4RBPH

Crystal structure of hiv neutralizing antibody 2g12 in complex with a bacterial oligosaccharide analog of mammalian oligomanose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
220
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2G12 light chain
publication title Crystal structure of the HIV neutralizing antibody 2G12 in complex with a bacterial oligosaccharide analog of mammalian oligomannose.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 220
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rbpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rbpH01
3BDYH 1FNHA 5E5UB 5B38A 4ZSOB 3HC3H 1MI5B 3EIFA 1I1RA 3WD5L 2H2SD 4P3CH 2HN7B 3FB7A 2DTMH 1JK8A 4CRPA 3SGJA 3LV3B 5D71L 3KPMA 4OGZA 1OGTA 5I1CL 1AHWB 3KHQA 4QNPE 3W9EA 4BKLA 1T4KB 4RAUB 2OCFD 4JHAL 1NAMB 2DQGL 3FHQA 3QQ9C 5L9DL 3U1SH 3ZTNL 4RAVB 2HFFA 2V5YA 5CZVL 1BVLA 1MWAH 4C54A 4M00A 3RL2B 4ONGL 3FRPA 3MNZA 3ULVC 3MRNA 3FQNA 3P73A 4XP9H 2WSKA 3VXMB 1BQHG 3O4LB 4Y2DB 4NKQB 4C55A 5J11B 1BIIB 1F13A 2R4RH 4XMPL 3R06A 3KPSA 3VJ6A 1X5KA 5JZ7C 3T04D 3D69A 4NO5B 4P2YA 2XZCL 5J9PA 2P42B 3VFTB 4WCYL 5GJSH 4MNQE 1U93B 4GW5B 3H7BB 5BS0A 2F53A 3B2VH 3BEWB 4M5ZH 2X1OA 1GC1C 3KNBA 2WANA 4KY1H 5IW3A 2DLTA 3LDBB 2YBRA 5HI4D 2X6MA 5E6YA 4NHCL 3TH4T 1KIPA 3KJ4B 4HIJB 1HI6A 5C08D 3MLYL 4EEEA 2MFNA 1BZQK 4NNPL 5KN5B 1ED3B 2CRYA 5JXAL 1QPXA 4XVSL 4DN3H 4NNYA 5TQ0H 2NY5H 3UYRH 1AD0B 1KACB 4Z7OF 3CSGA 5E4EB 2JCCA 1FNFA 3ECBA 5KSVA 4NQDA 5J56B 1U8HA 4QHLB 1EAPA 3VDBA 1W0VB 1P4IH 5DJCB 4M6OL 5GZND 3D3VE 4U3HA 4PJBA 3ARGD 2GT9B 5J06A 1HILB 4IRJD 2Y5EA 5C2BH 4HPYL 2VE6A 4G80A 1TVDA 4BSWA 4G7VL 3BXNA 3DVIA 4ZS7L 3ISWA 4FFVD 2XTLA 15C8H 5IIEA 3DGGB 5FUZL 2AI0H 2YA0A 3EHBD 4YBLB 1IC7H 4PJAF 1I8LC 4U3CA 4IRZH 1SQ2N 2EC9U 1FC1A 1KTRL 3C87A 3T4AA 3L95B 1YEKL 2YC1B 4G6JL 1U8OB 1PLGH 4LLVB 5C08B 3UDWC 4NP4L 1K8DA 1VEMA 3FT4A 3QJHB 2APBA 5FGCE 1IAOB 3RAJH 5I73B 5KAQG 5HYIA 1VACB 4OTXH 2ZUSA 2CRMA 3WIHL 4XP6L 3O8XA 2I9TB 1A8JH 2DQJH 2JJSA 2OTUA 1TXKA 5HI5D 3B5HA 5DJ6A 2B4CC 4G6ML 1P2CB 3T0DA 1ZGLB 3ARGB 4NN5C 1OPGL 4JRXD 3MRJA 4CJ1A 5IR1A 3T65B 3TVMD 2EDFA 4Y5XC 3MBEB 3SBWA 2H26B 5FO7A 4GOSA 4PJHE 4QTIL 5IBLC 5IFHH 3G6JE 3QQNA 1DBKH 4KXZI 3WS6A 1AR1D 3CFCL 4OKVB 1T0MB 1CF8H 1ZHKA 2J4WH 4HJJL 3ARRA 3UJTL 3U0PA 4KJWC 2MNUA 1DBMH 2J6EH 1QSFA 4P48A 3FO2B 4NO3B 3GMMA 5JXED 3K8MA 3O9WC 4QCIB 2NMSA 5ICZB 3VI4F 4A6YB 4AIXA 3NOIA 1RZFL 5E4IA 1NUFA 3HRZB 4ESKA 1UH2A 4X99A 1Y18B 4YBQD 1KFAH 1CDBA 3NFNB 4Z18A 3QHZL 4HJGA 3NZHH 4KKNA 2J8UB 3QIWA 4HKJB 3QAZB 1YEEH 3V52L 2FZ3B 1RUPL 1K5NA 2BX5A 4E41D 2OL3B 4RNRB 3SKNA 1CD8A 1EZVY 3QXDB 5GRVK 1TQCB 4APQD 2VDML 3NCMA 2ITDB 2QADD 4LLWB 3QUKA 4AMKL 3MLUH 4JQIH 4JRXB 1TETL 1MCRA 3VFOA 4YDJA 4K8RL 3EFFB 5IM7B 4W70A 3NCYP 2AEIT 4PD4J 2Z31D 5HHVH 1RURL 1JPFB 4CVZB 3JTTB 4G6AD 2N7BA 5EBMA 1XGUA 4PR5A 5IROA 2GKIA 3LKQA 3OKEB 2ADIA 1NCUA 1AXIB 2IGFL 1DVFD 5CSZB 5DSCB 1A6UH 4XXCC 4N0YL 4GAJL 1H8OA 2D3VA 1OGAA 4FXGB 1IZJA 3W9DB 5AUMA 3T0EE 5EOTB 1MFEL 1WBZA 4IMKC 3H0TA 3MGTB 1FH5L 3I6KB 1II4E 5IOPB 1JZ7A 3B8SA 3WLBB 4NN6C 4L8SC 1M7IB 3LQAH 1DZBA 1TJGL 1ZANL 2VDOH 3GMQA 4E41B 3NA9L 1FZOB 4PRPE 3OPZH 5INDA 2VIRA 4APQB 5CJQL 3SKMB 4ZUTB 5GS2D 1UXSB 2QADB 5DK0B 1ZHLB 4L8BB 5CUSH 3B9EA 4RMWA 1NANI 1UEYA 4KHTH 2K9UA 1EFXB 4YO0A 2IAMC 1E6JL 2Z31B 1F2QA 3FFCE 3QCUL 1QFWL 3U6RB 2R29L 1HHHB 1NGYB 4LASL 5HGDA 4PLOB 1MJJB 4HDIB 4YXLL 3QEQD 1KTKE 4J4PA 3MO1B 4JO1H 4MNGA 3GJEA 3HUJF 4OLEA 4OLZH 1OF2B 1KEMH 3CFEB 3L3IB 1DVFB 4KC3B 2APVA 2EH7H 3AS0A 3HC4L 4PYGA 1XCQA 1G6VK 2HT3D 2XA3A 2ZSWA 4M48L 4MVBD 3MRPA 4LLMA 2C3XA 4X7FC 5FYJE 4UUJA 2CIKB 3CAFA 3KHOA 3TH2T 1HKFA 3X12B 3GMLB 3QPXL 3IFPA 3G5XB 4PJGB 4LU5H 3CUPB 4OCYH 2UVEA 5I8CB 3TBTA 3TGXA 4GW1A 2PXYB 3DRQA 4XRCB 4LIQE 2DIAA 1BQSA 2AKRB 3PWPA 1L7IL 3BPOC 4QXTB 3WLWD 2Y23A 5FECB 2G5BB 1BM3H 4HX1A 1RU9L 1GPOL 3GJFB 3PNWA 3LKRA 1FORL 3D3VB 5C70A 2F8XC 3B9AA 1HXYB 3VD4A 5CJ8A 3K2UH 4JFOA 5DRNA 5JW4R 1IQWL 3UJIL 1A6WH 4I48B 1CGSL 3QEQB 1JGDA 3S36X 1U8MB 3RY6C 1E6OH 1J88A 3QUZA 2KKQA 4JRYE 4XP1H 1QBLL 5AD0A 3WFDH 2VUOA 4C83A 1QLEL 4M3JA 2OJZH 3BZ4A 4FQCL 2B5IB 3WN5C 2AXGB 3VMOA 1J8KA 2EXWC 2HT2D 4UOJA 3WFBH 4MQXD 4Q2ZB 3CX5K 4HPOL 4GBXD 2DQCH 1U8IA 1NDMB 1KB5L 3HFML 3VGAC 4G5ZH 4XPHH 2O5ZH 2Q87A 2N1KA 1PD6A 5ESQB 5L0QB 4JY6A 5I2IA 4G9DB 3WJJA 5GSVB 2JK5B 5F7HA 1OCWH 3LD8B 4MXWH 3V7AG 5HHOA 3O3AB 4Y8AA 3TFKC 4NUGH 1TQBC 4O2CA 1NJ9B 1HZHL 3V5KA 1I9RH 5KSBA 1CXIA 2EYTB 2X1QA 1RULH 3RWDA 1CN4A 2W9EL 4QWWC 1MVUB 5DUBB 5LAXB 1E4KC 2ZSVA 3STZB 1KEGL 2GCYA 5EWIH 3MLTA 4X9FA 1HQRA 3AREA 2YSSA 4XCYB 3BRDA 4ZPTA 3LRSB 3TT3L 3AROA 4FXKB 3ZKXB 4MD0A 1MRFL 4PRBB 1B0RA 1IGIL 4OFYA 2YK1L 4KMTL 1WBYB 4GBXB 2BNUA 4OUUA 3ARFD 4HWNA 2K3TA 5ICYA 3OKMA 4XXDB 5F1NB 4MD4A 3QI9A 2H1PH 4IDJL 5B8CC 3LEYL 3DBXB 4HWBH 4JKLA 5DT1H 5GGTA 3DO7B 4JFEE 1OP3H 3MJ7B 2AAVA 5TF0A 3EO0B 5HGAB 5IW6A 3OXRB 2HRPL 3MYJB 5F1IA 1T83C 1G7IB 3C6SA 2APTA 5D7JC 1N3NA 1BBJB 4Y4FC 4KUCF 5AYUL 4M6ML 2VOTA 4FMFA 4I4WB 4HH8A 5DTFB 3KPRE 2Y6SC 1V8HA 1A9BA 1GGBH 2F54E 4LCIL 2IFGA 2JJTC 2VXTL 4H1LA 2BRRH 2OR9H 4R90H 1T1WA 3HR5A 2Q6WA 2J1KA 3VRIA 4JAMB 3BMVA 4AQ1B 3QFJD 4XPGH 1RHHA 1UM6L 4IHOB 5I1DA 3BYTA 2OXGA 4KK8C 5DD5H 1HH6A 1I8KA 1EO8L 4ZXBA 4QRTA 3SEPA 5L7XH 1KLGA 4M1CC 5FKPB 5ISZD 3ARFB 4WTZA 1D5MB 4MJIA 4OQTL 5ACMA 4WUKH 3DOSA 1UB5B 5IJVA 5BXFA 1BWMA 1CE6A 3S97C 1Q9KB 2VMFA 4UOW0 5INCB 3P4OA 2DWEA 1F11A 3K4DA 3ILPB 3AUVA 1UJ3A 1MAKA 5BVJA 4ZUUB 4AQOA 2CKNA 2AGJL 3F58H 1OOAA 1D5ZA 1ERNA 4P2OD 4XBGA 4YDLC 4CVXA 4R7DB 3QIBD 5DJ0A 1BVKA 3RWIA 4K3GA 4WW2A 1KCRL 1F6LL 5IQ9B 4ZFOA 2Q8AL 4Z7WE 3P4NA 1RZ8A 3HE6A 3IAGC 2A73A 1DLHA 4NWTH 3U2SB 2ARJA 5HGHA 4ZD3H 2Z91B 4HLZH 1RZGA 3VFPB 1JRHH 1HEZA 2QHRL 1LGVA 2C3VB 4CN4A 2HT4C 2VLME 1GGIH 5ISZB 3GKZA 3QUXC 3IT8D 3PP4H 2ESVE 5HHME 3OGCB 1NEZA 4XHJD 1A6TA 4IRSD 3BHBB 4YDVA 5C0CD 1GC1L 2PO6A 1UA6H 1XGQB 1H3GA 2F9BT 3ILQC 2GJ6A 3LKSA 1SVZA 1I8IA 1S5HB 2XZAH 3IDMB 3OWEA 4OJFL 1YPZE 3WE6A 5D70H 4JM2A 4KI5E 3BUTA 4XPAH 1B0GA 2UYLA 3KG5A 5JOEA 3G04A 4WW1B 2OI9B 2GTWA 1EGJA 4OIIL 4P2OB 4GW4B 4R0LA 4Y4HD 3PE9A 3RKDD 3QIBB 2YD5A 2BNQE 3BN9D 3GNMH 1XGPB 4OZGA 4YE4L 5IB1B 3C08H 4HAFA 3V0WH 4RFNC 2I24N 5CGTA 4AG4L 2FATH 2ZCHH 5D7IE 5F9WB 3KPQB 2HYMA 3O6FD 2EE6A 1OTTC 2XICA 3VFGH 1S7UB 5L2JA 4R3SA 2Y7QA 1MHCB 4F33A 2VLKD 3ZDZF 1KOAA 1OW0C 4HIIA 1G9EA 1MIEL 1C1EH 3CFJA 1AI1H 4U1LA 5C0EB 3LAFA 3QO1A 3VFMB 4X6CA 1YNLL 2J8HA 3BZFB 3IETA 4R2GC 5GJTH 2NR6D 2YPVL 1F4WL 1YN6A 2NLJA 4NJ9L 5FO8B 3UJJH 4IRSB 3BP7B 4K2UL 4M7LH 2QEJA 1UZ6E 1G7LB 2QL1A 2G9HA 5T3ZH 3DVNA 4FQ1L 5LG1A 5CJBA 3PQYE 1FDLL 4LHUA 4XNXH 1G0YR 1RHFA 3HZVA 5F7MC 4YAQA 5HYFA 4YH6A 1L9NA 3RTQD 2MCPL 1RIVH 2FWOA 4U7KA 5DMKA 4GRLD 4Y4HB 1M71B 5FYLH 3WXWL 1KJVA 4HXBL 5DUPH 1YY9C 2FX7H 4C56A 2QLVB 1ZS8A 2X70B 4MWFA 2HA1A 1BD2E 3SDCC 2Q3ZA 4E5XB 3V5HB 1WZMA 1KELH 3O6FB 1J1OL 4FQJL 4G7YH 1NAKL 2VLKB 3EBAA 3NFSH 3PDGA 5D6DA 4POYA 1IEBB 3L9RA 4MNQA 4P9ML 4NDMB 2IC2A 4FQXC 3ZT7A 3SDXA 4LSRH 3D25A 3UTQA 4NO2B 4EQ2A 1X7QA 3GRWA 5ERWA 5CP7B 3HE7D 5ICXB 1WTGT 1MCLA 3CLEH 3E6HA 1J0ZA 2GJJA 4MDJB 4GUPB 3FOMB 5KSUA 1GH7A 3J7HA 3RZWA 4PLKD 1LEIA 1IM9B 4L5FH 4UAOB 4P59H 4OM0H 2XA8L 3VXPB 2G2RA 3BKCH 4OAWB 3OXSB 4JANA 1S7RA 2A9MH 4OV5B 4GRLB 2VXQL 3I50H 4G8GE 1ZLSL 5IUSA 5C0GA 2IBBA 1P5VA 3BVNB 4HS8H 3ARDD 1BAFH 1U2CA 2HTKD 1RFDL 1MCNA 4GFTB 4PJDE 5ALCL 4NKOB 3FO9B 1AP2A 3U4BL 5KSBF 3SY0B 3B9KC 4M93C 3KPRB 3L3DA 1OSPL 5SX5K 1EEZA 4UINL 2GJZA 4EVNA 4PJCE 2BVOB 3QEHA 4N9GA 1N5YH 2V2TB 1G0XA 5IMMA 2X44D 3AFLA 5EU6D 3LMJL 3S34H 3GBML 3LRGA 3BIBX 3MZGB 5EU4A 3HE7B 1CBVL 4PREA 4EKXA 3TYGL 5IKCA 5DO2C 3LY6A 4XCCH 3DX9A 3L3HA 3JWDL 2IFFL 3O3DA 5E9DD 3HC0B 5TQ2L 1G7JA 4P4RA 3MNWA 1E0OB 1MWAA 4QGYA 4U2ZA 1LHZA 3RIAF 4IMLA 4QRUA 3TZVB 1YY8B 1CGWA 1J86A 3IDXL 5SWSE 3V6FA 1NAMH 3ARDB 3SCMA 2WIMA 3DTXB 5C8JA 1ETZB 3VI3E 4GH7B 4ZUVB 5E8EA 2Z8VC 1BBDH 1DBJH 2ZOLA 2VL5A 2ADGA 3DX8A 1U8NA 1N26A 5FHAL 3BEVA 1FL3A 1UADC 1XH3B 1AXTH 5D2NC 1OAYH 1MFAL 4Z7WB 4R97B 4AT6A 1I7TB 4M03A 3PIQA 1EJOH 4OD2A 5EU6B 2DTSA 2X7LB 4GKSA 5IMLA 3R1GH 5D1QC 1AGBB 4BJLA 3HAEA 4OZFB 4O9HL 4OD1L 3RWFA 5HI3C 3UC0L 1B6DA 1A22B 2DRUA 5EG6C 4DGYH 3ZTJH 3MRIB 2DMBA 3LKOB 1K4DB 4RA0C 5BJTA 3RPKA 2WAHA 3CGTA 3AY4A 3PGCA 5E9DB 1NGPH 1LE9A 4RX4D 2FGWL 4V1DD 2IALB 3QDGD 2QQNL 3ARBA 1IGYA 2YPKB 3QSKB 4MNHA 3QUYC 4WUUE 4XZUA 1G7QA 5E2VH 4HS6B 4AM0A 1IEHA 1WQVT 4XNUH 1CG9B 1LEKA 1D5BB 3A67L 1CFTA 2D03H 2BC4B 3WS3A 4PGDA 4FP8L 1WZ1H 3HPLA 4OGAC 4PJ9C 4R7NA 2DL9A 4XBPA 2BSSA 4HFUL 1JI2A 1BD2D 5CGYC 5D5ME 4OFKA 1PJ9A 3TJHC 3ROOB 2UUDH 3VRJA 4QYOB 3V8CA 1NCCL 5D7IB 1U95A 5DMGD 3QG7H 2NXYD 1XF2A 4FG6D 4CNIB 2CXGA 5JNYB 3BZDA 4EN3D 1FN4B 5M94B 1JUFB 3RA7H 4O02H 4KGJA 2VDQL 2VISA 4PUBL 1CDYA 4HK0A 1R5IA 5FOJA 3FFDA 4KPHL 3VU2A 5D1XA 5MEND 1ACYH 1UWXK 1KJ2L 4M6NL 1CDGA 2P46B 4ZPVA 4V1DB 3P0GB 5J3HC 1YMME 3UCRA 2BVQB 3BWAA 4LCCC 2DIBA 2J8UF 3PDOA 1CQYA 4PRPA 4GAYA 5MEOB 4ZO6A 4QT5A 1DBAL 3PWLB 2VDNH 3IU3B 4G9FE 4M9OA 1FSKC 3THMH 2AJVL 2ZUXA 2YMXH 2R56H 4D8PA 1DL7H 4JO3L 4M1GH 4TTDC 4ACPA 2R0WL 2AW2A 1IGJA 2I9LA 3FFCA 5CINH 4JPKL 2O93L 1BD2B 5CEXB 5HVWA 2FX9L 3T4YB 2QJDA 1YDPB 4J12A 1A0QL 4E9LA 4LCUA 2NXYB 3GI9L 5ECJE 1RK0A 2H6PB 4WHTA 1K4CB 2NY7H 4P57A 4EN3B 4ZDHA 4MXVE 1X4XA 3QDME 1A6PA 5FDWA 1HHGA 1P6FA 5IW1B 3MODL 2BVEA 2AV7B 4MSWA 1A6ZA 2BHZA 3RGVA 2BFVL 2Q8BL 3VG9B 3PHOB 1RUQL 1BLNB 3QJFB 4NKDB 1GZPB 1KG0A 1F3DH 1L6ZA 1P4BH 3WSQL 5MENB 2BSRA 4L8DB 4XGZA 3K1DA 3WEXA 4AH2B 2ZG2A 4U6YB 1T03H 3D0LA 4RISH 4G3YL 3G6AA 3HZMA 2VQ1B 1EEUA 1QLFA 1RZJC 1H3PH 2HH0L 2PW2A 3UTSD 4QNPF 1GHFH 5BZDB 4C4KO 2D2OA 2LTQB 4X6EA 2H8PA 3T0AA 3HLAB 4FTVE 1DANU 5FKAA 3U7AA 4TQEH 4UQ2B 3VFWB 4DGVL 3MOAH 3ZYJA 5SWQB 4G8GB 3RVVD 2E9BA 3Q1SL 4JQVA 3GSNA 4I3SL 4OLXH 3MREA 4U6XA 2HRLA 5DVLA 4MB4A 4DOHB 1OM3L 5E94B 3VFVA 3DWTA 4IDLA 1SY6L 4B0MM 3S37L 3BI9X 4KK5D 2YZ8A 3MUGA 5KW9H 4TNVF 3P77B 4DKFL 2YA2A 1ORQB 5J7CC 4OZ4A 4PJCB 3CZFA 4KAQL 1NBVH 3PV7A 5DQDH 2FH6A 1WITA 4JCLA 2R9HD 5JQHC 3C6LC 2EXYD 3D6GA 5HHQA 3R0NA 4Y16A 4OZHA 5MEQB 1EDQA 4P23D 3MACH 1Q72L 3VXTA 2D31B 3CC5B 1Z9MA 3P11L 3UTSB 4K8RD 1XGRB 2JB6A 2Y1VA 3KYNB 4FZ8H 4PP2B 1M6OA 4QRQA 4L3CA 1G9ML 1WFUA 2A0LD 1U36A 1EK3A 3N9GH 3ZDXE 2QSVA 4X4YB 4M7KH 2YPLD 3L6FA 3C9NB 2DD8L 4OLUH 5GRZA 4DUVA 4OGYH 5I0ZA 1J5OL 4LRIC 5MERA 1LEGB 3KPOB 3MLXH 1FCGA 3LRHA 4HK3N 3M17A 3HG1D 2P45B 1AXSB 4HGWA 2PW1B 3NPZB 5EO1B 1SM3L 2AQ3A 3FAXA 4OQ1A 3QZWB 3FO1B 4P2RA 5ESAA 3LS5L 1EEYA 4M8QA 4ISVB 5K9OB 3LIZH 3GSRA 1QACA 3VWJA 5I8OH 3NN8B 4ZTPL 2W9DL 2H3NA 4LKXA 4NQEE 3CVHL 4P23B 2CR3A 3KPNB 4OCXL 1QYGH 3GGWA 5I16B 4NQXA 3VMNA 3RZCD 5F9DC 4MCZA 1AGFA 4JFEA 3DGCR 2R0LH 2XXCB 5BRZD 1OLZA 2JE8A 3MRMA 1WZLA 3VG0L 3MLWL 2D9CA 3HI5H 1A02N 3L3JB 1S9YA 4N0RA 4F58L 2ORBL 4KQ3H 1HQ4B 4XHQA 3BQUC 1MF2L 5GS2H 1Z9OA 2F54A 3MRCB 5EC1B 4PJEE 1CD0A 4JPIB 2BJML 3HG1B 4CMHC 2BCKB 4PJHF 5KJRH 1S78C 3GJFH 3G6JF 1JN6A 4XC3H 4NM4H 1UZ8B 1E4JA 3MGAA 1INEL 4NJAH 2QQQA 2E9WA 3D18A 1KYOJ 2XQBH 1TZHB 4HS3B 4JEGB 3X3FL 3PL6D 1S9XA 3CFDA 1R5WA 1FFNB 2VR4A 3VXRE 1P4LB 3TYFB 3ETBF 3IGAA 3DXAD 3RHWF 1BECA 3U4EA 4UT6L 5I6XC 3RZCB 5F6HJ 3UTZB 1MREH 4UIKH 3QWOB 2VABA 4LCYB 4HT1L 5BRZB 4JREB 4PJ5D 5I1IH 5DDHB 1A6AB 3TNNB 1FVEA 1SMAA 2AK1L 4PRHE 2FSEA 5EA0H 3BSZL 2PTTA 4WY7L 3FQTA 4ZQKA 2DF3A 1U8KB 5EZOL 4G9FB 1YYLL 1RD6A 3IDNA 2HLFD 4HUVB 3UBXI 3SJVE 3C8KB 1TENA 4JFZH 5K9QI 1CICC 3O45B 4ZNEE 2AJYL 4JKMA 3SGJC 2GK0B 4MHHI 2P4AB 3CCHA 2C5DC 3VGBA 4D3CL 5C0BD 5BMFL 1FO0L 4JG1H 5D96B 3C5JA 5JMOC 2AJXH 2OQJB 1G9NC 4Z7QE 1GZQB 4Y4KD 3FT3B 3QDMB 2ERJB 5DURD 3PL6B 1DEEA 1FYTD 2F19H 3MXVL 3NA4A 4B7IA 5D72H 1TCMA 3DXAB 2DM2A 5MEPB 1KLUB 3ELAT 3MX0A 1U8LB 2OK0H 4DKEH 1IAKA 1NL0L 1QLRA 1P1ZB 4I1NB 1LD9B 4NM8L 1CK0L 1YPZA 1I7UA 1NMCC 4OF5A 4PJ5B 5JPNA 1Z0NA 2BVYA 4PJFE 2OSLA 5FB8A 2D7TH 3C5SA 5EZJA 4TSCH 3STLB 3BH9A 3TP4A 5ADOL 2X4UA 3GSVB 4F3FA 5HJ3A 1ZLVH 2BNQA 1XF4A 2I60H 2CDFA 4GG6B 4NGHH 3VFSB 2AABH 1S5IL 1JFQH 2PTVA 4JLRB 2F5BL 3RDTD 4M1DL 4U1KA 1LO3H 3H6JA 4I18A 4JR9H 5C0BB 3IVKA 1ZTXH 3VWKA 2DQIL 4PY8I 2YN5A 3DIFB 2R1XA 1RK1A 4I77L 2ZCKH 4E0RB 4Y4KB 3H9SA 1FBIH 5DURB 1MRCH 4FQ2L 3TESA 1FYTB 1JZ5A 2IG2L 3O2WH 1FFOB 4RWHA 1IAIH 5DHVB 2UZIH 3N1MC 1NCTA 4DVBB 3ZKMD 3PQYA 2ED9A 1FG9C 4PGBB 5CMAB 4RWYH 2X9XA 2AK4E 3QIUC 3F12A 4L9LB 1T2JA 4DZBA 1FNAA 1DR9A 3ULSB 3J8F7 3DI2B 4RGMB 4G8IA 2P5ED 4S0TD 4H8WL 2WIIB 4JZJB 5HDBE 4GRWB 1OP5H 5IHZA 1PY4A 3FT2B 1T1XB 2ADJB 3RDTB 4K7FB 4O51A 5FHBH 4XCFL 1OP3K 1FRGH 2FHBA 1AO7E 3BAEH 5DWUH 5DJAB 1AGCA 5CWSA 1IRAY 5L2KE 2HJKB 1KPVA 4U1IA 1CFNA 2E6JA 1IC5L 2IWGA 3SDAA 1LP9E 2JJSC 4NRZA 4XAWH 1BF8A 4N8CH 4YHOL 3MQIA 2DM7A 3OF6A 5HYJA 5HXMA 3KPLA 4HC1L 3SBWC 1DDHB 1YEDB 4P5KA 1MSPA 2YD2A 1PKOA 2HMIC 1OTSC 4KRMB 3L7FA 1B6UA 4PTTB 3QQ9D 4M43L 4UILH 4ODTH 3JWOC 2F5AL 2V5MA 2XN9D 4OLYH 5CS7A 4E42B 5DJXB 3U4AA 1A1NA 3MXWH 3I02A 1A7NL 5IF0A 5HYSG 1IGTB 4L4VA 3ULVD 2P5EB 4ELMB 3D5OF 1SYVA 5BO1H 3JUYA 4S1DC 4K3HA 3P2TA 2OMBA 2Y07H 3P4LA 5JQ6L 3D0VB 3S37X 3LSOB 1UWGL 5DJYA 5JZ7D 2VC2H 3IKKA 4LFHD 4O2EB 1Q9WA 5ANMA 4ZYKA 1VCAA 1D5IH 1PSKL 1FAIH 2P8LA 4LARH 5J13C 1K6QL 1I7RA 1UYWL 2JJUA 4NWUH 4WJ5A 5IB4B 5JR1H 5ID1B 3GUTB 2DLFL 1AE6L 2P7TB 1W0WB 3PXHA 3LH2L 2AJSL 4UT9H 2ZOKB 1DN0B 4HIHA 1DUYA 3VH8B 5FIEA 2B1AL 1CL7L 3MBXH 1CVSC 1WBXA 2FH8A 4X6FA 3W2DH 2VAJA 2XN9B 2W07A 3QCTH 5IROC 5EFIB 5FYKL 4H1LG 5DS8A 4U6HA 4WV1A 2DQEL 3BKJH 1DQQB 2VR5A 2DYPD 2WWKO 3KXFD 5SWSA 4BZ2H 5CD5C 4KVNL 3U7WL 1MFCH 2DBLL 4JDVB 5F7EL 3MV7E 5HVFB 4NZJA 3ZO0A 2VZ1A 3WIIL 3HMWL 2X2YA 3BZEB 3L1OH 1KENH 1MPAL 4PBXA 5F7WC 5C0RH 1RJLB 1JNLL 1QBMH 2AV1B 4K9EH 4MA3A 3TBWB 5F6IC 3KLDA 5GRJH 2VXVH 3GHEH 4L3ED 4NQCD 4XMLH 5IBUB 3WFHA 4ETQA 5C09D 4NKIL 5CEYA 3JZ7A 1RIUH 2P8PB 1LK3L 4POZC 1CFVH 4XVTH 5DXWA 4MDIA 2AEPL 4D9QE 3FN0H 3WO4C 3F7YB 2FD6L 2XNAA 1MLBB 4N0FA 1KTLA 5DEGB 1U8QA 2DMKA 3D9AL 4J4PC 4BZ1L 5HHPA 4WUUA 1IT9H 3WUWG 2YXMA 1FVCA 2YN3A 1F02I 3BP4A 2DYPB 2CJUL 5JW4Q 4PJFB 3KXFB 1X9QA 4YHKL 1QR4A 1OHQA 5DD1H 4AZ8A 1UCBH 2W0LA 4X7SH 5IT2L 3EUUA 3N06B 4QXUL 1A4JA 1MJ7H 5IBLD 4L8CB 1I3RB 1I1FA 4MXQC 5KG9B 1NSNH 2XPGB 3P9LA 2ITCB 2MKWA 2SEBB 4Z7WF 2C1OA 1FCCA 3RNKA 4KJWD 3SGDI 1TDQA 1S7XB 2XRAL 4L3EB 4Q7DA 5C09B 3O9WD 4U1NB 3UBXA 4TSAL 2VR9A 4QRPE 3U9UB 3RUGB 3GIZL 1F6FB 2VZTA 1SYSB 4LSUH 3KDMA 1FNSL 4M5YL 1DLFH 4H0HB 1QVOB 4FABH 2HFGH 4X98A 4X8XA 3K4AA 2NTSP 1YMMA 4UBDC 1AFVL 5DYOB 2DIJA 4GKNA 4NFDA 1ZOXA 3M8OH 3RGHA 3U0TB 1I3GH 4S1RH 3QUZC 3SDYH 3EO9L 1YPZF 1NAMA 1Y6KR 4NN5B 4KI5F 1YJDC 5EZIH 5IV2B 4Y5XB 4DTGL 3BD5A 5C0FB 2A9NH 3LN5B 4R8WL 4U7SA 5E8DL 4CN6A 4EXKA 1NCWH 5T5FL 1JF1B 3CX2A 2ATKB 1AHWC 3O2DH 2IQAB 5D8JL 2H32A 5I8EA 4PRDB 3WIFB 2FX8L 3VXMA 5C6TH 5D7IF 1BEYL 5LCVL 1BIIA 3WJJC 3QXAA 1CLYL 2V17L 3QULB 4PGJA 3MRGA 4YUEH 4NO5A 2GQHA 1A7OL 4N0UE 3O9WB 3MR9B 1GIGL 2ZCLL 3H7BA 4X4XB 4ZOEA 4OI9A 4OB5L 1MCKA 3MMEB 4LNVA 2CSPA 1AIFA 1T1ZB 3EYVB 2A1WH 1HOCA 2QBWA 3QG6A 3NZ8A 1UZ6F 4HJ0C 1WFNA 3UZQA 4PBWD 2YHGA 5EOQL 1YC8A 3P40A 3MRDA 3S4SG 2B0SH 4FTVA 2DLIA 3AREC 4NZUL 5E2UL 5J1AA 1AD0A 2LAAA 1KXTB 1O7SA 1PEWA 3OQ3B 1KN4L 3CXDH 3FB6B 1VESA 1OLLA 3RU8H 2NX5E 2GSGB 3AXLA 1B4JL 1W0VA 3GSXB 3HNVL 4RBPK 3OSKA 4NO0A 1NCAH 3LQZB 3MLSL 3T8XB 1EHLH 3MCKA 1HSBB 5JW5B 2JIXD 3L5IA 2VL4A 4R26L 5E4EC 1V3JA 5JW4N 3T77B 1UWEH 1G6RB 3UZEA 1K2DB 1ZA3B 1E4WL 3EOAA 2V9QA 5H2BA 2EIZA 3PWNB 2FJHB 1FNGA 5D71H 1ADQL 3G5VA 4XP4H 5AZEH 5I1CH 3STBA 1EX0A 4YFLI 3ZYIA 5KBNC 4P9HC 2YC1A 2FL5B 4JFXA 4ENEC 1Q0YL 1RZIA 1U8OA 4NN6B 4AIOA 1NBZB 4L8SB 3UTPE 3VD5A 5C08A 1FJ1A 2IBGA 5L9DH 1I3VA 2R2BB 4KH2A 5T1KB 4QHMB 5CZVH 5F9JB 4F7PB 1R0AL 2WBWB 1ULVA 4ONGH 2BOCB 1WICA 4XI5C 2DI9A 4YHLH 4O4YH 2I9TA 5EORL 5M7QA 5KZCD 2IAMB 5DEZA 1R3JB 2Y36H 3CU7A 1IAMA 1BFTA 3W0WD 4JFHD 5J1SC 4JHZA 4PJDF 4IRJA 3T65A 3QNYA 5I1AB 4K71C 3LHPL 2NTFB 5DQ9B 3TWCL 1NFIA 1MJ8H 4PJCF 3F7VB 1BF2A 2OBGA 3OKOA 4OKVA 1V5JA 3MLZH 2A83A 1UJ3C 3TBVA 2AJZA 2EXWD 5JLZA 1CZ8L 3HI1A 3MBEC 4NC1C 5F3HB 4PRID 3MLYH 3MJ8B 4ZAKA 1IKFH 1G9NL 1Q1JL 4XVSH 5FCUH 1FGVL 4QCIA 3EYQC 5IEKB 4CJ0A 3MJGX 3L3OB 3HE6C 2IPKA 3B4NA 1UM4H 3U9PL 3BPOB 3QNZA 1BZ7B 1MCCA 2VWEC 5AZ2L 1HK6A 3TFKD 2UZXB 4BYHA 5ALBH 5I1LB 1T20A 1YQ2A 2OJEB 4G42A 3RJQB 2FZ3A 4Z77A 1A7QH 5E6IA 5KZCB 3MLRL 1F8TL 2A2QT 2X1XR 4RMVA 4X5XA 3W0WB 4Z76B 4ETYA 4PJEA 4QWWD 1VSCA 4YEEA 3VI3F 3TVMA 3VD3A 5HHNB 1M05B 1NFDA 4DAGL 5KS9E 5IM7A 2PO6C 2D7PA 4OKDA 2E7CA 25C8L 4BH8A 3DROA 1JPFA 4CVZA 1KJ2B 1TQCC 3JTTA 1LILA 3O6MH 4CVUA 1V05A 3WN5B 2BMKA 1WWWX 3ZYOA 1RJYB 4TSBL 3BW9A 1AQDB 3OKEA 5GGUA 1J05A 5HDQL 2IPTH 1F90H 2CDEA 5DA4A 4R0LC 2FBJL 4UTAL 3IRPX 3VGAB 3V4UL 1U42A 3V7AE 4JN1H 5I18L 1ORSA 1LDSA 1D3CA 3ARYA 3BESR 5BV7L 4BFEA 4XP6H 4JY4A 5EZLA 3MGTA 3RWEB 2VERN 4PB0L 3H9ZA 4PRHA 5F88B 1TQBB 4ODUA 2ZUVA 2G5RA 3FQUB 4Y4FD 3AC0A 1XR8A 2IMNA 4QTIH 3SKMA 4ZUTA 3SJVA 1G7PA 5DK0A 2Y6SD 5LGJA 4L8BA 4I3RL 3EAKA 3TO4B 4PG2A 4WNQA 3OAUL 2W92A 1B2WH 1FZKB 2R0KL 4L3AA 5D5MF 2WUCH 1ZMYA 3IFLL 4KK8D 1WZKA 3MUY1 5CHNB 4S1SL 2E6PA 4Z78A 5CAYB 5JOPD 2Y5TA 2OTWB 3JWNC 3PGDB 2HFTA 4M1CD 5E70A 1JHKH 2RQ8A 1QO3B 5L6YL 1LO0L 3RI5K 5AWNH 2GY5A 5TH2A 3SQBA 5C0JB 4TUOA 5D7KD 4CVWA 1EHAA 3L3GA 1YYMH 4LRNL 2CIKA 5EIQA 1AGEB 1R24B 2ZG1A 3LQMA 1JHLL 2YD6A 3G5XA 4PJGA 4XWOC 4Z7UB 2M2DA 5DK2A 3VFNB 3KR3L 2DQFB 2BOBA 2BY0A 5D7JB 4K3EL 3OMZA 4Y4FB 4F80A 2COQA 1D6EB 5B39B 3W39B 7FABL 1YEIH 2YRLA 1IJ9A 4NZRL 1WAAA 4X4MA 2VAAA 3EDEA 3WJLA 3TIEB 3I75B 2I07B 1HH9A 2GK2A 3V79C 1A21A 2ZUYA 2C7UB 2PXYC 1VEPA 1J9CT 1T0NA 1EH9A 5DMIL 1JPST 1CD1B 3QEQA 5E5RB 2VXUL 4GAJH 1U8MA 1T2QH 5JDSB 4MXVF 4NQTA 2GITB 2HT4D 4KVCH 1ZVSA 4ORGA 4LQ1A 5T5NF 4ZFGL 1QR1B 4HH9B 5KVGH 3EKCA 1MFEH 2R8SL 3QUXD 4DW2H 1QD0A 1FH5H 1JNNL 1SJEB 5IHBA 2AXGA 3CK0L 3ILQD 4NQVA 5F7YC 5ENWA 3VGDA 2NY3C 1EZVX 4QXWA 2E27H 4BQ6A 3QWRD 2AK4A 2VLLB 5CJQH 2FNBA 5C07D 1NDMA 1QKZH 2Q3AA 3QP3A 1IKNA 2J12B 1LDPH 5EBLB 4TUJA 1VFAA 5ESQA 1U2HA 3TIDB 4G9DA 3EYUL 4R4FH 2G60L 3OR7B 4YDLB 1IFHL 3GMRB 3PHQB 4JJ5A 3O6KL 4JDTL 4WFGD 4JZOB 5HGGS 4LASH 1NJ9A 5K59E 3QDJD 2IAND 3P9MB 2GFBB 1ZT1B 1OTTD 3DV6B 4ERSH 5ITBH 4O58L 5L2KA 3FB5B 1FC2D 2PKDA 5FOBB 4MQ7B 5DVMA 1NGQH 1U58B 5FK9B 5CLTA 1LP9A 1XR9B 2DQHH 3IU4L 1VDGA 5HTSA 4R2GD 3PWVB 1NMAL 2R2EB 4LK4A 1HHJB 3H3KA 4FXKA 1CYGA 1UB6B 3GJFK 4X6BA 4OFIA 1WBYA 4QHKI 3PWUA 5C07B 3CFKB 3DX6B 3R8BB 3NTCL 3RL1B 3V0VB 1RU9H 3DBXA 1GPOH 4K3DH 1OD7A 3DO7A 1JNHB 3OZ9L 1EFQA 1W72B 1YY9D 1FORH 3GM8A 4QRRE 4LCWA 1KCLA 3MJ7A 3ZDXF 5HGAA 3SDCD 3OXRA 1JWSB 32C2A 3ZSTA 5HBBA 5EU5A 3RWGB 3QDJB 2IANB 1CGSH 5DJDB 4M02A 3B6SB 2E5EA 1I1YA 1MHHB 4BSVB 3AY4C 1QBLH 3IXAB 4HLJA 5DTFA 3D48R 4FQXD 1OAZL 1KYOK 3CDGA 4LGPB 5K9KA 2RFXB 4ODWB 4R2GB 1A14L 1RI8A 3INUL 1T3FA 5FYKE 3S96A 1IGFL 2X4NB 3SE3A 4KKBC 3ARZA 1TZIA 1BGXL 4EXPX 1QSEE 3ESVF 4OSUL 3WNOA 4M61A 4U1HA 8CGTA 3EOBB 4AIZB 1J8HD 4TULL 5CCKH 5GGSB 3L5XL 3E6FA 4G6FD 3ARFA 5CD3B 5TF1L 5EU3A 4KJPC 3P30H 1UB5A 1BQHA 4NUJB 5DHVH 4LSSH 1KULA 3HNSH 2QQKL 1FO0B 4Z8FL 3ILPA 3MV7A 3EGSA 5D93B 4JFFD 3SDCB 4Y1AE 3K7UA 5DD3H 4UV4H 3T0EC 4LPWA 5I19L 4H88H 3B9KD 5FUOL 2XWBB 4TVSa 1S7SB 2ZPKL 1XGTB 4OF6A 4PJEF 1RUKH 4F8TA 1RUML 2DJ4A 3VA2C 2VLJD 4N0CC 4GRWH 4HKBA 1YEJL 4YDKL 1ZLVK 3EJJX 4QOKE 4FQXB 5DC9B 2GTZB 2V2XB 3UO1H 3I6GA 3MV9E 3SE4A 3U2SA 3QFJA 5E99H 3BP6B 1BHGA 3ME0A 2EE9A 2Z91A 2QHLA 5DO2D 4KK6C 1KB9J 2OM5A 2C3VA 4X80L 4CAGA 1J8HB 3LEYH 4G6FB 5ISZA 1V3KA 1N0XL 1YMHA 4MCYB 3SQOH 1A3LH 3BHBA 2XQYK 5T3XL 3VCLA 3VXSD 4F9LC 1KJ3L 1Z5LA 4ONFH 3UP1A 4U1MB 3SKOA 3SKUD 5AYUH 4JFFB 1V7ML 1FG2B 1Q9LB 2C4FT 7CGTA 2FIRT 1XF3B 4KTEH 4ELKB 1QRND 3KYOA 1E4XH 5TGBA 4M93B 2VXTH 5FO9B 2HFEB 1PG7L 1JWMB 4JHWH 2VLJB 1S7WA 4HIEB 3JV4A 3T1FA 2CIIB 4HG4J 5D1QD 4X6DE 3LKNA 3LZFH 5C7XL 5IB3A 1AGDB 2XG4A 1MHCA 1VB9A 2E3VA 4H5SB 4OI7A 1RUAL 4Z7QF 4PV9B 1V7NL 1T0PB 5DR5H 5HI3D 5FM5M 4DCQA 3PDDA 5HD8C 4OQTH 1KC5L 4KDVA 5EPMA 5EBGA 1BX2B 5GGTL 2HLAA 5C0AE 5SV3A 3VFMA 2WP3T 5DLML 4JQVC 1DQTA 1PKQB 3EJZC 1NMBL 4I2XB 2D4FA 3V7MA 3CFBA 4LSQL 3IDYC 2Q1EA 2O5YL 5C0CA 3KS0J 2O5XL 2VDKH 3QUYD 2MQ3A 2BVUA 3MRRA 2YOCA 2GEEA 1KCSH 2X09A 5IFJA 2W0FA 3LS4L 3TCLA 1JGUL 4Z7VE 3GMOB 4LMQE 4PJFF 4UTBH 4PJ9D 4OGAD 4HKZB 3IFOB 3VXQB 4HZAA 5C3LD 3PGFH 2BERA 2DWDB 1IAIM 1QRNB 3PABA 2Q8AH 1PQZA 4OCWL 1DE4A 1CR9H 1ZKAA 4LLDB 4UQ3A 4WU5B 3BUYB 5CGYD 5E00B 3TJHD 4Y16C 3ULVH 1BVZA 2AEQH 4GO6B 5D2NB 1QFPA 4HMCA 2R15A 3MCLH 3V5HA 1PX3A 5FM4A 5DRWA 1HHKB 5D1QB 5FGBC 1MLCB 2DQUH 5I1EL 1YNKH 4N0UA 2VLKA 2E9IA 3KS0H 1IEBA 4ZUSB 4TRPL 2X4SB 3ES6A 4IS6B 2XOTA 1JYVA 5GRUH 2RBLA 1GC1H 1K9TA 1MHEB 3P0VH 1QBBA 1G1YA 1S8DB 5J3HD 4X7EC 5F8QC 4OM1H 3FOMA 1SY6A 3IJYB 5E08L 3FB8B 5CKAA 4D0BA 1FPTH 3NH7H 3B83A 1JV5B 2A6KA 1C5CL 3NCJH 4J7RA 4HLZG 5DC0A 3RRQA 1TJIH 3O6LL 4ZFOL 1G1CA 2VKXA 5IGXL 4U6VH 2Y4SA 4TTDD 2R39A 3T2OA 3RTQA 3JBG7 3VWJC 4AG4H 2WQRA 3QEUB 2FJGB 2NY1B 4P3DB 5HDBF 4HK3J 3BFOA 4PRNA 5DRZA 5DJ2B 4YX2L 1MIEH 4IOIB 1KN2L 3RWHA 1O7VA 1SEQH 4GKZA 3QQ3A 1N5AB 5D7LE 4JFDE 1PZ5A 4PBVC 1SBSL 2YPVH 1HKLL 4NJ9H 3BPNC 1ZEAL 2HAZA 1LP9F 4K2UH 1DQDL 3N85L 4BFIA 1I3UA 2RB8A 3ESUF 3ROLB 1QQDB 1JPGB 1MEXH 4PV8A 4ZTOH 1BQLL 5FUCE 5ELIA 5F71A 1DQJB 4LCCB 3MJ9H 1U6AL 1N6QL 5HPMB 1EGJL 6FABL 2WM0A 3CLFH 5JPMB 4K7PL 1CL7I 4HBCL 4GMTL 4HUKB 1FSKB 4X9GA 3VMPA 4DGIH 5T1DH 3CXHJ 4TOYH 4HW6A 5A2IH 1S7QB 1TNNA 4YNYB 2IH3A 4G43B 3O2DA 4WEBH 3DPBA 4M6AA 1OAUL 2B4CH 1FL5B 1SJXA 3CVHA 4PJXE 4YFLF 1JPTL 3L5WB 4HUUA 4ZUVA 2HP4A 4UU9A 5B22A 4HXAH 2CK0L 5SWZD 3MTRA 3CSPA 3TZVC 5I1HH 5IMOB 3EOTL 5LQBH 1VGKB 4YHPA 5J6HB 1S9WB 2IH1A 2V5TA 3D2UD 4P49A 3L7EA 5EU6A 3C6LD 3HCVA 2CRIA 2VDLH 2ICES 3KPSE 5GS1A 3OKLB 5E1AA 1A7RH 1KLFA 2PYFB 2KL6A 4WI8A 5BW7A 2XA8H 4LSPH 4R97C 4PJAB 4XVJH 5E9DA 3FONB 4S11A 1MFBH 2VXQH 1ZLSH 1R3HB 3DUSA 4WO4A 1KGCD 4RQQA 2LU4A 2YPKA 3RWCA 1O5DT 3REWB 5EDXA 2E8YA 1TVHA 1F4AA 4QHNB 3U4BH 2GUOB 1CG9A 4MA7H 4UDUB 2QQLL 1D5BA 1OSPH 4C57C 5KS9A 4PB9L 5IQ7L 3C09C 2YS4A 3DNKA 3QCVL 2PF6A 2JCCE 5CEZE 5SWZB 3GRWL 5KVEH 1BFSA 1JYNA 1H15B 1J0JA 1CTOA 1XIWA 2XXMB 2EIDA 1FGNH 3OG6B 4KI5C 1E27A 1WIPA 2FHCA 4QYOA 4AEEA 3V6ZB 2EDWA 4PJBE 1IBGL 2X4OB 1UQSA 4CNIA 1UC6A 1YA5A 5GGQH 1QOKA 3C6LB 3CH1B 2V7HB 4ZUWB 5A2LH 3SGKA 5ADPL 1JUFA 2R69L 4HZLA 1R3LB 4CU7A 4N90E 5IBTL 1G6RH 3AAZB 3QA3B 4DVRL 4EIZC 4Z7NE 1ND0A 4XNYL 1UG9A 4OD3H 5ILTH 3VWKC 5F89B 4V1DA 3QDGA 2P5WE 2UY6A 5DJ8A 5JIIA 1ONQB 3RIFF 4WGWB 1SJHA 1AKJD 2D9QB 1VFMA 3BQUD 4MJ4A 4NPYA 1T22A 1TVBB 1EBPA 1TMCB 4EIGB 3NAAH 5FHAH 4YPGB 3BDYL 3MGOB 3JV6B 1MFAH 5DC4B 3HC3L 1S3KL 1S78D 4LBEA 3EO1A 4QTHA 5GIRB 4P3CL 1A1OA 2DTML 5CEXA 4ODBD 4MJ5B 3H9HB 1C08B 1WCBB 1YDPA 3KLAB 3MV01 4OD1H 1GSMA 4N5EC 3G5ZA 4LMQI 4EN3A 1P5UA 4RIRB 4JFDD 2A6IB 3MRFB 4KRNA 5IW1A 3U1SL 5KAQF 3QH3A 1MWAL 1IM3A 4W4OC 3PHOA 2QQNH 3QJFA 4I0PA 3T2PA 4XP9L 1KCVH 4WFED 1UVQB 2EDEA 1HHIB 4HWZB 3IXTB 5E8OA 1Q9OB 1F00I 2A6JA 2VITA 3A67H 2R4RL 4WFHE 2VLRE 1QFHA 5H37H 3OHXA 3SDAC 3MUJA 5BZDA 2PYEA 1FE8H 2ATPA 1AKJB 3BQUB 3U46A 1XZ0A 5D2LE 4MD5B 5GJSL 1X5IA 2EYRA 3B2VL 4UQ2A 3VFWA 3BJLA 4M5ZL 3ZTJG 1CICD 1NFKA 4CMHB 1PG7X 4EDXB 4H26B 4KY1L 3C8DA 5IB2B 2CKBB 3G08B 4Q9CA 4KMQA 1HSAB 4JG0H 1T7XA 5C71A 3OKNB 1XCTB 3VXUE 1K8IA 4PYHA 4HUWA 4DN3L 3GDBA 4WTWA 2OMNA 4PUBH 4RRPG 5TDPA 2ZJSL 5TQ0L 5D7LB 1ORQA 3UYRL 4JFDB 3U48A 4KHXH 2X4QB 4M6NH 5I6XB 4X83A 1C16A 2J88H 2K7PA 1NC2D 3HUJB 4U7MA 4B41A 1J0IA 1P4IL 2V7NB 2QTEA 3SPVA 1XF1A 4JFQB 4PG9B 1J87A 5C2BL 1VGEL 1FZMB 5MP6L 4IM8A 5BS0D 2F53D 2W0KA 3FO0H 1OGAE 4M7LT 5A2KH 1XGRA 5B38B 5HGBB 4D9LH 2CGRH 4CMMA 1F58L 15C8L 5CJ5A 2Q76B 1CICB 4HMEA 1JK8B 3C9NA 3MJ6A 4IRZL 1OGTB 3I3EA 5I17A 2YUXA 4BKLB 3KPOA 4BK5A 3P4MA 1PLGL 4C4KT 2VXSH 3HZKA 2BNRD 4PLNC 1LE5B 4KTDL 4TPRH 4HUXA 3RAJL 1AXSA 2HFFB 1BVLB 4WV1C 4LDLB 1UACH 4NQDD 2Q8BH 1MFDH 3L5HA 3W11C 4OTXL 5TFSL 2A6DB 3CFIC 3MRNB 3FQNB 3P73B 2GHWB 5KANG 2B8OT 5K9OA 3BWUC 2EKSA 2DQJL 4Q9RH 3NN8A 1NCBH 1GGYA 2WLZA 3R06B 4N1EA 3F8UB 4XB8A 3VJ6B 4MNGE 1NMCB 3D69B 5J9PB 3QIUD 3Q5YA 3GSQA 5BS0B 2F53B 2WWMC 4DGVH 1IGCH 5IFHL 1DBKL 1BJ1J 1CFSA 3KNBB 1NBQA 2OX5A 4QRRA 2Z8WC 2VDPL 3Q1SH 2HKFL 2IJ0C 4I3SH 1CF8L 5BOZG 3GSWB 3NIDE 3V5DB 1MFNA 2NNAA 3OKDB 1MQKL 1KIPB 1OM3H 2YPLA 3B8YA 1N59A 1HI6B 1DBML 3DARA 1ZHNA 3D39E 4KI1A 4AEIH 4NNYB 3QXVA 2LFGA 3MRCA 1YQVH 2BNRB 4KAQH 4LF3A 2I26N 1INDH 2BCKA 2JCCB 1UEMA 4CADB 4GAGH 3ECBB 1KFAL 4WGVB 3MRQA 1FHGA 5KSVB 4NQDB 4KUCD 1DSFH 3NZHL 3S5LB 1EAPB 3HS0B 1YEEL 3FOLB 1BJ1H 4JFYB 1I85A 2HJLA 1J10A 1DN2A 1TZHA 2VE6B 4G80B 4BSWB 2HMID 1OTSD 1WC7A 4DN4L 2ICCA 3MLUL 1A5FL 2CDGA 4JQIL 4S1QL 4L29B 4YBHA 1P69B 3C2SA 1KF9B 4QHKJ 5HHVL 3GSNL 2WK2A 1QSFD 4LCYA 3T4AB 4NHUB 4S1DD 4Y1AA 4Y8DC 3PJSA 4PRAA 5KSAA 1EXUB 1OVZA 5E5MA 1K8DB 1MRDH 3UTTE 2NY2C 2HVJA 3FT4B 5GPRA 4X7TA 1A6UL 4FZEH 4JHBA 4YWGH 4UNVA 3TT1L 1IEAA 4LLUA 4QOKA 3O45A 3O8XB 5KS9F 5BQ7B 2GK0A 3ARVA 3QFDB 4CUCA 2EICA 3IS1X 35C8H 2PN5A 1MCWM 5T3XE 5DJ6B 2W9DH 1NBYB 2RHEA 3LQAL 3MRJB 4NT6A 5IR1B 1GZQA 5FO7B 3OPZL 2JELH 1OWRM 4OCXH 3PL6A 4EQ3A 1TFHA 1OSZA 4KJYA 3ULUE 5CUSL 3DXAA 4KHTL 4WU7A 4YQXH 3KWWA 1ZHKB 4LLYA 3VG0H 3MLWH 3AS2A 3U0PB 2VH5H 2ERJC 1LD9A 1QSFB 5CD5D 4I9WD 2NXZC 1GGCL 4J23A 3GMMB 4JO1L 3HZYA 1E28A 2OS7A 4OLZL 3F7RA 1CDUA 1ZA6A 3STLA 1YEGL 1T1YB 2CXKA 4X99B 1Q94B 4M7ZC 2EH7L 4UT7H 1W72H 4GXUM 1H3TA 3U83A 3MRKA 3LEVH 3QIWB 1C7TA 1INEH 5GRXG 3MV8E 1K5NB 4X6DA 3SKNB 4U1JA 3KYMA 1X5JA 1HINH 3X3FH 1J0KA 3GBNL 5GGRY 4LU5L 3QUKB 5HY9A 4PGEA 4OCYL 3ZE2E 4Z9KB 4E0RA 4POZD 3VFOB 4YDJB 4TUKH 5C0AA 1LO2H 3VW3H 3BGAA 3DJ9A 1BOGB 3D85A 1CDIA 3UZVB 2WQ8A 2LQRA 1BM3L 5DFWH 2KZWA 5EBMB 1XGUB 2FO4A 4PR5B 4HT1H 4X7CC 1FV1A 4J4PD 3LKQB 5DHVA 1N6VA 4NSKA 2AK1H 3AU1A 2ADIB 3KJ6L 5I76A 3K2UL 3BSZH 2FR4A 4Z7VA 4NCDA 3UPRA 4OUOA 4Z0BH 3MROA 1E6OL 1OGAB 2N56A 2YA1A 3Q5OA 1S9KC 4J1UA 5IEHA 4I5BB 4MJIE 3RVWC 3WFDL 4X0KA 1MJUH 4H25A 4MXQD 1WBZB 2OJZL 3WNMA 1KXVC 2Q86A 4JZJA 3WKNA 1T1XA 3WFBL 1U92B 4UMGA 4TVPD 4L9LC 1J11A 3GMQB 4M4RA 1GVIA 4B50A 5INDB 5F6IB 2VIRB 3PWPD 5SX4H 3N1GC 8FABA 4XPHL 2O5ZL 5AAWA 1ZGLP 4D0DA 5E2WH 3HN3A 3IDJB 2R4SH 1I9JH 4MXWL 2VDRH 4YO0B 4R4BA 3WO4B 1AQKH 1NL0H 3S3SA 4XTRC 4NUGL 4UBDD 5HGDB 1CTNA 1I9RL 2JF1A 1DDHA 2B2XH 4MNGB 4N8PA 3GJEB 3AB0C 1RULL 2WINA 3QUZD 43C9A 5F9OL 3ZKQD 2MTPA 3FMGH 1T04A 1ZHBA 2CLRB 4J6RH 2ZSWB 2F58H 1NDGA 1CXLA 1NUGA 1NGXA 4GG8B 2OP4H 4QF1A 1IGTA 4ZAKC 2GJ6E 3IFPB 5K59F 2C1PA 5JHDE 3TBTB 2Y06H 3LSOA 3CSYA 2VRAA 3PWPB 1ITCA 5HHOD 3OX8A 2H1PL 1Q0XH 1BZ9A 3GO1H 2EEBA 4HX1B 1EUTA 3JSSA 4OZGE 1MAMH 3O4LD 1YECH 5E6IC 3LKRB 5IB4A 5F96H 4JFOB 2KQMA 5DRNB 1R3KA 3JVGA 3NIGE 5DVNA 4HJ0D 1KXQE 4LSTH 1LO4L 3TVMC 2R1YA 3BH8A 3P0YH 3QUZB 5AD0B 1QP1A 3TPKA 3GZKA 1GGBL 3ARED 2Z93A 4X6CE 3UROR 3BZ4B 1OB1A 2OR9L 2X1PA 4R90L 1G7MB 2XQYG 5BZWA 2Y25A 4QHUA 5BOPA 4RDQG 5I1KH 1OY3B 4FOMA 5DD5L 4PJXA 4PTUB 2NQCA 3X3GH 1IC4L 4JY6B 5IMKA 1HCVA 2W9LA 1IC5H 1D5XA 5E8NB 3C60A 4F15C 4WUKL 5HHOB 2N4IA 1CGUA 3DYMA 5EBWA 4HKXA 5KVDH 4QXGH 5DK3A 2CMRH 4C56E 4O2CB 2H2PC 3V5KB 4F37K 5KSBB 4LVEA 4HC1H 3IF1A 2PTUA 1KB9K 4DWHA 5F97E 1FVDA 3FQWA 5TE7H 3RWDB 4ENED 5I71C 1UWXH 1J1XH 2P8PA 1KIRB 3F58L 2ZSVB 4PG2C 4P2QD 2GYSA 4P4KA 3WKMH 3GMPB 1P7QD 2DL2A 4NRYA 2GCYB 3F7YA 3MLTB 4CN1A 3SDXE 3F62A 3MCG1 3AREB 1YEFH 2YSSB 4ZPTB 4R96A 4URTB 4XI5D 4MD0B 3CIQA 1B0RB 5FYJU 4LSVH 4NWTL 2W65A 3EJYC 5JQ6H 3MLVH 4LAQL 3NCBB 4HD9A 4ZD3L 2BNUB 3BO8A 1T7YA 5EC2B 3B5GA 1JRHL 2OR7A 3GBLA 4U1SA 3VFUA 5ICYB 4MD4B 3QI9B 2X89A 5D1ZC 5DZOA 1QNZH 1GGIL 5IVXA 4HG4K 5KG9A 3PP4L 4EI5A 5I0DA 3W5MA 2W59A 5TPWH 4UZGA 5IW6B 1UA6L 1XF5A 5F1IB 3VA6A 3C6SB 3MBED 4NKMA 1N3NB 2XZAL 5D70L 1S7XA 4NQCA 1A6VH 5JORA 4UDTA 5C09A 3RJDA 1A9BB 5BVPH 4LGRB 3WJLC 3MJ9A 1JZ4A 3UDWA 3EYQD 3PXJA 4P2QB 3VDAA 3HE6D 1T1WB 3OR6A 3HR5B 5E8PB 2Q6WB 2VJXA 1P7QB 3GNML 2OZ4A 3VRIB 4D0CA 3C08L 2X4RA 2P5WA 1RHHB 3V0WL 3E8UH 3TM6A 4EI6A 5I1DB 2FATL 1R6VA 2R23A 2ZCHL 2NW2A 3U7WH 5A2JH 3U0TA 3VFGL 1HH6B 4ZXBB 4QRTB 4MAUL 4RZCA 3ZMRA 1T6WA 2A74B 4OT1H 3HMWH 5EO9A 3HRPA 1U0QA 1AI1L 4K3JH 4MJIB 1JTPA 5AAMA 1OAKH 5C0FA 1F97A 4JN2A 4CDGC 3TBSB 2ARWA 5BXFB 5IJVB 2PO6D 4K71B 4XAKE 2YR3A 1JNLH 1CE6B 4N9OB 4H0IA 4J8RA 2LAGB 4P2CG 1F11B 4X5LA 4M7LL 3PWJA 3WMSA 1IKNC 2D0HA 1UJ3B 5T3ZL 3RNQA 2R2CA 5BVJB 1RAMA 2P8MA 4PY7A 4X6DF 4XNXL 1D5ZB 3U36A 4XBGB 4CVXB 5DJ0B 1BVKB 3RWIB 4F7EA 4WW2B 1NKOA 2FD6H 3B9DA 4ZFOB 4Z0XB 1RIVL 5C92A 4X4XA 1JGVH 3P4NB 1RZ8B 3HE6B 3MMEA 5DUPL 5FYLL 3BOVA 4BZ1H 2FX7L 3MOBH 1T1ZA 3EYVA 2A73B 1DLHB 4CU8A 2IPUK 2ARJB 3ZHLA 4ZFFB 5HGHB 3OBAA 3S6CA 2VLRA 1MQ8A 1KELL 1RZJH 1HEZB 4G7YL 2PR4H 3NFSL 5D2LA 4Z7VF 1NEZB 5HHXL 5T1MA 4YDVB 4LSRL 4YK4C 2M26A 5IG7B 3I9GH 2FYYA 2PO6B 5DQJB 3ZKSD 2GJ6B 3DHMA 3QR2A 3LKSB 3GSXA 4K94C 1I8IB 4LHUD 3CLEL 3O3EA 1ZT7A 5E0QA 2YD3A 3VXUA 4KU1A 4JM2B 3UAJC 1B0GB 2DLGA 4X8JA 3H3BC 5B3JE 5C9JA 4L5FL 2GTWB 4YC2C 1EFXD 1CXFA 1RIHH 4R0LB 4P59L 4LGSB 1AH1A 5A43C 5A1AA 4OZGB 1G6RA 3BKCL 3QQ4A 1K2DA 1FNEA 1ZA3A 1HDMB 2A9ML 2YUWA 4XC1H 1CIDA 3EYFA 3I50L 3RPIB 2VSCA 3SDDC 5L2JB 1KPUA 2Y7QB 4R3SB 4F33B 5JIPA 3JWDC 2FLRT 4XWOD 4MNQD 3CFJB 3EO9H 4MAYA 5ETUA 4U1LB 3CXHK 3BPCB 1T6VN 4DTGH 1X5XA 1OQXA 3QO1B 2R2BA 1CT8A 4HEPG 4X6CB 5E8DH 3IETB 3K3QA 2IMMA 4JDZA 4QHMA 4RFOH 2E8ZA 3SE3C 3GKWH 1H8NA 1YN6B 2NLJB 5F9JA 3V6OE 4F9PA 5GSRA 1P7HL 5FEBA 1N5YL 3HMXH 5D8JH 1RQ5A 5C0DA 4FQQA 3S34L 4NQUA 2G9HB 3DVNB 1BEYH 2PXYD 2UWEA 4LHUB 4ZO9A 4WENB 1CLYH 2V17H 4DUXA 4Q0XL 3HZVB 4YAQB 2DLEA 4MJ6A 1A7OH 1WVZA 4EUPB 1GIGH 2JIXA 1FL6A 2FWOB 5DMKB 1EMTH 3S35X 3NMEA 3T2QA 3D3VD 3PP3H 4OB5H 1KJVB 3QXWA 3KYKH 1ZS8B 2HVKA 3V0AC 4MWFB 5AG8A 3U0WH 2O26U 1LNUA 5HPOA 5FF6A 2V9RA 4U49A 2NY3D 3EZ8A 3DI3B 3JTSA 5EOQH 1NAML 1A9EA 3GK8H 5IK3A 2F8VA 4XNMA 3L9RB 4MNQB 1T89C 3IDGA 1BBDL 3MRLA 2ID5A 3PV6A 3QUMH 3NCFB 1RJCA 1KN4H 3D25B 1MCPH 3TC9A 1AXTL 3UTQB 1OAYL 3SE4C 1X7QB 5ERWB 3B2UC 4NNXA 3HPJB 5I1LA 1EJOL 1UKSA 1YN7B 3E6HB 3D39A 3T2NL 5KSUB 3MZTA 2EDKA 3R1GL 5MHSE 4NN7C 5F1SA 5IB5A 3Q0HA 4L4JA 3W0WA 5ACZA 3TNMA 4XCEB 4OZFG 4DGYL 1P9MA 3LCYA 4PJXF 3ALXA 1MH5A 3DLQR 5HHNA 1M05A 4KROC 3T3PE 1A3QA 4JANB 1S7RB 1NGPL 1Z9SA 4DQOH 1JWUB 2CKBH 3TLRA 1ADQH 4PJ8A 4LLQA 1RVFH 2HG5A 3WN5A 5E2VL 3WFCH 4Y5VC 5GISL 1AP2B 2NY3B 1UJTA 4PRIA 2D03L 1IMHC 3BKYH 1EEZB 1VFUA 2GJZB 1WZ1L 4NFCA 4EVNB 3QEHB 1R0AH 4N9GB 1BWWA 2BRQA 1U9KA 2H9GA 5IMMB 2JB5L 5DGQA 4GLRI 3V4VH 4MA1C 2EC9T 3UTTA 4JVPA 5EO0B 4CW1A 4OZHE 5IKCB 4JY5H 4KKLC 5FGCB 3RA7L 1JBJA 2AJUH 3S35H 3OAZK 3O3DB 2FB4L 3WNNA 5A16A 4NQSA 1G7JB 1KJMA 2ICWI 4P4RB 2B1HL 3RY5A 3MNWB 3GB7B 1MWAB 1I75A 2DDQH 5CILH 2JCCF 4IMLB 2LVCA 4QRUB 4UNTA 5IVXF 4KKBD 5J6GA 4FQLH 5EUOA 2LU7A 3V6FB 4H20H 3SCMB 5EIIA 4WFFE 1G9NH 4PJBF 3ZE0E 3ARQA 3N0PB 4M7JH 5C8JB 4PJHB 5I8KH 3TO4C 3DX8B 2VDNL 2VL5B 2ADGB 3G6JB 1U8NB 1VADA 2OTWA 3LKPB 2YMXL 5HYSA 1QO3A 2Z8RA 1FL3B 1A1MA 2R56L 2BSTA 4KJPD 5HYQA 1DL7L 4LDOB 3LN4A 4M1GL 4P2RE 4XPTH 4Z7NF 3PIQB 1CU4L 2V2WA 5CINL 5B8CA 4OD2B 4AYFA 4GKSB 2MPAH 5I74C 5IMLB 1FNLA 1F8TH 2EDJA 3HAEB 4KQ4H 2AP2A 4Z7UA 3RWFB 2NY7L 1T83A 2DQFA 3T0ED 1U3HA 5DRXA 4YR6A 1D6EA 3AS3A 4DAGH 4LSDA 4QRSA 3BP5B 3PGCB 1LE9B 4R9HA 2GAZB 1NLBH 4N0CD 4GJTB 2XWTA 3MV8A 4N8VB 4O00A 1P4BL 4PRPD 2NY0B 1IGYB 4MNHB 4XZUB 1G7QB 2XFXA 4TSBH 4FNLH 2C7UA 4AM0B 1P7KA 1J18A 1CCZA 2WLYA 4RISL 1DBBH 1LEKB 2ILLA 5HDQH 1H3PL 4O2FA 5E7FA 3WS3B 1Z3GL 1GHFL 4KK6D 3V4UH 4R7NB 5JDSA 3WXVH 3AMLA 3FFCD 4ZFZA 2BSSB 4HH9A 4Q9BA 3HNTH 1MUJA 3VRJB 3T1WA 3O41A 1SJEA 1U95B 3BT2H 1XF2B 1PDKA 2D7MA 5FM8A 1NLDH 4ZO8A 5KW9L 2VISB 1G9MC 3IYLW 3OB0K 1X5GA 1OARH 3T0EB 4HK0B 5FYJD 1R5IB 3M45A 3FFDB 4YHYC 1L6XA 1CLOH 1NBVL 4WWKA 5DQDL 5D2LF 3GMRA 4JFPA 4ZPVB 3DECA 4JZOA 2R0KH 3BWAB 5CP3A 3PDOB 3IFLH 4X9IA 4PRPB 4GAYB 3IJHA 1N0LA 1ZT1A 4S1SH 3KYAA 3BMWA 3MACL 4QT5B 3I6LE 4RMQA 5HD8D 4FZ8L 3DV4A 3RWJA 5A2FA 5I30H 5C0IA 2VZVA 2I9LB 3FFCB 4W6XB 1H5BC 3WUWA 3EJZD 3N9GL 4F2MA 4YHNB 4M7KL 4EBQL 3QUXA 4LRNH 2ZUQC 1IGMH 1U91B 4OLUL 5MI0B 4LCUB 4WHTB 1AC6A 4JRYD 1XGYH 4P57B 4YIQA 1JMZA 4K3EH 2EDHA 4UB0H 5FDWB 1HHGB 3NFPB 4DFHA 3QWRA 2P43B 4MSWB 4BM7A 1A6ZB 3JWOH 5CJXA 3C5ZC 3RL1A 1X6NA 4FFZH 1IQDA 3DMMA 2BSRB 4LNRA 3CZJA 3QZWG 3WEXB 3MNVA 4Y16D 3LIZL 3D0LB 5GS1C 3IDIA 3ARSA 3G6AB 5I8OL 5JW3H 5JHDA 3GSUA 4YHMH 3RWGA 2IANA 2PW2B 5ID0B 3FTGA 2H8PB 3V8OA 1BMGA 1OW0A 3IXAA 5FKAB 1QYGL 4ZFGH 1L7TH 3NACH 4O5LH 4GQPH 1WWAX 4LAJH 2CLVB 4WO4C 3G9VA 4ZS6C 4RSVA 43CAB 4BH7B 2Z4QA 3GSNB 4JKPL 1F6AA 4Z5RA 3MREB 4U6XB 2X4NA 3HI5L 3VFVB 3IDYB 3G5YA 4RGNE 4KDTC 3MUGB 4D9RE 4JRYB 4KQ3L 5CSBA 4AIZA 2EDNA 3H9SE 3OKKA 4OZ4B 5M95B 3EYUH 3TJEH 3CZFB 3RVTC 2G60H 1XIWC 4Y88A 1SMOA 5CD3A 5KJRL 3TF7C 1U8PB 1PGRB 1CDHA 3O6KH 5EUKA 4ODVH 3VWJD 3SGEH 2DMCA 4J3XA 3X11A 4M4PA 1BOYA 5IFAH 2NZ9C 1DUZA 3SGKC 5HHQB 5IVZA 4Y16B 1NPUA 1GXEA 1IM9D 3NIDF 2XQBL 4M62H 3VXTB 3G6DH 4HGMA 1MY5A 4Y0GA 2JB6B 3ZL4H 4JFED 1YNTA 4BQBA 4PJIE 1M6OB 3KVQA 2LU3A 4L3CB 5IHLB 3CDFA 1CXHA 4JB9H 2L4OA 5D93C 5K9QG 3TN0C 2DS4A 4HV8B 2V2XA 5H8DA 4OZIA 3FQXA 5MERB 4XNQA 3DVGA 1X5ZA 2IADA 3KPRD 3S4SA 1NC4A 3ZT5A 5DEFB 2F54D 1QA9A 3M17B 1ZWIA 4Y19E 1T5WB 4P2RB 1B88A 2FIKA 2A38A 2XZQH 4JFZL 5ESAB 3OZ9H 5IJKA 2YKLL 2EZ0C 3FRUA 3U7YH 3DX7A 2DQTH 3VWJB 5HYJE 1UH4A 4JG1L 3GSOA 5E1HB 1ZV5A 2H3NB 4LKXB 3QO0A 3U82B 4HWEH 1PBYA 4JM4H 3BD3A 1N64H 3S9DB 2X5PA 3GGWB 5I1JH 4NQXB 2F19L 1XF3A 4MCZB 1AGFB 1DQLL 4DUWA 3B9KA 5D72L 4JFEB 4I0PC 2ZKHH 3Q6GH 1A4KA 3TZVD 3INUH 2OK0L 4L4VE 1IGFH 4ALAH 4DKEL 1JWMA 5IHUL 3BPNB 1RZ7H 4TNWF 1S9YB 2CIIA 4TVPH 4K94L 3B5TA 2CPCA 2WMPA 1AGDA 5EH1A 3BIKB 2F54B 4U0QB 4PV9A 5EU7E 4TSCL 5ANME 5LKNA 4XBEH 2BP3A 2MOVA 1KUMA 1MNUH 2YUVA 2ICWA 2I60L 1QEWA 4BQ9A 1QG3A 4NGHL 1JN6B 3ULUF 4PJ7E 2AABL 3FZUC 1KBGH 1QSZA 1JFQL 1UXWA 4LEOA 2QQKH 5DI8A 1D6VH 3D18B 5CFHA 1LO3L 4JR9L 1ZTXL 3VXSA 1NQBA 1S9XB 2VLMD 3CFDB 3C2AH 1R5WB 5I19H 5T3ZE 3HI6H 5HHMD 2ESVD 4OIAA 3IGAB 4ZG1A 3GMOA 1FBIL 1YJDH 1MRCL 1C5BH 4LLAA 4Y5YA 4RBPH 4H8WC 1D7FA 1RUMH 4AL8H 1MAJA 3OAYK 1N8ZA 1QRNA 5D4QA 5GGVH 2VABB 3L5JA 4L4TE 3O2WL 2YEZA 5E00A 4KGLA 4KI5D 5FYLE 4LHQB 1IAIL 5C9KA 1FVEB 1A3RH 1I8MA 1WLHA 2UZIL 1J1PH 2FSEB 2PTTB 3FQTB 3TA3A 3VXOA 5D1QA 4RWYL 2BNQD 3IDNB 2VTFA 2HJFA 4DK6A 3DYPA 4X80H 3ZE2F 5E95B 5CZXC 2X4SA 1T5XA 3SE8H 4IS6A 3NABL 4BUGA 3CCHB 3SO5A 3VWKD 1MHEA 4PFEA 3C5JB 3DUHA 3ZSSA 2NW3A 3MA7B 5FHBL 2KDGA 4UV7H 1DQMH 1V7MH 4FQHA 3I2CL 3KPTA 3RVXC 2QR0A 3K4ZA 3FB8A 3BAEL 3QUYA 5DWUL 1DEEB 4U0RC 1QFOA 5HHMB 2ESVB 3EFDH 4YXKH 1VFOA 4H0GA 4PJ9A 3C09B 2ADFL 1IAKB 5DJZA 1QLRB 4XAWL 4N8CL 4KMLB 3PQYD 3KPPA 1NCDH 3HR6A 3CNKA 3K46A 1YPZB 1I7UB 1N2RB 5JPNB 4K07A 5CBAA 1RUAH 3C5SB 4N5ED 2N7AA 3BH9B 1KV3A 2X4UB 3LOWA 4F3FB 2BXYA 5HJ3B 2BNQB 1XF4B 5F7DA 1R3IL 3BGMA 2CDFB 4UILL 4ODTL 4XPBH 1D9KA 1MCSA 3DRTB 4OLYL 2NY1C 3TO2A 5TDOA 1UM5L 3MXWL 1PFCA 4WW2F 3EYOA 1WT5C 4U1KB 4RGOH 2O5YH 4Q6IA 3OGOE 2XTJE 3VWKB 2CUMA 5FA3A 5GGRB 1JPGA 4FN0A 2MKLC 2WUBH 2R1XB 2Y07L 4WI2A 3H7LA 2QSCH 1C7SA 4P9HH 2AXFA 2FLBT 3MRHA 3H9SB 1CS6A 4JO2H 2VC2L 3SDAD 5HPMA 2EDXA 2EH8H 2BK8A 3V6OA 4Y2OA 5JPMA 5T33H 1AD9B 4OCWH 1FAIL 4OV6F 1MI5E 4LARL 3EW3B 1OAXH 1I85C 3WFEH 5JR1L 2BVPA 1IL1A 2E7LA 3PQYB 3MC0A 2Z92A 5DD0H 5JHLL 4Q9QL 5I1EH 3Q5TA 4JM2F 4EOWL 2BDNH 4KXZH 1MCQA 4DZBB 4UT9L 1U8JA 3MBXL 3BKMH 3DO3A 4G8IB 4G8GD 5FA4A 3RBGA 1PVHA 4ONOA 3VH8G 3QB7C 3W2DL 4XX1G 1BFOB 1NGZA 3OG4B 3OJDA 1KPRB 1W8OA 2ZG3A 5IHZB 2BHYA 3S8WA 4OZGF 3WNLA 5KSAC 5DFTA 1L0YA 4O51B 3BKJL 3E3QE 1X4ZA 3VXME 5I9QC 4BZ2L 2J6EA 1MFCL 2VZ3A 1HWHB 5CWSB 3VXNA 3OKLA 2KQNA 2Z35B 3NIGF 4KRLB 4U1IB 3WHE0 1CFNB 3O6LH 3MLPA 1OAQL 4UIMA 3SDAB 1AC0A 3L1OL 4GAFB 4YHZH 4HHAA 4NRZB 1YC7A 3N1FC 1KENL 3O3BA 4LFHG 4X6CF 5C0RL 2C26A 1QBML 2KUTA 4GKOA 2NPLX 4K9EL 2Q7YA 1R3HA 2IQ9H 4HQQH 4P5KB 5GRJL 2VXVL 4A6YH 4XMLL 3L7FB 3BDXA 1QSVA 1KN2H 2AJ3A 2DI7A 5IBUG 3RFZC 3M07A 1JRHI 2L7JA 1OT2A 2EDYA 4XVTL 3WUZA 3FN0L 1A1NB 4MLSA 3I02B 5IF0B 3W11D 5FV2A 5HVHC 1SHMA 4AENA 1DQDH 2OL3H 5SWSD 1SYVB 1A2YA 4PJDB 4BQ8A 1IT9L 3AVEA 3DUUA 5IWLA 2X4OA 1T66C 4D94A 3D2UA 1MCFA 3RX7A 3C6LA 5DJYB 1M1SA 4F7TB 5DD1L 1Q9WB 5ANMB 1UCBL 1WIOA 4X7SL 5JO5A 5GGSY 1M4KA 4ZYKB 1R3LA 3RVUC 1MJ7L 3BE1L 4K7PH 2P8LB 2WWMD 2R2HA 1HCFX 1I7RB 3S98A 4WJ5B 4K23H 1NSNL 3SDXF 4KTYA 2IPUG 3HMXA 4BZYA 2G75A 3RKPA 1PX4A 1ONQA 4LRIA 1HIML 5C08E 4HIHB 1DUYB 1WWCA 1Y0LB 1NANH 4MMXC 2V5RA 2O61A 1WBXB 1TVBA 3IJSA 3FN3A 1TPXB 5ITFB 3CDCA 3O11A 4LSUL 2MQ0A 3JV6A 4OF0A 4WUUD 1DLFL 4FABL 1H3XA 4WV1B 2HFGL 2P24A 4ONHA 1WF5A 3GFUA 5SWSB 4NCC2 3GHBL 1C08A 3M8OL 2LE9A 4XPFH 1KIQB 1I3GL 4S1RL 3SDYL 3ZDYE 1GCFA 4EUPH 1ZLUH 5F7FA 3EDDA 5EZIL 2A9NL 4YEFA 3QUMA 9CGTA 1KIUA 1KCUH 1NCWL 3DSFH 3O2DL 4MA3B 4JPWH 3B3IB 1ZSDA 4XWGH 5C6TL 3WFHB 5CEYB 1Q9OA 2NY2D 1DEDA 1ZXQA 4MDIB 1NUNB 4YUEL 4JRWA 4J3WA 4LEXH 3QCVH 2E7BA 2XNAB 3MFFB 4N0FB 1YMMD 1U8QB 3GRWH 5DHXB 5HHPB 4WUUB 3BPLC 1JVKA 2CKBA 2A1WL 3BP4B 3Q6FA 4G9FD 4HF5H 3OV6A 5ADPH 3HB3C 2NZIA 4F57H 4PD4K 4KKCC 1F4YL 1A4JB 5TE4H 4JRXE 5CJOH 2P48B 2B0SL 1NFDE 5D5MB 5LGHL 3CXDL 5JUEH 3RU8L 2XTJB 2C1OB 3HUJA 2OYPA 3PP3K 3RNKB 2XY2A 3QDMD 4OBSA 2P44B 2Q20A 2F74A 2X1WL 1NCAL 2NXZD 5DD6A 2I5YH 3RY4A 1EHLL 3IKCA 4G8FB 3UBXB 4P5TA 1CWVA 2NY2B 3O0RH 3O3UN 3REVA 4M9PA 3KDMB 1AJ7L 1UWEL 5HGBA 2MQCA 1U3JA 1S3KH 4X98B 4V2CB 2CLZA 5BCAA 5FUCC 1YMMB 2Q76A 2QV2A 1FFPA 2QSTA 1DP0A 5E2JA 1CICA 3JVGC 3MSPA 4GKNB 4XP4L 5AZEL 2R0ZH 4FTVD 4E41E 1AY1H 3GIVB 4PIRF 3S3JA 4GQ9H 1LE5A 1F3JA 2LVEA 5B3JF 1JI1A 1MHPH 2A6DA 4ODXA 1OT1A 3TPUA 2DQDL 2H32B 5I8EB 4NO0D 4YHLL 2W60A 4O4YL 5AYQA 3SKJH 1RSFA 4HGKC 1NC2A 2Y36L 2D7NA 3QXAB 4AEHH 2NXZB 3MRGB 5CKGA 3C60C 2DB8A 2X4PA 2ED8A 2QKIA 4XNZB 3RVWD 4NZTH 1VA9A 4HWBA 1AIFB 4FQIH 4M7ZB 1MJ8L 2BXZA 4LVNC 3OJVC 1HOCB 5J12C 3GSWA 3MLZL 3HAEH 3V5DA 2XACC 3OKDA 3QG6B 3NZ8B 3QWQB 5D7SH 1FQ9C 4PJGE 2YRZA 3F5WA 1IKFL 4P4KC 5FCUL 4EZMA 3MRDB 4FTVB 2XKNA 2ZJSH 5DHYA 3VFRB 5J1AB 4G6KH 2BNRA 3MA9H 5H37G 4XCNA 4FXLA 1WAAE 4X4ME 1DANT 4CADA 2KBGA 1SVCP 1UM4L 3AXLB 4XTRD 3S5LA 5ALBL 4OLWL 3SO3C 3HS0A 3O2VH 4K55A 4NO0B 1QFUH 4FFYL 1A7QL 3FOLA 3AM8A 4JFYA 1P6AB 1JGEA 1KB5B 3MCKB 4CU6A 1VGEH 2P49B 5MP6H 3IB4A 5CBEB 3QEQE 4OFVA 1CE1L 2PCPA 5BV7C 4EI5C 3H42L 1OTUC 4L29A 5KTEH 2XIDA 1F58H 3QIUA 2C3HA 3SN6N 3EOAB 4LKCA 5H2BB 5GZOC 1NKRA 2EIZB 4JKWA 2XWJA 4F7CA 1RZKC 1FIGH 1FNGB 5CSGA 4NQED 4ZAKD 3G5VB 3O6ML 4J3VA 3KLHC 1C12A 4NHUA 3GI8H 1TJHH 1BP3B 4JFXB 1RZIB 4GRMA 3SOBH 1EXUA 5F3BA 2AQ1A 3VE0A 1FJ1B 2IPTL 1CIUA 1F90L 4PJIA 4KTDH 1QTYT 2EYSA 5F7UA 4KZEH 1H0DB 4JN1L 4R6UA 5TFSH 4GSDH 1NGWA 3T3PF 1S9VA 5E6ID 1Z6JT 5BQ7A 3QFDA 2FHFA 4KJQC 2D7OA 3DURA 3TBYA 4G8EA 1HYRC 5GXBB 4P5MA 1NBYA 4S2SA 4IRJB 5DUMH 3QNYB 4Y19A 3LEXA 3O8XC 4MQTB 3AB0B 4PGCA 4RA3A 1JHTA 1NFIB 3FAWA 2VDPH 5KANI 2HKFH 3OKOB 3ZKNC 4EDWH 1TCRA 2A83B 3TBVB 2AJZB 5JLZB 3HI1B 1MQKH 1B2WL 3DETC 3VXRD 2WUCL 4NQEB 5FGRA 2JJVA 1S7TA 4ZAKB 2VNCA 2FJFB 3F6LA 2MSPA 4OZHF 3WS6C 2X40A 3X13B 4RCAA 5C0NC 2C3WA 1PYWA 1T1YA 1JHKL 5FYJH 2IPKB 1CGVA 1I1AA 4WRLA 5AG9A 1Q94A 5AWNL 4HIXH 3QNZB 4OF8A 3H9YA 4PRHD 2BVTA 1EUUA 1T20B 1KT2A 4RFEA 2H2PD 4G42B 4LCWE 5TE6H 4Z77B 5E6IB 1YYML 4N1CA 4WEMB 4YHIA 4LIQH 1KTDA 1TZGH 3A6BH 4X5XB 3SJVD 4PJEB 4OCSL 4DN4H 4KK9C 3ZE0F 1A5FH 2KPNA 4S1QH 4XH2A 3TVMB 1NFDB 3QIWC 1YEIL 4PJ7A 4TN9A 5B39G 1BOGA 4BH8B 3DROB 3A0OA 3GSNH 1AR2A 2HKHH 2HWZH 4UNUA 2BMKB 3BW9B 1VKXB 4KDWA 4P46A 1FFRA 3EJYD 4MS8C 5GGUB 1W8NA 3VXRB 1J05B 2CDEB 3OTTA 2X10A 1T2QL 3QNXB 1ORSB 5D1ZD 4KVCL 4I5BA 4EJ1C 3TT1H 2R1WA 3KGRA 4JY4B 5KVGL 4J3UA 5EZLB 3TV3H 4L4TA 4DW2L 1ZT4A 4F15B 4LQFH 4JO4H 5C1MB 3QHFH 1RMFH 4PRHB 1N4XH 4HCRH 4ODUB 2EEDA 4MAYC 1U92A 2Z9TA 3M1BA 2E27L 3FCTB 1XR8B 1SBBA 1VPOH 1QKZL 2HTLC 4HMDA 3SJVB 1CLZH 4I0CC 4F9PC 1G7PB 1CFQB 1LDPL 5TDNA 5I71B 5LBSL 5LGJB 3QHTC 4IIQA 1CXKA 1Z9LA 5C2UB 4R4FL 3IDJA 3V4PH 3BGFC 2GY7B 5D6CA 4RAHA 4WNQB 4PLJC 2DKUA 1WISA 5ACLA 3X14A 3I85A 5I66A 5L88L 5LWYH 1GGCH 3QFJE 5KVFH 4ERSL 5ITBL 4Z78B 1I4FA 2Y5TB 1YEGH 3CMOH 4GXVH 3SE9H 5GHWH 1NGQL 4XMKH 2CLRA 5TH2B 1JGLH 3T0BA 4PS4H 5I1GH 5ISZE 2DQHL 5D1ZB 4TUOB 4GG8A 3L3GB 5EN2A 3ET9F 2AK4D 1A7BA 1SEBA 3GBNH 2EIBA 5DK2B 1MIMH 2BOBB 4HSQA 4L9DA 4OCNC 1JZ3A 1KNOB 5K9JH 3IRZA 4OLVH 1CGYA 1FAKT 4BQCA 2VAAB 1LK2A 3WNPA 4BA8A 2WBJA 1WTLA 4OGXL 5H35A 4K3DL 4DZ8B 1HH9B 1AO7D 3KJ6H 3EYSH 5L2KD 1ES0A 1T0NB 4ODSH 1P9MC 3WL9A 1JMXA 1YUHA 1HWGB 2VYRE 2XYCA 1ZVSB 4ZSOA 4ORGB 1FLRH 1MI5A 4PJ8C 1UFUA 2HN7A 1G7MA 1I9IH 4ZNCD 4OCRL 3QRGH 3LV3A 4NQVB 5ENWB 5C0CE 5IP4A 1AHWA 3H3PH 1T4KA 2AK4B 4RAUA 4PTUA 4DK3A 3UAJD 2GSIB 4TUJB 1VFAB 5CCKL 2MJWA 1BFVH 4RAVA 5E56A 2Z8SA 3Q3GB 4J3OC 5E8NA 3P30L 1DFBH 3RL2A 5C6WH 3E2HC 4JJ5B 4LCWD 1WEJH 4KZDH 1TITA 3X17A 4XB7A 5E2TH 4LSSL 3HNSL 3L3KB 3O4LA 4Y2DA 1AO7B 4JZNB 3SDDD 5L2KB 4KUZL 5F9OH 5DD3L 4UV4L 1FLTX 2VLKE 5I15H 4H88L 2MHAB 1KIRA 1LP9B 3VFTA 1U93A 4GW5A 3BEWA 3GMPA 1V3MA 1RUKL 1JTOA 1I7ZB 3UO1L 4OZFH 4YK4B 4HIJA 4X6BB