5CEYB

Crystal structure of fab 9h+3l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
232
structure length
232
Chain Sequence
QVQLQESGPGLVKPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLKSRVVISRDTSKNQLSLKLNSVTAADTAIYYCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 9H+3L Fab light chain
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 232
sequence length 232
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ceyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ceyB01
1J0IA 3L3KB 5SX4I 3O2WH 1KJ2H 3O3DB 1A1OB 3OKEB 4X4XB 5TDPB 3T0EA 4CBPA 5GS1B 4E41B 3NZ8A 1WZLA 3NIGF 3FTGB 3OL2A 4U31A 2HJLA 1G6RB 3D2UD 1IGMH 4LCWA 3C6LB 2P46B 4YHZL 2GUOB 1GVIA 5CZVH 1ZMYA 3MXWL 3P4NB 4QRTB 1CFTB 5INDA 3VFPB 1CXKA 2LU7A 1MCSA 1G7HA 4LQ1A 2NXZC 1JCKA 1DSFH 4YDKL 1FFOA 4ZO9A 3WHXB 3RIAF 4UNVA 2CDFB 5BQ7A 4DGYH 1G7IB 4JVUA 4DEPC 5LAXA 3FFDA 4PJFF 4PJ5E 2D31B 2O61A 4D0CA 3DVFA 2D7OA 3ZDYE 1U6AL 4HFUH 2OXHA 3JUYA 3TO2A 2DKSA 1LDPH 4Y89A 2APXA 1NFIB 3HI6H 2PNDA 1CD8A 2D7MA 3KLAA 3FB7B 3MRLB 5IROC 4KROD 1ND0B 3ZKND 3ZKSD 4K8RL 3I6KA 5GZNC 4A6YA 4QHNB 3I02A 3IYLW 1CFNB 1ED3B 1NEUA 4O2FB 2CUIA 1FL5B 3RWDB 1KG0B 3BQUD 3G6JE 5J1TC 1E4KA 1ZWIB 5IB1A 3FFCB 1UJ3B 2CKBL 3ELAT 5IM7A 4ELKB 2ID5A 1K4DB 1CD0A 1YUHB 5HGBA 3FN3A 2NX5E 4O4YL 1M7IB 2B1AH 4JN2A 3E0GA 1FORH 5ID1A 3TZVD 5TE7H 5KVDL 3VXMB 2PETA 4D9RE 5F70A 4GAFB 2H6PA 2AGJL 1I1RA 4P2YA 4GJTB 2EKSA 1HIMH 5MEOA 3QQ4B 3RA7H 2QR0A 3RKDC 5FGRA 3AAZB 4RIRA 1A6UH 4MD4B 1JWMB 1YA5A 4P99A 3RWEB 4R2GB 3U0WH 3BH8A 2A77H 3L5XL 1O5DT 2G2RB 5SX4H 2ZP0T 4LVHC 3ULUD 5F9AC 1FVCB 3DVNB 2YKLH 4FQHA 5CHNB 3ULUH 2VXVL 3HFMH 3HZVB 5IROA 3RU8L 2CD0A 3QUMA 2CLRB 1Q9WA 1HZHH 4HS8H 1ZHKA 2FO4B 3QWRA 4LOUD 1MHPL 1JPGB 1SJHA 3E6HB 2VITA 3MUJA 4BZ1H 4MXQC 2GJ6D 4P46D 4XHJC 5HI5D 1L6ZA 2X6MA 4OZFA 4WI6A 4XMKH 1XGQB 3LRGA 4C58B 5CJ5A 1PBYA 3TV3L 4HH9A 4PBVC 4CNIB 3V0AC 1D5IH 4HPYL 4RGNB 1YNLH 3UJIL 2ZJSH 3DX7B 2C1OB 2EH8L 1J8HB 1DEDA 4WY7H 4H1LG 4LSUH 4EDWL 2GCYA 1ZT7B 5E94B 2V2XB 4LHUB 2DI8A 4ZS7L 4NQEB 1K6QH 5C09D 5LWYL 4APQD 2CO6B 5L9DL 4MHHI 1JRHI 4LP4A 1N7ML 5D1QC 5HGHB 4DKFH 1A22B 5F8QC 5HVHB 2XRAH 2B4CL 4D8PA 2NY0C 1DEEB 2VLKD 1R3JB 4PRHB 3MCKB 1F8TH 4NRYB 2FL5B 1MFBH 3ROOB 1KEGL 5DRWB 1BD2A 3V5HA 5HYFA 1AE6H 1NL0L 3BSZH 3TJEH 3J8F7 4HPOL 1J1PH 1RJYB 2J5LB 2VXTH 3QG6A 5T1LA 3BKJL 3HG1D 2DDQL 5F9DC 2CDGA 1LGVA 3QDJE 1A6AA 2VKXA 2FHCA 4Z5RB 3Q5YA 5F6HI 2HJFA 4MB4A 4PJHE 5ICXB 4P2OC 2Q20A 2I9LA 5HHMD 4JGUA 2GYSA 3FAXA 4QOKE 4P9MH 3EGSB 2ZCKL 3HAEH 1NGZB 1FNEA 1RUKH 1JF1B 1BPVA 4O2CA 4EBQH 1RJLB 4O58H 4KPHL 2Q76A 1A6VH 1QYGH 3MRPB 4Q2ZA 5C0DB 4G6KL 3V5KA 1OCWL 1RIVL 3HE6C 4KI1A 3CFIC 4ORGA 1MCPL 1NPUA 3DV6B 3GI8H 3I9GL 1LK3H 3TBYA 5D1QA 5IUSA 1CICB 1FDLL 3L3IA 3DECA 3GMQB 3QNYA 4GH7B 3L95A 5HHNB 1EA9C 4H25A 3KPTA 5HHQB 4MNGA 2EYRA 5I2IB 3OJDB 1FIEA 3RNQB 3WDJA 3DX9A 3QDGB 4YXLH 4LSDA 1S3KL 1JI1A 4S0SD 1AR1C 3NIDE 4UT6L 3WLBA 1HHIA 1UVQA 5BO1H 3IETA 3LDBC 3TPKA 1RZKH 4ZUVA 4F7CA 4QXTA 2VDOL 4PJEE 1U42A 3TA3B 2L0DA 4KKAD 2DL9A 1GZPA 5I9QC 1ZSDA 1M4KA 1H8NA 1J18A 5C0AD 1JRHH 4UV7L 3ROLA 3RWGA 1UXWA 1J0JA 1F4XH 2OQJA 4P2OA 5MP6H 1JI2A 3STLB 4PJGA 4POYA 3TT3L 1PY4A 1KTDB 1TQBB 3T09A 3QUKB 3CXDH 3KWWB 3C8KA 3OG6B 4WUUA 4LFHG 5I1LB 3CX5K 4JRXE 3OKNB 1AY1H 1SEBA 5LBSH 3PQYB 3W0WE 5IMMB 5B4MD 3HE6A 5F9JB 5KS9A 2HLAB 3QULA 3HNVH 5FYJE 4YXKH 1J05A 1QVOB 3EDJA 4MJIA 1S7VA 3ARBC 3KPSB 1PX4A 3LQAH 3H3PL 1G9NL 3FB6B 5E2VH 3QIWC 1OP5K 2PO6D 4Y16C 5DEFB 1S7XA 5GRWA 1U8LA 3ARFB 1A2YA 4HCRL 4LLMB 4NWUH 1WFTA 3MA7B 4XBEH 2XG5A 3LPFA 1W72H 1IAOB 2PR4L 3O4OC 3HUJA 1RK1A 1UM5L 1FFPA 2IBGA 4XBPB 3VXSE 5I16A 4KHXH 1GHFH 3DHJA 3S36L 4JKPH 4P5MB 3DXAD 5F89A 1CTNA 3ARRA 3GHEH 5DJYA 3CFJB 3I84A 4MVBC 1OM3H 3O41B 3BPOC 3QUYC 4DQOH 4ZODA 1MCLA 2W9EH 3BAEL 4NM4L 4AM0A 5MERB 1YY8B 2CK0H 5C8JA 4HJJH 5DJ0A 4G9DA 5DF0A 3SDXA 5A16A 2C9AA 5F9OH 2HJKB 4WI5A 1I7TA 1B4JH 3C5SB 1ZHBB 2W0FA 3KLHD 4MA8L 3H0TB 3V0VA 2VXUL 2PCPA 3TVMB 1NAKL 4R97C 3GJEA 3QG7L 5JHLL 3EYSL 1Z9OA 3HE7C 5FV2A 4I77L 5IV2B 1DQMH 1UH4A 4R3SA 3STZB 4YGVA 4ODUB 5LG1A 3T0DA 4PRNB 1YMMA 1H15B 1QSEB 1X5AA 1AD9B 3MV9D 5H2BB 4HUXA 4TOYL 5CSZB 3ESUF 5FHAL 3WFEL 5FYJL 2Q87A 1GGCL 4PFEA 1P2CB 2WUBH 3LH2L 3QIWA 5EWIL 3JTTB 4YPJA 5C3LD 3VD4A 4Y16A 3RWFB 5CILH 4UU9B 4M93C 1EGJL 3MRBB 5GIRB 4M03A 5B3JF 1TETL 1IARB 1DQJA 1KN2L 3BWUC 4P59H 4XPAH 2OZ4L 2X5PA 3VFGH 1IZKA 4N8CL 1CFBA 1F4YH 2DQTH 2UWEB 4GAJH 5I8CB 5IFJA 3SPVA 1IQWL 4GG8A 1FNGA 1DBBH 1NFKA 2VZUA 2WW8A 4NN6B 4ZTPL 1XF4A 1AJ7H 1BVZA 3QUYA 3FB8B 1DQDH 5IIEA 1QRNA 1NUDA 4JFPB 4NQCD 3SDCA 2DQCL 2K1MA 5IQ7H 5F71A 3VD7A 2IBZX 4NQDB 3SBWC 1B0GB 3KPMA 5GRXG 1EEZA 3RVWD 5SV4A 1HQ4B 1IL1A 2WBJA 3S3SA 3W11D 3ZL4L 5L0QC 3ARGB 4K94H 1KCVH 2XV6B 1NFDA 5H35B 1KFAL 2ADGB 3HE7A 3EYFA 1G1YA 4UT7L 4N1CA 2UYLB 4OD1L 5TE6L 2VLLA 3TH3T 4FFZH 1R3KB 1NBQA 1YNTB 2UZYB 3EOAA 4TUKH 3MRQA 2OBGA 1XEDA 3BWAB 1JPFB 4OTXL 2BFVH 4NN5C 3MLRL 1IAIH 3ARQA 3RWHB 4OGAC 1OQXA 3EYQD 1J8KA 2XYCA 4Y4FB 2RAMA 5HHVH 1MELA 3F6IA 4XVTH 3QHFL 3QHZH 5BRZB 1LP9E 2XZQL 4OB5L 2Y06L 1F2XK 4K3EL 5KSAD 3D85D 4ZAKD 1TIUA 3QEQA 1F3JA 2VDQH 4JPKL 5GGQL 2HRPL 5C0BE 3MLTA 5C0CB 4ZFGL 3QXAB 1DCLA 4JO4L 1OAZL 5C08E 3G5ZA 3DIFA 1F58H 3KJ4B 3HI1A 2YMXH 1FV1A 3V4VH 3OR6A 2XQBL 4J3VA 1YQ2A 3BH9B 3ZE1E 3G5VB 3K1DA 2R4RH 2NTSP 5CFHA 1SY6H 4XCCH 3SBWA 2X4SA 3TWCL 1KB9K 1IGYB 1T0NB 2B39A 2YA2A 1WICA 2AV7B 1YN6B 3BT2H 4Z7VF 1QR1B 5CBAA 3DMMC 5HHXL 3QB7C 2RIKA 4LKCA 1QLRA 3U0TA 3OKDA 4IOFC 4ALAL 4HG4K 3DSFL 4I2XE 4BK4A 4PB9L 5ESVB 3SY0B 1KLGA 4HJ0C 1JYVA 5F3BB 4PJDA 2JJVA 1RUPH 5DJAB 5CCKL 4FFVD 4M8QA 4M5YH 1CE1H 5DHXB 4Z7UA 5EC2B 1YPZE 1SM3H 4KKNA 5ACMA 2X1QA 5DQ9A 3JWDL 5L2KA 3C5JB 4NKIH 4C83B 2VC2H 1A7NL 3THMH 2IALA 2OI9B 1M6OB 1RJZA 1KJVA 4U1NA 4PV8A 3U9PL 1ETZB 4KRPC 5GS3A 3IKKA 5ICYA 4D2NA 4TSBL 4GT7A 5F1IB 2D3VA 1AQDA 3UTPD 4FFYL 4ZPTA 5I66B 2YZ1A 5E7FA 2APVA 3RIFK 3X12A 3BN9C 2QSQA 4HKJA 3RBSA 2BRRH 3IRZA 5EZOL 1UCBL 2FJGB 2GFBB 5EZIH 2DM4A 3TP4A 1R24B 3OKYA 1YJDC 3DMMA 3QRGH 2BC4B 4ELMB 5C2BH 3QQ3A 3SN6N 3LPGA 1FE8L 4PJBA 1PJ9A 1JV5A 1B0RA 1KNOA 1MRCL 4KMTH 4XBGB 3MLUL 4RQQB 3RBGA 1OF2B 3T4AB 3V4UH 3ZT7A 4OM1L 35C8L 1T2QL 2HG5A 2VLJA 1YEGL 1J0ZA 3QIBC 5DEGA 1GJIA 1AI1L 4Y8AA 5JOEA 4RBPK 2F8VA 4PG9A 5EBWA 4DK6A 3L5WA 1RUQL 4OKVA 5KJRH 1FAIH 5DHVB 1E4WL 3C6LC 3T3PE 4F37K 3PGFL 1FC1A 5FYKE 5DRXA 1HXYA 3PL6D 4YDVB 1C5BH 3WIHA 2AKRB 4PJXA 4LLVB 1YEFL 4ZNCD 1LEKA 2LFGA 4K9EC 2HMIC 1AGEB 1S9XA 1KB5L 2QKIB 3GMMB 3V6ZB 3DGCR 4XCEB 4BQ8A 5E2UH 3RWIA 4GMTH 4DGIL 5K9JL 4N5ED 1XGTB 2WP3T 3H9SD 1KELL 1VSCA 3R1GH 4KUZL 4Z78A 3MRFB 1EUUA 2WSKA 3L9RB 1FRGH 5FGCB 3LEXB 1BHGA 1FPTH 4LSSL 3CH8A 1WCBA 5D8JL 1TTUA 2BVEA 3ZTNH 5IEHB 2WAHA 1ZLSH 1GCFA 5DQJA 5F96H 4HXAL 2PTTB 2IBZY 3OGOE 5FB8B 2XKUA 5EC1B 1UJ3C 3TT1L 4LNVA 4KVNL 2JB5H 2K9UA 4MDJB 4BM7A 2FBJH 3O3DA 1A1OA 4JY4B 5TDPA 3JWNC 4LCIH 4N90E 5INCB 5I1AA 3HI5H 4N9OB 4ONHB 4PP1C 4LP5A 1L0YA 3FTGA 4XMLL 2JJSA 3Q1SH 4C57C 2W65B 1Q1JL 4HWEH 4KQ3H 1YQVH 4MMZC 1G7LB 3WFDL 3N85L 4HC1H 5FYKL 2V9QA 5C0JA 3MNZB 3OXSB 3VFPA 2BVYA 5ETUB 3TBVA 4PJHB 3SOBL 3X3FH 4H20H 3OPZL 1VGKB 3WHXA 1PW3A 4QOKB 4R2GC 2CDFA 2YA0A 3RY4A 2PW1A 3LPWA 2D31A 4Z95H 1MLCB 1K9TA 3QUXB 3JWOC 2WK2A 1JWSB 1UEMA 2HKHL 2E7CA 3CVHA 2G60L 1FL6B 4XNYL 4IRJB 3MRDB 3QO1B 1NFIA 4JDVB 4MDIB 4K71C 4YHIA 2Q7YA 3FB7A 5DD0H 3MRLA 5EULV 5DUML 2OR7A 4HV8A 1ND0A 3HC4L 3QUZD 4KXZI 4DVBB 4JLRB 4QHNA 3ZE2E 1I3GH 1UGNA 2NMSA 5J0BA 3QCUH 3S5LB 5FO8B 5LXGL 4JE4B 1ED3A 1G7QB 1G7JB 4YHKL 1KG0A 3B9VA 2D7TH 4YQXL 1X5HA 4IRZL 4LDOB 5EH1A 3BDYH 1UJ3A 4JFFE 1EJ6A 2DAVA 3UCRA 4YO0A 3B2UC 1M7IA 5AG9A 4AIZB 4RGNC 1AKJA 2IAMB 3VXMA 4KRMB 4PJEB 1NAMH 3VXNB 1JK8A 2W07A 2Q3AA 3RJDA 1VHPA 1NLDL 3P9MA 5KSBE 3UTTE 2ENYA 3H3BC 4AMKH 3UTSD 5E6ZA 3RWEA 3GBML 1TJHH 1AO7D 1BFTA 2H3NA 2NNAA 3D6GA 5HVHC 4WU5B 5EPMA 1J7VR 3P30L 2ZUVA 4JRXB 4PJAF 2LVCA 1PLGH 4MCYA 4TPRH 3DVNA 3W0WB 2I9TB 4V2BA 2VWEE 4BH8B 3KHQA 1JYNA 3HZVA 3IDIA 4CN1A 5C9KA 5ESAB 2FO4A 1YEDB 5HHPB 2J6EL 2OTWA 4Z7OE 4KKBC 2AJYH 3E6HA 4PRPD 2DQIL 3TIDB 4DKEH 1YN7B 4CL7A 4MZ2A 1HINH 3MNWB 4PLKD 4YFEA 4LLWA 5L7XH 3T0ED 5IMKA 3Q3GB 3VXSB 1OPGH 3TF7C 3MLSH 3HRZA 4CNIA 3RGVC 2X70A 3QXDA 1MCRA 4LCWD 5C6TL 2E9IA 1BZQK 2OLDA 3CDGA 5EBMB 2MPAL 3U7YL 3DX7A 3EDEA 4MXVF 1ZLVK 4GXUN 1J8HA 3B9KB 2DB8A 3WXWH 1JMZA 1PEWA 5EIVA 1ZT7A 5AAMA 4KXZH 5E94A 2V2XA 4LHUA 3NAAL 5DD5H 3S35X 1OVZA 1GSMA 3CCHB 3U6RB 3TESA 4I8DA 1A7OH 4C4KT 2CPCA 2CQVA 2EC9U 5HGHA 1C16A 2AABL 4OGXL 3ZMRA 1RULH 1R3JA 4PRHA 5I1DA 3MCKA 3DBXA 4MA7H 1ZLWK 3HMWL 3BJLA 2CIKA 4G5ZH 4JO3L 1ZANH 4WEMB 4DN4H 5B8CC 1FNSH 2C3HA 1EHLH 2R9HD 2FGWL 2BSTB 1OAUH 1UYWH 1WIOA 3KYOA 3CMOH 1R3IL 2AEIT 5DR5L 4RMVA 4RMWA 4OQTA 4DGVH 4FXKA 3TA3C 4B0MM 2VIRA 3HR5B 5E9DE 3HZMB 2IGFL 5GGUA 2N7AA 4NRXB 4Z5RA 1MAJA 3MLVH 3MRNB 5I8EB 3VWKB 3REVB 4HT1L 2XZZA 4JDZB 1MCDA 1TQBC 3RGVA 5DVNA 4L3AA 2IQ9H 1NGZA 1G7MB 1JF1A 1NCDH 4M00A 4D0BB 4JFDA 4K3DL 3MTRA 1JGEA 4WRLA 3FQXB 1P84K 4OV5B 2CGRL 1XGYL 3MRPA 15C8L 1C8PA 5BS0A 5J89A 3FONB 2NXZD 4GAYB 2E8YA 5I75B 1RZIB 4H26B 3DV6A 3JUZA 3QT2A 5ADOH 2NY7H 1RFDH 4QO1A 5A3IC 5HHNA 3AREB 2EXYC 3ARFC 4JG1L 4PV9B 5F8RC 3V0WL 5M7QA 1WGOA 3NCJH 5HHQA 3NACH 3S35H 5I2IA 2ICEB 1GH7A 3OJDA 1DR9A 1BQHG 4AJ0A 4Y1AD 3RNQA 5B8CA 5D4QA 4EN3B 4WWKC 5SX5K 5FV1L 3P77B 5GZND 2W9DL 1EO5A 3QJFB 2RCSL 1CWVA 2I5YH 3QWRD 4WI2A 3B6SA 4PTUB 3O2WL 3JVGA 1KJ2L 1LP9B 1NC2A 1KC5H 4F9LA 5I1KH 5B38G 2GW5A 5J13B 3FT4B 3BMWA 4RMUA 1UKQA 4M4PA 3FRUA 5C0BB 3STLA 1IGML 2HT2C 4OZFH 5C08B 1J86A 5CZVL 4OFPA 4LSVH 4L3CB 3KWWA 4GW4B 3W81A 2X09A 5FKAB 4NDMB 3HRPA 2AQ2A 3P9LB 1VFAB 3OKNA 5I1JH 1DSFL 3TPUA 3GKWH 3VFOB 3RKDD 3PQYA 5IMMA 1IC4H 5F9JA 5HYSB 5IW6B 5ANMA 4R90H 4OZIF 3ESVF 3BD5A 2HTKC 3VGBA 3KPSA 1HHHB 1OAQL 4CMMA 5AAWA 4HFUL 3MRGB 1EMTH 4XGZA 1LDPL 4YFLF 4WO4D 1JUFB 2OTUA 4HEME 3ARFA 4I2XB 3MA7A 1GGIH 4RRPG 1IAOA 3BP4B 5DMIH 4BFBD 2RGSA 3VXUE 4KJQD 1QR4A 5EZLB 4G9FE 3MOQA 4PD4J 1V3KA 4WWKA 1JN6A 5T1LD 3M1BB 1YPZB 5EO9A 4NN6C 4IHOB 5I1HH 3NN8B 4TNWK 4CU6A 2VL5B 1JFQH 3O41A 3U0PB 4YJZL 3MJGX 5GGTA 2V17H 2GJ6E 1U93A 1YY8A 4MXQD 1DLHA 4XHJD 5LGJB 2B1AL 3TJHC 1FORL 4P3CH 3HAEG 1T6VN 1WAAA 3Q6FA 3RQ3A 1S7RB 5HPOA 3C5SA 1ZHBA 5TE7L 3H0TA 2VB5A 3ARGC 5K9OB 4HK3J 1FC2D 3RNKB 1WWWX 1HIML 4GG6F 5IV2A 3RA7L 4CU7A 3STZA 1UWGH 1A6UL 3IDMA 5T5NF 3PWNA 4OIIH 4ZFOL 5C09E 4XTRC 3U0WL 1HDMA 3HZKA 2A77L 4YWGH 5H2BA 1U95B 5DJCB 3AROA 1LD9B 5CSZA 1I1CA 3P11H 1Q9LB 5D1QD 5DZNA 2CH8A 3P2TA 2V6HA 4WGVB 2AK4D 2EKJA 2IH3A 3DNKA 5E24E 2IH1B 3FB5A 4CN4A 2D7QA 3RWFA 3ULUL 3TLRA 1I1FA 2DIBA 1RK0B 1GOFA 3HFML 1UM6H 3MRBA 2F53A 4NRZB 1HZHL 4GW5A 2HFEB 5MEQB 2KKQA 2UWEA 2G5BB 3I6GB 3UBXI 1DE4A 3HG1E 4EOWH 2Z8RA 1S9WA 4HXBH 4MHHG 4KV5F 4HUVA 3KJ4C 4WJ5B 2X42A 4I3RH 1N59A 3IKCB 4BZ1L 4JZOB 5CLTA 2BCKB 4QNPE 3FB8A 4L8SB 4XMKL 2D0HA 5JW4Q 4JFPA 4OI7A 4NUJB 4F57H 4PLJC 5CP3A 2R1YB 2NTFB 3WNKA 5HHME 3VA6A 4LCCC 3QRFM 4P2OD 3PIQB 1D5IL 1HQ4A 2QADB 2WIIA 1YNLL 4QRSB 3NFPB 3ARGA 2ZJSL 1RVFH 5CZKA 3DTXB 3ULSA 4L8BA 2DQJL 4AK1A 5A40E 4WUUD 4LSUL 2XI9A 4NBXB 2UYLA 3SCMB 2MKWA 5DK2B 1K6QL 1BJ1H 4JHZA 2R23A 1R3KA 1YNTA 4X5XB 4OCWH 1SMOA 4M7LT 3HE6D 4DKFL 4XXCC 1JPFA 3CFEB 2XRAL 3UDWA 4MJID 5IMLB 1FL3B 4MAUH 3MV11 5E8PA 1F8TL 2XG4A 2MJWA 4TUJB 2YUVA 2HLFC 3ILPB 2KL6A 2OXGA 1MFBL 2D7PA 1P4LB 4JREB 4LGPB 3BSZL 3TJEL 2KQMA 1KIPB 3PWPB 3V5DB 1J1PL 1T83C 1CGSH 2VXTL 4Z7QF 4G42B 5KG9A 1FBIH 4PBXA 3SKNB 5C0CA 1AR1D 1CTOA 4KK6D 3MJ8B 3IU3B 1X6LA 3BFOA 1IEHA 4QTHB 4F2MB 1R5WA 2EYSA 3QXTA 4W81A 3MPCA 3MJ7A 1ZVHA 2BVPB 1IGYA 4P9ML 1T0NA 4LCCA 2Z8WC 4I3SH 1VFUA 1D9KB 3IF1B 3VI4E 1DP0A 1S9VA 1RUKL 5I6XB 3FHAA 5HDOA 4O58L 2ZSVA 5CEYB 4NM8H 3H6JA 4YFLI 1A6VL 1QYGL 5DJXA 1KPUB 2LAGB 2X1WL 3AMKA 4WU7B 5I15H 1YMMD 3ALXA 3MJ9A 2UVFA 2VABB 1TNNA 4XNMA 5ESVA 4N0FB 3GI8L 1LK3L 4OF0A 1NKOA 3W9EA 1ORSB 2VE6B 4Q9BA 3B3IB 4RFNB 5DJAA 3M07A 5HY9B 1YEKL 12E8H 3ARBD 4KTDH 5C6WH 1GC1C 3QIWD 4X8JA 4Y16D 4JFEA 2GJJA 1IGJA 4HKZA 3OXRB 4YXLL 1M6OA 2YN3A 1VESA 1XCTB 4JFFB 1T83A 1EO7A 1TJGH 2VUOA 1CVRA 5BO1L 1RZKL 3MLWH 2VZTA 2FB4H 1ZGLP 3EJYC 3DXAE 1CE6A 3IJHA 2LU4A 5FF6B 1D6VH 1I4FB 3QNXB 1JRHL 4MVBD 1LK2B 3QUYD 1F4XL 1QRND 1MAMH 5MP6L 5I66A 2D2OA 4HWUA 1ZXQA 4NNPH 4P2RE 1TQCB 2I07B 5EOCH 2PUQT 1U8QB 5ALCL 5KSBB 3UTTB 3CXDL 5DI8B 2BNRE 1R24A 2FYYB 4Y2OA 4OZHF 1EFXA 3RWCA 2H8PB 3VXTB 2R0LH 4ELMA 1R3HB 3RX7A 1AY1L 2YA1A 4I5BB 5LBSL 3T4AA 2QBWA 3CJJA 4XAWH 4P9HL 3QNZB 1A47A 4PJ7A 3T1FB 2VDNH 3HNVL 4YXKL 5CJQH 4NJAH 5IBLC 1IC5L 1TZHA 1WFOA 1X5FA 3LQAL 4JZJB 5KVGH 1MFEH 3GB7A 4XP1H 4NWUL 2HVKA 2NY1D 5D7JD 4XBEL 3NTCH 2A6DA 3X11A 4UQ2B 2AKRA 4U1GB 5EU6A 5C07D 1ZV5A 4KHXL 5ECJE 1GHFL 5K9KB 3QEQD 4U0RC 4JKPL 1AGEA 5F7DA 5IEKB 3GHEL 4F3FB 3DX6A 4XCEA 2IPKA 3MNVB 4ZPVB 1OM3L 4ISVB 4DQOL 3HKFA 3G5XB 3MUGA 4XZUB 3UPAA 2W9EL 4HULB 1XGTA 2CK0L 3BGMB 1IC7L 4PJ9B 4HJJL 4PJIA 1P6FA 4BSWB 3PUCA 3QUXC 4GW1B 1ZLUH 5F9OL 4LHJB 4NWTH 4OCXL 1B4JL 2LV4A 3MRFA 5DDHA 3QO0A 1V7NH 1MI5D 5T3XE 3C09B 3KR3H 3TNNB 5ITBL 1DQML 4AG4H 3C6SB 2Q8BH 1KT2A 1CG9B 2PW2B 2H26B 2PTTA 1C12A 1SYSA 3VMPA 3QDME 4MDJA 5DD6B 3CSGA 3CXHK 4JY4A 2JELH 5E8NA 2WUBL 1JGDB 3LD8B 1I9JH 1BFOB 1TLKA 4PYHA 2XOTA 4RA0C 5GRZA 4OGAD 5CILL 3CX5J 1XH3A 2IAMC 2W65A 5L2KD 2BX5A 3GMLB 1G7LA 4YNYA 4P59L 5FGSA 3VI3F 4N1EA 4XPAL 5E9DB 3VFGL 1F4YL 1F90H 2DQTL 3MNZA 4GAJL 1CLZL 4WENB 5ETUA 4PJHA 5T1KA 2O5ZH 3ALWA 1DBBL 3BPLB 2MFNA 3MMEB 1U36A 4QOKA 1QSVA 2I60L 2OTPA 2X41A 3WUWG 1CDJA 1NBYB 5IQ7L 4IIQC 1MLCA 5BV7B 4FFWC 1TVHA 5J11B 1JWSA 2R2EA 5GRYA 4EUPA 6CGTA 4K94L 1KCVL 1MIMH 1RZ8B 3MRDA 3MODH 4OI9A 1MREH 4S1QL 3DMMD 3OB0H 43CAB 1A0QH 1ZHNA 2NW3B 4J4PD 1FFNB 1LEIA 3S5LA 5GISH 4FFZL 4IOFD 1G7JA 4TUKL 4TTDC 2VLJD 5HYJE 3WUZA 4LBEA 4HJ0D 3MX0A 5SWQB 2BFVL 4X98A 3RWJA 2Y25A 1IAIL 3OGCA 3CU1A 3LCYA 5HHVL 2D0FA 4XVTL 3QHZL 1T03L 1HKFA 3BW9B 2JIXB 4PJEA 2VN4A 3VXNA 1W0VB 2VDQL 4NIKB 3B9KC 5IFAH 3IS0X 1NJ9B 3K0WA 1ULVA 4AT6B 4M7KH 2J8UA 4G6MH 4KY1H 3WIHH 5JPNA 1F58L 5E8DH 4ODXB 2YMXL 3V4VL 4MNHB 4URTB 4JZNB 4FMKA 3VWJB 5C7XL 1NCTA 5IB4B 2BJMH 2R4RL 2GJZB 4IS6A 1SY6L 4MQ7A 4XCCL 4IIQA 2M2DA 5JA8B 5F1OB 4V1DA 4LGSB 3BT2L 3CZFB 5E6YA 2YC1B 4X7SH 4X4YB 2I9TA 3IDNB 2VXSH 3D39D 4HIEB 4NO0D 4KJYB 4DTGH 5I19H 3CFBB 2X4QB 1T20B 5J12C 5A2IH 4HKBB 5DK3A 1YJDH 3PV7A 1X5GA 3H8NA 2IFFH 2P8MB 3UPCA 1OSPH 1NGXB 3QIBD 3TIDA 1HNFA 1RUPL 4BQ6A 1H8OA 3VXUB 4M5YL 1CE1L 3MNWA 3TCLB 3VWKC 5ILTH 1SM3L 1A64A 1XGPB 4B50A 4H0GA 4E41D 4G9FB 4G80B 3H3KA 2EDLA 4NKIL 2ADIA 2VC2L 3THML 3C6LD 5EBMA 1VCAA 2BNUB 1G6RH 3B9KA 5CGYC 4R4FH 4WWID 3LN4B 4IOSD 4AEIH 1T2XA 3D3VB 3L6FA 2HMID 1MCWW 3AM8C 2IF7A 4QWWC 2EDRA 3O2DA 4Z7WA 1DBKH 5I75C 2DRUA 4KGLA 1PZ5B 1V8HA 4K9EH 5J1AB 4Y0GA 1NEZG 5HYQA 1AGCA 4P4RA 2BRRL 1FCCA 3MGTA 5IESH 3AREC 5EZIL 4KHTH 5JOFA 3QRGL 3H2WA 4KMTL 3V4UL 4EN3C 2VDKH 1WJ3A 4M7JH 3MROA 2BSTA 1IKFH 1RY7B 5HDQH 1RUAH 4M5ZH 1N2RB 2PKDA 5K33A 4EDXB 1TFHA 1KB9J 4GRMB 3HR5A 4YHYB 4D9QE 4NRXA 3FFCD 3MRNA 3VFUB 5J13C 5KJRL 5I8EA 3VWKA 4KZEH 3QFDA 1FAIL 3REVA 3JXAA 4LAQH 5D7KE 4KDVA 2EDOA 3HG1B 3LRHA 4PP1D 1C5BL 4WEBH 3VXMD 1FO0A 5EU3A 3ZE0E 3KPPA 2W92A 1JL8A 4HG4J 3G04B 5DHYB 1ITCA 1D5MB 4XNQB 3FQXA 4OV5A 2CUHA 4X6DA 4J8RB 4OCMC 5HHMB 3C9NB 3HAEB 1CVSC 4NNXB 5E2UL 4GMTL 4GAYA 3NA9L 1INQB 3AM8A 3FQWB 5F7WC 1RZIA 1SMAA 4PREA 4R2GD 1RPQA 2YUWA 4TN9A 1IGTB 3R1GL 3C2SA 5ADPH 1FRGL 4ZUSB 4PV9A 1FPTL 3D0LA 2KBGA 5AUMB 3JWOH 2ICEA 4ZO7A 1I9EA 1ZA6B 2O5XH 3GBLA 4BA8A 2F74B 3ZTNL 2AV1B 1VADB 1ZLSL 5FDYA 1J1XL 5F96L 2YPKB 4L8CB 2JB5L 4PTUA 3U2SB 4FQXB 2FBJL 4RSVA 1XF2B 4RFEB 2W91A 4LCIL 1KUMA 3V95A 3FT4A 4KK5D 4TSCH 3K46A 3T4YB 4FQQA 1KSRA 3VXRE 3IJYB 3Q1SL 4U6HA 5F88B 1I3RB 4HWEL 4KQ3L 1ZTXH 4L3EE 1YQVL 4H0IA 4RGND 3N1FC 3OG4B 4HC1L 4XPBH 4PGEB 1XF5B 4NDMA 3P9LA 4JKLA 2MHAB 1J8HD 1VFAA 3NCBB 2IQAB 4H20L 4MNQA 3PHQB 3VFOA 1WFUA 4LHUD 3UTSE 4NQED 5EZJA 4NQVB 5HYSA 5I0DA 4Z95L 3GM0A 2RR3A 1QSFA 6FABL 1J9CT 4Z76B 2ZOKA 5E1HB 3QXUA 3LMJH 2EO1A 4HIJA 3MRGA 4GUPB 4WHYH 1JHTB 4PRHD 4NUGH 1JUFA 4CDHA 1CXIA 3WO4B 1BQLL 3IXAB 3BYYA 5DD0L 3SKMB 9CGTA 1U8IA 3HN3A 5JR1H 3GSUB 3H7BB 2ZG2A 1I3GL 4RISH 5CP7A 3QCUL 3FMGH 4JO2H 4Q6IC 4L4VA 1J11A 1YPZA 1HYRC 4HMCA 2D7TL 2C26A 3O4LB 4IHOA 4U1HB 4RZCA 3BDYL 2VL5A 4PRPE 3U0PA 4L8SC 4KKBD 5LGJA 4JM4H 3T0EE 1T66C 5EUOF 1UB6B 2HFFB 3TH2T 4ETQA 1WFNA 3RGVD 4LCWE 1NAML 4I18B 1JTPA 3BGFB 1QPXA 3RNKA 1PSKH 2BVQB 1G6VK 1YNKH 4NC2B 4OSUH 3SCMC 2WUCH 2BY2A 4AMKL 4P2RB 2NY5C 3TEUA 1TJHL 3DRTB 4X6EA 5KVFH 3JBG7 1S9YB 4TVPD 1E4JA 2BNRB 3VXQB 5DJCA 1A7PH 2FEDD 1LD9A 3UROR 2MOVA 1U92A 1C5CL 1SQ2N 4TVPH 5SWZA 1PLGL 1BLNB 4M6MH 2KH2B 3G6JF 2IH1A 1V3LA 5E99H 5C71A 3KPNB 4Z0BH 4NRZA 3BZ4A 4F37F 1NANH 2BERA 1L0XA 2AAVA 1KJMB 3QDGD 5HDBE 1X5YA 2G5BA 3I6GA 4Q6IA 4Y2DB 5IVXB 3S98A 5I8KH 1OP5H 2AJYL 2XA8H 4DKEL 3PWLA 3IKCA 1HINL 3TA3D 2VZSA 2BCKA 4L8SA 2XA3A 1VB9A 4XT1C 5L7XL 4BZ2H 1ZK9A 4OZFG 1CQKA 1OPGL 1TZIA 3MLSL 1JZ5A 3L7FA 3GSRA 3PIQA 1IFHH 4Q74A 2EICA 4Q9RL 4RMSA 1D9KC 1GOGA 1WISA 5I6XC 2X1PA 1Z0MA 2Q8AH 1JE6A 5J6GA 1JVKA 5T3ZD 1BWMA 3WXWL 3LV3B 1MWAA 4LASH 3SCMA 5T3ZH 2FCBA 2NZIA 2V7NB 3BO8B 2GHWB 3NFSH 5DD5L 1XCQA 3PQYD 4U4BA 4WFFE 4LMQE 1A7OL 1CZ8H 4UB0H 3HNTH 2IJ0C 3NFNB 5K59F 1J1OH 3KPSD 5T1DH 4OV6F 1T1WA 4MA7L 3AY4C 1NBVH 3VU2A 1MJUH 3QFJA 2UY6A 5A3ID 4G7VH 5CIPB 3ARFD 2EXYD 2NXYB 4G5ZL 3QCVH 5FO9A 5IGXH 5KANI 4BYHA 1KIPA 3PWPA 5GHWH 1K5NB 3QDMB 3U4EA 1EHLL 3E8UH 3P0VH 1PVHA 4M6AA 1OAUL 1UYWL 2Z92B 3CMOL 5JIKA 1CDIA 4RAUA 3SKNA 4OZGA 4FZ8H 3MJ8A 4DGVL 2QSVA 5EO0B 3WD5H 4QTHA 2VQ1B 4F2MA 4NJ9H 1OW0C 2AI0H 3MLVL 4QGYA 4MD0B 5L6YH 5D9SB 4XX1E 1S5HB 1TQCC 2AQ1A 5IMOA 5GGTH 1VACB 2FLRT 2IQ9L 3PGCA 5JIHA 2R1WB 3G5YA 3IF1A 3VD5A 2HT2D 3TVMD 1NCDL 2BDNH 1MCIA 5KTEH 5JXED 2BHYA 4HKXB 4H5SB 4OLXH 5CEYA 1J10A 4AIXA 2ICWA 3A67H 4X6FA 1KPUA 2DQGH 1E6JH 1LO5B 5D70H 4QF1B 5CGMA 2VABA 1QO3A 1I7RB 1QSED 1YC7A 4P2QA 4M1DH 4XP5H 4P23B 5CJBA 1ORSA 2VE6A 5ADOL 4JZJC 2NY7L 3G6DL 1RFDL 2XPGA 3LVEA 2HTKD 5HSFA 2W0LA 4JAMA 5FUOH 3VFWB 1JHLH 3AY4A 3NCJL 1FNFA 2NLJA 3NACL 3S35L 4X5WB 3BIKB 4IOIA 1Q94A 5CEXA 1BD2E 4KJWC 4CW1A 4U1GC 5HYJB 4RWHA 2K3TA 4WFED 3QIUC 4LIQH 4H88H 3CSPA 3E2HB 1N0XH 2I5YL 4QRRB 4PTTA 3ARZA 5DJ8A 1II4E 4LDEB 5FF6A 5I1KL 1KC5L 4PJ9C 3QNXA 2IPUG 1OW0A 4KWUA 4FQJH 2WINB 4FQCH 2ZUQB 1OARH 3IDXH 4PGDB 1OD9A 4UBDC 5CBEA 2GAZB 3DVGA 4I0KA 3TJHD 3WLWC 1UEYA 1U8QA 4LSVL 2E3VA 3V2AR 1UZ6F 5DI8A 5E8OA 4GS7B 3C09C 2FYYA 3MYZA 4YDKH 1T0MA 3ARGD 3BUTA 3VXTA 2H8PA 4NBZB 3PGDA 1IQDA 2FD6H 3WUWB 3U48A 1D5XA 4I5BA 3GKWL 4FABH 1CI5A 4LU5L 4EI6A 1IC4L 1QNZH 1IEAB 4U1IB 3QNZA 3T1FA 3WYRA 4R90L 4G43B 3U7AA 4XTRD 2FECI 1OP9A 4K3GA 3WN5B 2ARJA 5I1IH 2OL3B 3C8HA 3LD8C 1EMTL 1VKXB 4CVZB 1CD1B 1Q8MA 1GGIL 2A1WH 3D25B 3QPQC 4N5UA 5DMIL 4MNGE 1TITA 5BRZD 1FJ1B 4UQ2A 2BVOB 3BESR 1QSZA 3FHQA 5D1ZC 5TPWH 4F7PB 3QIUA 1XF3B 5C0CD 4F3FA 5I1HL 3MLPA 4ZPVA 1JFQL 4ISVA 3MSPA 3G5XA 2H32A 2V17L 1U3HB 2DN7A 3KXFB 3BGMA 4YAQA 5BV7C 4BSWA 3O8XB 2MWCA 4P3CL 4UAOB 2EIEA 2P24A 1JPTH 4PLJD 1MCWM 4PJGE 4JJ5A 1U8JB 5CJOH 2B5IB 4JFXB 1BWWA 1UG9A 1NGQH 2EDBA 3T0WA 2WV3A 3TNNA 1N5YH 1RHHB 1XR9B 3Q2CA 4WUUE 1EDQA 3C6SA 3EDFA 1UWGL 4UIMB 4EVNB 1A9EA 4OIIL 2R1XB 3LQZB 4QHKJ 1A9BB 2H26A 3KYKH 5KS9E 4RAVA 2R8SH 1C1EH 5CWSB 4MS8C 3P11L 4TNVK 3MJ9H 4XB8A 1TVDA 4M8VA 1BFOA 3TYGH 1HILA 3DROA 4WFGE 1BBJA 3GMLA 1UM6L 1LE5B 1DBAH 1S8DB 5E9DA 1DTUA 5FOBA 2BXYA 3HUJE 1Z3GH 2VUYA 4RBPH 5D1ZA 3K8LA 2X89D 4EOWL 4HXBL 1SBSH 4I3RL 4M61B 4OBRA 3UZEA 3OF6A 3ARDB 1CXHA 5IHUH 4F57L 2V9RA 4D9RD 2YRPA 4E42B 1F42A 5FO7A 3SDXE 3NA4A 1KACB 2MKLC 3CFKB 4R0LC 1RVFL 1RZ8A 4IRSB 1BM3H 43CAA 3LKQB 4C59B 2GK2A 1NEZB 2NW3A 4LLQB 3EO0B 1YMME 4OCWL 2OR8A 1N26A 5JO5B 1N6QH 4KDWA 3L3DB 1Q72H 1CN4A 1WK0A 5SWQA 3RI5K 4MD5B 4MAUL 3FOMA 4RGMB 2Z31B 1NL0H 1V05A 2C3VA 4XMPH 3T0XA 4LPYA 4U1SB 4WHCA 4TUOB 3BW9A 3CSYB 2JIXA 2V5SA 4FTVA 3U46A 4ODWB 3WCYA 5JPMA 1CGSL 1W0VA 3FT3B 1NJ9A 1VGEH 1FBIL 4AT6A 1JYWA 4XAKE 5C3TA 1BX2A 5DJDB 3VXRB 3MRHA 5HDLA 4P49A 3TN0B 5HHOA 3EJYD 4MNHA 1JNNH 2BMKA 4YC2B 1BF2A 4L3EB 4JZNA 5TDNA 4IMKC 1OTUC 3WSQH 3OKKB 3BX7C 2GJZA 1F5WA 5TF1H 3WNOA 2LTQB 1QRNE 2ZCKH 3VGFA 1JYXA 2DLFH 1A6TB 4I3SL 1FZMA 2UZIL 3G08B 3PDDA 3QXVA 1W8NA 4R6UA 5DA4A 1U8NA 4X4YA 1DZBA 4R0LA 4L29B 2B1HH 4UDUB 3P73B 1KIQB 5F7NC 3OJVC 2AXHA 1BOGB 3VD3A 3CFBA 1NFDE 4NM8L 4JY5H 2QQLH 4M1GH 2VR4A 4LLYB 5I15L 4I0PB 1LP9F 2B0SH 2CSPA 2FR4B 2Z9TA 3EBAA 4YHYC 1FGVH 1NGXA 5IBLD 5T5NG 12E8L 3TCLA 5I74B 3FJTA 4KTDL 5CSBA 1XGPA 3L3HA 4G80A 4HMDA 5JLZA 4CKVX 3FN0H 1KPRB 4UT6H 5DS8B 3ZE1F 3DUSA 2AJZA 2YUZA 5FCSH 1HSBA 4Y7MA 4XVSL 5F1NA 2EH7H 1HWHB 1TJGL 3PHOB 3MLWL 2FB4L 4ERSH 3OV6A 2BY3A 5T1KD 4UV7H 3D3VA 2P49B 1D6VL 4JANA 2HJLB 4JQVC 4QOKD 5MENE 4IMKA 3SGJA 1BFSA 5GGSB 1MAML 4JM2F 1TCRB 5HGAB 3X17A 4NQXB 4N0CC 4NNPL 3ZKMC 3EDKA 5EOCL 5INDB 3QUXD 3OBAA 3DYOA 4L1HA 5SV3A 2R0LL 3OKMA 4G6FB 5BQ7B 4AL8H 2V5TA 2GSGA 5LAXB 3FRPA 1CF8H 4D0CB 1VERA 3NGBC 5MHSE 4XAWL 1JGVH 1N2RA 2VDNL 5CJQL 4EDXA 4NJAL 1CFVH 5DQDH 4GRMA 3TO2B 4S1DC 3DGGB 4PJDE 1OLZA 3KLAB 5KVGL 4PRDB 1MFEL 3V6OC 3ZSTA 4XP1L 2OK0H 4Z7UE 5BJTA 3I6KB 4JN1H 4A6YB 4DKDC 3NTCL 3HC3H 5L2KE 5D6DA 2IAMD 2AJ3A 1I7UA 1JPST 3VGHA 3IJSA 1QHPA 3OMZA 5IB1B 5IM7B 4XNQA 5D72H 5HGBB 1MQ8A 1IVLA 3C9NA 4YUEH 4DN3H 4YEFA 1J0YA 3FQWA 4JQVA 4NGHL 2VXUH 4NN7B 2DWDB 4NWTL 2H6PB 1ZLVH 2JTDA 3WDHA 5E03A 2EKSB 5MEOB 4JRXD 4ZUSA 1CQYA 2GT9A 1V7NL 4RIRB 2NXZB 1B3JA 4V1DD 3MR9B 3W0WD 5CJXA 3K81A 5AUMA 4AG4L 3BH8B 2DJSA 2E9BA 2Q8BL 4NC0B 4DEPB 1GGBH 4QHKI 3CLEH 4PJBE 2JE8A 3T3PF 4DUVA 5E1AA 3EOYG 2V7HA 4C56B 4D9LH 2XXCB 2P1YA 5DFTA 4UDTB 1YEIH 3IXTB 4KDTC 5JIPA 5FM4A 4FQHB 4Q6YA 2FEEI 1I9JL 3V6OA 4TQEH 3QUMB 1Q9WB 1WV7T 3NIGE 3VXSD 3ABZA 5F88A 2P44B 1I3RA 2IPTH 2QHRH 3GNMH 4I18C 1IGCH 3BGFC 2W0KA 1HCVA 1ZA3A 1P7KA 3QR2A 4PGEA 3BZEA 1F90L 1SJHB 5JDSB 2ZNXA 4PJXE 2O5ZL 3B9KD 1NCCH 4Z8FH 2IQAA 4OZFB 4YBQD 1RSFA 5J7CC 2C4FU 4HH9B 1A1NB 4NQVA 3JV4B 3FQTA 3FZUC 4Z76A 3O2DH 2G75B 4GUPA 3IVKB 1JHTA 4JR9H 4LSPH 1N6VA 1MIML 2GCYB 3MODL 3ARVA 3VDCA 2E6JA 1MREL 3IXAA 3GSUA 1A0QL 5BOZG 3MRCB 2XKSA 3QCTH 1CDHA 5GISL 3TYFB 4JHBA 4LPXA 1A4JA 3GMOA 3VG0H 4U1HA 3O4LA 3N1GC 2AK1H 4KDTA 3I6LE 1BD2B 4UUJA 2XZQH 4GBXA 2Y06H 1FYHB 3VWKD 4AENB 1I8KB 4G6AC 3KNBA 3QQ9C 1UB6A 2HFFA 3HC0B 5SX5H 3QG6B 4PRBA 2CDGB 3EHBD 5AEAA 2HFTA 4I18A 3IB4A 5IFAL 3ARTA 1CIDA 2BVQA 3MRMB 4MA1C 3WNMA 1N0LA 1RIHH 4M7KL 2XQBH 1D5ZA 2HJFB 4G6ML 4KY1L 5CGYD 1SVCP 3WIHL 4WUKH 5E8DL 2WZPD 3CXHJ 2I9LB 4P2RA 2CRIA 3DI3B 1RZJC 1WTGT 4ENEC 1TNMA 4QWWD 1S9YA 3NCYP 4X7TB 4ZO6A 4CN6A 4ZXBC 1NGYB 4X6BA 4X7SL 2Q76B 5C0NC 4BH7A 2VXSL 3ARED 1WUNT 3V5KB 5A43C 3EFFB 3KPNA 3NCMA 5I19L 3CU7A 4P4KB 4ORGB 2FHFA 1EEUA 4N8VB 4P2CG 2JJTC 3T2OA 5AZEH 4CU8A 4EN3D 1YJDL 2IFFL 3WFHA 3L3IB 2NY0B 5IVXA 2I26N 1OSPL 1MRDH 5MI0B 1F3DH 5HGDB 4GOSA 4H25B 5CKAA 1HEZA 2BNQA 5ILTL 2ZZUT 5LCVH 3VXOB 5KSBF 1U8OA 5B39A 4PUBH 3DX9B 5IB2A 3WLBB 1HHIB 3B5HA 5C0BD 3U9PH 3RAJH 4NKMB 1WBYB 2R2BB 3IETB 2X4OB 5C08D 5ISZA 2B7DT 4R4FL 3I3EA 1AH1A 3EKCA 1ZGLM 4KC3B 4AEIL 4NOFA 1HI6B 32C2B 3ROLB 1UXWB 3GMRB 4OAWB 4MNQD 3U82B 1DBKL 4LHUG 1T80A 4K9EL 4P23C 1UCBH 4WHYG 3C8KB 5CSGA 2X44D 1FGNH 4ZXBA 5IESL 2AEPL 1SEBB 2F19H 4Z7OF 4KHTL 1MRCH 3UPRA 5CIPA 4UV4H 5E2TH 1YZZA 2APBA 4GRWF 5KS9B 2IANA 2VDKL 1K5NA 5FYJU 1HNGA 4M7JL 4LLDB 1IKFL 1J05B 1AD0B 5HDQL 2Z92A 4QCIA 3LEYH 2JJTA 1RUAL 4M5ZL 2A73B 3E2HC 1VFMA 4HBQA 4L4VD 5ENWA 4XNUH 2VQ1A 1S7XB 3ZDXE 4MD0A 4O9HH 5L8KB 5D9SA 3HUJB 5DUBB 3WKNA 1RK1B 4NO3B 1VACA 4UOW0 4WEBL 4RGNE 5F89B 1D6EA 5DJYB 2A6JA 4JJHA 2CO7B 4H5SA 3FKUS 1LMKA 4D94A 2ZWLT 4MX7B 4YDJA 4JPWH 5DJ0B 3SDXB 1QBBA 1LO5A 4QF1A 1IGIH 1MJ8H 4PRAA 3UAJC 3I85A 1WQVT 2FDBP 4Z18A 3V0VB 4P23A 3T04D 3NCEB 1CDCA 3GJEB 4HDIB 1NCAH 4AEEA 5ADPL 1A6ZB 4LSSH 1HN1A 2J3SA 5SWZD 4YGVB 4PRHE 2BK8A 3MGAA 1OP3K 2VDML 3CH1B 2BSSB 3JWOL 3NOIA 4X5WA 3VXPB 2O5XL 5J4MA 4HXAH 1JMXA 2ICCA 3RVVC 1M1SA 1QZ1A 4QRRA 3PP4H 4ZD3H 4OLVH 2XY2A 1JZ8A 3PV6B 5D96C 1U3HC 3RP1A 5HTSA 4BQ9A 2DBLH 2MQ3A 5FGBC 1MJJA 4ODHH 5FYKD 3O8XC 4TSCL 4WTZA 5FDWA 1DQJB 4PGDA 5FYKH 1MQKH 4K3HA 2VAAA 2GAZA 3VGDA 1ZTXL 2B5IC 2QADD 3SOBH 3I2CH 1FNGB 2HT4D 4XPBL 5JDJA 5ACZB 2IFGA 1EGJA 2MNUA 4U3HA 1N8ZB 4JFDE 5IIEB 3TBSB 3SDCB 3SCMD 4YDIH 4ODVL 2QTEA 5BS0E 3KPMB 1EEZB 4U1IA 5KSVA 2OMNA 1T1ZB 2G60H 4G43A 5TQ2H 1KTLA 4HUUA 4TVPE 2WBJB 1DQLH 3DWTA 3LHPH 3LMJL 1NFDB 1JZ2A 4OUUB 2NY5H 1ZEAH 3EYFB 3HE7B 4OIAA 1VKXA 4NZJA 2DIAA 4CVZA 5AWNH 3SQBA 1CD1A 4M7LL 1KCUH 4OLUL 3D25A 3D0VA 5C9JA 5JR1L 4X6CA 2GTWA 3DURA 1Z2KA 2OS7A 1FJ1A 2P47B 3MRQB 4HMEA 4RISL 2BVOA 3PWPD 3FMGL 4JO2L 4F7PA 1RI8A 3OAYK 3C2AH 1WT5C 4N90D 2KZWA 2OM5A 4ORZC 1KIRB 1PGRB 4Y5XC 4TTGA 1WC7A 2YN5A 3MCLH 3KYNB 3KXFA 5D7IA 5FGBA 1CFSA 3UP1A 4JM4L 2FRGP 1D3CA 1YEHH 5L88H 4OZ4A 4ONFH 1F3JB 4HLJA 5ERWB 4MJ2A 2YOCA 3MLTB 2C1PB 4JQXC 1PYWA 1D9KD 3G5ZB 3JWDC 4FQLH 3E6FA 4IRSC 4Z0XB 3DIFB 5MENB 2FZ3B 3OR6B 1YNKL 4OSUL 1XR9A 3J7HA 3ULUF 3R4DA 4EVNA 2WUCL 2R1XA 3LQZA 2DQFB 2JKXA 2X4SB 3P30H 5KVFL 2NW2A 2ATPB 1A3RL 1A7PL 5ANME 4P2QD 5L0QB 4TVPL 4LKCB 4RGMC 1F6AA 3BZFB 4M6ML 2Z31C 2UY7A 1N4XH 1X3DA 2F58H 3OKDB 5E99L 3DLQR 3MRIB 4WHDA 1A7QH 4Z0BL 2WQRA 1S8DA 4W68A 2RQ8A 4NKDA 1F02I 5JXAH 4PJDB 4JFFD 1CGUA 2DQIH 3UO1H 4M8QB 1BEYH 1WT5A 5I8KL 1FH5H 5DVKA 3TN0C 1PAMA 2XA8L 4YC2C 5HXMA 1JGUH 4Y5XA 2DICA 5DQ9B 4PY7B 1KIUA 1INDL 4XI5D 1CL7I 5FA4B 2IALB 4YK4B 2AEQH 1RJZB 2MPAH 1KJVB 1IFHL 2HWZH 5TH2B 1JP5A 1WAAE 4PV8B 3QI9C 3V7AG 3X3GH 3CFKA 2Q8AL 3TNMB 3UTTD 3DHMA 3NAAH 5ICYB 4XHQA 3U7WH 3PJSB 4RFOH 3LKQA 4LASL 4UI2A 5T3ZL 4ZPTB 3A6CH 4LLQA 4I0PC 3NFSL 5TF0A 4OGXH 4HKJB 1CZ8L 3NIFE 4UB0L 1EX0A 5JO5A 3HNTL 4F80A 2L7JA 5D71H 4JY6B 4MD5A 5I74C 3WFBH 1J1OL 1Z9MA 5T1DL 2P8PA 5GSRA 1NBVL 2Z31A 4PJBB 1MJUL 1B0RB 1KNOB 4ZSOB 1I1AA 2Q86B 4CUCA 4G7VL 3SE9H 1GGUA 3CK0H 3QCVL 4QNPF 4TUOA 5IGXL 1TCMA 3CSYA 4LIQE 2UZXB 2HG5B 4HK3N 5GHWL 3BP6B 3E8UL 5DEGB 2F53E 3P0VL 4DAGH 1T3FB 1DANT 4KJWD 4HLZG 5FXCH 2DD8H 2UWEE 4FZ8L 1CGWA 3QIUD 5HBBA 3VXRA 4LGRB 3WD5L 3TN0A 1HQRB 3RVXC 3A6BH 4NJ9L 2AI0L 4IMLB 2L7UA 1DVFB 5FYKU 5DRXB 1T1YB 1HXYB 5L6YL 4PJ9D 5JORB 5TJWK 4U05A 4QRPA 1A6TA 4QXUH 5GGTL 3G08A 4OKDA 3LQMA 4K3DH 1LEKB 3V7AE 3QI9A 4UBDD 4X7DC 3WLWD 1UWXK 3L5JA 15C8H 4XCNB 3Q48A 4KRPB 3TFKC 2BDNL 4XB7A 3OAZK 4FOMA 1AXSB 5KTEL 2XKNB 4OLXL 2FJFB 4I13B 1OB1A 2UUDK 3HZYB 5DK0A 4LLYA 3QA3A 1E6JL 5D70L 4I0PA 4BUGA 1GAFH 2FR4A 3FOLA 2X4NA 3MFFA 4M1DL 1KB5A 1R0AH 2ERJC 1AC0A 5D5MA 1CL7H 3KPQA 2AJUL 5FUOL 1JHLL 2B2XH 4K7PX 2QQKH 4ODTH 4S1SL 1B88A 5DS8A 5DQJB 5HVFB 2ZPKH 3QWOB 3E3QC 1PKQE 1DJSA 1E4KC 5E9DD 4LIQL 4H88L 3IDUA 3PHOA 5D1ZD 4RAHA 1N0XL 5C0CE 3VI4F 5I1AB 4YGAB 1MCFA 3OF6D 4FQJL 2GIYA 4FQCL 4NN7C 4MJ4A 5GGSA 1MCKA 3RIAK 1EAPB 1TCRA 5HGAA 4NQXA 1OARL 3IDXL 5C0JB 5J3HC 2AJXH 5I17B 5E0QA 2A9NH 5TGBB 3TBVB 3EZ8A 5IB3B 5BV7H 5KZCB 1EV2E 1BVLB 4NBYB 2FD6L 2PW1B 2I25N 4FABL 2R69H 3P4MB 4Z7NE 5JTWA 1QNZL 2A74B 1OAQH 4P5KA 3PWVA 3CVHB 5ABDE 3LKSA 3DGGA 5I1IL 3DJ9A 4YHIB 5KBNC 2Q7YB 1HHJB 4MS8D 4PRDA 4HV8B 1KYOJ 4X4ZA 3OWEA 2A1WL 1RJCA 4M4RA 4JFEE 5DO2C 2JIXD 4BFEA 5ALBH 5TPWL 2A6IB 4YO0B 1VPOH 2KPNA 5SWSB 5FHBH 1SJEA 4K7PH 2EEBA 1HYSD 1AKJB 3ZO0A 2VZVA 3VWJD 3N50A 2DWDA 1JPTL 3RL2B 1JK8B 3DX8A 3QPXL 4DJMA 5CJOL 1LWRA 3P9MB 1JNJA 1NGQL 3MR9A 4KKCD 5DMGC 2BRQA 3PP3K 1N5YL 3WKMH 4ELME 4R4BA 3QAZB 2H3NB 2NNAB 3WE6B 4EI5C 5EPMB 1O0VA 5KSUA 4NT6A 2E7LC 2LU3A 2ENSA 3KYKL 4C56A 1BREA 3F58H 1F13A 4PJ7E 2R8SL 1C1EL 4MCYB 4UDTA 3IXTA 5EU5A 3MJ9L 3SGEI 4K71B 4BZYA 1VA9A 3VXUD 3TYGL 4U1JA 2VQUA 1T6WA 3IDIB 4G9FD 4HAFA 2DYPB 1FZOB 1C7SA 2BY1A 4R7DB 2Y4SA 3W9DA 5EFIA 2Y5TA 1DBAL 3IAGC 3SJVE 2P5EE 2OTWB 5JDSA 1Z3GL 1ES0A 4BQBA 5EU6E 1P9MC 1SBSL 1CDYA 3INUH 4LLWB 1NDGB 5IMKB 3D3VD 1A1NA 3HRZB 4MMXC 2X70B 5IHUL 3JV4A 4ZUUA 2BSED 3QXDB 2R2HA 2FECL 4JFYB 2J6EA 1OTUD 3CDGB 2YXFA 4PJIE 2ARJQ 2G75A 2DQJH 3WIIL 5F7HA 3PE9A 2X4UA 3IVKA 5FGCE 2F8XC 1XIWB 4UQ3B 4EUPG 5DYOB 2QQQA 3RHWK 1YY9C 4P4KC 5IWLA 3ZYIA 1BM3L 4XP6L 3WS6C 3K4AA 3MRCA 3W5NA 4LARH 1C16B 3TYFA 4U33A 4EI5A 3S5LG 3O45A 5I1DB 1N6QL 2E7LA 5MI0C 3DBXB 1Q72L 1IM9A 1M71A 3O11A 4WHTA 2CIKB 1H0DB 1LO3H 1HHKB 4PJ8A 4PY8I 3NPSC 4AENA 1I8KA 2E5EA 4XMPL 3UJTH 1IAIM 3LKNB 3BD3A 3HC0A 3LKRA 3Q0HA 3KYOB 1QFPA 2W1NA 4LCUB 4FXKB 2VIRB 1VGEL 1GC1L 3MRMA 4MXWH 4G8GB 4HUMB 5GGUB 1P9MA 2EIDA 4RA3A 3GSWA 1JNNL 5C0RH 2Y36H 3MBXL 1S7SA 3WSQL 5CAYB 3RGVB 1LE9B 1FN4B 5TF1L 4K7PY 3CGTA 3P0YH 4X7TA 3U4BH 2DLFL 1X5IA 1T2JA 3OB8A 4JFDB 3SGEH 3F7VA 1JGEB 2FIRT 4ZTOH 1Q0XH 1NGYA 4N0CD 4BFGA 4U7KA 4I48A 5FYLE 4HUNB 5BMFH 2B1HL 5BS0B 3MOBH 3CFDA 2QLVB 3EFFA 4Y4HA 4P4KA 4JY5L 2EDWA 4KTEH 3WS6A 2QQLL 3BDXA 4M1GL 3B5GA 1MUJA 4N8VA 3BEWA 4EXKA 1CDGA 1HE7A 3TC9A 4ZQKA 2B0SL 5B3NA 4YEEA 1YEKH 2MQCA 1FGVL 4Z6AT 5HGDA 1ACZA 3I75B 5BXFA 4FQXD 4S1DD 3VXOA 1KBGH 5B8CB 4WDIB 3FN0L 4PRIA 4NKMA 1WBYA 2R2BA 5CLWA 2GY7B 2EIBA 2X4OA 3B6SB 2EH7L 3QQNA 1NC2B 1F4AA 4ERSL 1HI6A 32C2A 3GMRA 3GRWH 4OAWA 2J8UE 3FRUB 4N0UE 5FOJA 5TQ0H 1PQZA 4O2EA 5ALCH 1I8LC 4KK9C 4M6NH 1KJ2A 1H8SA 4TRPH 2YD4A 1EFQA 2F15A 4C55A 4V1DE 3TPUB 5DA0B 4AL8L 3BOVA 5FYLL 2OJZH 3RUGF 4P9HH 5ANMB 1CF8L 4LLDA 5EU4B 1AD0A 1IC5H 1JGVL 2A73A 4MSWB 1EEYB 4CMMB 1LO2H 1EO8H 2BY0A 2KZ1B 4HWBA 1CFVL 5DQDL 1QFUH 2H9GB 4XGZB 2OTUB 1WWAX 3O4LD 4H0HB 4F7EA 2VZ3A 5E8EB 1G9MH 1Z5LB 2JCCF 1OTTC 2C4XA 5EBGA 5DUBA 2OK0L 5H94A 5E56A 4JN1L 5EG6C 4LHQB 1MVFA 2WMPA 4NO3A 3HC3L 1QRKA 4WWKB 1JN6B 1DDHA 5EO9B 5GS0C 3F12B 4HX1B 1IAII 5D72L 1U93B 2X4RA 2HFGH 4MX7A 3SDCC 3VFVA 1IC7H 4KGJA 1DLHB 4YUEL 4DN3L 1J87A 5C0GB 3Q6FB 5DURB 4P2RD 4BSVB 1T1XB 3HCVA 2LVEA 4OCXH 4Z7WE 2WBJC 2BNRD 1RMFH 4HDIA 3SDDB 1I8LA 5T33H 3FZUD 4BKLA 1A6ZA 5ITBH 1EBAA 3K2UH 3MV8B 4OD3L 5JMOC 3CH1A 2BSSA 3IDMB 3PWNB 3VXPA 2BOBB 4GKNB 3BEVA 1NGWA 3F7QA 3EJZC 1HDMB 3HZKB 3MCG1 1GGBL 3CLEL 4OIBA 3TZVA 2C7UA 4D9LL 5D1XB 4Y2DD 3ZE0F 3PV6A 2IH3B 1YEIL 2YBRA 3GJFA 3FB5B 1I1FB 1DUYB 2VLRE 4LSRH 3FL7A 2BNQD 2F53B 5IBTH 4TQEL 4WI7A 3T2QA 5KW9H 4GW5B 3G6AB 2IPTL 1CLZH 2QHRL 1DE4B 3GNML 4PYGA 1T04B 3UXFA 2ED9A 3ZTJH 4JFZH 1IGCL 1S9WB 4HUVB 2P7TA 1N59B 4UOW1 5ACZA 4Y19A 4E0RA 1N8ZA 1NCCL 4Z8FL 3MUZ1 2F5AH 2I60H 3TBSA 4X6DE 4M48H 2HH0H 4B5EA 1AQKH 4ONGH 4YZFE 4HUKB 3IT8D 4PIRF 1T1ZA 3EO1A 1FSKC 2JJUA 2WIIB 5HYSG 4Z7VB 4RDQG 4ENED 3O2DL 5T3XD 2MCG1 1LILA 3ULSB 4L8BB 4OUUA 4WVRA 1RZJH 4S1QH 2XXMB 4JR9L 4LSPL 5T3XH 1Y6MR 1OSZA 2YWZA 2A6KB 5B38A 1OGAB 2R23B 2BOCA 3VG9B 5DEZA 2NXYD 5FA3A 3S3PA 3VFRA 4WW2F 5HVGB 43C9A 3QCTL 2CXGA 2IAND 4OCLC 3QDMD 5CIPH 5GGRY 4PJCA 5EBLB 3VG0L 4XC1H 1KIRA 5E8PB 3HTLX 2EIZA 4MQSB 2AK1L 3WHE0 3KYNA 4LLAA 1T03H 1PKQB 4YK4C 5EOTB 1KJ3H 5GRUH 2EDNA 5ERWA 5KG9B 3F7YA 4FG6C 3MXVH 2C1PA 4I1NB 1MH5A 1OTSC 4Z0XA 4HQQH 1X5LA 5MENA 2FZ3A 3AUVA 1RIHL 1R5WB 2V2WA 2EYSB 4XCYA 5C7XH 4WUKL 1JNLH 4O02H 4MNQE 3MJ7B 2DQFA 4XWGH 3VDAA 4JG0H 2AEWA 4LCCB 2EE2A 2ATPA 3GSXA 3KDMB 1S9VB 4P23D 4HBCH 4C54A 5KVMC 3VDBA 2HVJA 1QSFE 2FEEL 3BZFA 3VRIB 2ZSVB 5EDXA 5DJXB 2YRZA 5F9WB 5D2LA 5EIQA 4GLRI 2AXGA 2J8HA 3MRIA 3V4PH 4LSQH 1MCJA 4N0YH 2ZCHH 4OF5A 2EE9A 4XNMB 5K9QG 5HYJD 4QHLA 3W9EB 3EYOB 5AZEL 4HS3B 1H3PH 1NCBL 4L4VE 1MRDL 1Q9OA 4QRRD 3HA0A 1ZHLB 2R0ZH 4PY7A 5FECA 4X8JB 1DVFC 4JFEB 2DTMH 5FA4A 1NMBH 5LCVL 1IGJB 4HKZB 1FLTX 4PUBL 5KAQG 3SDAB 1GRWA 4RGOH 4HGKC 5TH2A 1PFCA 3RAJL 3S37X 4EQ2A 2WQ8A 5I1CH 3TNMA 2PYFB 3MREB 1HHGB 1CE6B 1QFOA 3IJHB 2PO6C 1B90A 3PJSA 1GIGH 3V9FA 2Y6SC 3W39A 5DTFB 4POZC 5FM5O 3K8MA 4N0RA 5MEPA 3UAJD 3DO7A 3PXHA 5HDBF 4DOHE 4JY6A 1T21A 1EFXB 1FGNL 3RWCB 4MWFA 3Q6GH 2F19L 3M17A 5SWZE 4ZSOA 2Q86A 1ZVSB 3MJ6A 4UV4L 2OL3H 5E2TL 5JW4M 5C0AA 3DETC 4X99B 4L8DB 3FN9A 4RCAA 4PJ7B 3BP6A 5DJ6A 4U2YA 1T3FA 4YHLH 3LEYL 3LN5A 1TZHB 1QOKA 1JHKL 1T4KA 4J3TA 1C7TA 4MAYC 4NYLB 3GB7B 4XNUL 1HQRA 2JJSC 2HVKB 3MA9H 4IMLA 4O9HL 5E2JA 1DVFA 1U3HD 1T1YA 2A6DB 5EO1A 2P5EB 3KXFD 3REWB 3SJVB 3X11B 2GK0B 5JORA 1OY3B 4LSTH 3O8XD 2CJUH 5EU6B 4JCLA 4YHNA 4NZTH 2EYTA 5F7DB 5DJZA 4ZS6C 1Z9LA 3DX6B 2IPKB 4XCNA 2AJVH 4GLRH 1AXSA 2XKNA 4K2UH 2FJFA 3EYVA 3NA9H 2PO6A 1W72A 3MUGB 4PJFA 3HZYA 4LPTA 2R4SH 3V79C 3IDJB 4JPWL 4PJIB 5E7BA 5D93C 3UYOD 1IGIL 1MJ8L 5JW3H 2VMFA 3S37H 2WNGA 3ECBA 5DDHB 2ZOLB 1NCAL 3QO0B 4DK3A 4NO2A 5LGKA 3IDGB 3QEGH 1DL7H 5AG8A 3WJJC 4JEGB 3RFZC 1KT2B 3QYCA 2GSIA 1J1XH 3QFJE 3W82A 2F54E 4KKLC 1CLOH 3QWOA 3RVWC 1C12B 1SYSB 4M9OA 3PWPE 4D9QD 2MQ0A 5E5MA 3GUTB 3GSNB 5E8NB 1Q9KA 1IKNC 1P6AB 3OTTA 3PP4L 4ZD3L 4OLVL 4OZGE 4MAYA 4X4ME 5DC0A 2DBLL 5D7KD 4ODHL 1XH3B 3RVTC 3ARDD 2VYRE 4YNYB 1EAPA 3IFLH 4AYFA 1MQKL 5I17A 3LKPA 3RZCC 3MV9A 5TGBA 5T1KB 3I2CL 4U0RB 5BCAA 5IB3A 4RNRB 3N1PC 4G7YL 4OZHE 1BVLA 5IHBA 4IRSD 4X8XA 3MYJA 3QAZC 5EOQH 3QWQB 3ILQC 4YDIL 3P4MA 6FABH 1TVHB 2A74A 4WW1A 5TQ2L 2R2EB 4OFVA 3VE0A 4EUPB 1CLYL 1DQLL 4P2QE 3LY6A 5CEZE 2D4FA 3LHPL 4FMFA 3ULVE 1CDBA 1BQLH 1HHJA 2NY5L 5GGVH 1QA9B 4DCQB 1ZEAL 5IOPB 2Q7NA 1FNAA 5AWNL 1ZHNB 1KCUL 2Z31D 3WJJA 1LEIB 2RJMA 3BVNB 4NQCA 1AC6A 3FQUB 1BJ1J 5IVOA 2A6IA 2NZ9C 3P0GB 4LBEB 1UXSB 4JQIH 1OGTA 3HMXA 4X98B 3C2AL 3RWJB 2Z93A 1LEGA 1IAKB 1IKNA 4W6YB 5SWSA 1U91A 2DLEA 4WCYH 3OGCB 1LO0H 3VXRD 2DQHL 1YYMH 3MCLL 3TN0D 1IGFH 4L3ED 1YEHL 1NDMA 5L88L 3RL2A 4ONFL 3JV5A 3NH7H 3TBTA 3B5TA 4KFZC 3QJHA 3RZCA 1K4CB 1XIWC 2J8UB 5DVOA 4FQLL 4U1LB 4FFVC 5JPNB 5CD3A 5M94B 3PG2A 4N0UB 1U8PA 1KPVA 2XFXA 3CZJA 3WE6A 4IS6B 4MQ7B 4EEEA 4IIQB 1C5CH 4I0PD 2R29H 5KSAA 3D85A 2H1PH 4V1DB 5IJVB 4YIQA 1I75A 2H41A 1N4XL 2F58L 3TO4C 2ZKHH 1CU4H 1FG2A 2PF6A 4YBLB 2DYPA 1FZOA 3FO2B 4Q9QH 1A7QL 4R7DA 5HYEA 1C5DB 1BP3B 3ZLQC 5E08H 5EU7C 5JXAL 1GZQA 1NC4B 5DMKA 4CMHB 1XT5A 3BIBX 4LMQI 3UO1L 5J8OA 1I8IA 4PJGF 1BEYL 4UNTA 1S7TB 1FH5L 2YD6A 5EORH 1NDGA 1UENA 5DGQA 1JGUL 3KPLB 2DQEH 3FQRB 3RVXD 1MFCH 2ADIB 4Q9RH 4JFYA 3UZVB 2AEQL 5D6CA 2HWZL 2CUMA 1NMAH 2VSDA 3X3GL 5KS9F 1QUNA 3RY5A 1XIWA 3L6FB 4UQ3A 2CRMA 3FO0H 5DYOA 1B4RA 3U7WL 2FIKB 4JHWL 4Z7WB 4AIOA 5IVNA 4RFOL 3TFKD 4G6FD 4OCRH 4W6WB 1A8JH 3GO1H 3A6CL 2YD9A 3GFUA 4X9BA 2NY4B 3G9VA 5HYQB 1AGCB 4P4RB 4UILH 3OJ2C 1CK0H 3AS1A 2DWEA 3MGTB 3TIEA 3O6FB 4H8WC 3HUJF 4QXGL 5EOCJ 5D71L 2AP2A 5JOFB 1JZ4A 1RZGB 3WFBL 2Z35B 1H0DA 3VFTA 1HHKA 1XGRA 5J12B 3SE9L 5GGVY 3MROB 3B9DA 4XPTH 3TO4A 3CK0L 3LKNA 3ZDZE 2QSTA 3MZGB 4BUHA 1NUNB 4LCUA 4DAGL 1BOYA 3ALPA 4A6YH 5TE4H 1KCLA 3JVGC 3OKOA 3SDXF 4F9LC 2VLRB 4G8GA 2DD8L 4QKXB 4X80H 3VFMA 4XVUC 3QFDB 3A6BL 1UQSA 2CMRH 3B2VH 2CR3A 1NUFA 4XP4H 5ICZB 1LE9A 5DVMA 3CX2A 1FN4A 1QTYT 2NY2B 1H5BB 1FO0B 5EU3B 3KPPB 4QXUL 3D5OF 4ONOA 2BZDA 1OAXL 1JNHA 1S7UB 5J3HD 4X6DB 2SEBA 4CGTA 2W38A 2CRZA 4IDJH 4U6VH 2PTVA 4U6TA 4WFFD 4F8TA 3ARPA 2K7PA 4PREB 1J0KA 1ORQA 2B8OT 3G6DH 1GAFL 3WEXA 3LN9A 1R0AL 4C56D 3I75A 3KPRB 3D0LB 2D9QB 5CZXC 1CL7L 4JCMA 4ODBD 2COQA 2B2XL 1OLLA 2QQKL 4WDIA 4NOBA 4ODTL 2D03H 4G6JH 1QFWM 3H9SA 2ZPKL 2VDRH 2P8LA 4Y5VC 3QUMH 3NCFB 4FTVE 3BPNB 3OKLB 5DO2D 2R2CA 4RWYH 5IB5B 3LKOA 4FQQB 2C5DC 3KPOB 4U6HB 5JQHC 1KEML 4XNZB 1NFDF 5HHOE 1NQBA 1H3TA 4G8EB 1LHZA 1OQOA 3WFCH 3SQOH 2GQHA 2HP4A 4AEFA 3SDDC 4ZNEA 2AJXL 1WWCA 2A9NL 5BV7L 1HXMA 4MNQB 4HS6B 4DWHA 4LU5H 1U8MA 1AP2A 5GGSY 1Y18A 5EZJB 4WNQB 5DMGD 4NNYB 4MB3A 5EU4A 2R69L 4OD2B 3FRPG 4NSKB 1AHWA 1QSFB 2ZCLL 2ZOKB 4MSWA 1EEYA 1YMHB 4HIJB 5D1XC 2HN7A 2IBBA 4QRUB 2H9GA 1F11B 5E8EA 1U8IB 1Z5LA 1BD2D 2GI7A 1PZUB 3E1F1 2VAJA 3MV7B 4JDTH 5B22A 5CP7B 1CXEA 1CGVA 4L4VB 2CDEA 1A02N 5IW3A 5ALBL 1S5IL 4Y5VA 3O81A 1EHXA 4RZCB 3F12A 4HX1A 1U9KA 2E27H 3SO3B 1VPOL 1NKRA 1EIBA 3RX8A 2J1KA 5FHBL 4K7PL 4L4JA 3HS0B 3D3VE 5IG7B 5C0GA 4BSVA 1T1XA 1HOCB 4ETQB 4E5XB 5C86A 3CDCA 3DV4B 3ET9F 3SDDA 1WSST 4P0DA 5DSCB 3WNPA 2IADB 3SO5A 2EECA 2H2PC 3MV8A 3VG9C 4Y4KB 4PJDF 2VDLH 2BOBA 4GKNA 4B53A 4X6EB 3WKML 3QISA 1WWBX 5GS2D 1YY9D 4P4KD 1A5FH 3IFOA 2VL4A 4Z7UF 2EDKA 3I50H 3GMPA 4DOHB 4JFQB 3BE1H 3UDWC 1U92B 5F3HA 3GK8H 5GS2H 1EPFA 5GQBA 5SWZB 2O93L 3F58L 5D1XA 2NY0D 5EN2B 2BVTA 5E5UB 1A3QA 5I18H 2ESVB 4NC1C 1DUYA 2EC8A 1UC6A 4I9WE 1D5BA 3BZ4B 4F7MB 1FQ9C 1J5OH 1UWEH 3G6AA 1AO7A 4MGXA 3TBWA 1T04A 4Q6IB 1MRFH 4FQPA 4J3SA 2XWBB 3O2VH 3PWLB 3OAUL 3S4SA 2YPLE 5JHDB 3INUL 4XCFH 4PPTA 1QFWI 3MUHL 1TZIB 2VXQH 3L7FB 3GSRB 2FGZA 4HJGA 1U8KA 2R9HC 5DC9B 1N64H 4Z7VA 1DQQB 3K2MC 5FIEA 4PJBF 1UZ8A 5J6GB 2DMCA 3ARSA 3PWUA 4AZ8A 4DKAA 2DBJA 1MWAB 1I9RH 5F9WC 2ITCB 5C0EA 1Q38A 2A6KA 1OGAA 3O9WB 4YDLC 5BZWB 1XCQB 4CVUA 1RZ7H 1SHMA 5J56B 3R06A 3RZWA 1J0HA 4LARL 4MQTB 5GRVK 2KQNA 5EBLA 2EXWC 4OJFH 2Y9RT 5BZDA 1T1WB 4HH8A 4KZDH 3QFJB 4PJXF 4R26H 2AW2A 2F54B 4WFGD 1OP3H 1MHCA 4UNUA 1LO3L 5DLMH 1X5XA 5FO9B 3A0OA 1PKQA 3SDAC 2AERT 4HWBH 5EOTA 3V6OE 3U4EB 3UJTL 5EUOE 5I0ZA 1CGTA 5DD1H 4RAUB 1AXTH 1LO4H 4OZGB 2P5WE 4MXWL 4QXWA 3TH4T 1RV6X 1N6UA 3MGOA 2W0PA 2FHBA 1LNUB 4N9GA 5C0RL 2Y36L 3GSOB 3MRKA 3ISWA 5IMOB 3RVUC 2UZIH 2QSCH 3PGCB 3P0YL 3KDMA 4ZDHB 3G5YB 3U4BL 3KVQA 4OZHB 1QG3A 2V9TA 4HIIB 1TPXB 1WLHA 3S97C 3SKJH 4YPGB 3VRIA 4ZTOL 1Q0XL 1L0QA 4KK9D 2ICWB 1T5XB 4X6FB 5BMFL 3MOBL 3GSVA 1LDSA 1MIEH 5FEBA 4X83A 4NHUA 4KTEL 1UH3A 1QO3B 3UJJH 3RL1B 3WIFA 4J12A 4P2QB 4JRYB 3EYOA 1OAYL 4HS3A 2HAZA 3NABH 3VH8A 2XPGB 1QFWH 4JAMB 5LKNA 1ZHLA 3P4LA 2E8ZA 3O4LE 4XPGH 3ZT5A 5LQBH 1KULA 1UA6H 2NLJB 7CGTA 3OR7B 4IOIB 4Z9KB 3DOSA 1Q94B 5CEXB 4CW1B 1KBGL 2EC9T 3SDAA 3ZTJG 3WHE1 3GJFH 3F62A 5B39G 4XVSH 1OTTD 3WS3B 4F7TA 1S9KC 3IDYB 2FNBA 4QT5B 4XAKD 3EYUH 3OAYH 5H8DA 3B8SA 4PTTB 2PYFA 1QLFA 5DJ8B 3MREA 1HHGA 5FK9A 3PWJB 3QEHB 3FAWA 4WO4C 2W9LA 3DARA 5GS0D 4Y19D 5E4EC 3GRWL 4OLEA 4TSAH 4LNRB 5DTFA 3MACH 3SDCD 5GS0H 4KJQC 4JFOB 5CBEB 3DVGB 4Y1AA 5TQ0L 4R96B 4NFCA 5L8LB 5I8OH 5E8OB 2WBJD 4LPCA 1T0MB 4M6NL 5K59E 5IK3B 4TRPL 1HCFX 3PGDB 2OSLA 1IQDB 3UYRH 3VFNB 1D5XB 3HE7D 1ZVSA 5GRJH 2N4IA 4EI6B 5I76A 2Y7QA 2D0GA 2OJZL 4X99A 4QHMA 4L8DA 2ORBH 5C70A 1PY9A 2APTA 3EJZD 3CVIH 2ARJB 2R15A 1LO2L 1ERNA 1EO8L 1QFUL 4NYLA 5IVXE 2W59A 4JKWA 1KENH 3S8WA 5T1MA 1Z0NA 3L3OA 4GMSH 2DJ4A 1G9ML 1CS6A 3Q5TA 4KAQH 3SJVA 2P5EA 3QH3A 1IM3A 4OBSA 3REWA 2BNQE 2GK0A 3LIZH 1CT8B 2IC2A 4NFDA 3FQNA 3MV01 3QIUB 1OOAA 1JWUA 1BIIB 4PLOB 4LKXA 5ISZE 5HD8C 2Q6WB 5MEND 2H32B 3RHWF 3BYTA 4WO4A 2HFGL 2QQNL 4YAQB 3IDJA 3IS1X 3C5ZB 4NGHH 2P24B 3MLZH 5IHZB 4MB5A 5JIIA 4HGWB 3QZWB 1A7RH 1U8HB 3N1QC 4JJ5B 1RMFL 4XC3H 2ZOLA 5IVZA 4GRLB 5T33L 4U1MA 2FSEA 4TVSa 4X7CC 3IDGA 1U58A 3K2UL 4L1DA 2G9HA 3ZDXF 1A9EB 4DFIA 5MHSD 5ID0A 3U1SH 4NQUA 5C2UB 2AJSH 2CLVB 2IANE 4IM8A 4RAVB 4WTWA 3GUTA 3GSNA 2OYPA 2WANA 4OLZH 3QDHA 1HILB 3DROB 4LSRL 1EJOH 3ZHLA 1BBJB 5IBTL 3RX5A 5KW9L 1BF8A 5DFWH 5FOBB 4WTZG 2X40A 5D1ZB 1UH2A 3IRPX 4JFZL 4LF3A 1K2DB 4RNRA 4FG6D 1UZ6E 4NZDA 5JZ7C 2J88H 1OTSD 2GITA 2AK4A 2F5AL 4PB0H 1PX3A 1NLBH 4M48L 2HH0L 5E5RB 1LQSR 1RU9H 4GAGH 2Z4QA 5AYQA 1AQKL 2DTSA 3EUUA 3GGWB 4NCC1 4ONGL 4PJAA 5FO7B 3K1KC 5B21A 5C92A 2X2YA 3DI2B 2ITDA 2BSRA 1UWXH 4KK6C 1QBLH 1QEWB 3LRSA 4KMQA 2HKFH 4MJ5B 3OAZH 4DCQA 1QA9A 1RZJL 1ROWA 5IOPA 1MCCA 4NKOB 2UUDH 5T3XL 4YBLC 3UZQA 1NCWH 2XWTA 4J7RA 3BVNA 2RBLA 3FQUA 1L7IH 4F9PC 3RPKA 5DGRA 4CMHC 1NGPH 1HH6A 1UXSA 1UB5B 3AS3A 1RQ5A 4XC1L 3FOMB 1IAKA 4HFWA 4QRRE 4QRQB 3AS2A 2C3VB 1R3LA 3VRJB 1OT2A 1DVFD 5C0IB 1B2WH 4FTVB 2DJUA 3U46B 4GKZA 1KJ3L 5GRUL 5JPMB 2BHUA 3AB0C 3MXVL 3V52H 1K4CA 4P5TB 1BX2B 4ZYKB 4JPIA 4U1LA 4HQQL 3D18A 3MRHB 2YEZB 4S10A 4KVCH 4N0UA 4KRPD 5HHOB 2BMKB 2Z0BA 1DLFH 5TDNB 2NY4C 1JNLL 4O02L 4XWGL 2Y6SD 3DRQB 4JG0L 1FHGA 4POZD 1FZMB 4KUCF 3AXLB 3O6FC 5DXWA 3BN9D 1U8NB 5IJVA 3O3AA 3OSKA 3SGDI 3MQIA 4HBCL 3JZ7A 1JIBA 4R0LB 1F00I 1OAKL 2FX7H 3GBNH 3O0RH 3P4OB 1MCEA 4PGJA 2YK1H 3V4PL 3FO2A 1MJ7H 3QXWA 4LSQL 4N0YL 2ZCHL 1C5DA 3VCLA 2RFXA 4F9PA 3DETD 4X6CE 2CIIB 1ZT1B 1NC4A 4EIGB 3H9YA 2DI7A 5DUPH 1H3PL 3I6LD 4G8IA 2J8OA 3U79A 1S7TA 3B8YA 1E28A 3L3HB 2X10A 2DQUH 2R0ZL 3KPLA 4MAYD 3ES6B 5JLZB 3UBXA 1IC1A 2DMBA 3FQRA 2DTML 2NY2C 1NMBL 4WI3A 1H5BC 3DUSB 3ARUA 5DJ2A 2AJZB 3KXFE 5D7IE 1HSBB 4RGOL 2YD1A 5F1NB 1S7QA 1BZ9B 2R56H 5I1CL 4G3YL 4LEXH 5KZCD 4ZS6D 2FIKA 1GIGL 2L4OA 2DKMA 3ARBA 4JANB 5TDOA 2NY1C 2NYYC 5D7JC 1X5ZA 4F15C 1VEOA 1G7PB 2Z91B 3VD9A 1BVKB 3O6FA 2MSPA 2AEPH 1QKZL 1RZGA 2DQDH 2Z35A 3Q6GL 4JGJA 4K23H 3OKMB 2CR6A 3CVHH 3JSSA 3PP3H 2GSGB 2F5BH 1X5JA 5DT1L 2OL3L 1I1YA 1U41A 5HPMA 4KKLD 3BHBB 3BPNC 4YHLL 1AGDB 2VLRA 2WWMC 1WAAF 4QGTA 5AYUH 3B43A 1SYVB 4YFDB 5GSVB 4FRWA 5IHLB 2PXYB 2Q1EA 2FJHA 3DSNA 5SWSD 1AXIB 5BJTB 3MA9L 4XNZC 3HMXH 5ICZA 4OGYH 4PGBB 5FM8A 3RPIA 1JF6A 1P4IH 1AKJD 3IU4H 1H5BA 2MTPA 3RVTD 2AJ3B 4JPVH 4LSTL 1I7UB 2CJUL 3SGDH 3IJSB 2YPLB 5DMJB 4Z77B 4NZTL 3NIFF 5IQ9B 2EDXA 3DVIA 1S7UA 3W2DH 1NCUA 3RZCD 5DRNA 2C3XA 4PGCB 2AJVL 5HI4C 4K2UL 4OZIA 2R4SL 1AGFA 5D7JA 3KLDA 3ILQD 5D7LE 4PGZA 5JW3L 2CKBB 2XQYK 4ODSH 3S37L 3ZYJA 5C07A 3S34H 2GT9B 2VRAA 4XXDA 3KPRA 2VDMH 2UWEF 3GHBH 3QEGL