH 2OMNA 5ANMB 1WV7T 2VWEC 2MKLC 2B20A 1DSFL 3G6JF 1QFPA 1AGDA 4WHYG 2GAZA 3UAJD 1EO7A 4YHKL 2LTQB 3CDFA 3FO2B 3QXTA 3UTSA 5C0IA 1CU4H 4ZXBA 2VL4A 2ARJB 1JZ5A 1VEOA 1JF1A 2HT2D 5LGHL 4OF0A 2VITB 5A2FA 4G7YH 4EJ1C 1IGIH 3U4EA 1BAFL 4XC3L 2R2BB 4HSQA 4PREA 1ZSDA 2J3SA 1ZA6A 4XGZB 4P4RA 3MO1B 5DURD 4JDTH 2VQ1A 3KVQA 5L2KB 1IQDB 4HCRH 2OM5A 4XVJL 5IK3B 5I30L 2R8SL 4XPAH 1HI6B 3IDJA 2DF3A 5A2JH 4RIRB 4MZ2A 2VLLA 4Z95L 1CD1B 5I8KH 1KJMB 2YUXA 1A9BB 3MLZH 1GGBL 4ETQA 1DN2A 2A0LD 4P5MA 5GGRY 1A6WL 5F9OL 4NQED 3QZWG 1FO0B 5TPWH 4BZ1H 4DW2L 3PL6A 4I2XB 1P4IH 1DQQA 1OSZB 4QTHB 1TZGH 1VPOL 3BD5A 4YQXL 1NCTA 5TE4L 4GXVL 3CZFB 4GJTB 4U1LB 1I9EA 4PRIA 5J13C 2J4WH 2YC1B 2WBJB 3T0DA 3OKLA 2R69H 4XXCC 2KH2B 4P2YA 2XN9D 2E3VA 4MA3A 3EGSA 1RSFA 1KPRB 1NC2A 2CK2A 3ZTNH 2P7TA 3G04A 3S35X 5F6HJ 2XRAL 2BVOB 3RTQA 4Z7QE 3HPLB 4PJ7A 3SDDB 1Z5LB 4DZBB 2VLRD 5F21B 3NFSL 3R4DA 3QDMD 2A73A 4GW1B 2FX7H 5I73C 4LNRA 4OTXL 3F58H 3OR7B 2AEPH 5MEOB 4G5ZH 3GZKA 3LKPA 2B1HL 1MAJA 5K9JH 5B4MC 3DX6B 3T0BA 3CPLB 4X6CB 4HW6A 4WO4B 5F9JA 2BHYA 1VDGA 3VFTA 4RWHA 2YD3A 5MERA 5T33H 2QQKH 1HEZB 5IB3A 4PJHA 2C3VB 5FKAA 1RZJH 1N7MH 1F42A 2FD6H 1DQDH 2VDMH 4PUBL 4HIXH 2OSLB 4CADB 4RGNE 4JFYB 2RFXA 5CCKH 5FV1L 4ZUVA 5IFJB 3C5SB 2R0LH 4HGWA 3S3PA 4QRUA 1RZ7L 1WGOA 1V3JA 1RUAH 4P5TB 1I7UA 3C87A 4GMSH 2QSQA 4GUPB 2B0SL 2NW2A 1S7TA 4BQ8A 1UM5H 4L9LC 5LWYH 1PKOA 1ULVA 2WAHA 5F7WC 5INDA 3GMQA 4OFYD 2EDFA 5HHME 2G2RA 1MREL 3L7EB 1OP5K 3LQAC 4MQXC 1JUFA 4XVUD 5T1KD 2IFFH 4QGTA 4C56B 5TH2B 4HV8B 4OZGF 1BGXH 2YHGA 4WENB 1DJSA 4FXKB 3O6FC 1ZTXL 4C4KT 1OD9A 1RV6X 4X6DB 5HGHA 4YO0A 2ZUUA 4GMTL 4Z7VE 3GJFH 3QDGD 1WAAF 5HYJE 4WWKB 5SWQA 2P8MA 2CR3A 3SJVE 2R4RH 3LQMA 1DQML 4LLWA 4ENED 4JG0H 1UM6H 3DSNA 3Q6FA 5SV3A 2C1PB 2DQUH 3VH8G 3VG9B 5B3JE 1KXQE 1YMME 3KXFA 5IESL 5GRUH 2XACC 2CGRH 1P7HL 2F5AH 2AQ2A 2XZCL 5KVGL 4MLSA 5CIPH 4P4KB 4M5YH 2IEPA 3C8KA 4ORGB 2NW3A 3NMEA 4RA0C 4JKWA 3CU7A 3DV6B 3HZYA 1V3LA 5EBWB 3WKNA 3BEWA 4KI5D 5DJ6B 3FOLA 3D0LB 4WU7B 3MRBA 4WW2F 3QRFM 2ICEA 1INDL 3LVEA 1P5UA 3QEQB 1UWEH 5EN2B 4G6KL 3WD5H 1F4XL 2BVEA 5CJOH 1CTNA 2NXYB 4YGVB 4P46A 1RUML 1V8HA 4BK4A 4TUJB 4XP1L 2YEZA 3K0WA 4RGMB 5IBTL 4ONGH 15C8H 4ISVA 4PTTB 3ILQC 3TYGL 5E70A 1KCVL 4HS3B 4K8RH 1UACH 1UEMA 5B21A 5C1MB 3P77B 4YHMH 1BVKA 4PJGA 1LD9B 4DVBA 3C60A 5MEND 1IJ9A 3L3HA 3AGVA 4OM0H 1RQ5A 4LAJH 4LASL 4DGVL 3U48A 5CLTA 1YNTB 2XQBH 3WKML 5C0NC 1MNUL 3OKKA 4TN9A 2NCMA 4PJIB 1JGUL 4R9HA 4ZFFA 4WUUB 4PB0L 1DBML 5IHUH 1JRHL 4G7VL 4Y2DB 3MRDA 4LGPB 5D6CB 5MP6H 3B9VA 3BFOA 2FX8H 4FFZL 4LPXA 1NUFA 1KCUH 1FC2D 5E9DB 4X4ZA 4IDJH 1EERB 1FNEA 1T0NB 2J8OA 1BD2D 1BQSA 4KTEL 3TVMC 5GHWL 1T66C 3NAAL 1RURL 4HXBL 2HFGL 5D1QD 4NM8H 3UC0H 1LE5A 2GJJA 1I3VA 2XZZA 5ILTH 1A7OH 3L6FB 2W1NA 5DQJA 3LKSB 3BGFC 1MFCH 5DI8A 4IS6B 4TUOA 1HKLL 4S1SH 3LN4B 5CSBA 43C9A 2CPCA 5FECA 5CSZB 2J12B 3HNVH 2VXQL 2R0ZL 3ARUA 4G8FB 1IAIL 1HH6A 4XRCB 5K59F 1LEGB 4HS6B 3N85H 2WQ8A 3BP4A 5DJ2A 2GITA 3O4LD 1G6RA 2PYEE 3S35L 3TBTA 2OBGA 3MRIB 5EUKA 3WXVL 5INCA 3GIVB 5CKAA 3ARTA 2AJZA 2DIAA 2P5WE 2YKLL 5C7XH 1RMFH 1IEHA 1BM3H 4Q9RH 1WEJL 2CO7B 1HILA 4W6WB 3MACH 3C9NA 1CQKA 1MFEH 4TPRL 4PRNA 5D7SL 3U2SB 4KAQL 4L1HA 3E6HB 1NEZG 1YEGL 1RZKC 3T4AA 1RU9L 1K3IA 5I1HL 3QQNA 1M05B 4J4PC 2NX5D 5EOQH 3VD9A 4MA7H 3TO2A 4LHUG 3KJ6L 2I9TA 3ULUE 1ZEAL 1BQHB 3H3BC 1UB6A 4D9RE 4P9MH 3MV7B 5IB1B 3WFCL 4DAGL 4DGIH 1FFRA 4I48B 4XBPB 4K2UH 4X98B 2VR9A 3JSSA 5JO5B 3FT2B 4GH7B 3CGTA 3CFBB 2V2XB 3O3BB 4JFZH 1PG7L 3EO1A 1FGVH 1HYRC 3FN9A 1KJVB 2YOCA 3FN0L 3MLZL 3RAJH 4JREC 4GBXA 2FBJL 2EE3A 2AJVH 5E7FA 3F62A 1EGJA 1TVDA 1M6OA 3CLFL 3UBXB 5IFAH 2EDEA 4DW2H 5EU4B 1P4IL 5IMLB 3PWVB 2XY2A 2BNQB 4FHBD 3KGRA 4YAQA 1XR9B 3DTXB 5IVXF 3JWDL 5AD0A 1YYLH 3CFJA 4PJXF 4XHJD 4HKBB 3DRQB 4JZJA 4YAQB 2JCCE 3SDDC 1AGFA 2RCSL 1NL0L 1INEL 5F3HB 1RUKL 2HTLC 5J6GA 1AD0B 4OT1L 1MPAH 5HDOA 1CLYL 3NBNA 5I73B 3GI9L 1MLBB 4YHPB 4UNVA 2Y36H 3MRCB 1Z9OA 1HHIA 4K3JL 1K2DA 3HUJB 5CS7A 2KKQA 2QQLL 3NIDF 3I3BA 3QEHA 3DVNB 1J0YA 1AIFA 3NIFF 2DDQL 4R26H 2LE9A 3QFDA 4HBCL 3WUWB 4X7TB 1S9YA 1UG9A 5BMFH 3BYYA 5E94B 1J05A 1T4KA 3KYMB 2FH8A 5C8JA 1WBYB 4O9HH 5D72H 1CD9B 1U36A 2Y06H 4RZCB 4X6EB 3S8WA 4JY5H 5LXGL 3E6HA 3DVGB 1NMAH 1P7QD 4D3CL 1DLHB 1FZMA 2X89D 1FN4B 5BS0E 2QKIB 4LCWB 3T4YA 3MRKB 3SDCA 5CINL 4N0FB 4UOW0 1NEUA 5GS1C 2APBA 1CLZH 1UZ6E 2EECA 2QSTA 3AM8C 3MJ8A 3HG1E 3W2DL 3EAKA 4LSQH 4TULL 3O3UN 3MREA 4PJAB 4U1JA 1I1RA 3ULUC 1U0QA 1GZPA 2IADB 4TSCH 3IFNH 3MRRB 4GBXC 4NQDE 3B9EA 2AJ3A 5JW3H 3O6FB 2C5DC 1W0WB 3GGWA 4X7SH 3F7VA 3ZE1F 3HRZB 2MKWA 4OQ1A 1LO2H 4D0DB 1A6ZA 1R5VB 2IFFL 1WIOA 2BOBA 4S1RL 5C0FA 1G9NC 2EH8H 4QHLA 1AO7A 3HAEA 4PPTA 4RFOL 4Q0XL 3QNZA 4FQHA 1FDLH 2D7QA 4PRPA 3RWDB 1CN4A 3MLRH 4D8PB 1LE5B 4ZTOH 4B50A 2Q76B 5B39B 5J56B 4GMTH 1A0QL 4OLXL 3SPVA 1H3XA 2H41A 1HIMH 4L8SA 1XGQA 5JMOC 2VC2L 3K1KC 5GGVL 1BLNB 5J3HC 4Z7UE 1WBXA 5GSVA 3EW3B 4Q6IA 5DUPH 4OFIA 3VI4F 3SE4C 4AT6B 5I16A 3QO0B 3ARDA 3QIWD 3QJHB 4JQVA 1FFPB 1PD6A 5CZXD 5HI3D 2ZOLA 4FFVD 4UV4L 5I16B 2A6KA 4U2ZA 4Q6IB 2FHFA 2X6MA 1X3DA 3CD4A 2GSIB 3VMOA 1HINH 3SPVB 4JM4L 3UYPA 4Z7UA 4FFVC 2EO9A 4JVUA 3IS1X 1S9VB 4UUJA 2Z8RA 3KWWA 3E8UH 3FZUD 3FQTA 3QUMB 4HXAL 4C59B 4EQ3A 3K7UA 4LEXL 2A74B 3WDHA 4OGYH 1J8HB 5KSAD 4PV9A 3QNYA 3UTQB 4YHYC 3PWPE 3JWOL 1MJ7H 4ISVB 5C0FB 5JDSA 4K3EH 1IL1B 4ZSOE 1NGPL 4BUHA 4OV5A 3C5ZC 1DANT 4HH9B 3MFFA 2CXKA 3GGWB 3HZVB 1F4AA 3QEQA 1EZVY 2OL3L 4LKXA 1L0XA 4BSVA 2FDBP 5DJ6A 5AUMB 4M8QA 3TVMB 1RFDL 3GSUB 3PWLA 4ZODA 3PDOB 4X4XA 4MX7B 4OI7A 2VDNL 1GRWA 2ZUWA 2IH1A 1JRHH 2V17L 1KIUA 2Y1VA 1MIEH 5L88L 4PFEA 2XWTB 5CD5C 4XC3H 2ZZUT 3UYRL 4C55A 2QHLA 1AGEB 5BJTB 1I7ZA 2VB5A 4FFYH 5I1GL 4K7PH 3KXFB 3T3PF 5D7LE 4OI8A 1G7HA 1B6UA 5FYJD 3MJ9A 3GSOA 4KMQA 3ULVF 1DLHA 5KVMC 4HCRL 2WINB 4PRHD 4R96B 1FL6A 3QDGA 4ODWA 5EUOF 4ZSOB 4PBVC 2COQA 2VKWA 3HG1B 4FQXD 5EUOA 2X5PA 2AAVA 1GGBH 3OX8B 5HGHB 5IOPB 1WZKA 2V5SA 3ULSA 1LP9A 4NHCH 5IV2A 5KSAB 2EDHA 1YEIH 4PRIE 5A1AA 1NCAL 1MAML 1ZT1A 5E6IA 1NFDE 3DV4B 2IFGA 2GJ6D 3QWRA 4HC1H 3VRLF 1AIFB 3S37H 3VXOB 5BXFB 4GXVH 5HGDB 1VFAB 4LU5L 5KS9A 1IAMA 1QBML 2BOCB 3RU8H 4YFDB 1LP9E 3EHBD 1YA5A 2FGWL 1T03H 4GUPA 1MUJA 1QD0A 2NX5B 1U8OA 1KIQB 2XN9E 3EDDA 1OD7A 3C5SA 4CU8A 4P59H 4BKLA 5F7EL 4F7TB 1QEWB 4OIIL 2HFEB 2MFNA 2DQCH 4WW2A 5D6DA 3KXFD 3VFOA 2EDDA 4DZ8A 1XGYH 3EDFA 3N50A 1KB9K 4OZGE 2OMBA 1TMCB 2X70B 3CSPA 1NMBL 4DKEL 3H42L 1IKNC 5I1EH 1K9TA 2OK0L 4U3CA 3ZDXF 3ZE0E 1I8IB 1XF5B 2NY5L 1VADA 5D7JB 3SE8H 4LNRB 4HWEL 4JREB 4J3OC 3P73A 4XCYB 4DGIL 4AZ8A 1UCTA 2DQGL 1T2JA 4WEMB 1J8HE 3BP5A 5HHOB 2BC4B 2L4OA 2KL6A 1EVTC 1FGNL 4NKIH 5IEHA 2BVOA 4BFEA 2VDML 5KOVC 2W65A 1F97A 1OGTB 2MWCA 2AJVL 4KTDH 5KN5A 3BO8B 4F7TA 2X4UA 5JTWA 4KJPD 1T7XA 5KG9B 4NJ9H 4J8RB 2PXYB 4OZIB 1WQVT 1EEYB 2DL9A 3H2WA 4ZAKD 5C6WH 3GSQA 4P3DA 3IT8D 4B7LA 5ABDE 1ROWA 3MA9H 3MV9A 5DSCA 4E41E 1DDHB 2DTSA 4JFHD 3CX2A 4RFNB 5IM7B 5TJWK 1RULL 5F9OH 4V1DD 4KJPC 4WI2A 2BVTA 1U8PA 2JCCA 4Z9KB 5IFHL 5FCUH 5IVZA 1D5ZB 5DFVD 3CFEB 3D5OF 1ZS8B 4ALAL 3REWB 5EUKB 2APWA 12E8H 4BJLA 2ZUTA 1CLYH 3C6LD 2ICCA 2DS4A 3BPCB 4X5XB 1GJIA 1CR9L 2VYRE 4JGMA 2UWEA 1ORSA 1LEGA 5J7CC 1E4WL 2WBJD 2EYRB 3WNNA 4OLEA 1IC5L 3V0AC 4F58H 5EUOB 3QXWA 4JLRA 4GO6B 1FG2B 2HKHH 3P4MA 4RCAA 1YEFH 4LRNH 4TRPL 1Q9WA 5T1MA 5T5FL 3C6LA 3EYOA 1D5IH 1JHTB 3ZTNL 5HGGS 2PF6A 1UH2A 3EYVB 5F7MC 1FZOB 1N2RA 2W38A 3GSOB 1NGXB 3EYSL 4LBEB 1Z9LA 1J1OL 2BVUA 2Z92A 5HDBF 1ERNA 2ZUVA 5DJDA 3T0ED 1VFOA 1P9MA 4HBQA 3AFLA 4MJIE 1KT2A 3P4NB 3ZYZA 2DMBA 3C2AL 2H1PL 5I2IB 3O3DA 1QKZL 1MFAL 4N0CC 3F58L 3GSUA 1OT1A 5IB5B 4LLYA 1P9MC 4JPVH 2P49B 3CUPB 4O51B 3RI5K 3RBGA 3TFKC 3R0NA 4NQXA 4XP5H 3BZFA 3HZVA 3WJLA 3MFFB 4FNLH 5D6CA 1S7XA 4PRHE 3RKPA 1OARL 4YHNA 3ROOB 4BFBD 1R5WB 3IXAB 5EBMA 2RHEA 5T33L 4JFFD 4IIQB 3E2HC 4WFFE 4UINL 3T65B 5FYJE 3TFKD 2CDGA 3RWEB 1U8IB 3I50L 1A5FH 3QFJA 1TITA 2JELH 4O2FB 1YY8A 2N7AA 2CUHA 1OF2B 2XQBL 3IB4A 3WKMH 3VE0B 3PQYA 1U8NA 4Q74A 1TVBB 3C8HA 1K6QL 4LHUA 4PJBE 3QFJB 3DWTA 1J7VR 1LO2L 3BRFA 3K74B 4X4YB 3DX8A 5FYKU 4IEFB 5EBLB 1X9QA 2HRPL 3BYTA 2X4TA 3WFBH 1S7RB 2EH8L 2ESVB 4ERSL 2NTSP 1G9NL 2KUTA 1GZQB 2BNRA 1GHFH 1MEXL 3O4LA 5C07B 4HIEB 5IB4A 1UVQB 4KTEH 3QI9A 1TCMA 3MLRL 4WHTA 3DX7A 5FIEA 5IWLC 4F15B 3CUPA 4O51A 4NWUH 1BIIA 3MRQB 5EC2A 3PWPD 4LLMA 3MQIA 3OAZK 3L7FA 4GOSA 4NUJB 1KCSH 5I19L 4I0PC 1BFVL 1CDIA 3WL9A 4M02A 2DWEB 1KEGL 3DUHA 3HB3D 2BVQA 4EBQH 4WU5B 2EXYC 3DO7A 1UT9A 4MNGE 4U6XB 3MRJA 4WCYH 3ZKQD 5DQDH 2H2SC 4R8WH 3EYVA 1A22B 2C1PA 4RGOL 4I0PD 5DUBA 4NNXA 2DQUL 1SMOA 4UIMA 3DROB 4OF8A 4ORZC 3OV6A 5DHXB 3VH8A 3VWJB 2PNDA 1E4KC 4OQTA 5CILL 2X4QA 3TA3A 3C5ZB 2DQHH 1JF6A 6FABH 4YO0B 5KVGH 3L3JB 3D2UD 1T66D 3WJLC 4ONOA 5C3LD 3RVUD 4XI5D 2VE6B 4HFUH 3TIDB 4QHMA 3MBED 3TV3L 3MROA 5IJVA 1MIMH 1UCBH 2A1WL 4OGYL 4PJAA 3SGEH 1OSPL 5EOTB 4OZGB 2NY1B 4ZUSB 3KPRE 1QLFB 3ZYIA 3VXSD 3BW9B 2EICA 5ESVA 5IVZB 4TNWF 1QO3A 2LAGB 2QL1A 4TPRH 3FTGB 1IFHH 5DHVA 5CJOL 4YBQC 4OIBA 5ETUB 2QKIA 4LCWA 2VDLH 3MV9B 3T4YB 5DSCB 1CIUA 1CG9A 4D9QD 1EEYA 3T77B 3CXDH 4GRWF 2NZ9D 4MDIB 2F9BT 5EOQL 5IMOA 4ODTL 2NY2B 4YDLB 4ZUVB 3U7AA 1T1YB 5H94A 2V17H 3UX9B 2OX5A 4X9BA 4PJDE 2AEQL 2HP4A 3FT4B 3OG4B 5E2TH 1WBYA 1DQLH 5F9AC 1I3RA 1X5AA 4K7PL 4D9RD 1F3JB 2CJUH 4ZOEA 3HMXL 3GNML 5F71A 3MNWB 4E41B 4LQFH 3JV4B 1FNLA 3ESUF 2XNAA 4DN3L 1AGCB 4L3CA 4OFVA 3R06B 4L1DA 4OCRH 2IWGA 2FBJH 3ULVH 3HUJA 1YEIL 3SCMD 4JPKH 3IETB 3NAAH 4U1SA 2CXGA 1MAMH 2OTPA 4J4PD 3HA0A 3VMPA 4KKLC 4R0LC 2CDFA 1EAPA 3HZMB 2ZPKL 4CVXA 1QFWM 4O02H 1CE1H 1IC4H 4YIQA 1LGVA 1NFDB 3WS6C 3NIGE 4LPVA 4GAFB 4HKBA 4ENEC 4XTRC 1T7ZA 4MD5B 3GSNA 2FHCA 5GS1A 2P7TB 1UB5B 1FYTB 4M7ZC 4F3FA 3G5VA 4JFHE 4RX4D 1P5VA 2VR5A 3G5XB 4XVTH 4QRTA 5F1IB 4IDLA 5EU4A 4WUKL 5I1CL 1HXMB 2Q86A 3ARBD 2AQ1A 1QLRA 1MH5A 2GI7A 4I5BA 1U8HB 2CRZA 4NO2A 3OKDA 4GRLA 3U7WH 3TT1L 1P2CA 4R4FH 5GXBB 1JWMB 3LKQA 1WITA 4U1LA 5HYJB 3VI3E 1DEDA 5HVHB 3AC0A 3QP3A 5D7JC 5EU6D 1AHWC 2DI9A 1D5MB 1ZMYA 1R3KA 4KU1A 1FAKT 3VRIB 4OF7A 2JB5L 4I48A 2CSPA 5DZOA 1P1ZB 3CH8A 3O2WL 4PR5A 5CEZH 5HHQA 5IB1A 4ODSH 1MCOL 4U6VL 3EUUA 1MFBH 1NCCH 3IFOB 5FM8A 5KSAA 3HB3C 2Z31B 5EZLB 5H8DA 5FCSH 3HG1A 2Q7YB 4BSWB 3RHWK 3T4AB 4WFGE 5L2KA 2BX5A 4POYA 3W82A 5T1KA 1BBDH 4PRNB 3QO1B 2FYYB 3QPQD 4RMUA 3LOWA 4JQVC 1ITBB 5CGYC 3FHAA 5BJTA 4YFLI 1ED3A 1A3QA 2R4SL 2V2TA 5DXWA 3LMJL 3FO2A 2DLTA 1CCZA 1A21A 1E6JL 1JGLH 4JZNB 4XMPL 5DD5L 2NLJA 1AQDA 1I1CA 4OZ4A 1G0YR 4X7SL 5C09B 3FN0H 3L5HA 2Y9RT 4M7JH 5FKPB 3STZB 3KPSA 3ULVD 3TBWB 3AS0A 3B9AA 5CD3B 2IPUG 5L7XH 5IB2A 4MD4A 3RKDC 3WHE1 2XTJB 4L4TA 3KLAB 1A1MB 2XV6B 5CIPB 1DFBL 2C7UB 4XNZB 1NAMH 2R23A 5KSBF 4PJCE 4XWOD 1LO5A 3JWDH 4J3VA 3DIFA 2A2QT 4KDVA 2FR4B 5DO2C 5I17A 2VZSA 3BKYL 5D4QA 4O58H 4XWOC 4Z78B 5BO1H 4UILL 3H0TA 3ULUD 4YWGL 4OZIE 5GRWA 3BDXA 3VFUA 2B1AH 5DURB 5IQ9B 1D6EA 1JHKH 3QXUA 3CVIH 3FOMA 3KYNB 4IRJC 3VFPB 3DUSB 2F8OA 3LQAL 3MV8B 3SJVB 1J1OH 3G6AA 4HFWA 4UOJA 4DTGL 5D1QB 5ACMA 2Q8BH 3RL2A 4HF5H 4KC3B 1EDQA 4Y2DA 1SJVA 3DLQR 2H1PH 5EO1B 1QKZH 4XNUL 3O11B 3R8QA 1WIPA 2GYSA 4MNQD 1TLKA 5TDOA 3QG6B 4OM1L 1KF9B 1DQJA 2HG5A 5I1LB 5JORB 2QEJA 4PJGB 3NZHL 3EJYD 3RQ3A 1XIWA 1YEJL 2V7NA 4Y5VC 3DRTA 4J3XA 1Q0XH 4HDIB 2JJUA 2R39A 4TUJA 1CDHA 3RL1B 2AQ3A 3PGDB 3TWCH 3KLHD 2BFVH 3V4UL 4D2NA 5D2LA 3BSZH 4QLRA 1DUYB 1AFVL 1ZHBA 4ZS6D 3DVFA 5DK3A 1RFDH 2ICEB 3ZTJG 4JFDD 4F15C 3O2DH 1BHGA 4KK8D 3D3VD 4NKQB 5M7QA 3NA9H 1WFUA 3N9GL 5D7JD 3OG6B 5EBWA 4PJDB 3MREB 2HJFA 1U8QB 3GJFB 3H9HB 4OFDA 3X14B 4I77L 2GSGA 2CRYA 4MWFA 3H3PL 1CXLA 2W9EL 4KK9C 1C5BL 1U95B 1C12A 1QFUH 4M6NL 1G9NH 3B6SA 4HIJA 4WFED 1B0WA 1U42A 1EJ6A 4HK0A 3SKMA 4NQCE 5DHVH 1FN4A 1XFPA 1VKXB 2V7HB 2ORBL 4QXUL 4XHJC 4GSDH 1NUNB 2K3TA 1JZ2A 3NFNB 7FABL 2D3VA 1KLGB 4HWNA 3VWJC 3VWKC 3Q48A 3V7AE 1HHKB 3ECBA 1S9XA 4PJ8B 1BQUA 1BP3B 5E00A 3IDNB 4I3RL 3MX0A 4NWTL 5FDWA 1DANU 2DKSA 5I18H 5T3ZH 3IJHA 3L5WA 5TE7H 4RGOH 1QFWI 4U7MA 1X44A 2ID5A 3DVNA 2F53D 3FB5A 5C0BB 3UP1A 1HQ4B 2B4CL 2FEEI 5IWLA 1K2DB 4PGCA 3M8OH 5E1AB 2NY4D 4WHYH 1VHPA 4HWZB 1A1NB 1CFTA 4XWGH 5ERWA 4BZYA 4OIIH 1SEQH 3U9UA 1FORL 4HUUA 5DJ8B 5H37G 4H1LG 4HGKC 3NCFB 2NY2C 1H3WM 4YDLC 3BOVA 1VGKA 3ZKND 2V2WA 4CADA 4O4YH 2FJFA 4JFOB 1CFTB 4K71C 1MJJB 3DRQA 4JZJB 4K9EC 4L5FL 1AR1D 5E8OB 1NMBH 1PKQE 1Q9KB 1V3KA 4KHTH 4DKEH 3KS0H 3FB5B 4UDTA 1HNGA 4E0RB 5MENB 3O9WC 5E99H 5C6TH 4NPYA 2BNQA 3Q3GA 1FVEA 1O5DT 3U4BL 5J12C 5L9DH 4BQ9A 5BRZE 3O45A 1PVHA 1XGTA 3IJHB 1XH3B 5GGTA 2FZ3A 3JTSB 3AUVA 1KSRA 2XKSA 5E00B 3U7YH 3TPUB 1RIUL 3RVXD 1QUNA 4NQCD 2BRRH 3FRUB 4R0LB 2GW5A 3KPNB 3OBAA 4HKZB 4JPWH 5K9KB 5C0BD 1KYOK 3RVWD 4XP9H 3SDXE 3SDDA 1SYVA 2G75A 2BZDA 3VXSE 1FVDA 2AJUL 3QXVA 1XR8B 4G8GE 2ADIA 2EH7L 2HMIC 4M7ZB 4JFDE 2WUCL 5KBNC 3QBTB 2FX9L 3S5LG 4FN0A 3NN8A 1B0GA 4TSAL 3GMPA 1FL5A 1S9KC 2G5BA 4B0MM 1Z9SA 4O02L 1CE1L 1FL3A 3I6GB 3ZTJH 3CCHA 3FFDA 4G80A 1KTDB 1K5NB 3B8YA 5FCUL 1AXIB 5HVHC 2R1XB 3MRGA 4QCIA 2GT9B 3MGOB 4MCYA 4P9HH 5T3ZE 1KJ2L 3LV3B 3GIVA 3I3EA 3WJJA 2YPLD 2ADJA 1JTPA 1RI8A 1UWXH 5J1SC 5JOPE 1OOAA 1BWMA 2EDNA 3ALXA 4Q58C 3LEVH 1O0VA 2HKHL 1CTOA 3QG6A 2Z31C 3O6MH 1H0DA 4NRZB 4X8XA 4G8FA 5ISZE 4KRPB 5D9SA 5CSZA 3LQZA 4XT1C 4NHUB 3G08B 2RAMA 1XF2A 4PJFA 3V6BR 1HHJB 3DXAD 2JB5H 4QGYA 4TUOB 1H8NA 2KPNA 5E8DL 5C0EB 4YHZH 3DJ9A 3OAZH 2PR4H 3WIHH 3LHPH 5SX4I 4NBZB 5HVGB 2YRZA 5F6HI 4FP8H 2K9UA 2BY0A 2X41A 5I15H 4KJQD 5IG7B 4X9FA 4M43H 3U46B 4MAYD 2X1QA 3NIDE 1IGJB 2GAZB 2E7BA 4HAGA 4MQTB 4NZJA 1EX0A 3PJSB 4EI5A 1BBDL 1CFSB 3NABL 4U0RC 5GGQH 3NIFE 3VFGL 3OJDA 1NKOA 5B39G 1I3GL 1S7VB 4U6TA 3H9SA 3P40A 4NC2B 5CUSH 1IAOA 2HN7B 3QWOA 5FF6A 5IUSA 1MQKH 3WIHA 2PTTB 4LCIH 1WJ3A 4QYOB 1UKTA 3B3IA 4AG4H 4RMWA 4LVNC 1QA9A 4HLJA 5JPNB 5BVJB 5BV7L 5KS9F 1LNUA 4M1CD 5CD3A 3G5ZB 1FLRH 3H9SE 3JZ7A 1MOEA 3QIWA 3T3MF 3PWUA 3EOYG 5F7DA 5C92A 4G8GD 4TOYL 4HGMA 2GCYA 2C26A 2A6JB 3KPLB 4Z77B 5FB8A 5EU3B 4DOHB 4DUWA 4QHKI 2VQTA 1E28A 4JHZA 4GG6A 1VGEL 2WW8A 3K4AA 1H8SA 4HX1B 1U3YA 4MXWL 4TQEL 2IH3B 3D85A 3GJFK 2FYYA 5F7KC 4XZUA 5JHLL 3GMNB 5C9KA 3CFIC 2OR9L 1P7QA 1N3NA 2ZG1A 3WFZA 4H20H 3SKUD 5JZ7C 3C8DA 4BSWA 5E8NB 5HPOA 3SDCD 3RJDA 4POZC 3CVIL 5IBLC 4HPOH 5FUOL 2EIZB 3STLB 1RIVH 4KJWD 4HPYL 1MCCA 2GK0A 3B9KC 4XPGL 5L8LB 2DJSA 4FRWA 5CLWA 4OGAC 5DFTA 5T5FH 3BXNB 1DBAH 5DVMA 1MI5A 1M4KA 1MCSA 2IANB 2DQHL 3QH3A 5FK9A 1BFOA 1R3KB 5FGCB 2YA2A 4N0YL 1D5MA 4YX2H 5HD8C 4MDJB 1AGBB 2E8ZA 2FATL 2NXZB 4OGAD 3FQWA 1UCBL 1M7XA 2A1WH 1OWWA 5JA8B 2JE8A 4H1LA 1E6OL 4OM1H 1CICA 2V6HA 3NIGF 3MLYH 4NO2B 1P84K 5CHNA 4PJEA 2D0HA 4NKMA 2I07B 4X6DE 1N6QL 1KCUL 1YN6B 3AXLB 1UWGL 2DLIA 3HR6A 3DARA 1FIGL 1XT5A 3G5XA 3OKMB 2X7LB 1QP1A 3GMQB 4OCSL 4FNLL 2HT3D 1EJOL 5E4EC 4PJEB 1F02I 4HULB 1A7QH 3MRLA 2NW2B 1SHMA 3GSXA 1ZHNB 5FOBA 2N7BA 1JJUA 3EDJA 3W5NA 5AZEH 2X4RA 4LPYA 4DGYH 1OLZA 4QT5B 1B4JH 5F96H 3F7YB 5AAMA 2LQRA 3QH3B 1U3HA 3FFCD 1JPSH 1DR9A 2G60H 5IW6B 4PJ8C 3MRMA 3HMXH 2VLKD 1HEZA 3VD5A 2PYFA 5FA4B 1UQSA 2DQDL 1BVLA 1J1PH 3CMOH 2UUDK 4RAUB 1F4YL 5KW9L 3ZT5A 5DS8A 5ACZA 1SVZA 1DN0B 5FO7B 3MLTA 4H88L 3ARXA 4PP1C 2R2CA 4IBLT 6CGTA 4NKOB 4OUUB 3WFEL 1N6VA 3PDDA 2D7OA 3FT4A 2NX5E 2XN9B 4XNYL 4DK6A 4Z8FL 1EO5A 2FSEB 5E6ZA 2R0KL 3V5KB 3DMMD 5DMKB 1U92A 1M7DB 4OD3L 2VWEE 1CGVA 1QNZH 3GIZL 4UDUA 5FHBH 4L8SC 3OXRB 5DJ0B 3HPLA 4HEPG 1RVFH 3KHQA 1F4WL 3TIEA 3WUWG 9CGTA 3QIUC 3BESR 4QHUA 5TDPB 3VRJA 3FB7B 5KOMC 5CP7B 4OUOA 3WIFB 1X4XA 1G0XA 1FV1A 2YR3A 3DHJA 4CNIB 4ZUSA 5JPNA 2JTDA 2UYLA 3UTPD 5J12B 1G0DA 3AXLA 3UAJC 4C56E 4Y4KD 1CXIA 3VXTB 1WAAA 1B9ZA 2DLHA 4OZFG 4UT7L 4N8VG 4KHXL 3QUYA 5EIVA 1BD2B 1OSPH 2NY1D 3CVHB 3WHE0 5D7LB 4YK4C 3O2WH 5TF0A 5CZKA 4Z7VB 5I9QB 3SKJH 4UIMB 1FO0A 3PJSA 3WO4C 4ZPVA 4Y0GA 2ZSVA 1IZJA 2PW2A 1IGJA 3RVVD 1YEDB 3B5HA 4POZD 1WAAE 4U6YA 3RGVC 5IFAL 5JOFB 1QRNA 1KBGL 4OD2A 5EU5A 4PP2A 4P2RE 5C0CB 2W60B 3RTQD 3V6ZA 2XZAH 3L7FB 5AWNL 3ULUF 4YHLL 5C0EA 3HNTL 4P57B 2XIDA 1CIDA 2Z8WC 3HZKA 1XF2B 3LQZB 5HYJD 4QOKB 1RJZB 3TYFA 2DQJH 1H0DB 4NRZA 4UIKH 2W9DH 3O4LB 5EWIH 4I9WD 1RZKL 2ESVA 1SBSL 5DD1L 3N1FC 3MCKB 3CH1B 4NGHH 1I7RA 3NCBB 4MA1C 1X7QB 4H5SB 2RR3A 4X4YA 4OF6A 3HE7B 3P11H 2ED7A 3RY6A 3BWUC 3MJ7B 3RPIB 3QPXL 1PW3A 1FNGA 2DI8A 4CKVX 4QRQA 3TH4T 4ZO8A 4DEPC 3P30H 2NTFA 2GT9A 5B4MD 1JV5A 1V7NH 3MZTA 1C5DB 4GT7A 4MA8H 4O2FA 5CJXC 1D6VH 2WLZA 4Y5XA 3V0WL 3D25A 4G80B 3RWEA 4KRPC 2ESVE 4IIQA 3ARFA 4WWKC 1CGSH 1IGYB 3WLWC 3CDGA 5F70A 3VG9C 4YBLC 3EYUH 5BZDA 2M1KA 4ODXB 1G7QA 3SEPA 5GRYA 4AIXA 1R3HB 1JIBA 2PO6A 1CXFA 3GRWL 3TZVA 4P4KC 4XAKE 5HJ3B 3NTCL 5IB5A 3P9WB 5DFVC 1CL7H 4MNHB 1SYVB 3BP6B 4XAWH 4CJ0A 1INQB 4HJJH 5I2IA 1U6AL 5KVFH 3U7WL 2HLFC 4R4FL 5I0ZA 5C09D 4DTGH 1UXSB 3SDXB 1RZIB 2FLRT 1HSBA 4QRPA 5DRZA 4JY6A 1YQVL 2DBLL 4OBRA 4M93C 3QFJD 3ARED 4Y19A 4YHIA 3K46A 4KUCD 1X6LA 1G7LA 2D7TH 4X6FB 1GPOH 1MHEB 2NXYC 3PABA 4PS4L 1U58B 4HC1A 2A9MH 1VFMA 3U6RB 5C71A 4ODSL 4JAMA 1MCOH 5HYEA 4OZFB 2NNAB 4KDTA 4X4MA 1M71B 2AK4B 5GGQL 4HUKB 2RQ8A 3A67H 4V1DA 3DI2B 2A6DA 3IU4H 4QRPE 3SGJC 1E27B 2NXYD 2H8PA 4JY4A 3V5DA 4NSKA 4KZEH 1MFDL 4RFOH 4LSRL 2ADJB 2HRLA 2VXVL 3REWA 2VDKL 4LCIL 1QACA 1E4XL 3GSNH 2QBWA 4L29B 1A4JA 1OPGH 1HXYB 4MCZA 4JN1H 1YUHA 1C08A 1K8DA 4NQCA 35C8L 3CCHB 4PGCB 5DEFA 1CDYA 1OAQL 5KG9A 1E6JH 1GC1L 3UTTE 3JBG7 2A6IB 4N5UA 3S5LA 4TOYH 2ILLA 3MOAH 4N0RA 1RZFL 3IDUA 4P46D 1HHHB 4ZUWB 4XCNB 5SWZD 1JGEA 5J0BA 4Z5RA 1J18A 2UZIH 5C0AB 1NUGA 2M8XA 3E3QC 1WZ1L 2W65B 4M7LL 4NQUA 1VGEH 1F6LL 4Z7UF 1P7KB 4DN4L 1IEAB 3B9KB 4PB9L 3O3AB 5JHLH 3PGCB 4NZRH 1SVCP 1IC7L 4FZ8L 2ZUYA 4HLZH 8FABB 5GZNC 1B0RB 3W39B 4MLIA 4HS8L 4H20L 5CBAB 4XCYA 1JYWA 1TFHA 2D31A 3HTLX 4UQ2B 3GHBH 4K7FB 2WIIB 4KI5C 4A2LA 8FABA 3BKYH 5FGSA 3ZT7A 5D96C 5TE7L 3MR9A 4LVHC 1NGPH 4OZFH 3WV0A 4FXGB 5J06A 4JFFA 4Q9CA 4JHAL 5D2NB 2EDYA 3SDAB 3ABZA