1J8RA

Binary complex of the papg receptor-binding domain bound to gbo4 receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords PYELONEPHRITIC ADHESIN
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 1j8rA00
4Z3EA 4Z3GA 4Z3JA 4Z3IA 4Z3HA 1J8RA 4Z3FA 1J8SA
chains in the Genus database with same CATH superfamily
2YQ2A 4KNUA 5IK3A 3D07A 4JO8A 3E6HB 3KLSA 3SKNB 3DNKA 1BQLL 2CSPA 5ICYA 2FGWL 5DSCA 3SZKC 1G1KA 1I7UB 2PR4H 4NZUH 3VRJB 4BZ1A 3S97C 1QEWA 2WWKO 5GRJL 2JKJA 4HCRH 2K45A 1OSPL 3QH3B 3ZGIA 2J6EH 3BVUA 4AM0Q 4KROB 2ITCB 4KV5F 1INEL 1JGVH 5CM1A 3KYOA 2NXZB 4LU5L 3IM1A 4IQHA 6FABL 3T65B 4HJSA 1BMWA 5JZ7C 3Q2LA 2UWEF 2NX5E 2CDGB 1WEJL 1NAML 1HHKB 1T6VN 3OXRA 2RAMA 2F19H 2FWOA 4PJ7F 3ZQXA 2GJPA 1HILA 3C2SA 3VMNA 1A47A 4FMKA 4D0CB 3UMTA 3RVXC 5T1JA 4FNRA 2BNQA 2P24B 2MCG1 2VLJA 5E7FA 2NMSA 4F7KA 1KELL 1N2RB 1C5BH 1UM5L 2GJJA 1VZIA 5LCVL 3CJJA 1HZKA 4LSSL 4X5WB 3MAWA 2V3EA 2DDQH 1KIUA 4HGWA 4FAAB 1WPCA 2GI7A 5GS0C 2ZCHH 2V5YA 2EH8H 2VKXA 1HILB 1FNGA 2Q8BH 1OAZL 1JUFB 2DWXA 4ALAC 2W88A 1FLRL 2FO4B 3DXAD 2ED6A 2Z93B 2P7TA 1HNFA 3UROR 1ROCA 1KBVA 4FE9A 4PJHA 2HJKA 5DO2C 4OM0H 3NUKA 2X6CA 4GFTB 3MUGA 2XBDA 5AVTB 2FUTA 4JS7A 2O30A 1TZHA 4K71B 1A3LL 3VWJA 1S8DA 1XCQB 5GGTH 1ASQA 4N2KA 3V0HA 1GPOL 2E4FA 1M9SA 1TKWB 3NEXA 1AR1C 3N43B 2CJUL 2HLFD 4LARL 3SDAC 1I9RL 4L1TA 2Y1ZA 3QIWB 1PQZA 4ZFOB 1F58L 1NC4B 2ZUYA 3H42L 4FLHA 4A7UA 5IB2A 1G9EA 3DSNB 2WYZA 4CC4A 3ULUF 2KQNA 1IFGA 3S0PA 4WUKH 3Q6FB 3WJJC 3SDXB 3E1F1 3C5ZD 2V33A 3GSNA 4PJXE 4JQIL 3F84A 4OT1H 3ZUNC 3NP4A 1U8NA 4B41A 2IPTL 1PDKB 1AZCA 1N67A 4OM1H 4I9WE 4UZSA 1EHNA 4PY8I 2WKGA 4L1LA 4I4WA 3ZE1F 5CLWA 3HS0B 1WH0A 1ZANL 2XWJA 4OD1L 3CMOL 2X1PA 4UBDC 4Y16B 4RMSA 1NDGB 2AANA 3RNKB 1XH0A 3MCLH 4U1IB 1HXKA 2JELL 1KC5L 1H19A 5LAPA 1ZSDA 4TUKH 3C6LC 2XN0A 3CSTA 3KXFE 1OTTC 1U58A 1WIOA 2BNQD 5FYJH 4WSKA 1H9DA 3VE0B 4JFFE 3Q5OA 3RZWA 2UZYA 2CUAA 5GGQL 3RAJL 3BI9X 4AGQA 1RPUA 4OSUH 3WENA 3BIKA 3DUSA 2DD8H 1L6ZA 2QPDB 3QEQB 1Y07A 4K3JL 3W0WB 5DJ0B 5FYKL 4E9QA 3WAJA 1T3FA 1BPLB 3FOMA 1JUFA 3RUGA 4WK2B 3QIUD 1H8LA 2BP8A 3COOA 4YFEA 3HUJB 3OX8A 3NIGB 2XDHA 4JLRB 4XOEA 1ZLSL 1WWBX 2D2CC 1MRDH 4IRZL 2JCCB 3QFDA 4JZOA 3V8OA 4LVNB 4EOWL 1Q9KB 5JNYB 1YNLL 1F2XK 4DPRA 1BZOA 1UZGA 4DSYA 3HUJE 3WIIH 4X7EC 4HCGA 4YDZA 4IW4C 2WINB 4WTWA 4JUSA 4FQQA 4XMLH 4W9FC 2YD7A 1TJXA 2X4UA 2X6BA 3QXWA 2R0LL 3OKNA 1T89A 4WRLA 3EH2A 4PRHB 4F7PA 1KLFA 3QDJB 2PW2B 2D2OA 5HGHB 3U0PB 5FYKD 2XKSA 1G7MB 1HXMA 2CMRH 1WGOA 1W6WA 4YEFA 2P46B 2D7TL 2NT0A 2RALA 3GFUA 3HE7B 4MA8L 5D1ZC 1W6LA 2R0WH 3OAZH 1AC0A 4KFMA 1LP9F 3RKPA 3P0GB 3WEXB 4GEIA 5SWSB 1J86A 1M56B 3P4OA 4I3SH 1R46A 4NN5B 3LN5A 1ZLUH 1BQRA 4G43B 4X9IA 4GRWH 2VT0A 5CP7B 3FO2B 1FG2B 3QUMH 4FYRA 3P40A 4Z18A 4YHNA 4M9PA 3HG1E 4MMZA 1I7RA 4MFHA 3QXUA 4XNBA 2QTEA 3F7KA 1LL1A 4ZS6D 2KLSA 4MDJA 4WWID 4FKKA 5DRWB 1GYUA 1MCRA 2WOBA 3QRBA 4LEEA 4U1NB 4ZZKA 3ZHKA 5DHYB 5T3ZD 3V4VA 1CB4A 2QPEB 2FHBA 3APCA 4EE2A 1F41A 3KLQA 2K7QA 4IJ3B 4JKLA 4X6DB 3DO7B 2VJ8A 3LIZH 2FZ3B 5GS0H 2MSPA 4FNUA 1H8OA 1PJ9A 1XL6A 4JJ5B 2ZUWA 4KKBC 4PSPA 3GINA 3PWPB 4JFZH 4F8NA 4D0DA 3JVGC 5CJ8A 4FFVC 4P3DA 2ZONA 3L3IB 1MWAA 4K94L 1FL6B 1KBGH 4PP2B 4ZQTA 1IGMH 1NAKH 5FW6A 5IFJB 3N40P 2H32A 3I6SA 4WW1A 3HC4H 5CJOL 2CM6A 3LB6C 3OKEB 5A1AA 1KCVH 2L3BA 3ARVA 4TS6A 1XF3B 1MF2L 1OCWH 5KYYB 3NA4A 4M93C 3OKLB 3TBTA 1S7TB 2XVLA 4JQVC 1OZTG 4LCUA 4ZUUB 1O7SA 3MNZA 2WKOF 4X80L 1D5MB 5FW8A 5GGSA 3FQWA 4Z7WB 3Q7JA 2DD8L 1IKNC 1IRAY 4A6YB 1P84J 1P4LB 4AL8C 5KW9H 5HYQB 3RUGB 5I18H 1U8KA 3I74A 3KJ6L 3NJVA 5E9DB 4ELMF 3GXNA 4F15C 3GRGA 3S37X 2AAVA 3N1MC 3WLWC 1HEZA 4R9HA 4DFIA 1SLXA 5AAMA 3NP3A 1BJ1J 1LK3L 3NK3A 2KYIA 2A73A 1F4WH 1NPNA 2Q9OA 3SOBL 1KJ2L 4W93A 4MJ6B 5E2UL 1OE3A 3V6FB 2BP3A 4BH7A 2N1TE 2BY0A 3FO9A 1ZWIA 5FK9B 4K7FB 3WD5L 5EA0L 5KN5A 2P24A 5E8PB 2K3HA 4HH8A 1HNGA 2EYSB 3SEPA 5MEND 1UZ6E 3FQXB 3IRPX 4NT6A 3EO0A 2QVKA 2DH3A 3IAPA 3N85H 2EXYC 4XNUH 4H8WC 3MR9B 1XCXA 3WFZA 3HZMB 3UJJL 1I1AD 5EOQL 5I15L 5JORB 3OKOA 4O4YH 1X6LA 4ELDA 2DQDH 4QXWA 2HPOA 3IVKB 3V4VB 5DVLA 2UWEB 1KXQA 3F6IA 5DTFA 3LKQA 3B9KC 1URZA 1OGAE 4R4FL 3BE1L 3RIAK 4KKQA 2H3NA 1XF4A 4HK0A 2ZUTA 5E8NB 4FXGC 4WWKB 5JDSA 1Z9SA 4RWYL 2AXHA 1OK0A 5JPNC 1S9XA 1HE7A 3BKCL 2WGXA 4XWGH 1MCIA 1B9KA 2VDKL 1KXVA 3GRWL 1K4DA 3FB6B 4YHLL 5DFTA 4YGVB 2F19L 5B1CA 4AQ1B 4LSQL 4BGLA 4GRLD 4KDVA 3QUML 4LHJB 1HC1A 2WIIB 4BINA 4RMRA 2MNWA 4JO2H 1SN5A 2X70B 4OV5A 3L2LA 3QUXB 1MWAL 2ZOLB 5JIHA 2F58L 3PFQA 2ICCA 4L5FL 1NLBH 3GZKA 2C3VA 4XNDA 1C5BL 1TMQA 1UM5H 2APWA 3M7FB 3TV3L 4UM9D 2OXHB 4OLXH 4KTEH 2EE9A 4LQFH 4KGLA 5DD5H 4JFVA 3DV4A 4IBYA 4DTGL 5FIEA 3AROA 3VGHA 1JDAA 2IAMC 2YMOA 1OHZA 5A16A 2EAEA 4HA1A 3IDJB 4HJTA 2VQ1B 2AK4A 4KO7A 2B16A 3TO4D 1CLZL 3C5ZB 4JX0A 2F53D 3QI9B 4JCLA 2GUOB 2GTWA 3LJ3A 2HFFB 4AIXA 5I75B 3QQXA 4GW4B 4XZUA 3ZDYB 1YA5A 1GJUA 5DQ9A 2A6JA 4G9FA 4NUGL 1OP3H 1JWSB 4QRPE 3OLIA 2K1MA 1ZKAA 1Q72H 2RBLA 2ADFH 2CJUH 1AS6A 2ODHA 2ZF8A 4I0PB 5CSGA 3AG4B 3NRFA 4O02L 5GGVH 5J13C 2XN9A 2VZOA 1G1CA 4JKWA 3U4EB 4HLJA 1CUOA 2DL9A 2GEEA 3K2UL 2G3XA 1T03H 4ODVL 1O6SA 4P2OD 1WA0X 4XH2B 1P7BA 2JIXA 3MYZA 5KW9L 3ULUD 1RZFL 2Q86A 3BUYB 1WISA 3B2XA 4JM2C 4S1QL 5FB8A 1P5UA 4P9HL 1ZS8B 4RA3A 1P69B 1BD2D 2EIBA 3GNML 4Z76A 1JP5A 2Q7YB 3JTSA 5JOFA 4A66A 3MX0B 1TFPA 1JGEB 4WFFD 2B9AA 4EIUA 5DD0L 3MMEA 4TQEL 3U36B 1B6UA 4XC3H 2OZ4L 5T3ZH 4HUVA 3P9LB 2C4XA 4MJID 2DLGA 4PRIB 3MLZL 4TUKL 5LUMA 2E7LC 1DVFD 5IGXH 1JRHI 1KZYA 2B4CL 4FQXB 5MENA 4MX7A 1XD0A 5GJTH 5A7BA 4GP4B 3OMNB 1OGTA 5I1HL 5B38B 3GJFH 4RX4A 4TSCH 3ELQA 1A5FH 4U6TA 3IFPA 3MMEB 4Z7NE 2D03H 4G3YL 1A9BA 1YNKL 4H20L 2D3NA 4YHOL 5HGHA 3I6LD 3FPYA 3VNZA 1RUKH 1BVLA 4MAYD 4CVZB 3PDOB 2VLKA 5E2TL 3QDMA 3QIWC 4JY4A 1AD9B 2HFEA 4UOQA 2BVOA 2YEVB 2Z0UA 3DARA 2J2ZA 2O6DA 2X40A 2QJDA 4GUPA 5EU5B 1GIGL 3DHPA 5HYJB 4HEPA 1E4JA 4BSJA 1J9RA 4HWEL 3OZLA 1T83A 3AMLA 5HHMD 4WGVB 4HIIB 2IGLA 3KPRD 1MRDL 1JWUB 1TZGH 1XGTB 4NO5A 2OX5A 4Z7UA 5FR3A 1WHOA 4KK8C 4CL7A 2A83B 2X89A 2SEBB 1N4XL 3LKRB 5C0CE 3S4SA 2NXYC 4GKLA 1CTOA 3S8WA 3EFDL 1E5ZA 1PDKA 2DWEB 1FQ9C 5AOJA 1FCGA 2FO8A 1EUTA 3OZ9L 4PJEF 3FFCB 4PI0A 5IW3A 5BXFB 2YPKA 4XMTA 1HWWA 1KXQE 4K3DH 1AIFB 3I02A 3GGWA 2WBJC 2IV9A 3REWB 1QOKA 5CEZD 5A2LH 4I0KA 1SVCP 5KANG 5IB2B 3HAEG 2EDBA 2VDQL 1X9QA 4YQXH 3UMNA 5TDPB 1C16A 3OR6B 1J0YA 1TNMA 4FYSA 4YOKA 5FYLE 2IGFH 4QCIB 3BP5B 2CA3A 2DQEH 1T4WA 3F7YB 5SWZB 4L1SA 5BVPH 4FA8A 4RMTA 2UZIL 1DVFC 3WJMB 3QNZB 3BLBA 3MZGB 1X7TA 1ZLVK 2X4SA 1EO7A 2DEWX 2VERA 5EC2A 5FYJU 3HVDA 1K5NA 3KPMA 4HIHA 3X14A 5DUJA 2R27A 4MJIA 4F5CE 4Y0GA 1D9KA 3ARWA 3DX6B 2CBPA 3KXFD 4HDIB 1W72A 2EDFA 4ELKA 4JZJA 4K07A 1EAPA 3S96B 1DZ0A 4HOMA 3N41F 1E42A 2CO4A 1J8HA 1HSAA 3L3OA 1FJ1B 4FTVA 4KX9A 2AJZA 4JM2B 5AZ2H 2F8XC 5ACLA 5EIIA 2Q2LA 2NY6D 1AXTL 4HPOH 4I77L 5E6YA 4E36A 5FO8A 3H9SA 2E47A 1FFQA 2ZG3A 43C9B 4JZJB 1QFUH 3E6HA 3SKNA 5J0BA 4MMYA 1JCKA 1W0YT 1MCEA 2R69A 4MDIA 3H2QA 2Q5BA 1BWWA 3K0WA 3L1GA 1D6VH 3QJHA 4X42A 1DQKA 3NTCL 4YHKL 1B0IA 5DD0H 2YKKA 4GO6B 1LO0L 4KKRA 1OM9A 2XY1A 4DT2A 1S7UA 4J8QA 1FC2D 1N6QH 3MO1B 1QFWL 4KMTL 2PO6D 3L13A 5B7EA 3TIEA 3BOVA 1BQLH 5F1KC 3L95B 3QPKA 2IADB 5DWUH 1J0IA 1MRFL 2R4RL 4UT6L 3MUHL 1JPSL 2WKLA 1TTGA 1JZ8A 4BK5C 3D2UB 1BQHB 2OYPA 5GRJH 3ABKB 4ZTEA 4BFFA 4TRPL 3L6FA 2ICEA 2KZ1B 4WUUA 2VXTH 2ITDB 3FCBA 3VH8B 1JGVL 3K1DA 4OBSA 3P0VH 5FX3A 3HPJA 5IM7B 1GGUA 1M2VA 3QAQA 1BZ8A 3QNXA 4WTQA 5EEYA 4ODBD 4AL8L 4PR5B 3WIHL 3K8LA 5C09E 4A55A 1MXGA 2ZG2A 5C0BB 2EUZA 5F7LB 5B38A 3RIFF 3ASOB 3MGTA 4QMEA 3QIBD 4UOZA 1BFTA 4XBPB 4TM9A 1TF4A 5ICZA 3GB7A 2WNWA 3B9DA 1M2VB 3O0RH 3VFTA 2Z1PA 3SDXA 4HJUA 2PPEA 4GUQA 4U2YA 2A0LC 2E8YA 1ET5A 1QZ1A 1JNNL 2NCEA 2KL6A 1N26A 3OKDA 4JO5A 3GO1L 5FFOA 3VD5A 3WFHA 3QEHB 2EH8L 3UAJC 5A3IC 4IHOA 3TYFA 5I0XA 3OPZL 1ZT7B 4IEFB 5D1QA 5LBGA 5BRZE 3SE9H 3VFMB 2YGQA 2EECA 1VADB 3KL0A 3DV4B 3GMOA 3QDAA 4LEOA 4FXTA 2XFXB 1ZMYA 3E80A 3Q13A 2DQDL 1AOZA 4X7SH 5C3LD 1R75A 4U1IA 1F4YH 1UM6L 3D05A 3G6DL 3MFFA 4G42A 5D96C 4B3EA 1VKXB 5H2BB 4NQCB 3BE1H 5GGTL 2IJ0C 4Q2ZB 4P2AA 3RVWD 2YAFA 3FTWA 2YMXH 5H4ZA 4JN1H 4JFQA 2XOTA 4JFWA 2CCLA 4JO4L 3OLDA 4JVPA 1LEIB 3T71A 2Z8RA 1OCRB 1R24B 2XFXA 2VZ1A 2VXVH 4JPVH 5C0JB 2XWXA 1I31A 2IO5A 3CDCA 1MLBB 2XY2A 4NPKA 1OTSC 5KBPA 2NQ3A 3WKMH 3KNBB 2R8SL 1RIVL 4PS4L 4OZHA 2NZIA 3B6SA 4HUNB 3L3OB 5F3FA 1BJ8A 4JQIH 1E8ZA 3MV8D 2EC8A 2OMYA 3D34A 4UDUA 5G4MA 4R4BA 3CVHL 2A9NH 1TZAA 3ZPDA 4M1GH 2DYRB 3ZDXF 4HPOL 2YD3A 2AQSA 4U1SB 5CR8A 1FDLH 3MGOB 2VDPL 3SKMA 5GS0D 1FO0B 5E1QA 1IGYA 2CD0A 4WW2A 3LEYH 1Z32X 1GGYA 2AMUA 4HW6A 5CSBA 4KRNA 4FNTA 5CCKH 2HLEB 3FCTB 4Y4HC 2NUTA 2JWYA 5GSVB 4PR5A 2DMGA 1IM3A 1NUFA 5LG6A 4L18A 2BK8A 3UZEA 1F3JB 1MCHA 2NY2B 2VLRE 3CU1A 3GMLA 4E9XA 1DBAL 3LSOA 4G6AD 4UNUA 1TVHB 3WIFA 4KDTC 5AB9A 3TZVB 5BMFL 5DWUL 4V2CB 1T7YA 2VDMB 1VJSA 4AKOA 1NWOA 3U79A 3M17A 5T3XE 5ICUA 4KZEL 2K6YA 4WI0B 2WWOA 4NWUL 1M7XA 4XO3A 4M02A 4WWKA 1ZGLA 4PRAA 1IJNA 1S5HA 1IQDB 1UZ8A 4O2EB 5I6KA 5HY9A 1FN4A 4AVHA 3SQBA 3OM3B 4FQJL 3SBRA 3U7YH 3BAEH 5T1MA 4BBWA 2HA1A 1VFBA 1CFSA 4L3FA 3OHXA 1JHLL 2GUYA 4JDVA 1MELA 4GG6F 2AAAA 3C08H 4HULB 3MRHA 5BZZA 3BGFB 1KTBA 4UANA 3QIBA 3NAAH 4KJYB 3FOLB 4KY1L 4TQEH 1C12A 5DXWA 3SDAB 4P2QE 2ESVE 3DV6A 2NW3B 3SGJA 4PWGA 4PV8B 1QBLL 4OF8A 2ZG1A 4Z6AT 3OWRA 3GPEA 5D2LB 4RIRA 2O5YH 3UX9B 4BKSC 5KSUA 1CFTB 1S46A 4A63A 4WFEE 3GGWB 4WV1A 3HE6C 1E27B 2OYLA 1IIIA 2DLIA 4MA7L 4KKNA 4YHOH 3RIFK 2DQTH 1KYUA 3PWNB 4H0IA 1FE8L 1HKFA 3V6ZB 4BKTC 4Z23A 3FUEA 2AVGA 4H2AA 5I74B 5K9QG 4XMKH 5JHLL 5AYUH 3FB8A 4FG6C 3VO0A 4C8XA 1WWCA 5DLMH 1M1XB 1GMEA 2IBZX 1BECA 1U3HA 2EE3A 3ET9F 3I9IA 4JN1L 5CJ5A 4KOCA 2V6HA 1KYAA 1XO8A 3L4WA 4PRIE 1JZHA 4JCMA 5AYTA 4LMQE 5HDBF 1EO8H 3NDZE 1OOWA 4YIQB 4RQQB 1PFCA 4S1DD 2Z64C 2ISDA 3V9FA 1ILSA 1RIVH 3ARFB 3HS8A 3OKMA 4F7TB 2JJSA 5KAQF 1OT2A 3VFRB 3IFNH 1AGFB 4QYOA 3Q5TA 4L4TE 5JXAH 3ZXAC 3NK4A 1Q0XL 1YRKA 1CR9H 3L1FA 4HPHA 3FSAA 1VGKB 4OLZL 4KKLC 1CBJA 2O5NA 1EBAA 5BV7L 4LGPB 5DF0A 1RIUL 2A77L 1RZ7H 4IIZA 1NKRA 3W11D 5K93A 5DRZA 1JYXA 1ZVYA 4JPQA 3LEYL 3UERA 2YQGA 1WSST 5KVEL 2NCMA 2W91A 1FZMA 4UIKH 3BVDB 1EX0A 4WJG3 4OCRL 1BIIB 2BSSA 2ICWI 4U49A 3V6OA 2Q20A 4AITA 5L8JB 1MCDA 3SE3C 2ZYRA 3CHOA 1W72L 4UDUB 2E74C 2N4IA 4HOXA 4BK4A 2OL3A 3FB5B 3PWPD 2WP3O 3DTDA 4Q89A 1RQ5A 4OCWH 3OR7A 3CXHJ 3MOBH 4ZUVB 3O2DA 3T2PA 1NL0H 2IIJA 1V5JA 1ZLWK 1FNSL 1KG0B 3GK8H 1GJWA 2CO7A 5CLYA 4DOHB 1EWHA 1YMMB 4K9JA 1KTCA 1S7QB 4QKTA 2EYRA 5GGRY 5L88L 2R15A 3MA7B 3PV6B 5T5FA 3RKDC 4BFNA 1L9MA 4QF1A 4YHPA 3WEBA 3WHXA 4Z7VF 3SPVB 1F3JA 3C12A 2W5PA 3O6LL 4PGEB 5AZ2L 3MCKA 2I85A 2JB5L 3MREB 4KHTH 1R3LA 3MNVA 2W0FA 3KEHA 4QWWC 1SYSB 3QZLA 2V9UA 1K4DB 3FB6A 2JJTA 2AABL 3K6SB 2F5BH 4G6AC 4KHXL 5JR1H 5ISZD 4NRYA 5CP3H 5CJXC 5GSRA 4JRXE 3GJFK 3M17B 4JFUA 1T20B 3CSBA 1IT9L 2D9QB 3WTSA 4OU3A 2GCYB 3PPSA 1A4CA 3EOAA 3KPRE 5FDYA 1WAPA 3BT0A 4WNSA 4AG4H 1ETA1 2UWEA 2Z92A 5DTFB 2L7JA 4BWTA 3S3JA 5EO0A 5HHNB 1BQKA 1N5YL 4M00A 4HOZA 4X5XA 4Y4FA 5I8CA 1J5OL 1N2RA 4ODTH 1WGVA 2D8KA 2KDYA 3EH5B 4JANA 1R3KB 3O2WH 3UYRL 3UXFA 5F7HA 4GQ9H 1R3JB 5CWSB 4AT6B 4PH8A 1BMZA 2JMRA 4I1NB 2H7WA 4FMFA 4PREA 1ZRUA 1YEEH 4U1HA 4GBXD 2NYYD 4XAKE 4NNXA 4HS3A 4AYDC 1T6BX 1FORL 2QKSA 4AXWB 4XMWA 2EVFA 5I1LA 1CICB 3C8DA 5ITBH 1UJ3C 2CR0A 15C8L 3TO2B 3MFFB 1JJUA 1WC7B 3J8F7 4PV9B 3SQRA 2NZ9D 3JV5A 3ZOAA 3TXAA 5DC2A 1ZVSB 5BRPA 3CZGA 4LSQH 5JOEA 4IIQB 2VW4A 1CK0L 2NY3D 3NJIA 1F58H 2J8UE 1GZPB 4R7DB 5DJXA 1QUNA 1J7VR 1ZHLA 3LQAL 5DEJA 2PWGA 1MHPL 5EOCH 5C08D 4JRLA 3U4BL 1ORSB 3DX7A 1GZQB 1XH3A 3IDIA 2WUBL 3Q44A 4PV9A 4P59H 1A6TA 4FFZH 3H3PL 3S3BB 4XXWA 1KIPB 2PWEA 2VTFA 5B7MA 4AVJA 3QB7C 1THCA 3HMWL 3F3HA 1K3IA 2ZCKL 3QRFM 1RZ7L 3SE9L 1NOLA 1BJ1H 2ZF9A 4HK3J 5L9DH 2IQ9L 3L7FB 4PJ9C 1UOVA 1MI5A 3EJYC 1XSJA 5HJDA 2XJLA 2AZAA 4ZNEE 5KZCD 1SXBA 2Z91B 2WANA 1AGFA 3QJXA 3ARDC 3QYMA 5TTRA 3WTWA 1BFOA 1J18A 3NJFA 2APFA 3GSVA 2A73B 3FU7B 2F15A 3ULVC 3W56A 2WM0A 2FYYA 5ABAA 1TQBC 1U42A 2AI0L 2EDRA 4HS8H 4PQXA 3BQUA 1F02I 3QDME 2CU9A 3CC5A 4ZOBA 1ZE3H 4YXLL 2WQVA 5HYSG 4PB9H 3SO3B 3TA3B 1MJUH 3QCTH 1X5GA 4XNQA 5IVOA 3QR2A 4PRAB 4LRIA 3NJMA 5AW3B 4JAMB 2Y1VA 4OB5L 1DSFH 2AP2A 2W1NA 4N8PA 4HZLA 1EANA 3BAXA 1XHHA 3OF6A 4TKWA 1RUML 5ENWB 1WP6A 1SFHA 3FU9A 1KYOJ 3FJTA 1M7UA 1AQHA 3L6FB 2HN7A 1B3JA 2ATPB 3UFIA 2OJEA 3KWWA 5CCKL 3MRJB 1Z2KA 4X6EB 5I1KH 3TURA 1PF3A 1GMIA 1KJVB 1KV3A 3GC3A 2GBUA 2OMWB 4AM0A 3FOLA 1P5VB 4XMPH 4EZMA 2JKXA 1A14L 1TLMA 1BVNP 1J5HA 5BNXD 1QA9B 1JF1B 4ATTA 1KJ2A 1RZGA 1L0XA 3DX6A 3O2WL 3FU3A 3SJVE 1DLFL 3A24A 3O8XC 4U0QB 1UYWL 5FUCC 3NSCA 1LQSR 4JFDB 2LLGA 1FYTB 3W2DH 4N9OB 2VC2H 5I17A 3EYSL 4B97A 1P7KB 4Y9BA 1JVOA 3GSXA 3BKJL 1XAKA 3AQYA 3HA0A 4J4PA 4RDQG 1H3XA 1A0QL 1MPAL 4LO9A 2WJ5A 1EGJA 1DTUA 1GGCL 3C09B 3U7YL 4PJCE 3KW7A 4N0FA 3B2UC 5LB1A 3FU0A 2R29H 3FYIB 5BQDA 4IMLB 1EHKB 3PWPA 1D7DA 3F05A 4PJ7B 3UYOD 1G9ML 4U6VL 3B9KA 1JPFB 2LTQC 4N3UA 3VYPA 3M07A 4M9OA 4R96B 1B4TA 2B9BA 4OGXH 5HVHC 4X7TA 5E23A 5B3SB 1G7IA 1RU9L 4LNRB 1ZV2A 1HL5A 3PP3K 4XXDB 1DVQA 4UYPA 3V7AG 1IVTA 5C6WH 3X3GL 5INCB 1BAFH 2W9LA 5GS0L 1OB1A 3CFCL 4XVSH 4Z7QF 3HI1A 3SHSA 1CDYA 3GSUA 1IAIH 4HQQL 4FD0A 3MRMA 1R0AL 5EUOB 4Z7QE 2LR4A 4NM4H 1JN6B 3L3JA 3SDCB 1QBBA 3DMMB 3MRDA 4PY7A 2OS7A 4OKDA 2BIQA 5IJKC 4F27A 1UOKA 3MZTA 3IJHB 3C60B 4G6MH 4BFOA 3NJJA 5GZND 1GH7A 2CZNA 4FQLL 3GZOA 1DHKA 4LSTL 5ERWA 3MUZ1 3FT0A 1DEEB 2ZCLL 2BSRB 2J1WA 3NPSC 2H5UA 3LQZA 3FTUA 3PWVA 4RNRA 4LIQE 4YK4B 4PJDA 3DOSB 2V0AA 3IFNL 1XGYH 3JYBA 4PJCF 5E4AA 4FA6A 1IC0A 2VN5A 1KJMA 2EDJA 3O11B 3OAZK 3WSQL 2R9HC 3RHWF 3GHBL 2VR6A 3APMA 3MUUA 3Q48A 4HWBL 1LLAA 3GMNA 3LVEA 2HFTA 3BUQA 1M6UA 2FWSA 5FM4A 2YAOA 5D7KD 5L4IA 3RWHB 3WNMA 5AL8A 3RL2B 2V2TB 3AWFA 4R5VA 2BNQE 1VB9A 4V1DE 1SVZA 4HXBH 1G0XA 3LEXA 4HEME 3MRKB 1Q1JH 4HGKC 5LGJB 3VWKC 4IKIA 2XICA 3KLDA 3NRQA 4HHWA 1Z3GH 3J7HA 3CZSA 3MBWA 4NPYB 1OF2A 5IBTH 2XWJB 5CINL 1E0OB 4N68A 4WV1B 3SPJA 2R7EB 3S36H 5H4YA 2OMNA 1I1YB 3HJEA 3P11H 1N10A 1TLKA 5TDNA 4HUUA 3A4DA 12E8L 5ESQA 1R3JA 4L3EB 4HC1A 2X41A 3KPOA 1HKLL 3MV8E 3D2UD 2VC2L 2NZ9C 2JQMA 1PLGL 1U8OA 4OF0A 5DR5H 5HD8D 1OAXL 3HG4A 3DVGB 2FSEA 3ZDXB 3R8BB 4PG9A 5DJCB 2AK4D 1LEKA 2KI6A 2EJ1A 3KLAB 2X88A 2BWQA 1A8ZA 4PJFA 1IMHC 3TO2A 4ZMAT 3X3FL 4PJ5E 4AMKH 1DBKL 1TJGH 2XIIA 1PCSA 5DEFB 1XGUA 1JSYA 2WTRA 3O81A 3QIBC 5DUBB 1CGTA 5I1CH 1YNLH 5GJSH 3MXVH 4H13C 4XP5L 2AJ3A 3RVWC 3QNZA 2HRPH 2K6WA 3TVMB 1ED3A 4MQ7B 2VLRD 2GYSA 2EVHA 2GFBB 2NNAB 1WIUA 5I1DB 4ZSOB 1WWAX 3RNQA 3FT2B 1MH5B 3ECVA 3UOAB 2XWEA 4NXKA 1CF1A 5CF3A 4QRPB 5D93C 1N0LA 5IR1A 1SJMA 1YJDC 4S11A 3EXJA 2ZQKA 5TE4H 2J55A 5F96H 4ERSL 2AKRA 1U4EA 5GS1A 3SBPA 5I73B 4FQ2H 4LCCC 5EUOA 1YEEL 1JF6A 3QUMB 3NQIA 4UINH 1QHPA 4MA8H 1XR9B 2OMXA 5CJXA 1T5KA 1KGIA 3KYMA 2VXQL 2A6IA 4G6ML 3VSVA 3ZR6A 5IVZB 4XXDA 4UAHA 3VSTA 5BRZA 3U46A 1F6FB 4GG6B 2IV8A 4BFKA 3IDMA 2XNAB 4YK4C 3NJXA 1X5IA 3QXDB 5J5EA 4ZO8A 5D72H 3ARGD 1WVZA 1CYGA 5LBSH 4AMXA 2AMGA 3VFOA 3ZL4H 3O4LE 3JUZA 2WD0A 4KXDA 3D0VB 1PTZA 4MD4A 1YQ2A 3BN9C 4FFZL 3VXRB 2CIKB 3LNFA 1XF4B 5TF1L 3VXRD 2WB7A 4PRPE 4NCC1 3O6FB 4PRNA 4UIMA 5EEXA 1V8HA 1U8HA 1FNEB 3AM8A 5C0IA 4MMXA 3RZCD 4MBOA 4L3CA 4MQXD 3STZA 4YXHH 2ZXBA 3REVA 1GS8A 2G4GA 4POUB 3VG9C 5FUCE 2D4DA 3MRBA 1G0DA 4QOKB 2W0KA 1E9PB 1HINH 1KBGL 4A68A 5I8KL 1BQ5A 1OPOA 3EO0B 3FTVA 4KTYA 4PHXA 5I2IB 2E27H 4APQB 2ADYA 2Z9TA 1YC8A 2FGWH 1CICC 3U6RB 1CC3A 4EQ2A 5MEQA 4PJCA 2BSCA 2CUMA 2XN1A 3PHQA 3WFEH 2YFOA 1JHTB 2VSMB 5K9JH 2FBJH 2W81C 1B4JH 5E2TH 5KSBA 1HAWA 3BLPX 3QPQD 3NCFB 3KPNB 5DS1A 4H2CA 3ZJAA 5HJ3B 3FFCA 5BXFA 5IQ7H 2YD8A 3T3MF 3KLLA 3FT3A 3NCMA 4I88A 3U6RA 5I0VA 2EC9U 3SDAA 4HXAH 4XCYB 5I1AB 3V5DB 2ZOWA 1U3HC 5C0EB 5B39G 3P4LA 4PJGB 3U4AA 4YUEH 5AVSB 4Q6IB 3UTOA 4S1SH 5IB3A 4J3OC 2WXLA 4NJAH 1IBDA 4O00A 4FNPA 1P4BH 3TEXA 3IGLA 1A4JB 3N50A 3EDJA 5H2BA 4CMHB 5DHVB 3EGXB 5IOPA 1KCUH 2R2BB 4HJJL 1BREA 1ZT1A 3HG2A 1RSFA 3KH3A 1M7DA 2Z4QB 3WU1A 5HYSB 4M8VA 5EF1A 3T4AA 1HVXA 3POCA 4K3DL 4HIEB 1CD1A 1I85C 3UBHA 2I27N 4M7KH 2WWNA 2VL4A 5DK0B 5IT2L 3R4DA 3K71A 5AKTA 4TLSA 3BJ91 3E0GA 3MNMA 5F96L 3GHEL 3R0NA 4L9LA 1MFBH 3HNSL 5F9OL 5C0FB 1EFXD 5C08B 5IFAH 2IGFL 3F6LA 2B4CC 2WN3A 4PJDF 3CC1A 1FO0L 5FFLA 4FLRA 3IJEB 5BVPL 1NZRA 5CLTA 2WLJA 3O4LD 1BMGA 3SYAA 2K7PA 1HE8A 3HAEB 3DXAE 2FWLB 1PZBA 2EABA 3DROA 5C0FA 5JQ6H 4ADIA 4MXWH 4XN5A 3RU8H 3SBQA 1R33A 4S1RL 4OJDH 4NC2B 3I6KB 2Z92B 1DBML 3UADA 4FCHA 1VERA 1C08B 3VXSB 3L4CA 4X4XB 2C1OB 3V0AC 4LQFL 4HYTB 3M8OH 3ESPA 1WO2A 5HHOE 2PCFB 2M83A 3NGBC 3CVDA 2N7BA 4RDBA 2DLEA 4UB0H 2IMNA 3PABA 3OAYH 5IMKA 5GPRA 1A6WL 1UKTA 3L5XL 1TENA 4LOUC 4LEXH 5JW5B 4KQ0A 5CIPB 1PNDA 3CXDH 3QS3A 4BUHA 1PJWA 1IEHA 1B3IA 2PUQT 1N6QL 4I48B 4NS0A 3F00A 2XXGA 3LNDA 5AVZB 1OTTD 1XD1A 1KTRL 5AFAA 1EH9A 3SKJL 2B59A 4QRQB 3C5ZA 3ZUCA 3GMOB 4FXLA 2Z4TA 1QUNB 1SUHA 1OGSA 2F1EA 4LCCA 2KZWA 4Y2DB 3O41A 4DEPB 1FG2A 3O3EA 2GJ6B 4NO3B 5B39B 4TLKA 5C0GA 1XXFC 4KZDL 4WUUD 1JXGA 1T2XA 1CGUA 4ZW7A 2DQMA 4Q4EA 5IFHH 4Q8BA 1D5IH 4YEEA 3QRGH 4J3SA 4HZ1A 5M95B 3FONA 4J6IA 5A2BA 1U91B 2A6DA 2HUHA 3VXMB 3O8XA 2WP3T 4CMHC 4NO0B 1K4CB 4QTFA 5FGBC 2KQMA 3S3PA 2BSBA 2KUTA 1MIML 2XZQL 3BAYA 3DUUB 3PL6C 3UAAA 4WKZA 4WY7L 1KYDA 2C9RA 5IVXE 4ZQKA 3I75B 5DUBA 1IGCH 4WU7A 4ZPTA 5B8CC 3AT9A 1IGFH 1CGVA 5EU6D 5DQ9B 5TE6L 2ADGA 3ZMRA 4IBWA 2EXSA 1X6NA 3T4AB 5IP4A 3RVUD 3C60C 1NDMA 2ZNXA 5CEZL 1EHXA 2XTJC 5E5LA 4PVLA 5I1HH 3FBQA 2XKNB 3QIWA 4W9GC 2OYMA 4Y16A 2CG9X 4KQ3H 1CDIA 3QJOA 3K6DA 4DO4A 4TYUA 2ARJB 1RLBA 3HR5B 2GSIB 1DL7H 3HUJA 3T65A 5DZPA 3RTLA 1ORSA 2CRYA 3LQZB 3UTPD 4LHUD 1WQVT 1ROWA 5BO1H 5C0CD 3VWKA 4ENZA 2F54D 4BH8A 5EWIH 4V2BA 4PEEA 4E41D 2HSIA 1I9JH 3BP4B 5DZNA 5BOPA 1TSRA 4JFTA 1JPST 1TZGL 2VABA 1GYAA 4AQEB 2AERT 3U4BH 3WUWB 1AY1H 3T2QA 3QFJE 4J4PC 3RU8L 3MRDB 4HAKA 1CU4H 4LLAA 1G6RA 1I9EA 3ROOA 2P52A 3R4RA 3GMNB 1U30A 3FT9A 2HJFB 3MLSL 3IYLW 2DMCA 3ILQD 1P2CA 3DLQR 2Y1AA 4HT1H 3RWEB 4OZIB 1EXHA 3N2JA 3GMRB 2F1AA 3MRRB 4NM8L 1U33A 4I5BB 4U0RB 3HC3L 3P4NB 2ZX8A 1YUKB 3MRIA 1JZ3A 4UZUA 1ZA3B 1R3HB 4ACTA 2CDEB 4LAQH 2P7TB 3FN0H 2JKIS 3RVVD 3SKMB 4HC1H 4JHWL 4JREB 4LCVA 5D7JA 2CJTA 1EEYB 4GKNA 5C0IB 1CQYA 2Q3AA 2P47B 4P57A 2YRBA 1P4IL 4M03A 4JFSA 3T2OA 4OZIA 5E6ZA 2CHDA 1G84A 2F5AH 1OL0A 1XFPA 3B7TA 2XHNA 2DQCH 2AI0H 2ENSA 2WLIA 3SDYL 2JCCA 2XQYG 4JZOB 2Z35A 1LHZA 3RY6C 1YEIL 3VH8A 5MHSD 3RDTB 2CBMA 4LSRH 2F1BA 3CFNA 4FXKC 4PB9L 3UTQB 2XXMB 1J05B 4N8VG 2IDUA 3SN6N 3KLKA 4B3VA 1BSIA 5B8CA 4S0HA 2WWKT 3GEFA 1A1NA 2G30A 4HUWA 4HUMB 1K5NB 4RWHA 4MLSA 1AXTH 4BFJA 2MCMA 5GIRA 1FAKT 3IEAA 1ET7A 1SBSH 3NIDE 4JFDD 4P04A 5JW4N 2XV3A 5C8JB 2BIIA 1KJ2H 1LDPH 5DK3A 2FR4A 1OSYA 1MN4A 2W94A 3JSSA 3HBGA 3RGVA 5ABZA 4MVBD 1N7MH 3B7UX 1NCJA 3ARZA 3INUL 4M4PA 4P2QA 5CEXA 3BPCA 5IIEB 2OKMA 1W0VA 3F01A 5DZLA 5IMLB 5F9JA 3MV11 4PJ9A 5J57B 1YLBB 5EU6A 2FCBA 2AJSL 2WCPA 3BP6A 5ICXA 2XACC 1OCWL 2FJFB 3SQOL 1PGRB 2W9EH 1QPXA 3DX8A 5JNYA 1DLFH 1WBZA 4UMSA 3U4KA 3RDTD 2AXGA 4ZUTA 2FJHB 1TPXB 1CLVA 4HUUB 4DO6A 3MLRH 3D18A 4H1LG 4X6CB 4YSOA 1MFEH 3BPLB 3W37A 1L0PA 1MCLA 2FQFA 3WAKA 1DE4A 5EN3A 3QFJD 3BIAX 1ZA6B 3HC2A 5LBSA 4RBPK 3RG1C 4XVJH 3KDPB 1NGPH 2CGRL 3ZW3A 3I2CL 3F62A 4G59C 3TA4D 2V17L 5FKPA 2QR0A 5FOBA 3DI3B 2ICEB 4TL5A 5EHFA 2EEDA 8CGTA 3T6QC 3ZTEA 3BZ4A 2CLVA 1DQTA 1L5GA 1NMBH 5EU7C 4V1DD 1CI3M 2Q7YA 4NQDD 4PJHF 4FZ8H 4QXVA 4ZX5A 3PL6A 5H37H 3BVWA 4F8PA 4K55A 1Q0YH 2ARJA 1HHIB 1RIHH 3A23A 4FKEA 4U6HA 2GC7C 2QVMA 3SE3A 2R7EA 4LRIC 3W0WA 1FYTE 5TK2A 3DURB 1I4FB 1TMCB 2FIKA 4QKXB 4XVSL 1E2ZA 3OPZH 4Y8DC 4EEEA 3VDBA 1XEUA 3HB3C 3FUKA 1INQA 1A3ZA 4F7EA 4WVRA 4YH6A 1E3FA 1NBZA 3U7WH 2LU4A 3S37L 3KPSB 1CE6A 2UXFA 2VDPB 1RULL 4E5XA 2DPKA 1R5WB 5A43C 1PU0A 2EYTB 1OEZW 3CZUB 3ESMA 3T0EA 4HZAA 4QXUH 2BW4A 4OBRA 3IWVA 3RGVD 3VI4A 4KI5D 3ZE0E 2B2XL 5C6TL 3TCTA 3IMWA 4LLYB 2ITFA 1DN2A 5KYWA 4X8GA 4RISL 4K7PY 5IEHA 3B9EA 3M86A 3MOBL 4M1CC 4P2QB 4Z5RB 5F8RC 4RZCA 3GB7B 1R5WA 1QLRB 2IH9A 3RYMA 1H3GA 4ODVH 1WWWX 1CT8B 3FU5A 3QQ9D 4HKBA 2O5XL 35C8H 5EORL 3LNIA 5DMGD 1VAHA 1QABA 3B1UA 1SVBA 4GSXA 3IDYB 1WBZB 1RK1A 4FEMA 1KTJA 4HFWA 5FA3B 1AIZA 3RY6A 3FTGB 3JV4B 5DD5L 5KVMC 5FHAH 3BUIA 4X99A 4ZNEA 3ES6B 1H0DA 5F7BA 4L8SA 4R0LA 4EVNA 1KB9K 1WAAA 2G60L 3QI9A 1HQRA 3DPBB 3T0XA 4Y9EA 5BZXA 1N5AB 1PNCA 1RFDL 4MD0A 1EZSA 1MVYA 1TZIB 3CFMA 2GFBA 2X10A 3CXDL 1GS7A 2DJ4A 3ZK0A 3MBEB 1B0WA 1E4WH 1UC6A 3OKDB 5IROD 1TVBB 4OCXL 3GDCA 3T9WA 4BM7A 2E75C 1XGPB 3HPLB 3RIAF 2RQEA 5LO7A 3QXDA 3SE8H 2WCSA 3II2A 4H20H 1HH9A 3ZMEA 2I60H 4G8IA 4BZ2H 5CFAA 3KPMB 1OWWA 2VZTA 4NAMA 3MLRL 8FABA 1BFSA 4GAGH 3KGSA 4L9LC 4Y4KA 4GS7B 4CVUA 4KNSA 3KYMB 1BVKA 3QARA 2YR3A 4Y4FC 2FB4H 3ATFA 3AFLA 1KXVC 1I85A 1JWSA 2VGLM 1F2QA 3TM6A 2J21A 4V1DB 4RGMC 2DQGL 2UY7B 3DSFH 5DS2A 1QHQA 1I7UA 4W9JC 3F2LA 1AXSB 1BYOA 4R7VA 1LK2A 4NYLB 4EBQL 5KAQG 1N0LB 3LX9A 1TQVA 2CR6A 4MZ3A 2DKMA 1JXKA 4KDTA 3T2LA 2OZ4H 5T3ZL 4FZ8L 3PREA 1KWGA 4PJAB 2GIYA 2F74B 5B1BB 5IJVB 2YQBA 1LO5B 5DK2B 3ABLB 3UTSE 2BHYA 2Y6SD 3F04A 3L2MA 2OSXA 3WNIA 3WEOA 3JWNG 3ATAA 3AZUA 3S4SG 3O0LA 4U3SA 3UDWA 5DK0A 3K71B 4OF6A 4KUCD 1NQBA 4UQIM 4PGDB 3T0AA 2W8CA 3BZ4B 1WFNA 4WW2C 3STZB 2X70A 1JXDA 2VDMH 1QO3A 2ATPA 4X4ME 4OV5B 1P7QD 4CBZA 2DQEL 4XWOC 2V37A 2UZIH 3T8XA 1E6JL 2YEQA 2FQEA 3ES6A 3S3DB 3DGCR 1NCAL 4PCYA 2VLME 3G6JF 2TAAA 5HPMA 5GS1C 3KDMA 2AV7A 4JQIA 4FC3E 4P5TC 2R1YA 1M6OA 5D4HA 4R8WH 5LBSL 3AQZA 4ODSL 4Z95H 3QZBA 1VPOL 1IO4C 1V27A 2R2BA 1ZLUK 4P5TA 5LKNA 2GSGA 5I9QC 4LLUA 5JORA 1S3KL 2VB5A 3KPNA 1MHEB 2LLLA 5C0BE 2FBOJ 4AK1A 2VM3A 1ML0A 1JYNA 1RKRA 4WTZA 3LKSB 4HCIA 5BJTA 3K6OA 5BVJB 3BW9A 4OM1L 4HT1L 4OLZH 1WF5A 2WVSA 4AQAA 1ONQB 1Z9PA 3KLHC 3PJNA 4LSVL 4QCIA 3KPOB 4Q52A 2NX5D 4IBVA 1A9BB 3P2DA 3OB8A 5FOJA 3IAGC 4DKAA 2UWEE 2H8PB 5HYFA 1CLYH 5F7UA 3LKPA 1MKFA 1ACZA 3KXFA 4R26H 2APBA 2R4SH 2COQA 2EO1A 1KIPA 4YMPA 3L7EA 3HKZA 4KMQA 2DQCL 2VXUH 2ZKMX 4TRPH 5MERB 2C26A 5IQMA 2F08A 3H7LA 4GQRA 3X1GA 3HE6A 4NEHB 5TD4A 5C2UB 3N06B 5GGRB 3DVIA 3GBML 3HLKA 3NCJH 4RDQF 1AGDB 5AOIA 4N1EA 3PU7A 2DYPD 2PTTB 1I7TA 4NZTL 1MCCA 4X9GA 2IF7A 2OCCB 1LE5A 5HHOD 4HG4K 4B7LA 3SGJC 4U7KA 4XBEH 3ZN6A 3WEMA 5IQLA 3RLSA 1I3GH 2F5BL 1G4MA 3L3HB 2X4PB 3QDHA 1BVOA 1KB9J 3ARBA 3BSHA 4POYA 1NAMB 2FX8L 4N2DA 1T4KA 3DXAB 3DJ9A 3EJJX 4YHKH 1FNAA 1YN7A 3MNWA 4B9YA 2ZSVB 1UTDA 1LO0H 1PEWA 1KFAL 1YY8A 3PF2A 4BK8A 5AZUA 2EDDA 4PJ8D 3DDGA 3LD8C 1JGIA 2HB0A 1JFQL 4AG4L 3IPBA 1MFNA 1YY9C 4LESA 5KSBE 4PRHA 4F7PB 4LCYA 2HT4C 3CQFA 5J9PB 2ZKXA 3MJ8A 2IH1A 1QYGH 2EEFA 4JFEE 3GHEH 3X3GH 4IRZA 4WWKC 3EYUH 4U6YB 5JPNB 4M3JA 2CMRL 4HUXB 4NO3A 1DQLH 3BKMH 3PWUB 4GPVA 1MJ8H 4L8SC 3QWNA 4NM4L 4FF9A 3WN5C 1P7QA 1EBPA 2EIJB 3AXLA 2G5BB 4FP8L 4GRLB 3OXSA 1G94A 3HZVB 1J8HB 1HSAB 4FTVB 5IJKA 4Q6KA 1TQUA 3UBGA 2DWDB 4MSWA 1OAUH 4WI9A 5D6DC 4RH4A 3K2MC 4DGVH 4N2EA 3RPIA 4C54A 2FWOB 4GH7B 4NRXA 5D70L 5KS9E 2OXGA 3UZEC 3VFPA 4Z3EA 1JWUA 3PWJA 1IEBB 5BZDB 3P77A 4S1RH 1NM9A 1ND0A 3D85A 2H0JA 3EJQA 3LQAH 3CVIH 1H5BB 4MNQB 3I9GL 3IGUA 4ZFOL 1QSVA 3B37A 4PGCA 5IMKB 4PLKD 5C1MB 3LHPL 5T1KA 3ROOB 3GSNB 3DV6B 4IKKA 1HAUA 3HG5A 1NBVH 1IGTA 4M3KB 4GSUA 3T0EC 4Y2DD 4G6KL 4YE0A 5E2VH 3U9WA 1Q8MA 1RH8A 5EMYA 1GR7A 4QHLA 1NFDA 2RH0A 2H2PC 3JV0A 4U31A 3D85B 1W0VB 1YEHH 2CAKA 1E28A 2ORBL 1N0XH 3FUHA 2E7CA 3RB7A 1CGWA 1NCIA 4JL1A 5D7HA 4XO4A 5ECGA 2VDLH 3CLEH 5FGSA 1H15A 4R83A 3UG5A 4P5TB 4E0RB 2N59A 2XETA 1Q9LA 3SPGA 3SJVB 3R0MA 5BZWA 1R24A 4MMXC 5JHAA 3AXIA 1CJYA 1Q9OB 1S7XA 3CHRA 2C9QA 2YXMA 4UU9A 3MRQA 1HJBC 4QRRE 3D8MA 25C8H 3MNZB 2EEAA 4NPYA 4FZEL 3ZL1A 1PD6A 1OT4A 2P8LA 3DVFA 3FFDB 3H4HA 3Q6FA 2BRQA 4NWUH 3D48R 3LPGA 4X4ZA 3VM7A 5HSFA 4MAUL 2HRGA 5L0QC 3ZKMD 1O7DE 1ZOXA 1BFOB 2VLJE 1FVCB 4KH2A 5IQNA 2JSFA 4FLQA 4WHYH 5I1LB 2YBRB 2NSMA 1JZ4A 2AEPL 3FT2A 2Y0SA 1RZQA 2R1XA 5DUPH 2WYTA 3O2DH 4PJBF 2H0PA 2VDPH 5GS2H 2ZUVA 4R0LC 4HU2A 2DM3A 2IDSA 3C08L 4CKVX 1VGEH 3ZRCC 2AXGB 5EBLB 5C08E 3MJ9L 3W39A 1GKEA 1D5MA 5GGSB 5CD5D 1KTDB 2EDXA 3B2MA 2FX8H 3LD8B 2MEJB 1OPGL 4M62L 2Y23A 1IGFL 3JT2A 2DF3A 5TFSH 5FV1L 1E8YA 3WD5H 1TNNA 3B1TA 3KGTA 5F8QC 4LVNC 1MVFA 2YAQA 1I7TB 2O5YL 1EZLA 2RMNA 1LGVA 3IPEA 4QXTA 1G5GA 4JFPA 2UV3A 3A21A 2B7DT 1S9VB 1NKOA 3LPFA 4WI0A 3FRUA 2XLLA 3MRJA 5D7LB 3R8QA 3NABH 3VTTA 1FL3B 4Y4KC 3UG4A 5I15H 1MLBA 4R2GD 2X9WA 5CGTA 1F3RB 1SDDB 4FQ1L 2COVD 3DWTA 1OF0A 3R18A 4UINL 3AQDA 1KULA 4H0LC 1WS8A 3POHA 1G7JA 1S5IL 2D7OA 4RFOH 4EN3B 2JV6A 3V4VL 4O02B 2D7QA 4RWYH 4WFED 3AU0A 1JK8A 4NRXB 3E6FA 5EZIH 2TRHA 3ZHNA 1JHLH 3C9NA 3TEYA 3VD0A 1WJ3A 2QQQA 4F37F 2HT3C 2Z35B 1DVSA 1BOYA 2DM4A 5I1JL 4PJ5B 4QJ3B 4AQZA 3BQUB 5ITFA 2VDLB 1UD8A 3VX0A 2E9BA 5AWNH 3QYNA 3PL6D 4ODWA 4M8QB 2BLFA 4X4YB 5K5YA 3IBEA 4WHYG 4PYGA 3GLAA 3MJWA 2C9UA 2VUOA 4ZTPL 5I6LA 3ZZLA 2W80C 4UTBL 2GCYA 4YDJB 4G5ZL 3ZRFC 4QOKD 4L8SB 1KCWA 1AAJA 3F5WA 4BE5A 4OJFL 5FA4A 2MKLC 2A9AA 5ITFB 1T7VA 4YR6A 5IB3B 3T3PB 3C8KA 3QFJA 1XX9C 5HVFB 2E7LA 3M45A 5EZLB 2DQTL 2R0KL 1UA6H 2VDML 4UT9L 5FXCH 2ORBH 1ND0B 4LASL 3RKDD 1ZV9A 1K8IB 4XMKL 1TCRB 4Q9QH 3M7OA 4F3FB 1KJVA 1TG8A 3NN8A 5J6SA 3EGDA 3HG1A 4Q2ZA 2EXTA 1WICA 3QQNA 1FFPB 1P6FA 4HAFA 4GS7C 3LKPB 4X2UA 4LARH 5T3XH 1YN6B 2E27L 1NL0L 4G6JH 1I8LC 3CE1A 4NQDE 4ZFOA 3U1QA 3EO9L 2F8OA 3KH4A 1E9OA 1PZ5B 5FGCB 5F7DA 5GZOA 5A7EA 1HCZA 4A39A 4HWZB 1WCBB 4PJXA 4M7LH 3RL1B 3DECA 1ZDQA 2YUZA 3OX8B 4JLRA 3VFWA 1HZLA 4XNAA 3DX9A 5DFVC 5BZWB 1UURA 3HB3D 2X3CA 4TULL 3KBEA 1TT6A 5EFIA 4HWUA 2DY2A 4ZFGH 4QJ4B 1QP1A 3QEQD 5PAZA 1JVLA 2DIAA 1IC4L 3D9AL 5DMIL 3ETSA 1JZJA 4MTMA 4ZMNA 1KC5H 1QRNB 1NAMA 2XWRA 5HHPA 1KOAA 1FGNH 2PW2A 3G5XB 4MB1A 2Y06L 2PNDA 4OZHF 1TJHH 4NBYB 3W0WE 2X4NB 3QULA 2VR5A 3OG6B 4R26L 3FUMA 4TLTA 5IBLD 4DVBA 3UYRH 2F2HA 4GQ9L 4DP6X 3MRPB 4F33B 4ZXBA 5EUOE 1KEML 3ECUA 5L8KB 4JKKA 1GVIA 4IDJL 4AYID 1BQUA 3FF8A 1MI5E 1H3UA 3M1OA 5HGAB 3VXNA 2OI9C 2WXMA 3GMPA 3IU3B 4Z7VA 4JY4B 2HKFH 2V8MA 3LRKA 3V9CA 4XOBA 2NXZD 1KCSH 4PJ5D 1DBBL 3MNVB 3D4ZA 1CG9A 1JGLL 5ANHA 2C7UA 3WKNA 1GCFA 5IEKA 3T0VA 2XA3A 2F54B 3V0WL 3OXSB 3VXUD 2EDQA 1N64H 5MENB 2X0WA 2PP8A 5FLUA 3IJEA 3TN0B 2DB8A 1LP9A 2ZWSA 3AXHA 4I3RH 3SPIA 5C70A 4KRPC 3BQUC 3TJEL 3VAEA 4U1MB 8PAZA 3UYPB 2DTMH 1WIPA 2LT9A 2VXQA 4QHPA 4YFDB 5DT1H 5GRWA 2ZXGA 2OSWA 1FNGB 3N1FC 4UV7L 1LK2B 4NYLA 1C1EH 4PJDE 1FV1B 3GXFA 3RGVC 3QCVH 1EMTH 3EJPA 5E6UB 4BFIA 1H6EA 2JJSC 2VERN 1L6PA 3LH2H 4JK0D 4HETA 1UT1A 4AQAB 5FA3A 5CCJA 1I1AA 1JPTH 4FADA 2XG5A 4FXKB 1Z5YD 4W9DC 4E42B 3OC8A 1RHFA 4XCEB 4RMQA 3U1SL 4L05A 2UXGA 3PWLA 5B4MD 4NO5B 3KGRA 3AS1A 5IB4A 3S37H 2VM9A 3IDGA 1A1NB 3EZJB 2UY6B 4QPEA 1SM3L 5D6DA 1YEKH 2CIIB 2OMUA 4JFXA 1YMHA 2NY7H 4LASH 1YUHA 4PRHE 2BVEA 1T1YB 3P73B 4NHUB 2CKBH 3QDJE 4Y89A 4K8RC 4V1DA 2J2ZB 2VH5L 1LVEA 3A6BL 5DLLA 3Q8EA 2CWRA 3TCLB 3BUDA 3LZFH 1NCTA 5K9OB 1F11A 1ZK5A 1U6AH 2YA1A 4J1UA 1TTUA 1B0RB 5D7JC 4KV5E 1AHWB 3ALPA 4P5TD 5D55A 4FI6A 4DCQB 3FT1A 3W82A 4P59L 1TETL 1AS7A 1EGJL 3MROA 4NI3A 2ZX7A 4MQSB 4X6DF 1ACYL 1UADC 4RSYA 1PBYA 4RAVB 5C0NC 1UJTA 2J6EA 3ESVF 3HS9A 3ZE1E 4ZW3A 2K0RA 1D5IL 4ZAKB 2E7HA 3ARBC 4XWOD 3QH3A 5MEOA 1PYWB 3FO9B 1MZYA 4BFEA 5BUGA 5KANI 5FW7A 3JTSB 1CVRA 4BZ2A 3QUYD 5EZOH 1T0MB 4Z7VE 2OR7A 3D7PA 2X87A 5DJ2A 1HINL 2ZTBA 3FU7A 4MXVF 3HC4L 5CJOH 2KPWA 5B22A 4HLEA 4TOYL 2Y06H 4FFWC 5D1ZI 5E8DL 1YYCA 4HWBA 2XX0A 5E6SB 2K8MA 4K2UH 4U4BA 4F57H 4FQHB 3QWRA 4H1LA 3B43A 3BHBA 4FN0A 3FCTA 4GT7A 4WDIB 1MWOA 2D9CA 3X1EA 3EUUA 4OV6F 3RA7H 1T4KB 2O5ZH 3DXAA 4P4KD 3T3PF 4AZ8A 1TITA 1MJUL 1A25A 1D9KB 2PYEE 3T3PE 4XB3A 3MCG1 3IJSB 3ILPA 1AZBA 2XBTA 4CNIA 4Y4HA 2HTLC 1JI1A 3CIAA 4J23A 1IBYA 2DRUA 2H9GB 4H44C 5IVZA 4CW1B 4NJ9H 3PAZA 4EJ1C 2DEXX 3MYJB 5HGBA 3CBJB 2X7LB 3FQTB 1F4WL 4HIXL 4LPYA 3VXQB 5CCHE 1RUAH 3C5JB 2QQKL 3PP4H 1UJ3A 5LNEA 1ZDSA 4BH7B 5CN3A 1S8DB 1TFHA 4OGXL 5DDHA 3HUJF 4PJ8A 2X9YA 3CFKB 5EA0H 4AQEA 5DD3L 1BF5A 3DIDA 1WC7A 1XBRA 1RP9A 2VLLA 4PRHD 3UJIL 1NA8A 3MV9B 1ODUA 3GO1H 4NDMA 4TQIA 3V5HB 4PCKA 4G7VH 2IQAA 5KJRL 2NXYB 5G5DB 1LO4H 4RESB 1JAEA 1T89C 4OVUA 3H9HA 1PX4A 2C5DC 3AM8C 1AGBA 4BRJA 1U8CB 1U8QA 3CHSA 3TN0D 1MRCL 2FLMA 4Q97A 1M42A 1NPJA 1ZVHA 3BISA 3EIFA 5F1IB 1SM3H 4N2LA 3IS1X 3KPSD 3N55A 4IDLA 4ODHL 2NY7L 3U9UA 2YLKA 3DX1A 1S5IH 2VSKB 3KVDD 1MY7A 3QQ4A 4HK0B 4XGZB 4ZFFA 4Q0XL 2YK1H 2FT6A 4QTIH 4X6FA 2EUWA 4IBQA 1XF2A 2IOOA 2BPBA 3BVNB 3GJFA 4CC4C 4P46D 2UYLA 2C34A 3W3BA 1O6SB 1AHWC 3GT6A 3UAJA 2C9PA 2H6PB 3BRDA 1YDPA 2C3XA 1DVFB 1X5AA 4LLWB 1KPVB 1WFIA 4OZHE 4NUQA 2DMBA 1JK9A 5F9DC 2GT9B 5A6MA 3II1A 2XPYA 4K94C 2Y07H 1TVBA 2V9QA 3CFUA 3MJGX 1NCBH 3MLTA 4QUOA 3D39A 1EXUA 4OZIF 4L4TA 3SZ6A 5IOKA 2GBVA 2WZ6A 1TU2A 4RAVA 2W38A 4KUZL 3WI9A 2A9NL 3BXNB 5HI3C 2A38A 1I1FA 5EU3B 1TQCB 1DJXA 2ZUXA 3RX5A 3WN5A 3SGDI 5D1XB 3O3DA 1ZV5A 4UB0L 4JRWA 5FYLD 4MMZC 3CK0H 1PL3A 1X44A 3ULVF 5L4MA 2VLKE 2OJZL 5CJQL 4RZKA 1I8MB 1G7PB 1JZDC 2NY1D 3TH4T 4R97B 1UM4L 2P3YA 4F8QA 2MQCA 3IKKA 3EH4B 4JAMA 1CD0A 2PYED 5C92A 4A7QA 1E4HA 5DJYB 1FIGH 1UG9A 3QPXH 3IN0A 4ZTOH 1MREL 5DEGA 3U25A 4K2UL 1EJ8A 1UACL 3GIZL 3B5TA 4W6XB 4E9VA 4MCZB 1MXDA 5IHUH 1R17A 3F8UB 4N8CL 4PJ7A 3TA3D 2CO3A 2AW2A 2WZ0A 4NRZA 3FB7A 4QRUB 3FSWA 3FUFA 5ABDE 4Z3HA 2J6EL 1XGYL 1FH2A 3LB6D 3DJRA 3U0PA 1IGTB 2YSTA 1ORQB 2H2PD 1S7SB 3I2CH 3QQDB 4JM2F 1I9IL 2ILLA 4JY6B 4AJWA 4JFPB 4NI6A 4OR1A 3QI9C 2Y5TB 3O2VH 1RP8A 3PCYA 3MV9D 1WG3A 3BUBA 4NKDA 5I1CL 3A4FA 3BFQG 1FA4A 1IC4H 3EFOB 4M6OH 5H37G 4U1MA 1KENH 5E0FA 2DJSA 2HRLA 3OKOB 3MBWB 4TSBL 4B9FA 3LY6A 4DF9A 2EDOA 4DP8X 1R3IH 2FGZA 5F7YC 2NUPA 1U8LA 4IRSD 5DD3H 2APSA 2BIMA 1NIDA 4WV1C 3G5VB 4K4KA 3WLWD 4DPCX 4CU8A 5JHDB 4UCFA 4PRPA 1T5WB 3HE6D 1D9KC 1C5CL 1A65A 4YLQT 3T5WA 5IB5A 1I1AB 2P80A 3T09A 4EQ3A 1YNKH 3B2DC 3TYFB 3NFPB 4DGWC 1AVAA 1HSBB 1NLDL 2Z3FA 3KCWA 4X9HA 3O45B 3G5WA 3EBIA 1TEGA 1FVCA 1DQDL 5CGYD 3T08A 1FE8H 1LNUA 2A2QT 1RULH 4ZT1A 5FPIA 3VTAA 4BK5A 1OAYL 1DBBH 4P5MB 4O51B 3LTVA 3R1GL 4K3GA 3QORD 1A3LH 3ZE2F 4HWEH 3GUFA 2OM5A 4Q0XH 4QTIL 5BO1L 1JPEA 2WLLB 4DZBB 2V3FA 4AJ0A 4QHKI 5IZ7A 4G70B 5TDNB 2ZPKL 3DPDA 4JDZB 3HR5A 1IKFH 4WWNA 2QPUA 4Z7UB 1UENA 3M6DA 1XTMA 3HZ3A 4CVXA 4PW9A 2K8QA 2UX6A 4WTZG 3SIKA 4AV0A 3CZLA 1DR9A 3ARXA 2R2EA 4LVHC 5ALCH 1KDJA 4PJ8C 5I5MA 2ZYHA 4YS4A 4GAYA 3HOGA 3DGGA 4Y5XB 4L8DA 1TEYA 3ARUA 7TAAA 3TVMD 2XIBA 4UUJA 5FDWA 1XBDA 4G83A 2G2RB 3U1SH 3OF6D 2AITA 4YNYA 3CFBB 3L3OC 4IU3A 4OTXH 5HHPB 4M7JL 1Y18B 4P3DB 2EXWD 2Z8SA 3VQMA 4BUQA 5EBMA 1E65A 4BA8A 4OCRH 4FFTA 5I6NA 1QLFA 4LCWB 5EU6E 4EDWL 3KWUA 1UM4H 1UZ6F 4Z8FL 3FOMB 4I0CC 4OQTL 1JG9A 4ZODA 1MNUH 2JI2A 5K69A 4X6DA 2OLDA 1GS6X 1GPOH 5IROA 4ZOCA 3VXTA 2F5AL 2VMJA 1F1GA 3FB8B 43C9A 4RNRB 4LP5A 3IFOB 3QR0A 1F6AA 2CO7B 4ONOA 3WFEL 4MAUH 4WO4A 3V4PB 1HL4A 4ONFH 2NUPB 1QD0A 3MX0A 1BW8A 1GHFL 3C6SB 2F74A 3UPRA 3WMQA 4K3JH 1LEGA 5GRVK 1PLCA 3TZVC 1T1ZB 2D3LA 2YPVL 4AYFB 4JE4B 2OQJB 2YN5A 4R97C 3K4ZA 1TIUA 4YE4H 2LFGA 1VGEL 2DWYA 3ABZA 1W2KT 4MXQC 4R90H 3CIQA 3GI8H 3ZE0F 3CFQA 2E9JA 3LV3B 2BM3A 2H41A 2Y7LA 5H94B 5HGGS 4AGPA 3VG9B 4XX5A 3ERXA 3QFDB 4RRPM 4X7FC 4ZYKA 2NY5L 5A2FA 1BYNA 1CT8A 5JPMB 4K7FA 3HW7A 3WKYA 3M1CA 2IAND 1I7ZA 3QAZC 2LFEA 4B60A 4K71C 1DDTA 2CO6B 3KJ4C 4X5XB 4M7KL 1NANH 3KBFA 4AI7A 5D1QC 2X4UB 3T0EE 2VLLB 5TPWH 4GW5A 4RBPH 1P0SE 5E0QA 1KT2B 2FECL 3SSGA 1WAAF 4FQPA 4JR9H 1MFBL 3HNSH 2R69H 1E6OH 4FABH 5DVPA 4WFFE 2PWDA 5E4EC 5F9WC 2ZJSH 4ZUVA 5MP6L 3T0EB 4QNPE 1MW0A 3TPUA 2ZUSA 3LXCA 2X38A 4KAQH 4UTAA 4PJ5A 1IBZA 1ITBB 1X5MA 5GRUL 4PRBA 3WNPA 3WLBA 4XC1H 15C8H 3BCFA 4EUPB 4A2DA 3VG0H 1E2VA 2YGOA 2CO1A 4G8FA 5A6IA 4UTBA 5IR1B 5JIKA 2XTLA 1BV8A 1F97A 4C56D 2J43A 4LCIL 4CILA 4DKFL 6TAAA 3V7AE 2QQNL 2VDRL 3EUDA 3S5LB 4GP5B 1AZVA 2WIIA 2XN9D 4MMXB 4BZYA 5I0DA 2ESVD 3SDXE 4X98B 3AUWB 1I1AC 1KBWA 3NFSH 3KM1A 5CUSL 4MNQD 4WJ5A 2H32B 1DVFA 2WUBH 2ICEC 1PVHA 3VA2C 1SJXA 3TIDA 1SPDA 4PV1C 4GAAA 3Q2VA 4Y5YB 4HGMA 2V5RA 2R0LH 2CLVB 3W81A 3W5NA 3S48A 3M46A 2EZ0C 4W9CC 2GBTA 3UAEA 2VQTA 2F7OA 2WO3B 4JFZL 4LPCA 3GSOA 3IU4H 5F9OH 3VCLB 3IDJA 1LEGB 3L5XH 4X7SL 4GLRH 5JOPE 1JE6A 2DJUA 2JQAA 4PGJA 1ADWA 5DHVA 3Q01A 4PJEB 5H8DA 1MCOH 3VB8A 5AVQB 2DLTA 5T5NF 4FFYA 3VWKD 2CK2A 4ZNCD 1P4LA 4D0BB 4N0CC 4Q56A 5DD1L 5SWSE 1Z5LA 1UWYA 3HVNA 1YCSA 3EYQC 1T7XA 4G7YL 1RJYB 4PGBA 4ANUA 4LSPH 4WGKA 3VXTB 2AJVL 4XCYA 4KVCH 3CU7A 4Y19E 3DX8B 4JGMA 4LLDB 2WCGA 3AG2B 4I89A 5EC1A 4J5VA 3MA9H 3WTYA 4YBLC 1P6AB 3O4LB 3QZOA 4K8RD 3J2PA 2R39A 5AW9B 4ZXBC 3P9LA 1ZVSA 4FFVD 3C60A 1I3RA 4WI5A 2HFGL 1T83C 4N5ED 1LO3H 1PX3A 2NW2A 2R23B 4L0PB 4PB0L 4QAWA 5HD8C 5C0DA 3RWGB 1NCBL 2GITB 2CIKA 1S9VA 4TULH 1WLHA 3U30C 4XVOA 5JLZA 1HU8A 5AD0B 2ZXWB 1XCTB 4M48L 1Q94B 3TIEB 5K59E 3RZCB 5T5NG 2Q76A 2P45B 3HG1D 1NCUA 1JIBA 4R3SB 3ARBD 1WAEA 2DLHA 3MRBB 2H0EA 3ZIYA 4ABVA 4UF7C 4PJAF 1OLZA 2OJZH 5CJQH 5I1KL 1A7NL 5DJAA 5HDQH 1NAKL 2LU3A 2Q6WA 2A99A 1CFTA 1U0QA 3MVSA 3SQBB 4LSUH 5JMOC 4ZBJA 2XZCL 5E00A 3UCRA 3S35X 2ITCA 2Q0ZX 1RZKC 2BVTA 3FHAA 2BXZA 2LE9A 3QA3A 1S9YB 3DETC 2YPLB 2NY2D 5HDLA 1I8LA 1UT2A 3H1ZA 1NINA 3BPNC 3IJ9A 3P0YL 4P23B 2WQSA 4H26B 4KROC 4RMVA 4BCXA 1KCSL 3MDJA 1MDTA 3JWNC 3MCKB 2NXZC 1LWRA 1CD9B 2C3VB 2VXSL 2XZAL 3HMXH 3O45A 4TMPA 4X9BA 1AZRA 3QR1A 1NMAH 3QWOB 3CVBA 1J1OH 1OAKL 4LDEB 3LZLA 3H0TB 4XCNB 5T1MB 1B90A 3VQ1C 1M9WA 1RZGB 2P44B 1NWPA 2WBKA 3QUYC 1FH5L 2DWDA 2FEDD 4MSWB 1LILA 3V6OE 3O3AB 4YHLH 4L9LB 4CC1A 4FXKA 3PAUA 4ENEC 1U3JA 1EZVY 3NMEA 2DJMA 4N5EC 1UJ3B 1J1XL 3ULUC 2G75B 5DJ6A 4N24A 3FUNA 1VEMA 3TTYA 2DBJA 5GS3A 1BPVA 1VEOA 3BW9B 4IM8A 2NY6C 2Z4QA 4OFKA 4PWHA 3BUYA 2ADJA 1RU9H 3QIWD 2DDQL 4KUCF 3O3DB 1WFUA 3REWA 2NDGA 4PMFA 4QT5A 4XP4H 1C5CH 3QBTB 1F3DH 5T1KB 5E2VL 1FLRH 3DBXA 3L3IA 4XNUL 5HDRA 1H6UA 3W39B 3BPOB 2P42B 4UM9A 1IAIL 3R7RA 4KK9D 1IAII 5C0JA 4Q6IA 1FSKB 3VXUA 1NCHA 2A83A 4MA1C 1JK9B 2OA9A 5DO2D 1BFVH 2V5TA 5JHLH 5DJ0A 3WO3B 2IFFH 4I9WD 2XPZA 3BP7A 2YBRA 2C1OA 3VYOA 3JBG7 4NUGH 4D2NA 5J6HB 4WAFA 4NXSA 4R4BB 3VD9A 3EJUA 4LSPL 3LXUX 2UZYB 3CDGA 4IOSA 4O02H 4G9DA 5G2NA 3MRMB 3ULUE 1QRNE 4QDGA 2FJGB 4XVTL 4KROD 3W1ZA 2BVOB 3F85A 2QGBA 5JPNA 4G80B 1JRHL 1S9WA 1ACYH 1PCXA 1KJMB 3NIDB 3NG5A 1SJVA 4U6XB 3BDXA 2YBGA 3AG1B 1I1FB 5EU3A 1XGQA 4XXWC 2ZAHA 1Z1WA 1AQDA 4RSVA 4YHIA 5HVGB 2BCKA 1KPUA 5D1QE 1O5DT 1PEZA 4LSVH 3H8NA 4Y16C 5J56B 3QEGH 1CG9B 4NP4L 1YPZA 2VW7A 2E9GA 3LMJH 2BZCA 1EZUA 2ZP8A 3F12B 4MJ5B 1OGAA 1MJJA 3UTSD 4H25A 5I8OH 4WQOA 3MLUL 4JFFB 3SYOA 5E8DH 1SEQL 4FXGB 3OKNB 3VFGL 1R47A 1VACA 2VO5A 4OQTH 5C0AE 3F5WB 1KPRB 3UAJD 3IJHA 1SXSA 1QQDA 2OP4L 2WY3B 3MJ9A 3T8VA 5AB1A 4QRQA 4H8UA 3GLDA 3P3RA 1A6UL 2H9GA 2F7IA 3PXJA 4AVKA 1KFGA 4JDVB 3V0DA 1CICA 1FPTL 2W65B 2ZNWA 3GQFA 2TRYA 3UBXI 3F12A 1Q9KA 3OPUA 4PJBA 4PJEE 4WU7B 2MTAA 3ZBMA 5I2IA 2IBZY 3TBYA 1BWMA 4K3EL 1HL8A 3IN2A 3GMQA 1E43A 4TL4A 3QJFB 4B27A 3RY5A 2HT2C 2HJFA 2OCJA 3TONA 4JANB 3I6GA 2W60B 1UWXH 1U91A 2A6DB 2AABH 1TTFA 2JVUA 1LDPL 4KO6A 5FA4B 3MV9A 5ETUB 3VW3L 1OTSD 3QHFL 5AVUB 4YZWA 4R6UA 4PJ9D 4W81A 3P30H 1I53A 2VDOH 2WXRA 4JQVA 5KSUB 4XTRC 3QUZD 4P3CL 4J6RH 1FZJA 2W9DL 3RI5K 3EFDH 1I8IB 3MV7E 3UJIH 5D8JH 1JFQH 3SY0B 5C97A 4Y2NA 3SQOH 3NZSA 4JW3A 3LQMA 4G7VL 1RZKH 1Z9LA 4B7IA 5GRVL 1KY7A 1EEUA 1I3VA 5GJTL 5EUKA 4KJQC 1D7CA 1SY6L 3KEDA 4XCFH 1MCWM 4TXVB 5DEFA 3RVXD 4WI4A 3FSVA 4E68A 5ADOL 4KK6C 2UYLB 1MHHB 3UJTH 4DGUA 4Z7OF 2GC4C 3VCLA 3S2CA 5CJBA 5KEZA 1ADQL 5DEZA 4YZFE 3QDGD 1NAMH 1JDCA 3F7YA 5E2WL 1DYZA 2G9HA 1U8OB 2BMKA 4N2CA 4CN1A 2QKIA 3IRCA 3GSNH 1QBAA 4X9YA 2BVUA 2G2RA 3ZU8A 2CKBB 2QQNH 2VDRH 1CMOA 3V6OC 5DA0B 5TE7H 1AZUA 3WUWA 2NQCA 2FO1A 3DRTB 2CA4A 2LV4A 2CDFA 1NKGA 4JJ5A 2H4EA 4M5ZH 4OGQC 5CEXB 2IALB 3DMMD 2O72A 3CHQA 3NZHL 3GRWA 5LDSA 5KYUA 4M7LL 2XG4A 4IJ3C 4NQDB 1VKXA 5E9DA 3QG7H 2YS4A 2PWFA 2AXFB 3TVMA 2HLFC 3SDAD 1H3TA 5C09B 5CAYB 4B5EA 3TH3T 3ZDYE 2G60H 3OHXC 2W07A 2A0LD 4OKVB 4GBXA 4M4RA 2YAPA 3FO0L 2PCPA 5B8CB 4DGIH 4MMYB 3VXPB 1GZHC 2VRQA 4A7VA 4PJHE 1NCCL 4WEBL 3V0VB 3SKUD 4CW1A 2BVQB 2VR3A 1BAGA 3P4MA 1IC7H 2EDHA 4RLDA 4UNVA 3QHTC 4I13B 4AEHH 5D2LF 4Q9RL 1LMIA 1B2YA 2DYPB 3WEXA 3D50A 2B08A 5TQ0L 4RISH 2P49B 4C47A 1KY6A 4KRMB 1TYJA 1OQOA 3NEEA 4BGDA 3MSPA 2OP4H 1BVLB 2PPAA 4KVCL 3MGTB 25C8L 1QACA 3V10A 1AD0A 4AMWA 3UO8B 2WJ7A 2MOVA 2ZKHH 3ENEA 4NO2B 2CIIA 1NTDA 1PG7X 3C8KB 3QFJB 4JN2B 4CDHA 4GG8A 3FQNA 4EI6A 4CADA 4HSAC 2R1WA 2PCYA 3MPCA 1U95B 3AWEA 3GMPB 1WUNT 4ZPVB 1QKZL 3AITA 1L0YA 2O4EA 4I2XB 3AG3B 2XN2A 5DHYA 2OK0L 3RPIB 3TU6A 4AYFA 4E42A 2V9RA 4FQXD 5DZJA 4F92B 1TEFA 1PQZB 4BQCA 5JW4R 1VADA 1QVOB 3L45A 2CCWA 4UZGA 3MHZA 5B39A 3IGFA 1OQXA 3RWIB 3VD4A 3AUVA 4LFHD 4LK4A 1M57B 5I76A 5K33A 2Y5QA 2CCVA 3V5KB 5MI0B 3O0RL 4WEEA 1NBYA 4ZO7A 5J1TC 3P4OB 2MHAA 4LAJH 4LSUL 4WCYL 5M7QA 1YEGH 5F6IB 5IW6A 5C0AB 1VFBB 1RZKL 1JZ7A 3STBA 1LD9A 2OMTB 3EBGA 3LRHA 2BOLA 2JB6A 1X9RA 4O4YL 1JF5A 4HHAA 5D7SH 4APQA 4KKZA 4N4YB 4CSSA 1T66C 4J1UB 3V7MA 4F8LA 4JB9H 3UBXA 1L7IL 4GO9A 2O6EA 3P0YH 4FQ1H 1GGIH 1E5AA 1SJHA 4R84A 1GZPA 4PWIA 4R7DA 1YEKL 1OAYH 3HZYB 5DC4B 2R83A 3PG2A 4NQVB 2XZAH 3IT8D 4XTRD 2ENPA 5DQDL 3ABGA 1RVFL 5FB8B 2OQJA 2VDOB 1G1YA 4JO4H 3WYRA 2PTTA 4N25A 5J6HA 2CKBA 1JI2A 2CNYA 2DTSA 3GSUB 4JZJC 4LLVA 4NSKA 4PU2A 2MQ3A 4PP2A 1KTDA 4R4ND 3V52L 2VMFA 3S98A 5GSVA 4JFEA 1UWGL 4JY5H 1HOCA 1U92A 1XF1A 1P1ZA 3CFIC 5EIVA 1V7ML 5CEYA 1EGJH 5BV7B 3VVWA 4N8UA 5FK9A 5ERWB 5EFIB 1Q4NX 3A5VA 1AKPA 1EO5A 3OHXB 4Z3GA 1BX2A 4C57C 4IKNA 4LLVB 4TNVF 5E1HB 4MAYC 5EF2A 1A2YB 1HQ4B 4N2HA 5HHVH 4Y4HD 1NPUA 4U1LA 1UXWA 2IAMD 3C6LA 1HS6A 4GMSL 3UYPA 4LF3B 4D8PB 4MRBA 2AQ2A 1HDMA 1N59B 2WBJA 3BPNB 4P23C 3QA3B 1DFXA 1OGAD 4N2MA 4ILDA 3CH8A 4NQTA 4G7SB 3RVTD 2AQ1A 3KZ8A 3ARGA 2ALWA 3OWEA 3A6CL 5C09A 4GW5B 4L9DA 1L3NA 2JFCA 3QUKB 1NBQA 3HI5H 3LSOB 5F88A 1U36A 5E6ID 1LMKA 3PWLB 2XWZA 4A7SA 1F4XH 1G7HB 3LEXB 5AKSA 1P6WA 3ZR5A 4ABWA 3CFKA 4LOFA 4J27A 1YY9D 3FNKA 4PCTA 1ETZA 2HLAB 3VGDA 2ODIA 4FQJH 2AJYH 3JWDC 2J8OA 5HPMB 4DN3H 5HJ3A 3SE4A 1D6EB 2DQHH 4ZDHB 4NC1C 1F18A 3S6CA 3ELAT 2A1WH 2HVJA 1TJMA 5AENA 3F83A 4QRSA 1RUAL 1CF8L 1WZMA 1CN4A 1ZPUA 2HRHA 1CLYL 4KKAD 1JGDB 1Y0LB 4A37A 4XNYH 4AWJC 1V55B 3HRZB 1KWKA 1DVYA 3I50H 1CDUA 2WVVA 5HHME 1RJYA 4PGBB 4Z7UF 4GG6E 5B7FA 5MERA 5TF0A 3D87B 4O58L 3U1PA 5JHLA 2E7BA 1HNYA 3UPCA 1U8NB 5TDOB 2NQDA 5EN2A 2ZOUA 3W9DB 2HZHA 3EG9B 1Y0LA 4C4KT 1XVSA 1Y6MR 3LH8A 1TQTA 9CGTA 5L8LB 4OJAA 4UYQA 1MG3C 4B9IA 2NW2B 2R23A 2BNRE 4JB9L 1CGSH 4LDCA 3WFDL 2AHIA 4EI5A 4CUCA 1OGPA 3JV6B 3ARDA 3MV01 1DL7L 2EZ0D 4EIZC 1HQ4A 4K3EH 3RFRA 3WFBH 1YG9A 3Q05A 3QG6B 1F1DA 4YDVB 4TNEA 3NEOA 2YK1L 5I1EL 2NDFA 4YFLF 4LL1A 1BF2A 5ADPH 4RGNB 4G7QB 5FGCE 3RX8A 1A1MA 2B1OA 3D3VE 3L54A 2DQFA 4NRZB 3NFSL 1LJMA 5GGVY 3VXMA 5C2BH 3VGAC 3V79C 1S7VA 3WHE0 4YC2C 2BS9A 3VI4F 5B1AB 3NIDF 3PYCA 3WGUB 2I32A 4OFIA 3HFMH 2NY2C 4LSSH 4UILH 4WEUD 5CMAB 4AQOA 5B3JF 3QZPA 3EFFA 4XODA 2ZCHL 4AUJA 2ADGB 1S9KC 1G7QB 3DTXA 1OD9A 1T1XB 2HKAA 1PG7W 3EYUL 1EFQA 4MKTA 4MWFB 3C6SA 3JVFC 2P48B 1QEWB 4LPWA 2O61A 4JKMA 4L2LA 4FG4A 2C3WA 4KWUA 4NIKB 4P2QD 4Y5VB 3HJ0A 4PVMA 5F7NC 2WQXA 4DQOL 4OI7A 1HI6B 5I26A 2ZYIA 5HHQA 4PGEA 2JJUA 3RWFA 3GSRB 5AG8A 3UGXA 2CKBL 1E67A 4XWGL 1Z0NA 3CN1A 1AHMA 5IB4B 2PTVA 3RURA 4IBSA 3A67H 2R56L 4L48A 3CUPB 1CDJA 1T21B 3RDTA 3GIZH 3MUGB 1S5HB 4O2EA 1V7NH 4FQIH 2G4EA 4QOKA 4AW4A 5D1XD 1UVQA 2NRDA 4ZZFA 5E1IA 4BFIB 1RHHB 4MDIB 4X4XA 2AEPH 5AW0B 1R34A 5IEHB 1XGRB 2H3XC 4Z7OE 1XQ4A 2XV0A 1CFBA 1FFNA 4QHLB 5HGBB 1KT2A 2NY3C 2XXCB 4GAJH 3SOTA 1M53A 5BVJA 1KIUB 4HGWB 1P9MC 3KYNB 3BZ5A 1HEHC 5SWSA 1R1CA 4B96A 5SV4A 5J4MA 1B88A 2IXQA 1NGQL 2V7NB 3HZMA 1P5UC 4QHUA 5E94A 2JJTC 1WRFA 4KVPA 4WZ9A 3HE6B 5ICZB 1CLZH 2YUXA 3AGVA 3CLEL 2D0FA 3O6FD 4ZOAA 1H5BA 5TFSL 3GXDA 1O6TA 1UT9A 3G6AA 5E51A 2FNBA 2CALA 5JYMA 2R9HD 3PGCA 1HZHL 4OLYH 1BOGA 1ETJA 4UDTA 2ZZUT 4KKPA 3BZDA 5TQ0H 4AC2A 2AEOA 5FUZH 3NABL 5E95B 4LVOB 3KLAA 2IBBA 2I69A 3FH5A 4RA0C 3RAJH 2GBAA 4IHBA 4LEOB 3UTTE 2W92A 5E8EA 2ENQA 3FHEA 1B9ZA 2QSVA 3EO1A 4JPKH 3R06B 1M1XA 1W0WB 5GISL 3V4PH 4EI5D 3OJMB 1YEFL 3ASNB 3G3LA 2DWSA 4YX2H 4HXAL 4JPWH 2GSIA 4GAYB 2HVKA 3O2DL 4JDTL 4HS6A 1NC2B 3FW6A 1IKNA 1EJ6A 2WK2A 2WUCH 4XE0A 4JNXA 2BY2A 2JE8A 3BQVA 1A7OL 2H3KA 1O9VA 4KHXH 5TGBA 5JR1L 2UVEA 2DQFB 4U3HA 4C4BA 4DAGL 4LOUD 2NUTB 3ROLA 4F15B 5C2BL 2DBLH 1D3CA 2BSRA 5LWYH 1QSFE 1UB5A 3P3TA 2A9BA 4PN6A 2BFVH 1PSKL 4P9HC 2BO0A 4ZX6A 4B0MM 4HV8B 2PETA 4BV1A 1A7PL 4EKJA 1BIIA 2BSSB 2QVIA 4PP1D 5LCVA 4YDLB 5IHHA 4GUPB 1OP5H 3S5LG 4OZ4B 4OTXL 3D2UA 3QO0A 5C07E 4TUJB 1BFVL 4JQXC 4W6YB 1ZLWH 2C4FU 2Z6FA 5F7FA 4EN3C 3D30A 4DGYL 1U8MA 2EDNA 1WFJA 5I9QB 3CX2A 4JREC 3E1ZA 4FQHA 1VCAA 5FEBA 5DQJB 3GTNA 3T0WA 4NBXB 2ERJB 4U6XA 5KSVB 3QZMA 1M7IB 5IW1A 2WSPA 5LGJA 1WS7A 2ESVB 2HN7B