4RBPH

Crystal structure of hiv neutralizing antibody 2g12 in complex with a bacterial oligosaccharide analog of mammalian oligomanose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
220
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2G12 light chain
publication title Crystal structure of the HIV neutralizing antibody 2G12 in complex with a bacterial oligosaccharide analog of mammalian oligomannose.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 220
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rbpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rbpH01
2GT9B 5A16A 4X6EB 1UACL 4F15B 1CL7L 3MNZA 3X3GH 3R06A 4UTAH 1AI1L 5IB3B 2IPUG 2V9TA 1FO0A 1VDGA 1UWEL 4PR5A 5D4QA 1ZOXA 5CCKL 3P77A 4NKMA 4F9PA 4HJGA 5B38B 2XQBL 1FL3A 1UG9A 1K8IB 3K2UH 3KPLA 4I8DA 5FUCE 3H3BC 3MXVL 1T80A 5A2FA 1VKXA 5ISZB 3PXHA 3QXUA 4U3HA 5SWSD 4PG2C 1YDPB 1JNLL 4H5SA 1NFKA 3JV4B 3WFHB 3D85A 5D1QD 4M62H 3AMKA 3L3HA 4FQXA 2MPAH 2D2OA 5FFLA 4O58L 2R0KL 3LKOB 1CD8A 5IHUL 1F4YH 4UDUB 3V95A 1XGYL 3GBNL 2AJVL 1HOCA 5FIEA 4JANA 3TBYB 1A7RH 1KB5A 2YRLA 5A3IC 3BP5B 3OZ9H 4Z77B 3EDJA 2R56H 2E7CA 2P45B 1EEQA 5E08L 2R23B 2DDQL 3O45B 1I1YB 3BMVA 2UWEB 5JORA 1NKRA 3QJHB 3WE6B 2BNRD 3KLSA 4QT5A 4QRQB 2D4DA 2VOTA 3VXMD 4NQDA 1NC4D 5FGBC 4OFYA 4HFWA 3HG1D 2XXMB 3BISA 3N0PB 3TFKD 3FOMB 1CD0A 3ARFD 1A6AB 3TBSA 4BH8A 4RZCA 3PUCA 3B9KD 3QH3B 5SWSA 3GJFA 5F3BB 4QHLA 1CIDA 1LHZA 4WO4B 4KUZH 2QBWA 2J3SA 4JQVC 5D1QA 1SYSB 1JK8A 4G3YH 4NDMA 5MEPA 1RIUL 1LO2H 4IRJA 3G6JA 3HZVB 4Q6IB 4GO6B 4PG9A 4HH9A 3PP3K 4PFEA 3E8UH 1YQ2A 5E94B 4M6NL 5I9QB 3BRDA 1KIPA 5HHPB 5BZDA 2A6DA 1IAMA 4G7VL 3SDAB 1MFBH 1A9BA 3OGCB 3MRIA 4QTHB 3V6BR 5GS0L 1GCFA 1I8LC 2MQCA 5DURD 4K3EL 5CBEB 3QDMB 4XMKL 2QADC 5FYLE 4O51A 4JHZA 2DRUA 3VXMA 1AGFB 1CS6A 1JMXA 2WW8A 3D69B 3ME0A 4I0PD 5HJ3B 3V0WH 3WS6C 4J8RA 3UCRA 3HG1A 3O2WL 1A0QH 5HGAA 3NN8B 1GGCL 3ARFA 3MLXH 5MERB 4NFCA 1N7MH 3B9KA 1D3CA 4TSBH 4I2XA 3VWJB 4TNWK 5CKGA 5IVOA 5GGRY 5ADOL 4QYOA 4DVBA 1Q0YL 3VD3A 5EOQL 2QQKH 4L4TD 2IH3B 3ZDYF 2Y9RT 1U8HB 4GAYB 3CC5A 3RVXC 3OKDA 1SVZA 1F8TL 4Z7VA 1QRNB 4NKOB 4APQC 3GDBA 1KIUA 1MCJA 4PY8J 4YBHA 4W4NA 1JPTH 4U1IA 4YHIA 3ARBA 1ZTXL 4GKNA 1IGYB 4PV9A 4YHOH 5I1LA 3U0WH 1YMHB 4CGTA 2VC2H 1B0GA 1V3LA 3G08B 5FHBL 3T0AA 4I0CC 5CEYA 4NRYB 1NLDH 3U4EB 1T83C 1BIIB 4I0PA 3IAGC 1N5YL 3MXWH 3P30H 4J3WA 1DQLL 5FDWB 1V3JA 2Z31C 2GJ6E 4PJ9D 2P8LB 3JWDH 3DIFB 1FSKC 4Y4KA 4WJ5A 1MHHB 1HHHB 1OAKL 2CXGA 4HMEA 4UV4L 2DLFL 3GSWA 3AB0B 12E8H 3RWJA 3QHZH 1TENA 2FGZA 2J8UA 2C3VA 1L6ZA 2NTFA 1Z2KA 2FECL 3CFBA 4L4TA 3LKRA 4LSQL 1GPOL 3VRLF 4EUPB 2UYLB 3MRGA 4YR6B 3HMXH 1KTLA 1I9IL 3EOBA 4D2NA 3GBMH 4S1DC 5D5ME 2CKBH 1S5IH 3RGVC 2E6PA 4PJIA 3L3IA 4YHPB 4PJ5D 1OAQH 5H35A 1CT8A 4JKLA 3VA6A 2FB4H 5FB8A 4PLNC 5DD5L 2EE3A 1VGKB 4RFEB 2FEEL 2AK4D 2VZTA 4KK6D 1M7XA 1RZGB 4WCYL 1TJIL 3D0VB 4I18A 2ICCA 4XC1L 4CL7A 5C0CB 25C8H 4DKFL 1NJ9A 1AIFB 5D1ZC 2OTPA 4M6OH 4BFBD 3OR6B 1MI5E 4HC1A 4GUPB 4PJ9A 3THMH 3VFOA 3KPRB 4R4ND 2C1OB 1ZA3B 4BH7A 4F8TA 4HZLA 4JPKH 3WFEH 3DUSB 3L5JA 2PO6D 1WBXA 1RJLB 4OGYL 2FSEB 3E6HA 4NQVA 1FZJB 2W91A 4LEOB 3M1BA 5EZOH 2VXQL 2Q3AA 4XMLH 3REWA 4JO2L 2XG5A 1IM9A 1P6AB 1U8NB 5GRUH 4MCZB 4N0RA 5M94B 1SM3H 3RTQA 1KCKA 4FQLH 2DJ4A 1I1RA 5TH2A 4HWZA 2VAAB 3F5WB 3SKMB 1JUFB 1CLCA 2EYRB 4TULL 4U6XB 2NY5C 1H3WM 1IFHL 3CAFA 1WAAF 2WMPA 1D9KD 2PXYD 4XAKE 4GAJL 3U9PH 1MJ7L 5I19H 5IVZA 1ZSDA 3L3JB 5ECJE 3IDMB 1I8MA 4K7PY 1IAOB 4OQTA 4WUUA 1UM5L 2GY7B 1NEZG 2VZ1A 5HYSA 5DYOB 4EIGB 4HWNA 3MSPA 2EH7L 4P5KB 5J11B 3O4OC 4RNRA 4G6ML 3ROLB 5BS0E 1HIML 1EHAA 3A6OA 5C0FA 3H3PL 2GI7A 4Z7NF 1MHEA 3W11D 4JG1H 3LQMA 4DKDC 5IK3B 2PO6A 3SJVD 4MA3A 1I7ZB 3CU7A 2VUOA 4GRLC 2IFGA 4AYFA 1XGTA 5EIQA 2X2YA 5DFVD 2YC1A 2VTFA 3WUWG 1RQ5A 4X7EC 4XVUC 3MLTB 2JJVA 1RK0A 4WFGD 4G8GD 4G5ZH 1JP5A 1RUKH 3QIBD 2P8MA 5LXGL 1MCHA 3BEVB 4OF6A 4C56E 4K9EL 1L9NA 1R3LA 4LLMA 4XNMB 5CEZE 4NNYB 1ZK9A 4YLQT 1D9KA 2F19L 3PDOA 1NGWB 1HILA 4L4VB 3DHMA 3T4YA 2WBWB 3RIAK 5FYLH 5A2KH 5HVHB 1R5VB 1XCQB 3TT3H 3MRRA 1A1OB 1BVLA 2QSTA 3GSVA 2AJUH 3UTPE 4NZUH 4Q9RL 2F5BL 5KSVA 1MFCH 3RNKA 5KSAC 4GG8A 4UNUA 3FFCD 4HIEA 4Y8DC 5BV7H 1TDQA 1PKQB 2VZUA 3QEUB 2X42A 3V8OA 4GW4B 5IB2B 1OGTB 1S7RA 3HCVB 3SJVA 2WANA 4P4KD 4NQCD 2BFVL 3CUPA 4LLAA 1B90A 4PRHD 4KK5D 5IFJB 4X6CF 4NO5B 3MJ7A 3EYSL 4X9GA 1T7VA 3TYFB 4QRPD 1A21A 5F72S 2CD0A 2VISA 4G8GA 3IJHB 3KPTA 3QIBA 4HMCA 2AEPL 3LN5A 4YO0A 1A5FH 3HA0A 4WTZG 2X09A 5CIPA 1KIQB 3TEUA 2DQFA 3HS0A 3ES6A 3MLZH 4XCEA 4NNPL 2D0GA 1L9MA 4YBQD 4R0LC 2BOBA 1PSKL 3D2UB 3RUGA 4RIRB 3BKMH 1NFDA 3X11A 4DGVL 1JNJA 3QNXB 4NFDA 4U7MA 1RZIB 1T1ZA 4LCWD 2D0HA 2EDOA 1QFHA 2GY5A 3I6LD 5LAXA 1N8ZA 2VKXA 3RNQB 5EU4A 1MHCA 4Z76A 5AUMA 2DQEH 2OL3A 2BVTA 4P23A 4JZOA 3BDBA 2HLAA 3HE7C 5FV1L 3P9LA 4N0FA 4LNRB 4P4KA 4X4YB 4PRHA 1TVDA 4MAYC 3VRIB 5DRNB 1AP2B 1AQDA 5ITBL 2IAMC 5ESAA 1LO0H 2KH2B 1BF8A 3QEHB 2GJZB 5J0BA 4M43H 1SQ2N 3ARDD 1N0XL 1JNHB 5GS0D 1DLHB 5I8EA 4JFDD 1RMFH 4NQXB 1FBIL 2Y06L 1DUYB 5DK0A 4BM7A 1OM3L 1JTTA 1FRGL 5IMKA 1ADQH 3QI9C 3PIQA 4RAUB 3SGKA 1MRFH 4HUWA 3H42L 4R96A 5DZLA 1FJ1B 8FABA 1RUAL 5DJAA 4OCWL 2NY6D 1WBYB 4B0MM 3R0NA 2HH0H 4OM0L 2X4UA 1G7IA 5I1HH 2QADB 4Y5VC 5KS9B 5T3XL 1NCBL 3TN0D 5EFIB 2YPLE 3GMNA 1P7KA 1NUGA 3BUYB 3HTLX 4XVSH 4AEIL 2MTPA 2ADIA 4XP5H 15C8H 5C09E 4RGOH 4MWFB 4ZOCA 3LQZA 3FB5B 3QA3B 3VCLB 2NXZD 4PJ7B 2VQ1B 1IGJA 4OCXL 5D6DA 4RA0C 5DJZA 3X13A 1FFNB 3EAKA 3VXTB 2BRQA 1R3IH 1M7DB 4L29B 4J4PD 3MRPB 4QRUB 5D7KE 4N90E 2A9NL 1S7QB 3NCBB 1QSEE 3D39E 4XAWH 1GC1L 2L0DA 5C6PB 1PZ5B 4YHNA 4JFDA 2NNAB 1P5VA 2VDQL 2ADFH 2FH6A 3O4LE 4H26B 4P5MB 1MVUB 1JZ5A 3PWPD 3FO2A 3HR5A 5SV3A 2DQDH 4FQJH 2B8OT 4X7TA 1KTRL 2BDNL 4LSUL 3UZQA 5D93C 1FDLL 3U0TA 2OP4L 4MQXD 3SEPA 4L8SA 1LK3L 3EHBD 3Q3GA 3V0VB 2CDGB 2X4SB 5IWLA 3UPRA 3NFNA 3BGMA 5CP7A 5FUOH 1YEFH 3Q48A 4WI4A 4LQFH 2FL5A 1FSKB 3MV7D 4ZAKD 4KKNA 4CMMB 3E1F1 1HEZB 3VH8B 4X4ME 3VGGA 3L6FB 1LO3H 1U41A 3K8LA 3Q6FA 1DLFL 3IKCA 5C0GA 3MBED 4H8WH 1KXQE 4QXUH 2NX5B 1H5BC 1HSAB 1RUML 2IPTH 5FKPA 1HINL 3KPSB 4WNQA 5MP6H 3T77A 3EJYC 2H41A 1KGCE 2GITA 1ULVA 4FQQA 2A74B 4FOMA 5INDB 1D7FA 1YEJH 4FXLA 4MA8H 5AZEL 5H37G 3INUL 4PRBB 5C0IA 5CGTA 4G8FA 3U30C 4U1SB 3PWPA 3LEXA 1BZQK 4DVRL 5FO8A 2YSSA 4LP5A 4AH2B 5FECB 1BFSA 3KYOA 3I02A 3QUMB 1EBPA 4ETYA 1HQRA 4ODBD 1ZGLP 3MOAH 4QKXB 3KYMA 2HJFA 1HH6A 1YMMB 5C07A 4Z8FL 2AXHA 1GVIA 4TUKH 1YEKH 4J3UA 4CVZA 3BPLB 3NA4A 5ERWB 5TDOB 1OB1B 4MJ5A 4NJAL 4UOW1 2CRIA 1OAXL 1H0DB 5D7IB 2ZUWA 2RCSH 3O8XC 3MV7A 1UH3A 5I1EL 4JLRB 3LB6C 4U6VH 3TJEH 4N0CD 4ALAL 2HVKB 1FVDA 5CGYC 1NGXB 1CE6A 1RURH 2AJYL 4OCYL 2Z0BA 1Q9WA 3MGTA 2ZOLA 3ZLQC 3EW3B 4DCQB 2X1QA 2R1YA 3MUGB 1YPZE 1X6LA 3ILPB 3DURA 5EBLB 3EYFB 4F9PC 5DMKB 1AHWA 5L88L 1YN6B 3PQYD 3ZKND 4PRPB 3V4UL 2EIDA 5IFHH 4NC1E 1CFNA 3RWHA 4NQTA 2EDJA 3DXAD 4WDIA 3W82A 2F53D 2WLZA 1PEWA 3NCYS 2ADGB 2YZ8A 2Y07H 1RHFA 1GAFH 3NCEB 5I1CL 1PYWA 3IU3A 4XC3H 5F7YC 4KQ4L 2YD2A 3GIVB 5AD0A 4RMRA 1CI5A 1U91B 3JTTA 5E8DH 3UZVB 4PUBL 2H32B 1CXLA 3LSOB 3BWAA 3MPCA 2ZG2A 4XI5C 3DV4B 1AFVL 2A1WH 5D7SL 2OM5A 5E5UB 3QPXL 1EPFA 1AD0B 4GMSH 4L3ED 5F96L 2FDBP 1YY8B 3BXNA 2FIKA 4GKZB 1U9KA 1TJHH 3M8OH 2VH5H 2GCYA 4G9DB 1HXMB 4TUJA 3FO9B 3AAZA 3BIBX 1E6JL 1D5BB 1YQVL 3AS1A 1PJ9A 3GMQB 1F4XL 1NQBA 5GGSB 5D1QC 4DN4H 2VXTL 4HPOL 1KJ2B 5DF0A 3WEXA 2PTUA 4JM2F 4RDQF 1LK2A 5E99L 5EWIL 2R0ZH 3AC0A 3KPMB 1PLGH 4MQTB 2F54E 2AAVA 4WV1C 5FA3B 1CE1H 4X99A 3IDNA 4EI6A 4GAFB 3HNTL 3OXSB 4OZGE 5KSAB 4Y19B 1P9MA 4JREB 5IP4A 3MREA 4OD1H 4IOIB 2AXGB 1MIEL 1OTTD 3OHXA 4LLQA 4F58H 4W6XB 3B3IB 3MUJA 3ZE1E 1IC5L 3CVIH 2AV7A 1SHMA 2X1PA 1JWMA 4K8RL 5D7LB 2OK0H 4L3EA 4Y8AA 3V4PH 1TNMA 4GMTH 3ULUL 1MCRA 2O5YL 5DEGB 5HHOD 3L3GA 5SX5K 1EO5A 3CPLA 1URLA 5JDSB 1RK1B 1WEJL 4HX1A 1JGUL 1F6AB 3PGCB 1RD6A 3BEWB 3TFKC 2IFFL 3S4SB 3RA7L 3ARFC 3E3QC 4GRMA 3LPWA 5DJXA 4QRTB 3B9KC 1MCOH 1P4BH 2XG4A 3BPNC 3F6LA 5IB5A 3ZE0F 4RAVB 2F58L 4MB4A 3BO8B 3C6LB 5DGQA 5A40E 4NQEB 5J4MA 4R0LB 2F9BT 4RGND 4EIZC 3GNML 2EC9T 4MDIB 1M6OA 4OFPA 2AEIT 4TSCH 1BAFH 4HSQA 1BGXL 3LRHA 1BOYA 2QKIA 3S97C 1MFNA 2BNQE 1TLKA 2ORBL 2GW5A 3BRFA 1RZJL 4AENB 3MNWA 3P4MA 3T4AA 5KOVC 1KLGB 1J5OH 3BESR 5GPRA 1VEOA 1I8KA 3H9SB 4DFIA 4R8WL 3WBDA 4YHKH 4MAYB 1DFBL 3MRFA 4JFOB 5LGKA 5DRXA 3WL9A 2OBGA 4JFED 4TNWF 4I0PC 2BVQA 2EDYA 1DUZB 4XT1C 4LLYA 3JTSA 1CU4H 1DR9A 2HP4A 3PWUA 1F5WA 1QLEL 4OLVH 1V3MA 3RWDA 1S7TA 4U1MA 5HGHB 4HXAL 1M05B 2R1XB 4F7PA 4OGAD 5T3XD 4N9GA 2CIKA 4NYLA 4O2EA 4PJAA 2H26B 3QQNA 1AO7D 1OP3K 5HGDA 3LKNA 2FNBA 5EC1A 4XPFL 1MJJA 2ARJQ 4D0DB 4OLYL 3LIZL 1ZGLM 1XIWD 4PJFA 1FFPB 1E6OH 3CDGA 5DC9B 3V5HB 4Y5VB 1P1ZA 3BSZH 1QVOB 4HFUH 4X8JA 3RI5K 3X3FH 3L3DA 5TE6L 2KDGA 5EN2A 2V7HA 4LPXA 3LHPH 4DOHB 3CU1A 1S78C 5B22A 4U1KB 2CR6A 1QHPA 1KENL 3WIHH 4NZTH 4PJ8D 4YDJA 5IV2B 1CGTA 4HBCH 1ZANH 3O6LL 5D6CB 5C9JA 4HUVB 2PYEE 1N2RA 4I18C 4Q9CA 4JJ5A 1ZT4A 1IQDA 1FNAA 1BD2E 5T3ZD 3ZDXF 1EVTC 4D9RE 4MX7B 3W2DH 3DWTA 1IRAY 4M1GL 1B6UA 5E8OA 1MWAH 1TZIA 1FNHA 4RQQA 1XT5A 3B9DA 4PJ9C 4BZYA 1SMAA 5AG9A 2MOVA 1XF5A 3EYUH 1CR9L 3HUJB 1WWAX 2VDLH 4KKAD 1OAYH 1NKOA 2QSCH 4A6YL 5CJQH 4NT6A 1AO7A 3GKZA 2J6EA 3C2SA 4P9HC 2VLJB 1NLBH 5J8OA 1UZ6E 4N8PA 5GHWH 2AEQH 2VLKB 1EGJA 2NXYD 2I26N 5D93B 1CXFA 1VA9A 3G6DL 2CJUH 4I5BB 3SPVA 2PW2A 4UU9B 3SDDA 5F6IC 1MCKA 4UT7H 1IGTB 3I84A 1R24A 3WNOA 2AJ3A 4PJXB 2V2WB 4KK6C 1T1WA 2LAGB 1DANT 1FL6A 2W92A 2YD7A 4NM8L 2QR0A 4HC1L 3TBVB 4OKVB 4XRCA 1A02N 2GAZA 4GW1A 1H5BB 1QRKA 4R7DA 2XN9E 5EU3B 3LV3B 1JGLL 3BJ91 4JVPA 5DJ0A 3OF6D 4YXKH 3F58H 4R4NC 1K6QH 5DVOA 4V2BA 1K4CB 2ICWI 4FTVE 4GBXD 4PRNA 3SDCD 3OKNA 2PO6C 2VLRE 4JM4L 3U30B 5JXAL 2W07A 1QOKA 3OMZA 3W39A 3UTQB 1F97A 2ZSVB 4K3JL 4LCIL 1XF4B 2B1AH 5T33L 1NAMB 3DX9B 4IRSD 3QEQE 2GTWB 2JCCF 2CGRH 5CHNA 3X14A 1QFWM 2NY2D 3A6BH 4GS7C 1KPRB 3MFFB 4GAGL 2WUBL 2RFXA 3EFFB 1GGBH 2XZQL 4KVCL 1XF2B 4XP1H 5BO1H 2FJHB 4ZFOA 3O8XB 1D9KC 2PXYC 5EZIH 1NGPL 2OLDA 4Q9QL 1MCNA 3NAAL 4CW1B 2EDTA 1ZLWK 4PJHE 2IADA 4DGIL 3QDGE 5A16B 4QRSA 4L9DA 3C08H 5H37H 1C5BH 1VESA 3VFPA 3OF6A 3MNZB 3Q5YA 3R06B 2VXVL 4PR5B 1FO0B 5KAQG 3F7PC 2ZCLH 3K4DA 3MBXH 3MCLL 1G7HA 1IBGH 4NKMB 1C16A 2R15A 3W11C 1FL3B 4GBXA 1S7SA 3KPLB 1E28A 3EOYG 1VKXB 5L9DH 1BQUA 3G5XA 1EAJA 4ODSL 4H5SB 3STZA 5GRJL 4AQ1B 1TVBA 3D85B 4QXTA 3L3HB 4FQXB 2IBBA 4QHMA 1T22A 1ZHKA 1JV5A 1QFWH 1V7ML 3QIBC 3QR2A 2FBJL 3QXWA 2HN7A 3CFDA 2QHRL 2MQ0A 2L4OA 4LLUA 2MHAA 2WBJD 1UXWA 1KXTB 2OZ4H 2H2SD 3REVA 1HOCB 3P0YL 3WJJA 4JANB 2E27H 4LEXL 2IJ0C 4DW2L 1KB5B 1G9MC 4KXZH 3GJFK 2J4WH 5JORB 4RMQA 4CVXA 4ZUUA 5JPNA 5E5RB 3STBA 4DN3L 2Z35A 4QT5B 1FORL 5IGXH 5JIPA 2M2DA 4JDTH 4NQDB 3MLRL 1GH7A 1T0PB 3OKLA 3P11L 4UOJA 4Z7UE 3NCMA 4HFWB 4ZO9A 4OLEA 4P2QD 3RU8H 4PYHA 2X9WA 1UZ8A 2OR9L 4P23C 1EUUA 3BGFC 1EHLH 4P4KC 5E2TH 3TBSB 4BH8B 2FRGP 4RZCB 3TO4A 3KHOA 5SWSB 3GJFB 2VWEE 3ARGD 4KK5C 4QHLB 2GK0A 3C60D 5D1QB 1JK8B 4NDMB 1VGEH 1NL0L 2XTJB 5MEPB 4IRJB 1AR2A 4OLUL 2FX8H 3G6JB 1ORQA 3S88H 3KG5A 2NW3A 1F02I 4YHZL 3S96A 1XMWA 2WBJA 5IBTL 4HH9B 5AWNH 1RV6X 2W0KA 1J1PL 3OG4B 4NWTH 4LRNL 5BZDB 2OCFD 2A6DB 3FN0H 3IU4H 1A9BB 3MRIB 4YBQC 3SN6N 1P6FA 1BJMA 4Y89A 2PR4L 3MACH 3P9MA 2BNRB 5B4MD 3N1PC 2FZ3A 4O51B 4LSVL 2HRPH 4OT1H 3VWKD 3EYOA 3VXMB 1NCAH 3H9YA 1J0ZA 4BZ2H 1SEQL 3HG1B 2KZ1B 3MRDA 4JHAL 3O3EA 2YD6A 4F57L 4GLRI 4U3CA 1V3KA 5HGAB 4ODUA 5T5FH 3CH1A 3ARFB 3GRWA 3EJZD 2K1MA 3B9KB 1MIML 1SY6A 1QUNA 1J11A 2AI0L 3ARGA 3T2NL 4I2XB 5IVXE 4HKXA 4QYOB 5KVGL 4DVBB 1G6RL 1QG3A 3ARDC 3CC5B 1QD0A 1S9YA 4NJ9L 5F8RC 4Z7VB 4YHML 4RX4D 1RUPL 2UUDH 3WIIH 1RAMA 5IOPA 4U1IB 4R26H 4TUOA 3SCMD 4YHIB 2IANA 4E9LA 1NGYA 4Z78A 1K5NA 4GKNB 3ETBF 4PV9B 5I1LB 4OCRH 3VFTA 1T66D 3O0RL 2NY6C 3JVGC 2APFA 4GXUM 1UKQA 5DURB 5I1GH 2ZJSH 2XNAA 1OQOA 1B0GB 4N8VA 5DD1H 5BZWA 5CEYB 4NO0D 3TN0C 1RZKH 4L8SC 2DKUA 5D2NA 3B2VL 1I3VA 2C4XA 4ZDHA 4I0PB 3ZYJA 1X9QA 5IWLC 4G7YL 4FABL 4R90H 2NLJA 2LE9A 3MRQA 1RZ8B 4YDLB 4LP4A 5C7XL 4LLVA 3HPJA 4WJ5B 2NXZC 5L7XH 3GMOA 4L8BA 4XB7A 4RISH 3GSWB 3RWJB 4KKCD 1F13A 4B7LA 3RX8A 3C2AH 3E2HB 2J8UB 2C3VB 2NTFB 5IR1A 3X3GL 3CFBB 3FQXA 3UYRL 3I2CH 3LKRB 4L4TB 3QULA 3MRBA 3MRGB 1KTLB 3EOBB 4MYWB 3VXNA 3P40A 3SCMA 5K59F 4PJIB 3L3IB 5F8QC 1JNNL 4JKPH 4GW5A 5H35B 1CT8B 5CZVL 2ZWLT 1F4WH 3G5VA 2P5ED 5FB8B 1TITA 2JIXD 2FD6H 2VRAA 2W9DL 4WY7L 4KRLB 1TMCB 4NO0A 4I18B 5JW4M 2JB5H 2Y5TA 2R1WA 3BPOB 1NJ9B 1WFOA 3EHBC 5F9OL 1ZLVK 1LE9A 1KOAA 1CDYA 4PJEE 1U8MA 4MNQA 4PJ9B 2R56L 4PP2A 3VFOB 4U1HA 3I9GH 4BH7B 3WDJA 4HZLB 3BKYH 3LKSB 4OLXH 1A6WL 3MBEC 1WBXB 3AU1A 5IBUG 4V1DD 2YA1A 4MLIA 3E6HB 4NQVB 1LEIA 2ZCHH 1G9NH 3M1BB 4NQUA 1IZJA 2A77L 2ITDA 5EO9A 3H3KA 4X5XA 1CXKA 5EC2A 1YYMH 5ALBH 3IYLW 2BVOA 1IM9B 2D4FA 1A22B 1AHWC 4Q9BA 4XPTH 3RTQB 1ZLSH 3R1GL 3V8CA 5KTEH 5TH2B 1CK0L 1IEBA 4HWZB 1KEML 5F6IB 4ETQA 1FNEA 3WSQL 4KUZL 2YD5A 3T0EA 1N4XL 5DTFA 4G3YL 1B4JL 2ED8A 4DUWA 5TPWH 2JIXA 5DS8A 2AGJH 2DQUL 5IVZB 1ZSDB 2WAHA 4QNPE 5DT1L 1J7VR 3N9GL 1YEIH 3VDAA 3JV6A 4LSDA 4WUUB 4PB0L 4OJFL 5HYSB 4YDKH 4X5WA 3AS2A 1OHQA 5CUSH 1FP5A 4MJID 4RNRB 4L9LA 1GYAA 1JHTA 1IAIM 1INDH 3HZKA 3MLUH 3B9AA 3BW9A 1BOGA 4ODTH 4AEEA 1MHEB 4N0CC 2QHLA 2PO6B 1NAKL 1ROWA 3VU2A 5DMYA 5IROA 3BD4A 1XGTB 4P9ML 2BJMH 1W0VA 3QDJD 1HHKA 2YC1B 1RK0B 1AKJA 3ZKNC 4IIQA 2P8MB 4GS7B 3BP7A 3BYYA 1TJGH 4YXHL 2DOCA 1QBLH 1R3LB 5D1XA 1E4XL 1KT2B 4YH6A 4CVUA 2QQKL 4PS4H 1F58L 1D9KB 2PXYB 3PDOB 4YDVA 1HILB 1AC0A 3T4YB 3KR3H 2AJXL 5IESH 2VZ3A 1HXYA 3MRRB 1NANH 1BVLB 1M7IA 3GSVB 2GUOA 4OFIA 4KJQD 5KSVB 1SBSH 5EU6E 3RNKB 2R8SH 2W0FA 3SQBA 1KACB 3X17A 3KXFD 4GG8B 1IKNA 2P48B 1J10A 3RDTD 1IAIH 1U3JA 4HIEB 2JELL 1FAIL 2EC9U 4OV6F 1S7RB 3SJVB 4CBPA 5C9KA 4JN2A 3CUPB 1FV1A 4ZUSA 3QCTL 1YUHA 1FQ9C 2BVYA 1IC1A 5I30L 2EDBA 3ZZ1A 3GSNA 3NFPA 3MJ7B 3QDJA 2FX7H 3OXRA 3DYMA 1VPOH 1PKQE 4FMFA 4NHUA 4XP6H 5F7LB 4TVPL 3RGHA 1UM6L 4HUMB 4G8GB 3QIBB 3B43A 2VXSH 2Y7QA 3UJIH 3QQ4A 3ZE2F 5L8JB 3VGDA 3UYPA 1H8SA 1X44A 4Y5XC 3LN5B 4YO0B 3BMWA 5CIPB 2DQFB 3IFLL 5IB1B 3W81A 3HS0B 3ES6B 4XCEB 4RWHA 4S0SD 4M48L 2BOBB 5CGMA 2X4RA 3RUGB 1OCWH 4NO2A 3QWQB 1NFDB 3X11B 3QG7H 3VG0H 1WAAA 1MAML 3VFGH 3PGFL 4OI7A 1T1ZB 4NM4H 2YKLH 5LAXB 4ZTOL 1CXEA 3KXFA 1N8ZB 4PBVC 4OCSL 3RDTA 5EU4B 1MHCB 3EDKA 4Z76B 4MHHG 2DICA 5AUMB 1OTTC 4HJ0D 2OL3B 3MLSL 4IMLA 4OIBA 4P23B 3T0XA 4JZOB 2HLAB 4ZS7H 3P9LB 4N0FB 3QNZA 4LCYA 4P4KB 5D70L 1BQLH 3E6FA 4NQCB 4PRHB 2DJSA 4JKMA 1WIPA 1AQDB 5ESAB 2YXFA 4XXCA 4O00A 5DJDA 5JPMA 1YEGL 4X4ZA 5E8PA 1W72L 2WQ8A 4Y1AD 4OZGF 2R29H 1IGFL 4HF5L 5TFSL 3ULSA 3VW3H 2O93L 1FGNH 4QHUB 4OZHE 4AEHL 5I8EB 3WFEL 1SEBA 1LO5A 2RR3A 3WUZA 2VLME 3ZE1F 2H9GA 5DK0B 1DBBH 5FCSH 3PIQB 4PJBE 3BZDA 4HUWB 4EI5A 4R96B 4XNYH 2EYTA 1KCVH 3K3QA 5DJAB 1DN2A 3UTSA 5GRUL 4OZFA 4P2RE 1NUDA 2X4UB 3RY6C 1G7IB 3UBXA 1L7IL 5JHDA 2D7OA 3GMNB 5DI8A 2EE9A 2WWKT 2C4FU 1P7KB 4MXWH 1I1AD 3W9DA 4G80A 5I17A 2ADIB 5JUEL 5KS9E 5I19L 2F8XC 3JWOH 3LQZB 1IGJB 4P2OA 3X13B 5DJZB 2BRRH 5B3JF 5DQDH 3KJ6H 4HJJH 2XACC 4ORZC 2NR6D 4R3SA 4NSKA 1XH3A 4YJZL 1KCSH 3QSKB 4X6CA 2ED7A 1AY1H 4PJ7E 5DJ6B 1IM3B 4YHNB 4JFDB 5ADPL 1S9XA 2DI9A 5FUZH 4KI5E 4YUEH 1YEHH 4OGAC 3KLAA 1XGQA 4F8QA 1ZEAL 1S7WA 1UCBH 3FO2B 3HR5B 3VGAC 1OARL 1EHXA 1XIWC 2VJXA 3W0WD 3BKJH 1WF5A 3U0TB 4JRXA 4M7ZC 4B41A 4WEBL 4L8SB 2OI9C 4UV7L 4X6BA 4UINH 1QZ1A 2BSSA 3KPPA 3Q3GB 4XBPA 4NCC1 3NFNB 3BGMB 5CP7B 4W70A 4PJ8C 4OTXH 5F1KC 5I16A 4U4BA 2FL5B 5DJYA 3TT3L 1E4KA 3MZTA 2OTWA 3A6CH 2AJUL 4OBSA 1SYVA 4LU5H 5GGQL 1MVFA 4LKCA 3Q6FB 3IKCB 1SMOA 1MFCL 5C0GB 1RJYA 5EOCH 5FKPB 4WNQB 1CL7H 4ZUTA 3T77B 1LE5A 1AI1H 2GITB 3ZO0A 4FQQB 1UWEH 2CXKA 2J6EL 2YD9A 5CCKH 5EA0L 2G5RA 2YWZA 2XQBH 2NY7L 4KKAC 4FXGA 4POUB 2D3VA 1H3UA 5C0IB 3MXVH 5L8KB 3UTTD 1LDSA 3KPSE 1EGJL 1X5KA 1J0HA 3LEXB 3PWPB 4R4FH 5FO8B 2YSSB 1JNLH 5GS1A 3KYOB 1N64L 4KTYA 3I02B 4MD4A 4S1QH 2NXYC 4O58H 3KYMB 5IHUH 2HJFB 1ETZA 1HH6B 5C07B 4AEFA 1XGYH 1NEUA 3RPKA 1A5FL 1YYLH 4CVZB 5C0EA 4PTUA 5LWYL 4MJ5B 4JFZL 1T5XA 4Y4FD 3H9ZA 3OAZK 3MV7B 4CU8A 1R0AL 4Q6YA 5E2VL 3BKML 1UZ6F 4UBDD 4WTWA 3T04D 3BGAA 2DDQH 1TCMA 1FVDB 3K7UA 2QJDA 1CE6B 1Q9WB 1RU9L 3MGTB 2ZOLB 3QAZC 1YC8A 3IVKA 2PETA 4I77L 5F7EL 2R1YB 3BQUD 3BN3B 2VDKL 1IE5A 4JZJA 3DURB 4UTBL 1AHWB 1AJ7L 4GBXC 3SDCC 1CFNB 3RWHB 1HKFA 4HWBH 4WDIB 4KGLA 4HH8A 2VE6A 3L3KA 3R0MA 4LARL 3N06B 3HAEG 2DKSA 3VXRD 5MEQA 2G9HA 1B3JA 1JN6A 2VDNL 4IRSC 1PYWB 5F88A 2GKIA 3IU3B 4BKLB 2NY2C 5AD0B 4E41A 4G9FA 2HLFD 1FCCA 3MRHA 4FP8H 1Y0LA 4QRRD 4XH2B 3JTTB 4M6NH 1MRFL 3FT3A 3FB7A 5B3NA 3DRTA 4Y4FA 1RJCA 5C0BE 2HT4D 3GMPA 3U0PB 3BWAB 2AABL 1Y6MR 4MJ4A 1U8OA 1ERNA 4K3EH 4XMKH 5JA9A 1BZ9A 2ITCA 1A6VH 5FGCE 4ONOA 2XZAL 3BXNB 1KIRA 1F11A 3BE1H 2FIKB 1PX3A 2VR9A 3O2DA 3O2WH 2O5ZH 4NZDA 1KN4L 3DO7A 2Z92A 2E9IA 1GGCH 2GCYB 3JZ7A 2XWJA 4TUJB 4F9LC 1D5IH 3DXAB 1OP5H 1RZ7L 3AAZB 4R97C 4Y2DD 3IXTA 5ADOH 1LO4L 4MXVE 1Q0YH 5EOQH 3WEXB 3FFDA 5F7NC 2Z93A 1LK2B 2JJTA 4AG4H 5J6HA 4MJ6A 4J6RL 5HVWA 1F8TH 2VB5A 4Q74A 3O3AB 3WNMA 1V7NL 2YMXL 3QUXD 4MD0A 4X99B 2WBJC 3IDNB 1A7QH 4EI6B 3G6JF 2H2SC 3BZ4A 1EVUA 4FQJL 3TVMA 3GGWA 3MREB 2R0WL 1ZTXH 1VFUA 4X8XA 3OHXB 4LLQB 2DLHA 4PRID 3T2OA 3EZ8A 2FX9L 2AV7B 3EYVA 4MNGB 2FLRT 4G42A 3T2QA 1D6VH 1JWMB 1BPVA 2JE8A 2KL6A 4L3EB 5HI4D 4U1GC 3KLDA 5LJYH 1BQHA 4XXDB 3LQAC 4X80H 1N5YH 3OJMB 1A3QA 4EOWL 1UGNA 3L3GB 3CPLB 4HX1B 4EVNA 3RY4A 1FYTD 1LO3L 3IDXL 4GRMB 1I3RA 1OAKH 4Y5XB 3BIKA 4UV4H 2DLFH 4BUGA 2APWA 2MJWA 3B8YA 5CAYB 3ARGC 4KRPD 4QXUL 4X6DA 4Y16D 5IB5B 3C60C 2P5WE 4LSQH 4LPVA 2V5TA 1GPOH 3NOIA 5C08E 3BAEL 3C9NA 4JCLA 4NZRL 2HYMA 1OTUD 4NRXA 1M6OB 4U7KA 1WUNT 4MA8L 5GRVL 2QKIB 3PWVA 3PXJA 4NQEE 3IDYC 4HIJA 5HYEA 2LU4A 3DI3B 3MNWB 1PGRB 4PRIA 5DD5H 3V7AG 3TT1L 3T4AB 1EIBA 3QCVL 1I8KB 3P0VL 4WCYH 5B4MC 4XC1H 4TUKL 5EO1A 3MRFB 5DRXB 4P3CL 2W1NA 3VWKC 3WL9B 4DKFH 2BVQB 5T3XE 4I3SL 4LLYB 5J3HD 4JVUA 3JTSB 3VFVA 1NMBH 1SY6L 2KUTA 5JQHC 3U2SA 3PWUB 1NUFA 1ZT7A 4HIHA 1FYTA 4U6VL 4OCMC 2IEPA 1S7TB 4U1MB 3EJZC 4XMPH 4L1HA 3CVHB 1RURL 2BZDA 3VXSE 5ACLA 4F7PB 4Y16A 2FJFA 4N9GB 2CIKB 4NYLB 3VA2C 4O2EB 4PJAB 1MHPH 5HGDB 3HI6L 4Y88A 3LKNB 1IQWL 5EC1B 5E7FA 1H15A 1MJJB 2VXQH 4XHJD 3NPSC 4S1RL 4JO2H 3KPQA 3C5ZA 3QPQD 4M9OA 4PJFB 4UT9L 1LEGA 3CDGB 1P1ZB 1CQYA 2DN7A 4HS3B 4JM2A 2VKWA 3L3DB 3O6FD 3QH3A 3QUMH 1OLZA 5EN2B 2V7HB 3SCMC 4TTGA 1A6TA 2OXHA 5IVXF 4TULH 4KK9C 4M02A 1LQSR 1S9VB 1IFHH 1ITCA 3DV6A 4PJIF 4YDJB 2C26A 4GAJH 2OMNA 5C9JB 1RZFL 2EDDA 1J87A 3L7FA 1N2RB 1DVFD 4DOHE 1ZT4B 3SKNA 4JFEB 5DVNA 5F7DA 5KN5A 1I1CA 5E8OB 2EH7H 2FO4A 4Q0XL 1TZIB 1MOEA 3OGCA 4RQQB 2VYRE 4G6MH 5DR5L 1HIMH 4G6AD 3RWCA 3H8NA 3WYRA 1JGVL 1XF5B 3H3PH 4QHNA 3VFSA 2A1WL 3V52H 2DQJL 4XVTL 5JTWA 2N1KA 4GMSL 4KKCC 5DJCA 3UPCA 1AO7B 2R4RL 1QEWA 4W81A 5KSBE 5KAQF 3VGAB 3DHJA 4Q58C 1II4E 3K0WA 5FYLD 1R3JA 5MERA 4M7ZB 1QA9A 2NY5H 5DFWH 5LXGH 2B20A 4Q97A 4K9EH 2E9WA 3SPVB 2PW2B 4XCFL 3SDDB 2ESVA 1CVSC 2EDRA 1R24B 1DQML 2B4CC 1J8KA 2AJ3B 1UB5A 3B83A 2F19H 1KV3A 1T1WB 2EXWD 4HGKC 1FL6B 4LDOB 1YJDL 2GSGA 2QR0B 4XRCB 5DSCA 2BHZA 2GAZB 3Q5TA 4GW1B 4XX1G 4P5TD 4R7DB 4PJXE 3V6OC 3MRKA 4PBXA 2VERN 4KC3B 1B2WL 4JFXA 4ZODA 2X70A 3CVIL 4WFEE 2XV6B 1QFPA 2XKSA 4ZOBA 2PF6A 5T1LD 4PRNB 3VXUE 2ATPA 2BFVH 3OKNB 3Q1SH 2OK0L 5F7UA 2I25N 5CZKA 4XNQB 1BHGA 4N8CH 5F9WB 4ELKA 5EORL 2AQ1A 3W39B 1L0YA 3O9WD 2PYFA 4X9BA 3DSFL 3NTCL 3W9EA 4XPAH 3L3OA 4PJEF 2NXYB 1JL8A 2X4OA 5FKAA 2Q87A 5CHNB 3X14B 2ID5A 1KJ2H 3NZHL 3UXFA 3S35L 2D7TL 3HHRB 2AEPH 4ONGH 2B39A 3V7AE 1NC2D 2RFXB 3BDYL 4ELME 1JZ8A 2GJ6D 1F6LL 4X6FA 1SJXA 4NNPH 4ZFOB 1UH2A 2MKWA 5F1SA 1BBDL 1PSKH 3MA9L 4TSCL 1BAFL 3B5HA 1GOFA 2VSDA 1FL5A 2IADB 5J57B 2V2XA 4OFKA 4C57C 1X5AA 1U6AH 4QRSB 5ABDE 2W65B 3B6SA 3VFPB 4PBWD 1IKNC 5IHBA 4PRAA 2EIEA 1RSFA 1J5OL 1G7HB 4Y5YA 4U1LA 1C16B 2R39A 4GBXB 3P4OA 1S7SB 4HKJA 5IUSA 4PGDA 3SDCB 2V9QA 4QNPF 1FLRH 5C0CA 2DKMA 7FABL 3G5XB 5EULV 5ITBH 3STZB 1TVBB 4QXTB 1FIEA 1YNKL 2ZUTA 5DLML 1HCFX 4QHMB 1T22B 1ZHKB 1JV5B 1N0XH 4K94L 4DQOL 3EDFA 4O2CA 4QOKA 2HN7B 3FHQA 3JV5A 1FBIH 1MI5D 4LLUB 1OM3H 1FRGH 2FSEA 4JVWA 4UAOB 5IEKA 2GJ6A 3REVB 1J0YA 1T1XA 3UP1A 3ARVA 1RUAH 5SX5H 1UC6A 4OCWH 4G43A 3WO4C 4OM0H 3ARRA 4U6YA 3X3FL 4CVXB 4ZUUB 5JPNB 3MRCA 1NCBH 2Z35B 4KJQC 1T5WA 3SKMA 3OKMA 4R2GD 2G5BA 5DMIL 3RDTC 3OKLB 4AEIH 2D7MA 5D5MA 1UZ8B 3S36X 3GSNL 3HAEH 3ZYOA 4X9FA 4JY4A 3RL2A 3S3SA 5JZ7D 2WINA 3TO4B 2PCPA 3QUZA 3LDBC 4LHUG 3W2DL 4XXCC 2GK0B 4WHDA 4XAKD 4N0UA 4ZXBA 3T0DA 1AC6A 1YECL 3ULUE 4LHJB 4GRWE 1GC1H 1ORQB 3HB3C 2VDLL 4F7MA 4X5LA 3HI1B 2NW3B 1XR9A 4OB5L 5IK3A 2VDQH 3S96B 4OI8A 2WBJB 4X0KA 3QRGH 4GFTB 2CK0L 3MGAA 4N0YL 5DUPH 3NVQA 2JCCA 5BS0D 2XTJE 4D0BB 3EO1A 8CGTA 1T7YA 5E4EC 4RMUA 1JTOA 2VR5A 4XX1E 2D9QB 3C09C 3NH7H 5TF1H 4LSUH 1FDLH 3P9MB 2OP4H 2FZ3B 4BQ9A 1LK3H 3EYOB 4Z7OE 1OP3H 2VO5A 3BHBA 4OLZH 1OSZB 3PDDA 3CK0L 1NGWA 3HZMA 3MRDB 4HJ0C 3EFDH 3FAXA 3O3EB 2PKDA 1LP9E 3KGRA 4L4JA 4C56D 3MA7A 4ODUB 1I9RL 3CH1B 1NCDL 4JGMA 1FZMA 5ACZA 4L8CA 1Z3GL 4R4BA 3ARGB 1DLFH 5CEZD 5H94A 1KLFA 1DSFL 4HKXB 4YXKL 1S9YB 3WO3B 3C6SA 5J6GB 6FABL 2EO9A 3UTPD 5MENA 3QYCA 4I2XE 3TNMB 2YPVL 2XKNA 2BVUA 4M3KB 5AZEH 4L5FL 5AAWA 3INUH 5IOPB 4TUOB 4NN6C 3IDYB 2IANB 1NGYB 5HY9A 4DVRH 4Z78B 5I71C 1K5NB 1BBJA 2YUZA 4XCCL 4Z7VE 3RWFA 3VFTB 3DVNA 4JQIL 3FQNA 4N8VB 5BZWB 4Z8FH 1I3UA 1IKFH 1XF1A 3CIQA 4OZHF 1CLOL 5D2NB 3VWKB 4ENED 4ZDHB 3CSPA 1GGBL 1KIQA 3RZCD 1I1AC 4M1DL 2J7LA 5BO1L 1OAXH 3V6FA 3BWUC 4PJBF 3AUVA 3U46A 1U2CA 4C56A 3MRQB 5TF0A 5K9KB 1E4KC 1P53A 4LLVB 4CNIA 3HPJB 4ALAH 4NNXA 3GMOB 4L8BB 1UADC 4J12A 4BQBA 1MEXL 3U4AA 4OCYH 1CDHA 5IR1B 4RMSA 5FGBA 5GS2H 3FQXB 3MRBB 2NR6C 2ZCLL 1IBGL 3ZDZE 3FT2A 3R4DA 5GZND 3VXNB 5L88H 5HDOA 5HDBE 2ZUUA 5E9DE 4X4YA 4IEFB 3SCMB 3T2PA 1NAMH 3GMLA 4JQVA 3TP4A 4GW5B 4FFVD 5GS1C 3G5VB 1JI1A 4FZ8L 2GFBA 3F7QA 1QFWL 5EPMA 5CSZA 1JNHA 5I1CH 4J7RA 4NO0B 4KQ4H 3A67L 4LKXA 2MCG1 5F7MC 2E7LA 1U3YA 2Y5TB 1TXKA 3V0AC 2R1WB 4MLSA 3S37X 3RZCA 5F93C 4CKVX 1LE9B 2E27L 3ORJA 2X9XA 3TGXA 2YEZA 5JQ6L 4PUBH 4MD5A 1U8MB 4MNQB 1I8LA 5BOPA 1WBYA 4PP2B 1XGUA 2ZUSA 1KYOJ 4I9WD 5GRXG 4WI9A 1TCRA 1AFVH 4JFFE 3AU1B 3QPXH 5F96H 1LEIB 4YFDB 2UZIL 5J12B 2ITDB 3F8UB 5EO9B 4I13B 3TZVD 4X5XB 5EC2B 2EECA 2BVOB 4NUGL 1EHLL 3HC0A 3QA3A 3NIGE 3QIWD 4XHQA 2YPLD 4WIQA 2J1KA 1ZLWH 3UTZA 1FFNA 4TQEL 4NFBA 1IEBB 1T89C 1M7DA 2EKJA 1BFVL 1E6JH 1FNEB 5DTFB 5FF6A 3WHE0 1F4XH 4RFNC 3P4LA 5C09D 2JIXB 3IS0X 5DS8B 4HPOH 3S3PA 4M93C 1WC7A 1RVFH 5EWIH 2WIIA 4K2UL 4HT1H 4PGCA 4APQA 5DWUH 1F90L 3JV6B 5EBGA 5D7KD 4N90D 4S0TD 4X5WB 1MREH 3HNTH 1QSED 3MV8A 4Y4FC 3GI9L 3RAJL 4L9LB 5LGJA 1MIEH 3HZKB 3BW9B 4UBDC 5E56A 3O4LD 1BOGB 1IC5H 2XTLA 4WUUE 4XBGA 1FN4A 4OZIF 3IETA 1FHGA 4OT1L 4K8RH 4WW1A 5K9OA 4BZ2L 4F37F 1B9ZA 1GOGA 5FM5O 1W0VB 1NEZA 2O5YH 2ZUYA 4WGWB 4GRWH 5T1KD 3ULUH 2Z31A 1OT1A 3BQUC 3OSKA 1WEJH 2XA8L 4FQ2H 1HEZA 4YEEA 2YPLA 5L8LB 4IIQB 3DROA 3OPZL 3BP7B 4PJDE 1WFNA 2EKSA 5GISL 2E7BA 5D1XB 5DFTA 3ZKMD 4NZJA 2F58H 3NIFF 3EO9H 1N3NA 3SQOH 2DYPD 3DRQA 4YDVB 4CMHC 1G1YA 5INDA 3GNMH 2JJTC 1HXYB 1NUNB 3WUWA 1R5WA 2J8OA 2WK2A 3EOAA 3RGVA 1M7IB 2D03L 5I15L 1BGXH 1HHGA 2QV2A 2HLFC 2GQHA 4G8IA 1QSEA 2W0FB 5JXED 1KGCD 2DQHL 3D39A 5J56B 5L6YL 2HT4C 4EDWL 2ORBH 1RZJH 1DE4A 4P46D 5FGSA 5HVFB 3UBXI 5CLTA 5A2LH 4JN2B 2YBRA 1FV1B 1DFBH 2RJMA 3GHBL 3O2DL 4ZUSB 5CWSA 5D1ZA 2CK2A 3ARED 3GSNB 3VMNA 1HKLL 3NFPB 3QDJB 5T1KA 3MLWL 4R90L 5EU7C 4NHUB 3QFJE 1QLEH 5D8JL 5DO2D 5JW3L 2Y7QB 3QQ4B 3RJDA 4HXAH 3F12A 2YZ1A 1PG7X 4Y2DC 4CDGC 4DFHA 5DMJB 2K9UA 5L0QB 2DYPA 4XPFH 4GQ9L 4P59L 4OLYH 1ONQA 3ILPA 3LIZH 4XBEH 2BSED 3I3EA 3EYFA 2X4RB 3WO4B 4NO2B 3LZFL 3QUXC 4PYGA 4ZFGL 1PAMA 5JXEA 3KXFB 5E0QA 3RDTB 1WCBA 1JGEA 3BH8A 4IMLB 4OFDA 1NFDE 3CCHB 3JWDC 2F5AL 3O6LH 3QNZB 4LCYB 4C58B 3B9VA 3E6FB 4AM0A 4WI7A 5HI4C 3LDBB 4IM8A 1F3RB 5JPMB 5DJDB 3VI4E 4M1GH 2H32A 5E8PB 4ODVL 2Z8VC 1CF8L 1MY5A 4JHWH 5HD8D 3I9GL 3QJFB 3ULSB 1OWRM 1D5XA 2ZOKA 1EO8L 1P7HL 4OLXL 4NQSA 1SEBB 1LO5B 4GRLA 2H9GB 1H3GA 4KRPC 4Y16C 2EIZA 4XPHL 3DBXA 3QO0A 1YY8A 3FQRA 5JLZA 1G1CA 4EI5B 5I1AA 5E4EB 1MNUH 2EYTB 5ALBL 3WIHA 3UTSB 1OTUC 1IEHA 4OZFB 3RVVD 4U1JB 3OJ2C 4G9DA 3UBXB 1ZLSL 1TIUA 3G6DH 5JHDB 3LS5L 5DI8B 1KC5L 5IM7B 5AG8A 3MCKA 3W9DB 1MWAA 2ZP0T 4G80B 5I17B 3G6AA 3QHFL 4MDJA 5DA0B 5JIIA 2I27N 3ALWA 4YFLI 2AGJL 5FUCC 1GIGL 5C86A 3QNYA 4NM8H 1XGPA 4HC1H 5F89A 3L9RA 4URTB 5CUSL 3G04B 1TZHA 4MAUL 5J3HC 4FQHA 3CLEH 4POZD 2YN3A 4HULB 1ZGLA 1JGLH 4XPBL 1K85A 4R3SB 4NSKB 3MLUL 2F54D 2OR7A 3I75A 4P9HH 4X6CB 3ZT7A 3MTRA 4OF0A 3W0WE 2FR4B 2B1HL 4WW2C 4X9HA 4JO3L 1XF3A 3KLAB 1KPVB 1XGQB 4JM4H 1NMCC 3UJTL 4NN6B 5JXAH 2NY4D 2NW2A 4GSDL 1ZLVH 2AQ3A 2VABA 1S7WB 5DEGA 4ZNCD 5I71B 4D9QE 4K3JH 4XHJC 4LCIH 3RZWA 5IMMA 3KPNA 5JMRA 4KHTL 3QPQC 5T33H 2O5XH 5MI0B 4QLRA 4JRXB 3DX6A 4AK1A 2IWGA 3O6FC 1QBBA 4X6BB 5GGVL 2BSSB 3KPPB 4XBPB 2XZQH 4KVCH 2VUYA 2XPGA 3MLYL 5E03A 1CDBA 4HKZA 5FCUH 4JPWL 4OQTH 5A43C 2I07A 1H3TA 5I16B 1NGPH 2DBLL 5DJYB 2OTWB 4Q9QH 1SYVB 1DVFC 4LKCB 3HNVL 4Y7MA 4DGIH 1KFAL 1SBSL 2R8SL 1TQCB 1W8NA 3UYOD 2BNUA 3VFRB 4OSUL 4ZUTB 2B7DT 4DEPC 1LE5B 2F54A 2VXVH 4G6AC 3HE7A 3MCLH 3QT2A 1P2CB 3H9SA 3LN4A 5HHQA 3S9DB 5EUOF 4FXGB 1GZPA 4OZGA 2BNQD 2IAMA 4Z7WF 1KF9B 2DMBA 3VMPA 2FX7L 4ODSH 4XWOD 5GS1B 5TQ2L 4CADA 4MD4B 3QXTA 1DP0A 2XRAL 1V7MH 2FBJH 1ETZB 4FQPA 1QNZL 1A6UL 3QI9A 4YEFA 4IHOB 5C0EB 4OIAA 4PTUB 2FGWH 3P0YH 3S34L 4Y4HD 1T5XB 4LF3A 3ARWA 4LEXH 4DAGH 1UENA 4DW2H 3CJJA 1XEDA 4JN1L 5BV7C 4M6AA 5C07E 5ACMA 3S5LG 3VG0L 3LRGA 4ESKA 2Z8WC 4DN3H 4P5TC 3SKOA 3IVKB 3FKUS 3MLRH 5FDYA 4BJLA 4OFVA 5F71A 4ZS7L 2UY6A 1O0VA 3VD9A 4JZJB 4Y5YC 1OPGL 4HUVA 4NP4L 2ZSWA 2DF3A 3SDXE 2E8YA 4JQXC 2XYCA 3SO5A 2OZ4A 3T3PE 5E2WL 1JZ3A 2VE6B 5DK2A 4AJ0A 3OKEA 2ZCKL 3L3KB 4MXQD 3O9WC 4HW6A 2WNGA 2V9RA 3VW3L 4M93B 1NL0H 5MEQB 2OJZH 5DJ2A 2G9HB 2PYED 4OLUH 1JN6B 2IQAA 5CIPH 2NCMA 2Z91B 5F88B 3DYPA 3SE9L 2NTSP 4P3DA 3PL6D 1BD2D 4NBZB 4YHZH 4E41B 5ILTH 4D9RD 2YRZA 1DBJL 4G9FB 4IOSD 1X5ZA 5IBTH 3MRHB 1FYHB 4V2CB 4M03A 1Y0LB 5KBNC 2QEJA 1UVQA 3FT3B 4Y4HA 3FB7B 1J1PH 3DRTB 4Y4FB 1KCVL 4LRNH 2C9AA 2WSKA 3GMPB 3WHE1 3U6RA 4BK4A 1A1MA 3MODL 1OAZL 1U8OB 1BLNA 1PX4A 1NSNL 2OL3H 1J8HA 2ITCB 4LSVH 1KIRB 1F11B 1Y18A 1SEQH 4BK5A 2BC4A 4J3SA 4JHAH 3B2UC 4F57H 5C71A 3DO7B 2Z92B 5E8NA 2XWJB 1OQXA 2Q1EA 4LVNC 3PP4L 2AI0H 4MVBD 3T2NH 3KJ6L 3HFML 3WV0A 4HJJL 3IXTB 5KVGH 3VXRB 3RBGA 3SDYH 4CMHB 1XZ0A 3FFDB 1JE6A 1AY1L 2PYEA 3HE6D 2O61A 1FG2A 5J6HB 1K4CA 1CLYL 4MJ6B 2AXFA 3PL6A 2DQCH 4TVPE 4YHMH 1YEHL 3D3VA 4MD0B 4PJCE 1RUPH 2EDLA 2XN9D 1EFXD 4PV8A 1NBYA 3MYZA 3OGOE 2ZKHL 3BZ4B 3TVMB 2PW1A 3FQWA 3GO1L 4UILL 3O0RH 3C5SA 2VLRD 3EYVB 1A7NL 4ZNEA 4G42B 4NC2B 4P3WA 5D7JD 1X5IA 4UINL 2YOCA 3B2VH 4R2GC 5DHYA 1BQHB 3D87B 2QTEA 1MUJA 3ZSSA 3ZKSD 1I8IA 3QEQD 1NBZA 3ULVL 2W38A 4EVNB 1Q72L 4B53A 4BSVA 1VFBA 5BW7C 5C7XH 2BK8A 2H8PA 4JFYA 5BVPL 4B5EA 1I3RB 5JZ7C 3BIKB 2D7NA 5KJRH 1JPSL 4X6DB 5EOCL 3G5ZA 4KZDL 3UYRH 2A73A 3C9NB 4DJMA 2RB8A 3HE6A 1PG7L 1JPFA 3ESVF 4NRXB 4JDZA 4AL8H 5MHSE 3QDGD 3QUXB 3VFMA 4R4FL 3PWVB 4AY0A 3IDJA 1JNNH 1QLFA 3GFUA 4P57A 5J06A 4HIJB 1IT9H 4S1QL 5SWZA 4WEUD 5CZVH 3AY4A 3SOBH 3OAUH 4FTVA 4PRIB 1AGBA 2W9DH 4WY7H 4YPGA 1SJHA 1JZ6A 2VLRA 2IF7A 1MQ8A 4W68A 3VGFA 1H3PL 5EO1B 1YYLL 4H8WC 4KPHL 5F9OH 3VFVB 3RVTD 1P69B 3QEQA 4G6FB 4F3FA 1NPUA 4YC2C 3U2SB 1ZT7B 4HIHB 4Z0XA 1FYTB 5K9QI 1ZAGA 3AMLA 2ICWA 3TV3L 5BRZE 2UVEA 2NZIA 4Y16B 1A6WH 2FJFB 4N1HB 2BSRA 1FPTL 1UJ3C 4F7TA 1H15B 2A77H 4Z7OF 1Z9OA 1UT9A 4DWHA 3BN9D 3KPQB 1N5AA 3C5ZB 1CWVA 4QWWD 1LEGB 1LP9F 2OS7A 4HWBL 4JM2B 5ETUA 4PJAE 3R1GH 1CK0H 1IAKA 1A6TB 1VEPA 1KEMH 3F62A 3WSQH 1ND0A 1N4XH 1OD9A 2QL1A 5HHMB 3F7VA 1B4JH 5F6HI 4PJFE 4DZBB 2VSCA 3DV6B 2H45A 4HHAA 2DQUH 4WV1A 3L7FB 5LQBH 1BWMA 3VJ6A 3DO3A 5DT1H 3BOVA 3N9GH 1L7TL 2BY2A 4OUOA 2Y36L 3U1SH 4FP8L 2E7LC 2XWTA 3SKNB 4PB0H 4OJFH 5F7DB 5KN5B 3RZCC 2V7NA 4LBEA 5DD0L 3GB7B 2VDPH 2FO4B 1R5IA 3RWCB 4QHNB 5HYQB 3VFSB 4XTRD 2BNRA 5DK3A 5IW1A 3F6IA 1NAKH 5EOCJ 1A6VL 4X7FC 5DJCB 3VXOA 1QEWB 4P9MH 3FTGA 1NC4A 3BE1L 3DMMD 3Q0HA 2O5ZL 3OAZH 1WWWX 3WXVL 5K9JL 4LVHB 1TETL 1S5HB 4I0KA 1R3JB 3SGEH 1O5DT 5GZNC 1D5IL 1QA9B 4LSSL 4D9LL 3SDAD 4YXHH 1EXUA 5F9DC 2ESVB 1E4XH 4FFVC 3CXDH 1UWGH 1UB5B 1F58H 1P7QD 3SKJL 4AG4L 3CMOL 1W8OA 4MSWA 4ZOAA 2AJXH 3T8XA 1HYSD 5F9AC 1QYGL 1MAJA 4HK3J 2GSGB 1DVFB 1A7QL 1HE7A 5DSCB 4EEEA 2XIDA 3GEWB 3MRKB 5KOMC 3CMGA 4ZSOA 4DEPB 3FJTA 4QXGL 5GGRA 4JFXB 3LD8C 5GGTL 1WZKA 1CFSA 2X70B 2JELH 2XY1A 1FAIH 4YK4C 1IC4H 1D6VL 1P4LA 5CSBA 2ATPB 4Y0GA 2Z8SA 4ZS6D 3QCTH 2X4PA 3VXPA 4ELKB 5I30H 4X80L 3EZJB 3DMMA 2P4AB 3TZVC 2EYSA 2PYFB 3W9EB 4TVPH 3L3OB 1UM6H 1RZ8A 1AGCA 2X4OB 5FKAB 3QIWC 4DK6A 3T3MF 3MO1A 3RWIA 3PF2A 4JFHE 4CN1A 3IFLH 2EH8L 2P24A 1T7ZA 5JW4Q 1P7QA 4X6FB 1INEL 1I4FA 2YRPA 5BV7B 4M48H 4PJGF 1EJ6A 5IVXA 1DBML 1FL5B 1VEMA 5DDHA 5FYKL 2GEEA 1MAMH 2V2XB 2VL5A 3NIGF 3PGFH 3ZKXC 2IPUK 3B6SB 4ZTOH 4HK3N 4OCSH 3JUYA 1ZHLA 4WFFE 4PRAB 1OF2A 3N1QC 4OLWL 3MLSH 5IKCA 4Y5YB 4U1LB 2H3NA 3P4OB 2R2HA 4HKJB 4PGDB 5D70H 4KI1A 4HCRA 4YZFE 4G6KH 1YZZA 2A9ML 3O9WB 1N6QH 1JHLL 1NMBL 1YEGH 2Q6WA 1W72H 4HF5H 1IGFH 5TFSH 4XMPL 4O2CB 2YD4A 2CRYA 4QOKB 5ICXA 3LKSA 4AEHH 4WVRA 3EBAA 1MAKA 2E5EA 1OVZA 5HI5D 2F8OA 1G84A 1NC2B 3IRZA 1T2QH 1MHPL 3ZKMC 5IEKB 2GJ6B 1G7PA 1T1XB 3EDDA 5TE7L 3GI8L 3KYAA 2I9LA 5DHVH 1UEYA 5FOBA 4G43B 2NPLX 2EEDA 1T3FA 1CFBA 4U6YB 3QUML 3CXHJ 3MRCB 1L7IH 4PJ5A 1M4KA 1TPXC 1T5WB 4HUUA 4WI3A 3OKMB 5T5NG 2AKRA 5JXEC 4PJDF 2G5BB 5D2LF 5DHXB 2BVEA 1JYXA 2AK4A 4P46C 4U05A 5C70A 5ANME 5H2BA 5D5MB 5JUEH 5ENWA 4FS0A 4JY4B 4JZNA 1Z5LA 1DBAL 2VN7A 4HAGA 3RL2B 5CS7A 1MH5A 2WINB 2PCPB 4LVNB 3QUZB 3AREC 2IBZX 5HVGB 2FH8A 3V5KA 5BCAA 4NBYB 3O2VH 4QCIA 5C0AE 4TPRL 1OW0A 4N0UB 4ZXBB 2A0LC 1K8DA 4OIIL 3CFCH 3UJJL 5DO2C 4F7MB 1SVCP 2DM7A 1X5YA 3HMWH 1ZVHA 3KS0J 3V52L 1XR9B 5ADPH 1MI5B 4X0KB 1FZKA 4PJEA 4GH7B 4LU5L 4LSTL 5IQ7L 4HUKB 5GIRB 1ZEAH 2JCCB 5J89A 4J3VA 3EO1B 1FFRA 4BQCA 1ZA6A 1OARH 5FA4A 4E5XA 3V6ZA 2NY5L 2F74A 4GQPH 2AK1L 4WEBH 4UV7H 1KT2A 4UQ2A 2MNUA 3BHBB 2PXYA 5HI3D 3HZMB 2B0SL 4NN5C 1XAUA 4U49A 2BXYA 1DJSA 3F65A 2CRMA 4NC1C 3MA7B 2G75A 1FZMB 5ACZB 1MPAH 4L8CB 2YD3A 5GGQH 4R4BB 3M45A 4K7FA 2MMXA 5T1MA 5H94B 1Q9LB 2FEDD 4FNLL 4ZYKA 1BVZA 5EIIA 3NCJL 1OWWA 5KZCB 5HD8C 3C6SB 5TE4L 2J6EH 2W60A 5EA0H 5MENB 3ISWA 2NY7H 4GG6E 1BM3L 3Q1SL 2BSTA 4O9HL 2XKNB 5EU6D 1UM4L 4KY1L 3M17A 3GK8L 4N8CL 3WCYA 1ACZA 4S1SL 5HDQL 5BS0B 3LPGA 1EGJH 5HY9B 1KTDB 5EB9A 4UB0L 2EICA 4M9PA 1BBJB 1N64H 4XPAL 1MFEL 3RWFB 3VI4F 1QSFE 3DVNB 4JRYE 4R6UA 3RVVC 2DQIH 3FQNB 1KJ2L 4ONGL 4FQ1L 4X7SL 2IANE 3OJDA 2P46B 5IB1A 1X4ZA 4NKIH 5LWYH 4JFZH 4W6WB 4P49A 3V6FB 3U46B 4HXBL 3VG9C 4C56B 1R0AH 5E2VH 3HZYA 4HIXL 4CNIB 4UNTA 4NNXB 5D2NE 4HGWA 5HYJE 3RHWF 1FIGL 1U6AL 3MROA 2A83A 1RU9H 1C08A 3FFCA 4JO4L 4POZC 1MCDA 4I77H 5F7EH 3FRPA 2L7UA 1PFCA 2VDKH 3FT2B 3Q6GL 4UTBH 4P0DA 4NQCA 1AJ7H 1A1NA 5EU6A 1FLRL 1S7UA 1NMAH 2I5YH 5LVEA 3CXHK 2NY4C 4QRPA 3GMLB 4LARH 4UZGA 2OR8A 3O6ML 2GFBB 4OQ1A 1ZS8A 5EPMB 3JSSA 4QHUA 5CSZB 2VDNH 2X6MA 1FNFA 4LKXB 1HYRC 3BI9X 4I9WE 4YFLF 3RZCB 5IEHA 5HHNA 2YEZB 3ZSTA 4MD5B 5JOFA 2IMMA 1BF2A 1XGUB 2GSIA 2VLMD 2AABH 4OD2A 5DVMA 3UROR 1TCRB 4LCWA 4AIOA 1U8QB 4OCNC 3FMGL 1JPGA 4WI6A 4YGAB 4MNQE 3PV6A 4LK4A 2XZAH 1WZ1L 5CZXD 2NZ9D 4P2RD 4LPTA 1S9WA 1JRHL 4CAGA 1KN4H 1KNOA 2V5YA 3HC0B 4KQ3L 3J7HA 2VZVA 1CYGA 4JB9H 1QFUL 3UTZB 1RZ7H 3QUYD 4XWOC 4ERSH 5FF6B 3AFLA 4TN9A 1LO4H 3FCTA 1F3DJ 3ARDA 1WC7B 4HBQA 5DJ6A 1IM3A 2WIIB 4QF1A 3SKUD 2M8XA 4J6RH 4PGCB 4APQB 4Z7QF 3QRGL 1V7NH 2YMXH 5DUPL 2R2EA 1T03H 3IDIA 4ZD3L 3T0EE 2Q7NA 4KMQA 2ARWA 3NACL 5I66A 3TYGL 3MV8B 4Y4HC 4NBXB 3LD8B 2J2ZA 4OZHA 2CLZA 2R0WH 3JVGA 5LGJB 2IPKA 4KI5D 3NH7L 5DZOA 5TF1L 5L2JA 4IDJL 3WHXA 2FX9H 3TN0A 3QO1A 4XBGB 4PJBA 1FN4B 3K8MA 3BIAX 4GKOA 3IETB 5JW5A 5IB4A 3NFSL 4WW1B 1REIA 3MCG1 4I3RH 5K9OB 1DTUA 4OLZL 1NEZB 3SY0A 1KCUL 4EOWH 2Z31B 3EFDL 5HPMB 2Y4SA 5J13C 1UFUA 2YA0A 3H0TA 2YPLB 3IDXH 3DROB 3QDHA 3BX7C 4L8DA 3PABA 3QUYA 2EKSB 4J4PA 2J12B 1LDPL 4MXQC 4DTGL 3L5IA 3UDWC 1N3NB 1FC1A 3DRQB 4PGBB 5I74C 3BAEH 1MCCA 4NZRH 2HG5A 3WUWB 4D3CH 1R5WB 3DGGA 3PL6C 3EOAB 3RGVB 3ESUF 4FA8A 2LVEA 1HHGB 2YXMA 5I8OH 4FQIL 4PRDA 3ZKXB 1CGUA 4KH2A 3SDXF 4ORGA 4G8IB 1QSEB 2V5SA 4WHYG 3T3PF 3D39B 4K3DH 1UA6H 1DE4B 4ZFZA 1N6UA 2GTZA 3TT1H 4WWKD 3QCVH 3P0VH 3KLHD 1CDUA 3FT4A 4C4KO 1IKFL 1W0YT 3KPSD 2YBRB 1G0YR 5CWSB 5D1ZB 4P3CH 2G60L 4TNVF 1J1OL 5T1KB 4I3SH 4C55A 4M61A 1SY6H 4ZAKA 1ACYL 2KQNA 1M71A 3IGAA 4ZG1A 2OMBA 5CMAA 5M7QA 4KVNH 3F12B 3MBEA 4MVBC 3NA9H 4K7PX 5SX4H 4WFHE 1RUQL 1AGEA 4QHKJ 3HI6H 4KTDL 4YAQA 1IQWH 2DYPB 2OSLA 4MA7L 5CJBA 1NCCH 3RWGB 3U7YL 3QZWG 4BELD 1ONQB 3QHTC 1X6NA 3HE6C 4S1RH 4X6DF 1G7LA 3D0LA 4UT9H 3WN5C 1H3VA 5BXFB 3RFZC 4IRZL 1RZKC 1EH9A 1NAML 5TJWK 2CKNA 3HR6A 1Q38A 4J3OC 1WICA 2MWCA 4F80A 1WCBB 1JGEB 5E95B 3AY4C 3BH8B 1XFPA 4WWKA 1F6FB 1ZWIA 5AYUL 4JE4B 3K1DA 5CLWA 1WAAE 4BKLA 5CP3A 4QTIL 1RZFH 1IL1A 5D7JC 4WU5A 4AM0B 1KUMA 4XH2A 5B8CC 4MZ2A 3O4OB 4Z95L 1ZVSA 4OZIA 3RP1A 4Q0XH 3U0PA 3DVGA 5DR5H 1A4JA 1D5XB 2ZOKB 1A3LL 1JGVH 1TTGA 1PEZA 4NQSB 3MR9A 1FO0L 1Q9KA 2DQJH 4Z7NE 2JB6A 4GRLB 2ED9A 4XVTH 2XWBA 1T2JA 2EIZB 4H0IA 2V5MA 3DBXB 5C0BD 2R4RH 3QO0B 2JKXA 3FQRB 5JLZB 3NCCB 1K3ZA 1KXVC 4M5ZL 5I1AB 5GSRA 4LSPL 4TSAL 4UI2A 1BIHA 3PQYA 1ES0B 2X40A 3DXAA 4E42A 2AJSL 2F53A 3PNWA 4XCFH 3MCKB 1MWAB 3UTSE 1DQMH 3G6AB 5FYKU 4MDJB 1RVFL 4GKSA 4F7EA 4HT1L 2HMID 1RHHA 5DWUL 5JHDE 2K3TA 3O3AA 4RWYL 1KB5L 4F15C 1YJDH 3QNYB 4KU1A 1XGPB 5F89B 5E1AB 1UQSA 2AVGA 3L9RB 1MREL 1U0QA 1TZHB 4FQHB 1G9NC 3RVTC 1ZGLB 2BMKA 1B2WH 2OQJA 3I75B 4LFHG 2WUCL 3C8KA 4MNGA 5ICZA 4ZTPL 1U8IA 1XF3B 5HYFA 1U3HD 3O3DA 5C0BA 5FO9A 4XXDA 2NW2B 4FZEL 5EORH 2HT2D 3KVQA 4OCLC 2VABB 3FN3A 4XPGH 1U58A 4WW2F 5IMMB 3KPNB 3BN9C 3DSFH 3NTCH 4HPYL 4KRMB 4FQ2L 1FVEA 2QQNL 4QWWC 1QFWI 2ARJA 4MB5A 3DX6B 4Y5XA 1E4JA 2FWOA 2EEBA 3NZHH 4W4OA 3S35H 2D7TH 1GL4B 1E4WL 1DBKL 1B6DA 3BDYH 3EO9L 2XPGB 3SQOL 1J05A 4HKZB 3WFBL 4KXZI 5GGSY 1PKOA 2I07B 3VG9B 5LBSL 3BVNA 2VZSA 1BBDH 3MA9H 2VWEC 1HCVA 5B39G 5CBAA 4NPYA 1ZLUK 2P5WD 5K93A 5C08D 1G7JB 4JY5L 2BNUB 2W0LA 2F54B 3C5JB 3HE7B 2JJUA 4OF5A 3SBWC 3LN4B 4XTRC 5HHQB 5FXCH 1WSST 1GZPB 3C6LD 4OZGB 2JTDA 3QBTB 1U3HA 2BXZA 4NQED 2IAMB 2VDRL 2NY4B 7FABH 1GJIA 3IAQA 5KVDL 1KJVA 1K9TA 5HHOA 3DMMC 1OGAE 1A7PL 4CADB 1YNKH 4DZ8A 5DLMH 3PJSA 1B0WA 3HC3L 3LKQA 4K94H 5L2KE 4PLKD 4DQOH 43CAA 3CVHA 5KVMC 4LCCA 1YY9D 3AGVA 3ROOA 3QI9B 5FK9A 1DEEA 1E27A 1VADA 4LF3B 5DC0A 3SE8L 3DUHA 4XBEL 5DD3L 1KN2L 2RQ8A 1B88A 4KJPD 3RY6A 3VXSD 1HYSC 3TPUA 2E7MA 2VDOL 4HS3A 5B38G 3N50A 5DQ9A 2P5WA 2ICWJ 3WLBA 2EXYD 4FFYH 3SKOB 5C08A 4M7LL 5DMIH 2KKQA 1S9VA 3V79C 1Y6KR 1X3DA 2N4IA 2EDFA 5GGUA 3GSNH 1A64A 5C6TH 2ZSWB 3VGHA 4JFEA 3L1OL 4ZS6C 5DK2B 3OKEB 2LU3A 1NFIA 4JHWL 5DJ2B 1WWBX 1YECH 2IQAB 2ICEA 5J9PB 3QP3A 4P3DB 1L0QA 3LN9A 4OB5H 1ZT1A 3MRMB 4N0YH 2C4FT 2CK0H 5IIEA 1UVQB 4Y4HB 3O41A 1MNUL 1RFDH 3TESA 5KVEH 1XIWA 1U3ZA 1ZXQA 4LVOC 5GZOD 3HAEA 3VXSA 3U6RB 1A1MB 5DRWA 4E41E 1RULL 5TGBA 4YX2H 4G9FE 2JK5A 1BLNB 2FLBT 1I85C 4Z0BL 1TZGL 1BWWA 1J8HB 3UO1H 1JF1A 4RDQG 4TRPH 4PJ8A 1Y18B 2JLLA 2BC4B 3CK0H 3TH3T 3WD5L 1J9CT 2K7PA 5ID0A 1I9RH 4M7JL 4KRNA 5E8NB 1NCDH 5C0RL 1Z3GH 2B2XH 5D5MF 5HPOA 3CLEL 1DSFH 2DLIA 2VLKD 5EUOA 4HMDA 4W6YB 1OW0C 1XZ0B 2PYEB 1MFDH 4P9HL 4Z7WA 5F1IA 3VFWA 2O61B 1FG2B 2AXFB 2X1OA 3RQ3A 6FABH 1MFAL 3PL6B 1J1XL 4LIQL 4XZUA 3IJSA 3D3VB 2YPVH 5HI5C 2MKLC 4L5FH 4XNQA 1TQBC 1I9JL 4PV8B 1NBYB 4OZFH 4H1LA 2FCBA 5I1IL 2PW1B 3FQWB 5F9JA 3S98A 3UX9B 4WFED 5F3HA 4OF3A 2O5XL 2R2CA 3MV9E 3PHQA 4XCCH 4JQIH 3EYQD 3VXUD 3C5SB 3JWOC 3RKDD 1CZ8L 1HWGB 5KSBA 4LDEB 1CLOH 3U7AA 5DHYB 3NIDE 4M1DH 5FCUL 4OQTL 5GS2D 5IMOA 1MUJB 5E00A 3FO0L 1ZE3C 1I8IB 4F33A 4WEMB 1NBZB 2LAAA 3EKCA 1OY3B 4BSVB 1VFBB 2H8PB 4JFYB 1GOHA 4OKDA 1OAUL 4N1CA 1MEXH 2W65A 4EQ3A 3G5ZB 4L1DA 2A73B 3T1FA 3D25A 4WHYH 3HE6B 2XZCH 1AD9A 1JPFB 4K7PL 4XGZA 4JDZB 3SDCA 3VFMB 3OKOA 5DFVC 3IDJB 4OUUA 1QLFB 3G5YA 2BCKA 5FGRA 4P57B 5SWZB 5DQJA 4FZ8H 3SO3C 4FTVB 4UDTA 1AGBB 1L6XA 35C8L 4IRSA 4YPGB 3VXUA 1SJHB 3AM8C 2VLRB 3TCXA 5ISZE 5J11C 2JJWA 3A67H 1NCUA 4D0CA 4RFOL 2X9YA 3MRJA 4YNYA 3ABZA 1BECA 2CQVA 4M7KL 2FGWL 5I1DA 1IGIL 1QPXA 3HC4L 4DAGL 3QEQB 5HI3C 4LGSB 4F3FB 5JQ6H 4LAJH 1G0XA 4Z0XB 4EUPG 3O3BA 1U42A 4FFZH 4NKDA 2ICWB 4LHQB 1ZHNB 1QPPA 3D85D 4ELMA 5F7WC 2HAZA 1OSPL 2DI8A 2FEDC 4FQXD 4KJWD 2BSRB 2UZIH 3MMEA 4F7TB 1T1YA 2UWEE 1N5AB 3LKPA 3SHSA 4NUGH 5IW3A 4F9LA 4P2CG 4OBRA 3MJ6A 5ETUB 1GGIL 5CKAA 4TQEH 1NCWL 5JHLL 2DB8A 1IAKB 1BFVH 1ND0B 1C8PA 2ENYA 3F7VB 4HWEL 2OJZL 4OD3H 2QQLL 3NZ8A 4EBQL 4HHAB 4JEGB 5FV2A 4K2UH 3HI1A 4WV1B 1NANI 3ZYIA 1G9ML 4DUVA 4NQDD 3VJ6B 5ILTL 1CFTA 1U92A 1F90H 5H8DA 4OFYD 2XWTB 1EUTA 4K8RD 4WI5A 4GG6F 5FYJE 5HHME 3TBWA 2V7NB 2O26U 4LBEB 4D0BA 2P49B 1I7TA 3ULUD 1IAII 3GI9H 1VFMA 3RAJH 1JZ4A 2HKFH 1R5IB 1PBYA 5HDLA 2VMFA 5IW1B 2OL3L 3H7BA 3QFDA 2XTJD 4HLZH 3VXOB 4IRJD 3GSRA 4RSVA 3TLRA 2IMNA 3FTGB 1NC4B 3SGDI 4YQXL 1UYWL 1OSZA 4P2QA 3IFPB 2M26A 4ZPVA 5T1DL 1WZMA 3QDME 2XA8H 2APXA 3W5MA 1KB9J 1KPUA 3P2TA 3OPZH 5E8EA 3BPNB 1HH9A 4Z7UB 1JMZA 1WFUA 1EXUB 3C60A 5GISH 3PE9A 5ELIA 2VXUH 3SDYL 3ZE0E 4WGVB 3CFKB 5J6GA 3AXLA 4MSWB 5GS0C 1ZVYA 3T8XB 2DQCL 2QSQA 3TNMA 2HFFA 3QXAA 2D03H 1QR1A 5I15H 2ESVE 3NABL 2G2RA 1W2KT 1FNGA 5DRZA 2XFXA 3KDMA 4ZSOB 2DQHH 5A1AA 5GGRB 1EAPA 2D31B 4EDWH 5L6YH 1CFSB 3OAYK 3QIUD 1QRNE 1YEDA 1T21A 3QB7C 4UT6L 4M5YL 3GIZH 3STLA 1V8HA 3MGOA 3OR7A 1P4LB 1V05A 1QKZL 3VWKA 5T5NF 3N85H 4BZ1L 3FZUD 3GHBH 3O2DH 2X4PB 3VXPB 1VHPA 5EZJA 1HKLH 3DMMB 5CZXC 2NZ9C 3MLWH 2CUHA 1MJ8L 2EYSB 5LKNA 1I7RA 5ESQA 5BQ7A 5K9KA 1AGCB 5D8JH 1IZKA 3EDEA 4WI8A 5JW3H 1UXSA 2CDFA 2Q7YA 3ARBD 3MO1B 1AXTL 3RWIB 4O2FA 1EEZA 5KJRL 3QUYC 4J4PC 1AQKH 3Q5OA 1LP9A 2P24B 4CUCA 5E6YA 1P7QB 2HVJA 3K80A 4GQ9H 4P59H 1I4FB 3WFZA 4BA8A 4RX4A 4AL8L 4XWGH 5IVXB 5GJTH 3LZFH 5DDHB 5IJVA 1QO3A 2VL5B 4ZFGH 4ONHA 1IT9L 5I8KH 4Y4KD 5C3LD 3SOBL 3OAUL 1CD1A 1ZHLB 3QIUA 3IFOA 1OF2B 3HI5L 4KI5C 5E9DD 5IKCB 4PREA 1J0IA 2H3NB 2F5AH 4MQXC 1S7XB 2R2HB 3T0BA 1A47A 4HUNB 2CR3A 4C59B 1CGYA 5B21A 3FB8A 3S36H 4N68A 1PDKA 2AP2A 3ZDXE 2A2QT 2GYSA 2Q6WB 3TH2T 4ODVH 1WCQA 4ZAKC 1CF8H 4ODXA 4OGZA 5KVFL 1EO8H 5ICXB 5C0CE 4DKAA 1S78D 3TNNA 3C8DA 2X4NA 3V5DA 3DJ9A 1AGDA 1YEEL 4XPHH 2D0FA 1G7PB 3KPRE 4PY7A 4LHUD 4S2SA 4ZUVA 2I9LB 4LVOB 1JYVA 4QOKE 4JCMA 2BERA 5I0ZA 2BVPA 2EO1A 5C6WH 3BRGC 5FOBB 1CG9A 4JFFD 1T3FB 3FQUA 1NBVL 2WBKA 3LS5H 4BFGA 4PJ5B 4HUUB 1ZHBA 1KC5H 2AKRB 4XVJL 5E1HB 1Y6NR 5CJXA 2P5EA 5JR1L 4NOBA 2HA1A 3QHFH 1MLCB 2AK4B 2EDQA 4R9HA 5H2BB 2WLYA 3TCLB 4IDLA 5E9DA 1LWRA 4WWKC 5ENWB 3GSXA 1GIGH 4JZNB 5LQBL 1Z5LB 1KJ3L 3KLHC 4X98B 4ZO8A 3NCYP 1CDCA 5FM8A 2RGSA 3U1SL 1HZHL 1MH5B 1KB9K 3P0GB 4A6YA 3V6OA 1IM9D 3V5KB 4BSWA 4MAUH 2VDPL 4QCIB 2W59A 1CL7I 3RTQD 2LQRA 4XPBH 4UOW0 1K8DB 4JPIA 4O02H 1UB6B 1ED3A 3KYKL 3L7EA 1EJOH 3OL2A 2I24N 2UVFA 1BEYL 1TTFA 4J1UA 1X5HA 3ULVE 2B1HH 5FM4A 1FZKB 4JO3H 4V1DA 1HHIB 1TQBB 32C2A 4PJEB 4UIMA 3UJTH 1JWUA 4N0UE 4GSDH 2NY3D 4ONFL 4XP4L 4LHUA 1EK3A 1FZOA 1ZA6B 5FA4B 3LS4L 3GMRA 3KJ4C 4WUUD 5AZ2L 4GT7A 4KHTH 4E5XB 3BPLC 4JFFA 1DQTA 3R8QA 3V6ZB 3UZEA 2F74B 5FYJH 4G6JL 3FHAA 2JCCE 5JDJA 4PY8I 4I1NB 4PJGA 5GGVH 3CXDL 1UWGL 2EDHA 1WT5A 4UQ2B 3PV7A 3MLYH 3LPFA 4NOFA 3PWLA 4JPWH 4KMTH 2DBLH 2R9HD 1YPZF 2DQTH 2G75B 5HSFA 3B5GA 1UJTA 1IEAB 1A14L 1BFTA 1U93B 1X4YA 3HNVH 3HPLA 4K7FB 5T1MB 1KFAH 4MJIA 5C3TA 4ZYKB 4L4VE 1QBML 5EIIB 3I6GA 5EIVA 4OSUH 4FQCL 2PNDA 3QQ9D 5DVLA 1ZV5A 1IC4L 2W60B 3E0GA 4WTXA 4JFQA 4YWGL 2BSTB 2NMSA 3PP3H 4K9EC 3M17B 3K4ZA 3SGDH 4E0RA 5DJ8A 5TQ2H 3SO3B 4NUJA 2DM3A 3D1MC 5MENE 1A2YA 3HLAA 1RIVL 2XRAH 1JYNA 2CIIA 4IJ3C 2Q76B 3VH8G 1QNZH 1U8PA 2ZG1A 2I9TA 4W4OC 3OJDB 1A6UH 4NN7C 3I6KA 4YIQA 5J1AA 3QFJD 3FOLA 4O4YH 3S34H 2BY0A 3MJ9A 2HMIC 3S37H 4JN1H 3HZYB 3LRSA 3U79A 4PJDA 5D2LA 4HGWB 2E9JA 3BYTA 2FIRT 5JIKA 4HLJA 3V9FA 3MROB 2AW2A 2A83B 1C08B 3FFCB 2YHGA 1A7BA 3NCFB 2Z4QA 4P48A 5EBWA 3CCHA 2DL9A 3JV0A 3OB0K 3BGFB 1OPGH 4NP4H 5DD6A 1A1NB 5EU6B 1S7UB 3FRUB 1FVCA 4H0GA 1U3HC 4G6KL 5E2WH 1WTLA 1N6QL 4QRPB 2HT2C 5IT2L 2ZCKH 2E3VA 2HFGL 3BJLA 3QJFA 2HT3D 2VDML 4HG4J 1ZS8B 3TC9A 3D48R 1T4KA 3SE9H 4JREC 4EUPH 4LCCC 1UEMA 1T2QL 4KV5E 5F1NA 2IGFH 1DBJH 2HJKA 1X7QA 4P23D 3QFJA 2E7HA 2CLVA 1KTKE 4OZ4A 5IEHB 3AS3A 5HHNB 4RGNC 5JOFB 2YWYA 5FHAH 2GSIB 4U1JA 5FO7A 4OD2B 3MODH 1DQQA 3CLFL 1OAZH 2WQRA 5I76A 1R3KA 3WLWD 4LCWB 1NSNH 5IM7A 1JPGB 3PV6B 1CCZA 1WK0A 2DM4A 4XNZC 1T0NB 1HSBA 5HGGS 1S9WB 1KLUA 3IDGA 3O11A 2EIBA 3I50H 3OKYA 1KNOB 5TQ0L 2ZG3A 3C6LC 3PP4H 3G04A 5CJOL 5EBMA 3O2VL 3HFMH 4Y1AA 5I1JL 3CVHL 2FECI 5IBUB 4C83A 3FCTB 4PP1D 3ARDB 1OP5K 4UQ3A 1K3IA 4F7CA 1KCLA 3CFCL 4QF1B 3HMWL 1CLYH 4PLKC 4XCNA 4FG6D 3K1KC 5F1OB 2FR4A 5IHZA 1YY9C 2VN4A 2R2EB 3IDIB 1KPVA 2X7LA 3N1FC 1HN1A 1LILA 2DMKA 5I66B 2ZKHH 4N1EA 4LPYA 2YK1H 4OZHB 2CLZB 2NY6B 3GO1H 4UILH 5JNYA 5IF0A 2FEEI