4M1GH

Structure of murine igg2a a27d7-fab in complex with vaccinia antigen a33r at the resolution of 1.6 angstroms
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
216
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFSLTDYGVSWIRQPPGKGLEWLGVTWGGGTTYYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAKHKASYNGLDYWGQGTTLTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Murine IgG2a A27D7 Light chain Fab domain
publication title Structural and Functional Characterization of Anti-A33 Antibodies Reveal a Potent Cross-Species Orthopoxviruses Neutralizer.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2013-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m1gH01
1UM4L 2NYYD 4LKXA 4HS8L 5E9DD 3V8OA 2HH0L 3KG5A 3HZYB 3SCMB 3BESR 2YD8A 2W0LA 4A6YA 4HK3J 5C0BD 5A3IC 1FFQA 1CU4H 3WS6C 1JZ8A 4LHUG 5IFHH 1ORQA 5GGVH 4OIAA 4M1DH 2EXYD 5FYLH 4A6YB 1RVFH 4DGIL 5F7WC 3EYOA 1ORQB 1J0KA 1OM3H 3BSZL 3LD8B 5LAXA 1YPZE 2PO6C 4AZ8A 4K23L 4M7JL 5KVMC 4XC1L 1AXSA 4NUJA 2V17H 4HWBA 1EHLH 4YDLB 2KPNA 4PY7A 5LAXB 4GT7A 4UU9A 4MQSB 5C3LD 2EDXA 4PRDA 5C08A 3CSGA 1AXSB 4U49A 2VKWA 4G5ZL 4NUJB 1YMMB 1GRWA 3GHBL 4JFEE 3ROLA 4UU9B 4XNUH 4PRDB 5C08B 1CWVA 4R7NA 4PJGF 1CFVL 4HIHA 4JLRA 1YEFH 4OCXH 4YPGA 2VWEC 3ROLB 3U46B 4TSBH 4TULL 3T0VA 2NY7H 3ZE2F 2GTWA 4PJGA 4U0QB 5CEZD 4R7NB 4PRPA 2IAMD 4HIHB 2FBJL 4JLRB 3IDYB 4YPGB 4RISH 2C1OA 5F7EL 2XY2A 4LPTA 5JNYA 2HRPL 1U8HA 2WNGA 4PRPB 1W72A 1NMCC 5C0ND 1VGEL 1TZGL 3EFDH 2DDQL 2FHFA 4LGRB 5JNYB 5D96B 3JV5A 5D9SA 1U8HB 1W72B 5DYOA 1MQKL 4ZQKA 4HJJH 4P2YA 4KXZH 3GMRA 5FKAA 4NHUB 3VRJA 2R2HB 4JDTL 3CDFA 2YA0A 5DYOB 3GZKA 4NQCA 1EEZA 4LCIH 4TTDC 1IM3A 1NCCL 4POZC 5JOPE 5IOPA 3QNZB 3GMRB 4ZYKA 1P7HL 5FKAB 3VRJB 4X6CF 4XAWL 4F2MA 2AP2A 3G04B 4YDKL 4GG8A 1EEZB 4NQCB 4RFOL 5JO5A 3MRPA 4XWGL 3CPLB 1UM5L 2VAJA 4X6CA 4ZYKB 4YAQA 4F2MB 1FL6A 3DYPA 3TH4T 3ZYOA 2EDKA 4GG8B 5JO5B 3MRPB 5IBTH 3T65A 2P48B 2VTFA 4F15C 4F33B 1KCRL 4YAQB 1MFCH 1FL6B 1MY5A 2QSVA 3WDHA 5LQBH 1O0VA 3UTSE 3T65B 3AS2A 3GNMH 1FC1A 4XNQA 4OF3A 4Z0XB 5DK0A 4LGPB 3FMGL 3FHQA 3QI9D 1IAIH 3FT2A 3QO0A 3SBWA 5FGRA 4QHUB 4LGSB 3OJ2C 3RHWK 4FXLA 3DHMA 4DQOL 5E8EA 5ETUB 5DK0B 1FLRH 3B83A 2YR3A 4P9HL 3ARRA 2EIEA 5F6IC 3FT2B 3QO0B 4URTB 1MCWM 4NQDE 5E9DE 4NQUA 2VOTA 3ARFC 1W72H 5DGRA 1AGDA 2VZ1A 4CVXA 3TT3L 5DD5L 2BP3A 5F70A 1M7IB 2LU3A 3TLRA 4PJ8C 2R69L 4RMWA 4Y5VC 1WV7T 1DLFH 4OGAD 5IB2A 1AGDB 4KY1H 3DXAA 5D2NC 4CVXB 4YDVA 3O4OC 5BMFL 2GSIA 3RHWF 3AS3A 2UY6A 4D9LL 4JFPA 2NX5B 4XTRD 1K3ZA 5TGBB 1U58B 4MXWH 1SEBA 5JXEC 3T2NL 3DXAB 4YDVB 3GK8L 1INQA 4NHCL 2EZ0C 3ZTJH 4JFPB 1ZVYA 1SEBB 3WFEH 4N0RA 1INQB 5BOPA 1U8NB 3MJ6A 4YBLB 1BAFH 4Y19D 1T1XA 5EB9A 3EJZD 3QQ9C 3U83A 1KPRA 3MRBA 2ADFL 1YEIL 1T1XB 2VMFA 1CGSH 4G3YL 1KPRB 3MRBB 4ZPVB 4UDTB 1H15B 3MLUH 5HGGS 1DQML 2E7BA 4ODSL 3LQMA 5CEZE 1ZXQA 3GBMH 3KJ4C 5I1AA 4FQIH 4H5SB 1NMBH 3CX2A 4P23A 4K8RH 2Y6SD 4XC3H 3DV4B 4OZHE 4HG4J 4DN3L 1J12A 3KPLA 5I1AB 1J18A 4L5FL 1RU9L 1F4XL 4P23B 4Z7WA 3V52L 4AQ1B 1OD9A 2CPCA 3E6FA 4HWNA 1KBGL 4YHIA 2DD8L 4Z7WB 1QG3A 2RHEA 1F90H 4LOUD 4HULB 3CU1A 3E6FB 4F7CA 1CCZA 2ICWA 2JJSC 5TDOA 2CK0H 1TCRA 3FHAA 4YHIB 3LEVL 2YD3A 2MFNA 1OAQH 4NC1C 1ZHNB 3W5NA 3EAKA 4FXKB 4PJ9D 2AEQL 3NMEA 4YFLF 4F7CB 5TDOB 1E0OB 1TCRB 4RAHA 4OGXL 1DVFA 5GGVL 4M1DL 3KLDA 5FYLL 5DRXA 1UWXK 1V05A 1G7JA 3EO9L 4QHMA 1DVFB 1CFBA 4IDJH 2UWEE 3VWJD 1D7FA 4XP9L 4OCMC 1CDCA 5DRXB 1QFUH 4PGBB 4HMCA 4J6RH 1G7JB 4HD9A 3STLA 4QHMB 3V6OC 5I8EA 2BRQA 5A2JH 4TSCH 2BOBA 1BM3L 1U6AH 1LGVA 3STLB 1AO7D 1KFAH 3MRDA 5B4MD 3TV3H 3WHXA 3K2UL 3SDYL 3BEWB 5LXGH 1QLFA 2GJ6B 1DJSA 3D2UA 1YEFL 2H9GB 3MRDB 3MODL 4ISVA 3WHXB 4RGOH 2DBLH 1PJ9A 3H42H 1BZQK 4PJCA 1QLFB 3WMSA 3D2UB 3QIWA 2NY2D 2D9QB 2YKLL 3ESUF 4PJCB 1OD7A 2Z31D 3QIWB 1CICD 2Q20A 4KHTH 4G6JL 4Z7NE 2YD9A 1RHHB 1NFDF 2IG2H 4K7PX 1JGVH 3TIDA 3REVA 1TVDA 4OCLC 1SMAA 1V3JA 1WWBX 4W68A 1NFDA 5GS0D 4YC2B 3SEPA 3IDJA 5CLTA 3TIDB 5EIQA 1GC1C 3NCCB 1UEMA 4JFQA 1Q1JH 1NFDB 4JY4B 3SO3B 3IDJB 2VH5H 4ETQA 5D7KE 2YEZA 3WNNA 4JFQB 4XRCA 3JWDC 1KPUA 1U8JA 2DI9A 5IJKC 5JR1L 2WBJC 1NFIA 4XH2A 2YBRA 5FHAL 1ZHKA 1PKQB 1R3IL 2YEZB 4N1HB 4XRCB 2Q87A 3QPXL 1U8JB 3GSQA 4JFFB 5LQBL 4KK6C 1NFIB 4XH2B 1L0XA 2HKHL 3GNML 4WWID 1I1YA 1ZHKB 4HC1A 3IAGC 3HC3L 1YEEL 5JW3L 4ZAKC 1HNGA 5C1MB 3QHTC 4ZO9A 5DC9B 3GSQB 3MLPA 4O5LH 4FQJH 5GPRA 3FQXB 1I1YB 1S9KC 2PF6A 1TNNA 5C08D 4DWHA 3WS6A 4DW2L 1UWXH 2CRZA 5I9QC 4DKEH 1FLRL 1LO5A 2PW2A 1IJ9A 4YBQC 4WEMB 3FJTA 4UUJA 5HPMB 5KS9E 4AIXA 4I0KA 1DEDA 1LO5B 3IETB 2PW2B 4GBXC 1F42A 4FFWD 5JMRA 3VDAA 2O5XL 2PO6A 4PRPD 4WWKC 1XEDA 1IILE 5B8CA 1VHPA 2DYPA 2PO6B 3R8BB 3OPZL 4NCC2 3SDXB 2VXVL 4KI5F 4MXWL 1DBJL 3SQBA 4HF5H 4ZSOE 3KPRA 4NFBA 2DYPB 4RIRA 4NWTH 1VERA 2OI9C 5IB5B 3WFEL 3KPRB 1F3DH 4ONHA 2P49B 4WY7H 4RIRB 4HUMB 2A2QT 1GGIL 3EKCA 4LVOB 3DWTA 5E4EC 1AO7E 4I2XB 3KPTA 4NQCD 1ULVA 2CRIA 2WINA 2F5BH 2G2RA 2P7TA 4QXGL 2WP3O 4ONHB 3UCRA 5I1IL 3RU8L 1WQVT 2NY6D 3FZUC 1TETL 2Y72A 5F6HJ 1CGSL 4ZDHA 3V8CA 2B20A 2WINB 3CSBA 2OZ4H 4RMUA 3S8WA 2P7TB 2G2RB 5CGTA 1ZLUK 1MFAH 4OQTH 2VDML 4NKMA 4JKPH 2EO9A 5BZWB 5C92A 1G6VK 3QWOB 4ZUUA 4I1NB 1ZTXH 2ZKHH 4NKMB 1UWGH 1T80A 3RTQC 5EU6E 4ZUUB 1TVBA 1QR1A 4LDLB 1IGFH 2X89A 3QEUA 5AG9A 1FNHA 1TVBB 1QR1B 1F90L 4P2QA 3SKMA 4PJHA 1RUAL 5CUSH 4OKDA 5ID0A 4KWUA 3L6FB 2A9MH 4WNQA 3P40A 1R3HA 3OAUH 4P2QB 4FP8L 4PJHB 4RX4A 2YOCA 5ID0B 5FAAA 4WNQB 4XI5C 1CFSA 1R3HB 5KSAC 1V7MH 3H3KA 4WUUA 2B0SH 1KEGH 4H1LH 4ZUWA 1CFSB 5JTWA 3PWJA 4JHZA 4JY5H 2NY5C 4WUUB 5TE6L 3O2DH 3RBSA 2X44D 4K3DH 4ZUWB 4V1DB 1UG9A 2PR4L 2J88H 1KIRB 4TSCL 5FHBH 3U4BH 1U6AL 2P42B 1D6VL 2AJVH 3I2CL 4KKLC 4NN6C 5LCVH 5F6IB 4DCQA 3OKNA 2CDGB 5DGQA 5C08E 4Y2DA 3D3VA 4PJ8A 4Y5VA 4PV9A 1IZJA 1DN0A 1DBML 4DCQB 3OKNB 5D2NA 3G9VA 5I0ZA 4JRWA 4N68A 4U33A 4PJ8B 4Y5VB 1GGCH 1DN0B 2W38A 4YHLL 5D2NB 4IRJA 1F8TH 4GSDH 2HT3C 5MEOA 1FIEA 4PRPE 1BWMA 2R29L 5IEHA 1TQBB 3FRPA 3ZE2E 5MP6H 2ZUSA 4IRJB 3K80A 3UC0H 3LRHA 4WEUD 3NIDE 4R26H 5MEOB 3MV8B 4DGVH 3BP6A 1SJXA 5D71H 3V7AG 4NDMB 1WZ1H 1JGVL 2J8UF 1I1FA 5EOQH 5GRZA 1SHMA 5EA0H 3BP6B 1JPST 2RJMA 3V5DA 3I75A 1J1XL 4JKMA 2AEPL 3AVEA 4OSUL 5GZNC 2AGJH 5J12B 3EDEA 2DS4A 2NCMA 1I1FB 4YIQA 4OCSL 5GQBA 3V5DB 3I75B 4NQCE 4LQFH 5CJXC 4EUPG 5F21B 5IVNA 3GFUA 1MCPH 2X70A 5C7XL 4YIQB 5HI3C 4RWYH 1AI1H 1PLGH 5JPNA 4I48A 1DVFD 4M03A 2CH8A 2R0LH 3BDBA 1A7RH 5D1QC 2AJSH 5H2BA 5JPNB 4GFTB 4I48B 1MRDH 3PGCA 1GYAA 1HHKA 3S36L 2JJSA 4LVEA 5H2BB 4QXUH 3KPSB 5T1DH 3PGFH 3PGCB 1HHJA 4FQLH 4FQXC 1HHKB 2R0WH 1AJ7L 3CFEA 1HHJB 3CXDL 1ZGLB 2FSEA 4F7EA 4Z95H 4JRYA 2YD1A 3D2UD 3CFEB 5EH1A 4PD4J 4LSRH 2FSEB 3VI4F 4L9LC 4F7EB 4JRYB 4X9GA 3QJHA 4HQQL 4ODUA 2Y1VA 1IGIH 3F5WA 2V5YA 1JMZA 1MRCH 1WWWX 3M17A 1D9KC 3DUSA 3QJHB 4ODUB 1MCFA 2IBBA 3DXAE 2ILLA 3F5WB 3NABL 1NBYA 1XIWC 3M17B 1S8DB 4OKVB 5EN2A 2Y23A 4YXKL 1BZ7A 3MBXL 5EZIH 2D7QA 1NBYB 4JG1H 3W11C 1CN4A 2NXYD 1X4ZA 3KPPA 5EN2B 4GQPH 5HHOA 3DROA 2VZVA 1BZ7B 4Z7VB 1LE5A 3IU4L 2F5BL 4RWHA 5B21A 3KPPB 1AY1H 5HYSG 4U1IA 3UBXI 5HHOB 3VG9C 3DROB 5E56A 1LE5B 2OZ4L 1MFAL 1I9RH 3LQZA 4WHYG 3GGWA 4GMTL 4OFIA 1XCTA 4S1QH 4U1IB 1CLYH 4GW1A 1TMCB 1UACL 6FABH 3L1OH 3LQZB 1CIUA 3GGWB 2XA8H 4GW1B 4GAGH 3HMXA 5J1TC 1SBSL 5L0QC 3G5XB 4S0TD 1IGFL 4BQ9A 2EIZA 3IAQA 2BVOB 4KJQC 1I3VA 4ZOCA 4Z7WE 3NACH 1IC4H 4G9FD 5FFLA 1IBGL 4HBCL 2EIZB 3Q3GA 1Y18B 4HUXA 2Y06H 3C6SA 2Z8VC 4HPYH 1QFWM 5FYKU 5HHMD 1A1MA 2EYRA 4F58H 2WBJA 3ZTNH 2ZUUA 3LCYA 4P48A 3OAUL 3CMOL 1ETZA 3KPOA 3QWRA 1Z9SA 4HUXB 4HAGA 4ZS6D 1P7QA 1A1MB 2EYRB 2EICA 2WBJB 4G7YL 1ETZB 5J3HD 1P7QB 1F4WL 3CFJA 4KDTC 3HFMH 2FEDC 1KEGL 2BVUA 4JFYA 2G75A 3BEVB 1GHFL 2DYPD 3EW3B 1OW0A 2D7MA 3O2WH 4OLYH 3OR6B 1E4WH 3K81A 3CFJB 3O2DL 4UT7H 1AGEB 1J88A 4JFYB 5D7JC 2FH6A 4MXVF 1JYVA 2J88L 4I5BA 5FHBL 4KI5D 3U4BL 5I9QB 2VITA 1GJIA 5CMAA 3TYGH 3EHBC 1TJGL 3O3BA 4I5BB 3HRPA 1ZAGA 1KIUA 4JAMB 5MEQA 1B0GA 4G7VL 2VITB 3MLVL 5CMAB 1PZ5A 5D7LA 4UOJA 3RWHA 3MCLH 3O3BB 1TJIH 1CLCA 3ELAT 5MEQB 1B0GB 1MHHB 4U7MA 3TJEH 3M45A 2EE6A 1PZ5B 3RWHB 3HMXH 3HR5A 5IBLD 4W81A 4PJCE 2DRUA 5DSCA 3I50H 1GC1H 4AMKH 1S9VA 1DANU 1Z5LA 5MP6L 1F6AA 3HR5B 5E5RB 2QJDA 4X99A 2FHCA 4BJLA 4R26L 2R2EA 1J0HA 3SDAC 4R0LC 3RGHA 1S9VB 4Y16D 1Z5LB 1TIUA 4HIXL 3BGFB 1MELA 3DNKA 1CVSC 3JWDH 3PP4L 1F6AB 4X99B 1WZ1L 2X89D 2R2EB 2A74A 4XBEL 5HD8C 5E4EB 3WD5H 1Q0YL 2JJTA 3JVGC 4MA3B 4P2QD 2D7OA 2A74B 3L7FA 1NFDE 5T1LA 2WWMC 2FB4H 5HI4D 1CL7H 1FNGA 4J3VA 2FWOA 1G7HA 4RX4D 3L7FB 3CUPB 4XMKH 3RTQA 5ACMA 5T1LB 4JN2A 4NBXB 4MJ6B 2VLLA 1FNGB 1CDYA 5AWNH 2FWOB 2R0LL 3FO1A 3T77A 4KV5F 5KJRL 3RTQB 1TTUA 4WUUD 4JN2B 4JFFE 4AM0A 1Q72L 1FSKC 2HA1A 1MRDL 2VLLB 1ADQA 2DTMH 3VG0H 3FO1B 3RWGA 3T77B 5HSFA 1FRGH 5EORL 5ADOH 3N50A 1LK2A 4QXUL 4JPVH 4AM0B 3GDBA 4PP1D 4FQLL 3C9NA 3OAZH 3RWGB 4ENEC 3AFLA 3VH8G 4H8WL 1JTTA 1CI5A 5FYJU 3MNWA 5BW7A 3DUUB 1L0QA 2ZCLH 4OV6F 1A2YA 5FYJH 3C9NB 3O2VH 4Y2DD 2IBGA 3VH8A 5KSAA 2NZIA 3D3VD 5DR5L 4TNVF 1UADC 1E28A 1MCIA 1R5VB 2GUOA 3MNWB 4XZUA 1Y6KR 1M7DA 1A2YB 1VCAA 2FGZA 2AW2A 5KSAB 1KEML 4BM7A 3WFHB 1E28B 2VUYA 5CCKL 2HFFA 1IGIL 4IRJD 1KXVC 4XZUB 1M7DB 4Z77A 3TBWB 3J8F7 1MRCL 4PRHA 2CJUH 1BREA 2HFFB 1R6VA 4PRHB 4Q9BA 4QTHA 1AR1C 1NANH 4BUGA 1SEQL 2X4RA 5JHDA 3MYJA 2R4SH 3KPRE 3GI9H 2F54D 2VLRA 4UZGA 1MEXH 4QTHB 2NY3C 5TQ0H 5GRVK 2W0PA 4I2XE 3LKNA 2X4RB 1GVIA 4PTUA 5JHDB 3MYJB 2VLRB 3O9WC 1QSEA 2EIBA 3BDXA 3MA9H 5TDPA 1NCWH 4I3RH 5GSVA 4PTUB 1T7ZA 3VCLA 3WLWD 2GCYA 1ADQH 1QSEB 1BQSA 5L9DL 1XF4A 5TDPB 4U1NA 5E6IC 2E3VA 4QLRA 5DLMH 2Q3ZA 4JZJC 5GSVB 3HPJA 4N9OB 4YHPB 1RI8A 3VCLB 2GCYB 2XWJA 6FABL 3U9UA 1XF4B 3VA2C 1H3UA 4HIJA 3S5LA 1Y0LA 3UTPD 4HMDA 3HPJB 3BRDA 3PWLA 4DVBB 3U9UB 4HIJB 1KB9J 2E7MA 3L3GA 1NLDH 3D87B 1Y0LB 3S5LB 1T1ZA 3PWLB 1IC4L 1JYWA 4J4PA 4MHHG 1J8KA 3D0LA 3L3GB 4EI6A 1F3DJ 1PFCA 2NY5H 3GMQA 1T1ZB 1K9TA 3CC5B 1OARH 4F58L 3ZTNL 4P2QE 5FYKL 5JXAL 2PTVA 4PJHE 3D0LB 1W8NA 4JRYD 4BH7A 4NQEA 4EI6B 5CZXC 5D1QA 3GMQB 1A9BA 2DQFB 4HEPG 3GSNL 4M8QA 1CD8A 1MJJB 4DFIA 1MPAH 4BH7B 4NQEB 5D1QB 2X42A 1A9BB 2EH8H 3EZ8A 3IDNB 3LMJH 4Q97A 1MCNA 2DQDL 4IEFB 3RKPA 4WUUE 2I25N 1ZSDB 3O2WL 3FT4A 4Y2OA 5F89A 3LPFA 4UT7L 3BFOA 2X4OA 2NW2A 3G08A 3QRGL 5DHYA 3DGGA 1CT8A 3IU3A 3NTCH 4QO1A 3ULUF 5EOTA 5F89B 3H7BA 3O6LH 3LPGA 2I5YL 2LU4A 2X4OB 3EJYC 2NW2B 4MQXD 3G08B 3SJVA 3Q6GL 3ROOA 3F58L 1DQJA 5DHYB 4NBZB 3DGGB 1CT8B 3IU3B 4YHKH 1A02N 5I6XC 2EDQA 5EOTB 2ICWI 1E4XI 1N4XL 3H7BB 3HI6L 4Q9QL 4L9DA 3GHEH 1SVZA 3MCLL 3ROOB 2CLVB 4S0SD 1D9KA 3MMEA 2Z9TA 4MJ2A 1LO0H 4KJWD 4FFZL 5D2NE 2M1KA 3RDTD 4LSSH 1TQCC 3N06B 1D9KB 4YFLI 1WITA 4N1EA 2A77L 1GC1L 3MMEB 4U3HA 5M95B 4AMKL 1AC0A 1XIWB 1NGZA 1JYXA 5T3ZD 1NCAL 4HWZA 4KPHL 2VXSL 1BQHA 1NGZB 3TIEA 1B4JH 1IC7H 8FABA 5JA8B 5LGHL 5F7LB 1JNHA 3RL2A 1BQHB 3MGTA 3V7AE 8FABB 3NIGF 4NRXA 3PDOA 2D2OA 1ZK9A 3VG9B 4JO4L 4Z7QF 1JNHB 3RL2B 3QWRD 1CGXA 5HYJA 4NJ9L 1TENA 2X7LA 1H3WM 3PDOB 4NRXB 4QNPF 2DKSA 1A4JB 1AFVL 4XP6H 1Q9OB 1AGBA 1FIGL 2KUTA 1PX4A 3DOSA 4QRRA 5HYJB 4OD1H 3P9MA 4E41B 2X7LB 5FA3A 3CH1A 2D7TL 4UBDD 5HGAB 3A6CH 3BI9X 2DTML 4I9WD 1KJ3H 3HI5H 4DOHB 4QRRB 3Q1SH 5L0QB 2VABA 3P9MB 5FA3B 3CH1B 3UTPE 4CVUA 3H9SD 4JPVL 5EU5A 4PV8A 1K8IA 4JHWH 1UFUA 5HDOA 2A1WH 1GAFL 1FH5L 3OKKA 3WFZA 4NFCA 1L4IA 4F3FA 3S97C 3BVNB 5EU5B 4PV8B 1Y6MR 3CLEH 1K8IB 1A6PA 3TFKD 3O2VL 1FNEA 5MI0B 3C87A 4F3FB 2VSDA 4KMTH 5D7LD 5IQ7L 3KYNA 2X41A 2HFGL 5FF6A 3AXLA 4JRYE 2QQNH 4D94A 4PP2A 1G9MC 1X4XA 4NKIH 3U82B 5JUEL 1UGNA 5F88B 1LDSA 4PP2B 4CN4A 7FABH 5C2UB 2CJUL 1OPGH 1FN4A 3V6OE 1E4KC 3MYZA 4LU5H 3MROA 5CBAA 5DUPH 5GHWL 3MRLA 5SWQA 2QSQA 1EAPA 1FN4B 1IFHH 1JUFA 3QB7C 4M62H 1R5IA 4QRSA 3C60C 2R4SL 3SGJC 3BIAX 3MROB 5CBAB 1A9EA 3MRLB 1FCCA 5C0GA 5SWQB 2XWTA 5D7IB 1A7PH 1JUFB 4QRSB 1R5IB 2BVPA 4TUOA 1A9EB 4X7EC 1CE1H 5J06A 1LO3H 2VSCA 3BWAA 2XWTB 5HHOE 5IVZA 1I8LC 2IANA 1HZHL 2BVPB 4TUOB 3KJ6H 1IAIM 4IOSD 1YN6A 3BWAB 4JR9L 1SM3H 4W4NA 5CEYA 2EE2A 1S7RA 5E2WH 3TN0D 3TT1H 2IANB 2HLFC 4G8FB 4H88L 3EYUH 4PJDF 1RSFA 2IPUK 4MMXC 1YN6B 4R0LB 5CEYB 1S7RB 3I3BA 1NBVH 3OHXB 1OCWH 5F7KC 1JTPA 4PJDA 1OLLA 3FQTB 2DMKA 1A1OA 5T3ZE 4H0HB 3TZVD 1F00I 1XGQA 2X40A 1ZE3C 4RRPG 1UZ8B 1QKZH 2MCPH 5SX5H 1A1NA 4AIOA 1XGQB 1MY7A 3HKFA 4IRZH 3ALPA 4XB7A 2IPUG 2ZUYA 3BE1L 4LFHD 1UXSA 5GGUA 1YEJH 1X5ZA 2I60L 2B8OT 4G6AD 5DMGC 3QUKA 2MKLC 5HI5C 1A4KA 1RZGB 1UXSB 3O6ML 5GGUB 1FSKB 1JHLH 1IAKA 3LMJL 2EO1A 4PRHD 3JV0A 1G7LA 3BIBX 5EIVA 1A4KB 5DMYA 4AJ0A 4BSVA 3B2UC 4BZ2L 3MNVA 3TO2A 1IAKB 4I9WE 3U2SA 3R0MA 4YPJA 1KSRA 1G7LB 5D1XA 2J6EA 5DEGB 4FQQA 5EC2A 3TCLA 4UQ2A 4RQQA 2QADC 4BSVB 3MNVB 3TO2B 3P4OA 3SE9H 2CO6B 5JHDD 2VLRD 3U2SB 3LB6D 3QP3A 4JCLA 3TNMA 4ETYA 4JVWA 4OFVA 5EC2B 3RQ3A 25C8H 3P4OB 3V6ZB 4Y8AA 4OD3H 1AIFA 1NC2A 4WHCA 1QSED 4FFVC 4RGNC 3TNMB 2WBKA 1N6QL 2XICA 1H3PL 3T08A 1AIFB 1NC2B 4LSSL 1JI1A 1XF5A 1V8HA 3P30H 1R0AL 1P4BH 4PLKC 3PDDA 5I76A 4PBVC 1YYLL 2CKBA 1TDQA 3CFBA 5I1HH 1M6OB 5HGBA 3I6LE 2ZUTA 4Z8FH 3BHBA 3S6CA 5I2IB 1XF5B 4P4KA 3VFWA 4YUEL 5I76B 4LLUA 2HWZH 3CFBB 2QHLA 4WI2A 5HGBB 4FFYH 3BHBB 4JFDA 4GG6B 2G5BB 3VFWB 3HNTL 4LLUB 3K3QA 4P2OA 5MEPA 1B4JL 1CXEA 1NGWA 4JFDB 4J4PD 2EEDA 4P2OB 3PV7A 5MEPB 2GI7A 1MWAA 2ESVA 4JZJA 1NGWB 1A6ZA 3VFGH 4F37F 3ALXA 2EC9T 3T0WA 3K0WA 4NO3A 3P73A 4NQED 5IUSA 2ESVB 3IXTB 4JZJB 5GRXG 1A6ZB 4O2CA 3LZFL 4XP6L 4R90L 2XV6B 2ZUWA 2JJVA 3VFPA 1YC7A 1BF8A 2J6EH 4NO3B 4KVCH 3BP7B 4CN6A 4MAYA 4P46C 3QEHB 4PRAA 4O2CB 3RVXC 3GSRA 4G42B 5ID1A 4LVHB 3VFPB 1KJ3L 2BDNL 1FNLA 3Q1SL 1BQLH 3BAEL 3W9EA 4PRAB 2O93L 4LASH 2XPGA 2C7UA 3GSRB 5ID1B 2A1WL 4WRLA 4JKKA 1LEGA 2XZAL 4YDIH 3SJVD 4O00A 3ULUD 2QQQA 2AXGA 1JHKL 1KCVH 1LEGB 1X5HA 5IMOA 4HXAH 5C9KA 4JPKH 1NQBA 1HH9A 1Z9LA 3SE4C 4OBRA 2PXYC 2AXGB 3L5XL 3LKRA 3V0AC 5GJTL 1T7WA 1UB6A 4O9HL 4DVRH 1NGQH 1XF2A 1OPGL 2AJ3A 1NCUA 3LKRB 4GLRH 1BBDH 4PRHE 3WIIL 4LU5L 4AEHL 4PJAF 1KF9B 5SWZA 3H2WA 2I26N 1UB6B 2Y07H 5C9JB 1A5FH 1FPTH 1BIIA 3BPLC 4ZO8A 3BPNB 1DQDH 4UTAH 1X7QA 1CFTA 4HJ0C 4PJAA 5GS0L 3BQUA 3CH8A 2LV4A 2P44B 5SWZB 4F9LA 5ILTL 1E4XH 5I6XB 1KTDA 1YQVH 4TPRL 5JHDE 3WSQH 5HTSA 1IAMA 5HYIA 4KTEL 2VLRE 1Q9WB 1AHWC 3EYFB 3U7YH 4PJAB 3NA9L 3BQUB 1R3LA 2ADJA 1G1CA 1CE1L 1JPTL 4G6ML 1LO3L 1OTTC 1ZLVK 3EO1A 1S9XA 3D0VA 2NXZC 1QSEE 4NN5C 1R3LB 2ADJB 1Z0MA 2ZG2A 5HYJD 5CAYB 5H94A 1QNZH 2WW8A 4K2UL 1CZ8H 3D0VB 3GMLA 1P2CA 4OBSA 1CGTA 5HVHC 3EYUL 4QRRD 1A47A 5H94B 1J1PL 4JDVA 1S5HA 3MJ9A 3DURA 1OCWL 3GMLB 1P2CB 3LY6A 3QCVL 5EC1A 2YSSA 3MC0A 1P9MA 5D93B 1YJDL 4JDVB 1IKNA 1S5HB 3DURB 2VL5A 5EC1B 4EXPX 2YSSB 4NKQB 1T5WB 1EGJH 2A0LD 3OX8A 2HTLD 2CMRL 2A38A 2ARWA 1QKZL 5FM4A 3RPIA 2VL5B 4YXHH 3DV6A 3O3AB 3OZ9L 3QUYA 4OQ1A 4LCCA 3DVNA 3RPIB 3RY6C 1YEJL 4K71C 5J8OA 3BT2H 3DV6B 3DYOA 4NQEE 3WS3A 4LRIC 4LCCB 1PSKH 3DVNB 4X6EA 3W9DA 3GBLA 1J10A 4PJEF 1BEYH 3UYRL 5JPMA 3WS3B 5HVGB 4X6EB 3RVUD 4PJEA 3EHBD 3EOYG 5HHVL 3QFJA 3WV0A 1VADA 4MWFA 4YHZH 5JPMB 4Z0BL 3OJMB 4R7DA 1IQWH 4LHJB 3QFJB 5FV1L 1VADB 5KSBF 3IFOA 3HUJF 4Y1AA 3RIAK 4R7DB 5DJZB 3SJVE 1YECH 1DQTA 3MA7A 4HEME 3HUJA 1FNSL 1O7VA 3ULUE 4Y1AB 3AMKA 1QBLL 2IAND 2YN5A 5A2LH 2DQUL 3MA7B 5BVJA 5KSUB 1E4KA 3BJLA 1FG9C 3HUJB 3BKYH 2H2PD 2Y7QA 3BWUC 3IJSA 5TE7L 2XA3A 3WNMA 2FD6H 4FMFA 3GMMA 5CZVH 5DEFA 5FCUL 5C6TH 5BVJB 2FJGA 3C60A 2Y7QB 3IJSB 4M9PA 1GGBH 4NM4L 4MJIB 4W4OC 4KZEL 3RIAF 1ZLVH 4XMLH 3GMMB 5CGMA 5DEFB 3DMMA 2FJGB 3C60B 4ZFZA 1RZ8A 4L3EB 2B2XL 3FQWA 2BNRA 3BZ4B 1FDLH 2ID5A 3HG1A 2AJXH 2JB6A 3ARGA 1RZ8B 3U9PH 2DQGL 2P8MA 2BNRB 1OP3K 5I19H 3HG1B 2CIKA 2JB6B 1LVEA 3ARGB 4KJYA 4UTBH 4L4VA 4JO2L 2P8MB 2MSPA 5GGRA 1KTKE 4YFDB 5IW3A 5DMJB 3NIGE 3NCFB 4KJYB 4L4VB 5HYJE 4FRWA 3ZKXC 3BISA 1H3VA 5GGRB 1KLFA 5DZNA 3WNOA 3S37H 1FGVL 5IVXB 4DOHE 4QRRE 3WCYA 4NCDA 4DTGL 4BFGA 4Q2ZA 2YN3A 1MOEA 1G9MH 1PEZA 1RUQL 4B41A 4LASL 4DZBA 4PGZA 3UYOD 3BZDA 5L2KA 5D1XD 4L4TD 2DL9A 3S4SG 4Q2ZB 2R0KL 1KCKA 2EE3A 5MENA 4XVUD 2ERJB 3GI8L 4DZBB 4XCCL 4LPVA 5L2KB 3W0WA 4E5XA 3GMNA 5E94B 3QUXA 2C3WA 4ONFH 5MENB 4MS8D 5D6CA 1NC2D 5C0DA 3QHZH 3W0WB 1C12A 1WFUA 4D0CB 4E5XB 2VNCA 1I85C 5D6CB 3ZSSA 3CAFA 3GIZL 4NJAH 4M6MH 4F7PA 5C0DB 1C12B 4DVRL 3BH8A 1NGQL 4LEXL 4ONGH 5HY9A 4UNVA 1Z0NA 2WM0A 1IC1A 4P4KD 4WTWA 4X98A 4S2SA 2Q76A 2Y07L 3QIBC 2BY1A 3BH8B 2QADB 1NEUA 2CLZA 3ZLQC 4UTAL 4XNXL 4JFDD 3F65A 2DIAA 3TH3T 4X98B 3O4LB 1EZVX 4S2SB 2K3TA 4P2OD 2Q76B 5K59E 2P1YA 4B50A 5D7IE 4JCMA 2CLZB 1JCKA 3T0EC 5C71A 3X3FL 3MLTA 4RGNB 3T2QA 5B22A 4QHKI 4MA1C 5IIEA 2J4WL 5FUOH 3IJYA 2ESVD 4M7ZB 2BSRA 3AAZA 5D6DC 1VFAA 1RZKL 2DI7A 4KJPC 1ND0A 3MLTB 1LO2L 2HMID 1FYTA 1P84J 5IIEB 4LIQH 1FFRA 2IANE 3IJYB 1JF6A 2BSRB 5DVOA 3AAZB 1D5MA 1VFAB 1ND0B 1DBKH 1OP3H 3LV3B 2IPKB 4M43H 4MAYD 4LPXA 1XR9A 1D5MB 4HZLA 3SGDI 4UIKL 2ITDB 3EDKA 2H26A 3I02B 2E6JA 4PJDE 4NPYA 4EUPB 2BVTA 1XR9B 1Q8MA 1GPOH 3SY0A 1RQ5A 1MFBH 1EGJL 3NFSH 1T21A 1I7RA 1RURL 3B8SA 2H26B 4NPYB 2RQ8A 1VPOL 3SY0B 2DIBA 1DBAL 1T21B 1I7RB 5F96L 5E8NA 3HI1A 4RFNB 2Z0BA 5E00A 4P46A 2AABH 2Q7NA 5C0IA 1U92A 1JE6A 3MJGX 2QQLL 4YHNA 5E8NB 1PSKL 1BX2A 5FCSH 4P46B 5DJ2B 3F7PC 4EVNA 4MA8H 2ORBH 2RFXB 1U92B 1QLEH 4YHNB 3EOTH 5DUBA 3L3DA 4X7SH 1CXHA 4WDIA 2MTPA 3O3EA 4EVNB 5SWZD 2D03H 3MOBH 4YHZL 2APFA 3IYLW 2DQHH 1NAMA 3HC4L 4NKOB 3L3DB 2PUQT 5DUBB 4QRQA 4WDIB 1IQWL 4NOFA 1KC5H 3BQUD 5DRNA 3RVWD 4P59H 1AXTH 2PXYA 5TF1L 4RZCB 3WXWH 2AKRA 1NAMB 1ZGLM 4G6FB 4QRQB 3GMOA 1T1YA 2FDBP 2JB5H 3VGHA 4MHHI 3DSNA 3ULVF 2PXYB 2L7JA 3P0VH 2AKRB 3QULA 2V7HA 3W81A 3V7MA 3S88L 1OAUH 3GMOB 3KVQA 4YXLH 4EUPH 5D7SL 1CGUA 4QHNB 5F1NA 1B4RA 5IEKA 3THML 4LAJH 2P45B 4R2GB 3QULB 2V7HB 1C08B 5F1NB 2NY4B 5IEKB 1WCBA 2C4XA 4HC1L 3RWDA 4J3TA 4LVNC 2P43B 3TEUA 4GG6E 2JELH 1AHWA 3BN3B 1V3LA 1LDPH 1WCBB 3ESVF 1HYRC 5CLWA 4R9HA 1RZ7H 1FORH 2AJXL 4JFDE 3P77A 3T09A 1AHWB 3OKLA 1KIPA 3C8DA 1EHNA 5DDHA 5I19L 1N5YL 3UJTL 2GK2A 3U7WH 2NZ9D 3P77B 4PLJD 1QBMH 3OKLB 1KIPB 2RAMA 2NXZB 7CGTA 2NNAA 4NN5B 2C4FT 3QUYD 1NUNB 4GUPB 5DDHB 4RMTA 2ESVE 2Z93A 3HS0A 1S7WB 4RBPK 4XXDA 1QO3A 2NNAB 3IDUA 1LO4H 5CJQL 4RAUB 4PR5A 4HPOH 2Z93B 4KKAD 3IDGA 4PJFF 4XXDB 1NAMH 1C1EH 2E7LA 4MAUL 1QO3B 3EJJX 1RZFH 2OX5A 4PR5B 4PJFA 4JFHE 5D72L 3IDGB 1G9ML 1DEEA 3QFJD 3MUJA 2Y36L 2X9YA 4JZOB 3KYMA 1DEEB 4ZD3H 4OGYL 3HRZB 3M8OL 3N1GC 2CD0A 5CD5D 1XGPA 3KYMB 4EN3C 2FX9H 1BVZA 2CIIA 4Q9RL 3QHZL 1KB5A 1WZLA 2DWEA 3OL2A 3QXWA 3WNKA 1XGPB 2CIIB 4NJAL 4C56A 4LBEB 4AG4L 4PUBL 1KB5B 2DWEB 2XQYK 1CFQA 4O02H 3V5KA 2HJLA 2IQAA 4C56B 1ZEAH 3G6AA 4PIRF 1WISA 4XPHL 2JE8A 3O41A 4TUKH 1CFQB 3WO4B 4BUHA 2HJLB 3RI5K 2IQAB 3DMMD 1X5AA 4JM2C 3DYMA 5DI8A 5SWZE 3O41B 1T5XA 5C0RL 1G6RB 2BNRD 4HFUH 2YD2A 4PFEA 5BOZG 3HG1D 3QR2A 1YDPA 4PJAE 3ARGD 1WVZA 2EDEA 3BUYB 5DI8B 6CGTA 1MREL 3DI3B 4XB8A 1T5XB 1JGUH 2GFBA 1YEDA 1KLUA 1KUMA 3MOAH 4OCRL 1HOCA 3VXUB 3FO9A 4N1CA 5DZOA 5DHVA 4HSQA 1DCLA 1YEDB 1KLUB 1HOCB 3G6DH 3FO9B 3RI5F 4KVNH 1NLBH 5DHVB 2CSPA 4M43L 1EHAA 4OLXH 4QXWA 5JIKA 1BOGA 1FZOA 4F8TA 2BY0A 3OB8A 5E1AA 3JXAA 4AL8H 5I1CL 4RBPH 1JWSA 1HKLH 4AT6A 3B9KA 1BOGB 1FZOB 4LLAA 5E2VH 3FB6A 3Q5OA 3NN8B 5E1AB 3AY4A 5H37G 4WO4C 1JWSB 3B9KB 1JFQH 3W0WD 3FB6B 4ZS7H 3MLXH 3QUXD 2IPTL 3DX8A 4S1SH 2VN7A 2ZCKL 2PN5A 1I3RA 2P47B 5LG1A 3VGGA 2Z4QA 5EZLA 1U3HC 3ZKXB 2GAZB 4M3JA 1AR2A 1G6RH 3DX8B 2R56L 2WMPA 5E2UL 2IQ9H 2EEAA 1N0XL 2Z4QB 4I77H 4LLQA 5EZLB 4BQ6A 5SX4I 3LQAL 3L3IA 3RX7A 3CXHK 4U1JA 3UTQA 1A6UH 3BN9D 2YPLA 2B1AL 4MXQC 4LLQB 1MHEB 2D03L 5JW4N 4U1JB 3GIVA 3WDJA 2DQHL 3UTQB 3CNKA 2YK1H 5KVEH 4PJEE 3HAEG 4LKCA 1A6AA 3QFJE 4APQC 1QA9B 2VE6A 1KC5L 3CVHH 3UDWC 3RZCA 1BIHA 3BKCL 3FONA 4QY8A 1OTUC 1RUKH 1I85A 3IVKA 4JM4L 4LKCB 1A6AB 1JPGB 4Y1AE 4YE4H 1W0VA 3QDMA 2R0ZH 3IVKB 3P0VL 1EO8H 4FOMA 1OAUL 3HUJE 2O5ZH 1CS6A 1FYTD 3ARZA 1W0VB 3QIBA 4BSWA 1X5YA 2HP4A 5HYEA 1JGLL 2VLMD 2OMNA 4MJIE 2DLEA 2WIMA 3VXSB 3QIBB 1I9IL 1KN4L 3MRFA 4UINH 4BSWB 2QHRL 4AIZA 2E27L 3T0EA 5C0CA 2EDJA 3LIZL 1LDPL 1S5IH 1T83C 1T89C 4X0KA 4YR6A 1QRNA 3MRFB 4X80H 3ZYZA 3NCJH 5FB8A 1ZGLP 4IMKC 4AIZB 1NAKH 4M48H 1X5XA 4LK4A 3T0EB 5C0CB 1OGAA 4U1LA 5D6DA 3SDDC 5DQDH 2BNRE 3LH2H 5BS0B 3AB0C 3HG1E 4X0KB 4YR6B 1QRNB 4QWWD 2AK4A 3ZYIA 5ADPL 3WN5C 4P3DA 1OGAB 4KDVA 3R1GL 4OFDA 4U1LB 4TVPD 4HUNB 4U2ZA 1URLA 4LCYB 3WIFB 2AK4B 2OR7A 3NA4A 1NMAL 3I9GH 4ZFFA 4O4YH 1F45A 4P3DB 1KNOA 4WEBH 4KRPD 4L4VE 1LO4L 3BDYH 1EJOH 1ZLSL 5AUMA 1ACYL 2AEIT 1KNOB 1U36A 2RGSA 2DQCH 3BP4A 2O5YH 1Q0XL 5AUMB 2BHUA 4L3CA 4M1GL 3U0TB 4LIQE 5F3BA 3BP4B 3E8UH 3ZT5A 4XWOD 3OKMA 4J8RB 1A22B 4G6FD 4L3CB 5L2KE 3BKMH 4I18C 5ICZA 5MENE 5TDNB 4RNRA 2EDHA 3W0WE 5E24E 4U1SA 5I16A 3FB7B 5DFVC 5ICZB 5FUCC 4R2GD 1G7PA 4RNRB 2Q8AL 1I1CA 4HUKB 4U1SB 3RKDD 2OSLA 2NY4D 5I16B 3ULVD 3BJ91 3F8UB 4M7LH 2SEBA 3HE7A 5T33H 3H6JA 4OJFL 1RJCA 5TQ2H 2DN7A 4GXVL 5T3ZL 5CINL 3VFRA 2HKFH 4G8GA 2OSLB 3OGCA 4HIIA 2SEBB 1MH5A 3UAJD 4FN0A 5K9OA 4G80A 3VFRB 4G8GB 2LAGB 4X6DA 3OGCB 4HIIB 4U6VL 3KLSA 1MH5B 4Y0GA 5K9OB 4G80B 4GKSB 1P4IH 5F3HA 4OCWH 4U3XA 2NXZD 4X6DB 5DWUL 4CMHC 3Q6FB 1IT9H 1GIGH 2CUMA 4YEEA 1BWWA 5IROA 3W2DH 4QF1B 5B3JF 5F3HB 4N5EC 4KRLB 3IGAA 3JTSA 1TNMA 2R9HC 3SPVA 1ROWA 4N0CC 1X9QA 3G6DL 4L1DA 1XF3A 2VLJA 4OLEA 1DQLL 3VGAC 5GRYA 5HDBF 1OP5K 2X4NA 2E9BA 5DHXB 5IWLC 1WK0A 1XF3B 2VLME 2VLJB 5AD0A 3IFLH 3EYVA 3QXAA 3OAYH 1JGEA 1WFOA 5AYUH 1QSFA 3AM8C 2X4NB 4LSTL 3OG6B 2EH7H 9CGTA 2K7QA 1HKLL 1TTFA 2DL2A 3HNVH 1N7MH 3QRFM 5AD0B 3EYVB 3QXAB 4LCWA 4WU5A 1JGEB 4PG2A 1QSFB 1C5BH 1JFQL 4LARH 4LCWB 4P9HC 4WFHD 4WU5B 1ZVSA 2F53A 2RB8A 1H0DA 3MLXL 3MUGA 4KQ4H 1FCGA 1CF8H 4S1SL 1MFDH 1HDMA 1RK0A 4TVPE 2EDOA 5IW6B 2OBGA 2DMBA 4ZFOL 2F53B 3B9EA 2RCSH 4DKFH 5IB3A 4M3KB 1UM6H 3ZYJA 3RX5A 3U4EA 1HDMB 5ICYA 4C56D 1RK0B 1YNKH 4I77L 3RWIA 4OLWL 5DJCA 4J3UA 5BQ7A 5IB3B 1CXFA 4PBXA 1JZ6A 3U4EB 5ICYB 2R4RH 4GRWB 4JFXA 4XPBH 3RVTC 3RWIB 5DJCB 4ZNCD 5BQ7B 4JANA 4EN3A 3ARDD 4JFXB 3CVHL 2H8PA 3H9HA 4NZTH 1BZ9A 1TTGA 3QQ4A 4B53A 1E6JL 4XX1E 3ZE0F 5DF0A 4JANB 4EN3B 3RGVC 4XVSL 4BK4A 4NNXA 2AV1A 2H8PB 3H9HB 5EOCH 3QQ4B 4UT6H 2VB5A 4JY6A 2R0ZL 1FO0H 1UB5A 1HNFA 4NNXB 2AV1B 2BCKA 4B7LA 1HEZA 2UZYB 3WIHA 1T6VN 2OP4H 4QYOA 2R2CA 3DGCR 2HJFA 3QO1A 3QA3B 4MX7A 4JY6B 4QT5B 1UB5B 3G5YA 4GKZA 2BCKB 2VXQL 1HEZB 3ULVE 3CMGA 4TTGA 4QYOB 2HJFB 4MX7B 1MCDA 2H41A 4TNWK 2FYYA 2R23A 3G5YB 4X4XA 1H8NA 1IGYB 4GKZB 3WJJA 1MI5D 5AZEH 4JM2B 5E1HB 5BXFA 4X80L 3NCJL 2R23B 4X4XB 1NAKL 3B9KD 3QPQD 1UA6L 5JOFB 2GEEA 1JJUA 2ZG1A 4PJ5A 4G43A 1HILA 1OP5H 1SY6A 4NYLB 5BXFB 5KZCB 3NCYS 2LABA 4MCZA 1YY9D 3QH3A 4PGEA 4GRWH 4O2EB 2HN7A 4PJ5B 1G0DA 4HGWA 1HILB 5GJSL 1OTSC 4KKCC 4XGZB 5E99H 4MCZB 1INDH 4TNWF 3QH3B 4PGEB 1ITBB 2RBLA 3P11H 2A6JA 4DK3A 5CKAA 2HN7B 2VXUH 4HCRA 4HGWB 1O5DT 3JUYA 4HG4K 1KENL 3F62A 4FZEH 2KBGA 5E8PA 1IZKA 1P1ZA 1JBJA 2A6JB 5J1SC 1PGRB 1AD0A 3HZKA 3DO7A 2OR9H 4IMLB 3LEYH 4XPAL 5E8PB 2O5YL 1QFOA 4WO4A 3MACH 1P1ZB 2YPLD 5FECA 2VKXA 1AD0B 1R5WA 4MLIA 3HZKB 3VE0A 3UJJH 1OF2A 1UJ3C 3TVMD 1CTOA 4WO4B 2OK0H 5FECB 1RJZA 1R5WB 3RZCD 2O61A 3WIHH 2MQ0A 1U3HA 2XNAA 2YS4A 1EXUA 1VFUA 4K7PH 3ECBA 2YHGA 4RMRA 1RJZB 4WFHE 1U3HB 1NDMA 3QDMD 1V7NL 5GS3A 1CLZH 4OCYH 1I8KA 4TN9A 4EDXA 3ECBB 4JQIH 5ITFA 5SX4H 1NDMB 3C09C 1MIEH 1A7OH 3SKJH 1DDHB 1CDGA 1I8KB 1OQXA 4EDXB 4HWEH 2X9XA 4C56E 2XKUA 3O8XC 5DVKA 2HKFL 1NEZA 2FEEL 4BKLB 4Y5XA 2H32H 1YNLL 3RJDA 1FL5A 2CRYA 5GRVL 3SQOL 1SY6H 43C9A 5IG7A 2VLKA 2WUBH 3GJEB 3CIQA 3GSXA 4NZRH 2AJUH 5C0CD 4OZGA 4APQB 1NEZB 1A6WH 3QDJA 4Y5XB 4I0PC 1FL5B 5I18H 5IG7B 43C9B 4NSKA 2VLKB 4N9GA 3P4MA 3QJFA 5C2BL 3GSXB 2NY0C 1U2HA 4OZGB 1OGAD 4WFED 5E6ZA 4KGJA 3CK0L 4JKLA 3QDJB 4FZ8H 3BGMA 5IV2A 1IT9L 1GIGL 4EEEA 3NOIA 1T66D 2AK4D 3KDMA 1RV6X 1A7QH 4MGXA 4N9GB 3GKWH 3P4MB 4CU8A 3QJFB 5CSGA 3SKUD 5IV2B 3BGMB 3KDMB 1FGNH 2CGRH 3VFTA 3I6KA 5B38A 3QCUL 4K94C 4G8IA 2E9JA 4JJHA 3IB4A 1T83A 5ALBH 2ZJSH 4KTDH 3VFTB 3I6KB 4EKXA 5B38B 2DLGA 4G8IB 3OBAA 4MD0A 1D5ZB 1IMHC 3PP3H 5IFAH 4Z7OF 2EH7L 1V3MA 5D8JL 2UZIH 1CBVL 4HH8A 1KELH 4MD0B 4LSPL 5CJOH 5ANMA 3DBXB 3ULUL 4GW4A 1AKJA 1C5BL 1UH2A 4BZYA 1S7QA 3QIUC 4R4FL 4G9DB 2OJZL 4MYWB 5ANMB 2CQVA 2X4SA 5DD6A 4CMMA 1EK3A 1CF8L 1AKJB 1MFDL 1RPQA 5IVOA 1S7QB 5E95B 5J7CC 3L3KA 3AGVA 2RCSL 2X4SB 4XHJD 5DD6B 3UTTA 2V7NB 3MLRH 1BFOA 3HE7D 3L3KB 5F9JB 1KCLA 4P5KA 3UTTB 3QUMA 3RL1B 2LTQC 3B8YA 4G8GD 3IDXH 4Q7DA 1BFOB 3PL6D 1ZS8A 4OD2A 4OZHF 1MHPL 4P5KB 2GW5A 3H7LA 3WNPA 1NH6A 4LRNH 1G7MB 3UPRA 3DETC 4JRXA 1ZS8B 4OD2B 1RFDL 1NL0H 5IW1A 1UZ6F 5C6WH 1K8DA 1K6QH 2HVJA 3KYKH 3EYSH 2WUCH 3MZTA 5DC0A 3UPRB 1EDQA 3OSKA 3PHQA 4IJ3C 3STBA 4JRXB 2PNDA 2WZPD 5IW1B 4ZFGH 1K8DB 4GS7C 3ILQD 2HVJB 1FO0L 3FB8A 3PWPA 1JWMA 1K2DA 4DGYH 5AG8A 5GGTA 2IH1B 2MQ3A 1WT5C 4PJIB 15C8L 3ZHLA 2OL3A 3UEZA 3FB8B 2XRAH 3PWPB 1JWMB 1UM4H 2VLJD 1K2DB 4HS8H 5DO2C 1MJUL 5E08H 1NUGA 2HH0H 3VW3H 5AEAA 1NBQA 2OL3B 2Z35A 3H3PH 3R8QA 2F15A 5AZEL 4WU7B 4U4BA 1QSFD 3T0EE 5C0CE 3D39A 4ACPA 2Z35B 4QCIA 3ULSA 4DGIH 1S7UA 3RWJA 4LCWD 1FAKT 1QRNE 1NCNA 5HHXL 1EH9A 3LHPH 3BSZH 3D39B 5CP3A 1OGAE 4QCIB 3ULSB 4WFEE 3V4UL 4K23H 4M7JH 3RWJB 4XC1H 1CYGA 2F53D 5DJXA 1RUMH 2AK4E 4Q0XL 4HKJA 5DJXB 4G5ZH 3VGAB 3B3IA 1EBPA 3TGXA 3GHBH 4FZEL 1AD9A 2AXFA 3AM8A 5HBBA 35C8H 5EU7C 5ACZA 5EZJB 2BJML 1T2QL 2GY7B 4HKJB 4P5MA 5T1KB 2XTJD 4Y89A 1MJ7L 1AD9B 5EZOH 2FO4A 5ACZB 1T7YA 4TULH 4DN4L 3CDGB 1IM9D 5GRUL 3QQNA 2FBJH 3UJJL 3IKKA 2FO4B 4Y4KA 4LF3A 5F7EH 3PNWA 1Q9LA 2WLYA 2HRPH 5I30L 1DN2A 2WIIA 5T3XD 1TZGH 1MAJA 3ZKQD 4Y4KB 4LF3B 4OUUA 1Q9LB 3PG2A 3VXNA 1LD9B 2IFFH 5DA0B 2F74A 4DEPC 2APTA 4I8DA 2X4PA 2GT9A 1ZA3A 5IQ9B 4C58B 1CLZL 4M93B 2CXKA 3V9FA 1MQKH 5ESVA 4OUUB 4JQIL 5H35A 2F74B 4JDTH 2X4PB 1ZA3B 3BPOC 1A7OL 2Z92A 3SKJL 4HS3A 1NCCH 5ESVB 1VA9A 4YWGH 3WUWG 1F6FB 4QXTA 4XAWH 3E3QE 1JPFB 4YDKH 3QZWG 4RFOH 4GRLA 4XWGH 4HS3B 4U6TA 4G8GE 4NZRL 1UM5H 2AJUL 2X4TB 3RGVA 3PJSA 4QXTB 1ZT7A 3QZWA 1EJ6A 4ZMAT 4GRLB 2V5TA 4XPFL 5DD0L 5EDXA 3VFSA 5GZOD 3RGVB 3B5HA 3H0TB 4X6DE 4ZUSB 1BHGA 3PJSB 2P4AB 1KCRH 2YWZA 1ZT7B 4H0IA 4FZ8L 2D3VA 1YN7A 4X6BA 4FG6C 3VFSB 3GKWL 1FFOA 3MV7A 3E1F1 4YGVA 5E70A 3GRWA 3FMGH 1L9MA 4X9IA 3NPSC 4X6BB 1O7SA 2UYLA 3P2TA 1JF5A 2APVA 3MV7B 5I1KL 3OQ3B 4YGVB 3PGDA 4DQOH 3IDMA 4FQ2L 1B6UA 2COQA 2X2YA 4P9HH 4IS6A 2UYLB 4KTDL 2GITA 3CFKA 2FLBT 2VLJE 2K9UA 4OM1H 3PGDB 3IDMB 4IS6B 2L4OA 4RFEA 3SGKC 1EFXB 5HDLA 2GITB 2WQ8A 1AXIB 3CFKB 4U6YA 4CUCA 4GAJL 5DD5H 1KELL 2R69H 3OKOA 5DRZA 1QSFE 1E27A 2HT4C 2ZUXA 4RFEB 3L7EB 4U6YB 5BMFH 4KQ3L 3IRPX 3W5MA 4LCWE 1U3HD 4FQHA 3OKOB 4D9LH 2VDQH 3KHQA 1E27B 3HZMA 3T2NH 3BKJL 4KK8C 3GK8H 3DHJA 4NHCH 4LLMB 4FQHB 2F53E 5KOVC 2XXCB 3N1QC 4OCNC 3HZMB 3MCG1 2CKBL 2I9LA 1PQZA 3D85A 5JOPD 2N4IA 1EMTL 4ZOAA 1R3KA 3WUZA 3ARQA 2EIDA 1RUPH 1UJ3A 2I9LB 4GRWE 1PQZB 3D85B 5EUOA 1YEIH 3HE6C 3SGEI 5CD3A 5DURB 5E8DH 1OTUD 4G3YH 5IJVA 2VLKD 1VFBA 1UJ3B 1YNTA 4E0RB 1MCBA 3OXRA 3PWUA 4M7LT 5EUOB 3QDJD 1CFNA 4UQ3A 2GY5A 2V5SA 3LDBC 4EJ1C 4Y4HD 5IJVB 1VFBB 2P5EA 1NL0L 1YNTB 1MWAL 1K6QL 3OXRB 3PWUB 3B4NA 3HMWL 2WUCL 4DN3H 3QUZA 4PD4K 4KKBD 4ZO7A 1CFNB 4UQ3B 5T3XE 3L95A 1CLOL 1RMFL 3L3JA 4MDJA 1RU9H 1F4XH 5CGYD 2OTUA 3V52H 2Q1EA 4IRSA 4LLDB 1HIMH 3QUZB 3E0GA 1BQUA 1U93A 4MVBC 3L95B 4IIQC 3HZYA 4MDJB 1KBGH 5J6GB 3SCMA 2OTUB 1JMXA 2XRAL 2BVYA 3VXTA 4NQDD 5E08L 3KXFA 1U93B 3VW3L 4I0PA 2OTWA 4GJTB 3LEVH 5F9WC 1XR8A 5GS2D 3MJ8A 3H3PL 3VXTB 4PPTA 1BLNA 1YYML 2AEQH 2VQTA 3KXFB 4WV1C 2IH3A 4D9RE 3TPUB 4I0PB 2OTWB 2H1PL 4OGXH 1XR8B 2DBJA 3MJ8B 1BLNB 1K4DA 2IH3B 1GL4B 3EO9H 3LHPL 4TVSa 4XP9H 5IK3A 3ARYA 2XT1B 5ICXA 1K4DB 4PJ5E 4NUGH 5CS7A 2FGWL 1RUML 1YMMA 5F44A 5EOCJ 4OIIL 5IK3B 5ICXB 1BM3H 2H2SD 5T5FL 4NBYB 3UTTD 1ZV5A 2APWA 35C8L 3U46A 3O6FC 3K2UH 1RZJL 3SDYH 1F97A 4TUJA 3QXTA 2BY2A 3NFNA 4J12A 5DQ9B 3ZKSD 1YEGL 3MODH 5EZOL 1AQKH 4TUJB 3NFNB 3QIUA 1QBBA 4RDQF 5C3TA 1UEYA 3NIDF 2W9DL 2YKLH 2CUIA 1ZMYA 3QIUB 4JRXD 1J0JA 2XZCL 2ITCA 2Y4SA 4G6JH 3EFFB 4JHAL 4NHUA 2IFFL 1WAAA 5I0DA 2R2HA 1JZ5A 2ITCB 5AZ2H 4NZDA 1H8SA 1OWWA 3PWPD 2NY1C 1NJ9A 4MB5A 5DJ0A 3QNZA 1I8MA 4KKNA 2XZZA 1OB1A 3G04A 4TOYL 3C6LA 2ZUQC 2ZWLT 3CPLA 2LTQB 1NJ9B 5DJ0B 1FYHB 4P5TD 5DMIL 1I4FA 1I8MB 4YWGL 2QV2A 1OB1B 1U8MA 1U2CA 5I17A 1FL3A 3C6LB 4MB3A 1A6TA 1S9WA 4F57L 5HPOA 4OLZL 3V0WL 3CU7A 5CZKA 3MPCA 1I4FB 4F33A 4K94H 3JZ7A 1U8MB 5I17B 2VLKE 1FL3B 1RIVL 3WKNA 5JR1H 1KN2L 4YFEA 1A6TB 4PTTB 3D39D 1S9WB 4N5ED 4OZGE 5FHAH 1QEWA 3U79A 1MHCB 1R3IH 3QDJE 4AQOA 4HHAA 4IJ3B 4Z0XA 3TJHC 3QPXH 2UVEA 4I4WA 3VD7A 4BFEA 4FNLL 4OZFA 2HKHH 4WFGD 1QEWB 4QHUA 3HC3H 1YEEH 4DAGL 5JW3H 4HHAB 3ZHKA 3ZKNC 5ETUA 5BJTA 1VFMA 4I4WB 3X14A 4OZFB 5IESL 4DW2H 5BJTB 3TO4C 3ZO0A 3X14B 1T03L 3IDIA 4BFIB 1M7IA 4OM1L 4KAQL 2B5IC 1XGUB 5DUML 4PY8I 3IDIB 4Y4FC 1D5BA 2O5XH 3GM8A 2Q3AA 2NX5A 5TGBA 1U58A 3GBNL 4HT1L 4Y4KD 3KLHC 1D5BB 2GQHA 3OPZH 2MKWA 4H8WC 5ANME 2VDQL 4Z7OE 2VXVH 1DBJH 3LS4L 3P9LB 3WFDL 3QDGB 1U8NA 4XT1C 2BNQB 2Q6WA 3TBSA 4EI5A 3B43A 3INUL 1BP3B 1GGIH 2PYFA 3DVFA 4KRMB 2Q6WB 3V95A 3UTTE 4ZPVA 4UDTA 1RUPL 1FVCA 3TBSB 4D3CL 1H15A 5KG9B 4QXGH 4EI5B 3DPBA 4UILL 3RU8H 5I1IH 1PD6A 2PYFB 5D7KD 3RAJL 1TETH 3QAZB 1UC6A 3I6GA 4AEFA 4FQ1L 5E8DL 3V5HA 3E2HC 4GRLD 4H5SA 2AK1H 4AEIL 1FVCB 4EOWL 4NQVA 3BD4A 4OZFH 3C5ZA 2VDMH 3DV4A 4X9HA 1JWUB 1N6VA 1MLBA 3I6GB 1PVHA 1EO5A 3V5HB 2IF7A 2VXTL 4NQVB 3GSOA 3JTTA 3C5ZB 4Z7WF 4JRXE 5A2FA 1MLBB 4DEPB 1YQ2A 4R4ND 5FUCE 2YMXL 4MJ4A 4WW2C 3GSOB 3JTTB 4OB5H 4NN7C 1HIML 1UZ6E 5JOEA 3FL7A 1KYOJ 3PWPE 3LKQA 1ZHNA 4FXKA 1RUAH 5JZ7C 4Q6IC 3LKQB 3GEWB 1D5XA 4FP8H 2LQRA 3QISA 1B0RA 2GKIA 5IR1A 4Y7MA 2YD4A 1D5XB 1T7XA 3K1DA 3U4AA 1B0RB 1CE6A 4PGBA 5IR1B 3P4NA 5K33A 3D39E 4OZIA 2WWKO 4AENA 4NUGL 1CE6B 2EDBA 4R97C 5TE6H 3NPSB 3P4NB 3G6JF 2Q8BH 5FYLD 4UAOB 4WFGE 4OZIB 1MF2L 2PR4H 4AENB 1KIQA 3MOQA 3BEWA 3MRNB 5LKNA 4PRNB 1XAUA 3G6JA 1D6VH 3I2CH 5KVFL 2GJ6A 2VDLL 3B5GA 2OXGA 2H9GA 4MLSA 5DS8A 3D85D 5A1AA 1KIQB 4LNVA 3BD5A 5DURD 3G6JB 4PJCF 1I1AD 1DBMH 1KB9K 2VZTA 5DS8B 3EYQC 1AQKL 4F80A 1I9EA 3TA3D 1YY8A 1OVZA 2HT2C 3GSVB 2AJYL 4MCYA 2DM4A 3LN5A 4YHLH 3RY4A 2M2DA 1BJMA 3VRLF 5EFIA 1SMOA 1YY8B 2R29H 4MCYB 5EU6D 4XNYL 2P5ED 3LN5B 1RHHA 4M61A 3OJDA 3D9AL 2EKJA 3QUZD 4XVTL 5EFIB 5LVEA 1B2WL 3FCTB 5AZ2L 2XQBL 4M61B 3K74B 4IRSD 4JGUA 5J9PA 3OJDB 2EDRA 3WJLC 3HE6A 1RK1B 5IBUB 2GK0A 3REWA 1J1XH 4JY4A 3SCMD 2AEPH 3N85L 3G5ZB 4OSUH 5B39B 4M1CD 3K46A 5J9PB 4J3WA 1LP9F 3HE6B 2LU7A 4QRPA 4OCSH 3KXFD 2GK0B 5E2JA 3REWB 4XMPH 1LP9A 4QRPB 5C7XH 1PKQA 5F7HA 1HI6B 4K94L 1IGJA 3LDBB 2IGFH 1LP9B 4JFFA 3MQIA 3U30C 2NYYC 4F9PC 4PS4H 5DK2A 1IGJB 2DQIL 4TVPL 3SE8L 4MA7L 2OZ4A 4HV8B 3IKCB 4OQTA 3FQXA 1CK0L 2Q86A 4ODBD 3CLFL 2VZUA 5DK2B 3S36H 1YMMD 4UT9L 2MJWA 4Z9KB 3MV7E 5FGCB 4JPWH 1I7UB 3D69A 2Q86B 5HPMA 1FE8L 1WEJL 1TZHA 1AJ7H 4M5ZH 5GGQL 3IETA 1NUDA 2Y9RT 3CXDH 5TFSL 3D69B 3IFNL 3VDCA 5EULV 4UNTA 2W9EL 1TZHB 3EOBA 4WV1B 3TPKA 4TRPH 3MX0A 3SDXF 5H8DA 3SOBL 1I9JL 2FRGP 1PG7L 3MV9B 5F9DC 3QIUD 4XP4L 1PKOA 3EOBB 4HQQH 3SDXA 3ES6A 4YH6A 2RR3A 3HAEH 1BMGA 5JDSA 5FKPA 2FCBA 1N8ZA 1OAXL 5KBNC 5DJAA 4XNMA 5TJWK 5IB5A 3ES6B 3NABH 3O6FA 2V2XA 5JDSB 5I1JH 5FKPB 2VAAB 3V2AR 2BVQA 5CKGA 1CDUA 1N8ZB 2IAMC 4I2XA 3ULVL 4YXKH 4H1LA 2V5MA 5DJAB 4XNMB 5FYLE 3MBXH 1HH6A 2BY3A 3MJ7B 3O6FB 2V2XB 3V6FB 2BVQB 2CK2A 3O2DA 4GAFB 3C6LD 1YEHL 4H1LB 3VA6A 5C0NC 3IU4H 1HH6B 3N1FC 1AGCB 3QDAA 1RZIA 3NVQA 5BZWA 3QWOA 2EXWD 1S7VB 1EERB 2AK1L 2V9RA 5EUOE 3BO8B 1IKFH 2MMXA 3L5WA 4GMTH 1BGXH 4L29A 1RZIB 5EWIH 1MCSA 3F6IA 1NMCB 2AV7A 1UACH 4OT1H 3RIFK 5FGBC 3L5WB 4L29B 1U95A 2P5EE 2AV7B 1SBSH 4OB5L 2NY1B 4P9ML 5DO2D 1U91B 5I1GH 1U95B 4PJHF 4UV7L 4K8RD 3L6FA 1IBGH 4HBCH 3HB3D 4ZUVA 3KR3H 2OMBA 4PRIA 3TBYB 1A7NL 5KVGL 4X7TA 1JRHI 3L3OA 2F8XC 3N1PC 2ARJB 3CMOH 3KXFE 4ZUVB 3RIFF 4PRIB 4X7TB 1A6VL 3L3OB 2DQJH 2D7PA 3QI9C 4KU1A 4G7YH 2R15A 5DTFB 3RRQA 4F15B 3E6HA 5IF0A 5KANG 2EDLA 2NX5D 1XGTA 1CXLA 1F4WH 2VL4A 1CGYA 1HWGB 1MJ8L 3DXAD 5CEXA 4V1DA 5L7XL 2AEWA 1GHFH 1AC6A 3GO1H 1LE9A 1KIRA 3E6HB 5IF0B 4U6HA 1XGTB 1EEQA 1X5KA 4MNGA 4X9FA 2Q8BL 5CEXB 2CDGA 3DO3A 4U3CA 4JQXC 2DLIA 1LE9B 2BSSA 1ES0A 4RAVB 4U6HB 3TO4B 4Z18A 1YMME 1MCOH 4MNGB 4OGAC 3ARFA 4M7KL 4Q6YA 5D5MA 1T1WA 3C5SB 2VDOL 1TJGH 4EI5D 1KJ2H 2D31B 1V5JA 4AYFA 2BSSB 2AQ3A 2ADGB 1ES0B 4JO3L 3TBVA 2B5IB 1F3RB 4G7VH 5ECJE 1HYSD 3MLVH 3ARFB 4XTRC 5D5MB 3QEGH 4LPWA 2KZ1B 1T1WB 2Q7YB 4HLZG 3SO5A 3IJHA 3TBVB 2DIJA 4E42A 5FIEA 1H5BC 3BGAA 5JXEA 4L1HA 3FRPG 3C5ZD 3O4OB 2FZ3A 3IJHB 4EIGB 3MV8A 3LEXA 2BVEA 4E42B 2JCCA 2VDNL 4XCNA 3EJZC 5IHUL 3K1KC 1LHZA 1JZ4A 1NSNL 5CIPB 3NCMA 4NDMA 4P23D 3MLZL 1S78C 1I8IA 2FZ3B 3LEXB 5DXWA 2JCCB 4XCNB 4HIXH 4K9EL 4D8PA 3PP4H 1I8IB 1TVHA 2PCPA 1WAAE 5DQJA 4XBEH 1BVKA 1Q0YH 2IBZY 4D8PB 1IE5A 2Y6SC 1TVHB 5I1EH 2M26A 2PCPB 5I74C 5DQJB 4RA0C 4BK5A 1BVKB 3V0VA 4XMPL 2DOCA 4KFZC 5IP4A 3KJ4B 3V0VB 4PGJA 2IGFL 4WW2A 4OZ4A 4C59B 3DX6A 1JNNL 4LOUC 5KJRH 4PS4L 4PJXF 3FAXA 3GJFB 1Q72H 4WW2B 3KPSA 4LMQE 4OZ4B 4OI8A 3DX6B 4AEEA 2PW1B 4NN7B 4PJXA 4PJ9C 5EORH 4NRYB 3RVVD 1I75A 2J3SA 1NGYA 3BMWA 5DA4A 3VGFA 4JPWL 1ZGLA 4PJXB 2HG5B 4H8WH 3T4AA 1PY4A 2GJ6D 4M5ZL 1QYGL 43CAB 1NGYB 5CIPH 2QEJA 3MRMA 3VWJC 2C5DC 3TYFA 5DR5H 2HJKB 3T4AB 2ADIA 4TRPL 3CSPA 3NZ8B 4ONOA 3MRMB 4HKZA 3UPCA 5DD1L 1FNAA 1RIHL 3EUUA 1KEMH 3TYFB 1X44A 2ADIB 3QIWD 3IF1A 5CCKH 4Y5YC 1ZLWH 2BXZA 5B4MC 3V6OA 4HKZB 3I3DA 5J11C 4JN1H 1S8DA 4M6NL 4JQVC 2NX5E 4OKVA 2ZPKL 3IF1B 1RJYA 1KLGA 4P4RB 3QDGE 4Z7VF 4IOFD 5I1JL 2BNQE 3K8MA 1SEQH 2NR6D 1RJYB 1IGCH 3GSNB 2NY2C 5I1LA 1KLGB 2ICES 4AY0A 4Z7VA 4RCAA 1ZT1A 3MRIA 4PYGA 1PZUB 2M8XA 4NT6A 2A9NL 2Z31C 4UDUA 3ARPA 3GJFH 5I1LB 1ZT1B 3MRIB 3RUGF 4QRPD 4NT6B 1T20A 5E03A 4UDUB 3RUGA 1ZKAA 1IKFL 5L9DH 1BGXL 1T20B 3C08H 5EWIL 3MLSL 3BP5A 1ZA6B 5GS0C 4JFFD 3RUGB 1L7IL 4OT1L 3MUHL 3G5XA 1YEKL 2BVOA 3BP5B 3FOMA 3CFCL 3WKML 2WQRA 5DD3L 2UUDK 1Y18A 2XIDA 5E2TH 4F7MA 5I1GL 4KUCF 4J1UA 3FOMB 1EVTC 4HXBL 5KW9H 5A3ID 3TNNA 3KR3L 2IFGA 1G1YA 4F7MB 5IT2L 4WGWB 1KJVB 5IJKA 4J1UB 4HAFA 4YDLC 5FYKH 2J5LC 5JXAH 2F19L 3TNNB 1X5GA 5AAWA 4F9PA 3C5JA 4NRZA 1JVKA 3CX5J 2DQJL 3GSNH 3U30B 2BSED 5F7DA 3BEVA 3OAZK 3OG4B 1A14H 2PO6D 5C09A 1B0WA 1YJDC 3BXNA 3FFDB 5C0BA 5E9DB 3C5JB 4ZAKA 4NRZB 1VFOA 3OR6A 2EC8A 1OAZL 1L7TH 5F7DB 1AGEA 1QFHA 4MSWB 2R1YB 1BD2A 5C09B 2DQDH 3BXNB 3GO1L 5C0BB 2OJEA 4ZAKB 4OZIE 4L8CA 2HFTA 4C55A 3O6FD 3KPRD 1BD2B 4FFWC 2VZSA 3QRGH 4JEGB 2OJEB 4JAMA 5A16A 4D9QD 4M02A 4O58H 4EDWH 1MCOL 2I5YH 4L8CB 5ITBH 4GBXA 3Q6GH 1KJ2L 3F58H 2J8OA 1BVLA 1MQ8A 3G6JE 5A16B 2GJ6E 2W91A 1MHHA 3PIQA 1N4XH 4WWKA 3HI6H 3QEGL 4Q9QH 4GBXB 2AS5M 1MAMH 1BVLB 4KXZI 3L3HB 3ZZ1A 3PIQB 1ZVHA 4WWKB 3KPNA 4FFZH 3CDYA 3V79C 3Q48A 2A77H 2FIRT 2ZCHH 3KPNB 4FQCL 4OLVL 5SV4A 2NY1D 1H8OA 4PB0H 1EO7A 2UV3A 1AE6L 3A6OA 2NY6C 3K4ZA 1F11B 4OF5A 1NCAH 2IAMB 4GRMA 4KPHH 1INEL 2VXSH 1VB9A 3AU1A 3VRLE 4TTDD 2OI9B 3PWNA 4MA3A 4CGTA 4POZD 1L6XA 1U3ZA 3G9AB 4YQXL 3KPQA 3C2AL 4GRMB 4XCFH 5LGHH 3AU1B 1FZMB 3PWNB 5I1EL 1IQDA 4PRID 3CUPA 1F58H 3KPQB 5I15H 1CR9L 3DECA 4MJ6A 4JO4H 5I8KH 1MCRA 2A6DB 1IAII 4QRPE 1LK3L 5K9JL 4XBPB 1IQDB 2LAAA 1DL7H 2UUDH 2C1PA 4NJ9H 3AMLA 1AFVH 1LP9E 4ELMA 3TWCL 1DP0A 4OAWA 1FIGH 3A6BL 1PKQE 5E0QA 2C1PB 3ZKND 4X4MA 3VGEA 4ELMB 4N8VA 2D7TH 3O3DA 4Y8DC 4V1DD 4YX2H 5LGJA 4OAWB 3MLWL 1G0XA 3BZEA 4R8WL 3ABZA 1CDHA 4N8VB 3O3DB 5LGJB 5FGCE 3S34L 3DUUA 1YMHB 5BVPL 2FX8L 2UWEB 1HINL 2G5RA 4XNZC 5I66B 3BZEB 1GAFH 1FH5H 4LAQL 3ARFD 1R5VA 4LFHG 1J0IA 3ALWA 4PJ8D 4WHTA 3WFHA 3TF7C 5CEZH 5IQ7H 3RP1A 3LN9A 4N8CL 3TBWA 2HFGH 3MV9E 2ZOKA 2K1MA 4WHTB 5JXED 5JUEH 5T3XL 2BMKA 5EU4B 2ZG3A 2ZOKB 1T0MA 3MV8D 4JN1L 2EZ0D 2MHAA 5I8OH 2YWYA 3SDXE 2O26U 2VERN 3ARWA 3CCHA 1QSZA 3MLYH 3F7RA 2BMKB 3MXWH 4LNRA 1T0MB 3HC0A 5GHWH 2MHAB 3CCHB 5IHZA 1DBBL 1H3XA 4WTZA 4X7CC 3QQ9D 5A2KH 1IGCL 4OGZA 4NN6B 3VRIA 4OTXH 5IB4A 5J89A 2L7UA 3QHFL 1UH3A 4LNRB 3HC0B 1NCBH 2DWDA 1QOKA 5CILH 4D9QE 5IHZB 2E8ZA 3VRIB 2VWEE 5IB4B 4NO0A 2DWDB 5KOMC 4Y19A 4PGCA 1H5BB 4DKAA 1HZHH 4XAKE 3IFPA 4YHPA 3ARXA 4NO0B 4JR9H 4Y19B 4PGCB 1U3JA 3C08L 3S5LG 4K3JL 3IFPB 4HX1A 4H88H 2WSKA 3RWEA 4DVBA 5L88L 4IBLT 2N7AA 3BYTA 4DJMA 4WUKL 2KDGA 1U8IA 3KPSD 4GXUM 4HX1B 4KHXL 3RWEB 3N9GH 2FECI 2CUHA 5FDWA 3RA7L 5E2TL 1CQYA 2WAHA 5JZ7D 1U8IB 1XT5A 1DVFC 1RZKC 3ZL4L 3CC5A 5CJXA 3LKSA 3QEQA 1Z3GL 5KW9L 5FDWB 4YDJA 4GKNA 2DQFA 3LKSB 1J0ZA 3QEQB 4EIZC 4PRIE 4W6YB 1MJJA 4YDJB 4DK6A 3BE1H 4GKNB 3IDNA 2I60H 2PTTA 3VFMA 1A14L 1RAMA 2Y5TA 4YNYA 1E4JA 1ZSDA 3O6MH 2VRAA 2D0GA 3KGRA 1L7TL 3U6RA 4FQXA 2PTTB 3VFMB 3UBXB 3RPKA 2Y5TB 2H3NA 4YNYB 4I3SL 2ZUVA 2DMCA 1J87A 4Q9CA 4BZ2H 4WI4A 1MFEL 3LVEA 1P84K 4V1DE 1A3RL 3U6RB 4FQXB 4RGMC 3UX9B 4HLJA 1QFWL 2H3NB 4MNGE 2BNUA 2X4QA 4O58L 1EUTA 4EDWL 4W6XB 32C2A 5ITBL 5LWYL 1CG9A 1B3JA 1PG7W 2KL6A 2CLVA 4L9LA 1X3DA 2BNUB 2X4QB 2P8PB 5D5ME 4S10A 2E6PA 5HHOD 4KZDL 5EUKA 32C2B 1CG9B 3EGSA 4L9LB 1MAML 1Y6NR 1N6QH 5F1SA 1H3PH 1H9VA 1Z9OA 4Y5YB 5EUKB 1OP9A 4DUWA 4JB9H 3EGSB 4K7FA 4ZTOH 1R0AH 1XIWA 2NXYC 1YYLH 4V2CB 1QP1A 1MCWW 2ZCHL 4LHQB 3SO3C 1GOFA 4JZNB 3B9VA 2W0KA 2V9QA 4K7FB 4MB4A 3MV8E 4PB0L 4YUEH 3WBDA 4WCYH 2JCCE 1QZ1A 1KCSH 1BQHG 1Q38A 2NY2B 5BV7L 4RMVA 5FV2A 1WF5A 5GXBB 3HNTH 4NWUH 1EA9C 3QXVA 1X6LA 4UOW0 2Z31B 1N5AA 4XCFL 4FABL 1HQ4B 4PREA 1G7IA 4KUCD 4KK5C 1F58L 5C6PB 1B88A 4POYA 5JQHC 1N5AB 4BQCA 1A4JA 2VDRL 4KC3B 4P3CL 5I8KL 5I15L 2WBJD 3SHSA 2DQEL 4PREB 1Q9OA 1G7IB 1MUJA 4PY8J 1DL7L 1UWEL 3NFPA 4M5YL 2FBOJ 4H25B 4J3SA 4E41A 1P7QD 3LZFH 4KK6D 5HGAA 4R90H 5C09D 1MUJB 1MCCA 4LKXB 1WFTA 3NFPB 1D3CA 1U9KA 4ZAKD 1S9YA 1P6AB 5CSZA 4NKDA 5D2LF 4HKBA 5SX5K 4OFPA 4YX2L 2DTSA 1BD2D 4WGVB 5F1KC 2BDNH 3BAEH 1B9ZA 4C54A 4LHUA 1S9YB 5D2LA 4KUZH 3KPSE 5CSZB 4NKDB 2BERA 4HKBB 4ZS6C 3BVNA 2BXYA 3HNSH 2XZQL 1RULH 3LKPA 4PJXE 4JDZA 4YBQD 3P3YA 1J0YA 3EYOB 5J3HC 1JRHL 4LHUB 5D2LB 3SE3C 3S36X 2AAVA 4WFFD 5B8CC 2NLJA 2XZAH 4UV4L 4NC1E 2VR5A 4GBXD 2DLHA 3LKPB 1NC4A 2APBA 3QUML 4JDZB 2J5LB 2NQCA 4TQEH 1JHKH 4WWKD 5CEZL 2NLJB 4KDTA 1SJVA 5F88A 1NC4B 4PY7B 3RNQA 4LVOC 4KI5C 3LKOA 4ZOEA 3NBNA 3L5XH 5F7FA 2R8SL 3I6LD 1MSPA 5FYJD 5D7JA 5GJTH 3RNQB 3CVIL 5I8OL 3LKOB 4O9HH 4R3SA 4GOSA 4WI8A 5K59F 5FYKE 3MLYL 2DM3A 5D7IF 5D7JB 3WIIH 4AEHH 1IVLA 1NFKA 3MXWL 2GTWB 4PJGB 1G9EA 4ESKA 2XKNA 4R3SB 1DSFL 4ODXA 5D7IA 5GGTL 3JUZA 2FX7L 5IHLB 4CJ1A 2C1OB 4OTXL 5GS0H 4P2RA 2OL3L 5IBLC 1TXKA 1E6OL 1F4YL 1NCBL 5ILTH 3FZUD 5CILL 4W70A 2XKNB 1QPPA 4ODXB 3MFGB 3OWEA 4TPRH 4Z7VE 4KTEH 2JJUA 3NA9H 4P2RB 4A6YH 5D9SB 1JPTH 4G6MH 5MHSE 5T1LD 4Y16C 4G8FA 4ZQKB 2VDPL 3WO3B 3SDAA 3RTQD 4R0LA 4K2UH 3RUGE 1TCMA 3OHXA 4LCUA 1IM3B 2OCFD 4G6KL 4OV5A 4PGDA 5IOPB 3FQTA 1J11A 2NY6B 1J1PH 5EO0A 3SDAB 1JNLL 3Q2CA 3HA0A 4P2CG 4HUWA 5HI4C 3QCVH 4HWBH 2VYRE 4LCUB 3JVGA 4OV5B 4PGDB 3N9GL 2VN4A 4X6CB 4Q58C 5EO0B 3DJ9A 1UZ8A 1YJDH 1X4YA 1FAIL 4H26A 2ED9A 4HUWB 3T3PE 2ZNWA 4QGYA 1RHFA 2QR0A 1U3YA 4MD4A 2CMRH 4H26B 1C8PA 1F5WA 1HE7A 4XI5D 2QR0B 5KSAD 3OZ9H 1NGXA 1SJHA 4MD4B 4XNQB 1RZGA 1WIUA 4PP1C 3UTOA 1NGXB 1SJHB 3U1SL 5E8EB 4U1KA 1NGPL 1W2KT 2G60L 1P5VA 5C09E 5C0BE 4Y2DC 3UYRH 5DEGA 4U1KB 4G8EA 3ZMRA 1HCVA 4KKLD 1BD2E 5HHVH 3LS5L 4JREC 4J23A 4XNZB 4Z0BH 3HR6A 3MSPA 4G8EB 5INDA 1MCJA 1TQBC 2E6QA 5IB2B 3V6ZA 3QT2A 4IRJC 2GSIB 5INDB 4N90D 1MCEA 4WFFE 5F8QC 4RA3A 4EBQH 3V4VL 1FNSH 4XPGL 3LQAC 1NBZA 4NO0D 5GGSA 2HT3D 4F8QA 1OHQA 5LBSH 4XVJL 1QBLH 1M6OA 2DQUH 2FJFA 2FR4A 5J12C 4JB9L 5I2IA 1S78D 3CD4A 1NBZB 4ZTOL 5GGSB 2K7PA 5TE7H 2EDWA 4GG6F 1MCQA 2I07A 1OAKL 5FCUH 2FJFB 5FYJE 2FR4B 4FHBD 2BRRL 3VDBA 4GG6A 1PBYA 3R4DA 2G5BA 4NM4H 5GISL 1KULA 2I07B 4KZEH 4WCYL 1KCSL 5KANI 3GRWL 4NGHL 4K3EH 5GZND 1JPSL 4X8JA 4GQ9L 3WLWC 3O9WA 2B2XH 2NY3B 3RY5A 5T5NG 4NWUL 5T5NF 5ALCH 4X8JB 3QEQD 3O9WB 2DQGH 5GGRY 3DRQA 3KPLB 5HI3D 3HHRB 5E6IA 3IXTA 2B4CL 4IM8A 2PETA 3DRQB 4JO2H 3RNKA 3A67H 5E6IB 5D1QD 1X5LA 3BP7A 3QEHA 2JLLA 4WI5A 4G42A 5IMMA 1CU4L 2ICWB 4QGTA 3UZEA 3RNKB 4ELME 4R6UA 5IFHL 3D5OF 3FTGA 1FGVH 4FQXD 4N8PA 1U8KA 4DTGH 5IMMB 1RVFL 4X4ME 4HWUA 4KUZL 1RUQH 2JTDA 3FTGB 2YUXA 3HNSL 1OM3L 1RULL 1U8KB 3OF6A 4N0FA 2R0KH 1DR9A 2J1KA 2V17L 3GI8H 4XCCH 1EHLL 3M07A 4N0FB 4TQEL 4YZFF 3BZFA 4NNYA 2W1NA 1GGUA 5C0AA 5I8EB 1VEMA 1A3LH 1WLHA 1EGJA 2BOBB 4P49A 1D9KD 3CZJA 4XNUL 3FQNA 3D25A 3BZFB 4NNYB 2BHYA 3TM6A 4OCXL 4LP4A 5C0AB 3GIZH 4MQXC 4TSBL 4BELD 1XIWD 2NY7L 3FQNB 3D25B 5C9JA 1JK8A 1Z2KA 4LEXH 1WTLA 4YJZL 4ISVB 4RISL 3ZDXE 5KVDH 3W11D 4RGMB 4D2NA 1UXWA 1GXEA 1X5JA 1DUZA 1JK8B 1XGRA 4XNXH 4KJWC 3EYFA 1Q9WA 3RDTC 3EFDL 1NDGA 1WIPA 1UXWB 2UVFA 1DUZB 1BJ1H 1DANT 1XGRB 4ORGA 4Z5RA 1XGYH 3AREC 3NIFF 3F7VA 5HYFA 3X3FH 4LP5A 4HJJL 1ED3A 1NDGB 4A6YL 4HZAA 4N90E 4WHDA 2J4WH 4ORGB 4Z5RB 3S3PA 4ZXBC 4LCIL 4HIEA 3F7VB 3KHOA 1TQCB 3REVB 1RZKH 1ED3B 1LO2H 2NXYB 4JPIA 4Y19E 2IEPA 4E41D 4D0DA 4PLOB 4HIEB 1BF2A 2P5WA 4JPIB 4D0DB 4L8DA 4BQ8A 1C5CH 4KJQD 5JLZA 3MRKA 4HWBL 5IBTL 2P5WB 2OS7A 1DQQA 2B1HH 4WTXA 1MCHA 4PJBF 5IMKA 4ETQB 1T5WA 4UIKH 4U7KA 4LHUD 4L8DB 1MFCL 1KPUB 3J7HA 3PHOA 3MRKB 1UKTA 1W0YT 5AYQA 5JLZB 1XMWA 2X1QA 2FL5A 4PJBA 1DQQB 2YBRB 3O3AA 5IMKB 2R1WA 1RURH 5JW5A 3PHOB 1VPOH 3QEQE 1IAIL 2FL5B 1NC4D 4PJBB 4UBDC 1QLRA 3CJJA 4G9FA 2QSCH 4OFKA 1DBAH 1OW0C 2R1WB 2YRLA 2BSTA 5F96H 1J9CT 5FO9A 3T4YA 5JW5B