5CEYB

Crystal structure of fab 9h+3l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
232
structure length
232
Chain Sequence
QVQLQESGPGLVKPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLKSRVVISRDTSKNQLSLKLNSVTAADTAIYYCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 9H+3L Fab light chain
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 232
sequence length 232
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ceyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ceyB01
3T09A 1Z3GL 3HS0A 5B3JF 1AGBB 4MAUH 2R2HA 2J4WH 5CJ8A 2ADGB 1SY6H 2HJLB 3C08L 5D7KE 3SDAC 1AIFA 3V52L 1TETL 3OQ3B 2W9DH 2WW8A 3TO4D 1QR4A 3MGTB 1U58A 3ZDZF 4PB9H 3ARDC 3F6LA 5K9QI 2H41A 4HFUH 4RFEA 1NBYB 2X1PA 2J8UE 2DI8A 5DJCA 1EEUA 1KJ2B 3S5LB 3AU1A 4XRCB 4PLJD 1T80A 5FOBB 1VGEL 3HZYA 1EAJA 4X9GA 5D6CB 2ENSA 2NY6D 2FZ3A 2ICES 3DUUB 5F1NA 2DQUH 1FZOB 4PR5B 1I7RB 4MS8C 4Y16C 3BP5B 1PJ9A 2W1NA 3ZHKA 4M5ZH 4M6ML 1GYAA 2FECL 4H88L 4X6CE 5D1ZC 4YHPB 2X4TA 1GPOH 4Z5RA 2R1XB 3O8XA 1X3DA 2F74A 3P73B 1KTLA 3HZVB 4EQ3A 5DQDH 1GOHA 2A6KB 4PG2C 5C0BB 3RNQA 4E41D 1OWWA 5FYJL 1CK0L 2XI9A 4LDEB 2GK0B 3PWNB 3MLTB 1FPTH 1J1OH 4U2YA 2AEPH 2CKBL 5I6XC 4PGEA 5JPNB 5T1LB 1DDHA 4TQEL 3LMJH 3FT3A 5DHVH 2VDMH 5D5ME 2PCPB 3RWFA 4TN9A 1WZMA 1LO0H 5IB5B 3VRIA 4OFDA 1JYNA 4LU5L 4NCC2 1QFHA 3HE6D 2ERJC 3WJLC 1A4JB 1VADA 2CUMA 4KHTH 4ZFOL 2AK4B 1MH5A 3PNWB 1MFDL 4U1LB 2EEDA 5DHXB 4AK1A 3WN5B 1UB6B 4JY5L 1WFNA 4NZUH 1NMAH 5F9JA 4OJFL 3TO4A 1FZMB 1V7MH 4M7JH 4LLUA 2MKLC 4OGYH 1I7UB 2ED9A 1ZANL 4N8VA 4YHNA 5EO9A 4PRAA 3KPSB 1U92B 3BO8B 4P5KA 4K94C 4R90L 2A74A 2ZPKH 4O5LH 3MV9B 2EIDA 5F9OH 1SEQH 1FYHB 3MRRA 1DBAH 4R4FH 1PYWA 2UVFA 5CS7A 5JA8B 1CU4H 4R96B 2B8OT 1BGXL 5DVKA 3VD3A 2GY5A 4MXWL 3MOBH 1C1EH 1OL0A 2DKUA 4HH8A 2Z31B 3CSPA 3T0AA 2ADIB 3E8UH 4ZAKD 4JY4A 2X1XR 4AIXA 4FA8A 1UCBH 4PJBA 2APFA 1ETZA 2DKSA 5GS3A 4HIHA 2CDGA 1DQQA 3MNZB 2PKDA 2XXCB 3BZ4A 1EXUA 4ZO7A 3G5YB 1GZQB 4NOBA 2P5WB 2K9UA 4OGXH 4GSDL 4RGNE 1MI5D 1HHJB 4CNIA 5IB3B 3FQUA 3KYNA 2B7DT 5GRJL 5EB9A 5HVFB 3K81A 2R29H 1G7QB 4NP4H 3GUTB 5DMYA 4P46C 1ED3A 3BVNB 4TNWF 2XNAB 1QFUL 4U1GC 5CLWA 3T3PE 4DGVH 2JKXA 1OM3H 4LBEB 4EI5B 2ICWB 3FN9A 4C4KO 2IH3B 4NQUA 3OJ2C 3HE6A 4CVWA 4WRLA 4JAMA 4X6DF 3HCVA 2ORBL 15C8H 4LCWB 2M1KA 4FXKA 3KJ4B 3QFDB 2DL2A 4CMHC 3EYSL 4PGCB 1J0IA 1GGBH 3RWCA 1QPPA 2O5YH 2ZUTA 1GZPB 4XVUD 3B2VL 3PHQA 4OLZH 4GRWH 4OF7A 4LOUD 1RZIB 4PRPE 4L1HA 4HH9B 3FO2B 3TT3H 1XF4A 2DJ4A 2X44D 5D2LB 4G9DA 4MGXA 2R2BA 3VFGL 1WEJL 3H2WA 4J4PD 1EO8H 2NW3B 4G3YH 1YY8B 4MX7B 3BYYA 4V1DE 1G9NL 2ARWA 2D03H 4KGJA 1IGFL 3GRWH 5HHPA 2UY7A 3KLHD 5ADOL 4KPHH 5ID1B 4ZAKA 1WZLA 1KJMB 2NX5B 4GFTB 4ODSL 1MWAH 4PBWD 3QIWB 1OF2A 1AC6A 2OL3L 3CFCH 3QEUA 3RIFK 4NQDA 4RMQA 4PLKC 2NY3B 1YEGH 1DL7H 3FONA 3QQ4B 2YS4A 5EZIL 1M7IA 5T3XL 1BJ8A 5TDPA 3P4MA 3G6JA 4OFPA 1S9VB 3H3BC 3L7EB 4HKJB 4Y5XB 5GS0L 1VACB 4I3RL 5C7XL 1N6QH 2BVQB 3CFBA 1AKJA 3GJEB 1Q0XL 1NCNA 2LU3A 2PNDA 4PJIB 1N7ML 3D3VE 1YPZA 4XP6H 4DTGH 4KDWA 2DD8L 2KQMA 5FYLH 5EZJB 2VZSA 3I02B 2E7BA 4GW4A 3NCJH 4XPBL 1TJHL 3OJDB 2LE9A 1CXEA 4J1UA 3VJ6B 4QNPE 2EKSB 4P57A 2W65A 3KXFE 4YXHH 2X4OB 1LP9B 4NKIH 1PLGL 3UTOA 1ACZA 5D70H 2VXSH 1XGYH 2Q3AA 4PJAA 3CU1A 1A3RL 4HZLB 3EZJB 1AXSB 1NL0H 2A6JA 2RCSL 1B0WA 2CQVA 2AEWA 2OZ4A 1AY1H 1RMFH 1VHPA 4WI5A 1N6UA 4CN6A 2VL5B 5LBSL 2YC1A 2DQUL 1JZ4A 2W59A 4ONHB 2APTA 4IOFD 5FV2A 5HJ3A 3RZWA 4Y8DC 5EU3B 4PTUB 3P4NA 2HJFA 4WY7L 4NNYA 2HVKB 3GMOA 3PABA 4I8DA 4FQIL 1GH7A 3OF6D 1GPOL 3HC0A 5F89B 1MRCL 4Q9BA 5F7MC 1CT8B 5C0FA 4L3EE 4L4TB 1KFAL 2JLLA 5F9WB 1ORQB 4NQEE 3K2UH 1N3NA 4KQ4L 3HUJB 1L7TL 1URLA 1PDKA 2Y1VA 1J1OL 1QG3A 4FFYH 5JZ7C 1Y6MR 3QH3B 2EICA 3H9YA 2IJ0C 4TSAL 1GGTA 4W6YB 1R3HA 3BP6A 3TJHD 3O3BB 3FB6A 3MMEB 1T4KA 3BRGC 2YWZA 1L4IA 2GJ6A 3S4SA 4UV7L 3ROOA 4CJ0A 1QSFA 4BZ1L 5DC4B 3PQYD 3I75A 1MJ7L 1VFAA 2KL6A 3HPJB 4MAYC 5LXGH 2D4DA 3M8OL 4HS8L 3LKQB 1X4ZA 3VE0A 3KLAB 3LN4A 1ADQH 2CLZA 3KNBB 4UBDC 1G7HB 4POYA 4WNQA 3QUXC 5ECJE 1RQ5A 4NZUL 1EHXA 1NMAL 1XGRA 3DROB 1BBJA 3GBLA 1V7ML 4G43B 1XR8B 1NCWH 4Z0XB 1XGTB 3WHE1 1I8LA 4Q9RH 4RQQB 1U8HA 4PGBB 4O5LL 2PYFA 5F9OL 5D7IE 1MAKA 2B5IC 3SDCC 3GBNL 3V8CA 1Q8MA 1CU4L 1Q1JH 3UBXI 4G6ML 4JFFB 5IMKA 1ZMYA 5F7LB 5IB1B 1MNUH 4XI5D 2VXUL 1OTSC 5ISZE 3OGCA 4QOKB 2OS7A 4WEMB 2IPTL 3Q5TA 3QDJB 3OF6A 3DGGA 3PWPE 4P2OC 3UC0L 1KPVB 2NYYD 3LKOA 3LQMA 1D5XB 2XICA 3VWJB 1A7RH 1X5YA 5CJOL 5CGYD 1IAIH 4LSSH 5I73C 3G5VB 1OSZA 3A6CL 5IHZA 1R3JA 3MV11 3PGDA 4LNRB 1F6AA 3OJVC 3MJ6A 5CJQH 3FOMB 3HRPA 1K4DA 5FM5O 2OJEA 4IRSC 4NO2A 3P11H 5EBWB 1DQLL 4S1QL 3A67L 3GM8A 4ZO9A 2BJMH 2GYSA 4YBQC 2GKIA 2YRPA 1HCVA 5C07B 1UJ3C 1CFVH 4Y4KD 2OK0L 4J12A 3QXUA 1EHLH 4PJFE 3BZDA 4PY7B 5DRNA 3MLZH 4ZPVA 5E8OB 4GW5B 2NLJA 3JXAA 2V2WB 1C8PA 1ITCA 3T77A 3NN8B 1RZFH 3HC3H 2HKFL 3R8BB 4YBLB 2EDXA 3QI9B 2XA8H 1HQRB 2F5AL 3DRQA 5DO2D 4BK4A 3FQWA 3SE3C 4D8PA 2VLKE 4LRNH 4KUZL 4HIIB 4YR6A 4KRMB 3SKOB 2AJYH 1HSBA 1FNSH 1RVFL 2D7PA 4M03A 3TV3H 4I5BA 4N8VG 3BRDA 1FG9C 5CWSB 3IT8D 1Z9MA 2BVOB 5T3ZL 5EULV 2RIKA 3A6BL 3RU8L 5DVNA 4ZTPH 2HT2C 2P7TA 3RGHA 3HPLA 2FB4H 3OR6B 3HI5L 1EBAA 4TUKL 4X7TB 4WI6A 1KTDA 2HFEB 3V7AG 4IM8A 3X3FL 2DKMA 1I1FA 3T3MF 3MV8E 1XH3B 3JZ7A 4U1IB 4D9LH 4APQB 1SYSB 1J0YA 4Z7OE 4IRJC 5EBMA 5IR1B 4M1DH 3VDCA 1B0RA 1G7JA 3CFCL 5TGBA 2YD1A 1H3UA 3QYCA 4WUUB 1KELL 3ARFB 1FL3A 3VXRA 1H5BB 4JQIL 4LVHB 1D9KD 3IXTA 4ELKB 2P44B 3CLEL 2XQBH 3HMXH 3WEXA 1JIBA 1GXEA 2CKNA 1CGWA 3VXOB 3OMZA 4YDLC 5T5NF 5E08L 4JJHA 1DE4B 2FSEB 4Y4KA 3MLXL 4ZUWB 1CGVA 2Y06H 1K5NA 3D0VB 3X3GH 5T1MA 3LRSB 2WIMA 3I6KA 5DJ0A 5BV7C 4JM2D 4RAUB 5IMLB 2ZUSA 5C0EA 1MCWM 5IM7B 3J7HA 4JZJB 4DVRH 4JCLA 5KSBF 3ZTNL 1TLKA 1I3VA 5BS0A 3TBWB 3X13B 1OQOA 2VDKL 2X6MA 5CJXA 3PWUA 5SWSB 3NCJL 4Y19D 1F5WA 4UT9H 5EA0L 3HA0A 1CQKA 4X99A 4ZSOE 4HK3N 3PV6B 5C0AD 1FZJA 5D70L 4PV8B 3E6FA 1G9ML 3NIGF 3CVHL 1FGVL 2X70B 3C6LB 4UINL 4L5FH 3LS4H 1I8IB 3MRIA 2BRRH 4UNVA 4NO5A 4LCYA 4JZOB 3RWHA 1AY1L 3DLQR 1CLOL 4HUMB 3S3SA 5AD0A 1OGTB 3C5ZB 1XIWA 1I1AC 4RGOL 4EJ1C 4PJ9C 4C57C 3VGFA 4P4KC 1NAMB 5ICYB 3DO7A 1T1ZB 1SJEA 5IIEB 5C6TH 1H0DB 4WFHE 1RAMA 1NMCB 2E9IA 4HS6B 1P4IL 1LNUA 5F7NC 3TZVC 5F7DA 2H32A 3UYRH 1G0DA 1D9KA 1T0MA 5DI8B 1YEEH 1HHIB 1SJHB 5ADPH 1QSED 3WO3B 1A1MB 4WHYG 2C4FT 2HWZL 2QBWA 2XXMB 5C0IA 2XOTA 4MNGE 2ZKHH 4UNUA 4R3SB 4XTRD 1EHAA 1JTTA 4HFWA 4NQSA 2W0PA 4FABL 2A1WH 2IQAA 2QADD 5DK0B 5HGHA 1BECA 5GRVK 3PWLA 1A14H 4X8JA 4I48A 1AGCB 1EBPA 1WZ1L 1S5IL 4XP4L 4AIZA 3UAJD 4JM2A 5T1KD 4CADA 3E6HB 3MGOB 2BFVL 1MIEL 3WE6B 4IHOB 1NGXB 4JJ5B 1JF1A 3QUZA 2UUDK 4I2XA 4J3TA 2K1MA 3MRLA 4P3CH 5EU5A 3V4VH 1RFDL 3D2UA 4NQXA 2Q6WA 2GJZB 3D9AH 4M43H 4Y19A 4JLRB 5EORH 5JOEA 2G2RB 4RNRB 2V7HB 2V2XB 2J2ZA 3MREA 1NCWL 5C0AA 3KPPA 4GQ9L 1T2XA 2QSCL 2EYRA 2H9GB 3TA3C 5MERA 2VSDA 1AXTH 2X7LB 1U3YA 3SOBL 5D1XA 1GIGL 4MQSB 3MJ7B 5DHYB 1HK6A 1AP2A 4BJLA 3CFJB 2UY6A 3DHMA 8FABB 3B9AA 5E2TH 5DVMA 2P48B 3NZHH 1OLLA 5EBGA 4F15B 1MNUL 1FYTD 4NO3A 2HT3C 2DQGH 4FXGA 3SDDA 2MJWA 2NW2B 2V5TA 4LSUL 4O2FB 1JZ7A 4WFGD 4QRSB 1YJDH 3TH3T 4GAFB 3F7PC 3HE7C 4NQCB 3BZFB 2PO6C 1XGPA 4MDJB 5GRUH 3S35L 1QSEA 4HUKB 5L2KE 1JPGA 4AT6A 1SEBB 2R69H 5EC2B 3HNTH 2PTVA 3WFHB 1U8IA 5T1DH 5C09B 4WW2A 1NMBH 4ZPTB 1S9XB 3HZKB 4G9FA 3SBWC 2ARJQ 2QTEA 4MCZA 1ZLWH 5JHDD 1OAUH 5DC0A 5AZEH 4J3XA 2A73A 2DIJA 3VXUD 4M00A 5KOVC 5T1KA 3ARGD 3B6SA 4UTAL 2WBJD 4KJWC 1N64L 3UTSE 4K3EH 1EHLL 1F58L 2AEIT 4K71C 1PEWA 1ES0A 1N59A 4C56E 3S6CA 3GMMB 4OIIH 3K8LA 2DTMH 4BFIB 4HKBA 4BH8B 3GJFB 1WZKA 3VGEA 4CRPA 5JQ6L 1YUHB 1G7PA 1NGPH 5TF0A 5FHAL 4HIJB 5FYKL 4EKXA 1YMHA 3QAZB 4S2SB 1TMCB 2JCCB 5BMFL 1HSAA 4M9OA 1KPUB 5JOFB 2ICEB 2YN3A 1NKRA 5I1DA 5EG6C 1NBZB 2LTQC 2YPLE 4ZUUA 3GMRA 3HR6A 3MZTA 4FN0A 4X7SL 1TZHB 3MJ8B 5I30H 1LO3H 3VDAA 1A7BA 5LAXA 1KGCD 5J1SC 1CL7H 4XCCL 5I8CB 4LLVA 3CFEA 1RU9L 4YK4B 3LV3A 4BQ6A 2XWTB 1C5DA 4F9LC 3NIDE 4CVXB 2PF6A 2PW2A 1VENA 2A6DB 1T5WB 5HGDB 1FYTA 1VKXA 3DX6B 4KKLC 5F96H 3SJVB 4QY8A 5T3XE 1RJYB 2CLRB 3C2SA 3MJ9A 3QEQE 3U7YH 4P5MA 3DX9A 5IV2B 4MDIB 2QHRL 2H26A 2FX7H 4PRBA 2VNCA 1LDPL 1ZV5A 2DQTH 3IETB 4OZHA 3BP7B 1JRHH 2VXQH 1BFSA 3GSXA 3KPRB 4O9HH 1A7NL 4ODWB 4LKCA 5GGTA 2DQIH 1ZE3C 1I7TB 1P4LB 2I9LB 1OAZH 2FL5A 1QQDA 1UZ8A 3HI1A 4RMUA 4WHYH 3ARGA 3OHXA 5EOTB 1Y18B 1YYMH 4LLYB 2IADA 1F3RB 5BZDB 5E5MA 5I66B 3F8UB 2W0FA 5IHUL 3RVVD 7FABH 3ALXA 5GGQL 4LARH 1QPXA 3MLUH 4U6XB 3DMMC 3IB4A 2B2XL 3TCLA 2D7TH 5CEYA 2FWOA 5E56A 3RTQC 5HYJE 3VFSA 5HYQA 4M8QB 5FHBL 3DSNA 3DXAB 1JRHI 1KLUA 1LK3L 3ZKSD 2VQUA 5EU7C 5IEHB 5KN5A 2AAVA 2Q76A 3QCVH 3EZ8A 1T0NA 4LMQI 4MNQE 2AV1A 1PQZB 1ZHLB 1BD2D 1HZHL 2FX8H 4GG8A 2ZCHL 5E2WL 3BQUB 2J8UB 2BRRL 5IF0B 5KVEL 4KDVA 4XP1H 4PTTB 3VFOB 4LGRB 4D2NA 4F7CB 2DQHL 4AEIL 2E9JA 2B20A 4NKQB 1F4AA 4WU7A 2YPKB 3EYUH 4PJ7E 3FRUA 5EU7E 2QQKH 2XQYK 3OXRB 4HWZA 3GIZH 4TUOB 5E9DE 1O7VA 3SDAB 4D0DB 1OARL 4EQ2A 5BVJA 4P2CG 4X6EA 3CAFA 1RUKH 1T2QH 3RVWD 5BOPA 3C60D 2OZ4H 4G6JH 4HIEB 1TVBB 3NMEA 2F58H 2E7LA 1HYSD 3IAPA 5GGUB 2BNQE 3SGEI 3V5DA 3O11A 3LB6D 1U8MB 1R5WB 3CSGA 3MFGB 2XWBA 4C83B 2ZKHL 3B9VA 4EOWH 1WVZA 3U9PH 4MA3B 3N1PC 3MZGB 2EXYC 2ICWJ 1MY7A 2F5BH 3NFPB 2VAAA 1AD0A 3ILQC 5CZXC 4FZEH 5J1AA 3B4NA 3G6AA 3IU4L 3QQ3B 5CINH 5CD5C 5FGSA 3QDGD 4XPAH 1F8TH 1YYLH 2OXHA 5D5MB 5JUEH 1GL4B 2FEEL 3PP3K 4NNPL 3LEYH 3RY5A 3O9WA 5DJYA 3OG6B 5ENWB 5D1ZB 4M7KH 5TFSH 4K8RH 3DRTB 5M95B 5D2LF 1CD8A 3DYMA 4N0CC 4R2GC 3V4UH 3FO0H 4ZS6C 4QWWC 4Y2OA 5ESVA 3ZHDA 5L7XH 1F11A 1B90A 5EORL 5EU6B 1I3GH 1YC8A 3G5ZA 1QRNE 1BD2A 3QA3B 5EN2A 2MHAA 4LASL 5FUCC 4ODXB 3L3KB 5I6XB 2VLRE 1FHGA 5DK3A 1KCSH 3SDXE 3BPOC 1RI8A 1ZGLA 3BMWA 5DQ9A 5JXAL 5GRVL 3EGSA 3CFKB 3AMLA 5EU4A 1K8DB 5F7WC 3O41A 1KTKE 2E9WA 5L9DL 2ESVA 4Y2DC 1A9EB 2HN7A 2ERJB 3O4LD 4JGMA 3CLFL 4QHUA 2PN5A 4K3JL 3RKDC 5DA0B 3I50H 3T2NL 3WO4B 1QEWA 1JK8A 3GBML 4IIQC 1II4E 5FO7A 2J6EL 5GISH 3SY0B 3BJLA 1CLZH 1J18A 3WHE0 1YQVL 5FUCE 4NRZB 4WEBH 1UACH 3RWEA 3KYMB 4YDIL 1I9IL 1UVQA 4JR9H 3BUTA 5DEZA 1K6QL 2Y5TA 2XZQH 1OPGL 2DLIA 3OZ9H 2MSPA 2IANA 3LRHA 4RGNB 1F6FB 3PWVA 2Z8RA 3U0TB 2BVYA 1J11A 5INDB 3BXNB 3MYJA 1YEHL 3KWWB 2ICCA 5FA3A 1IQWL 1OAXH 3QDGA 1KN2L 5HHXH 5IFHH 4DEPB 5J7CC 2F54A 4GRWE 1T1XB 3S37H 2VABB 4K3EL 3F5WA 4JFEE 1J05A 4LCUB 3NA4A 3IFNH 4U1SB 5ACLA 4XWOD 3TBVB 3GHBL 3UJTH 4OLVH 5J6GB 5FIEA 2NY0D 1D5MA 3ZDXF 4DKEL 4HPYH 4FQHA 4G7YH 2M26A 2AJZB 5KTEH 5IG7A 2APBA 2VKXA 1ZHBA 1VCAA 3IXAB 4P46B 4U1GB 5I30L 3BT2L 1DLFH 1T21B 1IM3A 3B5HA 2NY2D 3S7GA 1NCDL 5L8LB 4K9EH 1I3RB 1QYGL 5J13C 4V1DB 5KSAD 5F96L 3D48R 3TNNA 3MLSH 5CAYB 3Q6FB 1GGUA 2H3NA 3EOAA 4CMHB 2SEBB 5GSVB 2BOBB 5ITFB 3RVXD 3T65A 3OTTA 1U8OB 2XZCL 3HUJF 4Z78A 4Z76A 2DM4A 1QKZH 1IGCH 3MBEC 1KB5B 1HYRC 5KVFH 4FZ8L 1UWEL 3VCLB 4X6DA 5LGHL 3IDMB 3BGMA 4AMKH 4UDUA 3O6LL 5DS8B 4YHKH 2VAJA 2C1PA 3WFDL 1BX2B 1JPFB 2HJKA 4U1JB 3LHPH 3MBXL 3PGCB 1FH5H 4PP2A 2AKRA 4R8WL 2Q7NA 3KPOA 1JHTB 4Y1AE 1MFEH 4CBPA 1S78C 5FYLE 5JDJA 1IQDA 2J12B 3BAEH 1RULL 3RWGB 3SKUD 3UROR 3O0RL 3D18A 5ABDE 4KROD 1MCHA 2NMSA 3D3VB 1HH9B 2D7TL 4L4VD 2VDOH 5C0CD 1JNJA 1P7KA 3MCLL 3Q1SH 4P2QD 1NLDH 2BSTB 2EDHA 2P8PB 4U7MA 1JYXA 4Y4FD 1QOKA 5GGRY 3ZZ1A 1BFOA 2IPKA 2R0WL 3V6ZA 4R7DA 1R6VA 3JUYA 5E8NB 3VXSD 5JW3L 1S9YA 2LVEA 3UJJL 2VDLH 1IFHH 3VXTA 3HMWL 3RVUC 4Y4HA 2BZDA 5ACMA 2Z93B 1OTTC 4NN7B 3OPZL 5JOPE 2N7AA 2EDKA 2FHCA 1LEKB 3CUPA 1WC7B 5KSAA 5DJDA 4NPYA 1T3FB 2PYEB 3TO2A 1X5KA 3MYZA 1ZLSH 4C54A 5EWIH 4P49A 5DD3H 1UM5L 5AYQA 3TN0A 4RIRB 4C55A 3MNVB 3LSOB 5HDQL 3EYUL 1T22B 1L0YA 5FK9B 2DF3A 3X11B 2VH5H 2FEDC 4HC1L 3RBSA 3GSWB 1DQJB 1AD9A 1T2QL 4PPTA 5D7SH 4IS6A 4MXQC 1ZSDA 1UM4H 5KBNC 5IBTH 4FFZH 4YAQA 3IDIA 3LIZH 5HYIA 3NGBC 2ZSWB 4L3EB 2B1HH 1M1SA 2OYPA 6FABH 1P7QD 1H3PH 4J23A 4KK5D 1G1CA 1R0AL 5L6YH 4I0CC 5EO1A 2CMRH 4KJQC 4DGYH 1F4WL 1F4XH 4LHQB 3ULVL 2V17L 4XBPA 1CDCA 4PJ8D 1A5FL 2H32H 4GAJH 4N0FB 4JO1H 4A6YB 1BZ7B 2V5YA 4LSPH 3RWDA 2KQNA 2OMBA 4L4VA 1HQ4A 5JUEL 1TNMA 5FKPB 2YUXA 1JJUA 1N5YH 4P2QA 4UIKL 3DHJA 4F7PB 4WV1A 3LY6A 5KS9E 1J8HD 1A6TA 2DQJH 3P4OA 1Q9OA 1EV2E 1U93B 2IPUK 4RX4D 4HGWB 5CKGA 4BQ9A 4Y7MA 5KSUA 3OKMA 3W2DH 4ERSH 5I1JH 5IUSA 4OCRH 2YD2A 3SE8L 2C4XA 4UV4L 2GSIB 4YDVB 4AL8H 1MREL 1IBGH 2IFGA 3BH9B 2X2YA 3KHQA 3U9UB 4X6FA 2Q1EA 3I84A 3S3PA 1Z6JT 5J1TC 2CSPA 3E0GA 4JDTH 2YBRB 1N8ZB 5D7IB 1CGTA 5I1IL 3HC4L 3FJTA 1CDJA 4RAHA 6CGTA 1WSST 3SCMD 1S7XB 1CE1H 1RUQH 4TPRH 1SJVA 3NFNA 5AYUH 1RZJH 2B4CH 5HSFA 1UWXH 3U46B 4MAYB 3H3PL 1S3KH 5C8JA 3BN3B 3MFFA 2JIXB 2F9BT 4XCYB 4WO4D 3QUXB 5ISZB 4TVPD 1UM6H 3LN5B 4G6AD 4CKVX 1JNNL 2Z8WC 4MCYA 4Z8FL 3PWPB 4WEBL 1INQB 3Q2CA 2I60H 3LQAH 4J8RB 4JPKH 2DQCH 1P7QA 4XCEA 3STLB 3T8XA 1U8QA 1KYOK 4BELD 2DYPB 3L9RB 4HMCA 4U6VL 1QFWH 2BNRE 3L3HB 4U1MA 2B5IB 3SDCB 3BJ91 4OZFB 2O5XH 5F9DC 3T4AA 1RHHA 4BM7A 3W9EB 4U4BA 3MRDA 4UU9B 1FE8L 4EDXB 3RNKB 2AI0H 3UPRB 3FT2B 2KPNA 5FYKE 1J5OL 5IVXE 1YNKL 1JI2A 2X89D 1VPOL 3OKEB 2CIIA 3C5JA 1IGTA 4X8XA 4FQPA 5B8CC 4PJFB 4P2OB 5D9SB 1MLCA 5GIRA 3UJTL 3QO0A 4DN4H 1X6LA 3AREC 5FGCE 3ALPA 4FHBD 1ZA6A 2MCG1 5I73B 3CX5K 4HPYL 2FX9H 5L2JB 4HJ0C 1XGQB 4MVBC 4XBEH 3NFSH 3TYGH 3QNXA 4JDVA 1LD9B 4R26L 3N50A 4ZXBC 3MLRL 2VLKB 2DWEB 1HI6A 4IRSB 4WI8A 3VI3E 3GIVB 1TZGL 2APVA 3RL1A 1RK1A 3WXVH 3RGVC 5L8JB 4K23H 3DOSA 2BHZA 4IEFB 3MLSL 4Z6AT 1IT9H 3K7UA 5FYJU 1IGIL 4HCRA 3GO1L 3ARDD 5J4MA 5ALBL 1D5ZA 3TPUA 3GB7A 4BK5A 1TCMA 2WZPD 2CRMA 3QRGL 3BUYA 3VXPB 3AUVA 3CXHJ 1P2CA 1LEGB 1XF5B 4NSKB 4HUXA 2FJGB 2QJDA 5DD0H 3TBYB 4KK9C 5I16B 3MLVL 1C5BH 2HT4D 1TVHA 4QXUL 3BPCA 3OB0H 4FQLL 5A16B 3MJ9H 1GVIA 1HXYA 3LKRA 4Y16D 3QUMA 2VUYA 2C4FU 3VXME 4K7PH 1XF2B 3R06B 2ZCLL 4LEOA 4LLWA 5AZ2H 1C7TA 5E6IA 4HW6A 5KVMC 3QXVA 1ZLVK 2BNUB 2A0LC 5GGTH 4G5ZH 3QPQC 1EFXD 4IRJB 4JFDA 4OB5H 3MTRA 3VW3L 3DURB 5FKAA 4HULB 3NVQA 4LHUB 2B1AH 1U3HC 3L5WB 5J11B 3FQNA 4W6WB 4OLUH 2W0LA 1LE9A 3O2WL 1BP3B 1UEMA 3ZKND 3I6GB 3RAJL 1NQBA 4BSVA 3O8XC 3MXWH 5CEZD 4FP8H 4KJYA 4YDLB 2ZZUT 1KUMA 3EO9H 1KJ2L 4YHIB 2C3WA 1JWMB 1YEIL 4XPFL 4OIAA 4KI5F 3PL6D 5J57B 2JJSA 2XIDA 4A2MA 4QTIL 1TQCC 3BE1L 3ZL4L 2HRPH 4XVTH 2YSSA 4EEEA 4HWBA 5C0DB 5I75C 3V6BR 5F7EL 3QG6B 5GSRA 3BKML 3U1SL 1R5IA 2X4SB 3MUGA 4L8DB 3HNSL 1FJ1B 2XPGA 4Y0GA 3LIZL 4A2LA 2VOTA 3AM8A 2ZCKH 5MEND 1FP5A 2FH8A 1U42A 3TO4C 2W0KA 3ULUD 2X1QA 5KSBA 5F6IC 2JELH 4DW2H 4F7MB 2AXFB 1L6ZA 1NC2B 4JHWL 5JXED 1JV5B 2AV7B 2EDEA 4GAJL 4ZFOB 3TVMD 2Z91B 5KOMC 1F3DJ 4S11A 4WEUD 5F3HB 4G8GB 4PLJC 4P4KB 2YPVL 4QRRD 5I1AB 5T5FL 2JCCF 5SWZD 1J8KA 1YJDC 3DX7B 4KQ3H 4M6NH 2ZG3A 3IKCB 3L5XH 3L3OA 3BKJH 1P1ZB 2NY6C 1MJJA 3LPWA 5I1GL 1F13A 3TZVB 4RAVA 4J3UA 2I5YH 3DV6A 1MLBB 4OCSL 1VERA 3B9KD 3CK0H 3V0AC 2G75B 2YD6A 4QRTA 4X7CC 4K7FA 1AO7A 1J1PL 4QRPB 3EUUA 3V79C 5FO8A 2P24B 4MD4B 5EZOL 5FO9A 4E42B 5GGVY 1HILB 5E99L 3OV6A 4XNUL 4U3HA 1NJ9B 4H1LB 43C9B 2YKLH 5F93C 3UTZA 1ZVHA 3OR7A 3IDXH 2D9QB 4RMWA 3IFOB 1CLYH 4PJBE 3HE6C 3FN3A 3F58L 3OAZK 4B5EA 2GFBB 5FCUL 2RFXA 4TSBH 1FFNB 4E41E 3L3IA 5IW6B 3WNKA 1TFHA 5EFIA 3PHSA 4N9GB 2RGSA 2NY5L 4ZNEA 2X42A 3TVMA 1I8KA 1CDIA 5K9JH 1KOAA 1F3JA 1QR1A 5SWZA 3C2AL 2ITDB 1T89C 2DN7A 1I8MB 5JDSA 5SX4I 2ILLA 1IM9B 2DM2A 4P2RA 3UTSB 2EDDA 5TPWL 5HYSB 1NLBH 4HKXA 5ACZA 5JNYA 3HE7B 1QO3B 2PO6B 3AS0A 4NZRL 1NFIA 1MVFA 4ZAKC 1A4KB 3MRFA 2GTWB 4XBGB 2EDYA 3E3QC 3R0MA 4FQ2H 1FL5A 1KV3A 3ISWA 5HGAB 3SPVB 4I4WA 4KKBD 2J8UF 4XH2B 2AXGA 1MVUA 2A83A 3KPQB 4NRYB 4JN1L 3KPMA 3EOBA 4HIXH 4C4KT 3T0WA 5DGQA 5I74C 3SO3C 1FDLL 2YPLB 2FLBT 4DVBA 2OL3B 1WT5A 5D72H 4K23L 1A6ZB 4CUCA 4K71B 3N9GH 3S8WA 1OSPH 3FB8A 4X4ZA 2W91A 5BRZA 1U3ZA 2IMMA 5HHVL 3E3QE 4LMQE 5EUKB 4JG1H 1LGVA 4WU5B 3QEQB 3ARSA 1AGBA 1NGQH 1WQVT 3MO1B 3M1BB 4MZ3A 2ADGA 5E2JA 2HJLA 4POZD 4HJJH 4XVUC 1MI5E 3MLWL 4OD3H 3LKSB 4DGIL 4OD1L 5DLMH 4Z0BL 4LOUC 4UB0H 2JJTA 2V9RA 3MGTA 4M48H 5GZND 5ICZA 1W0YT 1T20B 5D5MF 3X17A 2WM0A 2AK1H 4N1CA 3AS2A 1NBYA 4ZDHB 3IFLH 2F19H 4XRCA 4YHLH 5FOBA 1CD9B 4J7RA 4MSWB 3L1OH 2VQ1B 4MA7H 5L88L 2X05A 1PZUB 3DUUA 2BRQA 4NM4L 3QEHA 1FZOA 4PR5A 4DWHA 1I7RA 3CMOL 1MFBL 4OB5L 2VR5A 3KLHC 1LVEA 2Z31D 2OXGA 4MA8H 3MRMB 5IBUB 4PD4J 1T6VN 3RIAK 4ONGL 4EN3D 1NDMB 2B1AL 2YN5A 4YHPA 2BCKB 4BQ8A 2D3VA 5CKAA 2R1XA 3VG0H 3P73A 3V6OA 2IBZY 2VTFA 5A1AA 3V4PL 2A6KA 5C0BA 4Z95L 2P5WD 4H25B 5D71L 3LRGA 5FDWB 3IVKB 2GK0A 3PWNA 4MNQB 3MLTA 2VLMD 3MRBB 4YDJB 1EJ6A 4PJAE 2OP4H 5JPNA 3WS3B 3ESUF 2EECA 4JHAL 4NM8L 3CJJA 2VIRB 5C6PB 3JUZA 5K9KB 3FT4B 2O5ZH 1DFBH 2PCPA 3SQOL 4H20L 4O4YH 1O7SA 3DMMB 5IB5A 1VEPA 3K4ZA 5DMGD 4PGDB 2Y07H 1B0GA 2XRAH 1A0QH 3RTQB 1HOCB 5HGBB 4F3FB 1A4JA 3RZCD 4OF3A 5AUMA 1QBMH 2AK4A 3KYKH 4U1LA 4PJ7B 5C0RL 2AXHA 2BSED 3O6FD 5DURB 3WN5A 1BFVH 1NAKL 1UB6A 5E9DB 1JHKH 3QIBB 2H6PB 1FZMA 5C08B 3PXJA 1G7IB 3QNZB 3VH8B 2I26N 4G6KL 3KPSA 1U92A 4YDKL 1Z0NA 3BO8A 3ZMRA 3EYQD 4NO0B 2ZCKL 1X5LA 2BNQB 2C1OB 4HV8B 1OB1B 1INDL 4Y5YA 2OTUB 2Y5EA 1PSKH 1CICD 1IZJA 5SX5K 3PIQB 4R96A 1I8LC 3ZKMD 1D5IH 4U1HB 4WDIB 1KEMH 5DSCB 5I8OL 2C3HA 4GKSB 4XPTL 2FYYB 2Z31A 3H9SD 3L5XL 4Z9KB 2ADIA 3S97C 1V7NH 3C8KB 3KPNB 4M1GL 1UA6L 2VXTL 1U8PB 3S3JA 4HXAH 1KNOB 4M5YH 2NCMA 3MNZA 4IOSD 4CGTA 3VFTA 1GZQA 5H94B 4YBQD 3OKYA 1NFDB 2P5WA 3EYOA 3PE9A 3CK0L 1TJIL 4XMPH 1HHJA 5IB3A 1ZEAL 1U8NB 1G7QA 4EI6B 2X1OA 2M8XA 3MV8D 4XZUA 4U2ZA 2VLRB 5E8DH 3ZYZA 4XXDA 4U1KA 3SDXB 4LBEA 2ICWA 1ZGLP 1KPRA 2IH3A 2I27N 4KC3B 4R0LA 2M2DA 2X09A 2HFFB 3TJHC 4HQQH 3RZCA 4XVJL 4LCWA 4R2GB 2MMXA 2HH0H 1B2WH 3LH2L 3O6FA 3GJFK 3QDMD 3MLYH 4LSVH 1GZPA 1UB5B 3CCHB 1IZKA 3UX9B 1F4YH 2E27H 5MEOB 1QLFB 1GGIL 1RZIA 2P43B 4WI4A 2EXWD 5T5NG 4DZBB 4HH9A 4NQVB 5J6HB 3MA9L 3FO2A 4YBHA 2HFTA 3H0TB 3QPXH 2NY1D 5CP3A 3EOYG 1CICA 4AEEA 3TT1L 5D2LA 1ERNA 1W72L 4GKZB 2PXYD 4K9EC 4AYFA 4YHZL 1VEMA 2NW3A 1PG7L 1YY8A 2IMNA 5IESL 4GAGH 2HFGL 3Q3GB 4Y2DB 4J3VA 4ONFH 4GUPA 5B39B 5DRZB 5ID1A 1BZ9A 3PQYE 1KJMA 2NX5A 4LFHG 4RMVA 4IIQB 1L0XA 4K3DH 1FO0L 4JFEB 4XNMB 4XI5C 4NFBA 4QNPF 5I0DA 5CIPB 4XB7A 1R3LB 4OZIA 4XNYH 3ALWA 5TE6H 5DFVD 4JPWH 1N0XH 3QQ4A 2HLFD 4UAOC 2NYYC 3GMPB 1D6EB 3VRJA 5LWYH 3M07A 2VDPL 2VUOA 4Q97A 4L4TD 5CGYC 4N90D 5GGSY 5JIPA 4BH7B 1MCOH 1P4BH 1UWGL 4UQ3B 3T0VA 5ESAB 1S9VA 4OFKA 4TULL 1CXIA 3L7EA 4HKJA 4Y5XA 2X41A 4KHXH 4WHCA 1VACA 3QUYD 3L95B 5EOQL 5JMRA 2BVQA 4LNVA 1G7LB 1JGEB 3BDXA 3U2SB 3S35X 5HYEA 3QDMA 3JVGA 4Y4KC 1UXWB 3NZ8B 4JG1L 5IMOB 5F7HA 1XEDA 2YXMA 2BY1A 5FF6B 1MSPA 3PDOB 3V0VA 4XT1C 5LCVL 5EZJA 3LDBB 3I02A 3MRJA 5E7FA 5E7BA 2YMXL 2EC9T 2I24N 5DLML 2EKSA 4YJZL 3QRFM 1I1AD 1MFCH 5DO2C 4HCRH 2X4OA 2Z0BA 1EAPB 1BQHA 3KR3L 5CJXC 3KPTA 5D96C 5DD1L 2MCPH 1C08B 1AXSA 5J13B 2PR4H 4XVSH 2AQ1A 4HXBH 5MP6H 4E5XB 3V7MA 2E6PA 4Y1AB 1FN4B 3L1OL 3UPCA 5GJTH 2VL5A 5A43C 4ZUVB 1UKSA 4ONHA 1UGNA 4XCNB 4N0UE 3QUMH 5EU3A 2GI7A 3S9DB 2HVKA 4M7LH 5CCKL 1I9RL 1EJOH 1XIWC 1VFOA 1KIRB 4QO1A 5F89A 5BS0E 3VFWB 5I71B 2GK2A 3FO1B 3CVHB 1CT8A 4XP5H 3QDAA 5D7IF 1YZZA 4L4TA 1NCCH 2GT9B 5IB4B 3HUJA 4ZFZB 1D9KC 4OLYL 4YGVB 1WK0A 4N5UA 2H45A 1OW0A 4PJCB 3QH3A 2DMCA 4WUKL 3STZB 1DUYB 1UFUA 3K8KA 1QBLL 3VFRB 4ODTL 4MQ7B 2H2PD 1BBDL 3MMEA 4KZDH 3K2MC 3MQIA 4OQ1A 5HVGB 1NAML 3BIKB 5JR1L 3GI9H 3HPJA 4FQJH 3TEUA 1LO2L 1FNGB 3LKQA 3LQZB 4JM2C 3KLAA 3KNBA 4HEPG 3K4AA 2AJVH 1XFPA 3DROA 4BZ2L 4G43A 3U79A 5D8JH 2IC2A 1DQTA 1XR8A 4PJXF 4Z0XA 1MHHB 1FNEA 1ACYH 2VITA 1XGTA 3NTCH 3UBXB 3EDKA 2HT3D 4HWBH 1RJCA 4PGBA 5FUOL 1BM3L 2P45B 3FOLB 3JWOL 1PSKL 4Q9QH 2Y23A 1RZJC 1MRDH 4MJID 4OFVA 3KYOA 1LE5B 3IDNB 3SKMB 4QHLB 2EIZB 2OR9L 5IB1A 5D1XC 3S5LG 3P30H 5DZLA 1ZT1B 4DN3L 1CCZA 3T1FB 4QOKA 5ALCH 3VMPA 3QCUL 3KJ6H 3QDJA 1LO5B 3L3JB 3HLAB 1YNLL 5GS2H 3LQAC 3O4OC 1KPVA 3HN3A 1FZKB 5IOPB 4Y19E 1D5XA 3VWJA 5DRWB 1I85A 4HPOL 4NDMA 5KS9B 3NGBB 1N4XH 2A2QT 4JRYD 4R9HA 5C0AE 5IVOA 3ARFD 4LNRA 5KZCD 4WVRA 3BDYH 1DLHA 3VGHA 3U0WH 5J56B 3CGTA 1RZ7L 1A6VL 5E8DL 4XTRC 5DJXA 4Z7OF 2CIKB 1ZT7B 5EBWA 1I1RA 2DQDH 5HI5C 4NWTH 2QADC 5HHOD 5C07A 5CEZH 4OZGF 1A6UL 1XZ0B 4OCNC 3TYFB 5FM5M 4PY7A 2EZ0D 3TIDB 3P0VL 4GW5A 5E8OA 3UAJC 3BOVA 2V2WA 3SN6N 1BEYH 5C0GB 5IMMB 4AENB 3NN8A 5GGVH 1KB9J 2RQ8A 1UZ6E 3LZFH 3RPIA 3CH1B 3QI9A 4M02A 3WLBB 1JP5A 1HQRA 1KIQB 4L8CB 1KJVB 1NANH 1QSEE 5DVOA 1Q0YL 5SWSD 5SWQB 4HIIA 3EHBD 4F2MA 3K3QA 5ILTH 2HKHL 1HKLH 4OT1H 1PFCA 5DRXB 2FBJL 5CWSA 3W9DB 1S7RB 2BNRB 2BVOA 4K3GA 1PX4A 3CFDA 3C9NA 5EPMA 3OR6A 4ONFL 4X7TA 1BQUA 2HFEA 4KZEL 1XH3A 1H3WM 4U1IA 5IVXB 1S7TB 1ZT4B 2WIIB 1SYSA 4APQA 4PJHA 1A02N 1LO4H 4FNLL 5EOCL 3VFPB 2R0ZH 3ZT6A 5IR1A 1YEJL 3FFCB 3OKOA 3GEWB 1G0YR 2OTWB 5FEBA 4YXLL 1YNTB 3WXWL 4P3DB 1MF2H 4JRYA 4O51A 3HHRB 3ZDYF 2VZTA 1C5CH 1IGYB 3ARFA 5FGCB 1NANI 5GRWA 1ZWIB 3QFJD 1H5BA 3RX8A 1CI5A 4ELKA 4LIQL 4ETQB 3VFUA 4IJ3C 4LAJH 1MCOL 5KG9B 2ADJB 3WNMA 4ELME 5I1HH 3C6SB 1X44A 3W81A 3VXOA 4PREB 3D0LA 1DE4A 5KVDH 2FSEA 3DSFL 5HHOA 4F58L 4ZUWA 4LF3B 1FYTE 4Z7VE 1E6OL 3UP1A 2RBLA 3D0VA 5B8CB 1J1XH 3TPKA 4TUJA 3LRSA 3RL2A 3ARGC 4Z7NF 2WBJC 2L7UA 3BEWB 3GMNB 3S96B 5ETUB 4WFGE 4RAUA 3UPAA 5TF1H 5IMLA 2BDNL 3U4EB 5GQBA 4JZJA 4RFOL 2DQEH 5I8KL 2CH8A 2IFFH 4X0KA 3VFVA 3TBWA 4OZHE 5SWSA 4ZXBB 5FUZH 3DUHA 3QCTH 2JB5L 3EYVB 3O2VH 3PV6A 4MA1C 1SMAA 4TVPL 2G60L 5JHDE 2VLJD 2VB5A 4PIRF 1JGUH 2YWYA 3P3YA 2X70A 1U2CA 3C6LA 3RGVB 2MCPL 1RUAL 1I8IA 4I3SH 1A2YB 1KEGH 1DBKH 1CG9B 1Q9KB 3NAAL 1OGTA 2OBGA 3C5ZA 3QZWB 3CMGA 3WFEL 4UIMB 4D0CB 3O6KL 5FB8A 3SGDH 1RIHH 5I1LB 1T1ZA 4ACPA 5IIEA 2CXKA 1H0DA 3NBNA 4M7LL 4HS6A 2I07B 4JFYB 3NIFE 2P8MB 5DUBB 4UTBH 3FN0H 1DSFL 4LCCA 1TDQA 2EH8L 5IVZB 3EFFA 4XP5L 5D7JB 4PJDB 1MCCA 5A2FA 1JZ2A 1SJHA 2VXVH 1AIFB 4NWUH 1A1MA 2AJUH 4JFZH 1HH6B 1E4WH 5K59E 3EOTH 4R3SA 1CDUA 1KGCE 2E7LC 3X14A 3VD7A 3GSNA 4ZS6D 2E8YA 5DK0A 3DI2B 3LEVH 1OP3K 4RFEB 4LPUA 1MFNA 1AGCA 2COQA 2AABH 4JKLA 1OCWH 3E6HA 3MGOA 5E4IA 4GRLD 4PUBL 3WE6A 1ZLUK 3GKWL 1NGXA 4IHOA 4JJ5A 4O02L 5HHQB 5F1NB 1U3HB 1P9MA 3NCYP 1FLRL 1C7SA 3I3DA 3U4BH 2GJZA 1SBSH 5ID0B 4JLRA 4F7TB 1KN4H 2G2RA 1MPAH 4RNRA 3WS6A 3CH8A 3QHFH 1FIGL 1A6WH 5B3JE 2X7LA 5JHLL 2ZUYA 2W60B 4EDWL 5JO5B 3MJ7A 5DHYA 3CFJA 1BJ1H 4N8CL 4PGEB 5DQJB 3IS1X 3FT3B 5IQ7H 2Z8VC 4PY8J 4QCIB 3ZDZE 1U95B 5I75B 4KTDL 2UWEB 2R56H 4HUNB 2NW2A 4O2FA 4GBXD 2CDFB 4O2CA 4ODVH 4QRSA 3MRNA 1NEZA 2UZIH 4N0YH 2C3VB 3BZFA 4MDJA 1LMKA 4G8EB 3ECBB 4HK3J 1SEBA 5EC2A 2OX5A 3C60C 3WIHL 1YDPB 4ALAH 4LLUB 1HYSC 3MACH 5C09A 3THML 1BD2E 5F6IB 1S9XA 3TNMA 4RA0C 3UXFA 3HZKA 4P5KB 3LB6C 5AG9A 5ANME 5E2VL 1EFQA 4OQTL 3D85D 3RKPA 4WJ5B 5DDHA 3MRQA 2XTLA 1T7YA 4PJGE 3P77B 2AGJL 1MCNA 2ESVE 2AVGA 2NY6B 2P5ED 3P9LB 4XNXH 3GMMA 4F57H 4BFIA 1NCAL 4URTB 5HPMA 1YUHA 2DM7A 2B39A 3QUKA 2BHYA 4HIJA 1V5JA 4PJBB 1F90L 4CMMA 4K94L 2JCCA 2BX5A 4S2SA 1A7PH 2ED8A 2CDGB 1KPUA 1JN6A 2ICEA 4JRXD 1A21A 4E41B 3T2PA 1OY3B 4PLOB 1EIBA 2HG5B 2GJJA 2XZAL 4X7EC 5I8CA 3KYNB 9CGTA 1T03L 1OOAA 5F1KC 1ZHKB 3AROA 3TBSA 4OUOA 5I15L 3EJYD 3L7FA 3QDGE 4CVXA 2V6HA 4RSVA 2A6DA 3H42H 1T5WA 5HGDA 2F54E 3DX6A 1IAKA 4XX1G 5CP3H 3SJVA 3ULUL 1JL8A 2F53B 4GBXA 1RJYA 2CLRA 1LO4L 3BESR 3HE6B 3ZSSA 2R0ZL 1DVFD 1GHFL 4JAMB 4MDIA 4FFVC 3HCVB 2X40A 35C8L 3CVIH 4FXKB 4KFZC 3IETA 5I9QC 3BP7A 4OBRA 2ICWI 1GOFA 1MRFH 3RWCB 1S78D 1FVEB 4WHDA 2IH1A 3CSYB 4ODWA 3PDDA 2K7QA 3H9HB 2H8PA 3NPSC 1P4LA 1KIPA 1Q9LA 3B8SA 4NOFA 1U8KB 4XAWH 4TSCH 1UXSB 4UOJA 1A7QL 1X7QB 2W38A 5KVDL 4U0QB 2IAMD 4LLYA 5BZDA 5I66A 3O4LE 1G6VK 2WQRA 4LPWA 1GC1L 3RUGE 4YHYC 2YA0A 3U83A 1AGDB 2WUBH 1P7HL 4ZAKB 4JM4L 4KVCL 4OLWL 1U6AL 3IDGB 2G5RA 1S5HA 3IDJA 3DXAA 4XWOC 3EO1A 3EDJA 2AQ2A 4OAWB 4JPVH 2R4RH 1YEKL 2NY0C 5EU6D 5F9AC 4X6DE 3PP4H 1MI5B 2OCFD 3QSKB 3SO3B 3RPKA 4Z7QF 3G9AB 3VMOA 3QEGH 4RMRA 3S37X 4GXVH 3BWAB 5TDPB 3P4MB 3BQUA 2A9NH 4K3HA 2J8UA 5IF0A 2OQJB 4ZYKB 3VFOA 5JW5B 4M4RA 3REWA 4F7CA 1BQSA 2FGWL 2ITCA 1CGSH 2NY2C 3U30C 4ZO6A 1RHFA 1NFDF 3NA9H 4R97B 3WFCL 4P59L 3BP4B 2YPKA 5KSAC 1HNGA 1QVOA 4YHMH 3OXRA 4KVNL 3ZHLA 1JNHB 2ZSVA 1IC5L 3QULB 4D0DA 4EBQL 5DJZB 3RVXC 2W9EH 3S34H 3TN0C 4HIEA 2FATL 4XMKH 1JNLL 1E28B 3OAYH 2NY7H 3SDXF 5GGUA 3JWOC 4QTHB 5A3ID 1REIA 1R3IH 5DD5L 1MHCA 1U8MA 1R5WA 4WI9A 3EO0A 4C83A 1ROWA 2CK0L 4ODHL 1Q94B 1QTYT 2I25N 3NFPA 4WWKD 5TH2B 5DMIL 3HI6H 2J5LC 3O45B 5E8PA 3PHOB 4PRHD 3QQ3A 2AABL 3BEVB 4JANA 3DTXA 5I1KL 1JFQH 4F33B 5D5MA 4HBCL 2H1PH 3DV4B 5B38B 5ENWA 5D1ZA 1FAIH 1D5BA 1KENH 5CMAB 3DRTA 4KROC 1YY9D 4BUGA 5HJ3B 3P4NB 2HJFB 4UNTA 2AJSL 4DQOL 5EU6A 1RIVH 4PG2A 4OSUH 3PABB 4ZODA 2LABA 3HC0B 4WV1C 5EUOE 4YUEL 5DT1H 4JO3H 4ODXA 3F6IA 3FQXB 3BGAA 3L3KA 3WSQH 4HUVB 2WUCH 1NCUA 4MD0A 1JZ3A 4FFWD 2X4PB 3V0WH 2L0DA 4GLRI 4XNQA 1A7OH 4WI2A 4WIQA 1GAFL 3CFKA 4A6YL 4L8SC 4RMSA 1K8DA 3MRKB 4EXPX 5BOZG 3PGFH 1EERB 1A9EA 5IQ7L 3SEPA 4L4VE 1M7DB 1CF8H 5C0CE 3FB6B 4NT6B 5I1EL 5JIIA 3T0ED 4G80B 4P2QE 3S4SB 4GQPH 4HG4K 1L7IL 1IC4H 5HY9A 3I75B 3SY0A 1VFAB 3GSRB 4XCFH 3JTSA 2MFNA 1UYWH 5H8DA 4AEHL 3VXSE 3KYMA 1UEYA 2J88H 1HINH 4UOW1 1XGRB 1BBJB 3OG4B 1N26A 3ORJA 1MJ8H 4WWKA 3U0TA 1NSNH 3S36L 2PW1B 5INDA 2VN7A 4JG0H 4PRHA 1CLCA 4J3WA 2KZ1B 4KTEH 3ARED 1D6VL 4KK5C 4JKPL 2Q8AL 3D39D 25C8L 1UT9A 1D7FA 3HNVH 3N85H 3ROLB 3GSUB 1T1XA 3LAFA 4PJ8C 3G6DH 1XT5A 4QXGH 4LCUA 5IMKB 1W8NA 5K33A 4U1SA 1PKQB 5EIIB 3VD5A 3TBVA 4X9BA 4UT7L 4BUHA 3OGCB 5CILL 5J6GA 5ESQB 4KRPD 5JPMB 3UCRA 3S88L 4YFLI 5ITBL 2AJZA 5DUPH 4IDJL 4D3CH 1NCBL 3LKOB 3RIFF 1K2DA 5AAMA 4JO2L 2EIEA 4LSQH 3IXAA 1FSKC 4QKXB 2R0KL 5IHZB 3BD4A 5BO1L 4G6FD 3PGDB 4Q9CA 3ARPA 1T21A 3RRQA 5F71A 3QG7L 1I3RA 4V1DA 1K4DB 2PYED 4KUCD 3WDIA 3Q6FA 4WW1A 1I1CA 4HWUA 1IGJB 3SCMC 2SEBA 3SDYH 4LIQE 4ZOEA 5KW9L 1CFTB 2BOBA 1RUPL 5ITFA 3PQYB 1U8OA 1DBBL 4L4JA 2OJZH 1J8HE 3QHZH 4ZPVB 2VDRH 5GHWH 3O3AB 4PJCF 3OJMB 1FVCB 2VLLB 4WO4C 1KB5A 3T77B 5CUSL 5F70A 4G6AC 3VCLA 1CXHA 1QHOA 1TCRA 1VFBA 3DRQB 3IDMA 1OTUD 3OWEA 1BX2A 1JPFA 4U1JA 1IAMA 3PGCA 2BOCB 5HDOA 2R1WA 2Q87A 2KZWA 5ERWB 3ARUA 4GOSA 4NJ9L 4Q2ZA 4L3CB 3U4AA 2CJUL 5I1CH 1QNZH 5B4MC 1HE7A 3WDHA 3RWGA 4XMLH 5KJRL 1JGVH 4CAGA 3D3VA 1HH9A 1I1FB 2VR9A 1IC7H 3DIFA 4TVPE 2NXYC 3FCTB 2BSTA 4Q58C 2P8PA 4P9HH 5HHNA 1KJ3H 2FRGP 4PS4L 4UAOB 5EIVA 1B0RB 3RJQB 3ME0A 4JHBA 3IAQA 1KF9B 5TGBB 5E8NA 3F7RA 3EFDH 4OCYH 5BCAA 1XR9B 3O6MH 2IGFL 1FVDB 1HCFX 3RX7A 4B7LA 1DTUA 5MI0C 3P0YH 2Z93A 3BX7C 3QEGL 3OAUL 4GXVL 2XY1A 2EEAA 3DVGB 1LEKA 1WC7A 1T1YB 3WEXB 3MODH 1T3FA 1T7XA 2PYEA 4M1CD 2BVUA 4ZOAA 4Y4KB 2LU4A 3MNVA 3LSOA 2BXZA 2X5PA 4W4NA 4MLSA 4X7DC 1T22A 3X11A 4YX2L 4QHNA 4KAQL 3I6KB 2JJSC 4RRPG 4N0UB 4NGHH 3TCXA 3AMKA 1DQJA 3T2OA 5C0EB 2LAAA 1FGNH 1LWRA 4JQVC 3VMNA 4IRZH 3WIIL 2YRLA 4FQXB 3AXLB 1ULVA 5F97E 3B3IB 2HT4C 4HF5H 1Q9WB 4X9IA 3UO1H 1HIML 1JPSH 1OP9A 2R0LH 3OSKA 3AM8C 1FZJB 3HI6L 2EYSB 4N0FA 4KY1H 12E8L 1MCPH 3B2UC 5BV7L 1S7WB 3CNKA 1DR9A 2ATPB 4XC3L 4OV5B 3FO9B 1G6RA 3VDBA 5AD0B 2RAMA 3GSNH 2HVJB 1KT2B 4F7PA 1SJEB 3ARBD 1MOEA 2N7BA 3C5SB 1U93A 3JV6B 4HGWA 1TPXC 4M7ZC 3QXDB 2GSIA 5IVXF 4I0PD 3ZKNC 5A2LH 3BH9A 4F37K 4FQCH 4TOYL 4WHTA 1WICA 2XY2A 4S1DD 4S1RH 1CGXA 5D7IA 2V2TB 5GJSL 3D69A 4FQQA 1EGJA 1S7XA 3REVA 4L9LC 2DRUA 1Y0LB 3V5KB 3U46A 3R1GL 4X8JB 4TVSa 4I48B 3PL6C 4MNHA 3RHWK 4AIZB 3P40A 2D31B 2JIXA 2VZ1A 1W2KT 2WP3T 5E1HB 4XCYA 3QUXA 5MHSD 1T04B 3LN5A 5IJVB 2P47B 3RA7L 2GITA 4LSTH 1KIUA 3MRLB 4LCIL 5EU5B 2BHUA 3OKLB 3PWPA 3C8HA 4Y19B 4J8RA 2DDQL 5C71A 3VI3F 4MWFB 5CEZE 3STLA 4KKCD 1TIUA 3L9RA 1BIIA 4GMSH 5C0AB 3KPPB 4NUJA 4OZFA 4NKOB 5F7FA 5KAQF 3SKNA 4EDXA 5MERB 3UPRA 3ULUC 3WD5H 2D4FA 1ZXQA 3QR2A 4PJXA 2X4RA 3OKEA 4OBSA 5JXEC 3CZFA 1MQKL 3G6DL 5B22A 3TVMC 4NQDD 1NBVH 5F72S 4OCWL 3DVIA 4GG6F 1ZA3B 1DBJH 4H8WH 3O4OB 4P2OA 4ODUB 4RBPK 3UJIH 3ARBA 4W4OA 4J3OC 3X12A 4NO3B 4FXGB 3SE9H 5D93C 2DBJA 4OTXH 1X5JA 2X4NB 4YXKL 5L2JA 3G08A 1T66D 4PG9B 1FBIH 4CW1B 1F3DH 5MENE 4I0PA 1MHEB 1LD9A 1QSEB 3ULUE 3I2CH 3B9KC 1AKJD 4RWYL 1WTLA 2DWEA 2Y6SD 4ZNEE 2NY4D 3NCYS 4IRSA 4OLXL 1GC1C 2VO5A 4R6UA 2IG2H 1HNFA 2QADB 3GIVA 4XNZB 2R8SH 2EH7H 1FL6B 1Z2KA 1WIPA 4QRRE 5SWZE 3F7YA 1AI1H 5E1AB 2CXGA 5IW1B 5T1KB 4PJDF 4OM0H 1KCVH 5KANG 4RBPH 2FH6A 2CLVA 4HHAB 3WFBH 4Q0XL 1OAYH 3IRZA 5IT2L 5FYJD 1XF5A 1OP5H 3UTTD 2AS5M 5TQ0L 2FJGA 1AQDB 4KXZH 4DKDC 4OZGA 5F1OB 2VDNL 3LN9A 5I16A 3O2DA 4J6RL 5A16A 1HSAB 1U8JA 3QO1B 2AXJA 3LEXB 4OCXL 4G7VL 4XB8A 3INUH 3R06A 1CGYA 3WHXB 5I1DB 4ZUUB 3Q6GH 2JJTC 3BH8B 4S1SH 4ELMB 1X6NA 5LAXB 3WKML 3IAGC 1NC2D 4YNYB 4H5SA 1K3ZA 2BNUA 2IQ9H 2F15A 5DA4A 4G8GD 4IRJA 4XMLL 2AJXH 4QYOB 4PJ5D 4Z7VB 2ZUQB 3IRPX 1HWGB 1XF3B 4NJAH 4FQ1H 3DURA 4ZD3H 3TWCL 1RURL 3HRZB 5TDOB 3QIUB 4LHUA 4NBZB 4P9HL 5CHNB 1BOGA 1I3UA 2R2EB 1DQML 2H26B 3AVEA 4XP9H 4BZYA 4HDIB 1CTOA 4NBYB 2FJFB 1PG7X 3I6GA 1GGCH 4K8RD 3GSXB 4Z18A 3KVQA 4KKBC 4NHCH 2VDQL 3MV7D 5KVGL 4P48A 4QRPD 1A3LL 1E27A 3AFLA 1H9VA 2UWEF 3VFMB 4YHIA 5CSBA 1QBBA 2GJ6D 3HFMH 4DZ8B 5JHDB 1A47A 1W0WB 1QSFD 1UZ8B 4Z7WA 3VXUB 4MAUL 3ARGB 2WBJB 1HEZB 2VISB 2J4WL 1SY6L 2YK1H 1BF2A 2VZUA 2R9HD 3IJSB 2W9DL 5C0DA 4S10A 5C0ND 4P5TD 3UTTA 3QG6A 4PB9L 4YE4H 5CEYB 5DJ2A 4HFUL 2X4SA 3VFSB 4JEGB 4UILH 2V9TA 3LKNB 2CKBA 1FJ1A 3SGJA 4P9MH 2RHEA 4POZC 5D2NC 1TTGA 4MA1B 5CLTA 5KN5B 3WN5C 1J9CT 3FRPG 2DBLH 3T04D 4PJEE 1RZKH 4JY6B 4YHOH 2FR4B 2BP3A 5GZNC 3BW9B 1NC4D 5DJ6A 1JPSL 4F7MA 2AXFA 4N5ED 1NC2A 2AV7A 4ZFOA 2Z91A 4KY1L 5CJBA 4Y5YC 4M5ZL 5F3HA 4G8GA 5DGRA 1JPTH 4NHUB 4RISH 4PJ5A 5I1AA 4UQ2B 3I9GH 3DX7A 4H0HB 3IKCA 3F62A 3KDMB 3TGXA 3PUCA 5DQDL 3JV5A 1CE6B 4U6YB 3K80A 3GSQB 3TZVA 4PBVC 4U1NA 2I9TA 3VD4A 5D2NE 2Z31C 3FRUB 4X98B 4E0RB 1FPTL 4GJTB 2ZJSH 2AEPL 4EN3C 3RDTB 5BVJB 3QWRA 5CP7A 3MV7A 3LMJL 4QRPA 5F7UA 2MQ3A 2VDML 4HD9A 3N1QC 1LO0L 4N9OB 1DBMH 3O11B 1AJ7H 4NIKB 1J7VR 2G9HB 4E42A 1H3XA 2C7UA 1HILA 4KHTL 2B0SH 2MPAH 3CXDH 4H1LA 1NUFA 43C9A 4RWHA 1IARB 2VAAB 4EIZC 2YUZA 4OD2B 3OX8B 2A38A 4M7JL 4OGYL 2VSCA 4P5TA 5DMGC 4YZFF 2BERA 3IFOA 4R0LC 4PFEA 1LK2B 5DJYB 3RWIB 2BSRB 2UYLB 1WAAA 2ZPKL 3RZCC 2MWCA 1SEQL 1AHWB 1YN7B 3KJ4C 4NZTH 1DBAL 1FFNA 3O6FC 4R4FL 1BAFH 5IW6A 2P5WE 5GS0D 4MMZC 2EDWA 3G5ZB 3MOBL 2VLME 3U82B 1C1EL 3QT2A 1NC4A 1BLNB 4U49A 2EDJA 3EYQC 1WFOA 3L5HA 3E8UL 1PZ5A 3U6RB 4IOIB 1WWAX 5ANMB 1FRGH 2GCYA 1UCBL 1CICC 2QQLH 3VWKB 2ITDA 1ZGLB 4ORZC 3ZKMC 4PJGB 4BKLB 1I8MA 2DLFH 1JHLH 1IM9A 3EGSB 4P4RB 3O41B 3G04A 3UTSA 2ADFH 2ZOKB 1DBJL 5IK3A 4OGXL 3VXRD 3HE7A 1QO3A 2O61A 2PO6A 4NKDB 4UOW0 3MCKA 1A4KA 4P0DA 3MROB 1W72B 5HGAA 3UTQB 2R29L 3SPVA 4NP4L 3K1KC 5D1QD 3C60B 4AG4H 2XT1B 1ND0B 1MHPH 1FBIL 4XH2A 1AR2A 3RI5K 2BVEA 4DGVL 3KPQA 1OM3L 4NRYA 1A1NA 1ZVSB 3SBWA 4QF1B 1C12B 1EVTC 4GMTH 1JWSB 2A77H 5D6DC 2CDEB 2CUHA 1S7VB 1XCQB 15C8L 4X4XB 2YPLA 1PD6A 4MJ6B 1FO0B 2FHBA 1GGBL 2O5YL 5IFAH 3MYJB 3H9SE 1BOYA 3QDGB 4YFDB 1SM3H 4ZFFA 1LDSA 4OLZL 4Y5XC 1XMWA 2GSGB 5CBAB 5F88B 5BS0D 1IAII 4GH7B 5EUKA 4AEFA 4WU5A 3TT3L 3QEQA 5JORA 4PB0H 4BA8A 2Q8BH 4KTYA 4OZIE 3MO1A 3M1BA 4D9RD 5A40E 3JVGC 1CR9H 5DZOA 4XXCA 1EO8L 1WITA 4WCYH 3BGFB 4G3YL 1D5MB 4LQFH 1FCCA 1JGDB 4FQHB 2D03L 3GRWL 1T20A 4XHQA 3SKJH 4KPHL 2EXWC 3QQ9D 1ZHBB 3DECA 2NY1C 3FTGA 1MWAL 1XIWD 2ZG1A 2PXYC 1KB5H 1U91A 4OZFG 3H6JA 2VQ1A 4GKNB 2NR6D 1YEGL 3GGWB 4I18B 4JGJA 1CD1B 1DL7L 3O4LB 3ULVF 1CZ8H 4ZS7H 3CD4A 4IDLA 4WGVB 3RUGB 5IJKA 3QDME 3MRMA 4X5LA 5I9QB 2Z8SA 4JREC 3EOAB 4ZOBA 5D1QA 2BCKA 1NGZB 3EJZD 3O81A 5HI4D 4DKAA 1JF6A 2XWJA 3NPSB 1N6QL 2Q7YA 5I19H 5DFVC 4LLQB 4PRDB 4EUPB 4H25A 1MCEA 2QSVA 2HLFC 4YWGH 4I3GA 4UT6H 3DVNA 5FDWA 3IVKA 3EYFA 3LKPA 4MNQA 1EUUA 1MY5A 4U7SA 3MRBA 1BIHA 4YDJA 4XP6L 4UDUB 4ODBD 4TNVK 3BZEB 2D0GA 2X10A 5F9WC 4B50A 3WS3A 3NH7H 2WAHA 5K9KA 3RVTD 4DTGL 2AKRB 4MB4A 3FT4A 3QUZD 1DEDA 4YHYB 3QUYC 1IC1A 3MOAH 2LFGA 4LSRH 1ZKAA 5FYLL 3D2UD 1YEFH 1K4CB 1V3LA 5DMKB 5E5RB 1HOCA 5ICXB 3EDEA 5HGBA 4L29B 4F3FA 4JVPA 5E2UH 3D18B 4I77H 4JQXA 3OKNB 3H8NA 4YXHL 4NKIL 3WJJA 5E9DA 2VXSL 1XGYL 2NY0B 2H6PA 3QIBA 1GSMA 5C08A 1ZK9A 3EAKA 1G7MB 1G7IA 3QNZA 4UILL 3VH8A 1NL0L 5GGRB 4L4TE 5D1XD 2IPKB 4N90E 4ZFGH 4NO0A 1RMFL 4LAQH 2BNQA 4PRID 4HV8A 1OB1A 1M6OA 3HUJE 5TE4H 1RZKL 2OTUA 1MIMH 1DN2A 1JZ5A 4NCC1 5DJAB 4FTVB 4QHKJ 4U1HA 5IEKB 1J12A 1U3JA 2DLEA 2NY2B 3SDDD 3ZE0F 5IQ9B 4WDIA 5DSCA 3U30B 5FXCH 4GKSA 1QACA 5KSAB 1HWHB 2FYYA 5DJDB 5DVLA 4TRPH 4OFYA 3IJHB 5BW7C 4NKMB 3K2UL 1UG9A 1U8PA 1KNOA 2YD5A 2A9MH 4OUUA 4FFYL 2ZG2A 5HI5D 1NFDA 4G9FD 1DEEB 1ZSDB 4LHUG 1G6RH 5T3ZD 4YQXH 4Y8AA 1I85C 5EUOB 1U8NA 1MUJA 1AJ7L 4EI6A 4YPJA 2VLRA 1XF1A 5DD6B 4XX1E 5LXGL 2VE6B 2VC2H 4WENB 3O3EB 1E6JH 4Y5VC 1ADQL 1QRKA 1CBVH 2HFFA 2H2PC 3WNLA 4KROB 5BJTB 1YC7A 4QOKE 4GKOA 5C0CB 4Q9RL 4PP1D 4P2QB 1UB5A 3CCHA 3GNMH 4Y4FB 1QLFA 4WV1B 3F65A 1EGJH 1ZLWK 4G8IB 5AWNH 1Q9OB 4PRIA 4RMTA 3VXSB 4NQVA 4DZBA 5J6HA 1RSFA 5CZVH 5HXMA 1Q1JL 3H0TA 4GRMB 1AE6H 5BQ7B 4GKZA 1RUMH 4L8SB 4I9WD 4X6FB 1K3IA 4XPHH 1DQDH 1M05A 3Q3GA 4Y2DA 1CDYA 2QQLL 4RFNB 3VU2A 5B39A 5TE7H 5DRZA 4OF6A 3KAAA 4DAGH 1A7RL 4GT7A 1IAIL 4LSSL 3NFNB 2YD8A 4OZFH 4K2UH 3WMSA 4XNMA 3BIAX 1B4JH 5CIPA 1JZ8A 5C8JB 4O00A 1QHPA 1H8OA 1ZTXH 3AS1A 4APQC 4GAYB 1OD7A 2D2OA 4ZG1A 4HS3B 3IFPB 4RZCB 5CJQL 3GMPA 4XPGH 3C8DA 4LPYA 3P11L 4QT5B 2BJML 1V05A 1EMTH 2Y36H 1CFVL 3BN9D 1OT2A 5ESAA 4G8FA 3ARFC 1P7QB 1MEXH 2P8LA 3OXSB 2KBGA 1U8QB 4MJIE 3MLZL 4U1MB 4XWGH 4Q6IB 1EH9A 3L95A 1TQBC 4HAGA 3T4AB 1X9QA 3EBAA 4PJ8B 1RZFL 3HC3L 4E9LA 2CGRH 1QLEH 4U6HB 1UQSA 2NTFA 1IKFH 3L6FB 5DWUH 2XA8L 4P9HC 3U2SA 2FD6H 4PJHE 4H1LG 4NUGH 1UXWA 3NZ8A 5IMOA 3C5JB 1NDGB 4XGZB 4LRNL 1KCRH 5FF6A 2EZ0C 5JMOC 3C09C 2AJYL 2OR8A 4JFXA 2Q8BL 3PDOA 1FNSL 4LQ1A 1MCIA 1OAQH 1J8HB 4JRYE 3BKYH 4KK8D 3TV3L 2JJVA 1AFVH 3NABH 1TNNA 2FNBA 4WCYL 5M94B 2KUTA 4ZTPL 1ZA6B 4UDTB 1FSKB 5GZOD 2FB4L 1FORH 1EAPA 1ONQB 1B6DA 3MRPB 4D9LL 4JFPB 5BVPH 3EHBC 1C08A 1L6XA 3VG9C 1FIEA 3NCMA 4M1DL 3VRLE 1KCUH 1I7ZA 4K7PY 5HHOE 3HG1D 1FN4A 4MHHG 1JUFA 3K74B 4X80H 4GS7C 3SCMB 3O2DH 5GRYA 1RK1B 1P6AB 5LQBH 1TZIB 1RV6X 1BQLH 1IILE 3C6LC 3I6LD 4V2CB 1I9JH 3P0GB 1DUZB 3UZVB 3QXAB 4WO4B 3QP3A 2RB8A 1D5ZB 3TPUB 2XQBL 3HMXL 1Z3GH 3BWUC 1R5VA 3VFWA 5HYSG 1CL7I 2VZOA 3FO1A 3CVHA 5SWSE 1L9NA 3WDJA 3C08H 2OLDA 3V52H 3D6GA 1TETH 2GT9A 4ZFZA 2BXYA 4LCCC 2Y06L 5CEXA 2CRZA 3X3GL 1HHGB 1TVHB 5D7LD 4PJCA 3LKRB 3QUMB 3STZA 1DUYA 1T7WA 3VFRA 1RJLA 4MQ7A 3O9WD 2GAZA 1BJ1J 4DVRL 3B5GA 1QA9B 2V5MA 3BPLC 1VGEH 1Z5LB 5FGBA 1ZS8B 4UT9L 1FC2D 3HAEG 4X4YB 5FKAB 4M6MH 3QFJE 4H88H 1OGAD 2BSSB 4L5FL 3LS4L 2R15A 4ENED 4X83A 1MHHA 5MI0B 4ZFGL 4KK6D 4OGAD 5GS1A 5K9QG 1KG0B 3ZLQC 5FYJH 3MRHB 2E7HA 1Z9LA 4BSVB 5IFJB 1CTNA 2ESVD 1CK0H 2YD7A 3SHSA 3QB7C 3HG1A 1S9WB 3RWJB 1LE5A 5C6TL 3IDNA 4QHLA 2JE8A 1IKNA 2CKBH 5IB2B 2EIZA 1FG2B 1MFAH 2DM3A 4TQEH 4X6CB 3UYRL 3H7LA 4OZ4B 1ZT1A 1YEEL 2D7NA 3T1FA 1KXTB 3ARDB 4KV5E 5ADPL 4LU5H 1LO5A 3L3JA 3HLAA 3FFCD 4M8VA 4F15C 4RCAA 1FZKA 2VMFA 1NGYA 5DRWA 1MFDH 3B83A 2JJWA 2IAND 2NZ9D 2FECI 1O5DT 5IBUG 2A1WL 4JY5H 5GSRB 2RJMA 4OJFH 3TH4T 1G6RL 3QWOB 1A14L 2WV3A 3NCEB 2CR6A 5D7LA 5H35A 1ZANH 2VLJE 4U05A 2XV6B 3TESA 3WNOA 2F54D 4Y16B 5FM4A 5JTWA 3ES6A 3IF1A 4R90H 1RIUH 4OKVB 5F3BB 1LILA 4LLMB 2CIKA 1ZT7A 3V4VL 4P3CL 4CVUA 4H8WC 1WCQA 2JB6A 3D9AL 4M43L 3GK8H 1BGXH 2BC4A 4BSJA 1XZ0A 1EFXB 4MXWH 3UTPD 1IL1A 1KYOJ 2QHLA 3TIDA 3FZUD 3L3OB 4GRLC 5C0GA 1FFPB 5IMMA 4QHMA 2QSQA 2ZNWA 1IEBB 1OGAA 3CH1A 1AXTL 4H1LH 1KIQA 4M7ZB 4L8CA 4ELMF 4UZGA 1BWWA 5AWNL 1DP0A 3WFZA 5SWQA 5HBBA 2IBZX 5E2TL 2NQCA 3QAZC 3NZHL 4AM0A 4GSDH 3NACH 3ABZA 1FC1A 4Z7VF 4K7FB 5E95B 3VH8G 5C70A 4Z7UE 2DWDB 2FHFA 4FFVD 1T83A 3BISA 2BNRA 2QQNH 2LV4A 2DQGL 1RUML 5GRJH 4KWUA 5FO8B 1Z9OA 5EO0B 4L9LB 1YJDL 2EIBA 1QFUH 1P84J 3PL6B 4ISVB 4EXKA 4M93C 4HWEH 5IVXA 5GRUL 4CVZB 2WIIA 4GXUM 4JVUA 2R69L 3VFPA 3HNTL 3FFCA 5T1DL 4PJIF 2ORBH 3UTZB 1NMBL 3BPNC 3OR7B 4P3DA 3OL2A 3FMGH 3EYSH 5LGJA 4GBXC 3GMLA 1WBZB 1IGYA 3Q5OA 2Y9RT 3B2VH 1G84A 1OAUL 3WLWD 1ZWIA 1UKTA 5AZEL 4XPGL 1TENA 1KBGH 4ETQA 5D7JD 3L3IB 2QKIA 5MENB 5I76B 2ADJA 4LDLB 2DQFA 2C3GA 2NXZD 3DNKA 32C2A 3C6SA 4PREA 4HUUB 4OIIL 1WEJH 3VFGH 2DTML 1LP9F 4XHJD 1KLGA 3GFUA 5CSZB 1NGPL 3BRFA 4HLJA 2AP2A 3RBGA 4LF3A 3NIFF 2CGRL 1G9NH 5B8CA 4QRRB 5SWZB 1IGFH 2O26U 3S96A 3GMNA 3WNPA 5ADOH 5ETUA 1YMMD 1WBXA 3FB7A 5IBLD 5D93B 4PRPB 2EKJA 2R2CA 4Y4HD 5K59F 5JNYB 3BKYL 3GI8H 1LO3L 3MNWB 1CL7L 3S36X 3WUWB 4OI8A 1CVRA 1JI1A 3B9KB 3C87A 5L0QC 4WFED 4GG6A 1WGOA 1KACB 3VGBA 5CBEB 3VXQB 1K85A 1MVUB 1YA5A 5EZIH 4PY8I 1X5AA 5T3XH 5MEQB 2J3SA 2YXFA 2XYCA 3U7YL 3TN0D 3OKKB 1P6FA 1KCUL 2FX7L 5GS0H 5D4QA 1B6UA 1Q9KA 5C7XH 1IEHA 2P5EE 2DQTL 1JRHL 2EDNA 2VXQL 3EJYC 1Q0XH 3QZWA 4DVBB 1BQLL 3F7VB 4O9HL 4UIMA 4D0CA 1N7MH 5I1LA 3RY6C 2DQIL 5B39G 2I07A 4JFYA 5K9OB 3U36A 3L3DB 1DVFC 1OAZL 2GQHA 3DXAE 4N1EA 4NRXB 1U36A 4LEXH 5IVZA 2DD8H 1RZKC 5D7JA 4PJDA 4JRXE 1YYML 1X5IA 4PV9B 1HHHB 1HH6A 4XPBH 2HTLD 1TJHH 2HMID 7FABL 4LARL 3MLUL 1V8HA 5ICZB 1PLGH 2G5BB 1G0XA 1BVLB 2MKWA 1A3RH 2ATKB 3IGAB 2RCSH 1YMMA 2IAMC 3QCVL 1U9KA 3K46A 3MR9B 3U7WH 5JLZB 5LBSH 5HHQA 3FHAA 3QEHB 1J10A 1U3HA 3QJFB 1EEZB 5CD3B 4WY7H 4YC2C 5ID0A 1I1YA 2X9XA 3KXFB 4F7TA 2FX8L 4DCQB 4LRIA 4FQIH 4CDGC 1S8DA 2XKSA 3B9DA 1MRCH 4XP1L 2X4UB 4PJGF 3ARZA 3WIFB 5EDXA 1KFAH 1VGKB 4LDOB 4KQ4H 2W60A 3DUSA 4PJEB 1L7TH 5JO5A 1PKOA 2QQKL 2Y7QB 1AGEB 3GIZL 5HPOA 1VESA 5DQJA 1MCJA 4TSAH 1A64A 1RUKL 1MFAL 1FNLA 2OZ4L 4G6JL 3AY4A 2F58L 2HYMA 3DYPA 4QCIA 1U95A 4FG6D 4PYGA 4YFEA 2UWEA 4Z77B 1SHMA 4NN5C 3MOQA 2F53D 1B0GB 4UV7H 4QEGA 2CDFA 4BZ1H 5I17A 1MJ7H 4EOWL 4NQEB 3O3DB 2C3VA 4HAFA 3QXWA 5AUMB 3U9PL 3M8OH 4HS8H 5D2NB 5EU6E 4G8EA 3WO4C 1UJTA 3ECBA 2F5BL 4I0KA 1KCLA 2XACC 3M17B 4FZEL 4NN6C 3FB5A 1YDPA 5CINL 4YO0B 5HHMD 4XPAL 5A3IC 1F8TL 1YYLL 5FGRA 3TBTA 1UWXK 2MQCA 1RIUL 3LEYL 5HD8D 5T33H 2ARJA 4Y5YB 4QXWA 4WJ5A 4M7KL 5TFSL 4K8RL 3P77A 4RGNC 4RA3A 3GBNH 2J6EA 3FO0L 3V4UL 4WWKC 3HTLX 3GK8L 1T7VA 4G6MH 5L7XL 1I3GL 4JFOB 3P9LA 5FV1L 4DEPC 2XN9D 2X9WA 1K8IA 2VXUH 2Q86B 3WV0A 1A9BB 1V3MA 3WYRA 1QD0A 2NNAA 4IMLB 2R1YB 2IPTH 4EN3B 5H2BB 1G9EA 1KCSL 1YY9C 4JDZA 3UC0H 4L8BB 3VFTB 1EVUA 5CJOH 4E41A 4HKZA 4DJMA 4JN2B 4KGLA 3EYOB 1S7UB 3NACL 2GTZB 2HG5A 3RUGF 3A6CH 3RQ3A 2J8OA 2QQNL 1YN6B 4PRHE 3I50L 3UBXG 1ZHKA 4JPIA 1A22B 2E3VA 2DTSA 4XZUB 4FFWC 5F44A 1WF5A 5GISL 2VYRE 5EZLA 4XXDB 1CLZL 3QISA 1BWMA 4U1KB 4HWEL 1DQLH 4S1QH 3UYOD 3A67H 3T4YB 2F53A 1UACL 1KPRB 3FAWA 2VQTA 4R0LB 2OK0H 4JR9L 2XZQL 3DGCR 3RZCB 3QJHB 3U7AA 3OZ9L 3ARWA 3T0EC 1SBBA 3O6FB 3FMGL 4Y89A 5TDNA 1X4YA 1FVEA 3SQBA 3LD8C 3ZE2E 2HKFH 2FJHB 3CSYA 1OAXL 5HHXL 5B4MD 2F5AH 3H9HA 3DJ9A 5IFHL 1KBGL 4TTGA 3BI9X 4AY0A 3IU3B 5E6ID 4OCLC 1U8KA 3S37L 1ZAGA 3T2QA 1UXSA 3IKKA 2NXYD 5CIPH 4KUZH 2Y25A 1JGLH 1X7QA 1CICB 3IFNL 1RVFH 1AGFB 1T89A 4JFDD 2JK5B 4WWID 5T3ZH 3OKDB 4OLVL 3A6BH 1PY9A 3RU8H 1DN0B 3OBAA 1MCDA 4MD5A 1VEOA 3HI5H 2XN9A 4G7YL 3H9SB 4GUPB 4TUKH 3T0EE 3X3FH 1AGDA 5KTEL 3GM0A 1BZ9B 3TFKD 3V95A 3IDGA 1GCFA 3OB0K 5A2JH 1QFWI 4D94A 5MEPA 3GI8L 4OZIB 1F2XK 4OAWA 3RIAF 1DLFL 4KRPC 1CD0A 3VI4F 4OFIA 3VGAC 2C26A 1UJ3B 1KELH 1MI5A 4K9EL 1CDGA 2YEZB 4HSQA 3ULVD 3VRJB 3W0WD 4JQIH 2CUIA 4BFGA 1JE6A 3BWAA 4BSWB 5GGSB 3ZTJG 1ZHNB 3D39E 3MV8B 3CLEH 3UYPA 2YA1A 2IWGA 2OQJA 4ZYKA 5JW5A 3L3GA 3M45A 3MUY1 5E08H 1QKZL 4NN7C 4X6BA 5SV4A 1IGCL 2VWEC 3MLXH 5KVFL 1Q72H 5EC1B 3BP4A 4NYLA 4EVNA 3T08A 2GEEA 1JNHA 1RJZB 4AMKL 5EUOF 3B43A 3QULA 3QDMB 4YHKL 5DJZA 1AR1D 4O2EB 3LHPL 1FH5L 3MA7B 3B2UD 4LEXL 1E28A 3DWTA 3ZTNH 4QTHA 3V0VB 1MFEL 5F6HJ 5GS2D 2VDKH 3MRJB 4LFHD 5EA0H 2NY1B 1P5VA 2CRIA 3BAEL 1YEDB 4M61B 1OTUC 2PXYB 2VZ3A 1Q94A 4FS0A 1BQHB 4J4PA 5TH2A 1H3GA 2VDOL 2VWEE 1CVSC 3O45A 1G9MH 3PHOA 4NQTA 4ESKA 3Q1SL 5C6WH 3CVHH 1FGVH 4HC1A 2PYEE 2FO1A 5CGTA 1NLDL 4UINH 3BEVA 3CPLA 3W11D 4F80A 3ZT5A 3J8F7 1N2RA 4S0TD 4F33A 5IKCA 2EE2A 5F7KC 1XGUB 5I0ZA 1CLOH 1T0PB 4JREB 3DV4A 5B38A 4OV6F 3CFIC 3U7WL 5K93A 2K7PA 4KJPD 2VDLL 1IFHL 2AJ3A 4RGOH 5CMAA 1PEZA 4R4ND 1AO7D 4ZSOB 5KAQG 1VDGA 1A1OA 1P4IH 3W0WA 2DJUA 1TTUA 4UUJB 1ZLSL 5BV7B 3FQXA 1W8OA 4HUVA 5EWIL 1M71B 3ELAT 5DD3L 2HWZH 2PETA 2X4PA 5J9PB 4DFHA 3QUYB 4P23D 1TVDA 2VH5L 3N1MC 4FABH 3MRKA 2OSLB 1RPQA 5D7SL 4ZMAT 4M1CC 3PF2A 1M7DA 1UM4L 1WZ1H 2BVTA 2DLGA 1IAIM 1S5IH 4XP4H 5IBTL 4NT6A 4FFZL 2BFVH 4G80A 3AAZA 1MIEH 3R0NA 2N1KA 2B1HL 2ZOLB 4G42B 1U8LB 3QZWG 6FABL 5GPRA 3GSRA 1H3PL 5L6YL 2ZUVA 1RFDH 4MNGB 2CMRL 4DGYL 1F4XL 4OI7A 4MLIA 4MQTB 4JO1L 1I1AB 4PJ9B 5F21B 4LSPL 4HT1H 1FNEB 4GQ9H 5EOCJ 2VITB 3MRCA 2QSCH 5FECB 2PW1A 1W0VA 2DI9A 1MCSA 5T33L 1N5YL 1CWVA 4P2RD 3SOBH 1GIGH 2E5EA 2DQJL 3KYOB 2WINB 3ROLA 3GSUA 1IAOB 1P5UA 2XTJD 1K9TA 3CU7A 4ERSL 1PKQA 3FAXA 3W2DL 5EIIA 5I1JL 3MUZ1 4N0RA 4OCRL 4AL8L 1A6AB 1IBGL 5ESQA 5JPMA 3QNYB 4LSUH 4LKXA 3V7AE 2DLTA 4QXTA 4LGSB 3ARBC 4W4OC 4Y88A 2BMKB 4JDTL 2OI9C 4NDMB 3S35H 1QUNA 4TPRL 1CE1L 1RUQL 2ED7A 5KSVB 4NFCA 1DANT 43CAB 5AYUL 1RZJL 2B4CL 4HX1B 4M6AA 4JFQB 4P23A 1S3KL 4I0PC 1H15A 5BRZD 4Y5VB 1PW3A 2ZNXA 1DLHB 4LSDA 4PJXE 1UM6L 3FQRB 4S1DC 5DJXB 3ZTJH 2IALA 4QRUB 1B3JA 3GSOB 4UTAH 1IGJA 2I60L 1N64H 5F1IB 1CFTA 5C1MB 4HJGB 3LQAL 3PQYA 4JPKL 2DQCL 1F58H 3TA3B 5L2KB 4F8TA 1OWRM