5CEYB

Crystal structure of fab 9h+3l, a putative precursor of the pgt121 family of potent hiv-1 antibodies
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
232
structure length
232
Chain Sequence
b'QVQLQESGPGLVKPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLKSRVVISRDTSKNQLSLKLNSVTAADTAIYYCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 9H+3L Fab light chain
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 232
sequence length 232
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ceyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ceyB01
3IKCB 1HHHB 1AY1L 2NY5C 3HUJA 5C0BD 2X9WA 5F7EH 3U4BH 3BMWA 4PGDB 3OF6D 1KENL 2EICA 5GZOC 5F8RC 5BV7C 1K85A 1V8HA 1S7TB 3HE6A 5F3HA 4DK6A 4LHJB 2WZPD 4F8TA 4WO4A 3BESR 5IEHA 3OHXA 1AO7D 4YDJA 4JR9L 2JB5L 2WQ8A 5B3NA 1MRCH 5LG1A 5TE7L 3TBSB 4KK9C 1V3KA 4URTB 1IGCL 1I9JL 4JREC 4L9LA 1C7TA 1NCWH 4OF0A 5F6HI 4HX1B 4GXUN 5HBBA 2F19H 5E8DH 1E28A 4X83A 1YEFL 3QIUB 4FG6D 4U1LB 1IEHA 1E6OH 1N0XH 1NCDL 3WDJA 4FFVD 1WFTA 3VXOB 2EYRB 3MA7A 4Y2DD 2E7LC 4S0SD 3ULUC 3PUCA 1K8DB 4HUXA 2JB6A 3BP5B 2IFFH 2C1PA 1U3JA 5EOQL 5AZEL 4PJBE 5FYLH 1S7WA 2R2HA 4S1QH 3BZEB 2HWZL 3MLVH 5IM7A 4Q6YA 5GRUH 2ZCKH 3WIFA 5AWNH 1IC1A 4HZAA 2WMPA 4N5ED 3BIKA 1PAMA 4RISH 3BKJL 4PJ9A 4QHLB 3V6BR 4EIZC 2GW5A 4G9FB 2EDBA 4H8WC 5H94B 3HE6D 4YDKL 1A6ZA 1EO8H 3KPLB 4WO4D 4Q9QL 2IPUK 1E4WH 2RCSH 3FO2B 5TDOB 3MRFA 1U91B 1KCVL 5DDHB 3NN8A 5FO8A 1RUQH 5HDLA 3C6LA 4YBQC 2DRUA 3DX6B 2J8UA 3LDBC 4OM0L 4QHNA 4UOW1 1SJHB 1RURL 5CHNA 2CRZA 5IBUB 4Q6IB 2VDKH 3O6KL 1MFAH 4PJXB 3G5YB 1H3PH 4NZTL 5D5ME 5CKGA 1SBSH 3VG9C 3ARFA 1IGFL 4BJLA 2R0ZL 4FQJH 4BH7B 3HRZA 2MFNA 3PP3K 1OAXL 4NYLA 5JHLH 2O61A 2GCYA 4ZD3H 2V5YA 5D7JB 4JRYA 3O6LH 5IV2A 2OK0L 4LDEB 3GJFA 1DLHB 3Q3GB 4ZQKB 3ULVH 5D1XA 5E2UL 4XNYH 2YPLA 2VR5A 1F6AB 4PJIB 5HVHB 2AQ1A 5SWSB 4I0PB 2VXUH 4L4TB 4YZFF 4AZ8A 5C0GB 5CBEB 4PJ5E 4ETQB 4Q2ZA 4KZEL 4PJ9D 1OAUH 1GGIH 1BBDL 4M93B 1CXLA 4LP5A 1GZQB 4NN6C 5D6DC 2P8PA 3RU8H 3THML 4G9DB 3VMPA 2PR4H 2HFEA 4Q74A 4QTHB 1KPRB 4PJ7E 5LBSL 4BSVA 5FOBB 5HYQA 4DVRH 3C6LD 1U8KA 3D5OF 3DO3A 2ZOKA 1HHJA 1DSFH 2G60H 5FDYA 1BJ1H 2D7TH 3QA3A 4P4RA 4RAUB 5GIRB 3PWPB 2VDPH 4OCLC 2F9BT 1RZGB 5F9DC 4BK4A 5FDWA 1OP3H 3MO1B 5CSBA 4IMLA 4JPIA 3WE6A 1XCTB 3K2UL 3GMLA 4TSCL 2V9RA 2VZVA 1D7FA 4JO4L 4P2QE 4XPTH 5I66B 4QHKI 3ARFD 5CJ8A 2HTLC 5TDNB 5C0IB 4UT9H 3QUZA 5HI3C 3S97C 4ZO9A 3A67L 2R15A 1T03H 3DUSB 1CE1L 3QEQB 5CIPB 4G3YL 3PDDA 5HHQB 4JRYD 1XEDA 2NTFB 4V1DE 2NMSA 4F2MB 5D1XD 3H3PH 3FMGL 4U3CA 4AEEA 2YPLD 3B2UD 1MIEH 4LCIL 2PO6C 2F74A 5DLMH 1QVOA 3DV4A 4NPYA 3NFNB 5KSAB 2BC4B 4U1JA 5IW1B 3VCLA 3UO1L 4CVZA 4JN2B 1WEJH 4DEPC 5I2IA 1PEZA 5ISZA 4X5XA 2RR3A 3K81A 4M7KL 3MNZB 2UWEA 2YSSB 5LGJA 2GTWA 1JVKA 3WIIH 5KVEH 4FFZH 3UMTA 3W81A 3CVHB 4LCCB 2A9NH 2XKUA 3HNSL 2I9LB 2Q8AH 3STZA 1CI5A 3RA7L 5C9JA 1FE8L 1OSPH 4JFOB 1LNUB 2G5BB 4LRIA 3V4VH 2AJXL 1MCLA 2X1WL 2E9WA 3T2PA 4M62L 5JDSB 1LO2H 2Q76B 1CE6A 1LO4H 1YN7B 4L29A 4NIKB 5C0AB 3D0VB 4Y16C 1FSKC 2VH5L 3D39B 3LN9A 4PJGF 3WFDH 4Y4HB 3T3MF 3F5WB 3QDAA 2GITA 1L0QA 4C56A 3GSVB 2YD2A 3S8WA 4LVEA 3U9PH 2ICWJ 1INQA 3QUZD 4UINL 3FTGB 1KLUB 4HXBL 5EO9A 1J18A 4JFDB 5JHDA 4Z7OF 1HZHH 2FJGB 1Q0XL 3SKOB 2F5BL 2B1AH 4KMQA 4FXLA 1ES0B 3MUGA 5CJXA 1FO0H 4LSSH 1ZHLA 3L3OA 3H8NA 1N59A 1NMCB 1HXMA 2NYYD 1GIGL 4FFYH 3OV6A 1GCFA 1VFBB 4MA3B 4N0YH 3PXHA 4Z7WB 1YC8A 4X7EC 4ZUTB 5GGVL 3RDTB 4BZ1H 5ISZD 5DUBB 4YGAB 3X12B 2AXHA 4MAYB 3FQRA 2XWBB 3HHRB 3MNWA 4XNMB 4M1DH 3IYLW 1NDMB 3BN9D 2H9GA 4ODUB 2ZWLT 3JTSB 3PGCA 4G6KH 4JFFE 1F4XH 1RPQA 2GJ6A 5E8EA 2VDRH 4KPHL 1X5HA 1T1XB 3NCEB 1CTNA 4KTDL 4P46A 1CGXA 1MIMH 4GAJH 3KNBB 2QADC 3HTLX 5E99H 4JO2H 3SBWC 4YHZH 4Y4FB 4EUPB 4KXZH 1S9XA 4EOWL 3IDYB 1N5AB 3BP6A 5B8CB 2F54E 1MWAB 1MUJA 1XF3B 4HKZB 4P5TC 4LCWE 4ZUSB 4WHTB 4I77L 4WWKB 4C56D 3QRGH 5E7BA 3GSWA 4R2GC 3NAAH 5JHDD 3G6JF 4I9WE 1ZLWK 1J12A 1IEBB 1PJ9A 2NXZD 4MSWB 3JV5A 2B0SH 4ZSOE 2NZIA 4G42B 5DVMA 4HS8L 5ICYB 2IALA 4ODWA 1V05A 2WIIA 5LXGL 3CX2A 1WZLA 4N5UA 3VXTA 1UT9A 3E6HB 3BGFC 2DQTH 4DKDC 3QDMA 3MA9H 4XBPA 4U1IA 5I1GH 3V4UL 3LKQA 3BPCB 1V3MA 3NCJH 3PWNB 4N0FA 1IAKB 4P3CH 5C09B 4Z6AT 4YX2H 1T21A 3C8KB 2QV2A 5EDXA 2D7QA 2X4UA 1IT9H 4NBXB 2ADIA 4DOHB 4X6DE 3QIWC 4W70A 1FZOB 3RWEA 1I3UA 1I8KB 5HYEA 1DE4A 2GJ6D 4GS7B 4X6EA 1W72L 3KPQA 3MCKB 4NO5B 2LAGB 1NCUA 2L0DA 4MVBD 3MRCB 4P46D 3AMKA 3LV3A 5BO1H 3NMEA 5EUOE 1MI5E 1S7QA 3NACH 1EJ6A 4PRIE 5GS0C 4QCIB 4Z5RB 2UYLA 3GRWH 4NN5C 4KRNA 1AD0B 2CRIA 3OKKA 4RGNC 1H5BA 5AYQA 1MH5A 2XA8L 3EBAA 3WLBA 3UPRB 3RVTC 1DVFC 1ZE3C 4KJYB 3JWOC 5CCKH 1I3GL 4FRWA 5BW7C 3QAZB 4QLRA 3BH9B 2GJZB 4I2XE 1WZMA 5D2LF 2DIBA 4NRYB 4IHOB 2OLDA 3O3BA 1AFVH 3OJDA 3ROOB 1CLYL 5EC2A 2IEPA 1NEZA 5MEQA 3LN5B 2Y36H 4KKAD 3T2OA 2BRQA 3BWAA 1FZKA 1Y0LB 4JPVL 4ZUUA 3FQUB 3QDMD 1T0MA 3WS3B 4LCYA 2DICA 3O9WA 3RWHB 3QJFB 3TV3H 2GYSA 2X4QB 3O4LB 2FIKA 4GG6E 1QLFB 5KBNC 5FUZL 2FNBA 2FJFA 1FZJA 2AEQL 5BQ7A 1J8HA 2IADB 3ILPA 1NSNL 5BVJA 3O6MH 3HB3C 1IGIH 1U8HA 2BNQE 3MGOA 3JVGC 5L9DH 3S34L 3MV7A 3SJVA 4I18A 5FYJU 1ZTXH 1D5ZB 4PRDB 4AIXA 3ARQA 1C5DB 2A74B 5CAYB 1OY3B 5DT1L 3FAXA 3B4NA 2Y9RT 4ODXB 4Z18A 3CXDH 5EBWB 1WF5A 5HHME 1CIDA 3HMXL 4HIJA 4U1SA 4I13B 4YO0B 2EEDA 4PJXF 4EI5B 2NX5B 3IAQA 1RZIB 5F21B 3TH4T 2CH8A 1D6VL 1AR2A 5T3XH 1FGNL 5E08L 1KIRB 1KFAL 3BP7A 4HBCL 3U46B 5J6HB 1OD9A 2EDLA 3RWDB 2FO4A 4JDVA 4MJIA 4NQSA 5TGBA 1OW0C 2XG5A 2DWDB 4G6MH 4OT1H 4ZUWB 1MJ7H 4YHLH 4XCFH 2I07A 4UMGA 3TZVA 3QEUB 1KJ3H 3OXRA 4PV9A 3O9WD 1KTRL 3C5JB 2GTZA 3HMWH 5HY9B 3TNMA 1NBYA 5IESL 3BAEL 4AEHH 2QSTA 5F72S 2WANA 5BRZB 1J8HD 2CMRL 3R8BB 3CLEH 3OG6B 3FZUC 3MV7D 3SJVD 4DN3L 2XYCA 1IQDA 4MNQA 1S5IH 3L95B 1CICA 5E1AA 3UYRL 5C0FB 1WUNT 4D9RD 2HTKC 1KG0B 5GHWL 4BFBD 1T83A 4OIAA 5D7SL 4QRTA 1YY9C 4HF5H 3D87B 4KTEL 1P53A 1YDPA 4Y4KA 3AREB 1X4ZA 3M1BA 2PTTB 3VFGL 1FVCB 3TGXA 4DVBB 1TZGL 1HWHB 3HZVA 1OPGH 4HW6A 3FQXA 3U4AA 1GC1L 4MJID 3HAEB 2Y06L 3OBAA 2IAMA 1ZVSA 4WTZA 3WIHL 4UAOC 2WWMD 4OLXH 4JPKL 3SDCC 4YHKL 3GFUA 5IWLC 5C08B 4TUOB 2H8PA 3IJYA 2XRAH 2C3GA 2X4PB 1GH7A 3TZVD 3O4OC 1X5GA 3MV8A 2CDGB 1YNLH 2GT9B 3VFPB 3TYGL 3FOLA 1K6QL 3AXLA 4KAQL 3WHXB 1NLBH 1D5BA 3FN9A 3UBXI 4XHJD 5KS9A 1FCCA 4LVHC 3AAZB 1DBJL 1MCDA 3DO7B 1RZKH 4ZNEE 4L4VE 1AIFB 3FN0H 1QTYT 1XIWB 3VFSA 1T7VA 1UXSA 1WWBX 1BEYH 3A6CL 1YEIL 4MNQD 2APTA 3ES6B 1LK3L 4JPWL 5FHAH 3SDAC 4Z7UB 1CICD 2O5XH 4Z0XB 2BOCA 1KXTB 4P2RA 3F12B 3RUGB 3BX7C 1ACYL 4Y5YC 4IRSC 3U79A 2F8XC 5AYUH 5C7XH 1EZVX 3L5WA 5FM5M 1U8MA 3U48A 3IFPB 3P4MB 4WV1A 1BOGA 4NOBA 3BE1L 4Y4KD 1NCAH 3WYRA 5IHUL 4LLMA 3WLWC 2VQ1A 4QRRA 5K9JH 1F02I 3DSNA 4LSVH 4GO6B 5IVXF 1E4XH 1IEAB 4K9EC 5GGSB 2IMNA 4IM8A 4G8FB 1Z5LA 2AK4A 3QUYC 1QP1A 4LLYA 3TBWA 2Z8RA 4LSDA 2BK8A 2MKWA 5FO9B 2KL6A 5C3TA 2BXZA 2IAMD 2OXGA 5TE6H 4PJDF 5A40E 3QSKB 1FG9C 4GKSB 5J11B 5E94A 4I5BB 2PW1A 5DD0L 5EO0B 1AC6A 4PRAB 4D0CA 5BCAA 3S5LA 3VFMA 3K7UA 2IBZY 3GIVA 3MV8D 1PSKL 4E0RB 1MFNA 4LVOC 1SJXA 3L3GB 3OR6A 4UUJA 2UUDH 2IBBA 2JB5H 3KPNA 4JDZB 4Z78B 4Y8DC 3ZKXB 1I9JH 4X4MA 3ESVF 3FQWA 1IC4L 4GKOA 3G5VB 3CX5J 1EV2E 2E27L 3KPRA 2XPGA 3B5HA 2R29L 3QXAB 1A21A 5JMOC 1YEFH 1ZT4B 1UM4L 4P2RD 2EDKA 5DJZA 5HVFB 5IEKA 3VXUB 2OBGA 3DYMA 1R24B 1NEZG 1CGYA 3RNQB 1NCDH 3VFRA 3R0NA 4UOJA 4KK5D 2NY4D 4Y1AA 4QRRD 3ZLQC 3EO9H 4R3SB 4DGVH 4NN7C 5C2UB 4QNPE 1FH5L 3IKCA 1HHHA 5LGKA 2DQGL 3L3JB 5EOQH 5AZEH 5ALBH 5CD5D 2AK4D 4PGDA 3B9KC 4H25B 1FFRA 4XP1L 3S35H 2ICWB 4MXQC 4PRBB 3TA3B 1S7TA 3OQ3B 4RGNE 2HWZH 4ELMF 3EYVA 3LKOB 4CW1B 4U49A 5CMAB 1OGTB 1M7DB 4KKBD 5J1AB 3MLTB 3TBSA 3BKJH 3D0LB 1BMGA 1JGLL 3BVNB 4WJ5B 4YDKH 3MLPA 4HX1A 4GOSA 2WNGA 4Q9QH 2ZOLB 1JNLH 3WDHA 1KCVH 2XY2A 1JWSB 4U1LA 4X5WB 3N1PC 2HG5A 2VNCA 43CAB 3CU7A 2CQVA 3VXOA 4OM0H 2EYRA 2CDFB 1DZBA 3O0RL 3UTOA 2E6PA 3KPRD 1RURH 1K8DA 3BP5A 3O6KH 5F3BB 1ZA3B 1C1EL 3JWDL 1VEOA 1GL4B 1KCLA 1V7NL 5E2WL 3RWCB 4HWNA 4S1RL 2R2CA 1IGFH 1A0QL 4Y1AD 3BZEA 1B6UA 1JPTH 1OAXH 1F2XK 4DQOH 2IG2L 1T5WB 1KEML 5F70A 4QHLA 1CDJA 4G9FA 4X0KB 4TVPE 4KI5E 4QEGA 5FUOH 3LKSB 5H94A 4IRZL 3KPLA 2P49B 3H3BC 4PJCE 3CFCL 5D7IB 5DMIL 2R0LL 5F9AC 3FO2A 5TDOA 4MB5A 1U91A 3EOYG 4RSVA 5DDHA 1RZJL 4P9ML 4KZEH 4X8XA 3QUMB 4K2UH 1BBDH 3DX6A 2C9AA 3THMH 4QRUB 3KPMB 1SJHA 4ZO8A 1UJTA 4OB5L 5IMOB 4Q6IA 4JCLA 1MY7A 5LBSH 3AU1B 5M7QA 1J7VR 5IFAL 2J8OA 1H0DA 4PJXA 4G8GB 1NAML 3G5YA 3TJEL 1KLFA 3KYAA 1Z6JT 5IOPB 4WI7A 3RKDD 3WNPA 1G9MH 4BH7A 4TNWF 4TSBL 1FLRL 4M03A 5E2JA 2LE9A 2PN5A 4DWHA 4R26L 1A64A 1TQBB 2YUXA 3K2UH 5D7JA 1MELA 1UJ3B 1DLHA 2R2EB 3Q3GA 1A6TB 4JO4H 4ZQKA 1G6VK 1F6AA 3OKEB 4PJIA 3HR6A 5T1LB 2VDLL 5BOPA 3A67H 5SWSA 4I0PA 4L4TA 3C09B 5C0GA 5CBEA 4LSRL 2GHWB 4OF3A 4HWBH 1T0PB 4ETQA 1W0YT 1LP9B 4G9FD 2Q7YB 2HMIC 4OUUA 1UCBL 1GZQA 4HIEB 4QHMB 4LCIH 4G9DA 1F6LL 1PQZB 4MDIA 4G6JL 4QTHA 5DJYB 1AP2A 4ODBD 3UO1H 5FOBA 1OB1B 5DQ9B 5I8KL 5EN2B 4M7KH 3SDXE 1CD8A 3OGOE 4XMKH 5GIRA 4FMKA 4RAUA 3V79C 3PWPA 1RZGA 3MO1A 2CD0A 4WW2F 3MUZ1 3HNSH 2ZUUA 4PRIB 1BF2A 4G5ZL 2DJSA 4P9HH 4ERSL 2AAVA 5KVDL 3RA7H 2VE6B 4IMKA 1FE8H 1FC2D 5I66A 1F13A 2X1OA 2AJXH 4OIIL 5C0IA 4K94C 4CMHC 3PDOB 5DZLA 3RX5A 3F58H 2GSIB 3ETBF 3ARDC 4JVUA 3DUSA 3QEQA 1M05B 5DD3L 5HHQA 5D7JD 2NTFA 1DQQB 2BMKB 4F2MA 5EU5B 1YNTB 4U1HB 3UDWC 5CJBA 4UINH 3O8XC 5C0EB 4HXBH 5SWSD 4I0PD 4L4TD 3S5LG 2PUQT 4JB9H 3BDYL 3NFNA 2BC4A 3FFDB 1O0VA 1Q0XH 5IW1A 2V6HA 2F5BH 4JN2A 4U2ZA 1K3ZA 3QDJB 3VDAA 1QRNB 1NJ9B 3ZE0E 5F44A 3MNZA 3B9VA 1PY4A 2UVEA 2XN9E 4YLQT 3QO1A 4QGYA 3KLSA 2HJFB 1KNOB 1RHHB 2VL4A 4UBDD 3VFNB 3CVHA 2HP4A 4LCCA 1A7BA 4NQXB 1F90H 2I9LA 25C8L 4M3KB 5GGVH 3DROB 4JFOA 3QIBC 5F89B 1LNUA 2G5BA 3SQOL 3PWPD 2FLRT 2BVUA 5JDSA 2Q76A 1YN7A 1MFBL 2AERT 3I6KB 5C0AA 3D0VA 3D39A 4JANB 4Y4HA 1Q72L 3RVWD 1UKSA 4FZEL 1JFQL 1ZT1B 3F5WA 3C60C 4OLEA 4GW1B 5H35B 4LLAA 3UYPA 3GSVA 1UKTA 3C8DA 3FTGA 1KLUA 1F3DH 4MQ7B 4DKEL 4JFDA 4LOUD 2PYEE 3NPZB 3RZCC 3CMOL 3QEQD 3AMLA 1B2WH 1KJ2B 4EOWH 1HQRA 1NGXB 1WAAF 1VSCA 2FJGA 3S7GA 1EFXB 3SKOA 4FHBD 4G6AD 4OBRA 3TH2T 1ES0A 4I77H 3VGBA 1Q0YL 5FKPB 1G1YA 5T5FL 2BHUA 3ZDXF 5HHOB 1CFQB 2P45B 4WFGE 1VFBA 2QSCL 4RFNB 4MA3A 4Z7WA 4HS8H 4ZUTA 3RDTA 5DUBA 3AB0C 4JRWA 3X12A 2XWBA 5HHPB 2XQYG 5GS0L 4XNMA 1FNEB 5EIVA 1NDMA 5HJ3B 4RIRB 3ARXA 3V4UH 3MLRL 4OZGE 2IWGA 2CLZA 1MFCL 1T1XA 2WM0A 5DVNA 4XC3L 3GMOB 3KNBA 1WIUA 2G75A 3C08H 4Y4FA 2COQA 5C0AD 3CFKB 3D39D 4I0KA 3C87A 4Y4HD 5KOVC 3WKNA 1H8SA 1N5AA 5B8CA 3ELAT 4HKZA 1W72H 4ZUSA 4WHTA 5T5NG 2F5AH 4PP1C 2R1YA 5C0CB 1VGEH 1FVEB 2OYPA 5DS8B 1OCWH 4JFDD 3G04A 5K59E 4MCYB 1IEBA 1Q8MA 4MSWA 1JE6A 2XA8H 4G42A 5I16B 2E6JA 5ICYA 1UWXH 4KROB 2NY1C 2J12B 3FRUB 5DMKB 5D93B 3OKLB 1I3GH 4HH8A 1NAKL 2E3VA 3P2TA 3GGWB 3V7AG 5SX4H 5F7FA 5BMFL 1EH9A 1FL3B 3E6HA 5FGBC 4S1DC 1HE7A 2X4TA 3F6IA 3BPCA 1CLYH 1D6EB 3RDTD 1KTDA 3PWNA 4Y7MA 4ODVH 1IAKA 4WDIB 4ZS6D 5C09A 4MAYD 3C8KA 2H2SD 5F1SA 4RFOL 3S88H 4OLYL 4MNHA 5IBUG 4N1CA 3ESUF 4TVPL 4HQQL 3LSOB 3MRNB 1WIPA 4JPVH 3U4EB 1FZOA 1I8KA 5A2JH 3FT4B 4L4VB 3QFJB 3MCKA 4NO5A 3ARGC 4HH9B 4EN3B 2FIRT 1SJEB 3MRCA 3TYFB 2FATL 2C4XA 4Y4FD 4QCIA 1UH2A 2OI9B 3S37X 1NSNH 4Z5RA 1WZKA 3GBML 4LAQH 3U7WL 1AD0A 5C0ND 4HDIB 4M5ZL 2BOBB 4WWKD 2OZ4H 3UPRA 3OB0K 3UTPD 4KJYA 3D2UB 1YY8B 2B1HL 3MXWL 5EORL 3LS5L 1UWGL 2Y23A 2LABA 1FCGA 1G0XA 2ILLA 1HN1A 2C3WA 2GJZA 3BH9A 4NO0B 3LY6A 5DT1H 4NRYA 4IHOA 3TIDB 4EZMA 1MCWM 3ROOA 1WWWX 3T0EB 3SE4C 2IANB 3LN5A 3RWIB 3HMXH 1CT8B 3V0WL 5HXMA 5KW9L 4N0UE 4MCZB 1LQSR 3ULVF 4PLKC 1MLCB 5I15L 1D6VH 1U8PB 1OGAB 1Y0LA 5TQ2L 5E08H 4K3HA 1KFAH 2A73B 3D25B 3GJEB 5GRXG 3WS3A 4HBCH 3RWHA 3UP1A 4BQ8A 2XKNB 3QJFA 1WC7B 4OGZA 3HPLB 2X4QA 4RRPA 5C09D 1O7SA 4X5LA 3BJ91 1QLFA 2ATPB 4YFLI 5DQJB 5TE4L 4JQVC 2DMBA 1QFOA 5ETUB 3DETD 1NH6A 5H37H 3MV11 2EDQA 2ENYA 4YK4B 5IESH 2K7QA 3BAEH 1D5ZA 4PRDA 3W5MA 3VXRE 4LSPH 2CMRH 1C5DA 4DZBB 4OQTL 4ODXA 1WK0A 4NOFA 3HZYB 5EBWA 3DYOA 5DFTA 5IB4B 5JPNB 5I71B 3QI9B 2E8ZA 4YO0A 2X9XA 4M02A 4EI5A 2NX5A 4ZFZB 4JO3L 1RZIA 3FL7A 3MJ9A 4PJFE 3N0PB 4GW5B 5GHWH 4U3HA 3FFCE 1KIRA 3CCHB 1X5JA 3U46A 4KDTA 5J6HA 3RWDA 3QZWB 1AKJB 1D9KC 3PP3H 1VEPA 1CG9B 2NY6C 3HI6L 1L7IH 4Y0GA 2DWDA 3VFGH 4ZUWA 5DWUL 2APWA 4U1KB 3MFFB 1TZGH 1A6PA 2VUYA 3QEUA 3C5JA 4Q7DA 2VL5A 2Y06H 3Q6FB 3TO4B 5FYKE 1FG2B 3WIHH 2FSEB 2QR0B 3DTXB 1D5IL 4JPKH 4YHKH 5BRZA 1QA9B 4YXHL 5IBTL 4X6CE 2R8SL 5AEAA 4WU5A 5E9DB 3RGVC 5HDBF 1K6QH 3A6BH 5A43C 3L95A 4KAQH 1NDGB 1HHKB 2XA3A 4LLVB 1SY6A 4WUUE 5C0FA 1J0JA 3DLQR 3P0VL 5IROC 1DBJH 1PBYA 3CZFB 5E8PA 1KG0A 2YXMA 4HIIB 3G9VA 5JUEL 4QRSB 1WFNA 3A6CH 2XXCB 4M1GL 3BRFA 1LK3H 4JPWH 4U31A 3HE6C 1G9NH 4KJPC 2ID5A 4EI5D 2NX5D 1UEYA 2PTTA 4LU5L 4XXCA 1FVCA 3HZMB 1KSRA 4DVBA 2DQUL 1ACYH 3GBLA 4K8RC 4L9LC 4XPHH 1T2QL 4B0MM 3HAEA 1YNKH 3BE1H 5IHUH 3QYCA 4OCWL 1ZHKB 4R4FL 3LKNB 5SX5K 5C08A 4TUOA 2GAZA 1YEJH 2X4PA 4NWTL 4DTGL 2LAAA 1RVFL 1QPXA 2CDGA 4F9PA 4YJZL 4U0RC 2GT9A 3CLFL 2JE8A 3TJHD 3OKNB 3VFPA 3PP4L 2E9JA 1VACB 4PJEE 3WHXA 5BRZD 5DD0H 4K71C 3AAZA 4Y5VC 5F9OL 3DO7A 1LE5B 1AIFA 5J3HD 5JOPD 1XIWA 2YK1L 1PSKH 3EZJB 4JQXC 1BVKB 1MAJA 3ES6A 1OSZB 4Z7UA 5JIIA 3LB6D 4Z0XA 1T5XB 4D0DB 3F12A 3RUGA 1LVEA 3DX8A 3FB7B 2OP4L 3ZTJH 3ZTNL 2C3HA 1IC4H 3IFPA 4PRPE 4Q9CA 1YEDB 4P5MB 1H3VA 1KPVB 1JRHL 2E27H 2R29H 3VJ6B 5HI4C 1JJUA 3JTTA 4MQXD 4V2CB 4YE4L 3K8MA 4JHWL 4L1DA 2NY2B 1IEAA 5AUMB 5JW4M 1GXEA 5GGSA 4G8FA 1OQXA 3NPSC 5FO9A 4H8WH 4WEUD 3M17B 2ZSWA 1CDCA 3I6LD 3GO1L 1QG3A 3CGTA 4GKSA 4I5BA 1FH5H 3VMOA 4PRAA 5C08D 1NL0H 4XRCB 2DQGH 1JPSL 1LDPL 4E0RA 4XBGB 4KMLB 4XP1H 4P2OC 4DJMA 3L3GA 3BXNB 2APFA 4OSUL 2JJTC 3KXFE 3ZYIA 3HG1B 1ZOXA 4O02H 4JDZA 3VWJC 5C71A 1XIWD 1ZVYA 4Z78A 3IDIB 4WW2C 4L3CB 1ND0A 1BD2B 1NLDH 2YRLA 2V2TB 3CC5B 5DJ8B 3G5VA 3V6ZB 4XCNB 1YQ2A 3NZ8B 3NA9L 3ARVA 3QXAA 1ZT4A 1JCKA 4M3JA 4J3UA 3VXUA 5EFIB 1R24A 4WVRA 5FUCE 3RNQA 1LO0L 4WI5A 1AHWC 4Z8FH 2E8YA 4R3SA 1QPPA 3BPOC 1EHLL 5ESQB 1MJJB 4G7VL 3L3JA 5C07B 4GRLA 3JWDH 1V7NH 5E2WH 4RRPG 3O41A 4H25A 1G0YR 2P5EE 1YMME 1ZSDB 2BSED 1JMZA 2A9ML 2ICWA 1A0QH 4PRBA 3TA3A 3LKOA 1TNNA 4CW1A 3Q5OA 5KN5A 4CVXB 5CMAA 1ZLWH 1OGTA 2IG2H 1M7DA 3IXTB 5J1AA 3MLTA 3NH7H 4LLDB 4YFEA 3D0LA 3QG7L 1AQDB 2ZUQC 3BVNA 4B7LA 4WJ5A 2J88L 2P5WE 5CGMA 3CFCH 4RA3A 2ZOLA 2R0LH 5DMIH 4LHUB 5F8QC 4ZTOL 5MI0B 4R0LB 1G7MB 4JFXA 1RZJH 1VFMA 1JWSA 4P9MH 2XXMB 4X5WA 4DGIL 43CAA 2Y6SC 2CDFA 2DQEH 3DIFB 3P4NB 4H5SB 5EA0L 4OB5H 3ZMRA 4BSJA 1N6QH 3AGVA 1YEGL 1QBML 1J1XH 1RIUL 5EIIB 3BW9B 1ZA3A 2A6DB 3IS1X 1BJ8A 3QR2A 5FYLD 3VXUD 5F3BA 3BPNB 1REIA 3TJEH 3RWCA 3DRTB 1DBML 2W91A 4QF1B 1K4DB 5I8OH 1QHPA 1CLOL 4TSBH 3V8OA 1FLRH 3CU1A 4TSAL 3T0BA 1FFOB 3D3VE 4R26H 1T5WA 2XTJE 3DGGB 4GRLD 1YYLL 2Z8SA 3E8UH 1NC2B 4YDIH 2X1PA 5DVKA 4X0KA 4JJ5B 5JNYB 3FB6B 5C0BE 3LKSA 3TA3D 1F8TL 3TVMB 2RB8A 3KR3L 1C8PA 4POZC 3VDCA 5I75C 5D7IA 2FX7L 4PLNC 4OKVB 1MVFA 1AO7E 2DI8A 3QUMA 2J6EA 2VB5A 4GBXC 3BZ4B 2GQHA 2HYMA 3OR7B 1UCBH 4QRUA 1Q1JL 3KPMA 4F7TB 4JE4B 4G6JH 2V17L 2GKIA 5IMOA 3QCTL 1L9NA 5FYKL 3AU1A 2JELL 1CDIA 5I8KH 5DA4A 4HKJB 4G8GA 4HFWB 3TN0B 5I19H 5CJXC 3BO8B 1IRAY 2OX5A 5IOPA 2R0WL 5JPMB 4F9LA 1URLA 4MA7H 5I73C 4ONFL 5F7MC 4ZNCD 3H3KA 1CFTB 2ZKHL 4G5ZH 4ERSH 1UGNA 1R3HB 2RGSA 5EWIH 1UJ3A 2AEWA 2R2EA 3HAEG 1A6TA 3WS6C 4EEEA 4OIIH 3OKEA 5T1LA 2LVCA 2X4RB 2Q8BL 4UT7L 1S7XB 4Z7VB 1KCRL 2DN7A 4HGKC 5GRJH 1BQHG 3GJFK 3EJZD 2WQRA 5CGYD 4MZ3A 1LP9A 4YHYC 3V0VB 3ZKQD 2Q7YA 2OQJB 3HUJE 3B2VL 1AJ7L 3QUXC 2J7LA 4HIEA 4QHMA 4AEFA 1UQSB 2ERJB 4HC1L 2GY7B 1PQZA 3BDYH 3CFDB 1OTUC 1R5IB 5DJYA 3TC9A 3VW3L 2GSGB 2YKLL 2MKLC 3P9LB 4F57L 1OB1A 4FN0A 5DQ9A 4Z76B 4O2CB 5EN2A 3J8F7 4LIQE 3ZSSA 4KVCH 4PB0L 4XNXL 3TF7C 4KKLC 1Z9SA 5EZOL 2PXYC 1UCTA 3CDGB 25C8H 4O2FB 2VE6A 3I75B 4G8GD 1MREL 3TCLB 1JTOA 3PDOA 2CPCA 1JF5A 2G5RA 2GSIA 2NNAA 3UTZB 1M05A 1KV3A 1MFBH 4MZ2A 2NPLX 2R2BB 4P57B 3HPJB 1TNMA 1DQQA 4FZEH 3P30L 5ITFB 1JFQH 2H32H 2BMKA 4L3EB 5EU5A 4PR5A 1YNTA 4D9LL 5A2IH 4U1HA 1UM6L 4XBEL 5T1LD 3F8UB 1AE6H 5C0EA 4DKEH 1OHQA 3KYKL 5DF0A 3CMOH 1P7KA 1IAMA 3FFDA 1WBXB 3QWQB 3ULVC 5DR5L 1FAIL 4MJ6B 3QDJA 1QRNA 1KIPB 1F4WL 1NJ9A 1JRHI 4OZFB 5L8LB 5I1IL 5T5FH 1KNOA 1RHHA 3VFNA 3GSNB 4NQXA 2BY0A 5BS0B 3L9RB 4WI3A 5E2TL 4OZHF 3IGAB 4XB7A 3BD3A 3DROA 2R4SH 3QXDB 1PYWA 5F89A 4JHAL 1UZ8B 3VRJA 1BOYA 2OTWB 5GS0H 1MRFL 1FL5B 3D85B 4PTUB 5DFVC 2J8UE 4EQ2A 4JANA 1QSEB 5IHLB 2XKSA 1N64L 2V9TA 4JFZL 1ZT1A 3O3DB 3V8CA 4OZIB 5H35A 5ANMB 3JWOH 2BP3A 3MOQA 4KRPB 4MQ7A 1YUHB 1KJ2A 2QSQA 1NGXA 1EFXA 1G7PB 1PD6A 3FFCB 5T1MB 3KJ6L 5FKPA 4DUXA 4PGBB 1OLZA 5I74B 5FCUH 4JRYE 4PS4L 1TVBB 4LKXB 1EERB 3Q2CA 1LEGA 5HHOA 2ZSVB 1CFQA 2YPLE 4EBQL 5C0JB 3QDJD 1QRND 4J12A 5EULV 1MAKA 3JV4B 4L1HA 15C8H 1NAKH 1G84A 1FFNB 3JSSA 4MHHG 5BMFH 1FNEA 3A0OA 4C59B 2FHBA 5HJ3A 3MV9B 4RIRA 4KVNL 4P0DA 1ZGLP 1E4KA 1JWMA 4RFOH 4OLYH 1CLZH 1HWGB 3GMOA 3N1QC 4HMEA 3FCTB 4TVPH 4HQQH 4OFKA 1JHLL 4MA8L 3GRWA 3CFKA 3HZKB 3IVKB 3L5XL 3SGJA 4U1NB 1EK3A 4PGCA 3WD5L 5C0CA 1FVEA 1I9IH 2V2WB 5DS8A 5DJCA 2FATH 2IQAB 1FAKT 4MCYA 2ED9A 4R7DB 1TCRB 3GBMH 1EFXD 1GGBH 4RBPK 3W82A 4M5ZH 4ENEC 5IG7B 2VAJA 4ORGA 5I16A 1ZGLM 4UQ3B 3MXWH 2CO6B 3FRUA 5DMKA 5EORH 1UWGH 1I3VA 3GGWA 4NZUL 1MCNA 5HHOD 4QWWD 1FL3A 2AGJL 3NZHL 4HJ0C 5IVNA 1X3DA 2HT4C 2JK5B 1D6EA 4YEEA 1CL7L 4J4PA 4WDIA 3V0WH 5KW9H 5K33A 4GQ9L 2CRYA 2XI9A 5J1TC 1CICC 1I8IB 4QXUL 5I9QC 5ISZE 2P46B 3SN6N 3MODL 4W4OC 2UWEE 4WI8A 3D9AL 3LSOA 5I15H 3MRNA 3GB7B 1GSMA 3U4EA 3EDEA 3OSKA 3FT4A 3QFJA 1Q94B 3QPQC 4KK6D 1AGCB 1UXWB 1JNHA 2A6KB 2J2ZA 3X14B 4EN3A 1SJEA 4PJHF 1FJ1B 2QQKL 3TYFA 3MCG1 4BQBA 3WJLC 3RIFF 2W92A 1RIVL 2Z31B 1BFVH 4HDIA 4TULH 1XZ0B 2BOBA 2FZ3B 5FHBH 2CKNA 3MLZL 3OPZL 5C0CD 3D2UA 1YY8A 4WI9A 4QTIL 1L4IA 4YR6B 1G1CA 1ZEAL 4N1HB 5T1DL 2NY3C 2PCPB 4C56E 4NO0A 2KUTA 4OQTH 4PD4J 1JZ7A 3TIDA 5JHDE 4M8QB 3T0EA 5DMGC 4KROD 1CDHA 2IANA 5B4MC 3RWIA 1CT8A 4MCZA 5B38A 3PWVB 4JO3H 1JGUH 3KLAB 2O5ZL 1MLCA 1OAQH 1U8PA 1OGAA 1I1RA 3SOBL 3X13B 2A73A 3D25A 3GJEA 3MOAH 4WFED 5KG9A 3HC0B 2XKNA 2BRRL 3MRGB 1WC7A 4U6YA 3GIZH 3HPLA 4J4PD 4MNGB 3P40A 5K9QG 2YN5A 4R8WL 3G5XB 2ATPA 4UTBH 4UV4H 5DWUH 2EXYD 3NGBC 5DQJA 3QDHA 5ETUA 3F7RA 4L4VD 1ETZB 3QFJD 4G8EB 4TRPL 3ZE2E 3LS4L 4WV1C 3WO4C 5IFHH 4EN3D 3BIBX 1KTLB 2GJ6E 3ARBB 4FQXC 3RIAK 2IH3B 3SKNB 4NC1E 4LIQL 1D5IH 1KELL 2F8VA 4MD5B 4FMFA 4YXHH 4DZBA 2R8SH 1R3LB 2IPKA 4HT1H 4OKDA 3HZYA 4LPXA 3D2UD 4YC2C 1ODAA 5JPNA 1Y18B 3QI9A 3G5ZB 4QT5B 4CMMB 3P0VH 4ZFZA 1BLNA 1NFDF 2AK1H 4K9EH 3P11H 4NO0D 5DZNA 4GW5A 5DHVH 3CCHA 1U42A 5JUEH 3FT2B 5BV7B 4OCRL 3T0ED 4B5EA 4L8CB 2YD8A 2IAND 4NCC1 4M1GH 4A2LA 1C16B 3LPGA 3QZWA 5LAXB 1DJSA 1AKJA 2WLYA 2DDQL 1CG9A 4LU5H 4EDWL 2VLLB 1H3WM 2DQUH 1OGAD 3IFLH 4U1KA 2EIDA 1GAFL 1TETL 4J3SA 4QXTB 2V2XB 5T3ZH 2WIMA 1UZ6E 4YFDB 1T2QH 5EOTB 5ILTL 3QDME 3TO4A 1IC5L 3Q6FA 3U36B 4OCWH 1FG2A 2FSEA 2QR0A 3DTXA 4R4FH 4WHDA 3ZDYE 1QA9A 1LWRA 1SEQL 3BQUC 4NWTH 4DTGH 1NGQL 5HI5D 1RVFH 4Z7QE 1T0NB 3L5HA 5ENWB 4MS8D 1R0AL 5E9DA 1BZ9B 1D5MB 1CFSB 1NDGA 1P4BL 4LLVA 1NPUA 4M1CC 5F9OH 1A3LL 3JXAA 5SV4A 3CZFA 1ACZA 1EXUB 4HIIA 4QRSA 2WAHA 2L4OA 3BYTA 3FKUS 2JJWA 3QI9D 1Z0NA 3FB5B 4G7YL 4QY8B 3HZMA 1F6FB 4OCXL 4M6ML 1Y6MR 2BVQB 2OP4H 5C92A 4XZUB 2QHRL 3ZTNH 3C9NB 1MFDL 4ONGL 1JRHH 1AKJD 2EC9T 1ZHKA 1PX3A 3X3FL 1OAYL 4YE4H 1J9CT 3LKNA 3UPCA 3QIUC 2C7UB 3LDBB 3W11C 2VAAB 3OKNA 4LGRB 2AJSL 3TO4D 1WBZB 4U1GC 1LO3L 3GO1H 1VACA 3VGGA 2W1NA 4NRXB 3RAJH 1S9YB 1RIHL 3L7FB 1DQJB 3GK8H 4PJBF 4JVPA 1LE5A 4CJ0A 1GPOL 3VG9B 3LEVL 5CD3B 1LDPH 2HT2D 4S0TD 1BVKA 1J8HE 1XAUA 3HS0B 5E9DD 4X8JB 2VR4A 3TM6A 1HYSC 4YBHA 1MY5A 1YJDL 1OSZA 1XF4B 4OSUH 5IMLB 2QQNL 3MV7E 1T5XA 3SJVE 2GUOB 1ITBB 5DURB 1LEIB 2B5IC 2VDMH 1T89C 4YNYB 3B8SA 3FB7A 1NQBA 1QFWL 2HLFC 3OWEA 4C57C 5DMJB 4D9RE 2H3NB 2W9EL 1YEDA 4P5MA 2D0HA 1KPVA 4N9GB 4F8QA 3K1DA 1OM3L 5IJKC 3VJ6A 2CXGA 3NA9H 2ATKB 4K3JH 2VXSL 1I75A 2Q20A 5AUMA 3JV6B 1PG7L 1TJIL 1LO0H 4NN6B 4TUKL 4LSQL 5AG9A 3K74B 1NUDA 2IQ9H 4MQSB 3M17A 3MRLB 3E0GA 5DGQA 3SO3C 2EH8L 4MJIE 4MX7B 1BPVA 2OJEB 4JM4L 1KCSL 4I48B 1N2RB 4XBGA 3SGDI 3VI3F 2A9MH 4YDJB 3BXNA 4LASL 2YRZA 1P84K 5CLTA 4HMDA 3HG1A 5JA8B 5EU6B 1LD9B 5D7JC 1O7VA 2DTSA 1CL7I 2X41A 4XTRC 2X4OB 4OBSA 1CDGA 2YMXL 4L3CA 1BD2A 5CZVH 1HNGA 5GJTL 2BDNL 2A6JB 3V6ZA 3H9SB 4I0PC 4XCNA 3SE9L 1YECL 1RZKC 2W65B 3NZ8A 2E9BA 4XXDB 4ZTOH 2EIEA 5LKNA 4MNQE 3PNWB 1HIML 2LU4A 4N9OB 4AM0B 5EFIA 3D1MC 2UZIL 1A6AB 4ZFOB 4HUXB 2PO6B 4M93C 4XP5L 4UTAL 1HNFA 5B38G 3BGAA 5EA0H 2NLJB 3CIQA 4PJ7F 4DEPB 3G6DL 4NM4L 4OQ1A 5ESQA 5DQDL 1QBMH 2NY2D 3LQMA 1RIUH 3PGFL 5C07A 1NCTA 1CGWA 3GKWL 3O2DA 1OTTD 1DBMH 1ZSDA 2EXWD 3IJHB 4J3TA 1EZVY 5BXFB 2EE6A 1CLOH 4WIQA 5E4EC 5IHZB 5GQBA 1U9KA 4CVXA 4NHUB 4NUGL 2FECL 1OWRM 3IXTA 4LLDA 1AQDA 3SHSA 3EYSL 1JZ3A 2R9HC 5CEZD 4QRPB 4NCC2 4FQQB 1WITA 3MV8E 4LOUC 1FSKB 4Y16B 1I9RH 5FO8B 3HG1D 4LHUA 2FX7H 2BNRB 2IBGA 4R0LA 2V7NB 2KPNA 3T3ME 1YEHL 4L8SC 5KS9E 1FPTL 2RJMA 1BD2D 1HCVA 1RQ5A 1MEXL 1W8NA 2I26N 4EXKA 2DQCL 1OAZH 3DIFA 3M8OL 3P4NA 2XQYK 4H5SA 1Q1JH 1LEKA 4FABH 2XY1A 4Z7OE 2V17H 3QCTH 4HEME 5FYKH 1IILE 3FONB 3WUWG 5EIIA 3BW9A 2JELH 2A6DA 1T66C 2F53B 3DRTA 4P2RE 4FP8L 4R90L 3ECBB 2R0WH 4GW4B 4JJHA 4QF1A 4FFWD 1JZ8A 1H3TA 3RBGA 3SEPA 1FFOA 3CVIL 2ZKHH 4HWBA 5C07D 1Q9WB 3DGGA 4QRRE 5F88B 4M48L 5GSRB 3LEYH 3OB0H 2CKBB 5JNYA 3FB6A 3P3YA 4NNPH 2AK4E 2Q8BH 3TVMA 2H2PC 3NABH 3HKFA 1EMTL 3NFPB 1X5IA 4HGWB 4OKVA 3SO5A 1H3XA 4QHUB 3BH8B 3QQ3B 4IIQC 3BEVB 4GFTB 4X9HA 1W0VA 2HFEB 3BZ4A 4Q9BA 2QADB 3B2VH 1AJ7H 3OR7A 1J0YA 4HC1H 1SJVA 4F7TA 4LHUD 5ICXB 1U8KB 1QOKA 4P5TB 1GJIA 3VW3H 2V5RA 2YKLH 1HHJB 4F57H 3IFNL 4HCRA 4RWYL 4HKJA 3TN0A 4HFWA 2VLKB 5CEYB 1GVIA 1NFDA 3BO8A 1LO5B 4R2GB 3CFBB 4XNXH 4KKCC 5JPMA 1FNGB 1KN2L 4X4ME 3ULSB 4NQTA 5EZOH 3IDMB 4OJFL 5GRWA 2Z4QB 2VERN 4DAGL 3KPRE 1R3HA 1WJ3A 5FV1L 2X4NB 6FABL 1MREH 3RNKB 4MAYC 1BREA 2LFGA 1MNUL 2X4RA 3BGFB 5JZ7C 3FOMB 4Z7VA 1S7XA 2HKFL 4JM2F 4LNRB 4O2EB 1S7RB 4Y1AE 2APXA 4R4ND 5IMKB 3P30H 4AG4L 4NSKB 1I1AC 3V0VA 3C2AL 4MA1B 2OQJA 4D9LH 1UM6H 4XBEH 5K9KA 3QIWB 3TVMD 1UQSA 3KYKH 1LE9B 3LAFA 1W0WA 2OR7A 5I2IB 4UIMB 1A7OL 1R5IA 3CFDA 5C0RL 3V9FA 3TFKD 2GSGA 5DR5H 3P9LA 1FAIH 1P1ZB 4G6FB 1KC5L 4Z76A 1UKQA 4O2CA 1F4WH 4WWKC 5I1IH 1OWWA 2E5EA 1GZPB 4WUKL 1A1OB 4O5LL 4NN5B 3BSZH 1A1NB 4YXKL 1RZ7L 2JKXA 1E6JL 5E2TH 4O2FA 3F6LA 1DVFB 3AY4C 3TN0D 1I8LA 1KN4H 5JLZB 2JJSA 3WHE0 5ALCL 1P5VA 3ZHKA 3KS0J 3TCLA 3R8QA 1QBAA 5HPOA 2RFXB 1CFBA 4M6OL 2G2RB 4P4KC 2OTUB 3RY4A 4KJQC 3PV6B 2E7BA 4YWGL 3UTZA 4KUCD 4XVJL 3RTQC 3VRIB 2R2BA 4P57A 4GAYB 2JIXB 1N64H 3HPJA 1INQB 4JFZH 4UNUA 5ITFA 4L3EA 2X10A 2EDTA 4J8RB 5EOCH 3O3UN 3NCFB 4X6DF 3O2VL 5HYJB 4W4NA 4YDLC 2EKSB 2VYRE 2BFVL 1QFWI 3NCMA 1WBXA 1JPGA 2Z8VC 1PG7W 3DX9B 3QQ9D 4M9PA 5EBLB 5C2BH 1NGYA 4MJ6A 2YOCA 3E3QC 4M43H 5D2NB 1KIPA 5GGRB 3T0AA 4OZFA 1AGDB 4OFYA 4PS4H 5C0DB 1A6UL 5EUOF 2ADFL 4CVWA 5B22A 5HDOA 5E6IB 4G9FE 4LARL 4EBQH 2B2XH 3AM8C 2MSPA 5HHXL 3GSNA 4DKAA 5BS0A 2W0PA 4IDLA 3L9RA 1BVZA 3ZYZA 3IGAA 4JHZA 1B0WA 3V7AE 1I4FB 1T7ZA 2P1YA 3QXDA 1TQCB 1A7PH 3I6GB 1UZ8A 3ZE1E 2OTWA 4U6VL 5F93C 1FL5A 3D85A 4PTUA 5GGTA 5E8EB 3IU4L 5SX5H 5DC9B 3EJYD 1QSEA 4M4PA 4JKKA 3SPVB 3O3DA 4OZIA 5GZND 5ANMA 4AEIH 4PLJC 3KYNB 1N6VA 4PJXE 3OXSB 1YUHA 1MUJB 1JHLH 1FIEA 4MA8H 1MSPA 2AP2A 3GSWB 1G7PA 5F1NA 3L5XH 5L6YL 1T1WB 4RMUA 5T1MA 4L3ED 3WD5H 4GG6F 4PGBA 2MHAB 4QOKB 3FAWA 1TVBA 2P44B 3VFWB 4LKXA 1TPXC 3P73B 3SGKC 1R3JB 3VXMB 3V6OA 4PJIE 2PKDA 3H9HA 1T2JA 5DO2D 1CIUA 3PIQA 5SWSE 4L4TE 2YD4A 4MAUH 1R3KB 2H6PA 4OFYD 3JV4A 4L9DA 1CLCA 3IXAB 4LHUG 4NZUH 1FFNA 3NZHH 5BS0D 5K93A 3MV9A 1E27A 1QKZH 1CL7H 1EBPA 2UZXB 4GQ9H 3D85D 4X6EB 3FCTA 3IU3B 3MODH 2FECI 3STBA 1ZVHA 4CU6A 1AD9B 5DJDB 5KZCB 2KZ1B 1QSED 3AUVA 3HZKA 3PWPE 1X9QA 3IVKA 4KY1L 1XF1A 4U1NA 4KDTC 2OZ4A 1AGFA 4GRWH 5JORB 1MCPL 3ARPA 5MP6H 3ZL4H 4FQLL 4H1LH 4X6FA 3IJSA 1A4JA 2UYLB 5DRZB 2QQKH 5BVPL 4HGMA 4KRPD 2IQAA 3OKKB 2DF3A 3H6JA 5TQ0L 3X17A 1U58B 2WP3T 3W2DH 4R7DA 3WLBB 1TCRA 1RIVH 2FO1A 5IG7A 3QEQE 3OKMB 1E4JA 1QSFB 3MLZH 3OPZH 4ZXBC 1U3YA 4UAOB 3PABB 3SDCB 4QTIH 3VFTB 4C58B 1ZEAH 1UVQB 1QNZL 5T1DH 3UROR 4KRMB 3O4OB 5TF1L 1JTTA 1NEZB 2VR9A 4LVNC 4XP6H 2CR3A 3KPOB 3LQAL 2JK5A 4BELD 1O5DT 5A16B 4OLVL 4XGZB 1MCFA 2A0LC 5D1QC 4KQ3L 1I8IA 2YS4A 3BT2L 5B3JF 3DOSA 2O5ZH 3GB7A 4Z0BL 3MV9D 3SOBH 3GSQB 2FIKB 1S9WB 1Q94A 3RX8A 2BRRH 3SDAB 3DJ9A 1MPAL 1AGCA 1EGJA 1UXWA 2A6KA 4XNZB 3X14A 3AREC 1FJ1A 4R8WH 4UU9B 4IRSB 4XNUL 1L6ZA 3UZQA 4PJAB 1XR8B 3OTTA 2Z31A 4TRPH 1XZ0A 2FZ3A 4UIKL 4EDXB 5C0AE 3D39E 3OAYK 3WNOA 1VHPA 1RUML 3Q6GL 4RGMC 2J1KA 2BVYA 1KYOK 1K4CB 1FNHA 2PCPA 4HXAL 3EZ8A 3QUYB 3QWOB 4JFDE 4U1SB 2OSLB 4M8QA 3MFGB 4JGUA 3W9DB 5FA4B 3PWVA 3S35X 2WK2A 1XF5B 3KLAA 5JIPA 5TGBB 2R0KL 4LVOB 3X13A 5L2KB 4OCRH 5FM8A 3HC0A 4BM7A 3MRGA 1MCQA 2GK0B 3DVFA 4MNGA 1OAKL 4Z7WE 3G5XA 2VDNL 3VGAC 4EDWH 4JZOA 5HHVL 1NKRA 1TETH 1T4KA 1JUFB 1DBKL 1HKFA 4G8EA 2D4FA 2FBOJ 5ILTH 8FABB 1IC5H 3TNNB 1KTLA 1RMFL 3ARBA 4JKMA 2DQFB 1QSVA 2IH3A 5HGBB 3SKNA 5A2FA 4WY7L 3MSPA 4PJ8C 3WXWL 4MD5A 5LCVL 3MLXL 4X9GA 1SEQH 1NGQH 4TNWK 1R3LA 2Z31D 4Y5XC 5DTFB 4NN7B 5F6IC 4XCCL 1P4BH 3G5ZA 4QT5A 3BDBA 4RMSA 4CMMA 4Z7NE 1QACA 4J7RA 3UTPE 3B9KB 3RVUD 1EJOL 1N3NB 3FT2A 3BKYL 3LKRB 5DHXB 4L8CA 1A5FL 5JW5B 1C16A 1K9TA 5TPWL 3KWWB 5LAXA 4G7YH 2XZCL 3L3IB 2E9IA 2VLLA 2CLRA 3BMVA 4PGJA 3KHQA 3ZKXC 4M00A 2QHRH 2FGZA 4QXTA 2V2XA 1JK8B 4GSDH 1MFDH 3GUTB 4ONGH 4AL8L 1JL8A 1S3KL 3OAUH 5EOTA 3OZ9L 1OP5K 3U36A 3IJYB 4XVTH 4MGXA 5MENB 3X3FH 2KBGA 4HIXL 5C09E 2EH7L 4AYFA 2MMXA 3GDBA 3B9EA 3GJFH 4S1SH 3VA2C 4PJGB 4DOHE 2NXYC 1OLLA 1PKQB 1T0NA 5ENWA 2E7LA 4YPJA 5EBGA 2AJSH 1BZ9A 4IS6B 1D5MA 3REVB 1LO3H 3ARBD 4QNPF 3WSQL 4ZFFB 5DK0B 1OTSD 1RI8A 3IDJB 1RIHH 1UXSB 4UB0L 4XB8A 4C4KT 3QNZB 1GPOH 1FL6B 1B90A 1EXUA 4J6RL 2FYYB 3OGCB 2P42B 4XCEB 1YJDH 4LLWB 2JTDA 3FB5A 3T04D 4C83B 1C08B 2QQNH 2V5TA 5JXAH 5I0ZA 4QY8A 1AGEB 5GZOD 2BVQA 1UEMA 1QFWH 2ITDB 3EFDL 4QRRB 3C9NA 5CKAA 1MHEB 2W9EH 4XPBH 1TCMA 4YHOL 4M9OA 1OM3H 1KXQE 2B4CL 2C3XA 4AQOA 1Z5LB 2VXSH 5D8JH 1RJYB 1DQML 3ZO0A 1PG7H 2C7UA 1U6AL 5F1OB 4G43B 4TUKH 4LSQH 2Z92B 2VAAA 1WBZA 4LCUB 4RMRA 5I1HL 4K3EL 4NRXA 2EH8H 3EHBC 1S9YA 1BQUA 3G9AB 3L7FA 1DQJA 1SMAA 1KT2B 4E5XB 4JM4H 1KCSH 4KJWC 1TJHH 1GC1C 3VD5A 3I3EA 1N5YL 3T4YB 3ULUD 1MHPL 3HS0A 4X8JA 4WFFD 5EC1B 2HJLB 4LASH 5IMLA 1NFIB 4B53A 2ED8A 2GUOA 4LDOB 3G6JB 1LEIA 3PL6C 4YNYA 4TQEL 2XG4A 1F00I 4M6AA 5CGYC 4ZFGL 2J3SA 2YMXH 4P23C 4WFHD 1DQTA 2H3NA 3HFML 4P99A 4HPOL 4N9GA 2BDNH 1DTUA 1YECH 2WUBL 2ATKA 4HIHB 2DB8A 5FKAB 2UZYB 1QFWM 3JV6A 3UTTB 4HV8B 4JM2C 4MWFB 4U7MA 2EECA 2NX5E 2UZIH 5D6DA 4UTAH 3MRLA 2GFBB 4POUB 4HWEL 3ARRA 2E7CA 2QQLH 3G6DH 3WNLA 4MX7A 2OJEA 5DQDH 12E8H 2YN3A 3GMMB 3PGFH 4YBQD 5GS2D 5J0BA 5H37G 1IFHH 2AJYL 4I48A 3GKWH 5J57B 2PF6A 1N2RA 5FYJD 3WFEL 3EYVB 2IPUG 2Z9TA 2WWKT 2EC9U 3MACL 4MD4B 4JAMB 3FQTB 2R1XB 3F7VA 5CJ5A 2W38A 1HEZA 4OD1L 5EU6A 2VXQL 1LD9A 2NZ9D 2X7LB 2DM7A 5EZLB 3SKUD 2X4OA 5BRZE 1M71B 1KCUH 2CGRL 4CMHB 4I4WB 4FQ2L 3E6FB 3ARDB 1MLBB 5JOPE 1TTGA 2A6JA 3CVHL 3H9SA 5E1HB 2W65A 3C09C 3C5ZC 2VOTA 4XXDA 2AABH 2HG5B 2W07A 5DURD 3PNWA 1VKXB 4WENB 5D2LB 4AM0A 4X98B 2VDQL 1SYVB 1FPTH 1A6AA 4CDHA 3O8XB 3UX9B 4ZFOA 2PO6A 5I0DA 2DQCH 3M8OH 3GBNL 3EYUL 3IKKA 2NLJA 4CVUA 4PRNB 2M8XA 1VFAB 1X4XA 1NGZA 3MRBB 4MB3A 1EDQA 3SDXF 3MX0A 1ADQA 1XF2B 2YWZA 4FP8H 3IJHA 3O2WL 5BXFA 5J4MA 1K2DB 5IHZA 3CVIH 5L88H 4OGAC 4NHUA 2HN7B 4OIBA 2A38A 3I6LE 3ZDZE 3KYMB 4RBPH 4M48H 4YDVA 1G6RB 2OL3B 5C08E 3O3EB 1YQVL 4Q9RL 3EGSB 4QRPA 4FQQA 4QO1A 4PG2A 5DEGB 4Y16A 5F7YC 1EMTH 5GGQL 2BNRA 1G7JB 5BJTB 3QPXH 3C60B 5EU6D 2V7NA 4JGJA 2HTLD 2HLAB 1QZ1A 2MCG1 1MAMH 5HI3D 1PKOA 1EAPB 5CP3A 3RZCB 2VC2L 1F4YL 3H9SD 5M94B 3BKCL 1H0DB 4X99B 4N8CL 3H42L 3HLAB 3FONA 4Z7UE 4RWYH 3ZE0F 2X9YA 2F53A 2D9CA 2PO6D 3RUGE 3ECBA 4PJAF 3DPBA 4GW4A 4WNQB 2DTML 5DRXB 3RKPA 5AZ2H 1KN2H 2GJJA 4OJFH 4DAGH 1MWAL 1XGYH 1Q9WA 3K4AA 4WHCA 5DHYB 5F88A 5GSRA 6FABH 3ARTA 2BCKB 4YAQB 2CKBA 1AR1C 2ARJQ 2HKFH 2ZG3A 1DEEB 3JWDC 3NFPA 4HGWA 1KB9J 3T0XA 4QHUA 1EEUA 2DLFL 5E6ZA 4BYHA 4OUUB 3BH8A 4D3CL 3WDIA 1X5LA 3QQ3A 2H1PL 3T3PE 4LSTL 3BEVA 4AG4H 1JZ4A 3C2AH 4MDIB 4P2CG 4QRPD 4DUVA 1U2CA 4J23A 3SBWA 3BJLA 1AP2B 2YA0A 4Y16D 4Q0XL 1A7OH 5ICXA 3ZTJG 3DUUB 5C0RH 2BNRD 4P5TA 2F58H 4AT6B 3CFEA 4U2YA 2WINB 4IOFC 1IL1B 1KC5H 4XMLL 4KTYA 3QXWA 1I7TB 2JCCB 1IGML 2VLKA 5CEYA 4GKNB 1LO5A 3INUH 3CFBA 1KEGH 1KF9B 4WUKH 1FNGA 4O5LH 4KMTL 3ULSA 1MHHB 1RZJC 3IDMA 1HYRC 2ZJSL 2Z4QA 4YXKH 1RZ7H 1E6JH 3JBG7 3O6FC 2HVKB 2NY1B 2FHFA 3OAZK 1U8QB 5IKCB 5DJAB 2F53D 1A22B 2X4NA 3RNKA 4PP2B 3VXUE 4M6OH 5FYLE 5L2JB 3KPPB 5I1DB 3FOMA 2Y5TB 3LCYA 2FGWL 2RQ8A 4YWGH 5KTEL 1DBAL 4LNRA 3E2HC 4O2EA 2BVTA 4OZGF 4XVJH 1S7RA 2M26A 4PUBL 4RWHA 2NTSP 5IMKA 3K2MC 4NSKA 2DM4A 2ARWA 2CK0L 1RUPH 1T22B 4Y88A 3QIWA 3O2VH 1LE9A 1MCOL 4W68A 4UIMA 3HNTL 3TT3L 1A3RH 2IPTL 4NGHL 3S98A 4A6YH 2BFVH 3ARGB 4CDGC 1P1ZA 3QO1B 1IKNC 4TTDC 3MGTB 4DKFL 1EEYA 2QADD 2IBZX 3DMMC 1A6UH 3GSOB 4S10A 1KB5B 1GZPA 2ADFH 2R56L 3L1OL 1A1OA 4LARH 4WU7B 3IDXL 5IF0B 3K8KA 2QL1A 1A1NA 4P5TD 3MUY1 3T0DA 3WNMA 3PDGA 4BH8B 4BFIB 2VXVL 1DVFA 1ZA6B 5FGCB 2VLKD 5JLZA 4G80A 2VQUA 4J1UB 4R2GD 5BW7A 4L4JA 2RFXA 3WJJC 2G2RA 2OTUA 4U6VH 3MRHB 3PV6A 3IU4H 4X7DC 3QHZL 3WN5C 5DZOA 3MBXL 5IVXB 3VRIA 4GAYA 2JIXA 2OR9L 1PFCA 1DFBL 3N1MC 2EO9A 4J8RA 1HQRB 1S7VA 3WO3B 4PJDB 2MOVA 5HYJA 5JQ6H 5E7FA 4K3DL 2CK2A 2EKSA 1A14L 5EBLA 3DX9A 5L6YH 5FXCH 4XVSL 5D2NA 5GGRA 1AGDA 5DUPL 5C0DA 3QIWD 1P6AB 1WT5C 3MJ9L 4U7SA 5FF6B 3SGEH 5E6IA 4CJ1A 4L5FL 3JVGA 1S78C 4G6FD 5D7IE 1U92B 5TJWK 1I4FA 3L7EB 2YWYA 3I6GA 5SWZB 3IFOB 1P6FA 1U8IB 3VU2A 1RULL 1QO3B 2EKJA 2CLZB 1VADB 1UACL 5I1EL 3SPVA 3RVTD 1DVFD 2L7JA 4JDTL 4RCAA 5DVLA 3TH3T 2G75B 4CL7A 1BAFL 4N0CC 4GMSH 3KYNA 2APBA 1MOEA 1JGDB 1M7XA 4G8GE 3OXSA 1X44A 4XMPL 2I25N 4HFUH 2BY2A 5I30L 2R1YB 4O51B 3IDUA 2JIXD 1J0IA 4KY1H 1OW0A 1T1WA 1MCPH 1TJGL 1D9KB 3G04B 3K46A 2MHAA 2NY6B 4KV5E 4FQLH 4QOKA 1SY6L 2KH2B 4DN4L 3VFWA 4GH7B 4IBLT 1OARL 3P73A 4H26B 1R3JA 3VXMA 5HYJD 2ADJB 5GJSL 4ELMB 2WBJC 4O58H 4HS6B 1BJ1J 1FBIL 1J05B 1R3KA 2CUMA 3BN3B 3BPLB 2YD9A 4K7PX 2QLVB 2DLEA 2K3TA 3IXAA 1LP9E 2X4TB 5E6ID 3UJJH 1BBJB 3HB3D 4LFHG 3GHBL 1KTDB 5INCB 5T33H 3LQAH 2XOTA 4K7FB 3RGVB 4MNHB 2NQCA 2NR6C 1L7TL 1PY9A 4OLVH 5HHNB 3L3HB 1U8OB 4KQ3H 2MNUA 4CKVX 4PJFF 3BT2H 3IU3A 1QRKA 5BZDB 5F7LB 2AI0L 4Z0BH 1AD9A 5DJDA 3LOWA 2FR4B 1G7HB 3PQYB 1DQLL 5JORA 1D3CA 4ODHL 1MPAH 2YRPA 4L3AA 1U8JA 4KHXL 5D6CB 3ZKMC 5DRZA 4U1MB 5IHBA 3RVVC 4XNUH 1FGVL 3BRDA 1U58A 2HT3C 1K8IB 1TITA 4OQTA 4XAKD 2VZ1A 2NW2B 5J89A 2AXFB 1I85C 5ECJE 4RZCB 1KCKA 4UIKH 3DXAA 3OKMA 1QSFA 4QOKD 1RUMH 3PABA 2OM5A 3TO4C 3SDCA 5IWLA 3VFTA 3P9MB 1UVQA 2J4WL 3VXMD 4HXAH 4MJ4A 4X6CF 2HFGL 5E5RB 3KPOA 4U0RB 3EIFA 3MLSL 3VWKC 5J6GB 2YPKB 1CXFA 4JG0L 5A16A 4XGZA 3RPIB 2QHLA 2VDOL 1IJ9A 4K71B 3QDJE 4Y5VB 1QRNE 4R97C 4X7TB 4MXVE 3FZUD 5GGVY 3RFZC 4O4YL 4I3RH 2R0KH 3GSQA 1BECA 2ADGA 1S9WA 2W59A 3RPKA 3HE7B 3SDAA 3ET9F 1AQKL 1S5HB 4DGYL 5D72L 2BVOB 1OAKH 3MCLL 3LQZB 4UU9A 1KJMB 3PG2A 2VDNH 2HTKD 2B8OT 4IRSA 5HHVH 4HJJL 1BQSA 1XR8A 4PJAA 5KZCD 1YY9D 1UB6B 2GK2A 1DBKH 4FZ8L 3ME0A 2DI9A 2F19L 4EDXA 3UPAA 2FEDC 4KI5C 1RMFH 1K4CA 5EU7E 5AD0B 3TPUB 1ONQB 1N6UA 1HH9B 3WXWH 3QUYA 1N0XL 3QWOA 1CFVL 2OSLA 3DXAD 3PGDB 4BSWB 1QSFD 4PJEF 5CZXC 3MR9B 3W9DA 3SDCD 4NQCA 4JZJC 5FA4A 4XCCH 3E1F1 4F33B 5CLWA 2EE2A 2ZCLL 2IFFL 3RVXC 2WV3A 1XF5A 4IDJL 5FYLL 5DJ6B 4P2OB 1EJOH 5KANG 5L2KA 5D7LB 5HHOE 4EKXA 4S1QL 1BGXL 3CX5K 1A5FH 2GK0A 5TPWH 5GRUL 5EPMB 3HNVL 4OAWB 2Z0BA 2XZCH 3IT8D 3VGFA 2PYFB 3BHBB 2A6IB 1TTFA 4WW2B 5TF0A 2VL5B 1B3JA 5GS1C 1DLFL 1ZLSL 3WBDA 3NIDF 1JUFA 3SDAD 4AL8H 5GRVK 8FABA 3OZ9H 5I1KH 3TNNA 2DQFA 5HGBA 2W60B 4HIXH 4IRSD 5A3IC 4WU5B 2I60L 2EH7H 4U6XB 4D94A 2NW3B 3VGDA 2BERA 4JCMA 1AHWB 2VABB 4ONOA 2PETA 3WLWD 3CDCA 5DTFA 3BPOB 3WSQH 5E8PB 2JCCF 4NKOB 1OP9A 5C0CE 4UB0H 3QUYD 3B9KA 4HD9A 2FBJL 1N3NA 3LKRA 1II4E 1PLGL 1X5FA 5JW5A 2JF1A 1X6NA 3KWWA 4NQCD 4HPYL 2MPAL 2XZAL 3ZKNC 4NKIL 5CSGA 3CDFA 1M7IA 1WFUA 3L3IA 4CUCA 2B7DT 3O6LL 1FNFA 1NMBL 4KUZL 4HUVB 5T3ZD 5L2KD 1GRWA 5H8DA 1JK8A 1X5YA 2BSTB 3GUTA 5IIEB 1PDKA 2H41A 4YHOH 3SE3C 2BJML 2CUHA 2GAZB 4WFEE 2B4CH 4W6WB 3K1KC 5MENA 3IDNB 1BQHB 1OAUL 1IQWL 5F9WC 1DQMH 1U8NB 5D9SB 4PJGA 1U6AH 3V5HB 2EIZA 2DD8L 1PKQA 3SE8L 2R4RL 4IS6A 4DZ8B 3REVA 3O11B 5I1HH 3QFJE 4K3EH 4ZFFA 5DK0A 2Y4SA 3IDJA 1S9KC 3QNZA 1IAOB 1FL6A 3QEHB 1J1PL 3QUML 2J6EL 5ESAB 2FYYA 1N5YH 2G60L 3MRPA 2DS4A 3OGCA 1MHPH 4XVUC 4XCEA 3NTCL 1SBBA 4LEOB 4LLWA 4ZPVB 2HH0H 4FXGB 3VI4E 4LNVA 5DEZA 3DX8B 4C83A 1C08A 1U93B 5D70L 5DEFB 4TUJB 3J7HA 1RK1A 3B9KD 1AGEA 4TQEH 4HJGB 2X44D 4MXQD 2ITDA 3ZYJA 4UT9L 1CDBA 1MHEA 3JTTB 5KVFL 1C5CL 3HFMH 4FTVB 4OF8A 3V52H 5I75B 5DUMH 5E8NB 5ID1B 2WUBH 3T0EE 4IEFB 2IANE 3CSPA 4J3XA 2AXGB 4R0LC 1GGTA 2ICCA 3LRHA 1DUYB 1RJYA 4H0IA 4GBXB 2NY0C 1YPZB 2ZSWB 5IVOA 4G43A 2P48B 2P7TA 1OGAE 2Z92A 4JY6B 1AY1H 3RHWK 4LCUA 4HWEH 2VIRB 5MEND 5CIPH 5GXBB 1KENH 1WEJL 4XI5C 4LP4A 1KT2A 4E5XA 5DI8B 1SVCP 3T4YA 3WFEH 4OFPA 3R1GL 3WIIL 3ALXA 3N9GL 5EC1A 4JR9H 3MACH 2HJLA 5I73B 5TE7H 1FYTB 2VRAA 4ZOBA 2Q8AL 1NFIA 1R3IL 1IGCH 3CD4A 5C9KA 1ND0B 3G6JA 3VXPB 1A2YB 4OD1H 4YBLB 2VXQH 1OSPL 5IQ7L 3IF1B 5IBLC 2A2QT 2CGRH 3WFBL 4M8VA 4OUOA 4AMKL 4FQ2H 4N90D 4OCNC 1LO4L 3CVHH 4GRWF 5D1ZC 2K9UA 3WFDL 1U0QA 4HIHA 4HK0B 1MCWW 5FKAA 4YHYB 3CH1B 3UTTA 3MRQB 4HV8A 4MWFA 2IFGA 3QUXB 4YXLL 2FEEL 2DBLL 2VLJB 3GBNH 2GFBA 3EYUH 3U83A 4ZG1A 3W39B 4GRLB 4WI6A 3NA4A 3ROLB 3O41B 1YN6B 2DIJA 1JTPA 3GMMA 1S9VB 4GAGL 4FXKA 4QHKJ 1FZMB 4C4KO 3TO2A 5KN5B 4AIZB 2PXYB 3MLYL 4MD4A 4JAMA 3FQTA 1CVSC 2R1XA 1HXYA 3NBNA 1T6VN 4BZ1L 2X7LA 1KLGA 5EZLA 4FQCL 1M71A 5JXEC 4RFEB 1YQVH 3NCYP 4I4WA 4KQ4L 3E6FA 3ARDA 1MLBA 4M1DL 1A4KB 5ACLA 4JFXB 3WNNA 3SKMB 5E9DE 5IVZB 2JJUA 2N56A 2VDRL 1VKXA 5D2LA 4X98A 5J13C 1SYVA 3V6FB 3UDWA 5CWSB 2V7HB 3O8XA 5IR1B 4F58L 3PWJB 2VC2H 2P8LB 3DHJA 5FOJA 5HD8C 5DRNB 4PRNA 4N8CH 1VFAA 4NZTH 3H42H 3MRBA 5HGHB 3UTTD 1CR9L 4Y19B 2HMID 2R0ZH 1QQDB 3BYYA 1QBLL 1BIHA 1XF2A 4IOIB 4WGWB 5J56B 5JW3L 3EOAB 3HRPA 5HYFA 4EUPH 2OK0H 1K2DA 1KJ2L 3VXSB 1QR4A 5E2UH 2HN7A 1MWAH 3KYMA 1A1MB 1G6RA 3ILQC 2OL3A 5IT2L 3O3EA 5EZIL 3EGSA 1NCBL 5DEGA 2DM3A 1NGPL 1VDGA 2YC1B 1PEWA 1G7JA 3EYQC 5BJTA 3C60A 4D3CH 5JQHC 1QLRB 4P3CL 2H1PH 2HLAA 4LSTH 4YX2L 1A8JH 3TT1L 4WEMB 3EAKA 1ORQB 2BZDA 1ZXQA 1EAPA 3SDDC 3ARDD 3RZCA 1J5OL 2N7AA 1KXVC 2R23A 4X99A 4PGZA 3HLAA 4YHNB 2ICWI 3WKML 4XMLH 4S2SB 1IGMH 3O8XD 1R5VB 1P2CB 2CR6A 4WNQA 5DRXA 1CN4A 5HPMB 4KMTH 5L8KB 4TSCH 1U95B 5C8JB 4MB4A 3H2WA 5D4QA 5JW4Q 5DHYA 3OAYH 2BCKA 1CE1H 4YAQA 3MJ6A 4KK8C 1ZHBB 2DMCA 1JYWA 2QKIB 4G3YH 1OT1A 1A9EB 1EHAA 4ZUVB 2J8UF 2FGWH 4APQB 1UG9A 5KTEH 1DBAH 4A6YB 1DEEA 3FMGH 5CZKA 4PUBH 4HK3N 4Z9KB 4PRHB 4KGLA 4OI8A 1H8OA 2CK0H 3QB7C 3A6OA 4X7SL 1MCOH 5CEZE 3HNTH 3TT3H 3DUUA 2IPTH 4NGHH 4AT6A 3GMQB 3C60D 2WINA 3TV3L 1IL1A 1UYWL 1NUNB 1I7TA 2JCCA 3HG1E 4DKFH 4GKNA 3RZCD 3P4OB 2LQRA 5HGGS 2R56H 1HQ4B 1BD2E 3IDXH 1MHHA 3N85L 1BVLB 3V6OC 4JEGB 3KPSA 4BFEA 2HVKA 1IZKA 2VXVH 3MJGX 1U8QA 5IKCA 5DJAA 2NNAB 4M62H 4PP2A 2VH5H 5L2JA 3KPPA 5FGBA 2KQNA 5I1DA 3MBEC 2Y5TA 1JBJA 1B4JL 3QHZH 4MYWB 1FO0B 3CXDL 4PR5B 3I3BA 1P5UA 2CLVA 2OR9H 1DFBH 2PTUA 5C07E 1P7KB 5E03A 1T22A 5I18L 1DEDA 4FQHB 2DQIL 4K3DH 1DBBL 1A14H 1RZFL 3DVIA 3FHAA 3ARGA 3QULA 4XVSH 4JN1L 4HLZH 1MCRA 3MGTA 5EH1A 1GIGH 5DUPH 3SCMC 5MHSD 4G6ML 4XHQA 3GSOA 2C26A 4OT1L 1KB5A 4LPUA 1MJ7L 3MJ9H 4WU7A 4NC0B 3Q0HA 5IF0A 4L5FH 1PYWB 1OL0A 1CGVA 1S7UB 2M2DA 4PP1D 3VRJB 1UA6L 4BH8A 2EDEA 3HMWL 4BFIA 1QYGL 1ZA6A 2UY7A 4YH6A 5HTSA 4J1UA 5GRVL 1OP5H 1TZIB 1BP3B 2NY3B 1IVLA 1RULH 3MRHA 4KPHH 3KPSD 5I1LB 1UACH 4KTDH 1I7ZB 5I1EH 5IVXA 3SE4A 2NY1D 5GS3A 4TNVK 4JDTH 2XZZA 5E4IA 5DJ0B 3OKYA 2UWEF 4M7LL 3P4LA 4PJDA 4S1DD 4XMPH 3GMNB 1IGYB 2OXHA 1FIGL 3WFHB 1V3JA 3MUJA 1CBVL 4KRLB 1KTKE 1T6WA 1TJGH 1LEGB 5K9QI 4HUWB 1SY6H 4DN4H 1OARH 1EEZB 3TEUA 4ZAKC 5FF6A 4ZS7L 2CIKB 2YEZB 2CIIB 3WO4B 4NUJB 3ARGD 2EYTB 4NC2B 5LXGH 1U92A 4FQXB 2FEEI 4D9QD 5A1AA 4LPWA 2BX5A 3L7EA 5SWZA 3IFOA 1YPZF 1U8IA 1FHGA 1U3ZA 4UZGA 2XRAL 1QO3A 1XT5A 1GOFA 4PY7B 1VADA 1JWMB 5C6WH 3QDGB 4YC2B 1P7HL 3VH8B 2EE3A 2R1WB 1JGDA 3CXHJ 4ODSL 3WV0A 1NFDE 2X42A 3EO0B 4PGCB 1BEYL 2VMFA 4IRJC 3NCYS 3GMPB 4O51A 3UAJC 1NUGA 1DQLH 5DJCB 5FHAL 1D9KA 1IC7L 4NRZB 2E7HA 3VXQB 4PLKD 4B50A 3WMSA 2Q3AA 1S8DB 4NM8L 4H26A 1FGVH 2ADJA 4ELMA 4ORGB 2AJVL 1CXKA 4HS6A 3ZE2F 1WGOA 4Z7VE 4F15C 1J05A 2X5PA 1MRDL 4KXZI 4N1EA 5FECB 2MCPL 3DI2B 2J4WH 4XP4L 1E4XL 3PV7A 3BQUB 1FN4B 3LIZL 1BBJA 1MHCB 2HFGH 1FNSL 4XWOC 5INCA 4PGEB 3MLSH 1T3FB 3RGVA 4K7FA 1LGVA 1AI1L 3B9DA 2BHYA 4JG0H 5FUCC 5HHNA 2VDOH 5SWZD 3L3HA 1U8OA 5IROA 1NKOA 1ZAGA 2MWCA 5F7NC 5BZDA 4CU8A 1P9MA 4NBYB 4O4YH 3DX7B 1JNHB 2SEBB 2FR4A 1G7HA 3PQYA 5FUZH 4AQ1B 1AQKH 2AEQH 4YEFA 4LLQB 4DGYH 5D6CA 5D72H 4Y89A 4N68A 3MCLH 4U1MA 1CK0L 1JI2A 3S34H 1K8IA 4HJJH 5M95B 2NW2A 4HSQA 2AXFA 4FZ8H 1UZ6F 2CSPA 4W81A 4RZCA 3T4AB 1H8NA 1XR9B 1D9KD 2NY6D 4A2MA 3FRPA 3W9EB 3ZDYF 3P9MA 4L3EE 2UVFA 5K9OB 4Z7QF 5C3LD 2EDYA 1ZWIB 3GSXB 5BZWB 1CFVH 4ORZC 5J6GA 2YPKA 4U1GB 5B38B 3B43A 2VTFA 3EO9L 2Y25A 3GNML 3RPIA 4DGVL 4PYHA 3WEXB 1FGNH 1CYGA 4Y5VA 2ZCLH 4X7TA 4WRLA 4HG4J 5KG9B 4X7FC 5ALBL 5FK9B 4IDJH 4U6YB 1FC1A 1JI1A 4JQXA 3ZT7A 3S35L 2A77L 3RGVD 4OD2A 3HE7A 4DW2L 1BGXH 1DN0B 1F3DJ 1T80A 4M7ZC 5BS0E 4K07A 1S5HA 5E00B 4NQDB 3HNVH 2BVOA 3LQZA 1KJMA 3C5SB 1JNNL 2B5IB 1IKFL 3FB8B 5IW3A 3BDXA 4P3WA 1DLFH 1ZLSH 3S36X 1UB6A 1CU4L 2XTJC 1HKLL 3KLHD 3PQYD 5FEBA 3CNKA 5CEZL 4NKQB 4P5KB 4KJPD 5TFSL 4TTGA 1QSEE 3BKML 1FFPB 3VDBA 1J8KA 1JNLL 1UH4A 2X89A 5F9JB 4OZIE 5AD0A 3TPUA 2IPKB 4K8RD 2I60H 5ANME 1ONQA 1HH9A 2A83B 3LHPL 4DN3H 4UDUB 5L7XL 1OT2A 4NQEB 3CH8A 3CMGA 3PGDA 3UYRH 4BSWA 5D96B 1BLNB 3MR9A 3SO3B 2XZQL 4F33A 3WUWB 5D7SH 3UXFA 3RIAF 4NO3B 2OS7A 4KTEH 5DJ6A 2NZ9C 2FBJH 4P2OA 1Q9LA 1T2XA 2ARJB 2FH8A 4HUKB 7FABL 5D7LA 3VI3E 4PY8J 3V6OE 1PLGH 1JHKL 3U0WL 1JPTL 2JJTA 5EPMA 4HPYH 2MPAH 3CUPB 4EVNB 2XZAH 4OAWA 4DQOL 4NKIH 4JRXB 4FG6C 2PYFA 3VWJA 1QFPA 4LF3B 4PYGA 3BHBA 2A6IA 1NMBH 2AKRA 4FFVC 4WW2A 1GC1H 2DIAA 2ED7A 3O2DL 4KUZH 4Y2DC 5FUOL 3HE7D 1UM5L 3S3JA 3MV9E 2BJMH 3V2AR 4P49A 1IGJB 3U30C 1A6VL 1F45A 2W60A 1VPOL 4POYA 4U6XA 1IQWH 1X5ZA 2NW3A 4UILL 4K2UL 3TYGH 4HKXB 1AHWA 2VABA 4R7NB 2DD8H 2AJ3B 3IS0X 5J7CC 3SE8H 2R4RH 5HI4D 2X89D 4N5EC 1D5XB 5E8OB 3HC3L 4NKOA 1R5WB 1IM9B 3RZWA 1RJZB 1YEIH 5AAMA 4XX1G 2AXJA 1J1PH 1SYSB 2J6EH 3QUMH 4OV5B 4IJ3C 1G9ML 4WO4C 3NTCH 5E4EB 4LEXL 3RI5K 5D70H 3ZT5A 4JFEB 2PTVA 5FYKU 1JV5B 2B20A 4P2OD 1KOAA 3OAZH 4HUVA 5D7LD 1GGYA 2RBLA 4OGXL 4OZHB 4ETYA 3QH3B 4U3XA 1CF8L 1UWEL 2BSTA 2D7PA 3LZFL 5IIEA 5KVFH 1C5CH 2EEBA 1X4YA 1A9BB 2VLRB 3VWJD 3IDNA 4R96B 4HWBL 1BQHA 3MZTA 1YMHB 2GY5A 4L8SB 4RMWA 1U8NA 1Z2KA 2AJZB 4G8IB 4XPFL 5D9SA 3V5HA 4H1LG 5A2LH 4DZ8A 3O11A 5DFWH 4PBVC 1IAOA 3QEHA 1WAAA 4U33A 2XNAB 1BX2B 5ESAA 4XMKL 4I1NB 3R1GH 3N9GH 4ZPVA 4LEOA 4FXGA 1JN6B 2WUCL 1U93A 2O5YL 1R3IH 5DEFA 4TUJA 4P9HL 2HRPL 4PJ9C 3CSYB 5I6XB 4TPRL 4DCQB 3ARUA 4HCRL 4HJGA 4CU7A 5CP7B 5IQ7H 3QFDB 3S3SA 3WFBH 5ID0B 3MRRB 3DYPA 1TTUA 4AMKH 3F58L 4FTVA 1UM4H 5CFHA 4YGVA 4PG2C 5E8NA 5ID1A 4NBZB 2LTQC 3HI5L 1NCNA 3C6LC 2VKXA 2AXGA 4IIQB 4NFBA 3KG5A 1DUYA 3MYJA 5KS9F 4GBXA 3QBTB 1YPZA 1H15B 4GQPH 4YXLH 1RU9L 4LRNL 3O3AB 5KSBB 4WHYH 4JY6A 2DBLH 4JB9L 2VIRA 4FQIL 2DJ4A 4UNTA 4MNGE 4CN4A 3S4SB 3ARFC 4TN9A 4F37F 2Y6SD 4GAGH 3X3GL 5LGHL 2EDDA 5DI8A 5B39B 3DVNB 3RY6A 4DFHA 1E4XI 3MLYH 1NBVL 2AV7B 1FYTA 1DUZA 5I8CB 1F90L 2X70B 1JGLH 5D1XC 3VXPA 1A2YA 3VD9A 3WS6A 3B2UC 3DV6B 3NIFF 3I85A 3IF1A 3OL2A 3TWCL 4FQCH 3FRPG 4QKXB 4KQ4H 3EUUA 4C54A 4E41B 3DI3B 3ORJA 3V4PL 1MCIA 4HUUB 4HK0A 1EUTA 1I1AB 3CH1A 3MRQA 3O0RH 4GUPB 1GHFL 1YJDC 1U3HB 3QUXA 4F58H 4RMVA 3LD8B 4FTVD 4POZD 1QUNA 2VLJA 1BHGA 2QJDA 1B2WL 1C1EH 3W39A 1VCAA 3BUYB 4UI2A 4S1RH 3ROLA 2C3VB 1YN6A 4OFIA 4GBXD 1S9VA 1CR9H 1G7QB 2B39A 3T1FB 1FZMA 1QBLH 1UC6A 3EDKA 1FQ9C 3B5TA 3BZDA 1WWCA 4AIZA 5JW3H 4H20L 2PXYA 1BF8A 2IJ0C 1KEMH 2GIYA 4PJHB 1KJ2H 2ESVB 1JIBA 3G08B 5MEOB 4ZO6A 4U0QB 1UADC 4FA8A 4LMQE 3LH2L 3UC0L 3QUZC 4IRZH 2FDBP 5IT2H 4P4KB 3EO1B 4RFEA 3NFSL 5EZIH 1NCBH 1A4KA 1FYTD 4HULB 4XCYA 1NGPH 3RTQB 3SKMA 3ULUE 3GSNL 5IVZA 3K4DA 4WI2A 3H7LA 3MQIA 4WFFE 4X9BA 5J12C 3GSUB 3V6FA 3KAAA 3TT1H 1LEKB 5CWSA 2V7HA 4MA1C 5IR1A 3TESA 2NYYC 5A2KH 3PWJA 2P8LA 5GGTL 4YDLB 1J5OH 3C08L 5ITBL 5IFAH 1NANI 1VGKB 4H0HB 4WFHE 5DRNA 1NAMH 2UY6A 3VFOB 2BXYA 5HGHA 2F5AL 3WKMH 3BISA 4Y19A 1QQDA 1SM3L 1VGEL 3QUXD 3KJ4C 4IOIA 4NQVB 1NGWB 1OCWL 1AH1A 3BN9C 3CPLA 1ZS8B 2VLJD 2J5LC 3EOAA 1OTUD 5EZJB 1ZLVK 1MCCA 3FO0L 4GT7A 3S6CA 3VXSA 5HYSB 2EDOA 3EYOB 4LKCB 3TBYB 4YPGA 4LRIC 4ONHA 1A1MA 2VDLH 1ZLUK 4KKLD 2DKSA 1T7XA 4KZDL 4LSRH 2FX9L 2PXYD 5FYJE 1JHTB 1GGCL 2YC1A 3MRIB 1W0VB 5EB9A 3UTSB 3IETB 4RA0C 1BIIB 4ODVL 1KIUA 1QLRA 4FOMA 4MD0B 1JF6A 3S88