4RBPH

Crystal structure of hiv neutralizing antibody 2g12 in complex with a bacterial oligosaccharide analog of mammalian oligomanose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
220
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 2G12 light chain
publication title Crystal structure of the HIV neutralizing antibody 2G12 in complex with a bacterial oligosaccharide analog of mammalian oligomannose.
pubmed doi rcsb
total genus 44
structure length 220
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rbpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rbpH01
1EHLL 4LARL 1P7QA 4PJFB 4C83A 3MRNA 9CGTA 2G9HA 3TYFB 4X6FA 3O2DA 3TO4A 5T1MB 3IJHB 4ZXBA 4OCXH 3RIAF 4JZOA 4ZFFA 3RTQA 5FFLA 5MEPA 4RGNB 4GQPH 2D7TH 5CD3B 3U9PH 3ZHDA 1DUYA 2A77L 3RL2A 2D31A 1G9MH 5KANG 3X14A 2Q86B 1PG7X 3I84A 5I1KL 4LLWA 1CGSL 3V52L 3VCLA 1A7OL 4PRAB 5DFVD 1BOYA 4X4XA 4PGZA 2YPKA 4OGAD 2F58H 4LRIC 3VFRB 1CS6A 5IHLB 4MMZC 2A9MH 1I7UA 3NACL 2AEPH 4N8CH 3C9NA 5DS8B 4HDIA 5ABDE 1FO0B 2YPVL 4GRMA 5AYUL 4Y0GA 4LCIL 3QIBB 4EUPA 2A83B 2YMXL 1UJ3A 2VNCA 3BZ4A 3KG5A 2BVQB 3VXUA 3QUYA 1GZPA 1KIQA 5C0JB 4FZ8H 4WHYG 3QPXH 4YZFE 5D7LB 1X5GA 4OF7A 1RSFA 3CLFH 4XX1E 3JV6B 3RPIB 5FO9B 2PTVA 4QOKD 5C0CD 3MLWH 3K81A 5EB9A 3EYUH 1DLFH 2EIZB 1UZ6E 1QKZH 2NX5D 3DV4B 4R0LA 3UTTE 1I8IB 3QXWA 1YPZE 1U91A 1A3RL 1L4IA 3KPMA 3IF1B 3QYCA 3LS4H 4HIEB 4HX1B 1FG2A 5JOEA 4KI5F 3C5ZB 4Y4KD 3WFEH 5GS1A 4D0BB 2JIXA 5F9OH 1A6VL 3PABA 1FIGL 5I1HH 1I1YB 1FL6B 3MJ6A 4QRRB 2APBA 4M93B 2NW2A 3SCMA 1W72H 4KTDL 3TGXA 4WUUD 3QUKA 1G1CA 1CDYA 4RMRA 4H5SB 1WICA 3DYPA 3SE9L 3WNPA 4PJIF 4PJ8C 1BVKA 2PNDA 1EXUA 1KEGH 4YWGH 2GW5A 1J0ZA 3EJZC 3O2DH 2C1PA 4OIIL 4ODUA 1BWMA 2WQRA 4R6UA 5B3JF 2CO6B 4JHZA 1QFWM 4KU1A 4FQQB 4JB9L 3P73B 1PG7W 4PRPA 4X4MA 5K9KA 3UAJC 1WTLA 2EYTB 4PGEA 1AD0B 5B4MD 5DRXA 3UEZA 3O8XA 5CIPA 1H3VA 3PV7A 3FN0H 1KLUA 1FVDB 2E9BA 3CX2A 3HRPA 1FJ1B 3QQ4B 1HN1A 3O45A 3DHJA 4RNRA 4NIKB 3IJYB 3QFDB 3OV6A 5LGKA 5F7HA 1U8IB 2NTSP 2XIDA 1S9XA 4BZYA 3FT2A 1JI1A 3KXFD 3NIDF 1K8DA 4K7FB 4Y5YB 5BO1L 4DKEH 1YEIH 4LVOB 5DGRA 1CD9B 3MRPA 5FYKD 1FBIH 3CU7A 3Q5OA 3BPCA 5MEND 2BCKB 2E7LC 1KIRB 4PP2B 3HE7D 1CFSA 2EIBA 2OI9C 4ELME 5IIEA 4L3ED 1QLRA 4NYLB 1T1ZA 1BLNA 4I8DA 2I26N 1YA5A 2VLRA 2CK0H 1L7IL 4JKPH 2EEBA 4X4ZA 2MPAH 3BJLA 3FO0L 2Q3ZA 1E4KC 4PJDB 4U3HA 3BKCL 1CG9B 4X7DC 3RU8H 4UBDC 3AXLA 5F7NC 5GS0D 1JJUA 4L3EB 4GRLD 3MRBB 4TNWF 4MSWA 3EYOA 4HAGA 3RI5F 5D6DC 5L2KD 2FZ3A 2VLLA 1WZLA 5C0DA 3V8CA 4FP8H 2ADJA 3MRCA 4RMWA 3HNVH 1KPRB 3UTQA 1ERNA 5KN5A 4TVPL 2WBJC 1H15A 4NKIL 4HPYH 3BHBB 1R5VA 4O9HL 3X13A 5DO2C 2L7UA 3IETB 4Z8FH 3M8OH 4QTIL 1TZIA 2NY3D 2Q7NA 2A38A 4UT9H 1QTYT 5BJTA 2XV6B 2A73A 3PJSA 4LPXA 4NN7C 4MAYA 2C9AA 4U1IA 2EDTA 2BRQA 4M6NH 4AZ8A 3HLAA 1EAJA 2R56L 1VERA 3HZYA 1NGPL 1TENA 1QLEH 3ARQA 1X4YA 5HYJA 1IC7L 2EDNA 3QDMA 2N7AA 4KJPD 3T0VA 4EI5A 4M7JH 3U0TB 3DSFL 1AFVL 3BH8B 1HWGB 1OQOA 4KH2A 1UM6H 3MRGB 4XMPL 5E1AB 1FNGA 3QDJE 4PJEF 5CIPH 3SO3B 4QGTA 1M05A 3KPRB 4F7TA 1NBYB 1CGTA 1U8MA 2R2BB 4KI5C 4JJ5A 2OSLB 4CMMB 2R0WL 1T2QL 3RFZC 1FFNA 3CK0L 3ARVA 3FFCD 4X5WA 4NJ9H 3EAKA 3LB6C 1U2CA 5TE4H 3MX0A 3X17A 3UYRL 3QHFH 1KPUB 2VLJB 1M71A 4NHCL 2Z8WC 4NNPL 1JVKA 3BN9D 1A14L 3GKZA 1CGXA 3F7QA 3FZUC 2Z35A 2H3NA 4G80A 2Z31C 4G6AC 4YQXH 5LGHL 4KQ3H 4NQEA 3STZA 1YEJH 2V5RA 3U4BL 5D1QD 3PIQA 1GGBL 1OCWH 5F21B 5CMAB 2HVKB 3FCTA 2FEEL 2VYRE 1TMCB 1U8QB 4XP4L 3F7YB 5H94B 4X6DE 4OI7A 3PV6A 4R3SB 1VGEL 5EBMB 2BVOB 4BA8A 2X7LB 1ETZA 3G04A 3L1OL 2VR5A 4UILL 4Z76B 3MRFA 1IM3A 1FZOB 4C57C 1KCRL 3OKMB 1EV2E 2E9IA 3EYFA 3L3KB 3OMZA 4YGVB 4QNPE 2ZUTA 4RMQA 3SE3A 1N0XL 3EOAA 4Y16A 2CLZB 1I3RA 4PJCA 5INCA 3FTGA 4AEHH 4R7NB 3JV4A 4ZNEE 2C3WA 2RR3A 3DVIA 5E4EB 1DE4B 5HVHB 3LHPH 1U3HA 3DX8B 1TVHA 3LN5A 1Z9SA 5JW5B 3P77B 2AJVL 4FZEH 4IOIA 1RFDH 3L3GA 5D7KE 2I9LA 2XA8L 1QQDB 1WCBA 3BXNA 2FX7L 1B0RB 2Q76B 3GK8H 4RZCB 4JN2B 5D9SB 1W0VB 1YMMA 5FYLL 2C4FT 4U7KA 4JRYE 3B4NA 3NFNA 3WIHH 2CRIA 1HHGB 1H3UA 3DX9A 2R0KL 2J5LB 3LD8B 4G8GE 1LO2H 2F9BT 1UWXH 4OSUH 4JKWA 3LKSB 4U6HB 3DXAE 4ZD3L 4S11A 4E42A 5JOFB 1RZIB 1I7TA 3HN3A 1QO3B 2FSEB 4X0KB 3SGKA 2D7NA 1X6NA 5HHOB 1OGAA 4LIQH 4LNRB 5KSVA 1TCRA 1CCZA 1IGJA 1P7KB 5A3IC 2PYEE 5F7YC 3L3DA 5GRZA 4OM0L 5ISZE 3FONA 5D2NB 2DTMH 1MAMH 4XP1L 4DCQA 1CL7I 2YD8A 3K4AA 4YHPB 4J4PA 3U48A 3I3BA 3GGWB 1MFAH 1MCWW 1JE6A 1NDGA 3ARBD 5JHDB 4HIJA 3VXRB 3MRRA 4M43H 1K5NA 4MJ4A 4ZPVA 5L7XL 1J0KA 1EJOH 3CXHK 1QLFA 3GJFB 3GUTB 1EBAA 1SMOA 1LP9E 3T0XA 5E00A 1MJ8L 3FT4A 2NXYB 2NY1B 5KS9F 3QDGB 4XPTH 2YD1A 5EC1A 1QPPA 3AM8A 3U2SB 3DIFA 3VXMD 3BIKB 5DD3L 3ZE2F 4LMQI 1XIWA 3K74B 3RWFB 5KVEH 4G8EB 1CD0A 5DMKA 1HILA 3VMOA 3VGBA 4HWZB 3DX6B 1NCCL 3E8UH 4W70A 4UV7L 4BZ2H 3F62A 1RHFA 2QQNH 3RWGB 5B3NA 5BV7B 4F8QA 4JREC 2UZYB 3VI3F 3RY4A 3PWUB 3GHEH 5E95B 1G7PB 3RL1B 4PJBA 4U6VL 5AD0B 12E8H 4KPHH 3R0NA 1NGYB 3O4LA 1YEDA 3KNBA 5AG8A 4QHMA 1J7VR 1J87A 1RZ8B 3ULUD 2DM7A 2QTEA 2P7TA 5MEQA 3BYTA 5ACZA 4JPIB 3EOBA 5IV2B 5FECA 4ODBD 1HIML 2BNRD 2VDML 4IRZL 1QFUL 4Z7WB 1G7LA 4P4KC 2VDQH 2H6PA 3GZKA 3T0BA 5F7WC 1MFBL 5FEBA 2R1YA 4KV5E 2ICEB 1MCPH 4C55A 1I8KA 5A2IH 3S8WA 2IH1A 4XNZC 4OZGB 3QUXB 3MMEA 3H9ZA 3VXUE 1TJIL 1ZHLA 3WD5L 4YFLI 4XPBH 1NFDF 4L9LA 4HJ0D 4EN3C 3OJDA 1FGVH 3O3BA 1LVEA 4LF3B 5DUPL 2VL5B 4XH2A 5DVKA 3BOVA 1Y18A 2HVJA 5C8JB 1OT2A 1S7TA 1U3YA 2L0DA 4KTYA 2UVEA 1F4YH 5EPMA 5C3LD 1IM9B 5EO9B 4S1RH 4BKLB 4DVBA 4C56B 3BPOC 1URLA 5D7JD 3SDAD 4D94A 1GCFA 4K55A 4HUVB 1YEKL 4OKVA 2L4OA 3RKDD 2CLVB 3QO1B 3LZFH 1JGLL 2Y5EA 1MFEL 5CBEB 3MRKB 4C4KO 1A1OB 4UZGA 3SDAB 3MJGX 2AEQH 4GRWF 4MHHI 4BQ9A 2VC2H 1FE8L 1MFCH 3H0TA 2PXYD 4WO4B 1JWMB 1CZ8H 4PGDA 4F8TA 3FAXA 4RQQA 4MCZB 1KN4L 1ZT4A 1C12B 2O5XL 3GIVB 2DWEB 4QCIA 4Y5XC 3W39A 4J3VA 1KIPB 3D0VB 1D5BB 1T1XB 2CKBL 2VXSL 4PRPE 4X4ME 4KKBC 5EIIA 1NDMA 4Y89A 3BPNB 4UI2A 4WJ5A 1BZ7A 4ETYA 3BN3B 1A6TA 2HN7A 2MCG1 3CD4A 2JTDA 3P0YL 1DSFL 4HLZH 3KPNB 1L9NA 1XF1A 5GRWA 5CGYD 3TBSB 5FYJD 1F13A 5I19H 3LN4B 1JGEB 3BGMA 1NGZB 3U30B 3SY0A 1AE6H 1T21A 1G7IB 5DQDH 5HVWA 3LKRB 1GHFH 5T1DH 2A1WL 3L5XH 3NPSB 4YXLL 3B83A 4JFFD 2HMID 4MNHA 5E2WH 1JGVH 2H2PC 3KLDA 5JW4N 3HAEB 3PDOA 5HVGB 1D5ZB 5KSAD 1F8TL 5DK0B 4IOFD 1VFAB 1NFIB 4MQ7A 5FA4A 4C58B 2ZUUA 1RUKL 3P4MB 1QBLL 2EDDA 5IVOA 1YDPB 3MNWA 5BOZG 4U1SA 3RGHA 3MRJB 2N7BA 2IANA 3VDAA 2VLRE 3R1GL 2A6JA 2H41A 3IYLW 2VQTA 3JXAA 3T4AB 3SQOH 2FIRT 4YIQB 3K1KC 4H8WH 4YX2H 4GAJL 4KY1H 1VEPA 1XR8B 4GBXC 5DQJA 2PO6C 3MYJA 4X9GA 1U8JB 4O2FA 2ZZUT 4WNQA 5BVPH 3MLUL 3U7WL 4M1DH 4I2XB 5L2JA 3OAUL 3TN0D 1AO7D 1JHTA 2LAAA 4OM1H 3L3JA 3S4SA 2E3VA 2XKNA 2PTTA 1KN2H 3QP3A 3L3OA 4OF5A 3T0EA 4G8IA 3VWJD 4W4OC 3QZWA 3MLXH 5IJKC 4QRQB 1I1RA 5SWZB 5JQ6L 4ZS7H 3EYSL 4Z7UF 1B3JA 3DV6A 2DQDH 4Y19D 4YBLB 3GIZH 3MUZ1 2BNQD 5E08H 2IMMA 5E8EB 5CUSH 4FXKA 4A6YA 1PSKL 1INDL 3PWNB 1QFWL 1FNLA 3RNQB 4WW2C 3SN6N 3VWJB 2VUOA 1EA9C 1Z9LA 1DQLH 1KSRA 3QUML 5ACMA 1WT5C 1RZJC 3BKYH 2WUBH 2C3GA 4Y19B 1I1AA 1Q72L 3QDME 3S96A 4GXVL 4IM8A 1IZKA 2AGJL 2QSCH 3CXDL 2GCYA 4RRPA 2RCSH 4OUUA 3CDYA 2IGFL 4HCRL 3LKOB 3BKJL 4F7EB 1E4XL 2OL3L 5DA0B 1FORH 1NEZA 3GSXA 4V1DD 1Z5LA 2VSDA 3X3GH 3RUGB 2ZKHL 1ND0B 1R3HB 1HH9B 3FHQA 3ZSSA 2IC2A 2HH0H 2X4SA 4O4YL 4PJDE 3ARDA 4KDVA 4P5TC 25C8H 5I1JH 3GSNL 1WWAX 5EZOL 4G6JH 3QFJD 4OCXL 3EDDA 3FOLB 4V1DB 5F7MC 2C3HA 4M6MH 3BJ91 2AK4A 4YFDB 5MI0B 1EAPB 4NQEE 5ESQA 3LQZB 5ENWB 3ZE0E 4BFBD 2ERJB 1AIFA 3H42L 2JE8A 4NBXB 1B6UA 4JEGB 1VESA 2PF6A 3PL6D 1JFQH 1B4JL 5FO8A 5C09B 3IVKA 1PY9A 3QWRD 1KB5L 4BQBA 4FFZH 1KJVA 4L5FL 4GOSA 4ISVA 3ZL4L 4M1GL 2ZPKH 5EWIL 1NMAL 1N6VA 4QRPD 1TITA 5DJ8B 4GMSL 2NMSA 2A9ML 1ZGLP 2AEPL 5D96C 1JTOA 3NOIA 4FQ1H 1MFDH 2B0SH 5E9DA 1FZMB 2MCPH 3FO9B 4HGKC 5E03A 2HT4D 1LO5B 3QXDA 1F4XH 1XGQB 2K7QA 1ACYL 3PHSA 5D1ZA 4G9FB 1ZT1A 4G43A 1KG0A 5DRZA 5SX4I 2OMBA 4M5ZH 3MLWL 4ZAKD 1ADQL 1A3LH 1ITCA 3EYUL 4BFIA 4RGMC 4Z7NF 4PLJD 4A6YH 1QKZL 2EXWD 4ZYKA 1H3XA 3MCG1 3S35L 2XWBB 3ORJA 4LBEA 4MHHG 5ITFA 4NO2B 5BZDA 1XAUA 1FPTH 2XT1B 3AB0B 5KVDL 4ONGH 1QFHA 2QR0A 3QAZB 4ZAKB 2HFEB 3UTSA 5T1LB 2FIKB 3I6LE 3NFSL 1V8HA 3ZDYE 1J0HA 1YMME 4DOHE 4QEGA 4Z18A 4N1HB 5IVXA 3TFKC 5J89A 2A0LC 2H9GB 1J1OL 1MWAH 4I3SH 4FQHB 1YNKH 1K3IA 5C2BH 1G9NC 1A6ZA 3A6OA 4DGIL 4XXDA 1MUJB 3R4DA 1CLZH 3IDIB 3BISA 4XP6L 4OLUH 3NA9L 1B0WA 4PUBL 1OGAE 2W0KA 1CVRA 2P44B 4QY8A 2HP4A 4X80H 4DQOH 5HYQA 3I2CL 1BZ9B 1XH3A 1OTUD 3MBEA 2Q8AH 4X7TB 4AH2A 4WWKC 3V6BR 2B2XH 5FGBA 2VLKB 1NKOA 1X4ZA 4AJ0A 1O7VA 4ZFZA 4LSUH 3JVGC 4NRXB 4FQXC 1KBGL 4XBPA 2R2EB 4KXZI 2ZSWB 1RU9L 3MV8A 4YK4C 5DFWH 2B39A 2V5YA 3VG0L 4AEFA 4IIQC 4NRYA 1MRDL 3VRJB 1XGUB 5C0IB 5GRJH 5IW1B 5EZIL 4K7PX 5F44A 1SVZA 1CXHA 3TA3C 1YC7A 3KHOA 4UAOB 1FH5L 5IMLA 3PGDB 3OG6B 3RAJH 2KZ1B 3HPLA 5GIRA 4DUVA 1Y6NR 5DA4A 2HAZA 2X1PA 2ZSVA 2F15A 1FBIL 5CEXA 2AJYH 3CC5B 3KPLA 5DD5L 1T3FA 1KXVC 3BIBX 4HF5L 3KWWB 3HNTL 4P9MH 5I1GH 2R1WB 1P1ZB 1I8LC 3K2UH 3MXVL 4JPVH 3BVNA 5MHSD 4PY7B 3MLSL 4JVUA 1XCTB 2CXGA 4ZUUB 4I0PB 5HDBE 5EU3A 4UDUB 3V7AG 1XF4A 2MPAL 2GSGB 3QSKB 4O00A 4ODWA 3TO2A 2XACC 3Q6FB 3FB6A 2PUQT 4U1GB 1T83C 3AS3A 5IMMB 4PJBE 4Y4FB 2GIYA 3O4LE 2P8MB 5FDWA 5TH2A 2VZSA 4DZBA 1OW0A 4KK9D 4MJID 4P2QA 2HG5A 5CEZL 1KCLA 1F90L 4KC3B 3V6OC 3WN5B 5J1SC 2AI0H 1K4CA 5DJCB 3TVMA 3VD7A 1QA9A 3T65A 4ODXA 1CF8L 5DGQA 4ETQB 5C0BB 4OF8A 2FEDD 1JGDB 1WFNA 4HXAL 1L9MA 2CLRB 1MRCL 3CFBA 3LKPB 5TQ0L 4LOUD 2R39A 4J3TA 5JHDE 4NQCB 2J88H 4JO2L 1N64H 3T2NL 5IEHB 4HIXL 1N5YL 5ESAA 3QIUB 3AUVA 5KVMC 2ITCB 3RZCB 4P3CH 1I1FA 1WFTA 2NW3A 4KVCH 1N26A 3U9UB 1Q1JH 1YY9C 3HC3H 4M7JL 2FEEI 3UMTA 1ZHNA 3ZDXF 1LEKB 4NN6C 2P49B 3RGVB 3SKJL 4F9LA 5IWLC 4JCLA 1T22A 2VZTA 2EH8L 4ZTOL 4OQTA 1ZGLA 1HKFA 4NOFA 1O0VA 1A4JA 4JFYA 4NNXA 3HZMA 2SEBB 4BK5A 1OSZA 1TQBC 3VA6A 3FN9A 2OYPA 4TSCL 3UPRA 2VE6A 2ARJB 4PRHA 4K94L 1YEGL 2AVGA 2JJTC 4L4VE 1BQUA 3TP4A 3DROA 5BOPA 1SY6H 4MNGB 1HQRB 3D39B 4MA1B 1KLGA 1FVEA 1WBXB 3GSWA 4P9HC 4WCYH 5F1IA 3V5HA 4JFDD 4DTGH 3QT2A 1TTGA 4OLEA 2WP3O 3A6BL 5GSVA 1MHCA 2IFFL 5DTFA 4XI5C 3I3DA 4PS4H 2XKSA 4S0TD 2PCPB 1BFVL 3BH9B 2PW2A 1D3CA 2QKIB 3IFLL 1E27B 1FFQA 2EIEA 3HE6D 3U1SH 3QUZC 3EGSA 5F9WC 2BXZA 4IS6A 4YHNB 3QXUA 3LMJH 1J9CT 1NC2A 4IMLB 5ICYB 6FABL 2RBLA 3WDJA 3QB7C 4FFWD 4H20L 5DHYB 4AL8L 4FHBD 4TQEH 1I9EA 2E7MA 3O9WC 3UYPA 3HE6B 3WYRA 4WIQA 2X70B 1WUNT 3VFWB 1EO8H 3DRTB 3TBWA 1G6VK 3JBG7 5MERA 2EXYD 3SDXF 5KTEL 5KSBA 3RDTD 1M4KA 3TEUA 1PAMA 2Z9TA 1RMFH 2FO1A 3GMPB 3ARGA 5F7FA 4CADA 2GTZB 4PJ9D 2GJZA 4RAVB 3WS6C 1SJEA 4YBQD 3PUCA 2K1MA 3H7LA 3ULSA 2C1OB 4WFED 5D72H 5LJYH 3D69B 3GSQB 4FZEL 2X4NB 2VO5A 3C6LA 2IANE 4QF1B 3AU1B 3BP4B 5BS0B 1YYLL 2CK2A 5F1NA 4HUUA 1J8HD 3WJLC 1RJLA 4Q9BA 3TBVB 2Y5TB 4ZUTB 1EMTL 4YHLL 1KNOA 2J8UF 4KHTL 4LASH 4PJHB 4UUJA 2GFBA 2VXTL 3NH7H 4JM2C 4N0FA 3WIHL 2AAVA 4OQTH 1KCUH 4HGWA 1YNTA 5A2FA 1DVFB 1UZ6F 2VQ1B 1ZV5A 4OSUL 5JHLH 3DOSA 3V6FB 5HHME 4XTRC 3T0EE 1NUDA 5DD6A 1WZMA 1Q0XH 2EEAA 2NXZB 4I9WD 4NGHL 3P40A 4JO3H 3O2VH 4XC1H 1JZ4A 1BBDH 1IAII 2NY2D 4IJ3B 4PJAA 4PRNA 4UNTA 5J1TC 3MGOA 4BUHA 5C0NC 1K2DA 4G7YL 1UZ8A 5DEGA 1G9NL 4IRSC 4XPFH 1DDHA 1H3WM 5FYLD 4N0UA 5GXBB 1H3PL 1EEZB 1EJOL 2OQJB 4RMUA 1ZA6B 4KTEH 1OPGH 2EH7L 3OR6A 2CDEA 5K33A 2DQEL 1JCKA 4EQ3A 1JIBA 1HI6A 1F3DJ 1CE1L 1HSAB 1Y0LB 5IFJA 4N9OB 4JG1H 4OLVL 4JFEB 5IB4B 3QEGL 4XMKL 3MA7B 3P4LA 3MV9A 3OPZH 1DQQB 2D0HA 1QSZA 4X8XA 3GMQA 5CZVL 1WQVT 3OXSA 4HUWA 2VIRA 5HPMA 1MCBA 3N0PB 5IJVB 4I2XE 4PJGA 3W82A 3B43A 4JY6B 4RISL 4HMDA 5HI5D 1VEMA 3QG7H 4NQDD 1KGCD 2X4PA 5CZXD 2Q87A 1RUPH 4J6RL 3N1GC 1MREH 1KCSH 3OKDB 4ONFH 5F3BA 4PJ8D 4CKVX 1OVZA 3KPQA 3SKMB 3LS5H 4N68A 4R26H 4JR9H 3EJZD 2APVA 5F7LB 4ELMF 4AENA 4CL7A 4CVWA 4E41A 4Y5VC 5EFIA 1VKXB 4KUZH 4QXUH 3UAJD 1U8OB 5J6GB 1C5CL 3RWHB 4D0DB 1XGYL 4LL9A 3FQUA 2ID5A 1F6AB 4X83A 3IDMA 5E9DE 3D25A 5C08B 1MCPL 5CJOH 4HWBL 4P5MB 4M61B 4EOWL 2FGWL 1SJHA 1U3JA 2AABL 2NY7H 2VKXA 5H2BB 4HBCH 2V2XB 4L29A 1FGVL 4WEBH 1UFUA 5DURD 2IG2H 2WMPA 4JZJC 2DWDA 5T5NF 4NPYA 4GQ9L 1KFAL 4NWTH 1QOKA 1F4YL 2Z92A 2GY7B 2IPKB 4S1RL 4LCCC 4JY4A 1CLYL 4MVBD 4WTZA 2Y06H 2GTWA 3ET9F 1XGPB 4LVHC 5L6YL 3UTSE 1A4KB 4X4YA 3BDYH 3LZFL 2ITDA 4WHYH 4IHOA 1KTDA 1HYSC 3QCTH 5I6XC 3L3IA 3AVEA 5IVXE 1Z9OA 1DEEA 2D03L 1S7VB 4UBDD 5TGBA 1EBPA 1FGNL 2NY4D 1JP5A 2NTFB 5AZEH 4WFHE 4LKCB 4X5LA 3N1PC 5LCVL 4ELKB 1I8IA 3CX5K 3O6LH 4HC1L 4JAMB 4ZUVB 4QOKA 5C0CA 3WE6A 3SKNB 1WC7B 2WBJD 4NDMA 2DKSA 2NX5A 4DEPC 5DO2D 1WIUA 4UT7H 3B2VL 3K0WA 4OBRA 4KRPC 1RJZA 3ZYZA 4QRTA 1LO3H 1F3JB 2R29H 4IDLA 1DBKL 5D93C 4Y4KA 3IXTB 4M62H 2WBJB 1ZAGA 4JG0H 4HHAA 4LKXA 1PZ5A 3VD9A 2F5AL 5ALCH 5DJDB 4JHAH 4KK5C 3WJJA 2IALB 4HK3N 4H88H 4WUUA 1T5XB 4DW2L 1NGQH 3HC4L 2EDFA 3I85A 3MCKA 1N6UA 1CE6B 5GGTH 4HIHA 5HI4C 3IGAA 1UWGL 2EICA 5DSCB 3ES6B 3VXNA 3D9AH 1FNHA 1I3VA 4JQIL 4X6DF 3LEXB 3MRIA 2QSQA 1DQDH 4JN1H 4OFPA 5DDHB 4ZNCD 2QHLA 4KI5D 5CSZA 4ZOAA 4EBQH 2R69L 5HJ3A 3EJYC 5TPWL 4N90E 4U1HB 1MSPA 4LLDA 1RIHH 4C54A 4LP5A 1XF2A 3B9KC 3LB6D 2OTUB 3B3IA 1VFOA 1B90A 5BQ7B 4DK6A 2X05A 4YX2L 4OZHA 4F33A 1S9YB 4HV8A 4LK4A 2Z31D 4WFFE 1L0QA 5HXMA 3CFCH 3GM0A 3CIQA 4LSQH 3NBNA 3HI5H 3TIEB 4P2QE 1TTUA 1IGFL 4NC2B 3KXFA 4K7PH 5HDQL 5ID1A 43CAB 4TTGA 1UM4L 4FMFA 5MENA 5DC9B 1T7WA 3L7EB 1F4HA 3F12B 3NCYP 3ESVF 4OGYH 2Z31B 2MNUA 1HEZA 3HE7A 4AIOA 2VABA 4L3EA 2LE9A 1HCVA 3DMMC 2WANA 1YUHB 5SWQA 2UZIH 2V2TB 5DJZB 3EFFA 3H7BA 2BFVH 3F5WB 3PWLB 4CNIA 1S7XB 4WHCA 2W07A 3JWDL 5IKCA 5DMIH 1QEWA 4RDQF 3JWOC 3RWIA 5LQBH 1ZSDB 1N59A 4GRLA 4X7SL 1ZMYA 3HFMH 5EOQL 3GJFK 5F7DA 5DUML 4B41A 1WEJH 5L2KA 2RCSL 1S7WB 3UJIH 1BEYL 4LAJH 4D2NA 5IESL 1JK8B 2BRRL 4D9QE 3HI1A 3KPPA 2CDGA 3FB8A 2IAMB 4H26B 5HYEA 4QHUB 3WL9A 1YEFH 5J13B 3H9HA 5BCAA 4G9DB 2P8PB 1HKLH 1JF1B 2HJKB 4L1HA 1SQ2N 4PRHE 1AHWB 4U0RC 3VFVB 2HTKC 2VDLH 4M5YH 2F5BL 4JDZA 1A7PL 1LP9F 1IILE 3S36H 2D7PA 3ZTNH 1NC4D 4JY5H 1LD9A 3SOBL 5ERWB 3DHMA 2W38A 3UBXG 4JFHD 5C0BE 5DJXB 1ORQB 1JFQL 5F96H 1DUZA 3LKNB 3WUWA 2BSSA 3BZFB 4K9EH 1K8IB 1MNUH 5IF0B 3CCHA 2X1OA 1FVCA 5EC2B 3ZT7A 1KPUA 1AGCB 1MHEA 5A3ID 3JTSB 4MNQD 3K3QA 1QACA 3RWCA 1NCNA 2AEIT 5ILTL 3FFCA 3NIGE 4OZIB 5BZWB 3CVHA 3QNYA 3LV3B 5I17B 5IR1B 1INQA 1Q8MA 3MOBL 4N0RA 4YHYC 3MZTA 1NAMA 5FYKH 2AV1B 2FATL 2A6DA 2ARJQ 4D8PB 2R8SL 1A7QL 3ZLQC 2PW1A 3NIFF 1I4FB 2ZUSA 4LLUA 5D1QA 1FYTB 2EC8A 3FRUA 5CSBA 1KJ3L 4RFNB 4PJ7A 1CBVL 1F6FB 1MEXH 3EDJA 2RB8A 1QRNB 1GVIA 1MRFH 1RZGB 2HFTA 4JDVB 4DGVH 3GSNB 5ELIA 2X1QA 3PWPA 4YGVA 2DQTH 3O3AA 3DUSA 2WZPD 2B4CH 3P30L 2UWEA 3SJVB 3PHQA 4HZLB 5GS0H 2VZUA 1DFBL 5HYFA 4GW1B 1SBSL 1T5WA 5CP7B 5EDXA 1MCKA 3RVUC 3OJMB 1DN0B 5GQBA 4HJJL 1QYGL 2XN9B 5IB1A 5I1DB 1DE4A 1RURH 4XT1C 3G5YB 2DB8A 2DAVA 1MWAL 1JNLH 2VN7A 1M7DA 4XWGL 5C2BL 2QQQA 1H5BA 5IBLC 3ZHLA 1RZKL 3I9GL 5A16A 3G08B 4MDIA 5F71A 3QWOB 4XXCC 4JREB 3C5SA 5HHNA 4PJFF 4G7VH 1TQCC 5D2LB 4Z95L 4S1QL 3VW3H 3RBGA 2DL9A 4WU7A 4L3CA 1KTRL 4LHUD 3WFBH 3FB7B 1F11A 4P4KD 3V5DA 3KLHC 4J8RB 4PJAE 1T66C 1GAFH 1DQJA 2APXA 2X4RB 5EZLB 3Q1SL 2I24N 5FV1L 5IMOB 1G6RA 3RY6C 4HW6A 3DGGA 1QSEA 1EVTC 2FJHA 1NMBH 2BVPB 2VXVH 3EBAA 1A0QL 1U8KA 4N0UE 4Y2DC 4EN3D 2ADGB 2GT9A 3T3ME 1X7QB 4IRJB 3RHWK 5BVJA 5DLML 3C2AL 5IMKA 5IGXH 3HUJB 1PGRB 1KPVB 3QO0A 2CIKB 1CR9H 4F9PC 1HHHA 3CVHH 1INEL 4KJYA 4HT1H 1MIMH 5BS0E 1S3KH 1C16B 3EYQC 1XCQA 3MV9E 3CDGB 3IU3B 2W60A 2O5YH 5JUEL 4U1NA 1XT5A 1K6QL 1XR9A 3AREC 4JVWA 4YXKH 3K2UL 1P5UA 5DVNA 4WY7H 1BD2D 4HUNB 5E0QA 1VACB 2DQHL 3ILQC 4YR6B 3R06B 4Y88A 3WXWH 2X41A 2JELH 4KMTH 3DBXB 4LSPH 4ONHB 2EECA 5GGRA 2OK0L 1P6AB 3ARBA 4XCFL 3ESUF 3K8LA 4F7CA 2YXMA 3OR7A 1HXMB 2JJWA 4WW1B 4UNVA 3M17B 3Q0HA 1EGJL 3IRPX 4R2GC 1ZVHA 5T1KB 3STLB 4HJGB 3NFPA 4YDLB 5HYIA 1JYXA 2NZ9C 2P8LA 1BIHA 1FL5A 3BD3A 4HKBB 2ZCHH 3V0AC 5FB8B 3BP5B 5LGJA 4X8JB 1MIEH 2MHAB 3NZHH 5C6TL 3VXMA 4E41E 3G6AB 3TO4C 4ZXBC 4KKBD 2HLAA 3LIZL 2DYPD 4AIZB 2FH8A 3BGAA 43C9B 4NO5A 2YD9A 5J4MA 1NGYA 3V4PL 5F1SA 3C8KA 4L4TA 5HGAA 1EDQA 1N3NB 3QI9B 4MB5A 1CXFA 1SM3H 1G7QA 1BAFH 2ZUWA 3EJJX 2DYPB 1CD8A 1L0YA 1YECH 4P23A 5I8CB 4F3FB 5ECJE 4P3CL 3G5VB 4UINH 3IDJB 4JHWL 4K3DL 4Q0XL 3HC3L 1MHHA 3BMVA 4OZFB 2H2PD 2NY0B 1FDLL 3BPLC 3E6FB 1EHAA 1UXSB 2G5BA 2IBGA 2WW8A 4W6XB 2R2HA 3C8DA 4U3XA 5CEZD 1T80A 5C9KA 2JCCA 1WITA 4LHUG 1G6RH 3OXRB 5E1HB 1UYWL 2BNRA 1UJ3C 4FFYH 3ZO0A 3GI9H 4QHLB 2EC9U 5JTWA 1AI1H 3QUYC 3O6FA 2IJ0C 3JWOL 3W81A 5HGHB 5GZNC 3TBYA 1KJ2A 5IOPB 2FB4L 2YD2A 4LSRL 2W9EL 2R1XB 4MCYA 2NNAB 4GBXD 2PR4L 1U8LB 2PO6D 3DVNB 1AGFB 3H3KA 4NKMB 1BMGA 1NCDL 1NQBA 1NCBL 1SY6L 4R0LC 3ARFB 5IK3A 3VJ6B 3DURA 2AKRA 4HPOL 1GC1C 3I6GA 1A6PA 2NLJB 4MJ6A 5C0CE 4QTHB 1VFUA 1IEHA 4LSDA 4XBEH 1D6EB 5DHVB 4YHOL 4PJ5D 5DHXB 3GJFH 1O7SA 2RFXB 4XNMA 1U95A 5J9PB 2FJGA 2XZQH 3CPLB 2OMNA 4KKCD 4RA3A 5D7JA 4YHZL 2ZCKL 2DF3A 4K2UH 4PJDF 3SDAA 3OWEA 3QQ9C 5IW6B 1NAKL 5FOBB 5E8OB 4XVTL 1RZ7H 1IQDB 4M3KB 4Z0XB 2FL5A 5JIPA 2EKJA 3L95A 4Y1AB 3VGEA 5DJYB 3NCJL 4LQFL 5BRZD 5EBWA 3T8XA 1QNZL 4WUUE 1IGIL 4C4KT 1EO8L 2AJXL 5BV7H 2PXYA 1NSNL 2YC1A 3U46B 3BDBA 4WW2B 3OKLA 4JZNB 4AQ1B 3QIBC 2ATPB 5CLWA 1IKFH 3WFCH 4ONOA 3KPNA 4JFOB 3C5JA 3OKKB 2X6MA 5D72L 4ZFGH 1SBBA 4U1KB 2DOCA 5H37G 2FO4A 4FS0A 4ODHL 1FSKC 4P5TD 4OZFG 4HIIB 1ZEAH 2LTQB 2VDPL 4FTVD 3F7VB 2R4RH 4GKZA 3VFMB 1X5IA 1ZWIB 4OZHE 4O2EA 3ULUH 1A47A 2Z91B 2ZNWA 3PXHA 5KG9A 3T1WA 3C6SB 3QULB 5TF1H 2Z93B 2HT2D 3C5ZC 4N8VG 1BVLB 5FYJU 1ZTXH 4JFFA 5J7CC 5MENE 3I3EA 5TDOB 4YDIH 5EU7E 5KSAA 5GGQH 2QQKH 1ZE3C 5DWUL 1MCDA 2GSIA 1KJ2H 4HAFA 1A6AA 4Z5RB 5ADOH 2XZAL 1I8MB 4WTWA 5LXGH 1NFKA 3PNWA 1Q94B 3LSOA 2VXUH 3HHRB 3O2VL 1DN2A 1A6UL 1MHPH 2HKHH 5JORA 2XWTB 2EC9T 4UTAL 2V9RA 5HGDB 4MDJA 3MJ8A 4LGSB 1VFBA 3H9SB 3VFOA 3TN0A 1AO7A 5CD5C 5D96B 5INDA 5F7UA 3S5LA 4J1UB 1AXTH 1ED3A 3HC0B 5JO5A 4BH8B 5FF6A 2D0GA 2V17H 4OKDA 3VWJA 5I0DA 4NWUH 1T89A 1FFRA 1S7UA 1KXTB 3MLTB 3RNKB 4UIMB 4TRPL 1AGBB 2BNQA 4DAGH 4BUGA 2IQ9H 4Y5YC 1QR4A 1HH6A 1T1YA 4I18A 1NH6A 3WLBA 5K9JH 1SYSB 1M7XA 4S2SA 3EO9L 3MLVH 1DZBA 1A2YA 1UCBL 3TT1H 2X89D 2KQMA 3QIWB 3U4EA 1RUPL 3RUGA 4JFQB 1RULH 4OCWL 1G7HB 1KCSL 4LEOB 4Z7VA 5I76A 4Y8DC 4UT6H 5SWSD 4G5ZH 4P2RD 4R26L 1A1NA 3HCVA 2YR3A 2ICWA 2IADB 2DQIL 3U82B 1M7IB 1VGKA 5DK2A 2X4TA 3CLEL 4WWKD 5FYJH 3FFCE 3P4OA 1EO5A 4Q7DA 3OB8A 4X5XB 4Q9CA 2DQFA 2A6IB 4TN9A 5HDBF 4S1SL 4RWHA 4NKQB 4NKDB 4ZPTA 1JGUL 5C9JB 2YRLA 4FXGB 3BZEB 4OLYH 3D18A 4KKLC 3QFJA 2ESVD 4BZ1H 4EDXB 2B1HL 4D3CL 1C08A 2DLFL 3P0VH 3EFDL 4WWKB 1XZ0B 4FN0A 4XAWH 1GZQB 2EKSA 3TA3D 4WI9A 1CLCA 4WU5B 3KYNA 4WVRA 2F8OA 3WS3B 4FQXB 4PJ7E 4K23H 3OJVC 3PL6A 5TE6L 5DJ8A 3FKUS 3GBNL 4YK4B 1YNLH 2ESVB 4IIQB 5D71L 4PG9B 1IGCL 3SPVA 3PWPE 3ABZA 3W2DH 4PRID 1BREA 4ZUWA 2R4SL 1BBJB 3KYMA 3ZKNC 1SJVA 4YUEH 3TA3B 2UWEE 2Y06L 1FFPB 2ZCLL 1D5XA 1IAOB 3SE3C 3QNXB 3MRLB 4QRPA 3PHOA 1UA6H 1YQVH 4NQSB 5EU6B 3GKWL 2D3VA 2VDOL 2W0FB 3LEYH 3HTLX 3W0WD 35C8L 4HZAA 3ROOB 4HFUH 4K71C 3HKFA 3SO3C 2EDHA 5IQ7L 3K4DA 4Q9RL 3I02B 5C07B 2X1XR 4E0RB 5E2TH 4TULH 3QEQD 1IVLA 1IBGL 3QEUA 1U58B 2AXGB 5DEFA 5KVFL 3X11B 3W0WB 2VAJA 5H35B 5D5MA 1GGYA 1T04A 1LGVA 2GAZB 5I16B 1P4BH 4N5EC 5I18H 1XF5A 1BOGB 2H8PB 1W8NA 3MRQB 1JN6A 3BD4A 4OB5L 4LAQH 3DO7B 4K7PY 2M8XA 1FZKA 5KSUB 5AWNH 4I3RH 1LO3L 2R29L 3HZKB 1DQTA 1YN6A 1U8HA 3IDIA 5GJTL 4Z78B 1KYOK 4JG0L 1PBYA 3KPTA 3BEVB 1QSEE 2CGRL 1AQDB 5ALCL 4NT6B 4P3DA 3SGKC 1JYWA 2AV7A 1GC1L 4QRSB 3BSZH 3KR3L 1XF3B 3RIFK 5CWSB 1YY9D 2RGSA 1RZFL 1FNSH 4PJXB 4LPUA 1RK0A 3EIFA 5T3XD 3FOMA 5I1CH 3FO2A 1MI5D 5GGTL 5IB2A 2X9XA 4Z7WF 2YK1H 5E2UH 3D9AL 4UQ2B 1HZHL 3NGBB 3CFJA 3U4AA 3CH1A 3WHXB 1IRAY 1ONQA 1ORSA 4J4PC 3MLRH 4OZGF 3VE0B 4EBQL 3TCLB 5E24E 4PB0H 5DR5H 1MI5B 4F57H 1BM3H 2XN9E 4O5LL 1N8ZA 4XC3L 5E4EC 1VB9A 5T5FH 3ARPA 1A22B 4U1LB 4D9LL 3MV7A 1FV1A 2JB6B 5JPNB 3NABH 3HMWH 1FO0L 1J12A 1DL7H 5FCUL 3HA0A 1UH4A 4KROC 1XIWC 2VDKL 4LSQL 5E99L 2BJMH 5B38B 1F58H 3JV0A 4XI5D 1LEIB 2F54B 4M9OA 3VXSB 3UC0H 5EULV 1AQKH 3VXME 3HNSL 2DQCL 1O5DT 5JA8B 1S8DA 5HTSA 3VGHA 4UDUA 3IFOA 5I1LB 3QUZD 4MXVF 3QEHB 3WDIA 1HHKA 2N56A 4L8SB 2J5LC 4ZS6C 3LD8C 3MACL 4EJ1C 2F19L 4L4TE 5EOCL 3WBDA 1CI5A 1R6VA 3FQRB 2Q3AA 3I6KA 3NCCB 2BSTA 1JV5A 2BFVL 1Q9OB 1MLBA 2BVUA 3QUZB 1U92A 3O4OC 1LO0L 4CW1B 3T4YB 2P5WA 5EO0A 5F9WB 3UJTL 3IDGA 3HUJE 1JGDA 3HFML 3ILPA 5I1KH 1HWHB 1CGSH 4MJIA 4LCUA 3V52H 1RJYB 4PR5B 3ULUE 3LDBB 3BIAX 2DLEA 4WHDA 3O9WB 1TCMA 1UXWA 5D1XB 2YA1A 1A7OH 1NGWA 3AGVA 2A2QT 1IFHL 2D7QA 1WBZB 2JCCE 1PD6A 5FHAL 2YEZB 3BP6B 3NACH 1DBBH 1CDJA 1IKNA 3WEXB 5AYUH 3GB7A 4LCIH 1P2CB 3LQAC 1G0YR 2MTPA 2NXYC 2YMXH 2KH2B 2NY1C 3PQYB 4L9LC 4YHML 4GAYA 4H25B 4PBXA 3MO1A 4PD4K 3U0PB 2VDLL 4O51A 4JM2D 4Q6IA 1L7TL 1TVBB 1B4RA 4IEFB 3RWEA 2B1AL 1TFHA 4XTRD 1BIIB 4TNVK 3D0LB 4APQC 4K9EL 4XVJL 4M4RA 4JM2B 1LNUA 4POYA 5EN2A 4YFLF 2XG4A 1A6VH 1FIGH 5C0FA 1ITBB 4LRNL 2EO9A 3GSRB 3H9YA 5C0ND 2P5ED 3BE1L 2KZWA 3IFPB 4KTDH 5F1KC 2WV3A 1KB9K 2C3VA 5FYKL 2VDNL 1RUAL 3SE9H 32C2A 3GM8A 1JWUB 1FLRL 5J6HB 4NRZA 4JFDA 3AC0A 3CFEA 5C0EA 2FR4B 1NEUA 4CU7A 2P5EB 1OAQL 3V0VA 2ZG3A 5SX4H 3QR2A 4OIIH 3T0AA 2WP3T 4KJQC 3G6JA 4IRSB 2F53B 4XPAL 5J11C 2IBZX 3KPSB 4JB9H 1TZHA 1IARB 4AT6A 1IAMA 4RIRA 4CU8A 5FM4A 4WI2A 5KW9L 1OLLA 4E5XB 2MOVA 1GIGL 3VGFA 3SE4A 5K9QI 3REVB 2Q6WA 5GGSA 4P46D 3DVGB 3PWJB 4MB4A 3A0OA 5E6IB 3H3BC 5FYJE 4BQCA 4HS6A 2GTZA 3VI4F 1T4KA 1YY8B 1WZ1L 1EEQA 3QCUL 3L3HB 3C60D 5BO1H 1JNLL 2V7NB 5CBAB 3RVXC 4U6XA 2X4NA 4JRXD 1HE7A 4YDJB 4QGYA 3RDTA 4GXUN 2CQVA 4UQ3B 3ULVF 2OJEA 3MFFB 3WIFA 4PJ9A 2OR8A 4L1DA 1QR1B 3VG9B 3D85B 4BJLA 4YO0B 4GKOA 1EERB 3ECBB 4M48L 1QPXA 4ZQKA 4LGRB 1FC2D 5DYOA 3DX7A 3BRDA 4WO4C 1L7IH 5ICXA 3LPFA 3KDMB 3K46A 2GUOB 4MB3A 3QXTA 3BKCH 5DZOA 1AH1A 3LRHA 4HG4J 4FFVD 3V6FA 1J8HA 1YMHB 4OZ4B 2EE6A 1ZXQA 3QQ3B 4Y4HB 4KXZH 1NGXB 3T0EC 3MGTB 1D5MA 3BPNC 1AO7E 4QO1A 3V6ZA 4NKIH 4X6BA 3T1FB 3CFKA 4R97B 4O9HH 5FKAA 5T33L 1AXSB 5HHPA 3CH8A 5EA0L 2YPLD 1QBAA 2BOCA 5JNYB 4R4NC 1MCQA 3NTCL 5DT1H 1RVFL 2FD6L 2W0LA 3TT3L 3NN8A 5D7IA 3FN3A 4LRIA 2BNQE 2R9HC 4JZJB 3NPSC 4PGBA 1I1AC 3AY4C 2O5YL 4KUCF 2W59A 4U7MA 1S7QA 5FO7B 3T04D 1EEZA 2R56H 3F6IA 1NGPH 4GUPB 1HYSD 2JELL 1IC7H 5IQ9B 1J8KA 1KT2A 1UC6A 3DSFH 1DLHB 4LVHB 1AFVH 3TZVB 4M4PA 4MQSB 3GI8L 1I7RB 4RAUA 5ESVB 3Q3GA 3DUUB 2R23B 4NZJA 4QLRA 3MA7A 2OZ4L 4Z7VE 4XMPH 5B8CB 2C7UA 1YN7B 5I6XB 4M8QB 2ZCHL 1PG7L 1ES0B 1S9WB 1LK3L 4JFPB 4OCYL 1MAJA 2R0WH 1T2QH 3S3PA 5D6CB 1YJDC 5HSFA 3CK0H 4KRPD 3RWJA 3UTTB 4HULB 1YPZB 2H32A 1EEYA 1OGTA 4OCSH 1LO4L 4X99A 5HY9B 3UYRH 4QT5A 1RPQA 4PV8A 4DEPB 2ADIA 3U6RA 3RBSA 4NNPH 2PETA 2VZVA 4PLOB 5FK9A 1ZLSL 1A14H 2UYLA 5GGRY 3SKMA 1NANI 5EUOA 3FT3B 4KK5D 3OKYA 3TBTA 4M6AA 3P9MB 2WINB 4A2MA 3U4BH 4NQDA 4YXHL 4YBLC 1GGBH 3MLYL 5D93B 4Q97A 5HI4D 3ZDZE 3RWHA 1IAKA 3WDHA 4PJ8A 5C0GA 3TNNA 2IWGA 4XP4H 3DSNA 5F89B 2C5DC 2GK0A 3O0RH 2ZUVA 2H1PL 1VGEH 5BW7C 4EI6B 3TESA 1KTLA 3IDYB 4J3WA 3HS0A 3L1OH 3D48R 4UILH 4BSVA 2DL2A 2I07B 4X6CA 3GI9L 1UACL 4QRPE 4KZEL 1KCRH 5CINL 5JR1L 5H2BA 4DKDC 1JNJA 1CT8A 3B9KD 5EZJA 4QXWA 1N0XH 1Z9MA 4UB0H 1RJCA 4WGVB 1MJJA 1KJMB 4QRUB 1AGEA 3EO1A 4ZTPL 2LVEA 3B9KB 1YEEL 3O3EB 4X7EC 3QH3A 5D5ME 4TNWK 1EZVX 3PDGA 2YSSA 4NUJB 1JNHA 2V6HA 2ZWLT 3BDXA 1NCAL 2AJVH 1IQWL 3G5ZA 3K80A 3E3QE 4FQJL 2EZ0C 4GJTB 5GS3A 1Q9LB 3LQAL 5MI0C 2FX7H 4JHBA 4FA8A 3DMMD 4ELMB 5E8NB 3F58L 1C7TA 2EYRB 5FYLH 2Z4QB 2FWOA 3MLPA 4GG8A 4WENB 4XX1G 3BAEH 1WV7T 5LWYL 5LAXA 4YHIB 3EOYG 3MJ9L 2R0KH 3QG6A 3X3FL 3DMMB 4JDTL 3QPQC 4UOJA 5C0AB 4ZD3H 1RHHA 5BV7L 3MBEC 1QBBA 3RWDB 2H32H 2QHRL 1ZLVK 3DECA 3BD5A 2KUTA 3K8MA 4KGJA 5KVGL 4OM0H 3SBWC 5C71A 5DJDA 4NQVA 1U2HA 2BMKA 4L8CA 4KK6C 4XP1H 4I77H 4MWFA 5EU5B 5IW3A 1T5XA 4ORGB 3AMKA 3PP4H 3GMLB 4OCNC 5HHVL 3KJ4B 1BGXL 4JPKL 3SEPA 3CNKA 4U4BA 3KPOB 3ARXA 4YDVB 4JPWL 4CDHA 2R4RL 3MV7E 2NR6C 4RMTA 5L7XH 2PYFA 2D4FA 2VR4A 1WAAE 3MNZA 4XCEB 4GW4A 3AB0C 1HXYA 3DETC 1MJ8H 5CLTA 4Z77A 5DJAB 3HPJA 5DQ9B 3SHSA 3L9RA 5DRNA 2P47B 4U1MB 4O2CB 5DD3H 1IMHC 4QHNA 1LEGB 4U0RB 3UBXA 4LLQB 3VRIB 2ZUXA 1PZUB 3MRDB 3IJSB 4YDIL 5DD0L 5GGQL 3QDJB 4NO3B 5ICZB 1NCCH 2P43B 5ADOL 1J05A 2J1KA 4L8DA 4KDTA 4UV7H 3KLSA 4G42B 3OF6D 5IG7A 5ALBL 5IM7A 2LFGA 2CKBA 3BQUB 3CGTA 2HKHL 4IOSD 4QYOB 3LPWA 3FQNB 2P5WE 3HR5A 1CL7L 3FFDA 1MY5A 2YOCA 4YAQA 1AJ7L 1CD1A 3F12A 4PJIA 2X1WL 4M7LH 1Z3GL 5DJ2B 5ADPL 1PEWA 4CVXB 4HUXB 3MR9A 3SE8L 4MJIE 4HKXB 2P45B 1S7SB 1LE9A 3O3DB 1AXTL 5L9DH 1FFOB 3VXTB 5F9JA 5CJXC 1HIMH 2VDMH 1S7XA 4F7PB 1HSBA 3L5WA 4IRZH 1QFUH 1EH9A 1S7RB 3BGFC 1FNAA 2YD3A 1MFBH 1LQSR 4OT1H 3SGEI 4X6DB 3CDCA 3BEWA 4ZO8A 2IQAA 2HLFC 1XGRB 4W4NA 2M2DA 1TJIH 5C3TA 1BQLH 3WD5H 4XCNB 4M7LT 5HYSB 1R5IB 1OB1A 5F6IC 5DUPH 4F9LC 2ZOKA 1NMCB 5B39B 5IBLD 1U8NB 3SDDA 4JFXB 4I0PC 3SKOB 1BF8A 4LLMB 4HWEL 3VXOB 4UT6L 2E9WA 4I4WB 5FGCB 4XMLL 5TDPB 1YEKH 2CXKA 4TVPE 4NBYB 4NO0D 1JTTA 4P4RB 3OX8B 1JGLH 4Y4FC 1MFEH 2G75B 3FQTB 4JRYD 5FA3B 3KLHD 5KZCD 1OF2B 4PJHF 2BVTA 1QSFD 3WN5C 5E5RB 5ERWA 1UB5A 4XVUC 3CXHJ 1F6LL 4ZFOB 3QHZL 5AUMA 2IMNA 4NO0B 3V79C 5IB5B 3MODL 5B22A 3VFNA 3WUZA 1F97A 1KN4H 4JRYB 1U36A 5EOTA 4F80A 3QUMA 4XPGL 5KZCB 2O5XH 1IGYB 5E8PB 5FUCE 1NC4A 3MOQA 5HD8C 4CN1A 4H1LG 2PYED 1X5ZA 4LFHD 5FGSA 1IEBB 1YJDL 3IFNL 4G8GB 3O2WL 2HRPH 5E5UB 5ISZD 3G6JE 2B5IC 3DXAB 3LRSA 4P57A 2CKBH 2VXSH 3QIUC 1E0OB 4HCRA 3F6LA 4Y2DB 3RZCC 4R4FL 3EYQD 3N06B 4WGWB 2OL3A 4MNQA 3T08A 3P0YH 2PYEB 3ARED 1DSFH 1FG9C 1ACZA 3ILQD 1I4FA 4YPGA 2FYYA 1JZ2A 3NCBB 3VA2C 3LEYL 5I0ZA 1FQ9C 3RGVC 3GEWB 1GOGA 3FQWA 4HFUL 1DR9A 2AQ1A 3ZE1F 3QA3A 3ARGC 3GSNA 4YXLH 3AREB 1T7ZA 4R2GD 2A74A 4DK3A 7FABL 4BSWB 2NZ9D 3WXVL 4ERSL 3MRHA 5TJWK 4PJEA 2MKLC 3C6LC 4MMXC 4B50A 1LP9B 3TPUB 1OP3K 2CJUL 3MZGB 1W72B 2N1KA 1RUKH 4P2OB 1S9VB 3TO4D 5I66B 1QBLH 4ZXBD 4WFEE 5I18L 4HKZB 4R2GB 2CUMA 1KB5A 4QXTB 5ACLA 4OLZL 1MOEA 1VA9A 4GAFB 5GSRA 1TLKA 1P7QB 4GAJH 3MRNB 3ELAT 1MCOL 4X6FB 3UXFA 2EDOA 2VITA 4I48A 4X6EA 3TO4B 2BOBA 4G6ML 3E1F1 3MLUH 4MGXA 4ZXBB 4JZOB 3ULVL 3U7WH 2XQYG 2Q1EA 3QBTB 4Z9KB 2YBRA 4ZFFB 3RTQB 5MEPB 1SEQL 3KPSE 3FB7A 2G60H 3MOAL 1DUYB 3D2UD 3RL2B 2D31B 1TXKA 5EZLA 3X14B 3IDXL 5JQ6H 4M00A 2IF7A 1IL1A 3EYSH 4LLWB 3QXAA 1P4LA 1ADQA 4R90L 1U6AL 4LHUA 3KYOA 3VCLB 1U93B 1PSKH 4X4XB 2GJ6A 2YPKB 1QFWH 4P4KA 1JI2A 1MCSA 3KS0H 3BPLB 5GZND 5GPRA 3QUMH 1I7UB 3C9NB 1JPFA 4HDIB 2E5EA 4GRMB 4OFYD 1Q72H 4HH9A 4GXVH 4EUPB 1QVOA 3U83A 2AGJH 1UJ3B 3BZ4B 2P48B 3CXDH 3VXUB 3QUYB 2BP3A 2IGFH 4HCRH 1GZPB 1KIQB 4EN3A 5L88L 2Z8SA 3BKJH 1E4XH 1I3GL 1JNNL 2OL3H 4LFHG 1X5HA 1ZS8A 3Q5YA 5EIVA 4M02A 3VXPA 1VACA 3VU2A 4O58L 3B5GA 2J12B 2BHUA 3DBXA 2ZKHH 3ALPA 4R0LB 2Z8RA 4RGND 2WLYA 3LH2L 4O4YH 2ATKA 2D0FA 2H26A 1U91B 1F2XK 4N0YL 1VFMA 1TETL 3KPMB 1HDMB 3GSNH 1DVFC 3NZ8A 3W11C 4KAQL 5EZOH 1BD2A 1FG2B 2XPGA 5GS1B 1W0WA 2JIXB 4RFOL 3PABB 5BXFB 2WAHA 4LSSL 3UO1L 1KELL 2NXZC 2MJWA 4F37F 3H42H 4NQDE 4NN5C 2NW2B 3SCMB 3QUKB 5DZNA 1B4JH 3MREB 4IJ3C 1KB5H 4PRPD 2NY6C 3JZ7A 4P49A 3QIBD 4L5FH 3ZL4H 2XNAA 1BVKB 1EXUB 1X4XA 4Y5XA 2EYSA 4M1GH 2X9YA 5EWIH 1NMAH 2C1PB 4ODUB 5D7LD 4GMSH 4PRDA 4X6CE 5JLZA 1H0DA 5K9KB 4PRPB 1DBBL 3G5VA 4PGEB 5DRXB 2YA0A 4G6KL 3BI9X 1Q9WA 4CDGC 1ACYH 3S98A 2QBWA 4WI7A 1KLUB 4TTDC 1AD9A 2ED9A 2Y36L 3O45B 4DZ8A 5D7SL 4RNRB 5KS9A 1ADQH 1FSKB 4OAWA 3P0GB 3C5ZD 1PW3A 4N8VA 1S9XB 3RVVC 5JDJA 3BUTA 3FT2B 4YH6A 2M1KA 1K8DB 3S35H 3MRPB 2VLRD 3BPCB 4QRRD 5KVDH 2ORBL 3HRZA 1UB6A 4EUPG 2R1XA 5IVZB 4WDIB 1BF2A 1AGFA 1CFSB 5GGVY 2YKLL 3NFSH 1MCEA 5IIEB 3BWAA 4PYGA 4UU9B 1QLRB 3DI3B 1T1ZB 1BLNB 1ZA3A 4D0CA 2ZUQB 5DMGC 2OM5A 2RJMA 2VLRB 1FAIL 1J1OH 4GBXA 3WV0A 2PO6A 3LKQA 4DGIH 4MX7A 3AXLB 2VOTA 4XP6H 4NOBA 4MSWB 3NA9H 2CRZA 3IDUA 4PUBH 2JK5A 5F3HA 4AYFA 5CD5D 3EYOB 1P84K 2BSRA 2FZ3B 2VLLB 5C0DB 3MRCB 2ADJB 1C5BL 3I2CH 4F15C 3VGGA 4U7SA 5KN5B 4YC2C 4PJ5A 4UDTA 1U3ZA 1H15B 3QRGL 1R5VB 3X13B 2Q7YA 1IGML 1CFBA 2XXCB 3PP3K 3EOTL 4NNYA 4RSVA 2YUWA 1TZIB 1KBGH 5BJTB 3WJJC 3QDMD 5FOJA 2A73B 3PJSB 4MAYB 1RU9H 4U1IB 3IKKA 5C70A 3VG0H 2HFFA 4GT7A 1L6XA 5K9OA 1MRDH 2JJSA 1NFDA 3UJJL 3HLAB 5EZIH 3T77A 2DMKA 2CO7B 2OXGA 4NQXA 1WT5A 2Y7QA 3HZYB 5BRZA 3RVTD 2QEJA 1FH5H 5TFSH 2AXFA 5CGMA 1XGTA 5HYJB 4PJ7F 2HA1A 3QDMB 2AJ3A 5EBLA 4EI5B 4AEIL 3WMSA 5DD5H 5DF0A 5B4MC 4EXKA 4HF5H 1I85A 4ZDHA 5TE7L 3HNTH 1FNGB 4OZFH 4XAKD 3VFPA 3VFMA 1M05B 3Q48A 4F7TB 3WNMA 3MXVH 5DRWA 1U8MB 4JJ5B 1EUUA 1MVUA 3MLSH 3O11A 1BX2A 4R7DA 5B21A 1FFNB 4PY8J 4P5TA 4X5WB 1HNGA 1CDUA 4FTVA 5GGSY 1DBJH 4X9FA 5C0AE 1NLDL 5GZOC 4KKLD 1UQSA 1Q9KA 4XBGB 1OP5K 3VDCA 1M71B 4PJIE 5EU7C 1G7JA 2RQ8A 5CEZH 2Z35B 2H3NB 4G80B 1F90H 3GMOA 3ZKXC 4NQEB 2YUXA 1T20A 1H3TA 3STZB 2WM0A 2R15A 5B3JE 1CF8H 4NJAL 3PIQB 4M7KL 1E6JH 5AEAA 1FCCA 4LCYA 4OZIF 4HXAH 1A3QA 5F9DC 5DMJB 2XWTA 3MPCA 3ZKND 5DT1L 2C4FU 1EFXA 1MRCH 3FCTB 5TQ0H 5HGDA 4GMTL 3PV6B 1WWCA 5DHVH 5GS0C 4ZSOA 2YUZA 4GRLC 4JO2H 2M26A 3T2NH 1ETZB 2FHCA 3G04B 4HIXH 3QJFB 1N5YH 3TNMA 4NM8L 4J1UA 2Q20A 1TJHL 2ZG1A 3KPRD 3EYFB 2X4QB 3EOAB 4Y16B 1R3IL 5JDSA 1PX3A 4GSDH 5DJ0A 3MBXH 1I3RB 4PJCB 4YEEA 5INCB 4XRCA 3SKJH 3FTGB 2DMBA 2BC4B 4K71B 3WIHA 2EH8H 4ZTOH 3JV4B 3B2UC 2NPLX 3G5XA 2VLJD 1V05A 2OTWA 3LVEA 1PQZA 3I6LD 4WV1A 1YMMD 2UY6A 1U3HB 1TVHB 5FKPA 3LN5B 3VRLE 1RZJH 4IOIB 5F97E 4TSCH 4OCSL 5HPOA 3L3GB 2I9LB 1FN4A 3SDCA 1WCBB 3BXNB 4POZC 2VB5A 4TSBL 4K94H 1YEGH 4KJPC 1RUML 1YQ2A 4DOHB 1YMMB 1MY7A 1CTNA 4LLYA 5DI8A 4BSJA 1S5HA 3A6BH 4TUOA 5D2LF 2IFFH 3NFNB 3H8NA 4P2CG 1AGDA 4ALAH 3DX9B 1BFVH 4JFHE 1HHJA 4ZOCA 3EYVA 4E42B 1I7TB 3IFLH 4Z7UA 4MA8L 5SWSA 4P2RA 1FP5A 1MCLA 2QADB 4PV9A 4S0SD 2V5SA 1OGAB 3O0RL 5J06A 5KSVB 1TCRB 4GRWH 3WO3B 2Z0BA 4MNQE 1IGJB 3ISWA 4AM0B 6FABH 4XCYA 4UV4L 3BN9C 3L3DB 4H20H 4AL8H 4MLIA 1B9ZA 1CFNA 3JVGA 1UKQA 4DCQB 2HFGL 2E7HA 5F9AC 3TIDA 5D1QC 3T3PE 4R4BA 2IAMC 4UB0L 3HUJF 4IIQA 1HNFA 1NDGB 4DVRL 2DJUA 2DDQL 4HIJB 5KTEH 1BBJA 3MRRB 5I8KH 3TA3A 3OKNA 4F58L 1K5NB 4ZPVB 5J13C 3NCEB 1A1MA 3B9VA 4PJEE 5FGCE 1QLFB 5I8EB 4DN3L 3BO8A 3QNXA 5I75C 3N85L 5E00B 3FT4B 1AHWC 2CUIA 2XWJA 4YPJA 3HG1A 1ULVA 3J8F7 5EC1B 3RVWC 3DIFB 1ZKAA 4PRIA 3KVQA 4KROB 4LDOB 1XIWB 1F3DH 1YYLH 5SV4A 4LPYA 2YD5A 5F88A 1HILB 5DMKB 1QRKA 1I8LA 4ZS6D 3P11H 5K59F 4FQIL 3O4LD 1H5BC 4CVZA 5HHOD 1EMTH 2HJFB 4YHLH 2VAAA 4KHTH 3OKEA 1T7YA 3BAEL 5EU4A 2VXTH 1MLCA 4L8BA 4YE4L 4M1CC 5E7FA 3OHXA 1T83A 4HWBA 5JXAL 5DJ6A 1BOGA 3QEQA 3MRQA 1A5FL 4PJBB 4CRPA 1CFTA 4OJFL 3O4LB 1YEDB 1GRWA 3M07A 3KNBB 3V6OA 4B0MM 1R3LA 3O4OB 4NGHH 2P7TB 2IH3A 3DYMA 5JHDD 5MEQB 3VXRD 5DC4B 1CFVL 4MD5A 3MTRA 3EOBB 3X12A 2GJ6E 5FECB 4JO1L 4I77L 1JWSB 2YUVA 1H3GA 3ZKSD 4G7YH 1G7LB 3U7AA 2NXYD 2NY1D 4RFNC 3PP4L 1G9NH 3QDGD 2R1YB 1G7MA 4FG6D 5E94A 1I8KB 2IH1B 1Z0MA 3HZVA 3MMEB 1H3PH 1ZHLB 3MA9L 2EH7H 1FL3A 4L9LB 2DQEH 3OJDB 3O3BB 3EO0A 1BP3B 1CE1H 5J57B 3T2OA 1MI5A 2G2RA 3LEVL 4R96A 4HC1A 1J0IA 1Y18B 4OLVH 1S7TB 4RFEA 3QEGH 4K3EL 5IHZA 5IWLA 1ZVSB 4APQD 4XMKH 2EE3A 1VCAA 1LILA 2OS7A 4DVBB 5CZVH 1MCNA 3DGCR 4L4VD 5GS2D 4OKVB 1BD2E 3DO3A 1WWWX 2VZOA 4N5UA 4RISH 3S97C 4APQB 4LCWA 4ODSL 1IAIL 4J3OC 4PYHA 4X9IA 3FO1A 1CK0L 2NY5C 4J6RH 1R24A 1EPFA 1FNEA 1KCVL 2V2WA 3IU4L 4HK0B 4L4VB 4XP9L 1TJGL 4M7LL 1ZOXA 3H0TB 5KAQF 4PGDB 4RQQB 1DANT 1ZT4B 5FDYA 3C87A 3OKOA 5D70H 4KJQD 5L9DL 3QUXD 5J1AA 1PKQA 1FC1A 4JLRA 4QCIB 5J12C 2APWA 1C5CH 3W39B 1FZJA 1Q9OA 1XGYH 2VXQL 3CMOL 2X10A 2DN7A 5EIIB 4OT1L 4YNYA 1NDMB 4IRJC 4P23C 4HWBH 4WJ5B 3UDWC 1BZ7B 1A6TB 1BHGA 3IKCA 3FHAA 4EOWH 2HN7B 3CFIC 5J11B 2FGWH 3Q5TA 2ZJSL 2AABH 1FRGH 5CEYA 1BQLL 4WW2F 1IM9D 1BQHA 3L5JA 2FX9L 3FB5A 4C56D 1LK2B 3P9LA 1MQKL 3S34L 1U8PA 5EUKA 3BGMB 1JPTL 3RVXD 3SY0B 3MROA 1T21B 4GQ9H 1KFAH 4GKSA 3ZE2E 2XKUA 3QISA 4PFEA 3O6FC 3S37H 1YYMH 5D8JL 4MNHB 1CLYH 3PDOB 5CEZE 4YBHA 1JPGA 5L6YH 3ZYOA 4FRWA 4MQ7B 5FA4B 4OBSA 4WO4D 4CUCA 5HHQA 2BNUA 1JHLL 1F5WA 1CWVA 4YDLC 1J0YA 2QLVB 3MV11 3MNWB 3TWCL 3VI3E 1SVCP 2IANB 4Q9QL 2D03H 2A6JB 1FGNH 4PP1C 5T3XH 4S1DC 5LCVH 5BMFH 3WLWD 4YGAB 3N1MC 2IBZY 4HC1H 3WIIL 1JYNA 1R3JA 1BIIA 5HHMD 4NKOA 5DQJB 3T0ED 5J0BA 2VTFA 4O2FB 3JV5A 4CJ0A 4WNQB 5K93A 5GISL 1IT9L 1QUNA 3E2HC 4PPTA 3L3JB 3S4SB 3RKDC 3B2VH 2EDLA 3QI9C 4TPRL 2HRPL 3GSRA 2XKNB 4PJ5E 5JXEC 1TTFA 2PTTB 4R4ND 5HHMB 3T0EB 4G8IB 3OQ3B 3QZWB 3T09A 1X5JA 4JCMA 1E28A 1DBKH 3H6JA 2YRPA 2R9HD 3CUPA 3DV6B 4ENEC 1MVFA 1I1AD 3REWB 2F5AH 4FXKB 3ZTJH 2PXYC 2NY0C 4G8FA 2E7BA 4XP5L 4A6YB 2P5EA 5L8JB 2V7HA 1CU4L 4E9LA 4XNQA 4KQ4L 4DW2H 5BRZE 3HC4H 1I1AB 3ZDZF 1UWGH 1DBML 3S96B 4EQ2A 3TH2T 4P5KA 3PGFL 4MD4A 4JQIH 2GCYB 1JZ8A 3SDYH 2NQCA 2JF1A 3BW9A 2R69H 3D3VA 4HS3A 3NAAL 1QBML 4GLRH 4M8VA 5TPWH 1NEZB 3GSXB 1MCJA 1UEYA 3ARFC 3W9EA 2JLLA 1Z5LB 5HHXH 1QZ1A 4O02L 2VSCA 4GRWE 4FTVE 1T0PB 3ARDB 3BUYA 3DJ9A 4P46A 2HJLA 4BYHA 1J0JA 5SWZD 1LE5B 2EDKA 4KHXL 1IGFH 4TUJA 1SYVA 3C60A 3PGCA 1A7NL 5HDQH 5ESQB 1CFQA 1UM4H 1AIFB 3IDNA 1F4WL 4JRXA 4RBPK 2G60L 2DLGA 1C8PA 1A21A 2P24A 5FO8B 1IGTA 3IVKB 1UH3A 4Y5VA 3MCLL 4ISVB 4ZSOE 3SKUD 5FM8A 4U05A 4UNUA 3JWDH 1MH5A 5JW4R 5FUZH 1JTPA 3G6DL 3UTZA 2EO1A 5HYJE 4X7SH 5E9DB 1N2RA 5IHBA 1C5DA 5EOQH 4ZUSA 5ITBL 1UVQA 5LKNA 5DUMH 3QXDB 4QWWC 3SDXA 2F74A 5D1ZB 1ZT1B 4G43B 3ULVD 1KG0B 1BEYH 5DRZB 5I1EH 4MJ5A 5IESH 1MWAA 2BRRH 3KAAA 1T1WB 2GJJA 2LTQC 4KVNL 3INUH 4PB9L 5E2JA 2FLBT 2YPLA 1D6VL 4PTTA 5DK3A 4BFIB 4I18C 2EZ0D 4LCCA 4ZYKB 4EDWH 4LBEB 5ITFB 5BZDB 4LIQE 4P2YA 1R3KA 2OR7A 4NHUA 1DLHA 1RI8A 4EXPX 4WFHD 2QR0B 3HAEG 1CLOL 5C09D 3UTSB 3VFSA 1ZT7A 4RRPG 5AZ2L 3TV3H 2J8UA 1WAAF 2F5BH 1A7PH 3UP1A 4AG4L 1D9KC 1W8OA 5IVXB 3UTPE 1N5AA 3SOBH 1PJ9A 1Q0YL 3QPQD 5D6CA 3RKPA 5FM5M 1NEZG 4XWOC 3CSYA 4LU5L 4Y2OA 3CFDA 1VADA 4XXDB 2XY1A 2YN3A 1MJ7L 3O41B 4Z7UE 2ADFH 5E5MA 4P2RE 3S6CA 2BHYA 4PGCB 4QY8B 4KUCD 5HYQB 5ILTH 1T7VA 4G9FD 5T3ZL 2AK1L 1XH3B 3MBEB 4AH2B 2DRUA 4XPHL 3GSUA 3MOBH 2NY5L 4F7MA 1CGUA 1EZVY 4PJXF 2FATH 4PY8I 1DP0A 4XBPB 1OAUL 2NR6D 2R8SH 3QCVL 1A7QH 3PL6C 3DYOA 3MV8B 1KLFA 4PJCE 1V7NH 3S88L 5E6ZA 4NRYB 4UTBL 1ZHKB 1KJ3H 1CBVH 3TLRA 4NM4H 2OTPA 3KJ6L 1BQSA 4KK8D 1F02I 5T1LD 5IMLB 4MD0A 5GIRB 4PBWD 1T7XA 1JUFA 1EGJA 3VWKC 2ZSVB 4N90D 3HMXL 5SV3A 3HG1E 2XQYK 5CEXB 3UZEA 4PRIE 3P30H 5JW3L 3VH8A 1T3FB 4OCMC 5JPMA 1PYWA 1OD7A 1PY4A 2VERN 1DFBH 5DVOA 4LSTL 1SBSH 4RGOL 1OAZL 1MCFA 3QIWC 1W2KT 5CS7A 4UIKL 5E2VL 1IEAA 1HOCA 4HJJH 1QYGH 3BVNB 2GITA 4TUKL 2X4UA 4WI4A 5EU3B 5E4IA 4MA7L 1CXIA 1XF4B 4ODWB 4XWGH 3TO2B 2FBJH 3FB6B 2AJUL 2HKFL 1RZKH 1JL8A 3I9GH 2VLKD 3E3QC 4OIAA 2J4WL 4N0CC 5FDWB 4DFIA 4DZBB 3V6OE 4Z95H 4P2QB 2FECI 2HG5B 2NCMA 4S1QH 5AYQA 1G9EA 1K4CB 5TQ2H 2A9NH 3TVMB 3WO4C 5LG1A 1QA9B 3BT2L 4U0QB 1CTOA 4ODXB 3T65B 4X98A 4XNXL 3Q1SH 3IS0X 1J88A 5I1AA 2HLFD 5ETUA 3CFBB 3MGAA 4PLKD 5ANMA 5I15L 1A6WL 4BH7A 1A0QH 4LLVB 2V5MA 3BGFB 4URTB 2AJSL 5ESAB 4GS7B 4WFGD 4W6YB 5TFSL 4D9QD 1I1FB 5DLMH 3C2AH 4Z7NE 2NW3B 4Z7OE 3OL2A 3W9DA 2GYSA 1SY6A 1E6OL 1ZHNB 3VFTA 1INEH 3GMLA 4I0PD 5DEZA 5EO1A 1HINL 1HQ4A 3V0WL 3MXWL 2J6EL 5F6IB 5CJBA 5KANI 1T22B 5JUEH 1WK0A 1GL4B 1K6QH 2OJZL 1PX4A 1ZGLB 3AAZA 4Y4FD 1AC6A 1KENL 1U41A 2DQHH 1A4JB 4XZUA 4NNXB 1X44A 3HZMB 3SGJA 5J3HC 1OSZB 2OK0H 2W65A 2WBWB 3RX7A 4XCFH 4XVUD 3RX8A 4LCWE 2QSVA 4EIGB 2VDRL 3UPRB 2VE6B 1DBJL 3LQMA 4PRHB 1EGJH 5C0BD 3QJHA 4DN4L 4PREA 3DROB 5ICZA 1KLGB 1FVEB 3GSWB 3MNVA 5HD8D 3V5HB 1FYHB 4JM2F 2E8YA 4H1LA 4HBQA 4LQ1A 4NQCD 3S3SA 1CICC 5C6TH 1AY1L 1MHCB 5DTFB 2FHFA 1PKQE 1E6JL 3QIUD 4N9GA 3LIZH 1OM3L 4LP4A 3RZCD 2PW2B 5C7XL 3M1BA 2CDFA 4Z7QF 3MUHL 5TDNA 3GSOA 3V4PH 3EGSB 4IS6B 3GSVA 2HWZH 2HTLC 3EW3B 1NC2B 2B5IB 3ROLA 4EVNB 4OI9A 3S36X 1GGTA 3F8UB 1KULA 3RGVD 2CPCA 2UV3A 3NGBC 1R0AL 4JHWH 4K3DH 4Q0XH 1K85A 3IAGC 4GW5A 3B6SA 2O61A 1P69B 1NCWL 2XXMB 1Z6JT 5DUBA 2K7PA 1OL0A 3QNZA 4GSDL 1FDLH 4OIBA 3TBWB 3U7YL 3MBXL 4X6DA 5MERB 3GMNA 5IUSA 5KSBB 3S3JA 4HKJA 4FQ2L 1B0GA 4LOUC 3VFUA 1X5YA 2DJSA 3ARGB 1UYWH 4CADB 2GJZB 3PWVA 5I9QB 4JM4L 4OD2A 3MUGA 1RK1A 3BP7A 3D39D 1SJEB 4RBPH 5GRUL 1RIUH 3ULSB 3JWOH 3KLAB 1RZJL 1LDSA 3C6LB 1ZHBA 2F8XC 2FB4H 4LSRH 2W9EH 1GGUA 1CIUA 1SEBA 3I75A 5I73C 2PR4H 1NBZA 3L6FA 5F1NB 1AR1C 1J1PL 1NCDH 1P4IL 1NCBH 1P5VA 1RJLB 5FUOH 5GRYA 1PEZA 5I2IA 4HPOH 3QHTC 5TDPA 5MP6L 4L8SC 1I7ZA 1KNOB 4UUJB 4I1NB 2GFBB 4N0FB 2CMRL 3FQXA 4V2CB 4ALAL 4HGWB 1YNTB 2WWKT 4YHOH 4NZRL 4TVSa 2YD4A 3DRQA 4EZMA 4U33A 2MQCA 4HGMA 4HXBL 5CJQH 2AEWA 4YHZH 2Y07L 2ZCKH 1VDGA 5DD6B 1T03H 4JQXC 4NO0A 1NAKH 2E6JA 4XVTH 1HK6A 2BVEA 4JANB 4M3JA 4MA3A 3MJ7A 2NZIA 3LCYA 1QSFA 1I9RH 3LDBC 4TOYL 4WI5A 4PJAB 4PRNB 5FIEA 3NCJH 5D1XC 4LQFH 3GJEA 3MGOB 5FUCC 3V95A 2ZOLA 4JO4L 1IEBA 3OGCA 1QNZH 1IGIH 2FH6A 4H1LH 1K2DB 1UZ8B 2AJXH 5DEGB 2DBJA 3WNKA 1NSNH 1VENA 1EUTA 1DDHB 5I8KL 1GH7A 2FJFA 4N0UB 5BS0D 3FRPG 1AP2A 5IEKA 3MV9D 3OR6B 5ISZA 1MJUL 3D3VE 2AJZA 4U3CA 1HI6B 3A6CL 3ZYIA 5IFJB 1WBYA 1CGVA 4HS8L 4ODHH 4M6OL 3R8QA 3RX5A 1DVFD 2DD8L 2VDPH 3MV9B 2DQGL 4OUOA 3GMQB 5MEOA 2VWEE 3P11L 3P4NA 3OXSB 4NZTL 4AEEA 4YZFF 4HUWB 4IMKC 5HPMB 2NXZD 5DZLA 1S9VA 1F42A 1J1XL 4NBZB 4HKZA 2X4PB 4JRXE 2NY6D 1BFOA 1OARL 1YPZF 1UCTA 4P48A 5F3BB 5DWUH 3KPQB 4XGZA 1G1YA 2XZAH 5HGBA 3GDBA 1T0NA 3IXAA 4NN5B 3GMRA 4AENB 4CN6A 4F2MA 4E41B 5E7BA 4K8RC 5EFIB 1A6UH 2ICWJ 5CKGA 2NY6B 4DKFL 5IFAL 4POUB 3MRMA 5EORH 3FQUB 4UTAH 2N4IA 3O6KL 3IDMB 3D25B 1EVUA 4TTDD 3A67L 4JFED 3SDXE 1V3JA 1NUGA 1AKJA 1SJHB 1GPOL 4GKNA 5F1OB 5A2JH 1U93A 3LPGA 4L29B 1CXKA 3RVVD 2VQUA 3D2UA 5E8DL 2DWDB 2XYCA 2YPLE 4NPYB 5E6IC 4Z6AT 2CIIA 4ZODA 2NY2C 3WSQL 4M7ZC 4TRPH 2Z92B 3V5KA 4WHTA 1CIDA 3EHBC 4JY4B 1UWXK 3KYKL 2AQ2A 2GTWB 5CHNA 1JPSH 4LDLB 5DMGD 5IB3A 3WFDH 4X4YB 3EO9H 4HG4K 2ITDB 5E6YA 4IHOB 2J8UE 2AK4E 1KTDB 4OFYA 3UPCA 4GG6A 3VG9C 1UCBH 3L3IB 1N0LA 2J7LA 3F65A 5L8KB 2DBLL 1DEEB 5CKAA 5TGBB 4OCWH 4PJFA 1HDMA 3TYFA 3JUYA 2J8OA 5C08D 4QOKB 5FAAA 5C0CB 5T1MA 3WE6B 3IJHA 5D70L 2DQIH 4ACPA 4NDMB 5GGTA 2W9DL 2NX5B 4Y4HC 5BXFA 3CLEH 3AS1A 5CD3A 1JPST 4S1SH 1MCIA 1JGUH 1RJZB 1HHIB 2O26U 5HI5C 4OTXL 4QRTB 4R97C 3SGEH 2Q86A 4F15B 5CZXC 3MREA 4Y4KB 4YC2B 2B1HH 4D3CH 2DLFH 4XHJC 3EFDH 3N9GH 4HHAB 1FRGL 4LKXB 1PZ5B 2DKUA 4PRAA 3TC9A 1IC4L 3VFRA 4WUUB 5TE6H 3GBNH 4PRBB 5D71H 5DS8A 3MCKB 2FNBA 1IGCH 1FO0A 4HIHB 3IGAB 2K9UA 1WZKA 2BVYA 3QIBA 3S37L 2R4SH 1YYML 2A83A 4ORZC 4CU6A 3VXNB 2BVQA 3MRIB 5GRXG 1B2WL 2ZCLH 2BDNL 5C0JA 3TZVC 2ICCA 5D7LA 5CSZB 3GKWH 1T6VN 2VDOH 4CVUA 5HJ3B 35C8H 3JV6A 3RPIA 5FO9A 5B8CC 4LLDB 3OTTA 4QHKJ 5IQ7H 4Q9RH 4OLWH 1XF2B 2EIZA 4ZMAT 3B3IB 3DV4A 1B88A 5T3XL 5GZOD 1CGYA 5BMFL 1IBGH 2MMXA 4Q58C 4OZHB 4F33B 3IF1A 5KVFH 4HV8B 5GGVL 4HIEA 4KDWA 4NP4H 5IVZA 4WDIA 4HX1A 4EUPH 4WTZG 4MVBC 3C5ZA 15C8L 4UU9A 3GRWL 4D0BA 3ME0A 1EFQA 4ZO9A 3KXFB 1I1YA 4OD3L 2BXYA 5ID1B 1FL6A 4QRRA 5MENB 4R8WL 4OB5H 3VRLF 4FQCH 1HEZB 4FNLH 3HE7B 3ZKXB 5GJTH 2VABB 2NY4C 4H5SA 1UG9A 2CGRH 3MV8E 5SWQB 4P9HL 5E56A 1G84A 5ANME 4MXWL 4ZOBA 1GC1H 3EFFB 3CSPA 3H7BB 3KR3H 2KPNA 4CNIB 4Q74A 5IKCB 1QEWB 3IDYC 1RZFH 3RWIB 1N59B 4FQQA 3P73A 5IP4A 4GRLB 2EYTA 1AD0A 1D5IL 5F7DB 1J5OH 5L2KB 1HZHH 3SDYL 3B2UD 2VLMD 1FVDA 1FJ1A 5CCKL 3QQ4A 3HI1B 3KPPB 2CDGB 1CYGA 3FB8B 4Y7MA 6CGTA 1GJIA 3IJYA 4O5LH 3QFDA 1RIVH 4XHQA 1U8IA 2NY3B 4QNPF 5HHXL 4XC3H 3WL9B 1CDGA 4K7FA 2V9QA 3H9HB 4POZD 4Y5YA 3T3PF 4D9LH 2EIDA 1TDQA 1DQML 3B5HA 2BCKA 2VH5L 4XNYH 2XZCL 1KIRA 1B6DA 4PP2A 1FO0H 3FZUD 5FCUH 4KZDL 5FCSH 2H45A 4G6AD 4JGUA 2VDKH 5E99H 3CDFA 4NYLA 4JDZB 1GOFA 4DFHA 1I75A 4OFIA 4KDTC 1LD9B 1SHMA 2DQCH 3HNSH 4HFWB 4H0IA 3GBML 3NA4A 4PJDA 1DUZB 1WGOA 1CG9A 2Y6SC 3WUWB 5FYKU 2BSSB 3MACH 3MRBA 3CCHB 1FVCB 4XBGA 1MHEB 1SJXA 2F19H 1ZVYA 3JSSA 5EOCH 3V9FA 5L0QC 2IEPA 3RWCB 3FFCB 2I9TB 1KPRA 3GO1L 1LO0H 5FUZL 1RUQL 3CVHB 3QNYB 3HI6H 3BHBA 3UJTH 4OD1L 2E8ZA 2IAMD 3IETA 1INQB 1NAMB 1MELA 3U0WL 4B7LA 2A6DB 1UT9A 2XQBL 2XICA 3PWPD 1V7ML 3V4UL 2XA3A 2PW1B 4JKKA 5I1EL 3KJ4C 2VZ3A 2BERA 2WUCL 4LLUB 5I30L 5D1QB 1IFHH 2WNGA 3FRUB 4UOW0 5FHAH 2Q8BL 4PJ7B 3INUL 3QJFA 4K8RL 3RVWD 2OCFD 1P9MC 3EDFA 3ARUA 1KYOJ 3PWPB 2CD0A 3O3AB 2X4QA 4EDWL 3DUSB 4YHMH 5I75B 3U0TA 2UWEB 2E9JA 3PHQB 3BH8A 2YRZA 4WUKL 3BESR 3UROR 5JA9A 1T5WB 1FIEA 2BC4A 3CMGA 3MRGA 5E1AA 3TV3L 3SDDC 1ZK9A 3KPRA 1NBYA 2WWMC 3MUY1 1L7TH 4M1CD 2YHGA 2FX8L 2R2BA 5IB1B 4WRLA 2OSLA 4CMMA 2B1AH 3CVIL 2DQJL 1M7DB 5JZ7C 3FJTA 3BQUC 3CZFB 1H5BB 5A16B 4XVJH 2MWCA 4U6TA 4MDIB 4RWYH 2ADFL 2VLJA 3C5SB 5HHNB 3VGDA 5HBBA 5F7EL 1PLGL 1QSED 4LRNH 4WU7B 1WIOA 4L3CB 5GJSH 2X2YA 3BE1H 2NYYC 1F11B 1FYTD 3V5DB 1QSFE 1DQJB 1QRND 3B9EA 3STBA 5CMAA 2VDNH 4GXUM 1RUAH 2HVKA 1G6RB 4P59L 1FLRH 3DGGB 5H94A 1EJ6A 1U8QA 3F7YA 1QSEB 3WUWG 1V7NL 2FJHB 4R3SA 1OAQH 5KSBE 3SJVD 5EBMA 4TSAL 1U8KB 1MPAL 2AXHA 2BVOA 2X7LA 4NM4L 1JHKH 4AM0A 4Z76A 2GT9B 4YEFA 4XPAH 4OGXL 2FGZA 1FZOA 5BVJB 2I5YL 3OKMA 5IMKB 3L3KA 2AQ3A 2XN9D 2OZ4A 3O6ML 3QO0B 2MFNA 3H2WA 1HHHB 4KV5F 4KJYB 2CLZA 5KW9H 1XCQB 2LQRA 5HI3C 1GIGH 1NMCC 2LVCA 2EDRA 2W60B 5T3ZD 4U1NB 1XR9B 4R7NA 1ROWA 5I8EA 1KEML 1WZ1H 1EO7A 3VFGL 3QCUH 3DX8A 2XTJE 5GGRB 2WSKA 5CILL 3ARBB 1NUFA 1VPOL 3P77A 4F7CB 5JW5A 2FBJL 5IVNA 3OR7B 3TF7C 1G9MC 2KKQA 1QQDA 4PG2A 1B0RA 5LBSL 2Q76A 1BJ1H 3NFPB 4RZCA 3K2MC 4JN2A 2P8LB