1J8RA

Binary complex of the papg receptor-binding domain bound to gbo4 receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords PYELONEPHRITIC ADHESIN
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 1j8rA00
1J8RA 4Z3FA 4Z3JA 4Z3HA 4Z3EA 4Z3GA 1J8SA 4Z3IA
chains in the Genus database with same CATH superfamily
5L2JB 5EEZA 4N0YL 3LXBA 2WZPA 3V55A 1NCGA 3CDFA 1NOFA 1F6FB 4EF3A 1NGPL 2YA0A 3T77A 2DBLH 2BZCA 2ZKHH 5BZDA 1E5CA 4QO1B 3H3PL 1MWAL 1SVBA 1MDTA 1W8NA 3IMRA 3LQAL 4HAGA 4HZLA 3B2PA 3BUIA 3S96B 3F05A 2E9GA 1FNHA 2CIKA 2P80D 4FQCH 4J28A 2FSEA 2J6WA 2HKHH 5I1DB 4FTVE 3L3KA 3KPQA 5DHYA 3Q8EA 5T3ZL 4OZIA 1QI4A 3MOBH 2OTPA 2XZQL 3S4SA 4LPUA 4JX0A 2Q10A 2R2EB 2WPGA 3QDHA 3EJRA 4TOYL 2PN5A 5EUKA 2ADFH 5DRZA 3WIAA 3ZKMD 2P3YA 1ZV2A 5F1KC 1NCHA 3U2SB 2IBBA 4Q14A 4I3RH 5MEND 4MJID 1K8DA 1DN0A 2QQQA 2IPKB 4MMXC 5DZJA 3DO4A 4JUSA 1BFVL 3EFFA 3NSCA 2WLLA 3PF2A 3GSRB 3TTSA 2DH2A 4MJ2A 1QA9B 2ZAIA 4NRZB 5A2KH 1MFAH 4JRXD 4AM0A 3FB5A 3D85B 5BOPA 3RDTA 1RHHB 4OJEH 2XN9E 4IGBC 3ZSTA 4G6JL 4GQQA 3BC9A 3G9VA 5C08B 4AGMA 1BJ1J 1MSPA 1QX1A 3UABA 4MKTA 3MRPA 5D2NC 2BS71 3VG0L 5D1XD 3VO0A 5C9KA 3VA6A 2WMPA 4FCAA 2WYHA 3S98A 5F89B 3TZVC 1DDHA 3AU1B 3PUCA 3OJ2C 1UUSA 1KJVB 3NDZE 4HWEL 1PZUB 2VR3A 3WNPA 1YECL 1L9QA 2OMTA 3SN6N 1N8OE 4NKOA 2C7FA 4HUXA 1MFCH 2R15A 5C8JB 2XZQH 3WXVH 2CUAA 2WXOA 5BRQA 3VAEA 3ZPDA 3QHFL 5HDOA 2FD6H 1WJ3A 3DMMA 1U8CA 4UM8A 1UWXH 1U21A 3BQVA 4I88A 5JIHA 4FTVB 1D9KD 3OKEA 4WTZG 2WLNA 2WUBL 2WVVA 4NQXA 3MNZB 2AAVA 4FG2A 1RI8A 1D7DA 4P9HH 2IOOA 2IQ9L 3KW8A 3L1EA 3ME0B 4MNQA 1QUPA 1AACA 4WCYH 3FCUB 3ISRA 2AGJH 2R0WL 2CAKA 5EEYA 3BPCA 4L4VA 2Y1AA 3ARFA 4GAJH 1FC2D 2A6KB 2HAZA 2XIIA 4FFTA 3ZDZB 1RJYA 1AY1H 4M5YH 4K3DL 2BP8A 3QORC 1H3TA 1U8MA 2BVEA 3EHBC 3PL6B 3S3JA 3VFRB 3D0VA 3NJKA 3RU8L 4AYID 1MCFA 1LP9B 4PRPA 3WEBA 5I6NA 3T1FB 1J5HA 3QNYB 5MP6L 4KK6D 5I24A 2AABH 2DQUH 2XFXA 1VFUA 1LO2H 2WM0A 3HW7A 2QSCL 2N1TE 5DK0A 4NUMA 1L9SA 2NY6B 1VZIA 4ZFZB 1BQHG 5J9PB 4F9LC 4H26B 1TUPA 3SODB 3ZE1B 3WXVL 1U2HA 4H7VA 1HHGA 1QSED 4AQ1C 1MFEL 4L8SC 3AS2A 4ORGA 4BK5C 3VRLE 4DP6X 5GS0L 3IDGA 1FFNB 3ZQXA 1TXKA 3P9WB 5HJDA 2FB4H 2R8SL 1J87A 1FZJB 2IDCA 3JVGC 2X4OB 1WBYB 1WG3A 4HLZG 5CCGE 1MW0A 4YHIA 3QO1A 4N6RB 3AB0B 2WQUA 3BQUB 4GSDH 1E4KA 2NNAB 5C0EA 3ZYIA 3G5XA 3IDJB 3ZT5A 5EF2A 1UEYA 3I6GA 1RULL 1CDIA 2EDDA 4M8RA 4O2CB 3VYNA 1R5IB 1AFVL 1UHVA 1XF3B 3VWKD 1RZIA 1NUNB 1L0QA 4PR5B 3MJWA 4XZ4A 2X42A 1XCTA 2Y6TE 4X7SL 3CC5B 1FIGL 1KB3A 2GUOA 2J57A 3BJLA 3U7YL 1B4LA 3IFOB 4MA1B 1DZBA 1T03H 3TBWA 4UIKH 5J6SA 1KG0B 4YSRA 2Z91B 4NUGH 1BFSA 1HSBB 2EVIA 3WFBL 1EHKB 5EB9A 2KKQA 2YPVA 4C57C 2VDOH 4ZODA 4HWNA 3QDGB 3UZEC 1Z9SA 5J1TC 2WANA 3VWKA 5BRZE 1NBYA 3D39D 4XNMA 2AXFB 4HSAC 4KVCL 4OIBA 4Z7VA 1G1OA 3BIKA 1OANA 3WNOA 5ID0A 4JM2F 1OB1B 5DUBB 4KO5A 1YVLA 3WIHL 4NUPA 1Z0MA 1GS7A 2IBGA 4HIHB 2CM5A 5FYJD 5C3TA 5AALA 2D9CA 1JZGA 2E56A 4V11A 1JBJA 4JVPA 1MG2C 2F58L 3OKMA 5KYUA 2A9ML 2KUTA 3H9SB 4B9FA 2A2QT 1KCKA 4NHUB 3KLKA 4A39A 1AIZA 5I74C 5L2JA 3QHZH 1L6ZA 1OAYH 4P59H 1PY9A 4L5FL 4D2NA 1A14L 2IC2A 3KR3L 4X4XA 5I19H 3RNKB 5GISH 3IFLH 2GTZA 5GGTH 3UXFA 1W72L 3PGFL 1DCLA 1PZSA 2IH3A 5JYLA 1QBBA 4KAQL 4HK0A 2WYZA 1OSZA 3MJ7B 3RVVD 3LRKA 3BKJL 5C09A 4WW2C 1QBMH 3EFOB 3GT6A 5LBSL 2LFGA 4GH7B 1NCBL 3BW9A 3ZTNL 4XN4A 1WISA 2EZ0C 2VAJA 3AFLA 4P5RA 2O6PA 3K46A 3NJNA 3OJDB 5GRUH 1N64L 3ULSA 3W9DA 2BMKA 1U8JA 4PUBL 4TUUA 4GXUN 4U4BA 2N7BA 2CHZA 5CR1A 3O41B 1HL8A 1M3IA 4XN5A 3HAEH 5ESQA 5LLIC 2A4EA 5F1NB 2WK2A 2X70B 4MJIE 4X4MA 5IQ9A 4CVZA 1YQ2A 3V95A 2VR6A 4LOUD 3SKNB 3BDXA 3FB5B 4QTIH 4UTBL 5H35B 2JCWA 2A9NH 5DJZA 3HS0B 4PCYA 3WS6A 1CO1A 2EIMB 1B4RA 3ZDYF 3S5LG 4N3TA 2BRRL 3B56A 3NJFA 4ZUSA 4ANUA 5HD8C 5KUKA 4QJ4B 5AVWB 2XN9D 2X12A 3ROOB 4GIPD 5IK3A 3MJ9A 5AKVA 1EO8H 4ZX6A 5CEZE 2EE2A 4J2QA 2AF2A 2OSLB 5CZXD 4XBMA 2YQ3A 1VACA 5GHWL 4Z7OE 1I7UA 4U1HA 4ZUVB 1DEEA 3ULVH 5E08L 2YO3A 3GK8L 3MLSH 5BV7L 4G9FE 4FQPA 3PP4L 4Y4HC 4URKA 3CIAA 2X6VA 4TKWA 1BAWA 3N41F 4JFSA 1G6RA 4LNRB 5IQ7H 2WVVB 1CZ8L 4TLSA 1LGVA 1QZNA 3AUVA 3A6CH 4PP1D 3IXAA 4P23B 4WFFE 3BPCB 5C0JB 3NK4A 2WCSA 1OHZA 4X7EC 5DJ2A 4N2NA 5AVTB 1H3XA 4I2XA 4PRDA 1SUHA 3DK0A 1XF2A 2BP8B 1UJTA 5B3JF 5CUSH 1U58A 4F7PA 3FPYA 1BF2A 4HXBH 2EDWA 1A2YB 4KVNL 3ATFA 4S0TD 5EU4B 2X9ZA 4YXHH 2E7LA 2W9DH 3HVDA 1OP3H 4L8DA 4PJIF 3CXDH 4GKSB 2EXYD 3VTAA 2FH8A 3KCPB 3P73A 4K3DH 4AL8L 3VW3L 4YFDB 3FQTA 5K33A 4YSUA 3U1SL 1LEIB 1IILE 4QRSA 4IOFD 4P4KD 4LCWA 3V6OE 3LXCA 4FXKA 4X6CE 3MN8A 2PCPA 2C9VA 2NR6D 4HIXL 3BZDA 4D3CH 3DI3B 4LKXA 3OB0K 4LO9A 4PRID 2YBRB 2OMUB 4P4KB 2WB7A 4HUUA 1E3FA 2EVJA 4HT1L 4RGND 3JV5A 3VB9A 4RBPK 2A77L 5IP4A 3C2AL 2GBTA 4CRPA 1F4WH 4WKZA 3U36B 5K9QI 4KMTL 4Y4KD 1ACCA 2DQMA 4N90D 1YYLH 1OP4A 4MMXB 5T33H 2WNGA 5EU3B 3ARFB 3GSOA 2I9LA 4I0PA 3MCG1 4HK3N 4N8CL 2MH4A 1BGXH 3Q2CA 1FVDB 5EUKB 4XAKD 5HVFB 5I1CL 1TTCA 1KGIA 4GRLB 4ZTOL 5F21B 3WNJA 1XSJA 3D25A 3MRGA 2PW2B 2B16A 2Y6SC 4RIRB 3S3SA 5K9QG 1FYTA 3D7PA 2XFXB 1P9MC 3O6ML 3CFCH 3KS0J 4AMXA 3BVNA 4OIFA 3DUHA 3GMMA 1BD2A 5KSBB 5DK2B 3DX8A 1BQHA 4R83A 3B5HA 3MRJB 4AYGA 1W8OA 3E9TA 1YEGL 4K8RL 5BQ7A 1OAZH 2K6WA 3U6RA 1PFOA 4FNUA 4XP1H 1OLLA 1ASQA 3AREA 1HE8A 5L2KA 2B8OT 4YDKL 5B3JE 4MB1A 2FECL 1MHCB 2J12B 5HHOE 2EKSB 3BMVA 1U93A 2P7TA 3APCA 4L48A 5AZ2H 1RZQA 2BFVH 2I25N 2DI8A 3HE7D 3HZMB 5IVZA 1P6FA 3ZGIA 3KVDD 4HWBA 5ESVA 2B1HL 1P4BH 1ZA6A 3BIKB 4O2CA 3MRFA 3KNBA 4QKXB 5L7XH 1MWAA 2NR6C 2CO7B 2XA3A 4I89A 3ZMEA 5C0IA 2H32B 3MBXH 3P4MA 4DGYL 4E5XB 3O6FC 1A7PH 3WFDH 3G6JF 5CD5C 1N5YL 3QEQD 1OPGL 2BOCB 4Q9QL 3CHSA 1DJWA 2X53A 3D07A 4XN1A 4BRJA 3FJTA 4NQEB 3CFBA 4TLTA 1MVUA 1NC2D 4M7ZB 4HPYL 2NLJB 4WV1C 3WJLC 5CSBA 2B77A 1XGPA 5JHDA 3ET9F 3NCBB 4IM8A 3VWJD 1TZAA 1RZJL 2YD9A 3T6WA 1P2CA 4JL1A 3WEOA 4I5BB 1XGYL 1J18A 5SWSB 2DYSB 3HC4L 3S0PA 4NHCL 1JMZA 2OZ4H 3HS8A 4JQXA 2IDFA 1KTLB 2PP8A 3O8XA 3TASA 1YC8A 1HXMA 2QEJA 2UX6A 3ARVA 5I1IH 1MCRA 2BMKB 4KNTA 1AQHA 1VHPA 1I3GL 3ES6A 4ORGB 1NGZA 4X9HA 5E2UH 1O75A 3QPKA 4LT7A 5IB4A 3RVWC 1QP1A 2DM4A 3G5YA 1GJUA 1OARL 5F97E 3C9NB 5GRUL 4HT1H 4KDTA 4U1GB 5HVGB 3UO1H 3VSVA 2X4PA 4F3FB 1LWJA 2GYSA 1UKTA 3OQ3B 2VRKA 4LSSL 1A3RH 1V55B 1DQLH 3MXVL 1MNUH 4M6MH 4OM0L 3B7SA 2UZIL 3WTWA 2O61B 2ZYSA 3GS0A 5JHLH 1BAFL 3FU7B 2AQPA 4RH4A 4UAOC 3MJ8B 4WU7B 2A9BA 5IBUG 4QEGA 4LDEB 2A83A 3CZFB 3V10A 4XX5A 5GGQL 3IF1A 3SKOA 12E8L 4NKIH 4WWKB 4N5ED 5E0QA 2HFTA 4MAUL 3PL6D 1F00I 3BW9B 5I19L 3JTTB 2GUOB 3GNMH 2EVFA 3FSOA 1DUZB 3FT3A 4UT9L 1AD0A 5CEZD 4TSAH 2B4CC 4H25B 1WZ1L 3RTQC 5HPMB 4ZFFB 1KJ2L 2HPTA 1I8IA 2EADA 2G60L 3WGUB 3BKCH 1QSZA 3QUMA 4X5WA 1R3HA 2UY6B 4AQ8C 5SWSE 4G9FD 43CAB 1AE6H 1W9XA 2QQLH 1CGYA 2B7DT 4Y4FA 1QTYT 3WJJA 3F2LA 1IEAA 2H47C 1NMBL 4NYLA 1E8ZA 1HCFX 2FLRT 1X5MA 4BK4A 5F7HA 2XX1A 3K81A 4GQRA 1DJXA 4P2OC 1IEBA 5DJZB 3IDXL 3ARGA 4LU5L 5JMOC 1YUHA 1GJWA 1G9NH 1KFAL 3P02A 3TJEH 3F7VA 5JQIB 2FUTA 3BGMA 3JTSA 3RUGA 2GITB 2FLBT 1PKQA 4L8DB 4FL4C 3A3YB 2J8OA 2H1XA 4TF4A 3RVWD 5D93C 1GY1A 3GI8L 4K7FA 1UM4H 2OSXA 3AJ7A 1AGEB 3GBDA 3K6IA 4ODVL 1I7UB 3GSNL 4U1HB 2EEFA 4ZUVA 3FUDA 3OGCA 4PRHD 4F5CE 3QUZB 3VQMA 3IXTB 3U2JA 1XGQB 3OTTA 4PJBB 5GQBA 4NJ9L 1D3CA 4DW2H 1FVCA 2O72A 1NFIA 2XTSA 2K8QA 5D7LE 4M5ZH 4KKNA 2YN5A 1EUUA 1D5XA 3D30A 2X3BA 2Z7ZA 4OCWL 4PB9L 3QJFB 3QJHA 1IAKB 4ODUB 1ROWA 1BSIA 2QSQA 2WUCH 4ODWA 3AMKA 5AW3B 5KSBF 1F1AA 1KJ3H 4I0PB 4TQHA 3GSWB 2VXVL 2YEZA 4HGKC 2NX5A 5KYYB 3GHBL 4FNPA 1AGCA 3CQPA 3D39B 5CO1A 4ZQKB 4A6YA 2Y7OA 1FNGA 3S8GB 3TJEL 2DQIH 2E7CA 1NMAL 1UT9A 2F2HA 1NSNL 2DQGH 2DQJH 2VLRD 3BVNB 4RNRA 3WNLA 1C1EL 4GUPB 4BCYA 3FFOA 1ACZA 4X4YB 1CB4A 1NMCB 1ZLUK 4TV3A 4L29A 3APFA 5HGGS 3SCMD 4M5SA 2EH8L 2B1OA 1OY3B 1AGFA 2QSCH 4CL7A 2AJZA 1JNLL 4LSQL 1RK1A 2ITDA 4AJYV 2KDYA 3MRRB 4QY8B 3PWPD 4DTGH 5K9KB 1SVCP 3T4AA 4CKVX 3NTCL 1Q72H 4GRWE 4IHOB 4B9PA 1ORQA 1S7TA 4TNEA 3QIBB 3O6FB 1IQDB 2E76C 2HRHA 4HYTB 7CGTA 1EEYA 4NKDA 3UPRB 1CT8B 3F85A 1HC1A 2NY1B 4TQ8A 1P6AB 3X11A 1DR9A 2NXZD 4HUCA 4LFHG 5HHOD 2JNZA 12E8H 3UTSD 3TCTA 3VRIB 5KTEL 1HH9B 2ZOOA 3QIWC 4MD5A 4RMBA 3JV4B 5BO1L 5JOFA 1P5UA 3EFDL 3LH2L 3KPMA 1MELA 1TQBB 4HHAA 2OMNA 1IV8A 4XNQA 2QPUA 2MCMA 2YPLD 3T5WA 4OGQC 5HYFA 2V7HA 4WWID 4BZ1L 4ICXA 2BHUA 2NYKA 1BF5A 2CPCA 3V6FB 2F8IA 4Y2OA 1BQHB 2D0FA 3AG3B 4K3JH 4HEPG 2N0KA 5LN8A 3QRBA 1NL0H 3HHSB 3FFCA 4WW1A 3RGVD 3U7YH 4FADA 2WXLA 3U6RB 4JE0A 3MYJA 1B0IA 2VLJE 4BFGA 5JHDB 3R7QA 1NGXB 1H6EA 5I0WA 4GKSA 2AS5M 5DHVH 4ODBD 4KU1A 3LSOA 1P4LB 4EZKA 2VR7A 1WPCA 4FABH 1NH6A 1RZKH 3UH8A 35C8H 3R8BB 4JDTH 2IQAA 5JPMB 2VDPL 3MRFB 1UA6H 4FL4B 5ACZB 3ARFC 2GJRA 4OFVA 4EI5A 2I5YH 4KWUA 1A0QL 1GS8A 1I7ZA 3DARA 3QAZB 4I4WA 3VXQB 4ZT1A 1BZQK 1TCRB 2VR8A 2DQIL 4E0RB 2HFEA 3W11C 3EO0A 3VM5A 1UZ8A 2XG5B 3WXWL 3QYNA 2YAQA 4HJGA 3CVHA 4MX7B 3A21A 1M7DA 4FP8H 1A4KA 4XO8A 2NY2B 4PJ9A 1B0GB 2V6HA 2J44A 3EOBB 3OAZK 4IDLA 1NUDA 1A7PL 2L0DA 2DLTA 3VI4F 4OF3A 4I0KA 3WTSA 2BIHA 5DMJB 2W91A 3B2DC 1DQVA 4X8XA 2NUPB 4QRBA 3CDYA 5E1AB 1UD6A 5CP7A 4PWJA 5C9JB 1FL5A 2AEPH 3E6HB 2CBPA 3BD4A 4IK7A 3SKMB 1IUZA 1Z5LA 3JTTA 4EBQH 4Y19B 2EXWD 2QGEA 1C08B 1J1XL 3EDDA 2ZUQB 1USQA 4PJHA 1A6WH 4OZ4A 1KLFB 5DD5L 1Y18B 3TA3B 3U0WH 1I4FB 3BT2H 3UCQA 3WUWB 2EDLA 3OR7A 4BDVA 4JKLA 4KK5D 2EUVA 2AJYH 3F5WA 3GMOB 2HN7B 1U3HB 2I5YL 3Q6FA 1CICA 5EZLA 3NJHA 2J2ZB 1JWSA 3BZFA 4PYGA 1IGTA 2K6ZA 2OYKA 2MEJB 3NAAL 4WK4B 1NANI 2AK4A 5I66B 2E9BA 4KROC 4JFOA 3P3TA 4LBAA 5A2FA 1ZA6B 2N01B 2OM5A 4S10A 3E1F1 4JFPA 3TO4B 5FAAA 4L0PB 2MQ0A 1NTDA 4Z95H 2YLHA 1ET5A 1Q94A 3QIWB 2VT0A 3D33A 2DDQL 2UXFA 3G6DH 4JFTA 5CLWA 1K9TA 4GP5B 1U3JA 5F3HA 1EHXA 4X5XA 2FE0A 1FG2A 4PBWD 4HMCA 5CIPB 5KN5B 3VYOA 5DVPA 1O7DE 3F65A 4GW4B 3S8FB 1R75A 3HMXH 4HKXB 5TF1L 4C8XA 2BINA 3ZTJH 2O5NA 3OMNB 4NKIL 5I1GH 2Y1YA 1GSKA 2B15A 1O6VA 1E9QA 1KB9K 3HBGA 2EE9A 4N2KA 4LZKA 3BWAB 1SN5A 5DRNB 2EEBA 2K6YA 4N2EA 3QJFA 3IVKA 3VX1A 4M93C 3RIFK 4QHNB 4JG0H 4U05A 4N4YB 4KY1H 4DK3A 4UV7H 1N12A 2FH6A 3GWJA 3L3IA 1NCTA 3QUYC 4FTVD 5CXPA 3TLRA 4Y2DD 3RPIB 3F8UB 3HKFA 4I1NB 3BUTA 1RVFH 4PRAB 2Y36H 3LNIA 1OGPA 3GIVA 2JI2A 1TNNA 3SGEI 4AENA 2CWRA 3AG2B 4XPBL 5E8NB 4OLVL 2YUWA 3ZZ1A 4MQ7B 1FQ9C 1N3NA 5CAYB 2JELH 2NW2B 2P46B 4ISVA 4UIKL 5HJ3A 2XC8A 1F4XL 4UOZA 2CHDA 1RUAH 3O3BA 2J20A 2YAHA 1HHIB 4KROD 2VMJA 2DTML 3ZDXF 5DJ8A 3IJYA 1YYCA 4ZPTA 1XIWC 2VDRL 3VACA 5I0XA 4BD4A 1BFOB 4KQ3H 3MJ8A 3GI8H 3OKDA 4DKEH 4F24A 5K9KA 3ESMA 2CIKB 2W60A 3QQNA 3N04A 3QDMD 3LN9A 5IW1A 1AXSB 1VERA 3L3KB 4TMPA 3CVDA 4I3SH 4LL4A 1ZCRA 4UQ2B 3VCLB 5KANG 4DUWA 4JJOA 4DAGH 3QDMB 5JIDA 5T3ZH 4KKCD 1AGBB 3D06A 4NNXB 1XV8A 1CGUA 3CXHK 4LVOC 5SWSD 1YPZF 1PQZB 3R0NA 5IROD 3ZTEA 4RAHA 1NCWH 1MW3A 4F2EA 1ZGLP 4WFHE 3GF8A 2PPCA 2H1PH 3LEVH 4N2GA 4EAEA 2L7EA 3ULUD 2VR9A 2A9AA 1HEJC 4ERSL 5EN2A 2WIIB 2B5IB 5CEZL 1J0YA 2PWHA 4PJEB 4F1ZA 1R3IH 5IHZA 2OL3B 5JIIA 3UJJH 1JV2B 1MQKL 3Q3GB 3WJMA 5DI8B 3T1WA 3PNWB 4H4NA 2XG4B 1VB9A 2FATH 4ZFOA 2B39A 4N2MA 1X5AA 3CN3A 1G4MA 1YEGH 4KVNH 4YXHL 3VQLA 5FV2A 3US1A 1VKXB 1MCBA 5DFAA 1Q9WA 5JPNB 1EAPA 2A9DA 3DC0A 3RURA 1OF2A 3LPOA 4ZNEA 1A7RH 1MIEH 3OR6A 3Q7JA 4K3EL 4OD2B 3DMMB 4Y88A 1TEGA 5F9WB 3U6XA 4FJZA 2BVTA 3EJJX 1WWBX 2FHBA 1NFIB 5CJ5A 2BNUA 1R9FA 1SJVA 4FX5A 2FZ3B 3UJIH 4YDIL 1AHWA 2EJ1A 3ZXAC 3MGTA 2HX9A 4U1GC 4A04A 3U48A 3BE1H 3BVVA 3BO8A 5FGCB 1Q9LA 2QFRA 3QCTL 4S1SH 4Z7OB 3HHSA 2OJEA 4N0UB 5KBNC 1HILB 3N0PB 4KUZH 3H9SD 5EBLA 2XNAA 3SE4C 1JGEA 3W0WA 2DW5A 5IBUB 3H4FA 4LVHC 2AQ3A 4HLZH 5DU7A 4HISA 1AO7D 3INUH 4M1CC 3QZMA 4YHLH 2CBQA 3K0YA 3LSOB 4W93A 3UGXA 1T3FA 2H8PA 1A9VA 3LKPA 2VLKB 1GGIL 5E1IA 4NO2B 3CFCL 1DYZA 1S9VA 3LS5H 3ARDB 3TF7C 2ADGB 1M3JA 1ILUA 1ZAGA 3T6QC 5EEWA 3B7RL 3CZSA 1AZZC 3VFMB 3UTSB 4JRXA 3BEWA 1NIAA 3HAEG 4LDOB 4KTDH 1GIGH 5E6IA 4F7EB 5JW4Q 3QQXA 2XQBH 1SLUA 1OOAA 4PJXF 2VDOB 1B2WH 3MCLH 4ONGL 3OMIB 3HBZA 4MD5B 4MBRA 1CYXA 2BZ7A 1MCJA 4ZW8A 1FRGH 1QFUL 1J11A 3WL9B 1GW6A 3MLTA 1TTAA 3BKJH 3ZZSA 4DKDC 1YMMB 3MROA 3QWQB 3FUHA 1FGNH 2ZAHA 1P69B 4PJGF 1XEUA 2PP9A 3N44B 3V0AC 2VISB 4LCUB 2JLPA 3V0IA 3VI3A 1ZHBB 5B38A 2YQBA 1I8MA 4N2BA 5E8DH 5FUOH 1EVUA 4OZ4B 4Q9QH 1F86A 1CICC 4P2AA 4BFNA 5IJCC 2LGNA 4JZOA 2C9XA 2EYSA 4M3JA 4P5SA 1DQQB 1FZKB 1P1ZA 2AJ3B 1BBDL 1DBBL 3FMGH 3KBFA 3LEYL 1CE1L 4YS4A 3J27A 4XX1G 1B90A 1KN2L 4JQIH 3QDGA 1JF1B 3PAYA 5B1CA 2G0LA 1NIEA 4MXWL 4I9WE 2OMBA 3VQ2C 2VSCA 4OAWA 4F15B 2VDNL 3MZTA 5I17A 1UXSA 2PTTB 3DO3A 3AREC 3L2NA 1Q0XL 5ACZA 3MRIA 2IGTA 2YFOA 3LS4H 4PGCB 3T0XA 3WGVB 4YNYA 5I6PA 4UOW1 1CJYA 4NO5A 4NOFA 2NY2D 2AXGA 5DS1A 4HCFA 5FDWB 1KSRA 3NRQA 3TT3L 4DETA 2HFEB 3CHXA 4K9EL 4X4ME 1WIPA 2WLIB 1D5BA 4YDJA 1IGYB 2EC9U 2UX7A 3JWNC 5EO9A 3PWUA 2OV0A 2ZUQC 3LZNA 4LIQH 3S97C 1JPTL 3LDBC 1U92A 5EH1A 4FQIH 4JFEE 3IU3B 2NRDA 4GKZB 5CLZA 5TH2A 3UAFA 4AJVA 5FWQA 2QQNH 3Q13A 4L0ZA 4WK2B 3SY6A 3LH2H 1NOLA 4OR1A 1OM3L 4QHLA 2X4SA 4LCCB 4YGVB 3CCHB 5DRNA 4KZEH 3QW9A 1Y1DA 1MJ8H 1E5UI 3SKJH 5A2CA 2BIOA 2HLEB 1KYAA 3B43A 3LIZA 2GSGA 3MLVH 3RVUC 2YAMA 4HF5H 4PRIB 5JIKA 4AIZB 2YMOA 3BAXA 3HG5A 3NG5A 4YDMA 4W6WB 4D7BA 3IRCA 4BJLA 4QXGL 4ETQA 5EC2A 3FL7A 3SE3A 1KTKE 3BKML 3QCUH 4CW1B 3KGUA 5J57B 2WHVA 1T89A 4JR9H 5I71B 2HRGA 2IH8A 3F6IA 3OC8A 2PXYB 5HGHB 5EZLB 3WE1A 3O3EA 5KJRH 1ZIBA 4D94A 7FABH 4X5LA 3VMPA 3TN0D 4TTDD 5EN2B 4ONHB 5T3XD 2M83A 4EKJA 2L7QA 3G5VA 3OB8A 5JIQA 1N6QH 4YVNA 1VGKA 4U6TA 3RAJL 4G7VH 3D85D 3GMQA 1EERB 4GXVL 1CD1B 3PHQA 2JB5H 4G5ZH 1IMHC 4AEHH 3DUUA 2WKOA 3GFUA 4J8RA 1QD0A 2QGBA 1D6EA 1I9JL 4AEIL 2XN2A 2P4AB 5JQHC 5CINL 1AGBA 1QHOA 4HIEB 4ZRGA 1BVLA 3OGOE 4Y4HA 3PRZA 2NNCA 1AD9A 3KLHC 3LQZB 3WIHH 1P9MA 2Q3XA 1YSOA 4Y1AD 4DGIH 5FM4A 1QZ1A 4WNSA 4OGAC 4E41A 1TQBC 3AWFA 1U8QA 3CPUA 4YWGH 3MRBA 2VQTA 1TR7A 5FPIA 3BISA 4JEGB 1M57B 2E7HA 2H0EA 4OJDH 2XV6B 4ZDHA 4X50A 4L8BB 1HILA 3E2HC 1U58B 1NCAH 4F7PB 2IALA 1LLAA 1OAXL 2XU9A 5HHQB 2IPKA 1XR9A 4OZGF 3QEGH 4UINL 2BW5A 4G1EA 4TULH 3DGGB 4UYQA 3AY4C 3MA9L 4LAQL 3TO4D 4U1KB 5IMLA 2FYVA 2JJTA 4ESKA 5I0DA 4NSKB 2R7EB 1QBML 2J1KA 3TEYA 5EUOF 1ANUA 2FO4A 2BSEA 1I1RA 1L7IL 3PWJA 4LLVB 3QJXA 3DJTA 4OQ1A 5FYJE 2BSTA 4GW1B 3HFMH 1HXKA 2NY4B 3FFDA 3AU1A 1OVZA 3TYFA 3QUKA 5I1EH 3W3BA 1XWVA 3TBTB 1IBHA 3BWUC 3VCLA 4UV4H 3RWCA 5DMGD 2JIXA 3QFJD 5DJDB 1RJZB 1GAFL 2A1WH 2CKBH 2F53A 1WDAA 4MDJA 3UTZB 3SPHA 1U6AH 2OJEB 5I5JA 1RMFH 4PLJC 4A2HA 5A7BA 1CDJA 4CSSA 3HG1E 3LKQB 3FT0A 4LHJB 2FX7L 3MLTB 2GK0A 4JJHA 3JWOL 4NZ8A 4ELMF 1YRKA 3QXDA 2FL5A 1MLBA 3QZWB 4XBGB 4ONGH 1IIKA 3K91A 4RFNB 3X1BA 1DVZA 3BT0A 3GXDA 1SM3L 2VSDA 4ACPA 4R4BA 5ISZB 1G7QA 2HT3C 3QUML 1QKZL 3GXNA 4MXVF 5FA3B 1BZDA 2AP2A 4PJ5B 5GS2D 2A9MH 4Y19E 4XPAH 3QDJA 5E2UL 3GJEA 4XBEL 2JCCB 2UXTA 1AOZA 2J6EH 3QEHB 4X9GA 5JORB 4TQIA 4K8RC 1ETB1 5GSVA 5CJOH 3SHSA 1MFDL 5HDBE 3VQ1C 4NFDA 2KPNA 3KYKL 2GAZB 2EKSA 3IMSA 1T1ZA 4DPAX 3PUUA 1VCBC 1ZA3B 3Q8FA 4PTUB 1OCRB 5E6YA 3BH9A 2EVHA 1USZA 2ZIDA 1FFPA 3ROLA 2C1PA 1BJMA 4FABL 1G4RA 2JTYA 2VMEA 3ZN6A 4M02A 3QQ3A 1A3QA 1JIBA 1PLGH 1FHGA 1W0WB 3NFPB 5HYJD 3Q5TA 5DGRA 3EBGA 4OLUH 3H3KA 1G94A 4UBDD 4UQIM 4KK9C 3T2NH 4BFRA 4Z8FH 1ROCA 3VFSA 4FJYA 1AHWB 1LMIA 3V5DB 1ZHBA 2Y23A 2NSQA 4KDTC 4WFGD 3ZDZF 5E6SB 5FGCE 4C58B 2LU3A 1AO7B 1AYOA 3DYMA 4AVHA 5GGVL 4HHWA 1P7QA 1YEDA 3G5ZA 5G4OA 1JZHA 4J3TA 5EIIB 4G11A 3QRGH 3WO3B 1G7MA 2H0PA 1AG0A 4ZMAT 1KULA 1GR7A 4FHBD 2EIKB 2I60H 5J1SC 1D5MA 2JKRM 4XP4H 4HH8A 1P2CB 1JDCA 3IU4L 5KSUB 1JP5A 3UG5A 3VVWA 2G5BA 4HFWB 4PG9A 1PKQE 1W80A 1OGAE 2GJZA 3N1FC 2OYLA 1Z5YD 2A0LC 4NO2A 1RUAL 1AHMA 1E6OH 3PNRB 1R5VA 5I1AB 3BD3A 4AQ1A 4YC2B 1AXTL 4XH2B 1PLGL 1HI6B 1H5BC 1T5WA 2NX5D 2Y36L 4PJDE 5LGKA 1OCOB 1JRHI 2OMTB 1RUQH 2Q3AA 4JDVB 3RRQA 4N0FA 1SXNA 2J21A 3W37A 4MD4B 1HXYA 5C0BE 3GJFH 2LTQB 5DS8B 5G5DB 5C07A 2Q6WA 3IMWA 1X5LA 1A5FL 4A2MA 5KSVA 3DX2A 1E28B 1NUGA 1DHKA 4JFFB 3CPLB 1OHQA 4HWBL 5D7LA 5AL0A 4RGNE 3KYOA 5C2UB 3JT0A 4JO3L 3GMQB 3BP7B 1CC3A 1WS8A 1OCWH 3AXIA 1TQTA 2X28A 1FNAA 4M29A 3M7FB 4POZC 1MAMH 4KGJA 5B4MC 1UM4L 4GYBA 1F3RB 4Y1AA 2DEWX 5E2WL 3VE0A 3DV6B 4UT9H 1E30A 4I3SL 1WAAE 1NDMA 2KZBA 3OVUB 1U8MB 4QRUA 2X89D 5FCSH 2YC1A 3MACL 4N0CD 3CU1A 2J7LA 2YQ2A 2VIRA 3T2LA 4DP7X 4NXSA 4B3VA 2R0LL 2VZOA 4PD4K 4OLXH 2OCFD 2FWLB 1YY9D 5FKPA 4NCC2 3GZKA 5LG6A 4MYWB 5E1QA 2KPWA 1N9PA 1KCBA 4JHUA 2D4DA 1FVEA 3TXAA 3KPLB 1GTFA 5F7YC 1EAQA 3OXSB 2WWNA 1TZOA 5AL8A 3UOAB 4NWTH 1DL7H 3VXUE 1M7IB 4WY7H 3B2VL 1OSYA 1AI1H 5CN3A 1P53A 1N19A 2FJHB 1XFPA 4WHYG 4N87A 3TH3T 2Z6FA 1KN4L 1HCZA 3ENEA 4QAWA 1C5BH 4NM4H 3QJSB 3RVXC 1FSKB 5IQ9B 3WD5H 3HC3H 3G9AB 4FQXA 3HMXA 4UILL 5C0EB 2JFCA 2C3VA 1I75A 3CQQA 3ILQD 3SKNA 1F8TL 5I0YA 4PJXA 3LH8A 1QRNA 1Z2KA 2ZOLA 4LP5A 4K5NA 5C2BL 4YSAA 3K7UA 4WWPA 4ZNCD 3MLZL 2FT6A 2F54A 1OW0C 2X2IA 1OSEA 1V5JA 2G3ZA 5D2LA 2VERA 1YEHH 4CNIA 1BV8A 3GINA 1FO0L 4KXDA 2YXVA 2Z31A 3QULB 4XHJC 3MLRH 5JXEA 1NDGB 2WLKA 1KEGH 5BXFA 3HUJA 3QHZL 1CLZH 2F53B 3UJIL 4Y7MA 2E7DA 4N2FA 4NKMB 4AJWA 4H8WC 3LY6A 2LHAA 3KWWA 3D39A 4R6UA 5CHNB 1KYFA 4ZQKA 4A7SA 1SEQH 1UWYA 4NZTH 1G6RB 4LNRA 3MRMB 3BJ91 1P7HL 4WRLA 2X6BA 4P04A 1LWHA 5LXVA 3EH2A 2PW1B 2FEDD 3UCRA 4OCSL 2NSMA 1ASOA 4BH8B 4QPEA 2B5IC 2O6DA 1L3NA 4IIQC 2NXZC 2CMRH 4XNZB 5ERWB 2WVUA 4WHYH 1OTUC 5T1KB 3VXNA 5EU4A 3QDJB 4NPYA 2V17L 4F57L 5F7NC 3QXWA 1PF3A 1E67A 3QEHA 4DZBB 1OAKH 1OOWA 1ORQB 3CUPA 1P7BA 4Y19D 1VDGA 1GOGA 3S37H 5JNYB 4Z7NF 1FORH 1DJSA 4MSWB 4R2GC 1T0PB 3BDYH 3F7LA 4QRSB 3NCCB 3HJEA 1RY7B 3GLDA 2DQHH 1RJZA 4G80B 3QRLA 4RFOL 4AYSA 3CDGA 1YEKH 1OCWL 2R9HD 2F5AL 4F33A 2GTZB 4F91B 2HT4D 2WSPA 2XV2A 4XC3L 2XWJB 2FHFA 3ZR5A 3BQUC 3AB0C 5IY5B 1HEZB 1URIA 2VWEC 5CEXA 3L5IA 2YAOA 1LDPL 4Z9KB 3UBHA 1G5GA 4BE6A 4YFLF 5E4EB 3ZHNA 2XQYG 4Z7NB 4Z7IA 5I9QC 3RJOA 3BZ4B 4FYSA 1QASA 1VENA 2PXYD 2YD5A 1Z66A 3FQ1A 4ALAC 2AJYL 5E95B 4CN6A 1AQKH 1DUYA 1YA5A 1IVLA 1WGOA 3LD8B 4U3SB 3ARFD 2NY6C 4ABWA 4YXLH 5FLVA 4J5VA 3KXFE 3K74B 1JK8A 2NMSA 4PJIB 3D9AH 4LSUL 3MODL 1F1GA 2ICEA 3S88H 1WTLA 4WEEA 2AEPL 4UIMB 3IDIB 3ZL1A 2W0LA 1RZKL 3TV3L 5KS9F 2GFBA 2QHRL 3FO2A 4R4FL 1I9IH 3VXRE 5JHAA 4BSVB 3PWJB 2XFGB 2GIYA 4MQXC 4K7PY 5B39G 3QFJB 4P2RD 4P3DA 2CJSA 3T04D 1KYUA 3H7BA 4H2AA 4MJ6B 5GJSH 1ZDSA 1FNSL 4Y4KC 4ZW5A 2YD6A 2YRBA 2E4TA 4XOCA 2ZNXA 2UZYA 5T1LB 5C86A 2Z93B 2FJGA 5DEFB 4N1HB 3RHWF 1Q9OA 1AR1D 3FQRA 1E6JL 4U7MA 1IM3A 4J4PC 2W9EH 3B2UD 5SX5K 4DGYH 2ESVA 5GRVK 3HN3A 3MCKB 4AVKA 4Y8DC 2HTKC 1JGLH 5GIRB 4PY7A 5FOBB 1SQMA 1QYGH 2OQJB 2QSVA 4UOJA 5D9SB 5MEPA 2FYYA 4HFWA 4LLQB 5D72L 4G8GB 4FAAB 2MPAH 1G7JB 3DDFA 4OBRA 4AXWA 4DNLA 3FB6B 3BP5B 1KLFA 2GT9A 1BJ1H 2WSKA 5K39B 2X4UB 4RAUB 2Y0SA 1BQLH 3MV9E 1ACXA 5AZEH 3V7MA 3HNSH 3KYNB 4BFIB 5FB8B 1JWSB 4F7CB 1RJLB 2KI6A 3RJDA 1CFBA 1KGCE 2I32A 2J8HA 3F6JA 3GLEA 4OGAD 3ZKQD 4JKKA 4XNXH 1P7KB 2DTMH 2ZCLL 1L9MA 3Q8AA 4ACTA 1F6AA 2C9RA 2Y07L 3K2IA 5HYJE 2SEBB 1E28A 1KUMA 4FFZA 1U8NB 3DJ9A 4QXVA 1O5PA 3SDCC 5DEJA 1SDDA 2CUMA 4KPHL 3MR9B 5D7KE 2B20A 2FX8L 4OLVH 5ICXA 3S2AA 1AR1B 1LWRA 4FMKA 5CD5D 4YDZA 2VXVH 1LQSR 3WN5C 2K0RA 1CG9A 3QQ4A 4PJFB 1WZLA 4RA0C 1JNNL 2OXGA 4O2EB 5AOZA 5EFIB 1SEBA 3RPBA 1NDMB 4GW4A 2P8MB 3KLLA 1O6TA 1ZY9A 5C6TH 1JERA 4W1TA 4XVSL 3WMQA 4J4PD 1K2DA 2WUBH 4X6DA 1A1NB 3B2UC 4BK5A 5GGQH 4WFED 1ZPUA 2JWYA 3C5ZA 4JZJA 3B83A 4M62H 5BJTA 5F3BA 3N43F 1HZKA 2OR9L 4WWKA 3O4LB 4PJGE 1FLTX 3QIUA 1J5OL 4PW9A 4QHNA 1OQOA 1ZRUA 5DTFA 3S4SG 4LEXL 5ENWB 1B9KA 3FUJA 5C0FA 3DX9A 1WAPA 4D9RD 3FOMA 4F2MA 4MAYC 1Z9LA 3EJTA 1QOKA 3THML 2WZPD 1S9XB 4QYOB 5EC1A 4L8SB 1Q8MA 4MNGE 3DURB 3EBHA 5BW7A 4L1SA 3QORA 2VL4A 1BOGB 3TTYA 3VDCA 1REIA 2W65A 2A6JB 3LAFA 2VDMB 1MCLA 4KX8A 2MNWA 2F1AA 3DWTA 4BFJA 1D7FA 2KLSA 2V7NB 1GGBH 1UVQB 3IJ9A 1YNTF 4Y4FD 3TP4A 1HNYA 4JS7A 4WTZA 1DQJB 1GTNA 2Z3FA 5DVOA 4X6DF 2K78A 2FEEI 3VMOA 1BHGA 2VW7A 2ZP0T 5EPMB 4D8PA 3O3DA 1JD9A 1AZRA 3K8MA 1OGTA 4AI7A 1QR1B 2Z4QA 1TVBB 5D7IF 4QXGH 4P5MA 5D6DC 3PL6C 3HUJB 3CFBB 3Q2WA 4JQIA 4NOBA 3OGCB 4NAQA 1IFRA 2JB5L 1TENA 5I1EL 3T3MB 3FONA 4R3SB 1PW3A 4QO1A 1ORSA 1FO0H 3MU3A 5DJ0A 5E6IC 5CHNA 2PCFA 3PHSA 3DLQR 5CEXB 1I1AA 1JNJA 3A47A 3W1ZA 3AY4A 3I6SA 4X6FA 2VR5A 4PGBB 4X0KA 4G70B 4PJCF 5IFJB 1EEUA 2WO3B 4TQEH 4NDMA 1AS6A 3OSKA 4FI8A 4A1RA 4NN5C 4Q89A 1SXZA 4GT7A 1F8TH 2OMWA 1L0XA 1T2XA 1TYEB 3QNZA 3KEHA 5AAMA 2NX5B 2GI7A 2GCYA 3E3QE 4OD3L 1UG9A 1FI8C 2HCZX 2G60H 4K5MA 3UJJL 1JTOA 3KPSA 4IKIA 3M1OA 5FGSA 2Z92A 3ATAA 1E8XA 1HWGB 2KERA 1QVOB 1G7LB 4V2CB 5DJYB 3C6EA 3N91A 3V8OA 5EOCJ 2E59A 2ZOTA 3CFIC 3X1EA 4NQSB 4F33B 4XP5L 5B1AB 1BQSA 5DZLA 4LSTL 1PCXA 5L4FA 4JN2A 1G9MC 5F44A 4ENZA 3S8WA 5C92A 2B14A 5KW9H 3RWEA 1U8IB 4GMSL 3E80A 3AS3A 1S7TB 4IRSC 3NT0A 5AOLA 2CIIA 4PCKA 1CLOH 4KV5E 1CXLA 5B21A 2J55A 4KI5D 4FQ2L 5IHWA 3X11B 1GYAA 2BNQA 2Z7UA 1WUNT 3GMPA 4OUOA 5C0NC 3TM6A 3OKOA 4D0BB 3V9CA 5FO8A 4YLQT 2YJLA 4HIIA 1EVTC 1WBXA 4GQZA 4LLUA 4UM8B 5D93B 2NY1D 1JGEB 4W6XB 1XH2A 3Q2LA 2BVQB 2VSKB 1CQYA 3CZGA 1M42A 5AG8A 4M7KL 1JWUA 3QDGE 3TU6A 2CDGB 4FLRA 2YUZA 1E8YA 1KPUA 2BNRE 2ZONA 2YARA 2HTLD 5F0LB 4P9HC 4HV8B 3ZIYA 4DPBX 2K7QA 2AEQH 1IEBB 3L4VA 1QO3A 1R6VA 1BIIB 2ILLA 3MTXA 4GSDL 4I48A 1LO2L 2W95A 3FB6A 3P9MB 1VAHA 2DDQH 3ARDA 4P46D 3MRQA 3VM7A 3IETB 4HS8H 5JZ7C 2ZYRA 4K5LA 3HA0A 3MV9A 2VN4A 3OKKB 5HGBA 3DO7B 3QNYA 4CA4A 1JF5A 2X1PA 3NSDA 3NJIA 3WO4C 4Y1SA 5CMAB 5FUZH 2AQTA 3O2DL 1YMHA 4ZO8A 1WC7B 4FQHB 4P5TC 1R47A 2ESVE 4N1EA 3VD2A 1INDH 4KDVA 4KFZC 3L45A 3FQRB 3QUZA 1WHPA 2P49B 3TBYB 1OT1A 5L0QB 5EBWA 1XHHA 2X44D 3BLPX 2F19L 4KJYB 4YBQD 5A16A 4YHYB 3N41B 4DEUA 3G5WA 3K71A 4PVMA 3FBKA 4OCYL 1E7UA 3H56A 1RL1A 2GEEA 4UAOB 3WAJA 1NLBL 4G8GA 2OMXA 2Y7SA 4PRNA 3KPQB 4F7TB 5LXGH 1M7DB 3GXUB 4YHIB 5D7KD 5EDXA 4ODXA 5I18L 3BZ4A 4KVPA 3G5XB 3IDJA 3NSYA 5ICYB 4BCZA 1F4YL 2EH7L 3F7QA 3WKQA 4P23D 1IC5L 3BUBA 1NKRA 4EN3C 1JHTA 3SCMA 1Q9KA 1KXVC 3GBEA 5C9JA 4NQQA 1JF1A 1RJLA 2V33A 1S8DB 2ICEB 5A6LA 2FGWL 2ZXDA 3QDJD 2DM2A 2K70A 3I74A 1M56B 4RGMB 3GPEA 4BA0A 3V0HA 3GD1C 4A37A 1U8NA 1U4FA 3FH5A 1DVQA 4HUKB 4BSVA 4CBPA 5EBGA 5HHOA 2FTAA 4YNYB 1MCIA 1TQSA 3LS4L 3VU1A 5E9DD 1WFMA 5EU7E 5IIEA 4TVPE 4XCYA 1KJVA 3MLYL 2AEIT 3QUMH 3QWRA 2WLIA 3QEUB 3FQ2A 4G6JH 4LVNC 4R5XA 5GGTA 4NB7A 2XVGA 1XH1A 2H2PD 5DK3A 2BSSB 4QXUL 1GZHA 1ZLVK 3FT4A 2VM9A 1CVRA 3RDTC 4UB0L 4PB9H 3T0EB 1ZT1A 1WT5C 4P2RA 4YOKA 4K94C 1G7IB 1XZWA 1M7UA 4GBXB 1ZSDB 1TEFA 2ZX9A 2IPUG 4K0OA 1BFVH 1KLGA 5GS3A 3S3CB 4AK2A 2VXUL 4ALAH 1GPOL 3MUY1 1GRWA 3ML9A 4WUUD 3ETSA 4JY5L 3OAZH 2YRPA 1SXAA 1TVHA 4ZMVA 3WXWH 2R1YB 4N90E 4NN5B 3ZKSD 3T65B 1FCCA 2DJ4A 1E4HA 1IM9B 1FAIH 5CGBA 3SGKA 1BIHA 3HE6C 3RNKA 3MV9D 3ZL4H 2IQ9H 3LHPH 3FSAA 4PV9A 1HOEA 1ASPA 3O0RH 1DQML 2HKHL 2YOAA 5K9OA 5INCB 3SB3A 2ZXBA 2A9CA 1CFSA 4BFIA 4MFHA 3N1GC 1BZEA 4S1DD 4YEFA 4CC4C 5DK0B 1J0IA 2AJSH 3RVVC 3UTPD 5DZPA 4Z7VB 3HB3B 2OULB 1CTMA 1KACB 1EHNA 3NABH 4M8QB 1F2XK 1T20B 4QTFA 4XP1L 1UQSA 2H5UA 3IAPA 4FYTA 5E4IA 1RZ8B 5DGQA 4OZGB 3NESA 3H9HA 4Y2DB 3CVHL 2VUOA 3BSZL 4NN6B 4UQBA 1MRCL 3RAJH 4Z77A 5KSAC 1UWEH 3L4XA 4A6YH 2Z4QB 1OE3A 4L4JA 2RFXA 4P9ML 4N2DA 5FO9A 3EO1A 3PIQB 5CEYA 4F1SA 3T08A 3MUHL 4X4XB 1HESA 5GS2H 1L6XA 1GKEA 2HJFB 3V0WH 1C1EH 1UFUA 4J1UA 1Z3RA 3K5SA 3VGHA 5HVHC 4WNJA 4PRHA 3QIUC 5GRJL 2PCXA 3MLWH 5DYFA 4BQ6A 2DZEA 4DN3L 4ZUWA 4AM0Q 4PR5A 2NUPA 4JZJB 1QLEB 1P4IL 3ROOA 3VFVA 1U8PB 3VXMA 3TZVB 3K6DA 5I1LA 2EDEA 1RFDL 3DNKA 1FPTH 4JO1H 4H0HB 4LPTA 4NZJA 2N7AA 2CZNA 2ERJC 3NCYP 4Q4IA 5HHNB 1JPFA 3ULSB 4C54A 4KI5E 5CZXC 2Q8AL 4EN3A 2UZXB 5CGYC 4YUEL 3AMLA 4YZFF 1PZ3A 2B2XL 2IALB 3GO1H 1HQRB 5CS7A 2GBVA 1TDQA 2ZWLT 5FK9B 3BZ5A 4LLYA 2EAEA 4WI0B 4QF1B 3B5GA 3BYYA 2QQNL 1KB5A 3EYQD 1NPNA 1XMEB 3SKUD 1U8LA 3QISA 5DD3L 1G7HA 4GRWF 1TVDA 3QS2A 4JFOB 3RWIB 2VITB 4BHUA 5I1JL 1BIIA 1XGRA 4AL8H 3VW3H 2LTQC 2FWSA 3BESR 5AOMA 5DA4A 4XWOC 4YDLB 3VGAB 1QLRA 2CDEA 4YSDA 1FFOB 3GHPA 3HRZC 5T5FL 4MLSA 2GY5A 5A43C 4YE4H 4C4KT 1EEZA 2ZJSL 3M8OH 1S9WB 2CIIB 1MF2L 1CYWA 4HCRA 3II3A 5GRZA 1A4CA 4PVNA 1DL7L 5EU6D 3GUTB 3VXMD 1AMXA 4FA6A 3P3UA 1WC7A 1S7RA 3KPTA 4FQHA 1CF8L 3S37X 1FN4A 4IEFB 5F96L 3VWJA 1N8ZA 4M5ZL 1L9RA 4G83A 4KJYA 3B7TA 4WZ9A 4BZ1H 1LO3H 3L9RB 3TV8A 1A3LL 4CADA 1A64A 2BC4A 1EXGA 3HHRB 4DERA 4HBCH 4XVJL 2FZ3A 3ZHDA 4QNPF 1QHPA 4EN2A 4KVCH 3FQUA 4P3CL 3ECUA 2B0SL 3CFEB 3BAJA 1E2WA 1AAJA 3WY4A 2A99A 3TGXA 1SF3A 2XIBA 4LEXH 5MI0B 3TBSA 4BFFA 2GCYB 4FLSA 3O9WB 1ULVA 3TT3H 2LU4A 4PHXA 1NLBH 4ZBJA 4TTDC 4M7LT 1NGQL 3OAWA 2QPEB 4PJDF 5TK2A 5ICZB 1T4KA 1Q9KB 2P52A 3SDXF 4HPHA 1V3JA 3DV4B 3HCVB 4Y16C 1GYWA 2CR0A 1WBZB 1NOAA 4PTUA 5EZIH 4H5SA 2V2WA 4PJEF 4B7IA 1AXIB 3VFGL 4IRSA 4QYAA 2VLKE 3ZKXB 1PGRB 2QTVA 1RUPH 3OJMB 3Q9PA 3LJ3A 2JK5B 2P24A 5A2LH 3U1QA 2XWTA 2GHZA 3FZUC 4YO0A 3UAJC 3K71B 1QSVA 5EZJA 1WTGT 2CO4A 3ZKMC 4JY6A 4LQFL 5C07D 3WNIA 5IK3B 1BD2D 3BEWB 5AW7B 1JF6A 2OMXB 5JYMA 3HKZA 4J6IA 3BE1L 3GSOB 2TSBA 2OMZB 1KCUL 3UFIA 4UU9B 4WDIA 4Y5VC 4Q8BA 2PYEA 3NA9L 2ARJA 4PRBA 3QDGD 3MC0A 3US0A 4N0RA 2CXGA 3FYIB 1D5MB 1HT6A 1UOKA 5E5LA 3EGXB 4I0PD 4B9IA 1PZ5A 3IAQA 3F58H 2HWZL 3AS1A 3GMMB 3BI9X 2OW7A 3K6OA 5C0JA 2Y1ZA 3ARGC 1ERNA 1MAML 3R8QA 3QQDA 4PRDB 4ZMPA 5AB0A 4HX1B 1KWGA 5G2NA 1MEXH 4YPGB 5HHVL 3LX9A 4FG6D 2R39A 5AW6B 2Q9OA 2VAAB 4MNQE 3DHPA 2F53E 2HG5A 3BAIA 3FTSA 5MENE 3FQWB 3LIZL 3SE9H 5HYIA 2AKRA 4P57A 2VW6A 2OW6A 3RFRA 5D6DA 2L4OA 4Y16D 4DT2A 2LQRA 3FT4B 4FI7A 3KNBB 4M1DL 1MI5E 1JXGA 4M7JL 4ZFQA 5E2TH 3HEIB 1F3DH 2H32A 2RR3A 3MODH 4YSQA 2GJ6A 2XACC 5E56A 4P4KA 4Z3HA 5I6XC 3VFNB 1XGUB 5IEKA 3QXUA 1RZ8A 5FW7A 1HWWA 1MVFA 4GRMA 5IB4B 1HYSC 4JNXA 3A4AA 5TQ2H 4ZYKA 2FDBP 3C9NA 3HIZA 3IGKA 2ZZUT 3PDOB 2VZ3A 3MLXL 5EU3A 3BZEA 2NY0C 4XPTL 4LLWB 1TTRA 5K93A 4WCYL 4JRYE 1F4WL 2YGOA 4G9DA 2VO8A 5EBLB 2V8MA 3RWHB 3NACL 1D5RA 5HHMD 4E2OA 4MCNA 1FRGL 1N0XH 1QFUH 3IJSA 4IRZH 4DPCX 2A83B 3QR1A 4IOFC 4I5BA 2XPGB 1NBZA 3W0WD 2VTFA 4HUWB 1H3UA 1KC5H 1P1VA 2JF1A 4JDEA 3V6OA 5I1CH 2HVJB 2BWIA 3LCYA 3NFNA 4M7LH 3R4DA 3GLAA 3ZQ9A 3ULVL 4NN6C 4KRLB 1AZVA 4OJFL 1MJ7L 2FX8H 2I85A 1DN2A 3C2AH 1MFMA 5B8CC 3W56A 4MB4A 4NO3A 4PG2A 1TQUA 2MWCA 2IAMD 3MREB 4WO4B 4E9LA 1BPVA 4PFEA 4H8HA 2BVOA 1UJ3A 3EO1B 5CEYB 2AW2A 2BSSA 1QBLL 4OCSH 4CJ0A 1NCCL 3EO9H 4MJIB 5GSRB 3TIEA 3VI4B 3C87A 1G7IA 3FSVA 1CLCA 3F7VB 1YY8B 1SOKA 3ZTJG 4ZUWB 3HZKB 4FNTA 1KLGB 4Z78A 4XMLH 2UZPA 3W38A 2D4FA 4OZHB 4FQXC 1UOVA 3G6AA 1E5BA 4DIXA 1JRHH 5HHNA 4HIEA 3F58L 3TO2B 4XHQA 2I24N 1CIDA 1VGEH 3PP3H 1Q0YH 1MCNA 4JKPL 3E1ZA 2YPLE 1MXGA 2EUWA 2CGRH 1YEEL 2D03L 1FVCB 1ZVHA 1IGCL 3WAKA 5JIMA 4K3EH 4QKTA 2ODIA 1KB5B 1SXBA 3STBA 1KLUA 1A25A 1C5CH 2XXFA 4R2GB 4XVSH 3DHUA 2Q8AH 3RWIA 1SLXA 2V5MA 4Y5YB 3SGJC 1RV6X 1PSKL 1KBKA 4ZW6A 1ICTA 1CR9H 4HDIB 3ML8A 1WCQA 5F3FA 2BNQD 5CIPH 1GOFA 1WIUA 1MOEA 3HVNA 1SOQA 2YA1A 5EEUA 4XTRC 2XWXA 4FFWC 1A1OB 2FBOJ 4XCFH 4K7FB 3CG8A 1WWAX 5E00A 5C7XL 3OMAB 4F3FA 5GGSB 4JFHD 1PZBA 3QP3A 4D0DB 1HEHC 4HS3B 4B0MB 1ZK9A 1HSAA 3ECVA 4LCIL 2OYPA 1IVTA 4AZUA 1SBBA 5EUOE 3VWJC 5BZDB 1ZJBA 5TDNB 1CWVA 1K6QH 4J1UB 2QQKL 2F15A 4ICWA 4LVOB 5IOKA 1RZJH 4FXGA 1B0RB 2HKFL 2JQZA 2NY6D 1WZAA 5ELIA 3IFLL 4YGVA 3GHBH 4AV5A 4XP6H 2DI9A 1BECA 1MNUL 1I1FB 4M6ML 4OM0H 2HRPH 2DYRB 3SDDC 3NDYE 3RNQB 2XV3A 3QORD 1T1WB 3LZRA 5DC0A 5SX5H 5IUSA 2Y7LA 4ODWB 2G2RA 1KCWA 4X8GA 4G7QB 5D55A 2VJ8A 2WTOA 3LQAC 1G7PB 4LHUG 1WEJH 4M4PA 5EUOA 3TBSB 3WY2A 1HYRC 5LXGL 1MCWW 3WSQL 4YZFE 4DKEL 4FKKA 5KJ4A 3WFDL 2CO2A 5IHBA 4QMEA 1P0SE 3B2MA 3JWNH 4L1TA 2JJSC 2J8UF 4WI0A 5E5RB 3W2DH 4LOFA 2NSXA 3HRPA 4OTXL 4R4BB 5C7XH 5IESL 4JPKL 2FIKB 4LPVA 1VEPA 3IJEB 4ONHA 3LVEA 4ES9A 1JRHL 5J06A 3CFJA 4PJ5A 5I6MA 3EYUL 4FG4A 4HKJB 1F42A 4DKFH 5GZOD 2Z7WA 3L5JA 4R96A 3BAYA 4JREB 3SYOA 4UWQB 1J1OH 5DWUH 5JORA 4JFYA 1RUMH 4WW2B 2AKRB 1AYRA 4HGWB 3SJVE 1AQDB 2WQXA 2ADIA 4NQTA 3T8XB 2WD0A 4JREC 4P5TB 4NKOB 3IFPB 2YXMA 1TKWB 2IF7A 4U1NB 4U1IA 3WO4B 2GHWB 4KZEL 1OF0A 1T5XA 1ZJAA 2FEJA 4PRPD 3HE7A 1OPOA 2GC4C 3X17A 4FEMA 4F37K 4QHMA 1O0VA 1W0WA 3NFPA 4BFBD 5MP6H 4XPGH 4F2ME 1DVTA 5EF1A 4FOMA 3BKMH 3IMBA 1RLBA 3BPLB 1FGVH 1UUNA 2IFFH 3MOQA 4HJTA 3O9WD 4H1LG 1VIWA 4FNSA 4ODUA 4DP5X 2VE6B 1PZDA 3DJSA 3K6NA 3KH3A 5T3XH 1ZSHA 5TFSL 1P7QB 3G5ZB 2F58H 4JY5H 3FFCB 3BP6A 3IDNB 3V4LA 3ATBA 3BOVA 1OK0A 4PI2A 2HWZH 3H4HA 4NWUL 1E9PB 4BE5A 2WXKA 2O5YH 2DRUA 2XY2A 1Y1UA 3ABZA 4DP1X 4FQIL 5CP7B 5IGXL 5C2BH 1J86A 4R0LB 3EYFA 4JM2D 3TNNB 2JKWA 4PWGA 5KJ7E 1UENA 5EORH 3LMJH 5IJDC 2FO4B 3L3JA 1E50A 5EOQH 4RX4A 3S3DB 4HGMA 2IXQA 1S7QA 1VPOL 2ZCKH 1FYTE 1KYOJ 2GTQA 5FM8A 5CGYD 1V3LA 4M61A 4UNVA 3T2NL 3EIFA 1T5WB 4KRPB 4YFLI 5ICUA 5IB2A 3HJ0A 3ZO0A 1VSCA 3HC2A 4TQPA 4UBDC 2R0KH 2JIXB 2D7MA 1RP8A 3NVQA 4HUVA 1JXDA 1O9ZA 3HHMA 1EQWA 1FDLL 3H9YA 1TTUA 1MXDA 5IESH 2J72A 1CFQB 5DC4B 3E0GA 4JFQB 4NN7B 2B9BA 4G6ML 1A6ZB 2H2SD 2XKSA 3COOA 4UNUA 3QG7H 1FL6B 5DVMA 4AVJA 2GK0B 3T0VA 4X4KA 1RZFH 1SJEB 4XNQB 1MLBB 4XBGA 2H3NB 3PWPA 4M8VA 3WFEH 4ECNA 3RP1A 3FFCD 2XQBL 4X9YA 1FZOB 5D5MF 3KLAB 3KYAA 1E2VA 4DCQB 2OJZL 4YDVB 1EGJL 3N5AA 1S5IL 3RL1B 3HZYA 3KJ4B 3NTCH 2XJKA 1F56A 4XCEB 4OIIH 4R9HA 3P11H 3MBXL 5A40E 1DJGA 2WKGA 2G2NA 3BGFC 2WZ6A 3T6XA 1KLUB 2ZOWA 1NBYB 3QUZD 4EIGB 5J6HB 4AKQA 8PAZA 1X5XA 4MJIA 5JPMA 4Z7WF 4N9GB 5HYEA 2MCAA 3F83A 1F4XH 1HHJA 3DK2A 3DSNB 2FR4B 1OAQH 3CD4A 3CH1B 3AG1B 1JN6A 3NP3A 4X7TB 4ZS7L 4AEHL 1S7SA 2MOQA 5AVZB 4F8NA 1MFNA 3CFKA 5E4EC 2VDLH 1Q1PA 2A6DA 2CRZA 4QT5B 1R33A 2IADA 2VDLB 3V5DA 2E27H 3AY2A 2KYIA 3ATDA 2AGJL 3L3DB 3LKRB 2WINA 2E8YA 1J9CT 2WO4A 4JFFD 5KS9B 2R4RH 1JTPA 2PP7A 3L95A 2B4CL 5DJ8B 2D31B 4RVBA 4DGIL 4A2GA 1UZGA 4TVUA 4FXGB 4N0CC 2VMCA 3SE8H 1OP9A 1PG7X 3QHFH 5DEZA 4A7GA 1BXVA 1IBDA 2FWOA 1MH5A 3L7EB 3TWCH 4PLJD 4NDMB 1T04A 1NBVL 3V0VA 3NCXA 3MRKA 4OM1L 1AS8A 1EV2E 3QCUL 2IDTA 1F5WA 3DROA 4XAKE 2DIEA 1J7VR 1U3YA 3PYCA 3IM1A 5BMFL 6PCYA 25C8H 2P5WE 1FPTL 1I1CA 1UWEL 3W11D 5E5MA 3REVA 2ETWA 2R2BA 4M5TA 5CSZA 1N3NB 2WB1A 3S35X 1JPEA 1NWPA 3ZMNA 3P9LB 4F8LA 5JTWA 1UEMA 1A6AB 5F1NA 4GG6E 3MV7D 1WZMA 2AK4B 4PN6A 5IJKA 1HHIA 5SV4A 3DDGA 3JV6B 1AGDA 3GSNH 3D4CA 5C0CE 4JZNB 4MJ5B 3ZE0E 3WS3A 2ZCHL 2APWA 1EANA 4N8VB 4GBXC 2B4CH 4P06A 4GG6B 3CPLA 1OAKL 2FQDA 2Y2WA 4KHXL 4FG6C 4RSYA 1YO4A 4K23H 4Q74A 3EH4B 1BAGA 4AYDC 3OHMB 4G43B 4KHTH 4ZAKD 4UQDA 4U3HA 1N0LB 2EC8A 1CU4L 3K0WA 5IB3B 2R23B 2A74C 3P0VH 4W68A 4LRIA 4OZGE 5EUOB 3NJLA 1K3IA 4MAUH 3SPIA 3STLA 3NJGA 5IEHB 3OR6B 3JWOH 1IKOP 3O45B 1PQZA 3B3IA 1HS6A 1KB5H 1X9LA 4J23A 2ZSWB 4YR6A 3V9FA 4NQCE 4Z7UB 4A7UA 4YQXL 1JFQL 1N0XL 5C7ZA 2ATPA 4IKNA 4JY4B 5L7XL 5MERB 5SWZE 1JL8A 3TH2T 4YL9A 2YPVL 4IGBA 5GPRA 2EO9A 3H9ZA 4R7VA 4A2EA 5H37G 2YRZA 4ZFOB 2Y69B 1OEZW 2OL3A 2R83A 2ZJSH 4A2FA 1F13A 4D9RE 1DUYB 3NBNA 2BW4A 3ELAT 3QEQB 4OLWH 5DMYA 4E36A 2FUQA 3ZBMA 1B9ZA 7PCYA 1A9BB 2BPBA 3IPFA 2DMBA 1DO6A 2FNWA 4JM4L 1N26A 3RQ3A 3UYRL 1KGWA 1YAZA 4FQXB 5HJ3B 1S7XB 3OM3B 3VXRB 7FABL 1D5IH 3IFPA 1YMHB 1ECZA 3CN4A 4MNGA 3RDTB 3WI9A 3L13A 3MLUL 3LPFA 3PQYD 4X5RA 5E4AA 5IGXH 3EW3B 1KEMH 1ES0A 3DTUB 5A2BA 3H0TB 1KENH 3DIVA 5C70A 1BDYA 3MZGB 3MRCA 2VXQL 1AXSA 1I1FA 4MBOA 3RBSA 2MJWA 5I1IL 2UV3A 4JO4L 4BUHA 3U9PL 4HUVB 1DCEA 1GMEA 1K4DB 1KY6A 4XXCC 4M7LL 2VDNH 1NBVH 5ICYA 4LASL 4NQCB 3KWWB 3MUJA 4Z7UE 5I74B 3KGRA 5EG6C 4GRLA 3QS3A 1JGLL 3MNZA 4E9TA 5AVSB 3FT9A 4H8UA 2XVKA 2RCSL 5GGTL 4H20L 1T1XB 5A2IH 1T3FB 1OTSD 4MMZA 1KIPA 3VD9A 2HT2C 1U8OA 5I6LA 1R3JB 1CDGA 1R4XA 4L1BA 1GJIA 4QUOA 4L4VD 3AT0A 5CJOL 4PP2B 3V4VB 4FZ8H 2E75C 3WFEL 3MBWB 4A68A 3U30C 1KCRL 4L8CA 1A0QH 4PYHA 4P48A 4XCCH 4JRXB 4XCYB 3CSFA 5EORL 2CO6B 1O9WA 4N8PA 1WCBB 1P7KA 5T8IA 1SZNA 3MRHA 3CH8A 2GIXA 1IAIH 4X5QA 3UZEA 3V4UH 1E65A 1F6AB 1DBAL 4JRXE 4OCLC 5GGSY 3HE6D 3CH1A 3VD4A 2JH2A 4KH2A 5DFTA 5C0ND 1EXHA 3ZYOA 3KDMA 5BO1H 2BY2A 2ITCA 4DO6A 2ERJB 1FZJA 1HAUA 1EFXA 4GKOA 4LLMA 1RD6A 5DHYB 1MEXL 4TVPH 5L4MA 3K8LA 4YDJB 5B38B 5K1VA 1IL1B 4UZGA 4F7MA 1MHEA 2QL1A 3IEAA 2APBA 3O2WH 5L8LB 1GZQA 1CMOA 3VH8A 1ONQA 2NLJA 4RMWA 1S78D 3RIFF 5CZVH 2MPVA 4JFWA 3L81A 2X2YA 2BIQA 3FRUB 3U4EB 3RHWK 1KBPA 3HNTH 2X4SB 4LCCA 1EHLL 3NZSA 2KH2B 3O4LE 4PJGB 3GXFA 3F6LA 2UUDH 2FO1A 3W2DL 4ZSOE 5DRWA 5BPPA 2IMMA 4PRIA 1PLCA 3L4YA 3EYVA 2V37A 3G08B 2ZX6A 4GSRA 3A6BH 1UA7A 4L8SA 3ISWA 3E3QC 3P30H 4KPHH 2JIXD 1OAZL 2WMPB 1OGAB 3L3GA 5FYJU 4CJ1A 3FOLA 4G6FB 3H9HB 2C5DC 3VRJA 4PUBH 3UTSA 4IW4C 4OF6A 4AKOA 1BOGA 1MCHA 4B41A 1KPVB 2OTUB 4N2HA 1FIEA 4KO6A 1XSOA 3MDJA 1T0MA 3GJFB 1OQXA 4GRWB 3LKRA 4UTCA 2Z4TA 3I75A 3RGHA 4GSXA 2V7NA 4G6KL 3JV6A 3RY6A 1WP6A 4ZMZA 2H7WA 3GZQA 3U1SH 1BWWA 4NERA 3FU7A 1IAMA 3ZR6A 3TN0C 4G8EA 4MDIA 5PCYA 1ND0A 4DOHE 2IG2L 1FL3B 4TUOB 3NFSL 3SKOB 3TZVA 1LO5B 5D9SA 5MEPB 4KK5C 3VYPA 1L7TH 2LV4A 4G3YL 1X4XA 1AD0B 3M45A 1EZVX 4KMTH 1Q1JH 4JPKH 3CX5K 3C60A 5F7AA 4YWGL 1EO5A 3H6JA 5FX3A 4YHZL 1MREL 1FNEB 3DMMC 3PHOA 2XBDA 2R2BB 2XXCB 1L7IH 1DQQA 2VB5A 5F9WC 1TQCC 1PMYA 2ZQKA 4PGBA 4X0KB 1RJCA 1WQVT 4J8QA 2APVA 1UACH 4MVBC 4U1MB 5HGHA 4P5KB 1YAIA 2H32H 4LAJH 1SYSB 2EABA 1WGVA 5KTEH 4L4TA 1EAOA 4M6AA 2V5YA 4PJFE 1SOXA 3MFGB 2ZXEB 2ICWI 4JFDA 4X6CB 1OGAD 4LAQH 1VCAA 3U0TA 2F5BH 5KVEE 3KD4A 3NAAH 1AZCA 3ZDZE 1ITCA 1HKFA 3GBNL 1QI3A 4PGCA 3QQ9D 1NFKA 2HUEA 3O41A 1H8NA 1VPOH 4QRRE 2ORBL 5T5FH 1A66A 5FYKH 2AQ2A 3SY0A 4ZD3L 2VRAA 1A6VH 2IADB 2O4EA 4LLAA 1GYUA 2WUCL 1MJ7H 5IMLB 2ZCHH 3FO1A 1QG3A 2X6UA 3BQUA 3L3DA 2D8KA 3A67H 4ES8A 2R7EA 5GS1C 4N3UA 3ZHKA 1UOLA 1RZ7L 4L5FE 1OIOA 2B1AL 2ENJA 2VCOA 2CJUH 3PXHA 4Z5RA 3ULAB 3P4LA 3MXWH 1K2DB 2D31A 4X6DB 4UTBA 5DYOA 1MUJB 1KN2H 4JQIL 3JYCA 1YZZA 2VLKD 3BPNB 1QBLH 2BC4B 4XPBH 3LNEA 4TUKL 4YLBA 4LIQL 2AITA 4GFXA 1T0NB 4AE0A 1TTBA 4Y4HD 5TQ0L 2G0KA 1XH3B 2VC2B 4PLNC 3ABLB 1JXJA 3GBLA 3VXUA 2OJZH 2BS9A 2W9LA 5KEZA 5JHMA 4MJJA 1WBXB 4ZS6D 2MKLC 3MV7B 4PIBA 4FFVD 2LFEA 5E5MB 2D7OA 3HI5L 1CS6A 4UCFA 2IAAC 2EO1A 2NXZB 2YGQA 5IHHA 3OZLA 4GQ9H 3NK3A 5DLMH 2W59A 1KYOK 3VD5A 2DLFL 4S2SB 3V5KA 4EI5C 1NMBH 2OX5A 5EF3A 1AHWC 4I48B 5ISZA 1DANT 1NZRA 4F8OA 5DUBA 4CAGA 2X5PA 2BSRA 3HLAB 1AP2A 2VABB 5DFVD 5GZND 3EDFA 2EXYC 3H6AA 4ZZFA 3QO0A 3LVTA 3M7OA 2CK0H 3LEYH 4JFXA 5CJQH 3S2CA 2R56H 3WFBH 4EXKA 4PS8A 4OI9A 5HGBB 4DKFL 5F88B 3TYGL 1WZKA 2IDUA 1BFTA 3VXOB 3KWTA 5EN3A 3CFUA 2ZCKL 4YDNA 1YEFL 4M93B 4P46B 3TA3D 1DSWA 4J8RB 4WGWB 2OMZA 4RZCA 3QUXC 1X7SA 2PCPB 4ZMLA 1EZSA 3D5OF 5DHVB 4OI8A 4XR8C 2PUQT 2X7LA 4CBZA 3C75A 4R7NA 2ZSWA 3QE5A 4PSPA 4PLKD 3WLWD 4I1RA 3OAUH 4YSCA 3HB3C 3P11L 4P2YA 1MRDH 1IAIL 2XTJB 2GI0A 3C5SB 3PV6B 1PVHA 1MVYA 3JWDC 4G8FA 5BZXA 4CDHA 3CVIL 3Q5YA 5BS0E 3MLPA 1ZDQA 3STZB 4G71B 4I8DA 3TNMB 4GY4A 5F6IC 4NQDA 3T3PB 1MAJA 4M6NH 3ARTA 1H9VA 2YPKB 1N6QL 1JZ3A 4W9LC 2OSYA 2VDQL 3MYJB 3MQIA 1C12A 4U1LB 4RETB 2YD1A 1L4IA 2C26A 2PR4H 2Q76A 4IU3B 4IRZL 2XRAL 2EDTA 3FQWA 3DIFB 3UEZA 2DQCH 4AUJA 4AKPA 4L2YA 2BHFA 4XXWA 1V10A 4JM0A 3RJQB 5AB1A 3VXRA 1N5AA 3MNVB 3BH9B 1QTSA 3TONA 1JVKA 3KLHD 2R69A 4EUPG 5L6YL 1TITA 1SMDA 4F37F 4J3VA 3GRWL 5GJSL 2GJ6B 3TVMD 5L2KB 1EJOL 3O4OC 1HVXA 3DJRA 4N26A 4MCZA 5JPNC 3MJ9L 5DQDL 3FHEA 1V7NL 4JK0D 3FSWA 1DDTA 2BZDA 2CA4A 3C09B 2PETA 1Y0LA 2G5UA 3S5YA 1H3PH 3MKGA 1OB0A 1XGYH 1YPZB 3DX3A 1SDYA 4K3HA 2XTJE 2DS4A 1E3ZA 2YK1H 4H44C 4P23C 2APTA 4Q52A 4XVUD 5IBLC 3VFGH 4J4PA 3HNVL 1UGNA 5E1AA 4GI9A 3BH8A 3TN0B 3O2WL 4O9HL 5KVMC 3ABKB 4JDZB 4Q0XL 3D2TA 4N22A 4FFYL 2RALA 1VADA 4R84A 4L37A 5GHWH 4LEBA 4MA8H 1Y18A 2DWSA 4MA3B 3LZLA 3C5JA 1FHNA 1MF2H 1XDTT 3QH3B 1FGVL 1PCSA 4WFHD 3WCYA 4AQ1B 4W6YB 4BFKA 4H13C 5K9OB 4EMZA 1HHKA 2HJLA 6PAZA 4KHXH 2I07B 4AQAB 2A3TA 2PYEE 2D3LA 5D1XA 2Q8BL 4ADJA 5FKPB 1ZA3A 3N42B 4X6CA 5FOJA 3BEVA 2DV6A 5EBWB 1GIGL 3APNA 1T7XA 1BQ5A 4UMGA 5D1QE 5HPOA 1V8HA 2FJHA 4UINH 2F74B 1CXIA 1EXUA 4M6OH 3SGKC 2ADJB 4NZTL 2W9DL 2CHWA 4Z77B 2DLIA 5IR1B 5FECA 3X3GL 2E86A 1AY1L 3FRPA 1UZ6F 4FCHA 1KJ2H 4PVBA 4GIOA 5JOPD 1NCIA 3NCJH 3R18A 3WTTA 3PE9A 1BQRA 4E41E 3CK0H 2DLHA 2WVTA 3KDPB 4LBEB 4QRUB 3C8KA 1LK3H 2OI9B 3VH8B 4JVWA 4CGTA 2KZWA 3EOAA 3ECBB 3O4LD 4K4KA 1JHTB 5K69A 1IBGL 3CZFA 2L7UA 3L9BA 2B08A 3NCFB 2Z64C 2Q2EB 2YSSA 4AOFA 3ULVC 2IAND 2VQ1B 3UC2A 2A73B 4ANKA 1SEQL 2NY1C 2F18A 2Z31B 3QULA 1GAFH 1ETZB 2CKBL 2DM3A 4TSBL 5HJGA 4E42A 2AJXH 3DX8B 4PV8B 4TNVK 3ZDYE 2RMNA 3H9SE 4U7KA 3KVQA 4AQ8A 1I8IB 2B2XH 3GO1L 2HMID 1CL7I 1ZT4B 3LKSB 2NY3B 3NPSC 1AO7E 2UY6A 1NFDA 1KV3A 1WLHA 2XLLA 3ZUNC 5I5IA 3BSGA 3MUUA 1KEML 3DX7B 1G9EA 3WV0A 4LLYB 3ZE2F 4P2OD 2QDVA 5CCKL 2V9TA 4N2IA 4FQLL 3PU7A 1H8OA 4UZUA 1PIFA 1I85A 2JMRA 2ICWJ 1NGPH 3I84A 4GO8A 4O5LL 3V0WL 4HS3A 4I9WD 4XE5B 1R3KB 1U36A 3BVUA 3HLAA 3O4OB 4LMQE 5GRJH 4KXBA 1NCWL 1KIQB 1KTCA 3IB4A 5A2JH 4OGYL 1CE6B 3VFWB 2Y5TB 4IBLT 2HFGL 4AYFA 4JR9L 3BP7A 3WHE1 4OZFH 4OF7A 2H4EA 2WKOF 25C8L 4NO0A 3RWGB 1T7WA 2DH3A 4G7SB 2AV7A 2AJXL 5FHAH 1IGMH 4GO9A 3AG4B 1S9KC 1RAMA 5B39A 4DEWA 4YSSA 4DQOH 3A4EA 5D1XC 3OL2A 4TPRH 5GZOC 1SBSH 1A3LH 2W38A 2YC1B 3S96A 3SD5A 4R7NB 2JB6B 1S7UA 3ULVF 4JPVH 2WBKA 2VM4A 4U1MA 5INCA 1D5XB 1I8KB 4Y5YC 4ODHL 3MVSA 5FYLL 2N3JA 3GSUA 2R4RL 4YMPA 1E3XA 4XO9A 5DJ6A 1BEYL 1T1YB 3TNMA 1WT5A 2DQTL 1XSIA 1FORL 2NXYD 4O02B 3SGDI 2R2EA 4I87A 3HI1A 1YMMD 3T0AA 2Y06L 4G8AC 2HXAA 3BVTA 1X4YA 4HKJA 4NUJB 4YE4L 2O6EA 3GXIA 5DZ9A 1IEHA 1XMWA 1JK8B 1KGCD 4OGYH 2IWGA 4W81A 1T2QH 4OZHF 5JNYA 1L3WA 3G5YB 5LNGA 3E6FB 3SY0B 4L9LA 2E8ZA 2YD3A 4XP5H 1XB8A 2DPKA 2LR4A 1GPOH 2P45B 2H26B 4QWWD 1S3KL 1GKOA 2WXGA 5K1JA 2FGWH 1NSNH 3KPOB 1MI5B 4ABVA 1MCOL 2AEOA 5I8EB 2QADD 4QHUB 1KTDA 4JFEA 5GJTL 1CTOA 2P26A 2W07A 4Y16B 5EZJB 3CK0L 3SQOH 5JPMC 2WXNA 3IF1B 4CNIB 3VXMB 4YC2C 4EUPB 4AV0A 1MFBL 4OB5L 3ALXA 3WNMA 4L18A 2XJLA 3FT3B 4KZDL 1XH3A 4M5YL 3K2UL 2QGDA 3MV8A 4PH8A 5JW5A 5HPMA 1LMKA 1GSMA 2K4WA 2LW3A 4HJ0D 4PGEA 4NP9A 2MPAL 4LFHD 2AJSL 4N0UA 3IDNA 4G7YH 4HPOH 4J12A 3NOIA 1E9PA 1EZUA 1IAOB 1DE4A 4NQXB 1RURH 3EGXA 4XC1H 2F54D 4ELMA 2R1WA 1A7NH 5ALCH 2OQJA 5CZVL 4NRZA 2P48B 2YAPA 1IAII 1KZYA 4Y2OB 4XTRD 1GHFL 3FTUA 1NFAA 4QCIB 1CD8A 3SE3C 1M2VA 1NGWB 2ALWA 5DD6A 1RJYB 1TETL 3I9PA 5E03A 1GGUA 1EGJH 1XO8A 2KC0A 5K39A 1S7QB 2GITA 3KHQA 5E9NA 1TTFA 4GPVA 3RU8H 4K07A 1YNKL 3U4KA 4DZBA 4JPSA 1XSKA 4JHBA 2D0GA 2QZQA 2I07A 3IE9A 2ZX8A 3H42H 4O58H 4WI2A 4AQAA 5K59F 2EE0A 3GI9L 3U4BH 1K8IA 4A67A 5JXAL 4MD0A 4ZFZA 2FIRT 3VGAC 1T83A 4HEMA 3QXTA 5HDQL 3GDBA 2VDKL 3IXTA 1I1AC 1U8CB 4WWOA 1RZJC 2ENSA 4AL8C 5IEKB 1DBJH 3B8SA 5CJXA 2I27N 1BJ8A 2Q20A 4CADB 4ZTPH 3V4PB 3ABMB 4BWWA 1SJEA 2AMUA 3DUSB 2PPDA 4ZYKB 1JZEA 3U0WL 4Y2LA 4KI1A 1C5DB 4OZIB 4FF9A 5CUSL 2ZXAA 3WN5B 4NRYB 4OQTL 4AXWB 4XWGH 1ZE3C 4HS6B 4IIQA 1MJUH 4W9IC 5HY9B 1F58L 1YYML 4U33A 4FA8A 1UD5A 4PJ9D 4RMVA 5HGAA 5B7MA 4G7RB 2OP4L 3M17A 2CGZA 1OT4A 3EYOA 5CKGA 4DP4X 1I85C 4WEUD 2V2XA 4GUPA 4FMVA 4HIXH 4LF3B 1Z5LB 2P5PA 3IS1X 1NEUA 2GJ6D 3OAYH 2WSDA 1S5HA 3I3EA 3EZJB 3CX2A 4XN8A 4CMMB 2PWGA 4FFZH 3A5VA 2WIMA 1V7MH 4RFEA 4WTXA 3MHZA 1I9EA 4HCGA 3CVHH 3FOMB 4U0RB 2WQWA 4QHKI 2FR4A 5CKAA 4PMEA 3NIFB 1HH6A 4FTDA 4F80A 2TRYA 5BZZA 5L88H 3L4TA 2ZICA 3C08L 4JY6B 1IM3D 2R56L 4MAYD 1QSFA 5C0AA 3R06A 5FCUL 3IBEA 4PQXA 4R4FH 1GMIA 1W6LA 3ASOB 5CD3B 4HHGA 4MMZC 4JFZH 2GJJA 2PPEA 3LRGA 1GCFA 1Z9MA 4GS7B 2XTJD 2NTFA 1QATA 3EJYC 4IIZA 3K72A 4U2ZA 4PRBB 4PRPE 3QJRB 4B5ZA 2DJMA 5TH2B 3ECBA 4NC0B 2C7UB 1Q94B 1A7QH 4J3UA 4ZMQA 3MX0B 3PJNA 3ZX1A 3H9SA 4N2CA 5DRXB 3CC5A 1IE4A 2NY3C 3NPSB 3QFJE 3V0VB 1BREA 5I18H 4NIYE 1SGKA 2GSGB 1A47A 4K7PX 4P59L 4BUQA 1I7TA 3C8DA 4MAZA 3KS0H 1AC0A 2VZVA 3GEFA 1LDPH 3FN3A 4DGUA 3AW5A 5MI0C 3A24A 3HE6A 1NM4A 3L48A 2PXYA 3KPRE 4KAQH 4KUCD 3HB3D 2XWZA 5FXCH 4B9CA 1G9HA 3SZKC 4NQCD 4TPRL 2OFQA 1CCZA 3PAVA 5DJ6B 3B1UA 4GQ9L 3JUZA 4H26A 2ZUSA 4OKVA 2HLAA 3OJDA 4E68A 3RGVC 1HHHB 3RKDD 3WS3B 1HHGB 2OZ4A 2BX5A 2P43B 1LHZA 5AW5B 2IAMB 1M1SA 4DGVH 5DJXB 1DJZA 1E43A 3CX5J 2ZF8A 1P6WA 1IBZA 1TFPA 5KVGH 5D7EA 2N0MA 4AK1A 2Q86A 4HJGB 4PJ5D 3D3VD 2B3RA 1H3WM 2VGLM 4C55A 2CKNA 4U6HA 3QZLA 5EEVA 1T21B 1RSYA 3D3VB 3RVTC 4Z0BH 5DJCB 4NLHA 3CZEA 3LEVL 4TL5A 3B3IB 3KG5A 5DUPL 5IQ7L 4ZUSB 3EFDH 4X83A 2IH3B 3I50H 3ZE1E 3SBRA 1X9QA 1RZ7H 4I0CC 2WXQA 5EU5A 3S48A 5AFAA 5JHLA 4O00A 5IROA 3EFOA 3TPKA 2E74C 4JDEB 1IU1A 5C6TL 3MV11 3X3FL 2GKIA 4QRTB 5HYSB 2I9TB 4LP8A 3DX9B 1A8ZA 3EF7A 5HYJB 4P2OB 4MXVE 5LCVA 5T5NF 3W9DB 1M7XA 1DVFC 4N0UE 1ZT4A 3CXHJ 2CKBB 4LCCC 2ALAA 1S6NA 4KO7A 3NN8B 4LSTH 3MREA 4WO4A 4XVUC 4DZ8B 2R1WB 2IWEA 4HBQA 4U1KA 5JHLL 5D5MB 3EAKA 5J1AB 4P4RB 2H26A 3MYZA 1IGML 1GS6X 3QI9B 4ZOAA 3VI4A 4JO2H 2QKIC 4R96B 4XVTL 1XGTA 1KTDB 4JFEB 3DRTB 4GUQA 3DHJA 1LP9F 5FYLE 4HD5A 3BSZH 4C4BA 2FX9L 2OR8A 5ISZD 1WHOA 4XE0A 2X9WA 2PNDA 4Z3GA 1G1CA 4P5TA 2XX0A 3OZKA 4BIKA 3ULUL 3JVGA 4EO5A 4NFBA 2HZHA 4G2AA 1K4DA 4LHQB 4GAFB 5IBTH 2QKSA 3NIGE 2Y24A 4OD2A 4LCYA 4P5TD 3MNDA 1OP5K 3FQXB 1RUQL 1IAOA 1XF5A 1WSST 1X5KA 4OLZH 4E9SA 2HJKA 3V9EA 1BMGA 2G3XA 1J5DA 1J0JA 1JGUH 1IC5H 3D52A