5CEYB

Crystal structure of fab 9h+3l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
232
structure length
232
Chain Sequence
QVQLQESGPGLVKPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLKSRVVISRDTSKNQLSLKLNSVTAADTAIYYCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody 9H+3L Fab light chain
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 232
sequence length 232
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ceyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ceyB01
1TJGL 3NABL 2XKUA 4JM2A 1MELA 1A64A 1I1YB 2XQBH 3OJDB 1WITA 4FQQA 1UT9A 3ARXA 2CDEB 4KUZL 1CL7I 4PJIA 1KT2A 1P7QA 3SGEH 2VXVL 3LS5H 1IC1A 4ZYKB 5E2TH 5T3ZE 5HVHC 4EVNB 3JWOL 4FZ8H 5GRJL 3QXVA 1AGDB 2ZUXA 5JDSB 1AGFB 3TZVD 4HKBB 2ICCA 4Z18A 1A7RH 3B4NA 4LLUB 3A6BL 1P1ZB 3QQ4A 1S9KC 1KNOB 2OZ4H 4U6YB 1H15B 4OZHF 4E41E 2EXWD 1P4LA 3PL6A 5I1CH 1CFQB 4HS8H 4OCSH 3KYMA 4WEMB 3OKOB 5K9QI 5EU6A 3QIWD 4P4KB 4FQIL 5E2JA 2HWZH 4XXCA 2X4NA 3L3GB 3RIAF 3VD4A 5B39G 1AY1H 3FO0H 2R9HD 3UYOD 4J3SA 4LNRB 3SEPA 3DO7A 1Q72H 3SDAC 1MHHA 4PJAA 2AK4E 3UTSD 4UV7H 5T33H 3S35H 1MIMH 5LBSL 1J8HD 4BJLA 5KS9A 4ZS6C 2A73B 3MA9L 5HJ3B 3GRWH 3UJIH 5EU5B 4GW4B 4QXGL 5A1AA 1A0QL 1CD1B 1U8QB 4FQLH 1J0ZA 1AGEA 5EORL 2DTSA 5BZWA 3WFHB 1KG0B 5E6IB 5FM4A 1G7HB 3G08A 4OAWA 4OIIH 3B6SB 4G5ZL 1YNLL 4ESKA 1I1AD 5DMKB 3GMNA 3V5KA 2EDOA 3KHQA 2HTLD 3UBXA 3MV8E 5CWSB 2RCSH 4X98A 4TPRL 4ODVH 5KG9A 5E8PA 3PGCA 4Q6IB 1G7LB 3QNYB 3O2VH 5IB5B 3GBLA 3SO3B 4QHNA 3RFZC 1PBYA 1AD9A 4HKXA 3GZKA 2IGFL 3MFFA 1UYWH 5IK3A 5I30L 1A9BA 5D7LA 1UKQA 5C0GB 3AY4C 3OR6A 3U0PB 2ZNXA 4LDEB 1QLFB 4IDJH 2C3GA 32C2B 1BGXL 3FRPG 3P73B 1JTPA 2ADFL 3ULVE 1K6QL 2J8UF 4JFZL 4URTB 1G6RL 3UTPE 4WI8A 3NCJL 4QT5B 1KLFA 1WTGT 1MIEL 4B7LA 4P23A 1T6WA 1H3XA 2FJHB 2YPLB 4JFHD 3KS0H 2ADIB 3C5SB 4ODUA 4HDIA 1R3KA 3TBWA 2EYTB 3H0TA 3EOAA 5HYJB 4YDVA 3RWDA 3SGEI 1KLGA 5GISH 2F19L 2PW1A 4N9GB 4E5XA 4KZEH 4OKVA 4S2SA 4J3WA 3UC0L 1W8NA 3SDDC 3QXUA 4MVBD 5IB2B 5DVOA 3UPRB 1JL8A 4N0FA 2N4IA 4KWUA 4FP8L 3QA3B 1MFNA 4I18C 4K3HA 2CMRH 3U7AA 1LO3L 4I5BA 3MNVB 2VLJD 4G8EB 4JY5L 2X6MA 5BV7H 1DQQA 4HFWA 2FDBP 5DSCA 1LP9E 2R1WB 4XVTH 3QISA 1AJ7L 5FHBH 5TDNA 4JN2B 1I8IA 2IEPA 1CGTA 1UJ3B 4V1DA 3L6FB 4XTRC 3TN0A 1EHNA 4A6YH 4WI4A 3FQXB 3VMNA 5FGBC 1F8TL 3H7BB 5J13B 4OF6A 1F90L 5FCUH 1J0YA 4MAYB 4XI5D 3RZCC 2VR5A 4BSVB 2BNQA 3MRMB 2BVPB 2F53B 2R2CA 1OB1A 1I8LC 3LEYH 1OOAA 3ORJA 3ZHDA 1D6VH 3UMTA 1UWGL 1F4HA 5CINL 2ITCA 4KKNA 4KC3B 2FHCA 1Z3GL 4WUKH 5JA8B 3IGAA 3MJ6A 1P7QB 4MNGE 4PJCB 4QTIH 5IVXA 3AY4A 1OL0A 2HRPL 5D2LE 5BCAA 2J6EH 1FYTD 4OIBA 1V3KA 4LAQH 3ULSA 3B9KB 4TSCL 4HXAH 3V6OE 1OAYH 2QQNL 4ZG1A 4KZDL 1S78D 4IJ3B 3VGGA 3RVWC 5HHQA 3QDGD 3GSNL 3QQ4B 4HHAB 1YA5A 4NUGL 1ZKAA 3PGDA 4R0LB 4QY8A 2APFA 4PD4J 3PWPA 2WBJC 1L0XA 4V2BA 3KYMB 1QFOA 3IKCA 4FXLA 5EU6B 3VJ6A 4TNVK 5D72L 1DN0A 2X4NB 1WT5C 1QRNE 4NDMA 3ARFC 3I02A 3SDDA 1OAZH 2C3VA 3CDYA 3RNQA 4XC3H 2LU3A 4HCRA 4K2UL 2QQLL 2V7NB 4EEEA 3DO7B 4NZDA 1MHHB 2EYSA 4PJAB 2LABA 1JWMB 4EQ3A 1E4XL 4I18A 4LVEA 1OPGH 5C0BA 3FOMA 3HG1B 4AEHL 4OB5H 4JQIL 2LE9A 3D48R 3RTQD 5KS9B 3K2UL 1U3HC 5E8DL 4PJBE 1CFVL 3SO5A 5ALCL 4Q9BA 4PJ7A 3T0AA 1X5HA 3EYVA 2Z0BA 1HSBB 5FOBA 2GQHA 4DGIL 1OAQL 1BAFL 3HZYA 4LSPL 3DROB 5IMLA 5E4EB 1IKNC 1UB5A 2AABH 1B6DA 2EIBA 3G08B 1GOHA 5J3HC 4JPIB 2A6JA 5ILTL 4N8PA 5KVFL 1A6TA 1ZA3A 4C58B 1Y6NR 1IC5H 3KJ6L 3UBXB 2YD6A 4L1DA 3WO4C 5C0AA 1FIGL 2XQYG 5KG9B 1OCWH 5ICZB 5E8PB 1HZHH 3TBYB 5F88A 1NCTA 2B4CL 4P2RE 1MVUB 1H3GA 2EDKA 5D7JD 4K3DL 3JV0A 4YO0A 4HWEH 1AD9B 2VAAB 3DUSA 4HKXB 4M7KH 4M6ML 3S88L 5DVLA 5TE7L 4F80A 5IK3B 1A9BB 4GT7A 3T09A 4S1RH 3S35X 2ZSWB 4NO2A 1P53A 3OR6B 5IV2B 3KPPA 3P0GB 3MQIA 3Q6GL 4YHMH 4OZIB 4EZMA 1FRGH 3VXTA 3NACH 5TPWL 5ACZA 4CU7A 3QIBC 2CR3A 4PB9H 4P23B 1UZ6F 2EKJA 1FFNB 3GSWB 3H0TB 3EOAB 4KU1A 3C9NA 2YRLA 1ZLSL 1KLGB 4NZRL 4YXHL 1WT5A 3ZE1F 1FZMA 4E5XB 2GK2A 5GJTH 1ZGLA 2FWOA 4PRIB 4OBSA 2AEQH 3S3SA 2GUOA 4KTEH 1A3RH 4ZMAT 4CVXB 1UEYA 1PKQA 3MOAL 4LSRL 2VN4A 4Y1AE 4BKLA 4WW1A 3H42L 3O6ML 1HEZB 3L5XH 2WAHA 4DN3L 3QFDA 2FX9L 1BQLH 1JZ3A 4I5BB 2EC9U 2O26U 4WI2A 2DQIL 4MNHA 4XAKE 1LDPH 1UM6H 5IHUL 1SYVA 1IKNA 3MLTB 5C09A 2P1YA 1DUYA 4HFWB 1TPXB 4QGYA 1IBGL 2VXSL 1I8IB 2KQMA 4V1DB 3LOWA 4YZFF 3WD5H 3TN0B 1JGEB 2BNUA 3L3OA 3QUKA 4AQOA 4MCYB 3BJ91 1MEXH 4K8RC 4KGJA 2E7LC 5CJQL 4P4KD 3QQ3A 5EIIB 3HAEH 1T6VN 4BELD 3TJHC 2BNQB 1VFMA 5EDXA 4GQPH 3W81A 5KOVC 2ITCB 2I25N 3X13A 3F5WA 4LU5H 2OYPA 1QSFE 5IVXB 2CKBH 1FL3A 3KJ4B 1L7IH 3GJFK 1U42A 3CCHB 2B2XH 1JVKA 1QEWA 3MRKA 3WEXA 4X6CE 2JJSC 5E6ID 3IU3A 3LAFA 3B5HA 4FRWA 3QCUH 3BPLB 3QPQC 4M4RA 4OLWH 3ULSB 1YEHL 3FONA 3PWUA 1FVCA 3Q6FA 4JDVA 4QYOA 4DVBA 1WBXB 5FYLD 2PN5A 5HHQB 5EZIL 1HHKA 1SJHA 2Z35A 5B39A 4FG6C 3QXDA 1NC4B 3WUWB 3VRJA 5J8OA 3MLWL 1B4JH 3LHPL 4ZPTA 3BYYA 1JZ8A 4U7MA 3DHJA 5DR5L 4YHLH 4PRDA 3I6LE 5D6DC 1SBBA 3U4EA 1MCWM 3VJ6B 4FNLL 2Q76B 4EI5A 1DN0B 3RWGA 5DQ9A 1YJDH 2GKIA 3I02B 1KIQA 2FO4A 3LDBC 3IJYB 3RNQB 1M1SA 5EUKB 4YHOL 3K1DA 1TJHH 2EYSB 5GZNC 4RFNC 4U1IB 4Z7QE 3FOMB 4ZUWA 3OKLB 4XPAL 4G42A 2GITA 3U46B 4LPTA 1JF1A 1LVEA 4PJ7B 5LGJA 1K3IA 1TENA 2ICWA 1FGVL 1GH7A 4M1CC 4O58H 3CH1A 4ODXA 1TFHA 3HZYB 3SKJL 1FNAA 5IMLB 4M02A 5LXGH 2EDXA 3MNZA 4ELMB 4PV8A 4GOSA 4X6BA 2YPLD 3KPOB 4ONGH 4PY7A 1A9EA 3KPSB 3LKNA 2F5AL 3VRLE 1ZA3B 5CEZD 2E7LA 5HYJD 3NCMA 4OF0A 2BFVL 3GKZA 5F9WB 3VG0H 3GHBH 1RVFH 2JJTC 5C0AB 4CJ0A 1U8HA 2J4WL 3N9GL 4OM1L 5LAXA 5F88B 2HFEB 4YO0B 5F1SA 3FRPA 5SWSB 3SE8L 4BQ6A 2YD7A 4LGSB 5K9JL 1QPXA 3O9WC 4NWTH 3P4MA 3C8KB 4OBRA 2UZIH 1KC5H 2QKIA 3NAAL 4NO2B 2PTUA 1NFIA 3KPLA 3IDUA 3BMWA 5I8EA 5KVDH 3BPNC 3BP6A 3KPPB 5JW4Q 2NY4B 3MLVH 1CGYA 1HKLH 5DMGC 4XPFH 2HP4A 2XQYK 1MCEA 4M6OL 4WFGD 5EH1A 4RMWA 5SWZE 2W0KA 3BGFC 4KKBD 4P5TA 3VXTB 5CEZL 1JZ7A 3ROLA 2ZUQB 5J1AA 5ACZB 3HI6H 2RHEA 4JFDA 4LMQE 3DMMC 5LG1A 4PLKC 2ITDA 4NCDA 2BVYA 4MAYD 5C2UB 1D6EB 3BN3B 1YYMH 4UUJA 2G5BA 1LO0H 2CGRH 4M8QA 3H9SA 2F53D 2YS4A 2OL3L 5D6DA 1U8LA 1G9NL 3C9NB 4I3SL 5C0CA 3QO0B 5HY9B 4XNMB 1P7QD 4MNQA 4OLUL 5J0BA 1WUNT 2R2EA 4XNZB 1PKQB 2PCPA 3MRNB 4YFLF 1ZSDA 4UDUB 4BKLB 4D9RD 1ZA6B 5CJXA 2XT1B 1DBAL 2MQ3A 3WNLA 3QFDB 3GJFA 3KYKH 1KLUA 3B9KD 2AP2A 1YEGL 5T5NG 3HLAA 2B1HH 4MNHB 4WFHD 1SYVB 2R1XA 4P48A 3SE9H 2VZ3A 4MX7A 3VXMB 15C8L 1DUYB 1P4BL 4AJ0A 5F9AC 3QUYB 1S7SA 1NFDA 3D5OF 3BPCA 1UENA 4U6TA 2ZCLL 1QTYT 1IMHC 2FJFA 4YHNA 5DRZB 2BNUB 1EEZA 2J8OA 3L3OB 3QUKB 1V3MA 1U36A 3NIDE 2C3HA 4HIJA 4Y7MA 2KPNA 4JG0H 5EU6D 5I1AA 3QDJE 4QOKA 4LIQL 3QQ3B 2Z8RA 5C7XL 4LSVL 5TE6L 3VH8B 2BY3A 1S7VA 2QHRL 4XP1L 3LN4A 3X13B 3MCKB 4XHJD 2NQCA 5EIVA 2Q1EA 5L2JB 4RGMB 3HG1D 3O9WA 2VTFA 3F5WB 1H9VA 3FZUC 4WNQA 4P3CH 1LWRA 3BH8A 1G0YR 4NZUH 1FL3B 4PRHD 1MUJA 1U8PA 4BZ2H 4ZDHA 4XPBL 1OLLA 1SY6L 1DUZB 5F3HB 3NIGF 4PGDA 3WEXB 1AGCA 4BZYA 3NFNA 3TWCL 5GRVK 3IU3B 3QEHB 2HKHH 4AZ8A 4NNXB 1KN4H 2MCPH 2B0SL 1D9KC 3PWUB 1WFTA 5D1QC 5EPMA 1UXWA 4JDVB 4QYOB 1C5CL 4UILL 1MF2L 1CBVH 3C2SA 1WZKA 3DMMA 4P59L 2Z35B 5B39B 2N7AA 4TRPH 3K8MA 4CMHC 5BVJA 3VRJB 3IRPX 4KJQC 4ZPTB 1C1EL 3NZHH 4J4PA 4FZEH 4J3OC 4O5LH 4WHYH 1EERB 3ZKXB 2BVEA 5I1EL 5C8JA 3ZTNH 4ZTOL 4Y4FC 1N6QL 3RKDC 3RWGB 2F58L 5DQ9B 4YUEH 2DM7A 2EDYA 1KIQB 1MNUL 1KFAL 2XV6B 3OXRB 5BQ7A 3BMVA 4WW2F 4Q74A 1JF1B 2O5YH 1IQDA 3EZ8A 4P2QE 3UYRL 5LGJB 4M5ZH 5IM7A 4MJ2A 4YNYB 4WFFE 2NY6C 4ODXB 3CH1B 4YWGL 1IT9L 5M94B 4O00A 5HHPA 4OCRL 3STZA 3U7YL 2JB6A 3HE7B 4HK3N 1CQYA 1T2QH 3GIZL 2OJEA 1A6ZA 4N8VG 4P23D 3S7GA 3FL7A 4X0KB 1D5XB 1MJJB 2VDLH 4G6ML 4PS4L 4PY7B 2P8LA 5I75C 3C09B 1A9EB 1X4YA 4WW2C 5MERA 3LKNB 4F15C 1Z2KA 3DETC 2CDGA 4YX2L 4H0IA 3V5DB 2R0ZL 1PZ5B 5F71A 4NT6A 4PRID 2VWEC 3E8UH 1FGNL 1HKFA 1U8HB 4HJGA 1MRDH 2EXYD 4Z7VB 1FFOB 2X40A 5LAXB 1HIML 1KCVL 1J1PL 5CEYA 4L4VE 3O2WL 1XR8B 1DQLH 2PTVA 4YC2C 1FDLL 4ZQKB 2NY5H 5DWUH 4H1LG 3P4MB 1KJ3L 2VE6A 3GSOB 1ETZB 1A6WH 4UOW1 2QKIB 3TO2A 1JUFA 2GY5A 1JPFB 3HN3A 2CRZA 5I8EB 3QH3A 5JMRA 1F58L 1D9KA 4HWNA 3FMGL 2W9DH 4V1DD 3IDYB 1UGNA 3OJ2C 4HW6A 3TN0D 2I5YH 5KVEL 3CXDH 4P5TB 3S36L 3VXOB 4OZ4B 4HIXH 5J1AB 3KPQA 4JFDB 4Y5YC 1RIUH 5E00A 2ITDB 5GS0D 4FN0A 4Y8AA 5A3IC 2Z4QA 4UUJB 2G5BB 4WI7A 3U0WH 2BNQD 4EIGB 3H9SB 1XR9A 1U8LB 2ZUWA 2E6PA 2XZAH 3L5WA 3SCMC 4YFLI 3WL9A 1B4RA 4GKZA 2VISB 4MNQB 4NHUA 1HDMA 5JIIA 3C60A 3CMOL 1CIDA 4GMSL 2R2EB 4GH7B 1N4XL 2PCPB 4W68A 4ZXBA 4MJ6A 3TV3L 1XF3A 3UTZB 1NUGA 4QCIA 4JO1L 4KVCH 3GJFB 3AMKA 3PGFL 1IZJA 1MQ8A 5D71L 3HLAB 3CVHL 4EN3C 3KPNB 3BD3A 2IQAA 5KZCB 5J6GA 3VG9C 1NFDB 1NC4D 4HLZH 1VKXB 2WWKO 1Z9MA 3ZE0F 2FJFB 4WENB 2BJMH 2EZ0D 4PRNA 4YHNB 4X4ZA 3CDCA 5DUPL 1GC1C 1CQKA 3L7FA 4HIJB 1LD9B 2B8OT 2PO6B 5CZVL 5I1AB 4FQ1L 2M8XA 4OCYH 1EVTC 2C26A 4F7PB 1JNNL 4GXVH 4PGEA 4OD1H 4O2FA 2OTPA 2R0KL 1BLNA 5E2VL 2ATKB 4CVUA 2B5IC 3GNMH 4G6AC 1ZAGA 4OCMC 1MPAH 2V9RA 1KELH 5DT1L 1KB9K 4U1KA 5DJCB 4ODSL 1W0VB 1U8PB 2GSGA 2CLVA 1KCSH 4ZDHB 2AKRB 4I8DA 2Z31B 1F6AB 3TPUA 3TVMB 4LP5A 3NFNB 2CIIA 1MQKL 1U2HA 1X5JA 1A6UH 4FQJL 4JFYB 2W0LA 1KIUA 3RDTA 5JW3L 3U6RB 4HD9A 5F7YC 1UXWB 3KPSD 1XF4A 3X3FL 3BRGC 1MWAL 5TDPA 1F3RB 1D7FA 4TSBH 5F1OB 1M4KA 2ADGB 3QUXC 5C0AD 2J5LC 1NUNB 5DVMA 1T7WA 1I7TA 3BX7C 2JJWA 3QSKB 3VFGL 1MFEL 4NC2B 5FA3B 1G7QA 3IFLL 3AB0C 5SWSD 3BQUC 2PW2A 4OGYH 1MH5A 1W0WB 1U8IA 1ED3A 5IESL 5GRUL 2LTQC 5EO0B 3QUZC 4CVWA 1JYNA 3F65A 4HPOH 5BQ7B 4KMQA 3QDAA 4U1GB 3FO9A 2NY4D 4UI2A 1IQDB 1UM4L 1KF9B 4PJ8C 5I1KL 2DQGL 5KOMC 5MP6H 3W0WA 1J0HA 3SGDH 3V79C 4UQ3B 1KUMA 5IB1A 4Y5XA 1WWAX 5EN2A 2OJEB 1A6ZB 4JFHE 3MGOB 3CU7A 5MERB 1KV3A 2XY2A 1GSMA 2HJLA 2JCCF 1X5FA 2VN7A 2XN9B 4LLVB 5IGXH 4AL8H 4K9EL 5DXWA 2F8VA 2Y7QA 4NOBA 1U3JA 4UBDC 4NT6B 4R26H 5CJOH 3LD8B 5EUOB 4HJGB 4PJDA 2EDRA 1N0XL 2IWGA 3DIFA 4DOHE 1EAPB 1YECH 5CEYB 1OM3H 3RVXD 5IFHH 2LV4A 3TESA 1MCKA 5FYKU 1TJGH 3BUYA 3I3EA 1OD9A 3IAQA 4S1DC 5E08L 5E9DB 2VE6B 3KPRB 2NPLX 3VWKA 4S1SL 3B2UC 4X5LA 2LAAA 2VXVH 3DRTA 3VXMD 2VABB 4OD3L 3HNVL 3QH3B 4IEFB 4JDTL 3QUYD 4FXKA 2DF3A 3CUPB 4RNRA 3JWOH 2YXFA 3ALXA 1XGQB 3S37H 5L2KB 1LO4L 1J9CT 2NY1B 1RK1B 2KDGA 1SBSL 2DLEA 5E00B 4XNQA 4L29A 3LIZL 3A6BH 4Y2DB 2D0FA 3IAPA 4HQQL 3OF6A 5HHVL 1XR9B 3BZDA 5LWYH 1EFQA 3VXRA 4PR5B 1JYXA 1JGVH 2VR4A 2AXGB 3L5WB 3WL9B 3ULUL 3VMOA 4GKZB 1QSVA 4NHUB 5ABDE 1HINL 3C60B 2Q87A 3P30H 1ZHBB 1CYGA 4ZXBB 1FYTE 4MJ6B 5HYQA 4WRLA 2VXQH 2P8MA 1YEFH 2QSVA 4JCLA 3LMJL 4PJ8A 4R8WL 2EE3A 3QZWG 1GYAA 2XZZA 3MA9H 1FNHA 3N50A 1EGJA 1PAMA 3QDGE 4QXGH 1X4ZA 2YPVL 4XZUA 4PJXA 5KSBE 4AG4H 1ZHKA 3CFKA 4TUOA 5DEGA 3WNNA 1AQDA 5EORH 3SE4A 1NCBH 4IOIB 5I1HL 1ROWA 3TJEH 4NRYA 4KROB 1HYSC 3HCVB 3G5VA 5IT2H 1Q1JL 3C5JB 4YQXL 4G5ZH 4OZGE 3OKNA 1FNFA 1MRFH 5JXEC 4QHMA 1S7XB 4PGEB 4PD4K 4YHYC 1XCQA 4O2FB 4MA1B 3PXJA 1F6FB 1BLNB 3D69A 2BK8A 4MSWB 5B3JF 3EDJA 3MODL 3MLPA 4NC1C 4OQTL 4ZFGL 3C6SB 1PG7L 1RZ7L 5HXMA 4U1KB 2Y1VA 3SGDI 2BP3A 4WU7A 4JKMA 3MJ7A 3BHBA 1XGTA 2GSGB 2CLVB 5JHDA 5I30H 1FVEA 1OAKL 3HE7D 2CIIB 4MQTB 3EGSA 2OBGA 2X89A 3HMXH 3RDTB 5FXCH 4X6DE 2V2TA 2R39A 5TDPB 4XMKL 2DLGA 4YK4C 3MLXH 1K6QH 4JFZH 1XGYH 1G6RH 3OJMB 2CK0H 2MSPA 4FFVD 3NCJH 5CJ8A 1I7TB 1TDQA 3IFOA 1G7QB 5F8RC 1FL5B 4KJYA 3ETBF 4D94A 1FO0B 1S8DB 2PW2B 4GAJL 1MH5B 1FIEA 1U8IB 2H26B 3WYRA 1ED3B 3D85B 3BPOB 1IAIM 4NQCA 1BX2B 4HIIA 3UC0H 4FS0A 4N8VA 2YSSA 4GMTH 4JGMA 2I9TA 1FHGA 1NC2B 4LKXB 3FO9B 2EDEA 3DVGB 1GGIH 1TJIL 3RVUD 1NCWL 1MY5A 4P2OC 4PP2A 4P5TD 1LO3H 3W0WB 5I66B 1JV5A 1BWWA 4JFEE 1OT2A 4JDZB 4FXGA 5IB1B 2AJSL 3GBML 4JFDD 4JY5H 3PHQA 1OAXL 2FRGP 3VFPA 1AJ7H 3H9SD 4PPTA 1I9IL 4DJMA 3D9AL 1TZIA 4H1LA 1ZHLB 3BXNA 3PWLA 3SOBH 5JZ7D 4MNQD 1F8TH 5D93C 4Z7UB 3VDBA 3DIFB 4JCMA 2VLKA 3SY0A 3IFNL 4F37F 3MJGX 2FB4H 5GS3A 2YUVA 3QYCA 3BUYB 1MFDL 4NPYA 2X4TA 1F97A 5CINH 4Y4KA 5A2IH 1GOGA 1S7WA 3OX8A 2XG4A 3DO3A 4KQ3H 4JQVC 3ALWA 4AK1A 1BPVA 2V2WA 2UWEE 2A77H 2FZ3A 5KZCD 2IANA 3QAZB 3C6LA 3PABA 4FXKB 4RNRB 1OP5H 1IGJA 3H9YA 1GL4B 2F54A 2ZOKA 5CD5C 2XA8H 4RSVA 1XGRA 2WINA 2PO6D 4XP6L 2VJXA 2QQNH 3I6KB 4XHQA 5CSZA 4L29B 4K7PL 3IDMA 2EDTA 1YYLL 4KK5C 5DC9B 5F93C 1IKFH 3RX8A 1PEZA 4NYLA 5BO1L 4P4RB 1V05A 5DHVH 3U4BL 4ZO8A 1W72L 4XX1E 5KVGL 4R4ND 1NLBL 1BBJA 4WCYL 4JAMA 2CJUL 5HYSG 4C4KT 2EEDA 4PLJD 5HYQB 2NW2B 2Z31D 3TVMD 4NJAH 4DQOL 4XCEB 2XFXB 1WBZB 1U8OA 3MROA 4HGWA 4DK6A 4HFUL 4R3SA 4DUXA 4X6EA 3K2UH 5FYLE 1FC2D 3QRFM 1CFVH 4Z6AT 2EEBA 3UO1H 3WNPA 1ZHKB 1X9QA 3CFKB 1AQDB 4IRJB 4M7LL 4XBPA 3S37X 4LSPH 2CO7B 4CDHA 5HGAB 3JWNC 4J4PD 4NRYB 4KRLB 2VDPH 3D1MC 3P4LA 4QRUA 3RP1A 5JQHC 1CLYH 5KVFH 5F97E 4D0BB 5IMKB 4NFCA 4OGZA 2SEBA 4YDKL 4YHKL 2HH0L 3KJ6H 5IHLB 3DV6B 1KPVA 3S98A 1AFVL 1XCQB 1EBAA 3I3BA 1L7TH 3EYUH 3VD3A 1Z0NA 3ZDYF 3EO1A 5I1DA 2B4CH 5EWIL 4BUHA 4U0RB 4K3DH 5DJ0A 1QQDA 2UY6A 2WLZA 4Q9QL 1HCFX 4QEGA 3FKUS 4WU7B 3MJ7B 5DRWB 1XGTB 1HWGB 5TE7H 3WFEL 5IUSA 4H20H 5JHDB 4H8WC 3X12B 1NAMA 3MCLL 1CGUA 2YPLE 1RZKC 5CGTA 2MPAH 4L9DA 3KR3L 1FG2A 5TDOA 2X4QA 3MLZL 2XN9D 4F7TA 5CEZE 5HYJE 1F13A 1MREH 5IVZB 3UYPA 1J1XL 1S9YB 4YDIL 1DBML 1HNFA 1RU9L 1IQWL 2VL4A 4HXBL 3UAJC 5C86A 3WIHH 1K85A 2R0WL 5TPWH 3M8OL 1FYHB 1JWUB 2ERJB 4P9MH 4M48L 5FF6A 3IFOB 1NSNH 4NO3B 4D8PA 3QNXB 1KJVB 1L4IA 3MLRL 4KJYB 2J88L 4H8WH 1RQ5A 3RRQA 4M8VA 4NZRH 3OMZA 1LK2B 5E9DD 3KPRD 3DXAB 1V3LA 5CUSL 3MRFA 4XWOC 2YSSB 2L4OA 4JKKA 4PJFB 3MOAH 1RIHH 4IMLA 1BFOA 2YUZA 4AEIL 4DN3H 4Z5RA 3VFMA 2X4PB 3PIQA 2RQ8A 5L2KD 3I9GH 1JV5B 4EBQL 1KXVC 4FXGB 2NY1D 3RAJL 2DQIH 5INDA 3IF1A 4HV8A 5C3LD 2JB5H 2PXYA 3GMPB 3VFPB 4CN6A 2BSTB 4Y2DD 2F53E 3OQ3B 4RISH 1IBGH 2VXSH 1UKTA 2ZUTA 4GJTB 1YEIL 1JPTL 5B4MC 5DFTA 1NL0L 3CPLA 1CXLA 4H1LB 4PJCE 1WAAE 1RUAL 4R4BB 4GKSA 5FYKL 3VFTA 3KLSA 1KTDB 5AZEL 1JZ2A 4JN1L 3D0LA 3KYNA 3C60D 5CJQH 3B83A 1IGML 3SKMA 4D9RE 1A7QL 4ZXBD 5INCB 1BMGA 2XACC 1VSCA 2DQFB 4P99A 2UYLA 5EU4A 4NPYB 4KK9C 2WP3T 5DFWH 4Y4KB 1CWVA 1A21A 3OJVC 3TBVA 3ULVC 1VGKA 4PTUA 2J3SA 4I3RL 4WFHE 1R5WB 5DRNA 2IANB 3RWIB 5CAYB 3C6LB 3D18A 5T3XL 3SBWC 3GGWA 1FORH 2HKFL 5CIPH 3BKML 3X11A 3E6HA 4W6WB 1YDPB 2V9QA 4KROD 2ZOKB 2Z91A 3W11C 1XGRB 3GM8A 4JG1L 4GAGL 1C8PA 3REWB 4WHYG 3G5XB 4I0PC 5EZIH 1QA9B 1XF5B 2AK4A 1LP9F 4LKCA 4PRBA 2R23A 1RULH 3LHPH 1L9NA 2JJVA 4NYLB 1JPSH 3HG1E 5KS9E 1T66D 5HGHA 3QZWA 2DQUL 3LKSA 2P42B 3LKPA 5L6YL 1BBJB 4PRHE 1FJ1A 3NPSB 1S9VA 5GRVL 1N59A 1KBGH 3O8XC 3MRIA 4NZTH 3MFGB 2RR3A 3OSKA 3RDTD 2NY2C 3NH7L 1AH1A 1A1MA 1HHHA 4R3SB 3FFCA 4HUKB 5C71A 3MV8A 4YIQB 4RX4A 3U1SL 2AEPH 3HPLA 3PWJA 5I73C 5D2LF 1MFBL 5DMIH 1BP3B 5AAMA 3WFDL 3U0TA 3K8KA 4J7RA 1J0KA 5HTSA 2H6PA 1WBYA 1IC7H 1NMAL 1YPZA 1N7ML 4CVZA 3QUML 2CRMA 4AT6A 2AAVA 2P45B 4QRUB 2F5AH 2OR7A 3EYQD 4ZAKB 2SEBB 3D85D 4HMCA 3O2DH 4X99A 1CXFA 2BFVH 4X7DC 1BM3L 2J4WH 3VI4E 3KNBA 4OM1H 4ZOEA 2ARJA 1NC2D 2DJ4A 1F11B 2J7LA 1QQDB 3CSYA 3FHQA 4PB0H 4RAVB 1WJ3A 2VO5A 3V6OC 4OZIE 3SE8H 3EJZC 4HUNB 4YBQC 2IJ0C 4IS6A 5K9JH 1CICA 4UU9B 4XB8A 2FR4A 4MZ2A 3W0WD 4X9FA 1J5OL 4LSDA 3NAAH 5EOQL 5JPNB 2QL1A 4BFIA 3TC9A 4HMEA 5TDOB 4XCYA 2X4QB 5ESQA 4F7TB 1CXKA 3TO4C 4JRYA 4PJBF 1JFQL 4HS6B 1RUPL 2AQ3A 3GSQA 3QXAA 1CLZH 3OB0H 4PRIE 5EOCL 5I9QB 1ITCA 3P9WB 5I2IA 3REVA 4M43H 4PP1C 1M7DA 1J1OL 4WHDA 4MA3A 4U1NA 3GM0A 2V5SA 5FF6B 4R90L 1IM3A 1CXIA 5BV7B 1PY9A 1AR1C 1IFHH 4I3SH 4LVNC 4D0DB 1N6UA 3WHXA 2ZPKL 2FBOJ 1KN2L 3O8XA 3MRFB 4OLUH 2XI9A 3VGAB 3BGAA 2YBRA 3C2AL 2J12B 3LCYA 3VGEA 2D9CA 4IMLB 3VGHA 1BFOB 4V1DE 2J2ZA 2N1KA 1GZPB 1MCPL 2E27L 2FECL 2EEAA 4Z5RB 5DFVD 3PIQB 4K3EL 4AYFA 4RGNB 5ELIA 3DSFH 2C1OA 5INDB 3W9EA 2PXYB 4KKLD 15C8H 2BNQE 1P4BH 4LPCA 2CH8A 2XWTA 5ITBL 3CPLB 3ARGC 5GS1C 4MNGA 2KQNA 1A1OA 1UWXK 4Q2ZA 4P9HL 3MUJA 3MJ9A 4GKSB 3VFTB 1OD7A 5IVXE 5A2FA 3KYNB 1LEIA 4YEEA 4U1SA 1NCUA 3N1FC 4H5SA 4J1UA 3SKMB 4F7MB 3UDWA 1DVFB 3OPZH 4LSVH 3ZYZA 2X4UB 1U58A 4OD2A 2D7QA 5EU4B 4JHBA 3V6OA 5JUEL 3DURB 4XVUD 2BSED 4M3KB 1VGKB 1TVHB 2R29L 1EEYB 2NX5A 3DYPA 4AH2A 4H0GA 3QG7H 4M9OA 3VA2C 3FQRA 1FFPA 1E0OB 5DRNB 3L3KA 3D18B 3O6FA 4XPTL 4XPBH 4IRJD 3MV9E 5F72S 1SY6H 1IAMA 3GI9H 3N85L 3E6HB 4POYA 2YEZB 3TO4A 3AGVA 3TWCH 1C08B 2QJDA 5IJVA 1WEJL 2Z91B 2B0SH 1CL7L 1A4JA 2ZKHH 5I15L 1BIHA 1QRNA 4R7NB 4LRNH 3T8XB 4UILH 1MF2H 3FT2A 3ZKMC 1MCOL 1JHKL 2VERN 5DD5L 3S6CA 5HYSA 1RIVL 1MAJA 2OS7A 4ZTPL 5DEFA 2OJZL 2AK4B 3ZT7A 4PRBB 2R23B 3H6JA 2FATH 4NQXA 3HC4L 2Y4SA 3V6FA 4PJBA 3J8F7 2O5XH 1IEAA 2OTWA 3RL2B 3QZWB 2BHYA 2BZDA 5HHXH 4LASL 2CXGA 2DIAA 3LKSB 3U9PH 4I77L 2HT3D 3TIEA 5KSAB 5CMAB 2F58H 1S9VB 3WN5C 1N59B 2AQ1A 3HNTH 3P9MB 3MRIB 5JHDD 1IAOA 5EZOL 4ELME 1XIWA 3EHBC 4ENEC 4KMTL 2X89D 1RZFH 3KPSE 4FFYL 1JE6A 5BVPL 8FABA 3O6KL 5EOTA 1HHHB 3FFCB 1IAKA 5I18L 3BD5A 3MV8B 1CR9L 1VA9A 3HPLB 3PWJB 2MKWA 4JB9L 4APQB 4ZOBA 3B9EA 1DL7L 1ZLWH 4OCRH 5EBLA 3U7YH 5IEHA 2VMFA 1WBYB 1KB5L 3GIZH 1YPZB 4CVZB 1P6AB 2WIMA 4TTDC 3ARGA 2HT4D 4AT6B 4DVRL 1CF8H 4PS4H 4M7ZC 4KPHH 5SWSE 3GBNL 2W0FA 3BEVA 5IW1A 4X4YA 4YX2H 5GGVH 4N0YL 4ORZC 5KANG 3OG4B 1OF2B 2VL5A 4LVHC 3DXAD 1FGNH 2ARWA 3RPIA 4RWYL 5B21A 5A2LH 3JTTB 5EIQA 4GRWE 4P49A 3ARRA 3CSYB 1U8MA 2H2PD 3SQOH 2YKLL 3BH9A 4IS6B 1CICB 5ICXB 4POZC 4HWBH 4BFIB 1DBJL 4JPKL 4FQ2L 3EOTH 3G6AA 1I3UA 1H3TA 4OUOA 4Z7QF 2ED9A 3U2SB 4JO3H 5AWNL 4JRYB 3BDYL 1S3KL 1D5IH 1NLDL 5E4IA 1T83C 3BSZH 5BW7A 4L9LA 3QXAB 4R4FL 1A7NL 2XYCA 1T3FA 3IDGA 2YA0A 3HUJF 3QP3A 4Y1AA 3U30C 3REVB 2NY0C 1M7DB 3L7EB 4J23A 5IFJA 3WJLA 3G9VA 3SKNB 3VRLF 1S7TA 4Y4KD 2EE9A 3KG5A 2UY7A 3VXME 3FOLA 5C0RL 4Y4HC 1DEEA 2YBRB 2IAND 3CMOH 3QR2A 3RWEB 3C6LD 5TF1L 2XQBL 1JYWA 5FKAA 3TV3H 1JN6A 2ZJSH 4JO1H 3PGFH 4JEGB 3DYOA 1GGCL 2A0LD 4ZNCD 3CVHH 3CFJA 4FZ8L 3MTRA 3A0OA 4NFDA 3HS0B 1GGYA 2B20A 2OXGA 2XWTB 5HPMA 5J1SC 1A22B 2CKBB 1CFNB 1A7RL 1B2WL 2OLDA 5GGTH 4Y5VA 1PZUB 4FFWC 1A1OB 4Q2ZB 2OZ4L 4M3JA 4P57B 5CZVH 5E1AB 1LEIB 2NXZB 1ZTXL 4X6CA 4F9PA 3D25A 1HXYA 5ALBL 1K2DA 2R0KH 3MA7A 5E2VH 2HWZL 2OK0H 1AQKL 5IOPA 1RZJC 5EBGA 2YHGA 5DJXA 1AY1L 2NX5B 4AH2B 3FO0L 3MNWA 3FQRB 1MLBB 2FEDC 1FFPB 3WNOA 3C5ZA 4NN7C 1BBDH 1Q72L 2ZG2A 2XRAH 3L3KB 1NGWA 1MIML 3O6FB 4DZ8A 3ARTA 4DCQA 3GRWL 3UJIL 1OQXA 1AIFA 1T83A 4FQJH 3B5TA 5JW3H 5IVOA 5CLWA 5FYJU 5FUCE 1MWAH 4NQVA 4NC0B 2R4RH 3NFSL 4ZAKD 3FT2B 5D7IA 3FN9A 4HAGA 5F6HI 5HYSB 4KFZC 4JFOA 2NY3B 5DEFB 4OIIL 1SJEA 1R3JA 4YXLH 1RZJH 5DK2B 1RSFA 35C8H 1RJCA 3VFGH 2NXYC 4J3TA 1MFEH 3GK8H 3MGTA 1C12A 1KCLA 3ZDXE 1ES0A 2MQ0A 1NBZA 1PX3A 2EYRA 4NRZA 2FYYA 5JR1L 1NCNA 2IMNA 3DYMA 3O2VL 1IAOB 3TNNA 2DYPA 4XGZA 1OAUH 3QPXH 4LGPB 5GRUH 1Y0LA 1XIWB 2APXA 3RX7A 5E24E 1KJ2A 1VADB 4PG2C 4RDQG 1T03H 1UM4H 5JHLH 5I1KH 4S10A 3FFDA 2Y23A 4IDJL 4JZJC 2C4FU 1D5ZA 5EBLB 4Z7VE 3CX5J 4HC1A 3WHE1 1G84A 5DZOA 2ZUSA 2E9WA 3JBG7 5IW1B 4OM0L 4K9EH 4X4YB 3RVVD 5D7SH 3DBXA 3DI3B 4I2XA 3MXVL 3CSGA 1XEDA 3B3IB 2VL5B 4LCUA 3O4LE 3ULUF 3VWJA 4JY6A 1N0XH 3JUYA 5MEOA 5GISL 2ARJQ 5SWZA 4HUWA 4CMMB 1CE1H 5DO2D 4OCNC 4RGND 1T0PB 1IRAY 5B8CA 2PXYD 1V5JA 6FABH 2DLHA 4OD3H 4EXKA 3G6AB 2CMRL 3H9SE 2LU4A 3AU1A 3V4VH 1REIA 3MJ8B 4L9LB 4XNUL 5BV7L 2X4RA 4MNQE 4XVTL 5FHBL 4Y1AB 4LAJH 1SBSH 5L8JB 4OLEA 3LIZH 3NPZB 1LILA 2D31A 5IFJB 1UACL 2D0HA 4A6YL 1DVFD 1MI5A 4HQQH 4LSUL 4Z95L 3U9UA 1G0XA 1X5GA 4HCRL 5FCUL 1IC4H 3QB7C 3ULUH 3QIUC 5JOEA 1UQSA 3FOLB 4KMLB 2YK1H 3LEYL 5H37G 1DEEB 4XWGH 3BKCH 1D6VL 3KDMB 4ERSL 4NKDB 1NFDE 3HTLX 2RFXB 3H9ZA 5FKAB 4WUKL 1OWRM 1LHZA 3CFDA 4JHAH 1QFUL 2OTUB 3LPFA 3QDJA 4R8WH 1T5XA 2J6EL 3CFJB 3SQBA 4JZJA 2GI7A 2YPVH 4LAQL 3QEUB 1K8IA 3NFPA 5HPMB 3NCFB 3JVGC 2A38A 1FSKC 1OAYL 4XRCA 2B1AL 4TYUA 1JNLL 4Y5VB 5ANMB 3ARBB 1MCLA 4Y16C 2NY7L 1Q1JH 4KTYA 2YD3A 1F2QA 3DX8A 2H8PA 5KSAD 1KENH 3FB8A 5IB3B 4X6CB 4KKAD 3D25B 5FHAL 1E4JA 1HXYB 1INDH 1K3ZA 3IS1X 3MA7B 1A1NA 4LFHG 4X5XB 1I3VA 5IOPB 1U8JA 1WCQA 4FQCH 4TTGA 4ZFGH 5E8OA 4XC3L 3FFCD 2MWCA 3MNWB 1PG7H 4BQ9A 1R3IH 3MV8D 2H9GA 3C5ZB 1AHWC 3QEQB 1EFXA 1QSEA 2YUXA 1OPGL 4NN5B 5CEXA 4IRZL 4APQD 1NGWB 3QCTL 4FQXA 5IJKC 4DZ8B 4DCQB 4F7CA 1OAKH 1FV1A 1JF5A 1L6XA 1EJ6A 4NQVB 3ARSA 1Y18B 3HFMH 5IBUG 5D7IB 3AUVA 2PYEE 2EDJA 3CC5A 4YXKH 1SJEB 1VHPA 1ZMYA 3VFVA 3OG6B 4JFPB 4XVSH 3TZVC 2CD0A 1IC5L 5D9SA 4ODWA 1W2KT 4P2QA 2RGSA 1KULA 4NN6C 5IBLD 4RQQB 1H0DA 4M1GH 5CHNA 1GIGL 3QIUA 3RI5F 5HHOB 1JF6A 4NRZB 1I7ZB 2FYYB 2VDQL 3T4AA 1OCWL 1CICD 1HZHL 2ZOLA 5IWLA 1E6JH 3TNNB 4XGZB 3G6JB 1D5BB 4HWEL 3BT2H 2H32H 1Y6MR 5EBWA 2EXWC 5F6IC 5CFHA 2NTFB 2DQTH 3MZGB 2XN9E 1KOAA 3OGCB 1KJ2B 4JRYD 4S1RL 1MJ7L 4JJ5A 5T1KA 3QIWC 5MEPA 3BEWA 4MXQD 2IPTH 2XNAA 3VFSB 5EUOE 2R9HC 3OB8A 1TQCC 1D5ZB 2XWBB 1XCTA 3JVGA 1ONQA 1TZGH 4YHML 4J3XA 1FRGL 1AO7E 4WHTB 3NACL 4D9QD 4NO0A 3HC0A 2XZQL 1G7MA 4GUPA 3D9AH 3DBXB 5E9DE 4I2XB 3KPRE 1IGTA 2R69H 4HH9B 3F62A 3VXUB 1U8KB 4YFDB 3VWJB 5JMOC 1IM9A 4JY6B 3V0AC 2EECA 5SWZB 4L8CA 1I1AC 1YY9D 4HUWB 1LEKA 1U3YA 2AEQL 4KTEL 1A3RL 5L2KE 1MFDH 2QSQA 4QTHA 2HTLC 3MUGA 4X7SH 3LRHA 1WZMA 2IBZX 3VFWA 1TNMA 4ALAH 4IOSD 3IXTA 4Z76A 1QFWM 5B8CB 2VRAA 4ZNEE 1UB6B 1OW0C 3VXPA 5IHBA 3C8HA 1BZ9A 2C9AA 2CUHA 3AU1B 2Z93A 1UM6L 5ISZE 5F7FA 3IXAA 1HHJB 3HB3D 1M71A 3QO1A 4XP6H 4IRSA 3U82B 2NXZD 2BSSA 1ZLVK 1BOYA 3TZVA 1MI5B 1OP5K 2CLRA 2ORBH 3U9UB 3ARZA 2YRZA 1DLHA 3BJLA 4LLWB 4XX1G 2AXFA 3MO1A 3U4BH 1DQTA 2NX5D 1VB9A 1W72H 1NLBH 5FEBA 2IFFH 4WDIA 4QXUL 1AE6L 4WCYH 2VDNH 3BVNA 4BM7A 1CVSC 3O6FD 2ED8A 5HGDA 3WS3B 4LU5L 1GCFA 4JREB 1T4KA 1TQBB 3CFDB 3IDXL 3G04A 2CKBL 4GS7C 1L7IL 3QDJB 3QPQD 5E1HB 1EEUA 1QFPA 4BFGA 2W92A 1JTOA 2V7HB 1PDKA 2AJ3B 3BP4A 3QCUL 2NY3D 4K8RL 4LCYA 4MVBC 4OLWL 2VDMH 5J57B 1PJ9A 3Q5YA 1K8IB 4CU8A 3T77A 4FG6D 4XRCB 2HVJA 4OFDA 1K4CB 5EC2A 4N0CC 5DYOB 3T1WA 1ZGLP 5F8QC 2DD8H 4LPYA 3RUGA 2V2XB 4EDWH 1NBYA 4ZUVA 3DX8B 2H8PB 5CD3B 4YHKH 4YDKH 3FB8B 3JXAA 4KVNH 4YHLL 4PRPA 5IQ9A 4UT7H 3CIQA 1ZANL 1XIWD 4UNTA 1SYSA 1EHXA 1A1NB 3L5HA 1S5HA 3MC0A 1U8JB 2CDFB 1RZIA 1NBVL 4RWHA 1FPTH 3BAEL 5E8OB 3P2TA 1TJHL 4Q9QH 3QXTA 3HRZA 1ADQA 1QSEB 1KXTB 1IGFH 5FYJL 1I4FA 3WFEH 5CEXB 4FQXB 5GRZA 1HHIA 4F7CB 1F2XK 3AREB 1FV1B 1O5DT 4YBHA 2X9YA 3KR3H 2DQHH 5JA9A 4I0CC 3QHFH 1HSAB 5HYIA 1JGLH 1T04A 1CDIA 3LEVH 5LXGL 3QHTC 3BGMA 2P5WE 4YDIH 1DBMH 2FD6H 4F3FA 3QBTB 1C5BL 1FZOB 1IQWH 3A67L 4ONGL 2WV3A 4TUKL 2R0WH 1KIPA 5CGMA 4M48H 5LJYH 4ODWB 1G6VK 4P2QB 4NQDA 1H0DB 5CHNB 3GHBL 5IMOA 2XWJA 3MLRH 2FO1A 3CZFA 3LKRA 1S78C 2BOBB 2AXHA 2J88H 5D2NE 3W0WE 3ZYJA 2ZOLB 6CGTA 2HJFB 4IIQC 2XTJB 4NJ9L 3TIDB 2DM3A 4FABH 3OXSA 3FO1A 1WZLA 5EBWB 1BEYL 5JW5B 1PG7X 1KEGH 1BOGA 2Y36L 4NWTL 2DMBA 5DUMH 5A2KH 4GKNA 3SDCB 4JJ5B 2EDLA 2KL6A 3BEWB 4ZSOE 1L6ZA 5KVDL 2UVFA 1G7PA 4YHIB 1UH3A 4KH2A 5FO7A 4EBQH 1CDBA 4Z7UE 3RAJH 3BIKA 1H3PL 4PJHE 4XPFL 1AI1L 1JGUH 1T1XA 4DKDC 3QJFA 2ENSA 3RTQC 4B5EA 3TF7C 3B8YA 3BZFA 3HC0B 2FIKA 3HI6L 4GUPB 1NL0H 3BE1L 3ELAT 3STBA 1LO0L 3PP3H 1NJ9A 4JN1H 5BMFL 2CIKA 3BFOA 3GUTB 1IGMH 1JGDB 1Q9KA 4G43B 1EO5A 1CK0L 4F33B 3V52H 5I71C 2JCCB 3GSNA 3H7LA 3V0VA 3MUGB 3QT2A 4PBXA 3U36B 1LEGA 4PLOB 5EU7E 1FAKT 2GTWA 3IXTB 5DF0A 4Z76B 2DKSA 2XXMB 3BKYH 5DHVA 4LLQA 4G80A 3E2HC 3VXPB 2CLZA 4NNYA 3KYKL 4X9IA 3T3MF 3V0WH 2LFGA 5D7JC 5BJTB 3BKMH 2B1HL 2Z93B 3SE9L 4PJEA 2P5EE 1CD9B 5A43C 5J1TC 3QI9A 3ARBD 3NBNA 1SVZA 5ADPL 3FT3B 2IQ9H 4JG1H 3QO1B 4IRSB 4OF8A 4LRIC 4YHPA 3SGKA 1KEML 1X5IA 5DHXB 4LCCC 5L8KB 3DX6A 5JW4N 4JG0L 1LGVA 2VLME 1NMCB 2AXFB 4NBZB 3QDGA 3RA7H 4AEFA 4C54A 3ARPA 4LLDA 2WLYA 5KSBA 1HH9A 4UT6H 2OP4H 5GRXG 4Z8FL 5DJAB 3C5ZD 3BI9X 5TFSL 3EKCA 3QEQD 5E7FA 2G9HA 3BZ4A 2DM4A 4TULL 5I0DA 4TNWK 5HGDB 3QQ9D 1JYVA 1T4KB 4P3CL 3I6LD 3G04B 2GIYA 2YOCA 3B9AA 4NZUL 4PG9A 4OZGA 1EZVX 4BZ2L 4GBXA 3IJSB 2IALA 1WK0A 2FEEI 2C7UA 2HKHL 3BP4B 1KN4L 2MCPL 3RTQA 5EZJA 2HVJB 2V5RA 1QOKA 1CDCA 3WSQH 3EW3B 2F15A 4QHLB 3PWVA 3RUGB 1FQ9C 4TRPL 1NBYB 3TFKD 3BDBA 5AZ2H 5CILH 5HHOD 1PQZA 4FZEL 5JHDE 4PGJA 3OTTA 1SEBB 4O5LL 4PRPB 5IQ9B 3O3UN 1FE8L 5DQDH 4X6DA 3ZTNL 1R5VA 1S5HB 1G6RB 3F7VA 4LCWA 5DC4B 4YUEL 1RZIB 4IMKA 1P2CA 3AS2A 3VCLA 4OV5B 1HQRB 3HRZB 4G9DA 4P4KC 5F21B 1CE6A 2Y72A 1I4FB 1I1FA 5D7JA 2ZUVA 1ND0A 3RWFA 2O5YL 5EOQH 4WTXA 4QXTA 1HI6A 5FM5O 4L8DA 3O3BA 3BGMB 1IL1A 1T2QL 1RUPH 4F3FB 5I1LB 3DXAE 4OLVH 2PNDA 3VXUD 1I8KA 5EOCH 3VWJD 4N8CL 5E6IC 5KJRH 1MJUL 1KIPB 4PJFE 3EDDA 1J1OH 4LOUD 2H3NB 5FB8A 4NQDB 4KDVA 4LCIH 4R90H 3ZDZE 2EDBA 2YD9A 3MRQB 5SWZD 5C0FA 2XWJB 5IMOB 4PJGA 3LKRB 3E8UL 4O4YH 2NLJA 3DPBA 4JFEA 1DLFH 2P4AB 3HI1A 3OB0K 4UIKH 2ADJA 2OSLB 4O51A 1DQLL 3FO1B 4NO5A 4QRRB 3C2AH 3CLEH 4Q6IC 1BOGB 2PETA 5DWUL 3SO3C 4MD5A 1A6WL 2O61A 1MCPH 5FDYA 2V5TA 3O0RH 3O6LH 1TCRB 2C1PA 2IBGA 4L5FH 1G7PB 3VXNA 5FO7B 4DOHB 2AV7A 3GSRA 4EVNA 2W9DL 3BIKB 3RY5A 2D2OA 5H35B 2I5YL 4D0CA 4HKBA 3CXDL 3O3DA 1MI5D 3ZE2E 3BZFB 5ITBH 4LVOB 3V8CA 1RIUL 1EO8H 5ETUB 3GJEA 2UWEA 3CK0H 4WV1B 1P1ZA 3LN9A 2YR3A 5E2WH 3U0WL 1LO5B 2IANE 3NCYP 3TCLB 2CIKB 1KYOJ 4M6NL 2R0LL 2XZAL 4UDTA 3QNZB 3RL1A 2YMXH 1PVHA 5E8NA 1CFQA 5FECA 3GSNB 2IAMA 3QQNA 4MGXA 3V0VB 2BRRL 5JUEH 5C6TH 3GSUA 3QDJD 2GTWB 1TMCB 1RZGA 3TT3L 4NZJA 5DHVB 4LLQB 4P2YA 4G80B 3PDOA 4KVCL 2CLZB 4GAYB 3GSVB 1DZBA 4XPTH 5H94A 4JHWH 4GAFB 3N85H 4P46B 4PJEB 3K0WA 2BVTA 3QI9B 1CD1A 1U8QA 4PV9A 3V8OA 4YHZL 4QRTA 3O11B 5CCKH 2UUDK 3IT8D 1X5AA 1KG0A 4YHPB 1MCOH 1EUTA 5E6IA 1EJOH 4ZTPH 4XPHH 3B6SA 1UJ3C 3ZT6A 1X6LA 4JM2F 1Q9WA 5DMKA 3LV3B 4XMLL 3ISWA 4OCYL 1IE5A 2HG5A 4CUCA 1INEH 4KKBC 3QDGB 1P7KA 4LLDB 4Y89A 1FVDA 4PJCF 3T2PA 5CWSA 5KAQG 4HH8A 4OD1L 1G7IB 5J13C 4Z0XA 4U6XB 1CGVA 1QSED 4MAYC 3BZ4B 4H26B 1G7LA 3QNYA 4FQXD 4ONOA 2RJMA 5IB5A 5I76A 4I48A 1MPAL 3ARED 4JM2C 1KELL 4PG9B 4KRNA 4OZGB 5DQJA 5F89A 4FFYH 5BVPH 4GBXB 2OX5A 3MUZ1 4B41A 2VAJA 5C0GA 4DGYH 5I18H 1CR9H 1GC1L 2HJKA 4UOW0 1OP3H 1A6UL 1OHQA 3E1F1 2OMBA 3U0PA 4NM8H 5EZJB 3ZKQD 1TCMA 2X1QA 4TSBL 3B9KC 4P2QD 4PRAA 1FAIH 2RB8A 4YFEA 4O9HL 4IJ3C 4HEME 3DVNA 1PQZB 4QT5A 4N0YH 2VLLA 1AXSA 2XTJD 1ZLWK 1EX0A 4X6DB 4PJAF 4R0LC 5MEQB 1R5VB 4LHUB 4RWYH 2HLFD 5EOCJ 2EYTA 3F7VB 1NUDA 4LCWB 4OGYL 3W82A 5HYJA 5KS9F 1ZT4A 2KKQA 4OFIA 3SDCD 5IBUB 3NCBB 2FBJH 4XXCC 1CE6B 2R56L 2OL3A 4XVJH 2IBBA 4OF5A 1QFWH 3UPRA 1RZ8A 2AJZA 3TH4T 1ND0B 3RWFB 1DBJH 4MDIA 3FAWA 4FQ2H 4QXTB 4XHJC 2NR6D 3RGVA 4ZPVA 1E28B 1S7RB 1X6NA 1F00I 3EYOB 5AWNH 3O3BB 3BDYH 1IL1B 1VFOA 5JLZA 2Y6SD 2J8UE 4R4FH 1PW3A 2BNRA 2DQEH 1KSRA 3W2DH 1RUQH 2R1WA 3OAZH 5E4EC 4GW1B 5IGXL 1UJ3A 4AL8L 3L6FA 4OFPA 3AC0A 5FB8B 5C0FB 3DX9B 2CR6A 3FQXA 4PJGB 4R26L 2NLJB 4JFEB 5DHYA 1K8DB 4RGNE 1YECL 1F02I 3PDDA 5D5MA 2ADJB 4IOFD 5DD6A 3MRMA 2F53A 3B2UD 5C0RH 5FO8A 1YEEH 3T0WA 5TF1H 1EGJL 4MD5B 3T0BA 5J11B 3GI8H 2O61B 1IJ9A 1T80A 2ZNWA 4PJCA 1WAAA 4KI1A 3T3PE 1G9MC 1V3JA 2C1PB 4L8SB 1GGCH 5IFAL 3KGRA 3VXNB 1NAKH 2AV7B 3GSRB 3VH8G 4IRSD 3AM8C 4MHHG 2EH8H 1CTOA 4M4PA 4B7IA 3FQNA 4DKFH 3RQ3A 5AG8A 3S37L 4D0CB 3JV5A 4R96A 1G9EA 3O3DB 4OV6F 3B9KA 4WWKB 1B88A 4CGTA 3PNWB 1P5UA 2HVKB 2DTMH 1B2WH 4MJ5B 5CIPB 4OKDA 1SY6A 2UWEB 3GJEB 4P0DA 2VQUA 4HHAA 3EZJB 4U1LB 1RHHB 4XNYL 5LWYL 4G8GB 2Q7YB 1JGVL 4P23C 4R0LA 3SKOB 2VXUL 4UDTB 3RL1B 5E2UH 1ZTXH 1KCUH 5E8NB 1JHLL 4GW5A 4S0SD 1G9MH 3GO1L 5ALBH 5FOJA 5FECB 1MCCA 1P7HL 3HPJA 2IAMB 4M62H 4OGAC 3P30L 3GSUB 1K4DA 1AQKH 3T4YB 4N5ED 2VXQL 1RZGB 4CL7A 2LQRA 1KB9J 1YEFL 5HHNA 3CFBA 2V7NA 3U4AA 3PDOB 1MOEA 2YD2A 4G9FA 3QFJA 2EXYC 2O5ZL 4H25A 4JO2H 1JWMA 5CJ5A 1MCSA 2HMID 4K71B 2IG2H 2B39A 5H94B 3HG1A 4F2MB 5K9KA 2OCFD 3RBGA 2CUMA 3A6CH 5I16B 4AG4L 1HSBA 4PRHA 4PV9B 4YGVB 4QRTB 5HSFA 1NCBL 3DROA 3KPTA 5F7LB 1I7RA 3NFSH 3TJEL 2MKLC 1TPXC 4PRPD 3SHSA 5IT2L 5ITFA 4JPIA 1JHTA 1Q9WB 1MRFL 3TN0C 2HG5B 1P7KB 3FFCE 5ID1A 1FVDB 1DCLA 3GHEL 3D87B 5IVXF 4Z0XB 1QFWI 5DJ8A 5GS0C 5JR1H 5ICZA 4QNPE 4C4KO 4WGWB 3TBYA 4N0UE 1MVUA 5I76B 4I48B 2HN7B 1YPZE 1ULVA 2VAAA 4X7FC 4X9GA 5DQJB 5F89B 1J05A 5HI4D 1ZHNB 3BP5A 4J3UA 1UCTA 2ZSWA 3KJ4C 3AM8A 2HJKB 4UT9H 1T1YA 3HMXL 3F12B 1TITA 5IV2A 4MB3A 3TA3A 3H3PH 4RFOH 1WV7T 3B9DA 3BPLC 3MLXL 5HDQH 2Y06L 4NQDD 4HT1L 4OZIA 1XGYL 1INQA 4PRAB 3IYLW 3L9RB 5GS0H 4JR9H 5K59F 2CK0L 4NQSB 2IADA 3DVNB 4OM0H 3O3EA 3LSOA 3MXVH 2VLLB 1AXSB 3UJJL 1FFNA 4RCAA 1N5AB 3GSWA 3F7QA 2EZ0C 4QRRD 2J1KA 4RBPK 3GFUA 1SEQH 2YXMA 1HK6A 4JRYE 1ZT4B 1DQDH 4PJ7F 4PRIA 2OR9H 2G60H 5TH2B 4CVXA 1P6FA 2AERT 4FFZH 4GMTL 2OL3B 1LE9A 3WDHA 1RZ8B 2AJZB 4Z0BH 1GGIL 1XFPA 4ELMF 5LCVL 1HEZA 4X8XA 1T7ZA 4HJJH 4MDIB 4HAFA 3UBXI 5CBEB 3RGVB 4ZPVB 4D9QE 1KIRB 4X4MA 2VC2L 5JLZB 2R8SL 4CDGC 4XNUH 1J87A 2ESVE 3MLTA 2BNRB 3DJ9A 2DBJA 1DR9A 1K9TA 3MBXH 1ZVYA 3QWQB 2FX7H 3IDIA 2GTZB 1JGEA 1UACH 5HHME 2DJUA 3QJHA 3WMSA 4MCYA 4LSUH 3SOBL 4Z95H 3WFBH 3NMEA 3NTCH 1QR1A 5DHYB 2PUQT 5ACMA 4HCRH 3IKKA 1NEZG 2A74B 5EIIA 5F9WC 3ZE1E 5D5MB 4YDLC 4ETYA 3VDCA 5DD6B 5BOPA 1A14L 2FB4L 5FO8B 2BRQA 4ERSH 3LZFH 5SV3A 4KQ3L 2P24B 3FQWA 1T2XA 4P46D 1QFUH 2A77L 3OHXA 4WIQA 3QI9D 1VGEH 5E5MB 2MTPA 1A47A 3CCHA 5C07E 2W9EL 5HDLA 3H3KA 3FQNB 3T0EA 4WU5A 5MENE 1CGSH 4R96B 4TVPL 1CU4H 2XA8L 2CUIA 2NY4C 1YEKL 3E3QE 3P0VL 2CXKA 2NNAB 1WBXA 2B1AH 4YZFE 4R97B 1JNLH 1G1YA 4JM4L 2NX5E 2DM2A 2NY7H 1A3LH 1IKFL 1NC4A 3WUWA 3MV9A 1YN7B 4KV5F 5D1XA 5FK9B 3CVIL 5FHAH 4GW5B 4CNIA 5HD8D 5D6CA 4PYHA 3HPJB 2Q76A 3K4DA 5DMYA 1NAML 2EIEA 4K94C 1JWSB 1K4DB 2EIZA 4GBXD 3IJYA 5HHNB 5EUKA 2QBWA 3CFBB 1J8KA 4ZFFA 4NJAL 4G9FB 3QFJB 4XNZC 4H25B 4P3DB 4U1IA 5CP3A 4IRZH 3RVXC 3DECA 3OKLA 3QCTH 5ADOH 1RUML 5T5FL 5K9KB 5I1JL 1UZ8A 3U46A 4LFHD 4EDXB 3BISA 5C9JB 1LO2H 4PRHB 3UO1L 4IBLT 1PSKH 3V2AR 1BFSA 1I7RB 2EDQA 5M7QA 4GKOA 4ELMA 1UCBH 1EO7A 4U1MB 3BESR 3QUYC 3KPOA 2VDPL 4BQ8A 4TNVF 5ITFB 2BHZA 4NGHH 1JHTB 1CLYL 3KPSA 2WWKT 1GJIA 4EUPG 5I19H 3PG2A 5F1IB 2PR4H 4LHUD 3VXSB 1G0DA 4LCWD 3VFRA 5ID1B 1GIGH 3FB6B 2VDQH 5DJ8B 1L7TL 3EYUL 1EH9A 3OKDB 3DGCR 2HFEA 1YZZA 3QULB 2ZSVA 4ZO6A 5H8DA 4KI5D 3HMWH 3DHMA 4U1HA 5SWSA 3KS0J 4HS3B 4U31A 1J05B 4RGMC 2P43B 4H20L 4LSTH 3BP5B 1BREA 2CKNA 3MYJB 2FNBA 4Q7DA 3C8KA 1ACYL 4RA0C 4G8FB 1MJ7H 4RGOL 3V7AG 5ESVB 3HZMA 2MPAL 1T1YB 5LQBH 2BMKA 3TA3B 3HA0A 1WICA 1MREL 1BIIA 1OGAB 5T3ZL 1TLKA 4MS8D 4QGTA 1INQB 1JNHB 3LRSA 3WIHL 4JFXA 4MLIA 4KJWD 2XZQH 2IADB 4JFED 3O3EB 4P9ML 1X3DA 3LSOB 1PG7W 1WSST 5J12B 3LQAC 5KN5A 1D6EA 4Q97A 1NSNL 5JIKA 1QHOA 5EO9B 4HKZA 5F1KC 4H8WL 1FP5A 1Q94A 5HY9A 3QO0A 5D7KD 4ZUSB 1RZKL 4XNMA 1NDMA 3ZDXF 5FUCC 4JRXB 4EI5C 2MHAA 4BSWB 3MRNA 1RIHL 3SDXA 1LE9B 4UDUA 1R24A 1ZA6A 3CU1A 4OCLC 3RI5K 1DE4A 2VYRE 3PP4H 3F8UB 2ZCKH 3I9GL 4WWKD 4M1DH 4R6UA 3WE6A 1WZ1H 3LQAH 5HYFA 3MYZA 2JB5L 3A6OA 5IW6B 5D1ZB 3VXMA 1VPOH 3G5ZA 4U6VH 1X4XA 3QUYA 4RISL 4UTAH 3HE7C 4X5WB 1EA9C 1T21B 3EFDL 4G8GD 3U30B 3IDIB 5HVFB 3CVHB 5DRZA 1J0IA 3C09C 3QJHB 1AKJA 5IG7B 2IAMD 4KAQL 3FN0L 1QR1B 1JPGB 3HZVB 3MRDA 5F9OH 2DL9A 4KRPC 2BVOA 4FFVC 3VH8A 1RURL 4HF5L 4OUUB 4QXUH 1AE6H 2AEWA 2E8ZA 4DAGL 3MCKA 4JE4B 5L2JA 1I9JH 2DICA 2E9JA 3FQWB 5ANME 3OHXB 3IDXH 1GGBH 2YA2A 2P49B 2DBLL 1FORL 3S96A 1TVDA 3W11D 3MGAA 2VB5A 4NRXB 5F3HA 1DUZA 5I6XB 1TXKA 1K5NA 5EFIB 4OQTA 3T0EB 3HR5B 4WU5B 3QEHA 1Q0YL 4NNXA 4K8RH 4KK8D 5FV2A 4BYHA 2FH6A 3IS0X 3RVUC 3IDYC 3EDKA 1J11A 2GW5A 3LVEA 4P5TC 4RMRA 1F4AA 4DKAA 1RULL 3QEQE 4AY0A 2DJSA 3GKWL 3MV9B 5D1XB 1JPSL 3MRLA 1MWAB 5KTEH 1FN4B 4LGRB 2Y9RT 4CNIB 5A2JH 5D6CB 4M7JL 1ZANH 2WQ8A 1UXSB 4QHKI 2EIZB 2XY1A 1KBGL 1NBVH 3CDFA 5JZ7C 3BAEH 3I75A 4NZTL 5D7IE 2AJYH 2HFGL 4ZFFB 2VITA 4G7YH 2JJUA 3CJJA 3E0GA 3OXRA 5HI3D 1NFDF 5FYJH 5C3TA 2Y5TB 5CJXC 2P47B 5F1NA 1UZ8B 2Q6WB 4ZFZB 1EVUA 2AEPL 4YNYA 1L0YA 2VH5L 3LPWA 4F9LC 5DMIL 5HHOE 3MLSH 4Z7NE 3HE7A 5TGBB 1IC7L 1C5BH 3G6JE 3A67H 4X0KA 1D5XA 1MJJA 5IHZB 1MCBA 4TUKH 3VE0B 3NA9H 4QRQA 2OXHA 1P9MC 2X7LB 4BZ1H 3VFRB 4BQBA 3O2DL 1UM5L 2Y07H 3V5DA 2PO6C 1PZ5A 4PLNC 5CS7A 4MQ7B 2QSTA 3K46A 1C7TA 4Z7VA 1FFOA 1NGXA 4CRPA 3GJFH 1MFAH 5DI8A 2ZSVB 3M45A 4NJ9H 4PB0L 4U1HB 1XR8A 2D7MA 1BEYH 1XH3A 5BXFB 2V5YA 2Y36H 3RGVD 4YJZL 4LEOA 4ZQKA 1HCVA 2E3VA 4R4NC 2JE8A 1ETZA 3GSOA 1CCZA 3TCXA 4I2XE 5TQ0H 2BERA 3O4LA 2W38A 1FCGA 3HZMB 1JPFA 4PLJC 3ROOB 1A6PA 4GRMA 3VXUE 4HBCL 2BNRD 5IQ7H 5FFLA 2BMKB 2Z31C 2FJGB 3TVMC 4GRWB 1H3PH 1BIIB 3MJ9L 4KK6D 1AI1H 3LEXA 7FABH 2VDKL 4KGLA 1CLZL 2WUBL 1ZOXA 3I6GB 3LRSB 3VXOA 4OZ4A 4JFXB 4M43L 1X5YA 3BE1H 5KN5B 1U93A 3L5JA 2VR9A 2FL5A 3C87A 4MA7L 4HKZB 4UAOB 2ICWI 5L88L 5ECJE 5BMFH 4J4PC 3IB4A 1IFHL 1Q94B 2ID5A 1CK0H 4ZODA 3V4PH 4A2LA 1NDMB 3T1FB 2VISA 5BZDA 2MHAB 1CXHA 4OGXH 4JKPL 3W5MA 2GJJA 3GEWB 5FCSH 3PP3K 3SDXB 2HT2D 3P77A 1BD2A 1R24B 5E7BA 3UTZA 2DI9A 2H2SD 1MI5E 1DE4B 3LKQA 5DJ6A 4U1GC 3KLAA 4X6FA 3DSFL 3WE6B 4F9LA 3KPNA 3N1MC 4UINL 2ICWJ 3EIFA 1NEZA 1X44A 3G5ZB 4FQPA 5ADPH 1LK3L 5FUZL 5EUOF 1VKXA 3RU8H 2NZ9D 1XZ0A 1KEMH 1RJYB 2EDWA 1P9MA 1AKJB 1MLCB 4ZO9A 5HDBE 1V7ML 4WUUB 5IKCB 1LD9A 3D39B 2PO6A 5FGRA 2GT9A 5DUBB 4F7PA 2AQ2A 3LB6D 1KYOK 3MRDB 4MXVE 1QP1A 1U41A 3ZKND 3OPZL 4OF7A 2BVOB 3LD8C 5D96B 4Z8FH 1OARL 4G9FD 3QFJD 5TFSH 3EBAA 4W70A 3CXHJ 2ATKA 5K9QG 4TULH 3FB7A 4CKVX 4MMZC 4MA8H 3JV4B 4OFYD 4ACPA 4HZLB 3QG7L 3S4SG 1KCRH 1SMOA 3QHZH 4PGCB 5KSVB 1RJLA 4P2CG 5DJCA 2EO1A 1W0VA 3W9DA 3S96B 2AKRA 2Z31A 1ACZA 1F6AA 3GI9L 3R8QA 3VFNA 3WJJC 1K5NB 3TVMA 4JFYA 3U6RA 4MJIA 4L1HA 1VFUA 2QR0B 2ZKHL 4LRNL 2DS4A 3BKJL 2FHBA 3VXSD 4YR6B 1GPOH 1YMHB 2ADGA 2NY1C 2FATL 1QSEE 1LE5B 3MRLB 4Y2DC 2O5XL 3BWAA 4HK0A 4JPVL 5HHXL 1VFBB 3IJHB 5FA3A 5FDWB 1FE8H 4YDJA 4GRLA 3U9PL 1SM3H 4LLMA 2M2DA 2DWDA 4LPUA 2MFNA 1W0WA 4GG6A 3HNTL 2PYEA 1IAIL 5J56B 3I75B 2VITB 4X4XA 5EO0A 3C60C 3UCRA 1XT5A 1RZFL 3I50H 4ZXBC 1JRHH 2GJZB 4JZNA 4NKQB 4JANB 5F1NB 3TA3D 4EUPA 3HE6B 1OGAD 5ENWA 4AIZA 3T65A 4Z7WA 4J8RA 3ZO0A 4UQ3A 1BVLB 4BA8A 3HC3H 4I13B 3MGOA 2A1WL 2XTJE 5CZXC 1CF8L 2A9NH 1I3GL 2F74A 4KPHL 4AENB 4LLVA 2XN9A 4N8CH 4QRQB 1MJUH 5BS0A 1GAFL 4K7FB 5GGVL 4H0HB 4HUUB 2GSIA 1F4XH 4KROC 2QADB 5E6ZA 4JRXD 2DL2A 4Z78A 5EUOA 4OI7A 4XCCH 4KHXH 1FL6B 1EAPA 1NGXB 1NQBA 3HR6A 5DI8B 4MA1C 3JV6B 1MCFA 1AGBA 1AO7A 1MCQA 4RAHA 3SQOL 1XH3B 1T66C 5EZLB 1I3RB 4LEOB 3TNMA 3KLHD 1TZHB 3O41B 4NIKB 5E9DA 3KPRA 1BJ8A 2UZYB 4HWBL 3O4LB 3WJJA 5D1ZD 2VABA 4GRMB 3EOTL 1ORSB 1CDUA 3CUPA 4JO3L 1Z9LA 5TQ2H 4OTXL 3RY4A 1D5IL 3AVEA 3S8WA 3LEXB 3Q1SH 3BSZL 4K7PY 3RDTC 1XGQA 3CGTA 3S9DB 3DLQR 5L2KA 2JCCE 4B53A 1MCIA 1WWWX 2VZUA 3CMGA 1RK1A 4G6JH 4K23L 2PTTB 3I85A 4ZNEA 1U93B 4GQ9L 4Y2DA 5L8LB 2FL5B 2RBLA 3GIVB 3LH2H 4NCC2 5FM8A 4PR5A 4M6NH 2R0LH 2AXGA 4XH2B 2BY2A 5ISZA 1OTTD 3EYQC 5BZDB 2BRRH 2DWEA 4Y88A 1ZHBA 5L7XH 3IAGC 3P77B 1BD2B 3BPOC 4NKOA 1XF2A 3L3HA 3TT3H 2ZJSL 3T0ED 1QBLH 4XP9H 1W72B 3LKQB 5DJ6B 4PJ5A 3KLAB 4X6FB 5DVKA 4AIOA 5L0QB 4NSKA 1NEZB 3B2VH 4Y2OA 4YHZH 4J2XA 4ZUTB 4Y5XC 4PJDF 4Z7UF 4IOIA 1T2JA 2WWMD 3MV9D 5GGTL 1XZ0B 5D1XD 5D4QA 4C57C 4D9LH 3JWDC 4OLYH 2A6IA 1VCAA 3HCVA 3QRGH 3C5JA 3ECBB 1ERNA 4M7LT 1H5BB 4XMLH 2GT9B 4PIRF 4M93B 1S7XA 1JRHI 2BXYA 3QUMA 3N1GC 1QO3A 5I8CA 5IBTL 4MSWA 1NCDL 1OTSD 3ALPA 3RWHA 2OK0L 3FB7B 5J6HB 3WFCH 3C6SA 3NOIA 5CJBA 4LSSH 1RJLB 1BBDL 2VSDA 2XRAL 4RIRB 3RUGE 3T08A 4EJ1C 5LGKA 3W9DB 4QF1B 3VWKC 1SJXA 4ISVA 2QQKH 1UWEL 4HPYH 3VFNB 3JWDH 3QAZC 2F8OA 1GC1H 4PRPE 4HIEA 4MJIB 5C6WH 3EOBB 2R4RL 1FH5H 4N1CA 5DFVC 5T5NF 5EU7C 4NWUL 3UX9B 4YXLL 4X9BA 3PV7A 4O9HH 1RZJL 2NYYD 1OP3K 35C8L 4KKLC 4UB0H 1UA6H 3BWAB 4HK0B 1FZKA 3GK8L 3VD5A 1FL5A 4YDJB 4GRLB 4QRPB 3TBSB 1FO0A 1OTUD 4LLMB 1A7BA 5B3JE 1S8DA 2DWDB 3B5GA 4GG6B 2P5WA 2H26A 2DRUA 3D85A 2PYEB 3QDHA 1OAUL 3QPXL 4KY1H 4X4XB 4PJXF 1BX2A 2R56H 5C0ND 4JZNB 4JVWA 1NC2A 4LKXA 4EUPB 4N9OB 3DVGA 4ZFOL 1T03L 2DQJH 5ENWB 1WF5A 4NQDE 4AIZB 5JHLL 4XVUC 3T65B 4X9HA 3GB7B 4Z7WB 5D2NA 4J8RB 5I66A 4JDZA 4PJ9A 4Y19B 3DUUB 4FTVA 4JQXA 5F7NC 4IRJC 4JJHA 3SE4C 4NNPH 5LVEA 2F74B 1DANU 3MBEA 4QRRE 4DZBA 5HBBA 5BS0B 4Q9RL 1T22B 5D7SL 2GSIB 3FTGA 4JRWA 4R7DA 4HWUA 3IU4L 4ZSOA 5KW9H 1ZHLA 1Q0XH 3H9HA 4Z78B 4DK3A 2BY0A 2DLFL 4XPGH 3AXLA 4Z7UA 4PJHA 4NKIH 3OAZK 2DAVA 5KSUA 1AGBB 3L3DB 1AO7B 3ULUD 4MB4A 1CE1L 3WXWH 1EGJH 3TNMB 4U0RC 3BYTA 5SWQA 2HT3C 1MFCL 1P4IH 6FABL 4HG4J 3Q5TA 5IFAH 3RIFK 5FIEA 3TT1L 3V4VL 3OV6A 5GPRA 2AVGA 5HPOA 2VOTA 3GMRA 5I1GH 1Q8MA 4C56E 1AKJD 1TNNA 5ERWA 4WUUD 3D39D 4KUCD 3EYSL 3I6KA 2EICA 3W39A 4Q58C 2ERJC 1SHMA 4XNYH 4PJFF 5HVGB 2HT4C 1IC4L 2VXUH 4P4RA 5ISZB 2A6DA 2P5EA 3MX0A 3ZDZF 1JHLH 4PJEE 1L0QA 3GO1H 4U3HA 2YK1L 1YN6B 4XWGL 3BKCL 2DWEB 3X3GL 1E6OH 1EAJA 1XF2B 4NKOB 2NW2A 3L3HB 4XMPL 1P84K 1NCCH 2GJ6B 2D7TH 4JHAL 2O5ZH 5JNYA 4XCEA 2XFXA 4PJ5B 4U6HA 1WBZA 1QYGH 3MZTA 1WISA 4OFVA 2CO6B 3O4OB 2H2PC 2KZWA 4NSKB 4W4OC 4BK5A 1R6VA 3VMPA 3OZ9H 1CZ8H 4IRJA 3ZZ1A 4CN1A 3L5IA 4EKXA 5HGAA 4RMSA 4LQ1A 43CAA 3WHE0 5T1MA 2A6IB 3WKNA 4LDOB 3S4SA 4D0BA 5IMKA 1RHFA 1KENL 5JXAH 4HWZA 2N56A 5JIHA 4I3GA 3DV6A 4DUWA 1INDL 3GHEH 1KB5A 1DP0A 3QUMB 3STLB 1QO3B 5I8CB 3U83A 3RWHB 4OZFH 3RGHA 4RZCA 4FQCL 1QPPA 4XAWL 1ZVSB 4NKMB 1R3IL 3HE6D 5HVWA 4Y4KC 4ZD3H 1NGQL 2MJWA 5DRWA 3ILQD 4LL9A 4ISVB 5IR1A 4J3VA 3X12A 1S9XB 2HLAB 1RFDH 3U79A 1VACA 3C6LC 4WO4A 4HIEB 3VU2A 1R0AH 1HXMB 4X80H 4MJ4A 4H1LH 4LBEB 3RIAK 3HFML 4LCWE 5IVZA 2HFTA 1S9YA 4ONFL 3VFUB 5GS2D 2A0LC 2Y06H 2QADD 4HT1H 3R1GH 4YXKL 3VD7A 1F4YH 2FSEA 1JWUA 1BWMA 4U3CA 3LQMA 4XVSL 1BJMA 1FNGB 1FZKB 4KI5E 4WVRA 3UJJH 4NO3A 2PYFB 4M1GL 3MSPA 1KJVA 3QNXA 5FKPB 3WKMH 4DGVH 3ESVF 3ZDYE 2P5WB 1E6JL 1LK2A 4NQEA 5GJSL 3DXAA 1R3HA 2R2BB 3BT2L 1FCCA 3O4LD 4LQFH 3NPSC 1I9RH 2BOCA 2P44B 4LHQB 2DQTL 4PJFA 2DMCA 5BRZA 2VDRL 5LCVH 4EOWH 3RHWF 2X4PA 4W4OA 2IPTL 4MD0B 3F7YA 4P5KB 4PJGE 5FM5M 5D2NB 4PJ9B 3EO9H 1TZGL 3FRUA 2VC2H 5LGHH 2R8SH 3D3VA 3GMPA 4FTVB 3KXFB 2BSTA 3L1OH 4Z7OE 1CGXA 4G7VH 3MBEB 4DZBB 3HAEG 5D7KE 3JSSA 3FTGB 5DRXB 4R7DB 2R69L 4ZSOB 3MRRB 3H9HB 5EO1B 4ZAKC 4R4BA 4L4TB 1KTDA 5IF0A 2BVQB 25C8H 2HTKD 4I1NB 3AXLB 1X5LA 5DZLA 4PJHB 3GMQB 5INCA 1BD2D 5JOFB 5KSUB 2DQFA 3CAFA 1A14H 3Q3GB 4X7SL 2OZ4A 1R3LA 2ZCHL 4ALAL 3T0DA 1ORQB 1O0VA 3VW3L 5SWQB 5C08B 1FNLA 1R5WA 3DUHA 3RWIA 2W9EH 4KQ4H 4G8GE 3VRIA 3CLFH 5DS8A 3GMRB 1YDPA 2X41A 5C0DA 3P11L 4TVPH 5ERWB 5MHSD 1YEKH 1U2CA 3P0VH 1QUNA 3REWA 5ESAB 4CN4A 5GZOD 3G5XA 4JM4H 3W39B 1QA9A 4YGAB 1XF5A 2IPKA 3GRWA 5I9QC 4CAGA 4YAQA 2ORBL 3SKUD 3WIIH 4U1JB 1QLEH 2MMXA 4MCZA 1H3WM 3PQYB 3CVIH 1FNEA 1SQ2N 2OI9B 1ADQL 2A6DB 2P5EB 3V4UL 4WI9A 3Q0HA 5BV7C 3SJVB 2IFFL 3RVVC 2VDNL 1NAMH 3K7UA 2AI0H 3WDIA 1P5VA 4X7TA 3VGAC 4OCWL 4NP4L 5JNYB 5ICYA 4OZHA 3SDAA 4KKCD 4U6HB 4MJID 4M61A 1RUMH 1KTLB 5T5FH 5I1JH 2NMSA 4YIQA 3T3PF 1DBKL 5DO2C 4N0CD 2VLRB 4RGNC 2VDML 1A6AA 1F4WH 3ARDB 3DVFA 4OCXH 3WXVH 2PXYC 3M17A 3CFEB 2MCG1 1C7SA 3CD4A 43CAB 3BN9D 5T1MB 2DD8L 2E8YA 2VSCA 3S4SB 1YMMA 4EDWL 4GRLD 4QRPD 2Z8WC 4ZAKA 2GK0A 4HWZB 2WQRA 4KVNL 2PYED 1A5FH 3QWRD 2H41A 4UT7L 1CDHA 1KB5B 3ZL4H 5HI5D 2KUTA 1T7VA 4YBLB 2GAZB 4RZCB 1DVFC 5J7CC 3MV7A 4U2ZA 1FPTL 1Z5LB 1F11A 2K1MA 4RAVA 1U95B 4JM2B 2AJUH 2YPKA 1IGFL 4UU9A 4FQQB 3WUZA 3O3AA 4WI3A 5IR1B 4HK3J 3ZYIA 1H8NA 4PJIB 1ACYH 1KT2B 1VACB 4RGOH 1NH6A 5JPNA 2XPGA 4WO4B 3MXWL 4Y19D 2DQHL 1MAML 4W4NA 3QHFL 5A16A 5IMMA 4G6KH 1JGLL 3R4DA 4R2GB 3LEVL 5MI0B 5BS0D 4DKEH 2FIRT 4DEPB 2W0PA 4HS6A 5T3ZH 2FD6L 3F7RA 1E4WH 2CQVA 2FEEL 2FSEB 4MLSA 1WTLA 5FAAA 4WTWA 5DD0H 3FT4A 4MQSB 2AEIT 2WSKA 1AO7D 3EJYD 1P4LB 3PL6B 3OWEA 4D0DA 4LK4A 5FYKD 4W81A 1CDYA 4NQUA 4NQEB 4WY7H 2J8UA 1BECA 1RZKH 3WS6C 1R3HB 5KSAC 4FABL 4A6YA 3FJTA 2BNRE 2BOCB 2FGWH 3I2CH 4KKAC 4QNPF 1KEGL 1YQ2A 2HAZA 4MQXC 5DUML 5BRZB 1YPZF 1GZPA 3F7YB 2AJVH 1A3QA 4AMKH 5T3XD 4U33A 3FRUB 2YUWA 1JGUL 3D3VB 5D5ME 3B43A 4APQC 3U48A 1NANH 4LHJB 1AGEB 4JO4L 1X5XA 5BZWB 3TBTA 1FLTX 4BUGA 3EFDH 1AXIB 2J6EA 2ZZUT 3ULVF 5ISZD 4OAWB 2QEJA 4LIQE 4HJ0D 43C9A 3OKYA 1NMBH 5IF0B 2LAGB 3GMNB 4KAQH 3V5KB 3FN0H 5FGBA 4F57L 1XAUA 4F7MA 2QQQA 3MLUH 1DVFA 3RZCA 3V52L 1IEHA 2GJ6D 4X98B 1RURH 3R0NA 2X4UA 4HF5H 4QWWD 1I8LA 3PGCB 1R3LB 3DURA 4PJ5D 4DAGH 5IBLC 1TVHA 4L3EA 1EEYA 4QHNB 2LVEA 3BKYL 3MV11 2D3VA 1CICC 1J88A 4YEFA 3MFFB 2DBLH 2EO9A 3V0WL 5DGQA 1DQJA 5JO5A 2X4SA 5HVHB 3VRIB 5D7LB 5DS8B 1MCDA 3PE9A 1D3CA 5C6PB 4DN4H 2YEZA 5C0DB 1C08A 2WUCL 1Q0YH 4UOJA 2C4XA 2XZCH 5CLTA 2IQ9L 5C9KA 4R7NA 3T8XA 1EV2E 4XT1C 4MXQC 1TTUA 2IPKB 2VUOA 3HI5H 4YAQB 4G9FE 3QFJE 3GKWH 3ULVH 4MCZB 3FCTA 4FA8A 1FNEB 2VZ1A 3RA7L 1HWHB 2H1PL 3RL2A 1YC8A 3K4ZA 3R8BB 3VGFA 2IH1A 4UT6L 2OP4L 4ODUB 2WBJA 4HDIB 1R3KB 4M7JH 3TBWB 1N2RA 3WS6A 1IVLA 1S5IH 1NGPL 2DLIA 3PHOA 5KSAA 4YDVB 5CMAA 3RWDB 2A6KA 2PW1B 3CXHK 3P9MA 3ARFA 4X7TB 5EA0H 2HFGH 3CSPA 4OKVB 4S2SB 2FH8A 5ICYB 4OZHB 3MUY1 3SDAB 3CSBA 2G5RA 4M61B 1VESA 1YY9C 4N0FB 5F96H 3VXSE 1X7QA 1U3HA 1OVZA 1PLGH 3PWNA 4ORGA 4XCFH 1A6AB 4APQA 1O7SA 2VH5H 3WO3B 4GSDH 3M17B 1QSZA 4N0UA 1ZT7A 3WSQL 2JKXA 1DQQB 5DSCB 3H8NA 1ZWIA 5TDNB 1YMMB 5AZ2L 5CILL 1RAMA 2GK0B 4NQTA 1QHPA 2X10A 5CGYD 2P5WD 3MUHL 1UM5H 1OF2A 5FGSA 3HB3C 5DQDL 4QHUA 2NXZC 3IDNA 3UDWC 3JTTA 3WDJA 5I17A 3MV7B 1EMTL 4NBYB 3CZJA 1OGAE 3ARQA 4L3AA 1OB1B 3EJJX 3E3QC 1PFCA 2YPKB 1GRWA 1XGPA 5ICXA 3O3AB 5HYEA 1NANI 3IGAB 4PJ9D 2XPGB 3ES6A 3C08L 4FTVD 3KXFD 3O6FC 4HBCH 4WI5A 5A16B 5IMMB 3U2SA 3MBED 3RVTD 1A02N 3TYGL 1YJDC 4DTGL 5FO9A 5JOPD 3MJ9H 1YEJH 2WZPD 1I1RA 5JPMA 2Q8BH 2VDKH 5CBAA 2WUBH 4RA3A