1J8RA

Binary complex of the papg receptor-binding domain bound to gbo4 receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
b'WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYELONEPHRITIC ADHESIN
publication title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor.
pubmed doi rcsb
molecule tags Structural protein
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 1j8rA00
4Z3JA 1J8SA 4Z3IA 4Z3FA 4Z3HA 4Z3GA 4Z3EA 1J8RA
chains in the Genus database with same CATH superfamily
2DJ4A 2CBOA 4U7MA 1XIWB 2ZX7A 4QRSA 1Y18B 1UJTA 4P2RA 1BJ1J 1I7RB 4LLDB 4NZRH 5ICYA 2KDGA 5LNDA 1DVUA 3A6BH 2E74C 4HS6B 2A2QT 5CJQL 4GG6E 2RTTA 3RNQA 4EZJA 2P8PB 2VR8A 3BVXA 1V3MA 4NRXB 4YDZA 3RIKA 1GH7A 5HDLA 1M71A 4JDTH 3NH7H 2EH7L 5F7DB 5FKAB 2YOAA 1I8MB 1UZ6E 5D6CA 2VXUH 1PMYA 2E59A 2EVJA 3D06A 4KKCC 4Y4KD 1QKZL 2J88L 2HT4C 1DSWA 2MQ3A 2XXMB 3K0WA 2LFGA 4N20A 4PGEB 4KOCA 3ZDWA 4HV8B 4Y7OC 4M6OL 4HKZA 1IBDA 5BZXA 1Q9WA 2YJLA 3DV6B 3KYNA 2EEAA 3MODL 3DVFA 3MRFB 3PWPA 1LO3L 1MCFA 4MA1C 5B8CC 5IQLA 4Y2DD 1XBDA 4E36A 3GUTA 1AGDA 1KPUB 2HFEA 2HRPH 3QRBA 4JKKA 3UO1L 4QNPE 5I1HL 5LDUA 1L9QA 1IGFH 5HJBA 1MJ7L 1U93A 5DJAA 3UJJL 1P0SE 4MB3A 3V6ZA 3Q2WA 1W80A 2NX5D 3S8GB 1KV7A 3EADA 2GFBA 2Z0BA 4LPCA 3QI9B 4X5WB 4Z8FL 1E4WL 3FN3A 5ILTH 1CGSH 5B1KA 1OAQH 3K81A 5BV7B 1FNSH 2APFA 3NCYP 4ENED 3WS6C 3CHOA 4P9HL 4LF3A 2DQEH 2O5XL 3NABL 2WLHA 3HNTH 4HEME 3KLAB 2CGRL 2EE6A 3ATDA 3UADA 1A3LL 2W95A 5JXEC 2BNQB 1A7OH 2MEJB 2YZ8A 1BQ5A 1UADC 1W72L 2K6ZA 4P4KB 5JMRA 1J11A 2PXYD 4EI0A 4OZ4A 3VWKA 3CDZA 1MFMA 5D96B 1NWOA 3MLYH 4TVPD 5KZCD 3I6LE 1K4DA 1TF4A 4GW4A 3TPKA 3FSVA 3HAEG 5ISZE 2ZAGA 3TZVC 2JE8A 2OTUA 2MKWA 2WWMD 2AC0A 1JI2A 2XJKA 4Z7WA 4HIIA 5HHVH 4HMEA 1XX9C 4FRWA 5DJ0A 5IW6B 5GXBB 2J71A 2CSPA 5DT1H 5BS0B 1F02I 2V9UA 3QDGA 1MFUA 5MEOA 1G94A 1JN6B 3X3GH 4FLHA 5F89A 2AJVL 4PJ8A 1PZAA 5FDWA 2BK8A 2EDXA 3MV7B 5JMOC 1RZGB 1KENH 1XCQB 2YWZA 3ARDB 3WENA 1OALA 3TA3B 3VXUE 1JZ6A 3RVTC 1DJYA 1ZY9A 1J8RA 2AJSH 2XXFA 2AQSA 4F15B 1S4IA 1Q72L 3DYPA 2AJUH 3HFMH 4Y5YB 5EBWB 5B3NA 1VZHA 1FNFA 2NY5H 4OAWA 4GPVA 2DYPD 2Q0ZX 1E7VA 4G7YL 4J5VA 4O51A 3DIFA 1E43A 2RAMA 1QBLL 3SDXF 5D1ZD 1DJWA 1UENA 3VQMA 4FCHA 3MLVH 5D1QE 3EOTH 2PTTB 1F0LA 3TH4T 5I17A 4TPRH 4P23A 4KK5D 4JG1H 1CI3M 3IJHA 8PAZA 2MNUA 5CEXA 2FWLB 3EFDL 1Z5YD 4W9EC 1I8LA 3JT2A 3S3SA 5HHOE 2XN9A 4XPTL 4X0KA 1PG7H 3VSUA 5IQ9B 4PJ5B 4KKQA 5E7BA 3MRRB 5D2LA 2XA3A 1QACA 3CFUA 3REWB 2XG5A 1AHWC 5JHDB 5CF3A 2VDQH 5IB5B 2VSCA 5IQ7L 3MRQB 2NNXA 4K9EC 5MENB 2HJFA 2OR7A 3DBXB 1NC2B 1U4FA 4KHTL 3TN0B 4BD4A 5I5IA 4XVTH 3KPNB 5AW5B 2QPSA 2YPKB 4Q4EA 1TZAA 1IGMH 1AMYA 3F85A 4JGJA 3D6GA 4BHUI 4GKZA 4J3OH 4JVUA 5CD5D 1N5YH 5J11C 2P5WD 4GKLA 4PGDB 1FORH 5IOPA 4IU3B 3LZFL 5E2VL 5DJ6B 5EOCH 1QR1A 1T22A 3BP4B 4UAOC 4WWKD 4AENA 2YFNA 4LPYA 4I3SH 3KWUA 1CXEA 1UHVA 1UA6L 3U4KA 2E8ZA 1ED3B 1XB3A 3L1OH 4U1JA 5I1KL 1E67A 5JXAL 1FLRH 2CKBB 2E7BA 4CILA 1N5AA 3NIGB 2P8LB 5C70A 5JPMA 3M17B 3FPYA 4H13C 1EO8L 2C4XA 4BFRA 2OL3B 3AZUA 3KPMA 1P1ZB 2FR4B 3UGXA 3QDJD 4ODWA 3DGGA 3UYRH 4BFNA 4XN7A 5AW9B 5EBLB 3W82A 1U8JB 4N8VG 2FJHB 1QEWA 3H53A 3FFCE 1MI5E 4OGYL 3VSQA 5FHAL 1U2HA 4L4VD 2Z93B 3CXDH 4Q2ZA 4YXLH 1YEKL 2EC9U 3SO3C 2AGJL 3AB0B 5I8EA 12E8L 2L8AA 2LU7A 2DLIA 3A6CH 3T8XA 5I2IB 4WW2B 4LSVH 1ET5A 2BSDA 3RVWC 1A4KA 1EMTL 2H2SC 2W1NA 3MJ7A 2LVCA 2ODHA 4Y1AD 3F12B 3B4NA 2G75B 4YXHH 3ULUL 3MMEA 4WHTB 1G7LA 5ACLA 4PIRF 2CLRB 4B0MM 5ICZA 2JNZA 2O6CA 5JW4R 5BUAA 3HZKB 3KDMA 4UI2A 3GIZH 5FK9B 2XCMC 3EBIA 3ULVE 2AK4E 4WVRA 1CLOL 3P4OA 4AW7A 1S7WA 3OR6A 5MEPA 1A9BA 1XGUB 1WTGT 3DPDA 1NC4B 4KQ3L 2CWRA 3KS0H 4M1CC 3KPQB 4RGOH 1AD9B 3SPHA 4B0MB 4QRBA 3B2DC 1Q9KA 5DS1A 1TVBA 5LUMA 5C9JB 4LEEA 1UOVA 1FZJA 2WXRA 1YY8A 2AXWA 3UIYA 4CGUB 1B3IA 1H8LA 3D69A 4H8WL 5ADPL 3QIBB 2Q5BA 5C7ZA 5C92A 4HJUA 2C3WA 2CO4A 2DIEA 2FQDA 2BSTB 2Y7LA 2R51A 3KPPB 4YK4C 1AZVA 3U1PA 5EUOB 3RTQC 1RIHL 4IU2A 1WP6A 3PNWA 1X5LA 3DX3A 4JM2D 2ITFA 1QSEA 1E90A 2E27L 2YAMA 2ZYIA 4NJ9H 5BVPL 4NBXB 3WFHA 1KGUA 4HAKA 1NGZA 4MQ7A 3KGUA 5B8CA 5IVXF 4C58B 5G4OA 1FVCB 5JUEH 3ZVVA 1JSYA 3VFVA 1KMGA 1EZLA 2FUTA 2ENYA 2FL5B 4N2MA 4ELME 3P11L 5EUKB 1N26A 4JQIL 1G5GA 4FA7B 3JYCA 2WCSA 3FQXA 4XP5L 4Y9CA 3QIUC 3L45A 1KUMA 1R3IH 4DWHA 1COBA 4NPKA 1BVLA 4RFNB 1MCSA 3TEZA 5FW6A 4MNQB 3NTCH 3JTTB 3S2CA 3W2DH 2OTWB 2JJSC 2KZKA 3U6XS 2IH3A 1BVKB 1EAOA 2NCEA 4OIIL 4CKVX 3IDYC 4GUCA 1K8IB 2QVIA 3MNWA 4NIKB 3VXRA 4YXKH 4BSWA 2X4RA 2YAOA 1YO4A 5JXEA 5HYJD 3T8VA 1TJIL 4MYPA 1L9RA 3W0WD 5TGBB 4LSTL 3FTGA 4RNRA 3IJ7A 5D4QA 2A0LC 3QQDA 3D50A 3ESOA 3HZYA 2QSCH 4IEFB 1BVZA 1E5BA 4JVWA 1NCBH 5CMAB 4ZUTA 4AG4L 3WKQA 4M4RB 3TZVA 3BUYB 1T1YB 4LDOB 1OP5H 2ZT9C 4UBDD 3BE1H 3MU3A 4YHZH 3OC8A 1ANUA 2AXGB 4JO2L 5D70L 2PETA 3RZWA 2ZOTA 2ZP9A 4E0RB 3BSZA 1UD4A 1CFQB 1KWKA 1E4JA 5PCYA 4JRYA 3MRCA 4NUGL 3IRCA 4HKBB 1FLTX 1E42A 3RTLA 3DSNB 2NXYD 3VUAA 2PW1B 3BWZA 4OF5A 2DLHA 3GBML 4GKNB 1U91B 3QDME 1WDAA 3OKMA 1WF5A 4B9ZA 4U1IB 3KYOB 5DRXB 3TJEL 3IFPA 3X13A 2VH5L 3A4EA 4XPHH 2X9YA 7FABH 4LLWA 3IJYA 4P5TB 4ZMZA 1KJVA 4RDQF 2WQUA 4IRJC 2GSIA 1S7TB 2OJEB 5C0DB 1GA2A 1KCSL 2B3IA 4XCFH 3Q7JA 2DLGA 2BS9A 3RGBA 1TETH 4WQOA 1AFVH 4TUKH 4A2MA 3NFSL 2X0UA 1BREA 2I9LA 5EA0L 4V11A 4FJZA 3SDDD 5ACMA 5G4MA 4PJGB 5HGDB 1EZVX 1NOLA 4WUUD 1XMEB 1HHKA 3HG0A 2J1YA 2V5MA 5EWIH 2BSSB 2OJ1A 1PDKB 4JHAL 4KKBD 1AD0B 3D12B 3KYAA 4IRZH 3W9EB 1AKJD 2CPCA 3N44F 5DD1L 2APTA 2IVFC 3L3HA 2NMSA 2B0SL 2Z9TA 3LRSB 2CHNA 4QRPE 1TJHL 3GS4A 2FO4B 5HTSA 5MHSE 1AHWA 4V1DA 3CFDB 2FJSA 4FQLL 1MW3A 4I2XB 3UJIL 3WIFA 1D9KD 2X88A 2CBMA 3PFQA 3VYPA 4Z7OF 1CDIA 4P4RA 32C2B 5J12B 3FNKA 1G9EA 3D4YA 4JM2F 3HIZA 3IVKB 4QKXB 3BAXA 4HEPG 4W9IC 3CZSA 3CVHA 3U7WL 5INCA 4JGMA 1WHOA 5DZVA 3JZ7A 1UWEL 5GGSB 1NUFA 5E2TL 5E9DA 5LBSL 1SLWA 3KNBA 4ESKA 4XI5C 1EWHA 1R5WA 2VMEA 3C87A 2I5YH 5AVWB 4OJCA 4A7TA 2AANA 2DQDL 3RWEB 3G9AB 3C60C 3LQZA 4KMTH 4RBPK 2NDGA 5DS2A 3PWJB 2O30A 2D7NA 3PUUA 1E50A 3RBGA 5JIIA 3MRLB 2DLEA 1IIIA 1RY7B 3QXDB 1IZKA 5DQ9B 2Q3ZA 5FM4A 2NY3C 1R0AL 4NOFA 4ZXBB 1VKXA 3SE6A 3WLWD 4TM9A 5K9QG 2QGDA 1II4E 5E8NA 1BDYA 3R7QA 2X2JA 5KVMC 3AAZB 4TQIA 2XA8H 3FUJA 3VMNA 5GS2D 3RFZB 1T7XA 5F21B 4PJEE 3FPXA 3PXLA 4ODHL 4MB1A 3W5NA 3QCVL 4LFHD 4XMKL 2TAAA 2YHGA 4FZEL 4Z0XA 2F58L 3K72A 1U21A 4LLUA 5ESVB 2M26A 4JFQA 3TBTB 4OB5H 2XZQL 3TNMB 1HVXA 2PPFA 2AJXH 4FLSA 2OJZL 2EUWA 4AH2A 2Z1PA 4D0DB 4ZQTA 3M1CA 4X4YA 1NFDF 3RFRA 1UFGA 2MHAA 4HIXL 5AW1B 4BKTC 3PAZA 2JIXD 1BAGA 2VE6B 4UZGA 3ARSA 4FTVA 5F7LB 2Y3NA 3O8XB 1CQYA 2OMZB 1RIVL 3MBED 5F7AA 4UQIM 1XD0A 3O6FC 1EH9A 1KB9K 1B90A 2BDNL 2JCWA 3MCLL 5GGSY 2Z92A 4L05A 4EQ3A 2X44D 4EN3B 1PQZB 2ZCKL 5E99H 1BSIA 1G6RH 4G7RB 1DFBL 1BEYH 1I9RL 4FG6D 2XZAH 3RVUC 3FT3B 3I84A 1HU8A 4Z23A 1OWRM 3ALXA 1A14H 3MQIA 5K59F 4CUCA 4EI6A 3VI3B 2ZJSL 1I1AC 3QULA 3JTSA 4KY2A 4MMXB 2GPZA 2JJTC 1YHPA 4WU5A 2VL5B 2UYLA 4NC1C 4QRRD 4U1KB 4P2QB 3LQAH 4MXVE 1DVZA 1IAMA 1TG8A 3T09A 2MCG1 2N4IA 3QRGH 3RAJH 2XC8A 43C9B 4UWQB 1S9KC 4JJ5B 4XPGL 4TOYL 2CDEB 2K7PA 2CO6A 3P3SA 3KPSD 2GY5A 4Y1SA 2GBTA 3CBJB 5AAMC 3SYOA 3V6OE 5L8LB 4O4YL 5KG9A 1IM9A 1WPCA 2F54A 5D1XA 3NRQA 2FX7H 3ABGA 3FCBA 4QOKA 5F7EL 4A38A 5AYUL 3S35H 1M2VB 4CC0A 1QFWM 4PN6A 1U3HA 1M6OA 2N0KA 3CFJB 1ET7A 4GRWE 2PNDA 2QFRA 4GP8B 5I30H 2DRUA 4OY9A 1PAMA 1Y07A 4EAEA 4XMPL 4EUPA 3QIUA 2EDQA 1BOGB 1HL9A 3IMTA 5F96H 1DVSA 1M1SA 3WJMB 1NUNB 4ZX4A 1UM6L 3LSOB 5DHYA 3MGOA 1XR9B 1RK7A 3MR9A 2EXWC 1RZJC 2JJSA 2DQIL 3BMVA 3W9DB 1X4YA 4L3ED 4PJIE 1J18A 3E1F1 2X3CA 1GTFA 4XXWC 3FB7B 1CFNA 3S37H 3LCYA 3TWCL 4J27A 4AEIH 4ZSOE 2ADGA 4OM0H 4WWNA 1EAJA 3KDPB 2NNFA 2FLRT 2NY0C 1INDL 2CKBL 3SGEI 3U1SH 3BD5A 2JTYA 4I85A 1V05A 2OL3L 3BEVB 3EYFA 4HKJA 5IB2A 1IC0A 1PX8A 1UB6B 1WGOA 4JFFD 2R59A 4BFKA 1V5JA 2OMVA 3I9AA 3U82B 3D85B 3OF6D 2F8XC 2ZKHL 1CICA 2A4ZA 4Z7NB 4X0NA 5K9QI 3T9WA 1E9QB 3FB8B 4MA8H 4G6FB 1R3HB 4JN2B 4KDVA 1AI1H 1SJHB 5DD5H 1F3RB 4X5RA 5EU4A 3ZYOA 1YG9A 1MCEA 4WNQA 3RNKA 2QHRH 1DUZA 4Y4HC 3TBSA 2A99A 4NXKA 3UCRA 4JMXA 1Q9LA 2FZ3B 2YD7A 3QQ9D 3LD8C 1FN4B 4HISA 1OP9A 1FZOA 2KUTA 3MCG1 4F7TA 4IDLA 4LKCB 4KK6D 3HZMA 4PRIB 4NZDA 5DFVD 2CDFA 4OZFH 4C83B 5E6IC 1OHQA 3TCTA 1AOHA 4MNGB 2DQUH 1TZIB 3WFEH 3WY4A 4IRJA 4N2CA 2K70A 4PJBE 4MD5A 1QPXA 4YR6B 3H9SA 4FQCH 1H8OA 4XC3H 4J12A 5B1CA 1MW2A 4C59B 1VFAA 3O2DA 4XHQA 5DYFA 5GS1C 1I9EA 1U8QA 2YD1A 3BEWB 4LLMB 3TNNB 1T5XA 3LPOA 4HGWB 4TS6A 4YUEL 3VFOA 3MRBA 3I75B 5KSAC 5D55A 1KIUA 3CCHB 4K5PA 3ARGA 2HKAA 3SKMA 5I82A 1O5DT 3QUYC 5HGAA 3K1DA 3MRGA 2BMKB 1WVZA 1A25A 1RK0B 4HK0A 4Z7UB 1ITBB 1JYNA 1INQB 3EJZC 3LY6A 5EH1A 2NXZC 1ZSDA 2D73A 3MLRL 5G4NA 2D4DA 3G5VA 1SRDA 4ANVA 5E1QA 5FS5A 3QORB 5JIDA 2B77A 1OVZA 4QEGA 3CC1A 1KFAL 3EGSA 1IAKB 5D7HA 2V8LA 5GS0H 2R29A 3K5RA 1RJLA 4XGZA 5DCCA 1G0DA 5EULV 2P8MA 2WPGA 3ARXA 3BH8B 4UT7H 3TURA 1A7NL 3KXFB 4MCNA 3H42H 4TLTA 4NQXA 1ZPLA 4PI0A 5FWQA 4M43H 2B9AA 1O6SB 2PCPA 3WFDH 1CXKA 3V8OA 1C16B 3H3PH 4XR8C 2CPUA 2XDHA 1NCCH 2Y1VA 3TBYA 5HD8C 1NQBA 4NZRL 3OKYA 3ZTCC 1AYRA 3A6BL 4XCEA 5DHVA 3DMMB 2VN3A 4DSYA 2QDVA 1WAAF 1KB5H 4G42B 1MFAH 3MHZA 2V2XA 3VGAC 1F56A 1N19A 4JDTL 3NH7L 2WXKA 5DI8A 2ZWNA 1RZ7H 2VXUL 4FI8A 4XPFH 3EDKA 3LNGA 3CZNA 2XBTA 2UVFA 5AYQA 4DVBB 1Z3RA 2X6CA 4M00A 4K9JA 3UIZA 2G4GA 1URZA 1UT2A 2EDWA 3BT0A 3QUKA 2O6EA 4DESA 2HJKB 4M4PA 1UQSA 1H3VA 4A6YA 5JW5A 5IMKA 5TDOA 4N1CA 3GKZA 5IHZB 1WFOA 4AKOA 2Z35B 4QRUA 3U36B 3ABLB 2CJ3A 3PWVA 1NUGA 3MRPA 2WLLA 5DJ8A 1CQKA 1MH5B 2HRPL 2H9GB 5MERB 5TH2A 3O6FA 2QPUA 1N12A 1JVOA 2VB5A 1KELL 3BLKA 2GBVA 4JQXC 5HYSB 2V4LA 1AXSA 3AS3A 2E6QA 5DZ9A 2A6IB 5CN2A 3T65A 3MNVB 2Y5TB 2NSQA 2BIQA 2YGPA 3QEHB 1EO5A 5ILTL 1CGSL 2NY2D 1G1OA 4PJHF 4BWUA 1OAQL 4CW1A 2GAZA 4UNVA 4JRXD 4OF3A 1BZ7A 2ZOKB 4BFFA 2DQEL 2JJTA 1SZNA 3HNTL 5IHBA 5BS0E 2IJ0C 3QNYA 4PLOB 1HNFA 2COVD 4A7UA 5JIMA 1A6AB 1A7OL 1TQUA 4QR7A 4D0BB 3QNZA 1U95B 3AS2A 4L29A 4MX7A 4Y19D 4PRNA 2VLRD 1N10A 4CC4C 4LNVA 4JL2A 3T6QC 1GKEA 1KGIA 2YUXA 3MV7E 1OAKH 4N0FA 3BGMB 1EJFA 3KZ8A 2JCCF 2CUIA 3QZWG 4M02A 4UV4H 3O2VH 3DUUA 4A2DA 4D9QD 4K8RD 5HHVL 1E9OA 1HINH 4HUKB 1L9MA 4GAYA 4XWOC 3BIBX 1JNHA 5DT1L 4X6FA 3EHBD 4GO9A 3RWCA 1FFRA 1T4KA 3OJDA 5D5ME 5CHNA 4BUGA 5ANMA 3NIDF 4N3UA 3U0PB 3KGRA 5AVTB 2J1WA 3BQUD 4R7NA 3X3GL 3ARYA 5JOFA 1I7TA 4Y4KB 4LXFA 3OB0H 4M9PA 3OX8A 4JFYB 1IV8A 1KENL 3L13A 1HAUA 2WLMA 1NDGB 4WK2B 1HHHB 1E3ZA 1IGYB 4FYRA 3RVVD 1RUPH 2AJSL 3L3GA 2BP8A 4PEEA 2P5ED 3SPCA 1RPQA 3NUKA 4OUUB 2AJUL 2EDJA 3HFML 1QRKA 4K3JH 4K55A 5DFAA 1AZUA 2NY5L 4X7TA 4PJ5E 1LD9A 4NN5B 4L4TD 3TVMD 3UAFA 4PW9A 1D5BB 1GIGL 3HRPA 3UTZA 1FL6A 3QFJA 3HUJA 3EOTL 4WU7B 4KKLC 4HH9B 3ZDZB 5KSBB 2PW2B 4IKJA 4JB9H 1RUKL 3B3BA 4PWIA 3ECVA 3FDWA 1TTCA 4YHPA 5BZWB 5AD0B 1IZJA 2EDYA 2NX5B 1SMAA 2H8PB 4QYOA 2GTWB 4YS4A 4PGCA 1GY1A 3MOBH 4WF7A 1PG7L 3FUHA 5F6HI 3LEYL 4OIBA 1NCNA 4RAVB 5LN8A 1D5MA 4UQ2A 5F9OH 1Y0LB 1UA7A 4OZGF 2HSIA 4ZI8A 4YHNB 1ZLDA 4Y4HA 4IBSA 3NT0A 2NY4C 2IFGA 3C8KB 3RKPA 1E28A 5K9OB 5FPIA 3QHFH 3I9PA 5FF6B 4NI3A 4KVPA 2EYRB 4YO0A 4LEXH 2WTRB 5CIPH 3HC0A 2EIEA 4LQFH 4RSVA 5FGBC 3F7PC 4XVTL 3F65A 5E6IA 2F7QA 3HR6A 4LCWD 2PO6D 4PLJD 1S9YB 1TQWA 3QHTC 3MFGB 2PXYB 1IGML 2OMUB 2DBJA 5EIIB 3EO0B 5AVXB 4PREB 4AE0A 1GSKA 3NIGE 3LKQB 5E23A 5DGQA 3D33A 4ZX6A 1OGPA 5KZCB 5IMLB 1BQHB 3GNML 3LRHA 3O3BA 4QRQA 5FYLD 3SE4C 1N5YL 1WZ1H 3LHPL 3DVGA 1XCWA 1FORL 3D0VB 4AEFA 4EIBA 5E4IA 4WSJA 1L6ZA 4ZO7A 4PV8A 2OMYB 5FCUL 5GS1A 5I8KH 4NO2A 2XT1B 4I3SL 2RBLA 2KQNA 4G8FB 2HKHH 3JXAA 5ELIA 4WDIB 3ZSTA 1E8ZA 4UTBL 2PWDA 5KSAA 4MCYA 4OFDA 1A8JH 3OC5A 3INUL 3C5SA 5AG9A 3GLAA 3QXUA 5DF0A 4HZLB 3QUYA 1CBVH 4M5ZL 4UDTA 5CU9A 4UIKH 2OI9B 1E8YA 2X4UA 3DETC 3EF7A 4YE4H 1N67A 4P3DB 4YNYA 4PWHA 1UM4H 2CIIB 1ULVA 3D0LA 1KYUA 1X6NA 3FUKA 3QUXB 3Q1SH 1ZGLA 3H8NA 2AEPH 2QV2A 1NIBA 4JY5H 5BZDB 1GGIL 4EN2A 4AMKH 3VFUA 4UT9H 4LSVL 4P5KB 5GS2H 2FHCA 1HOCB 1G9MH 3T8MA 3TO2B 2APSA 2H1LM 1KXVC 3FFDB 3ZMEA 5FAAA 4I4WB 4NRYA 1S7VA 1H3WM 4HK3N 4JVPA 4YXHL 5MEQB 3VG9C 5DA4A 5FO9B 3C6SB 1FVEB 2EEFA 3M07A 3QXAA 3FTWA 5GSRB 2R15A 1ACCA 1OTTD 1BZDA 4UQ3B 3WV0A 3B9DA 4OZFB 2GUOB 3GIZL 3I85A 3EF4A 5DURD 3OQRA 4A1RA 5EUOE 1YQ2A 1BLNA 4N4YB 4YHYC 1SOQA 2DWEA 4ZFZA 4Y16B 4KV5F 4LEOB 4YSRA 4KUCD 4RGOL 3UTQB 4KXBA 2UXGA 2OP4H 4YGAB 3KGTA 2O72A 4FFZA 4G1MA 1CDYA 1G9NH 4E9LA 5FV1L 5D93B 4F58L 4U7SA 3K6DA 1L3WA 2HXAA 2VO5A 4Y1TA 5L0QC 1FQ9C 1ICTA 2X1WL 1NMCB 4N2BA 4G70B 4Z7VA 3RE0A 5HVHC 1R34A 4KO9A 3ZE0B 1TO4A 3WHE0 5GGRA 4M1GL 4TRPH 4TQ8A 3I6GB 2P5WB 3UPRA 5CWSA 3CFQA 2XV6B 1IBZA 4G2AA 2DF3A 3D8MA 4WWKB 2J1ZA 1TSRA 4XRCA 2NYYC 1KDIA 3B7TA 1JGIA 5LG6A 3L3DA 4GQQA 2GHWB 4PPTA 5KOMC 4ZS6D 3NBNA 1QI3A 5JUEL 5KW9H 1OOWA 5KBDA 2XWBA 4NN7C 4K7PX 3K0YA 5C07D 2OXGA 3ZQWA 2WXIA 1WS7A 2ILLA 3Q2NA 5GJTL 4JQXA 4XOBA 1ACYH 3QQ3B 3TBVA 3THMH 5ITBH 1R33A 4MAZA 1IILE 4PRAB 1CFSA 1L0XA 5IKCB 5HGGS 4PV1C 1R3IL 3DKHA 5H37H 4XHJD 5BOJA 3SDCC 4L4VB 1ESOA 1JF1A 4ILDA 4KK8D 4J7RA 5DD0H 3EJQA 3W2DL 1XGQA 3ORJA 1BOYA 1C5BL 1MNUL 4PRDA 2Y2YA 6TAAA 4WENB 3IKCB 1MHCB 2BXYA 4X9BA 1YEFH 2G5BA 4FMFA 4QHKI 1JI1A 5MP6H 1AC6A 2B7DT 3CHPA 1YY9D 4CNIB 2EIMB 4F20A 3EXLA 1WG3A 1BAWA 1KB5B 3F7QA 5CM1A 1ODAA 2QLYA 5DMKA 2QADC 4LHUA 4JKPH 4CC4A 5I23A 1AG6A 3FN0H 1NM4A 1NGXA 4QRTB 4QDGA 2VMCA 3LZPA 4RRPG 4CJ1A 4KAQH 4H1LG 3FT2B 4W70A 4Y9GA 3RURA 5DRZB 4CRPA 4LL4A 3IJSA 3SDYH 1DN0A 2BWDA 4HUWB 1TNMA 3DHJA 3U83A 3BE1L 3QIWB 4YHZL 1M05B 3KAAA 5J13C 2CLZB 1JGEA 2DKUA 1UCBL 1GZPA 4DVRH 4Q56A 4BYHA 1FH5H 2FSEA 4I0PB 4R97C 3QCTH 2P45B 4K07A 4H0LC 4OLUL 3D87B 3ES6B 1BFOB 4LCYA 3NMEA 5EFIA 1S7RA 1EZVY 2B1HH 4RSYA 1B0GA 4ZW6A 5ALCH 1QLFA 4PJGE 4HJJH 3L4VA 1IAII 4NRZB 2C9VA 1T1XB 3AXLA 3L95A 4RZCA 1ZIBA 4BQBA 4XPHL 2DQCH 3BC9A 3UTSB 3I9GH 5IOKA 4NI6A 3FAWA 3EJTA 4IHOA 4DN4L 4PJDF 2P1YA 5JW4Q 4F2MA 3BX7C 1P6FA 5F9WC 1EXGA 1N8ZA 1TETL 2X89A 1A7RH 1WITA 1AFVL 3F7RA 1INEH 2DJUA 4JRWA 4TUKL 3VFRA 1BVOA 1KYDA 2DL9A 3WIHH 3PDDA 4HHAB 1T03L 1HEZB 4OFYD 4WFHE 4Y7MA 1AZNA 3VXSA 5I74C 3E2HB 5EWIL 4KXZH 4HHWA 4IBZA 5EZLB 4QIRA 4N3TA 4F7CB 2F5BH 3HNSH 3ZN6A 4K5LA 4HU8A 2IAND 1XF5B 3LS5H 4G8EB 4HEPA 4IRZL 1B2WL 3MJ9A 1GW0A 2FT7A 3FOLA 2P28B 3Q3GA 2WZAA 2HLAA 4HWNA 1ZLSL 1ZOXA 3DVNA 5DK3A 3K2MC 4PRHD 3A4AA 4RWYH 3EOAB 1PFOA 3U9WA 4BQ6A 5DO2C 1W0VA 5INDB 4OJFH 3MGAA 1BCIA 4Q97A 3GGWB 4RQQA 3WO4B 1LQSR 2ICWB 4JX0A 1KIRB 3EO1B 5FGBA 1FJ1A 3NK3A 3CZFB 2XQBH 1KCRH 2R4SH 1YNTA 2DMHA 2J3SA 3CFIC 4I0CC 4NT6A 3ZDYF 1UH3A 2A9BA 1IFRA 1RERA 4H8QA 4U1GB 5EZJA 5IB4B 1P7QA 2I5YL 3SE4A 3G08B 4LOVA 4D9RD 4R0LB 4KMTL 4MSWA 4PJCF 2Y07H 2X5PA 4AMXA 2BZCA 3GEWB 2HTKC 5F70A 4X80L 3TASA 1QWHA 2JKSA 4B6ZA 2VLKB 5CXPA 1FUNA 2BVTA 3KBEA 4W68A 3U46B 2OYLA 1XGRA 4K71B 2WZ5A 3AQZA 4DK3A 3WY3A 1DQQB 3FB5A 4XCCL 4ZZFA 3GXIA 3LKNB 3A21A 4ZOEA 2DM2A 4PJ9D 5F9JA 2J72A 2KS0A 2VKWA 4NQDA 1O9ZA 1P4IH 4XP4H 1MREH 3RX8A 2AP2A 4E9SA 2HTLD 1OAJA 2EXTA 4KH9A 3K6NA 4F1ZA 1NMBL 4M48H 4LARH 1NLDL 5IJVB 3V0DA 5F97E 4C8XA 2AJXL 2JI1A 4JKLA 5HPMB 1LP9A 1DZ0A 3U30C 3IDNA 5BVJA 4FQXA 1NUDA 3VQ2C 3OXSB 4WKXA 5CBAA 3SDDB 2KH2B 4L3CB 1DL7H 4N8UA 5L2JB 1KXVA 1CXLA 4ODTH 4WUUB 3KJ6H 2N59A 4X50A 1AQDB 4WI3A 2F18A 3EFOA 5CIPB 1NBZA 1YYCA 3RX9A 1T0MA 2MKLC 4PRPD 4HFWA 2HJLA 3VI3E 3V4VA 2L04A 3NJNA 3HC3H 1SJVA 3RHWK 4P2QE 3OGCA 4MKTA 1JD9A 5E99L 2D7MA 1DBBL 3HLAB 3OAYK 4NQCB 1YYLL 5EV7A 4YHOH 3PHOA 4XCNB 1YEDA 3IDMA 1BEYL 3M1BA 2A6JB 3GM0A 4G5AA 2A9NH 5T1KD 5I0WA 1GRWA 3IB4A 1PLBA 4AM0B 1TSHA 2ARJQ 1FCCA 3MV9B 1A14L 1YJDC 5C08A 2DM4A 2CH8A 2H47C 1H0DB 3NZHH 4X5PA 3SD2A 5SV4A 1CIDA 5ESAA 1BIIB 3LQAL 4N8CH 1I75A 3GSUB 2D7TH 1FGVH 3SBRA 2WY3B 1AACA 3QRGL 4LLQB 3TO4C 3QH3A 4NKOA 1A6VL 1BZ9B 4EI5B 5GIRA 5A3IC 4A7VA 1NCOA 3BKYH 5D7IB 3AQXA 1J9RA 4NSKA 4WNSA 1G7HB 4JDZA 1YUHB 1ACZA 4ODUB 2FX7L 3UAJD 3PIQA 1E6OH 4P2RD 3S35L 3G6AA 5DUBA 1ZD6A 4UUJB 2JK5A 1F41A 3CHQA 3JWDC 2K1MA 3GZKA 4UU9A 1DEEB 5KWYC 3POCA 2C3VA 2VIRB 3P30H 2OAAA 2Y5QA 3ZDXB 3IMRA 3NJFA 4TVPL 2ATKA 1BZEA 5F96L 4H26B 4AV5A 3AACA 1EX0A 5IB1A 2JMRA 2ED6A 5KVFH 2YXVA 3RWJB 4F2FA 4AQZA 4Z7NE 3KR3H 3BGFB 1TZHA 4KTDH 1AJ7H 2OYPA 4HIEB 1HL8A 3VGBA 4WFEE 3S37L 3T6VA 4CVUA 1WQVT 1CLZH 2PCFA 3FC8A 2A4EA 4AEIL 4ETQA 5CJ5A 4WTXA 4YBQC 1JGVL 3U1SL 3MRHB 3F7YA 3PWPD 3ZTJG 4U6YB 5HHQA 1RV6X 3MBEB 2G2PA 1ZV9A 1H6UA 4P99A 4E5XG 1O7DE 5DQJB 4J1UA 3CPLA 3TJPA 2LTQB 4RMSA 4Q6IB 4KKAD 2A6DB 1UWXH 1OK8A 1MKFA 2WYZA 3PS6A 4PRIE 3N1FC 4MA8L 1EAPA 5B4MC 5J6GB 1AI1L 3MLSH 1H6FA 2CM5A 4IJ3C 5DD5L 3E38A 3QWRA 4XTRC 2BVOA 2AFNA 3I3DA 4KK9C 4JFOA 2X1QA 4MNGE 1ZCRA 2QHRL 4P8QA 5DEFA 4EMZA 4A7GF 4GQRA 1U8CA 3GWJA 4UDUB 3DOSB 2YMXL 2I26N 3FOMA 4N0UA 3T0EB 2V8MA 5BCAA 1FHNA 5EDXA 4OFIA 1I9IH 3SGKC 4JFZH 3L1GA 3AREC 4DCQA 2ODIA 1MG3C 4XMWA 1LL1A 3QAZB 4NB7A 1LLAA 2UY6A 1EV2E 5T3ZD 5HVGB 4Z5RB 1E5CA 4MAUL 1CFMA 1MCHA 2DQUL 3WFEL 2Q10A 5IFJB 3KPSB 4P57A 3T6ZA 2YSSB 2R0KH 4ZUVB 1J0ZA 4PB9L 3VWKD 2CHXA 3C2AL 1DJSA 3PGDA 3MCKA 3MNMA 1KBKA 4TN9A 4X4XB 2Z7UA 2FD6L 4NZFA 3WN5C 4ZFOA 5DJDB 3AY4C 5HVFB 4IRSC 3UX9B 5BOZG 1LK3H 3A22A 5A43C 1CF8L 1CYXA 3QDGD 1D6EB 3QJUB 5E4EC 3P2DA 2QQQA 4HWZB 4ALAC 3LDBC 2CNZA 2YKLH 3RY4A 3QRFM 1W0WA 5LG1A 4IQHA 3SBQA 3LZQA 4PJ8D 4X6CB 1R5IA 5FDYA 3HA0A 4L3EB 1Z7JA 3OM3B 1KGJA 3R1GH 3TEYA 4FXGB 5BPPA 1KCVH 2WWKT 3LEXB 4GRMB 4MXQD 3LN4B 4Q6KA 3ZKQD 1JVLA 5TQ2H 3QNXA 3BKMH 3BI9X 3MC0A 2WQSA 1AGEB 2ZPKH 3HMWL 4NQTA 2BSRA 1AGBB 1KY6A 5T5FH 3QC6X 4JFFB 4M29A 3MREA 3V0HA 5E94B 4UT7L 5F7MC 1LEKA 2FGWH 1UA3A 4AIZA 1T6VN 4DZBA 2O61B 3UZVB 2JWYA 3VD1A 3H42L 3F7KA 3SDAB 1D5XA 4M43L 4UQEA 5HI5C 4JFDE 3IXAB 3WFDL 4LCCC 2BSBA 4AVJA 1G7IA 2E6JA 2Q9OA 1EHKB 1P84J 2HH0L 5FHBH 4B9GA 4QMEA 1GYVA 1NCCL 1N6VA 3NJHA 2RGSA 3NSYA 4X8XA 3MLZH 1E5AA 2VXQA 3HE7C 1FFOB 1ZK9A 5A2JH 4KU1A 3WD5H 2UWEA 4GMSH 2V5SA 2Y1ZA 1KB5L 1MFAL 3RWGA 1IJNA 4TL5A 3VB8A 3DYMA 3O4OC 3QAQA 5DK0B 2E86A 4A7QA 1ROWA 2WLIA 4KZDH 1IBFA 5GQBA 2YUVA 1A1MB 2J1KA 3MUJA 2OMWA 2VW6A 2EIZB 4G1EA 4DUXA 1YMHA 2D31A 4X5LA 5D1QC 5LAXA 4WNJA 5DUJA 5LGJA 1M7DA 3CH1B 4S1DD 4ZZKA 4X4ME 2MCPH 1WE5A 1P5UB 4IKKA 3IAPA 5D7JB 3IGKA 1OW0C 1I7UA 3LNFA 2QGCA 3MI6A 5CJOL 4DGIH 3AGWA 4MVBD 2WVTA 3BAIA 4PAZA 3WFZA 4OT1L 4GB9A 1ZHLA 3EH3B 4PTUB 4QY8B 1SF5A 4NLHA 5JZ7C 3H2PA 5HHNB 1UWFA 5CSZA 3VSTA 1T89A 5CGYC 1AS6A 5IJKC 2V37A 2WBJD 4K3HA 4B7IA 3UYPA 1L9TA 3INOA 3WNKA 4B95C 4F33B 1AIFA 2J6EA 1KPVB 4JO8A 4CMHB 4XNUH 4RA3A 2WZPA 4ADJA 3CN0A 3MOAH 1NIFA 1R3LA 1TQCB 3REVA 3KJ4B 4XNMA 5A2BA 1C12A 3MRJA 4AQ8C 2BVQB 5CD3B 5I5MA 1A47A 4F37F 3WTSA 1T1ZB 4N6RA 3L7EA 4YIQB 3X1NA 3AQDA 4HWBH 3CZJA 4FE9A 3FYEB 4A2EA 5KSUB 4AQAA 2R2BA 3QZWA 2X4TB 5DK2B 3I6SA 2ORBH 1QP1A 3A4FA 3IAGC 2CR0A 2E75C 4F7PA 3VRLE 4WY7H 3NCFB 3P77B 2XWTA 3KWWB 4K7FA 2ADYA 1K4CA 1XSJA 3SPVA 1KTDB 5IK3A 2HN7B 4WTQA 2ADFH 3GMNA 3IGFA 5FA3A 4YEFA 3SJVA 4LSUH 4WTZG 1DQJA 1GZHC 4UV4L 1B9ZA 5ETUA 4QHLA 4KJQD 1HINL 4YZFE 4OQTL 1EEYB 1U8MA 2A83A 2OPCA 3T0WA 1S3KL 4X6BB 1A2YB 5EO1A 1P7KB 2XFXA 4J6RH 2CNYA 1EUTA 2FSDA 1OSPH 3FUIA 3D2UB 3ETBF 2FNWA 4XP1H 4O2EB 4XNZB 4YMPA 3IKKA 3ZR6A 2ZNWA 4M3HA 3L5XL 4PJXF 5ADOH 2VLJA 4OCXL 2KBGA 5KSBE 3WNNA 3PHQB 4YOKA 2HT4D 5BXFB 2TSAA 1KY7A 1ONQA 4FMVA 2NX5E 1RUPL 2Q7YB 1AH1A 1HL4A 5DR5L 3GSNA 4K3JL 3PAUA 1UB5B 4XH2A 1QSED 3CC5B 3E7JA 3VW3H 1A0QH 5E8DL 2HRHA 4X4ZA 1DQVA 3PWNA 1H3PL 1IFGA 1K72A 5FIEA 3V0VA 3ULVC 3C12A 1BPVA 5LDSA 1SDDB 1MPAH 2PP8A 3LX9A 4A2FA 3RX5A 4GG6A 4JB9L 4DFHA 3WCYA 2K3HA 4Z7QB 2JXMB 3MOBL 3PYCA 4NOBA 1XGYL 4JGNA 5I71C 1THAA 2WN2A 3LRLA 2BJMH 1DO5A 3G6DL 2NY2B 3N9GH 2N7AA 2GK0B 1KT2A 2DH2A 2EKJA 4HF5L 4K23L 5JA8B 4ODXB 4BRVA 3MRDB 3B5GA 3F01A 4AZ8A 3SGKA 4NAJA 3N04A 3STZA 2O6DA 1OTSC 2PPEA 5EEZA 4LEXL 5DZPA 2I60H 1A7QL 2YD8A 1IAOB 3UCQA 3DRTA 5IF0A 3CPUA 3VXRD 5JXED 1QMUA 3K46A 5C0AA 1HDMA 1UT9A 4WI8A 3D09A 2BOBA 3ROOB 1WZ1L 4EZKA 3RIAK 4X6DB 3IFOA 5HGHB 3ZL1A 3TBCA 2Y36H 3B9EA 3OAWA 3TZVD 4IGBC 3QVAA 5DWUH 2EQDA 3AG3B 3EHBB 1OE3A 2C7UB 2R9HC 3AY4A 4IRSA 2UZXB 3II2A 2HKHL 2Z91B 5TDNB 3I2CH 3LNDA 2HPTA 1GVIA 4RMWA 5ES4B 2GC4C 1JIBA 3BQUB 2A77H 4P46A 2V2TA 4WEBH 1BM3L 3OQ3B 4JRYD 4D7BA 4N0CC 4PGBB 1CBVL 3GXTA 3PP3K 3DDFA 4FGMA 2ZG1A 4UIKL 3PAYA 4YE4L 4BJLA 3LIZA 4JANB 2EC9T 4PR5B 1JGDA 3RVTD 1UM4L 1PZDA 3FT9A 3GLEA 2YWYA 4LLYA 4ZMLA 3S4SA 2XYBA 3PJSB 3TA4D 2AEPL 4JY5L 4D8PA 3WFBH 1BZ8A 5ISZA 3TT1H 3VXQA 1E5UI 3D34A 2GSMB 4AMKL 4UT9L 2PKDA 2VLLA 5EG6C 1BBJB 3ZKMD 4JZOB 5TE6H 1OKEA 1G9ML 2CIKA 3QUGA 4PJXE 1B4TA 3T3PF 4FABL 1LNUA 1PZSA 1PZ3A 1U8LB 3RWIB 5HJDA 3SGEH 4CKQA 4G8GA 4JHVA 5L4JA 5ENWB 3PV7A 2V2WA 1PZ5A 3GBDA 3U0TB 2EE9A 1JJUA 2AEWA 1G7MB 5GZNC 1MCQA 4LPTA 2R0LL 1S7XA 1CT8A 2NRDA 3ZE0E 3R0MA 2OA9A 3WKMH 1ZLUK 3VXUA 1V7NH 2GI7A 4CU8A 5T5NG 1WZLA 2P5WE 2FQEA 4P9HC 4D0CA 1DLHA 2OP4L 2XWJB 4TLKA 3GYRA 4JPIB 4V1DD 5DJCA 3BLPX 2DQHL 4U1HB 3A3YB 4KPHH 3WE6A 2BOCA 1G9NL 2GJ6B 4KO5A 4K7PY 1NDMB 3FSWA 4NO3B 3IDGA 4MQXC 2EUZA 4LCWB 2PO6B 5AFAA 5D1QA 5DVOA 4ZOBA 1YAZA 3HMXL 3JV0A 4MKMA 2FX8H 3BVNA 4TRPL 2EEXA 1JMZA 4ODVH 5E9DD 4X9HA 1DBAL 1FO0H 4PI2A 2D0HA 1T2QH 4KBPA 4M62L 4BFJA 4M7LH 2H1XA 3LRMA 1CD1A 4EBQH 4Q58C 4L4VE 4XNBA 1DQDL 3BZEA 4JY6A 3T0XA 5A16A 1S9XB 4GH7B 4S10A 5IJKA 1ACYL 1N18A 4L8BB 3THML 1NPNA 5ITBL 3QEUB 5EORH 3MA9L 3DHPA 1CVSC 5GGTH 1CC3A 4GS7C 3G5YB 3ZT5A 5J4MA 1ZGLP 4S2SA 5CS7A 1GCFA 5C0GA 2H6OA 3B7UX 1JXJA 1IQWL 2BPBA 5DD0L 4NNXB 4XNDA 5ABZA 2AEQH 3Q6GH 4NKQB 4H1LA 1YEFL 4G3YH 5I1GH 3ZKNC 4Z76A 2BP5M 5CO1A 1RJZB 5CKAA 4UINH 2H2SD 1I1YA 1HX0A 1JF6A 2QZ5A 4HMDA 5EPMB 2F74B 5HVWA 4JKPL 4FTVD 3GJEA 4XZUB 4LPUA 3BKJL 2VO8A 2QQKH 5IMOB 4KAQL 1WBYA 5DURB 1Z0MA 3HEIB 4E68A 3STLB 5JIQA 4UOJA 2ZOWA 1YVLA 1A6WH 1VFBB 3SKUD 1HHIA 1SVZA 3HE6B 1MCLA 1GW6A 3GBEA 5EOCJ 3MDJA 3T77B 1F1AA 3UTSE 1UXMA 1D6VH 3JUYA 2ITEA 3RJQB 4DVRL 1I3GH 5KJRH 1ZHNB 4M1CD 1MI5A 1MCJA 3GZOA 2HP4A 4BFIA 3HB3C 1HKLH 2YC1B 1GPOH 5AW6B 2B1HL 2W81C 4FQ2H 1KYAA 4KRPC 2WNXA 1JV2A 1VPOH 3RA7H 1CD9B 3BVTA 4GUPB 3AG4B 2JSFA 3EH5B 3VDAA 2EXYC 3NP3A 4TMPA 1ZT7B 1GMEA 1WZMA 2C9PA 2D03H 3KPLA 2DQCL 4YVUA 3I9GL 1TQTA 5GSVB 1J0JA 5FM5O 2C9XA 4ZMWA 1P53A 3QZBA 1L0QA 3P2TA 4M8RA 4NZUH 3DX4A 5IUSA 2AK4A 1A7RL 1A3ZA 1INEL 2CLVB 2DTSA 2ZXAA 2DS4A 2BP0A 5DS8B 2OULB 1IM9D 4K3GA 2F54D 5D1XD 3RIFF 3T6XA 5CUSH 1J1PL 4NKDA 2CUHA 4QOKD 4QAWA 4YDVB 3CK0H 3U9UA 4QXVA 4HOWA 1NM9A 3BP6A 1U3HD 3GRBA 3O6ML 3QUZB 4WSGA 1TJGH 1DQTA 3HNSL 5FO8B 1JE6A 1UG9A 4X8CA 1P69B 3VFTA 3QIUD 1NCDL 3DHMA 4ZTOL 2UVEA 2OR8A 2GY7B 2DTMH 1UVQA 1PZ2A 3JBG7 4JDEA 3T3MF 2E4FA 4OJFL 1PKQA 1XXFC 1XF2A 5T1MB 3VXNB 5I66A 2VLKE 1DANU 3K8LA 4ZFGH 2VISB 3V6OC 5B38A 1H5BC 3ZL2A 1R9FA 1SNRA 2XQBL 1KCRL 5I1CH 5BRQA 2G9HA 2I07A 2P47B 3V5DB 3D7PA 2ZX9A 1XZ0A 3OSVA 2K8MA 3T4YA 1IGJB 2WC7A 3B9KD 4ELMA 2X4SA 2GSGA 2ZUWA 4YPGB 1OLLA 3UP6A 1JK9A 2Y07L 1Z5LA 2EDMA 3L2MA 2OR9L 1W91A 1CICD 1L0PA 4J23A 1RAMA 1PGRB 4PJFB 1ZS2A 3DSFL 4R7XA 4YZWA 3WELA 4F57L 3NFPB 2R2CA 1L0YA 4H8WC 5BUGA 1CR9L 5C7XH 5C3LD 3MVSA 5AVZB 3Q01A 1NCGA 2WJ5A 5F7HA 1UWGH 3BAJA 3RZCC 3UROR 3SODB 4YQXL 1L6PA 4PD4J 4XBGA 5IEHA 3MJ8B 3LRKA 1GJIA 2I9TB 3MLTA 4LLAA 3MXVH 1NAKL 1KJMA 3HHSB 4WI7A 4XP4L 3ZKXC 2ID5A 1N0LB 1MREL 3JV4A 4FERA 4HJGA 4K3EH 2ZSVB 4WUUE 1A1NB 4RFEB 4KTYA 4MB5A 1P4LA 2V0AA 3HVDA 5T1LA 2QV4A 4ZMNA 2YXMA 1T0NB 3IJ8A 3F6IA 4M48L 3WNJA 4LARL 4HD9A 2BC4B 1ETB1 1J8KA 4AL8H 1DQLL 5IFAH 2XOTA 3IMWA 5C3IA 5GRJH 1NL0L 1JDAA 2ZWLT 1RZ8B 3KGSA 2KHAA 3C2SA 1BQLL 1QHQA 2H7WA 4JPVL 4IOSA 4NQCE 3K2KA 3HCVA 5CP3A 3H9SD 4OD2B 1XEDA 2WLJA 2QTVA 5J6HA 4ODTL 2G0LA 4PGZA 1S7UA 2ZTBA 1SLXA 3Q5YA 2ICEB 3T5WA 4PY7B 3MV9E 1OM3H 3E9TA 1Z5HA 4LSRH 3L3OC 4GINA 5GZNA 3ABZA 2IANB 4HZAA 1NH6A 2IG2H 1EHXA 2NOYA 3HC3L 4OV5B 5KTEH 3QDMA 2ZCLH 4EDWH 2H0JA 3ARGD 1DUYB 2A9AA 2YBRB 2Q86B 4JZJC 3NOIA 4E42B 2KL6A 2TRYA 3QXWA 4PRHB 3WLBA 3MGTB 3I02B 1QBAA 4FG0A 2P7TA 2A9NL 2VQUA 4B97A 4JK0D 1ZT4A 3VFSB 4FJYA 3FQRB 5D7IE 4ORGB 1W72A 1KLGB 1NFIA 5FO7A 4GBXB 3QA3B 1EA9C 1JNLH 2PYFA 1RKRA 3NZHL 2R1XB 1M7XA 5I1LA 4LIQH 3H6JA 5KYWA 1BJ8A 3JV6A 1C08B 3MRKA 2D7TL 3Q0HA 1J5CA 4XI5D 3ZDXE 4JM0A 1GGCH 2Q6WA 3FTYA 4XMXA 2XX0A 4K94H 4DP1X 4MRCA 4DZ8B 4EDXB 4QTHA 5E8OA 1FDLH 2NR6C 3G6JB 5EDSA 3BKYL 2J43A 5BJTA 1M7IB 1WAPA 3CBRA 4QRPA 3BVWA 5DHEA 5IBTH 2ISDA 4Y5VC 4PVMA 5AW0B 3S96B 4BK4A 3EUUA 3MFFB 2WO2B 1M1XA 1TQBC 5E8EB 3DURB 5GRYA 4GJTB 3KM2A 1T5WB 3RPBA 3P30L 1XIWC 4P2YA 3ULSB 2K8QA 2BHFA 2XPGB 4EKXA 2W60B 4JFEB 1QO3A 4K8RL 1KBVA 1NEUA 1K85A 2G2RA 1UGKA 1MXDA 4BFEA 2CO3A 1RSYA 4W9JC 2Q76B 4BGDA 1Z9LA 1ETZB 4E5XA 2NT0A 1PJWA 4KTDL 3CUPB 4J6IA 1AJ7L 3VGGA 4F7EB 1EVTC 1CLZL 2FT8A 1KYOJ 3CFEB 2Y06H 3OKOB 3FQNA 1D5IH 1RZKL 2C3GA 3O3DA 3DUSA 2QQLH 4LBAA 3T0EE 4HGKC 2DI7A 5TE7H 4IMLB 3KBPA 1JWSA 3H85A 5I73B 2GIMA 1RQ5A 5IUCA 2E7MA 3ARBD 3VJ6B 3QC5X 1RUQH 3FQTA 3MLSL 5LO7A 2EEBA 3UL4A 2AXFB 1CUOA 2HVJB 1A4JB 2Z65C 2X4NB 3DJZA 3LKRA 3LKSB 2WUBL 5T1KB 3UAAA 5I6LA 4NQSB 1KTKE 3ML9A 1TKWB 2WQVA 1KIQA 3VH8A 2ZUXA 1I9IL 4R5VA 2WINB 4HUNB 4JFZL 3QPXH 1I8UA 3U4EB 1IGIH 3JWDH 3QI9C 2V7NB 2D3VA 3BH9B 3IDJB 1J1XH 3JWNG 2H4EA 3N40P 3P9MA 4TNWF 2Y3AA 3NFNB 3TX4A 2BNUA 1EERB 3WMSA 1A6UL 5BV7C 1HXMA 1Q94B 3T2LA 4KGJA 2R0KL 2YIHA 3BXNB 1BJMA 3CLEH 4M61B 4U6XA 4X6CE 4J3OG 1F3DH 4QRSB 4L3EE 4P2RB 5AOMA 4HQQH 4X83A 4LNRB 4P4KC 2BY0A 3TH2T 3L3JB 4EJ1C 3RL1B 2WQ8A 3IMBA 5C1MB 4JKNA 1REIA 5I5JA 5D96C 4Q0XH 1ITCA 2F2HA 4X7CC 1LEGA 1VRSA 3HG3A 1OTUC 5E03A 5TF0A 4NCDA 2ED8A 1PD6A 2Y1AA 4TUOA 1YYML 2DYRB 2OQJA 5FYLL 2YKLL 3OMZA 5EZOL 3GSOA 3GUFA 2E7CA 5D6CB 3UGUA 2KT6A 5F7WC 4QHUA 3F7VB 1MQKH 1WFUA 4UQBA 3FUNA 5IMMA 3KVQA 5T8IA 5FOBB 5JOPE 3MROA 4GFTB 4U1NA 4ZYKA 1KCVL 4CN6A 3S5LB 5C0RH 3PJNA 4N9GB 3HZVA 1QNZH 4RIRA 4ADIA 3V6OA 2ZPKL 1H5BA 3J8F7 5E24E 5I19H 3ARDC 3U7AA 2JFCA 4LAQL 2FB4H 3TA3C 2NY0D 3TV8A 5I15H 5T5FL 4YDIL 4G6JH 4GW5B 3V7AE 4F15C 2F1EA 5DJ2B 3GUTB 1AGDB 4KVCL 3L81A 4OR1A 2FGWL 5F1SA 4Y5YC 5L4FA 1MRFH 5IVZB 4JFVA 2R2HA 4W4OC 1AGFB 4N5ED 3L1EA 4K5NA 1XTLA 1KLUA 1F58L 1LK2B 5DJAB 4IMKC 4C55A 4BELD 3D39A 1RZIA 4RBPH 5EIVA 5FHBL 5JO5B 3I6KB 1OK0A 3ME0A 4ZFFB 4U1MB 3MLZL 2VERN 1JXGA 1J0KA 3CFCL 3C6LD 4GMSL 3RZCA 1QLRA 1R19A 1EGJH 5HDWA 2WN3A 2X9WA 4Y8AA 3HPLB 1I82A 4ZSOA 4A63A 1I85C 5KYXA 3ZT7A 4LF3B 1ND0B 1G7PA 5IV2A 2APBA 5LCVH 1HYSD 2H32H 3HZ3A 4ALAH 4NBZB 1P4BH 3E8VA 5E6ID 3WBDA 1TU2B 4XX1E 2YGNA 4N1HB 1PIFA 4KY1H 1O6TA 3VWKB 5FGCB 3CDZB 3Q9PA 3UBXB 5GZOC 1IAIH 1XXDC 4PS8A 3L3KB 3OZ9H 3PFUA 3TN0C 4GW4B 4DGIL 5E5MB 3H9YA 1L4IA 4B5ZA 3DX9A 1UJ3A 4Z7WB 2IH8A 4HIIB 1BMGA 2NLJB 2YPVL 1JZEA 4N90D 5DJ0B 5E08H 4WO4D 4YHKL 3GMMB 3O9WA 2ZOUA 5H94A 3L3OA 1ZA6B 2BS71 3GZQA 5KSAD 1DVFB 5F89B 4PJ8B 4JZJA 3RGVA 2DYSB 3EDDA 4XNUL 1F13A 2VABA 2C9SA 2JI2A 3C9NB 3MOAL 3HN8A 1O75A 3EJZD 8FABA 4P2AA 1H3TA 3T71A 1UXWA 2B1OA 5IESH 2PWEA 3P0YL 5JR1L 1JL8A 3WIAA 4HWBL 5DSCA 1QFOA 4PJBA 5C8JB 2Y6TE 5BQ7A 4O51B 1NIAA 3CFBB 5LWYH 2X87A 1KGYE 4ZDHA 1Y6MR 2ORBL 3GIVA 2YEZB 1N2RA 5BW7C 4L5FL 3GXNA 4WY7L 2EICA 3KM1A 4G72B 1H8SA 4NNYA 5I17B 5DRWB 2PYEB 3AB0C 4BQ8A 1K5NB 2MQCA 4Q74A 5CEXB 3ETBJ 2NR6A 2ADFL 3FU8A 4WW2C 3W3BA 4HDIB 3F04A 3OGOE 4Y2OA 3ARZA 3VWJB 2OZ4L 5D2LB 1O9WA 1YA5A 2XG5B 4BDVB 4I77L 1DO6A 3JT0A 4TQPA 3V4PH 4ZMPA 4GFXA 1KN4H 3C5XA 1CK0L 2P80A 1OSPL 4XP1L 2HJFB 5DD6A 1X44A 4MDRA 2XQYK 2UZIH 1I7RA 4H0GA 5BRZB 3T0AA 1CGVA 5ADOL 4HS6A 4DO6A 3QJFA 5FFGA 2OTPA 3MN8A 1I8IA 2P8PA 5AZEH 5DQDH 4Z7QE 1N8OE 4I18B 4L9LB 5SX4H 3PXHA 2HPOA 3ELQA 4KFMA 3ZXAC 5C6WH 3W57A 1OIOA 5FC9A 5HDBF 4S1QH 5FKAA 2FEDC 3OR7B 3QIBC 4A68A 1I8MA 3NN8A 3VW3L 3CZEA 1A0QL 4PBDA 3CBKB 3IGAB 2VR4A 3HUJF 3Q8AA 5IOPB 1BFVH 2XVGA 4JFHE 2VNCA 4PGEA 4LVNB 1HHGA 5C09A 5EBGA 4AENB 2ZUSA 2X53A 3T0BA 2AAAA 2WQXA 1MPAL 3K2UL 3WJJA 4FFWC 1XVSA 4DEUA 1DBMH 3MACL 2WBJB 2IDSA 3DV6A 2DICA 1TENA 2IPTH 2Q2EB 2NY7H 4NERA 4YL4A 1K2DB 4WWID 3JVGC 5B7MA 1KPUA 2IWFA 1A4CA 5KBNC 25C8H 4UZUA 4P07A 2J1XA 7PAZA 3LXBA 4HPOL 1LWJA 3NESA 2BNRB 4HYTB 3OWRA 4UNUA 2DI9A 4XVSL 2EUXA 1E5ZA 4UT6H 3SQOH 5CFHA 3GS0A 3EGDB 4X6DE 3ZIMA 5FKPB 5ALBH 5FM8A 5KVFE 2DWXA 2ZSWA 3B5TA 5GJSL 2OX5B 5EMYA 1NANH 2JB6A 3MRMA 3VTTA 2BW5A 3T8XB 3QI9A 1JZHA 2I60L 1H3UA 4RFNC 1F90L 3BZ4B 2ITDA 1ZE3C 1F6AA 2EH8H 4HBCH 1XGPA 2EC8A 3QUMH 5HYSG 1A02N 3GXDA 4FFYL 3E80A 4DP2X 1ZVSA 3VG0H 2FJGB 4LHUD 5HHMB 2WBKA 3RWJA 1T1WB 3ZQXA 2VL4A 4MA7H 2Y36L 4XBPA 1BXVA 1QQDA 1YEGH 3P4OB 1S7WB 1K3ZA 5DWUL 3VQ1C 1A9BB 5IB3B 4BH7B 3FO0L 4ONGL 3NIFF 5BOPA 4JMNA 4K15A 4XWOD 2PPDA 1PD1A 1FNAA 3I2CL 2HT3D 3BHBB 1WIUA 4GY4A 4KMQA 4NM4H 4NPJA 3J2PA 2CU9A 2K7QA 1QBBA 4QHNB 1FL5B 3CU1A 1B4LA 3AADB 5BS0A 1IKOP 1V3LA 1XF4B 4UM8B 4A2GA 3FQWB 4AW4A 1CWVA 3PNWB 3BGAA 4R90H 4D9LH 1T3FA 1ZPUA 2HLEB 2V17H 2X1OA 4JHBA 5LGHL 2Z3FA 4O58H 1VCBC 3MV7A 4M9OA 5DHMC 1RZGA 3WFHB 4LPXA 3B8YA 1JUFB 3ARDA 1UKSA 1MZZA 4FX5A 3TA3A 3TT1L 3PHSA 2FBJH 3FRPA 1NGZB 3OLDA 4TXVB 4GAFB 5TE6L 4XBMA 4YHIA 2X89D 5EBWA 4P5TC 2VSKB 4W4OA 2GJ6E 4XWGL 5D5MA 2X4PB 1FCGA 4HJ0C 4ZAKA 4A04A 4IMKA 1ZRUA 4DFIA 2QKSA 3FJTA 3GRWA 4LCWE 3VXSD 2MCMA 3UFIA 1X7TA 3B2UD 1OGTA 2AQPA 3N41F 2PTTA 3FQXB 1N6QH 3WS3B 2HG0A 2QVKA 1SYSB 1FAIH 3WKML 1SJEB 1YNLH 1CL7H 4WGVB 3VVWA 2NQ3A 1DVXA 2NY1B 4QCIA 5IQ9A 3LRGA 5EU6A 5F7NC 2X1XR 4PJ5A 2JKIS 3VGHA 1BA9A 3MRRA 1KGXA 3BJLA 3EW3B 3P54A 5C0BB 4Z7VF 3REWA 4TSBH 3MNWB 3NQIA 3VXRB 4BSWB 4ZO8A 2X4RB 5BUPA 5IB5A 3FHAA 4JPQA 3U2IA 3D25A 4M6OH 4ODVL 2DH3A 3BUPA 4B41A 3DBXA 5IBLD 4GRLA 5J12C 1P7QD 3TN0A 1AC0A 4MMZB 1V54B 4M7LL 3HI1B 3KPNA 2YPKA 4NEHB 1LO3H 3UDWC 3DO3A 2IWEA 4EBQL 2B8OT 2UX7A 3RUGB 5I24A 1S7SA 3WNMA 1FBIH 3KLKA 1IC5L 3UO1H 5I1HH 5JQ6L 1LE9B 4XOCA 2YGQA 5LQBH 4PGDA 2MJWA 1U4EA 2VUOA 4IU3A 4F24A 1OP4A 1ET8A 1ZEAH 3VDCA 3MRCB 1KXTB 2V33A 3BP4A 5EORL 3ABKB 5EIIG 5GGTL 4FHKA 2HFTA 3LAFA 4FYSA 5FWRA 2AI0H 1ED3A 2NY5C 3OKMB 4WKZB 4NQDD 3DETD 1ZK5A 5EBMA 4ZXBC 1BQHG 2CKBA 2P8LA 5ICXB 5G2NA 2HX9A 2OL3A 3IJYB 3R06B 4LLWB 1BF5A 4GI9A 1E65A 5F3HA 1KJVB 2WP3O 1LO0L 3Q6GL 2FR4A 4YSPA 1VIWA 3RFZC 1NJ9A 4HAFA 4XNYL 5DHVH 4JO5A 5I1GL 4P9HH 1XSIA 1MJUL 1NAMA 1JV5B 4NQVA 5EBLA 4FQXD 4LESA 4EO5A 1A3LH 4ZUWA 4R7VA 5BW7A 2I9LB 4UINL 4DH2A 1BHGA 3AXHA 4FG2A 2Z93A 4NZTH 4LHJB 3VD3A 4L0YA 1P84K 1T2JA 5I0VA 1BM7A 1FGNL 4WW2A 3B1UA 5I2IA 1CGTA 1LHZA 4YAQA 4CADB 4QXWA 5AAWA 4UILH 2BWQA 2KZWA 5D8JH 3SYCA 4XVJH 4ZMXA 3F12A 4QO1A 2G75A 2JCCA 3G5XB 5FEBA 3WEXB 3VYOA 3ZYJA 3JWNC 3O8XC 4Z3GA 2CLRA 1I3GL 4V1DB 5KJRL 4I1PA 3MO1B 4W9CC 1XBRA 1HEHC 3KD4A 3LYRA 2C7FA 3WIFB 1TTGA 1HKLL 4FYTA 2IPUK 1GPOL 2AJVH 2XKSA 1NCWL 2UZYB 1MY7A 1N0XH 3EYQC 4FQ2L 1NC4A 5DLMH 1JD7A 3RILA 4EN3C 3KPQA 1AD9A 1QX1A 2IFFH 3C5ZB 4J3OC 5INCB 3FH5A 4XN1A 2ZOLA 5C9JA 1EJ8A 2YAHA 4MAYA 3RDJA 4X99A 4TTDD 5E9DB 2CR3A 3T1WA 1Q72H 1KLFB 4OZFG 3QIBA 1OT4A 1UM5H 4Z18A 3GSXB 4L5FE 4OFQA 1HZLA 4G7YH 2BSTA 3KPPA 2DQJL 4MMXC 3KEHA 1WWCA 4AGMA 5KSVA 2OMTA 5EUOA 3GSQB 2BFGA 2NYYD 3CN3A 2MTAA 1JFQH 1HE8A 2MIZA 5CUSL 1VKXB 2A9CA 3CK0L 3LV3B 1J8HB 3BP7B 5T3ZL 5E8NB 1Z9SB 3L7FB 2WVUA 1DP0A 1TJGL 4NQEA 1J48A 2YRBA 1FVCA 3CVDA 4UIMB 4X9YA 3VXMA 4GI6A 4U6HA 4YN3A 2DWDB 3Q2LA 3L5HA 3ILQC 4HPYH 5AW4B 4NO5B 1CCZA 4Z0XB 3TM6A 3K72B 4MJ2A 4RMBA 5EUKA 2WLNA 2ZF9A 4XCYB 3HBPA 2FWOB 1RPUA 35C8H 4S0TD 3P02A 3VFMA 2H3NB 3LQMA 4PJFE 1YLBB 4C57C 3ZUCA 4IIQB 1OQXA 4AH2B 4NUQA 3WXVH 2NYKA 1HQRB 1EIBA 4KHTH 2A1WL 1YNTF 4RDBA 4X4YB 3DX8A 4ZFGL 5IW3A 3JTTA 2OTWA 2W0KA 5I1CL 2LR4A 2YPLB 1E9PA 2DIBA 2AEOA 3ESPA 4FTVB 2CD0A 3HG4A 2VXVH 5JNYB 3BAYA 2D3LA 1K8IA 2X6AA 3BDXA 2PMZA 5DVKA 5E2VH 1IT9L 1KJ3H 4CVZB 2Z92B 5TGBA 3UEZA 3QWRD 2OZNA 3NJLA 5JDSA 4IEFA 3HW7A 1V7ML 3BVVA 1DBJH 1ZXQA 3IDIB 5CMAA 2RH0A 3HRZA 5EO9B 1T1YA 1EO8H 2YA2A 1WTLA 2BIOA 4G80A 5LGYA 2AXGA 2G60L 4GAAA 4EI6B 1IEAB 1GZQA 2CZNA 3QULB 5BRPA 4QI3A 4E0RA 3V0GA 2UYLB 1AO7D 3A4DA 5FFOA 1CFQA 4PY8J 3LH9A 1LP9F 1W8EA 4HKBA 1OHZA 4AL8L 1O7DC 2IANE 3DSNA 4J8RA 4BKLA 2BRRH 3DRQB 3MUZ1 5IFAL 2PW1A 5GRJL 4GKNA 1U91A 4OCLC 5DRXA 2COQA 3OKLB 3IETA 1WFMA 3LPGA 4PRHE 3B34A 5KG9B 1IM9B 2F54B 5D1XB 1HSBB 5DVNA 3TCXA 4P5TA 4QOKB 2W88A 4PTTB 2QZQA 3ULUH 2Y7QA 3TLRA 3K80A 1S7TA 1MQ8A 1U3HB 5C0ND 1OM3L 4X98A 4FXKA 2X4QB 4LSRL 3UAEA 1GR7A 3WU1A 1WLHA 2GHZA 4G5ZH 1FH2A 2Z6FA 5GRVL 2WCGA 2W07A 3QUMB 4QAMB 4Z95H 4PJGA 4RESB 4EDWL 4MLIA 4DPBX 4I7ZC 1X5IA 4LDLB 3ESVF 1QZ1A 5DHYB 3MGOB 5GRWA 5K5YA 3MR9B 2XWCA 4L1LA 5GRUL 1E2VA 4W4NA 3GB7B 1HH9B 1PDKA 5I6MA 2VDPB 2XLLA 1U36A 1YEIH 4OSUL 2X41A 3G6JE 4H8WH 3UTTD 2QELA 5ADPH 5FB8A 5DO2D 1USZA 3LRSA 1EHLL 2ADGB 2FO4A 1JNLL 4HC1H 3EUDA 2BSEA 1GAFH 3CFDA 4LCUB 5GRZA 4LIQL 4R8WH 1RIHH 5CEZD 1JZIA 3EYFB 4PHXA 4BZ1H 2FYYB 1PYWB 4IDJL 4OD1L 2D3NA 3N40F 3B9KB 4YDKH 2E27H 2CBTA 3BAEL 5BVPH 3QORC 32C2A 3QO1A 3X1GA 2HB0A 4K94L 3IVKA 1CICB 1H9DA 2QVMA 3UDWA 2X3AA 1OE2A 5HHPB 2HX7A 5AZ2H 4DEPB 4JFEE 1RULH 5IBTL 3ISWA 4WI5A 2HTKD 4RZKA 1KCLA 2VTFA 2O1AA 4NENB 5F8QC 4WNQB 4P59H 3OB8A 4L3AA 3S8FB 4NC2B 3BPLB 4DQOL 1B6DA 3N1QC 2AHIA 4JQIH 2Y24A 1CGWA 4KKNA 4NIYE 3T04D 2QQNH 3APNA 4F7TB 3MRLA 4NDMB 3QXDA 1CU4H 5DQ9A 3HZMB 4ZXBA 4LDCA 4XN2A 1X5KA 1YPZB 3DMMC 4FKKA 4MWFB 3F6JA 3CIAA 3AAZA 2ZKWA 3UO8B 4L2YA 3WDJA 3WN6A 5A2FA 3APMA 3GJFK 4MD5B 2Y06L 1Z9PA 2YEVB 2XXCB 3AROA 2RHEA 5FLUA 2BLFA 2OSWA 3V55A 1EFXD 3TBTA 1D5IL 2YXFA 1G1KA 2W9EL 4KI5E 1TJIH 2DJSA 3EJYC 5TE7L 4YDLB 3BJ91 3NA9H 3MRBB 1JTOA 3DO7B 1WCBB 2CJSA 4L48A 1BJ1H 1U8HB 3N55A 1S78D 1KIUB 4PG9A 5T3XH 2EYTA 3T4AB 1UEMA 3ARGB 3SKMB 3V0IA 2VE6A 3WNOA 2NZIA 5SX5K 2J73A 1J7VR 4POZC 1QNIA 3MRGB 3O8XA 2CDGB 2OMZA 4HK0B 5CBEA 2I32A 5HI3C 5KS9B 3ESMA 5CP7A 1MCOL 4Z3FA 2WZPD 4NAQA 1ZSDB 2CA3A 3KL0A 4KJPD 3GI8H 3OZLA 4QHMB 4U3HA 4F80A 4P2RE 1PQZA 4QJ3B 4EN3A 5HYQB 4DN3H 3QPXL 3GBMH 2J8HA 2UX6A 2PTUA 4AWJC 4C56E 1J1XL 1MHPL 4X6EB 2VH5H 4XGZB 4WWPA 1OF2B 2EO9A 1JGUH 3TC9A 5IHLB 1URLA 2P8MB 3RU8H 3QYMA 3FT3A 5AW2B 1TR7A 3OSKA 4NQXB 3EJCA 2PCPB 4MMXA 3K4AA 3MYZA 4PJDA 2HLFC 3HC4H 2ZXCA 4U1KA 5CCKL 3SJVD 3L3IA 4H25B 4FLQA 2I7OA 3DROA 3KW8A 1Y6NR 1WZAA 1TEGA 3N1MC 4JJ5A 2Y6SC 3LN9A 5DHVB 5DRNB 1PBYA 5FUCE 3SB3A 1B6UA 2HZHA 3AT8A 4NNPH 5G5DB 2V2XB 1TPXB 4X42A 4P05A 4JHAH 2B14A 4X5XB 5EC1B 5DI8B 4XE0A 5DD1H 3FQ2A 2ERJB 4DKAA 1TJHH 3UACA 1XEUA 1BXAA 2VLJD 2AABH 3EAKA 5C0RL 2YD5A 4ES9A 1WA2X 2AQRA 4ELKA 2ZE0A 2V5TA 2VR5A 3MZTA 1T66D 1BOGA 3QUKB 3WJMA 1PS3A 5A6IA 3DV4A 1ZWIB 5DUML 4Y4KC 1QNZL 4TV3A 3ZE2B 4A6YB 5C2UB 5JW5B 1XR9A 4CN4A 5TDPB 1ZSHA 5I15L 2FB4L 1U92A 3W9DA 3CTTA 4G6JL 4PIBA 5E2TH 5LBSH 3U9PH 1NGYA 4BRJA 3FB7A 4F27A 2DQDH 5TH2B 1SXSA 2AK1H 3ARBB 4NN5C 2Q8AH 4LFHG 2WJ7A 5JPNA 2WBXA 3SY0B 4AKQA 2ICWI 2ZYHA 3BEVA 3RB7A 4AKPA 3T65B 1UYWL 3TL5A 2UWEF 2G3ZA 1ZT1B 3ZX1A 4DPCX 3D85A 4UOQA 1R0AH 3V0JA 5FGCE 4M5YH 5E5UB 1EQWA 4HCRH 5CZRA 3TIDB 1E9QA 4CBPA 3FB8A 1KG0B 2VJ8A 4HIHB 4CW1B 1QAWA 1SJHA 2D7OA 3LQAC 1IBGH 2A7BA 4KZCA 4PUBL 4Z7WE 2DMKA 3IPBA 1OCWH 5GHWH 3WMPA 4X9GA 3QCVH 5AB0A 4XMKH 3QNYB 5M94B 1F5WA 1TTFA 3POHA 3H7BA 4NBYB 2FZ3A 1P4BL 2EVFA 3FU0A 4ENEC 1FN4A 2G4EA 1R3JA 2NW2A 4MX7B 4L29B 3MJ9H 4KY1L 1YN6B 2N56A 4P04A 5C6PB 1LE5A 3TEWA 4E41B 4LKCA 1NKGA 1HAWA 4N0FB 5C0AD 1JGLL 3D3VE 1L5GB 4C83A 2IDTA 3PP4H 4LK4A 4HWEH 2PXYC 4DGWC 1TYJA 4FCAA 4MNGA 4YLBA 5AVSB 1I3RA 1TZIA 1YRKA 5E08L 4N2OA 4ZD3L 2HVBA 4X6FB 3VI4F 1HL5A 4L8DA 5DDHB 2ZX5A 5F88A 3S6CA 2WWMC 3ZE1B 3BP5A 2JKLA 4YFLI 1WBZB 4S0SD 4P46D 4OZIB 3JQOB 3BEWA 2ZCKH 3TNNA 4HGWA 2AXJA 1ES0B 2PYEE 1GC1L 3I75A 3OAYH 1JK8B 3H9HB 1PIGA 3HS9A 5H37G 5DMJB 3TBWB 3K6OA 2A6KB 2WNKA 3O2WH 5F7KC 4X7TB 3D0AA 3ZW3A 5LWYL 4FC3E 1RK0A 1J86A 2OI9C 3UTZB 2BINA 5ISZD 1CZ8H 2R4RH 5E95B 5TTRA 3BISA 1JZ5A 3QORA 2Z4QA 2WAQA 3QUXC 4OLWH 4RWHA 1X6LA 3PWLA 4G8GD 4YHPB 5BRZE 1GS7A 4J3XA 4MDIB 3GO1L 5CLZA 5CZXD 1MCKA 2J4WH 3NG5A 5DZAA 3AABA 3BH8A 3UJTH 4KK5C 5I1IL 2HX8A 4AQ1A 1X5YA 5F7EH 3C6LB 1CJYA 1TIUA 5FLVA 4PD4K 1O6SA 5DWPA 4IK6A 3RYMA 3VXUD 4FKEA 3GLZA 3ZZLA 1UZ8B 4UNTA 1KN4L 4AMWA 1E28B 2M1KA 2O5ZH 4C4UA 4ZUSB 4Y16C 4HS8L 3DMMA 2FH6A 4AJVA 3K4ZA 1LWHA 1MFNA 1MCPH 5DQDL 5D1QD 5AZEL 4DGVH 2I69A 2IAMB 5JW4N 3AM8C 3GTTA 1HCVA 3BSGA 4LIQE 5KANG 4S1QL 5D93C 4JFDA 4IYKA 1CO1A 1Z66A 3QE5A 1INDH 1BFVL 1IGCH 5AZUA 2BNRE 1NMCC 3L8QA 1QSFB 1S6NA 3PL6A 4CN1A 4DVBA 4PV8B 5H35B 4GG6F 1LXMA 1YN7B 1ZVNA 2OCCB 4NO2B 1USQA 2OS7A 3WO3B 4WO4B 1XZWA 5CD5C 4IRZA 1XF3B 2HJKA 2CBPA 2XV3A 4ZMYA 1DBML 1CFTA 2ZKHH 1UZ6F 4JM4H 2EE3A 4OCRH 1PX3A 2EVIA 5I26A 5IHZA 2Z35A 4WWKC 2ATPA 3U36A 2EKSA 3C5SB 4XP6L 2NY7L 5DEJA 4Z78B 3B6SA 1OB1B 1FFNB 1T7WA 2E6PA 3LZNA 1A64A 5KVDL 1MH5A 5DJZB 3FSOA 4UDTB 1ZGLM 5L8KB 4YNYB 3K8MA 2DI8A 5AW3B 1KYFA 3Q6FB 5HYSA 4UT6L 4L23A 4BFOA 3EYVB 4K5OA 4WI9A 5HHME 4PLNC 3B43A 5ALBL 4MTMA 3KYMA 4MA3B 3PNRB 2Y5TA 2Z8SA 3IRPX 4AT6B 1Q0EA 3HJEA 1FAKT 4HVBA 2AQTA 4AYDC 4YSCA 2D9QB 4QNPF 5DVMA 1HCYA 4N2KA 4WJ5A 3F2LA 1I9JH 1PW3A 2EH8L 3ZGIA 3LNEA 1CD0A 3EFFA 3QUML 4HBCL 4XX1G 3ERXA 1JTTA 3FT0A 4D3CL 2IXQA 1UACH 5IVNA 3VG0L 3NVQA 4H0HB 4N8PA 4CGTA 4NFBA 2XRAL 2VDPL 4MA7L 1G43A 1W6LA 1FHGA 2EIDA 1YEGL 4D0BA 1U95A 4GEJA 3CD4A 2DN7A 4H88H 1DJZA 4N24A 4EIZC 3BGMA 2H26B 4LSSL 4P48A 4G6KH 4K0OA 1OP3K 3CQPA 3DA0A 4N28A 4TLSA 3X12B 3VD9A 2EINB 3QIWC 3WTTA 4HUXA 3TFKD 4NYLB 3VM7A 2V5YA 3WE1A 3LKOB 2X7LB 3N42F 1MCCA 3CVCA 3FUEA 3GMLB 1JWUB 3WAJA 4I0PC 2XTJB 5FUZL 3OKDA 1KYOK 5GGRB 4KJYB 3MLRH 1S9VA 4R90L 3U0PA 3VE0B 4APQC 1KCUH 3KEDA 4D9LL 4MJIB 4Y4KA 3Q06A 2XTSA 5AVRB 1U3ZA 5CWSB 5DA0B 3SKOB 3LPFA 4L18A 1KFAH 1N3NA 1JWMA 2FBJL 5IG7A 3EOYG 1F1DA 3S9DB 3LN5B 1SQ2N 5F0MB 3NCYS 3P3TA 2AK4D 2L7JA 4OUUA 2XV2A 4JJHA 1G7JB 2APVA 2XWBB 1U2CA 2OXGB 1EEZB 2VXSH 2ESVA 1G6RA 1ZE3H 2IMNA 3O11B 1D5BA 3VFNB 5C0BE 5L8JB 4OCSL 3VXRE 4WU7A 1N6QL 3LPWA 4P2OB 1CFSB 3QDAA 4I9XA 3FU6A 4XX5A 1FAIL 3AUWB 5HI4D 1YNLL 3F6LA 4EIUA 1CL7L 5BZWA 1LMKA 2H8PA 2BZ7A 1JF1B 2GTWA 5L7XH 2GEQA 1JYXA 1AR1D 4PRDB 4E9RA 4D7PA 5KBKA 2O5YH 2M83A 2HAZA 2VZVA 1BAFL 3CGTA 2G5BB 3RUGE 5KANI 3P0VH 1Y0LA 1OTSD 1BGXL 3B2XA 3H4HA 3SKJL 1WHPA 3H7LA 4TSBL 5HP5A 2HG5B 2RQEA 5IQNA 3K91A 4HIJB 2JLLA 4G8AC 4LHUB 1TTAA 1F8TH 2WTRA 3EZ8A 4JFXB 3WO4C 3D30A 1LMIA 2FGZA 1RMFL 2PABA 3IJSB 4YSAA 3Q8CA 2MPAH 1S9YA 1LVEA 2K9UA 5EIIA 2OMUA 1Q4NX 3EO0A 3QCUH 5GGRY 3LKQA 3SYPA 3QJQB 1FBIL 4KXZI 3FO1B 1JGEB 4U1GC 5IMLA 1BQHA 1GZPB 1PY4A 2R9HD 2F7PA 5LQBL 3WYRA 1OGSA 2Q1EA 1SLVA 4R0LC 1KELH 1FV1B 3CJJA 1SN2A 1BVNP 2MOQA 4FZ8H 1CFVH 1ZEAL 4MBOA 4RMTA 5D2NB 5EFIB 1X4XA 1S7RB 3BWUC 3V6FA 4A66A 1AG0A 2Z31D 3NDYE 5LKNA 1B0GB 1BMZA 2NY6B 4FLOA 3CQFA 2AI0L 4G8FA 4N0CD 1QLFB 1IKFH 4WDIA 1Q9OB 3KH3A 4L0ZA 2GTQA 4NKMA 4K71C 3E0GA 5DYOA 2ADIB 1OSZB 2UXVA 3L95B 3NGBB 4HUUB 3AXIA 5MI0B 5T1LD 1PLAA 3O3AB 4W9ZA 4FP8L 1JF5A 3H0TA 1D7DA 2KMWA 1TTUA 2X10A 4EXKA 4P3DA 1WIOA 2IDUA 4V1DE 1XT5A 2CIIA 3VFRB 4NZTL 3Q9QA 1E3FA 2C1PA 3MUGA 3QUXA 3FT4B 3A5VA 2DBLL 5D4IA 4DGYL 5TFSL 1N7MH 4CSZA 3VXSB 1PCSA 2WP3T 4UILL 1HOCA 3SDDC 5D8JL 3BPOB 3TO2A 4XVJL 5GZND 1JP5A 3FTVA 3FFDA 1WS8A 4Q4IA 5E9DE 4A6YL 3C6SA 1FVEA 3Q3GB 2C26A 1C8QA 5GSRA 4UQ3A 3SOTA 4GT7A 4PJ7F 4OZFA 4Z9KB 3C6EA 1E0OB 3FB6B 1SJMA 4WV1A 1L9OA 4ZW7A 2D3JA 4Y16A 1N0XL 4LEOA 5DLML 2IFFL 2X4OA 5F0JB 4PJXA 2EECA 3EH4B 1B0RA 4EOWH 2H6PA 3AM8A 1J8HE 2G5UA 4NT6B 3S88H 1F2QA 5FR3A 1UM5L 2X6UA 4JZNB 3ULVF 1RI8A 2G2NA 3JV5A 4IW4C 1GIGH 4GG8B 1ZTXH 1U30A 1PPIA 4JPWH 3FCTA 4F37K 4B9YA 5I6OA 1AY1L 5FFLA 4M6MH 2JKXA 4QRPD 5MHSD 2O4EA 1G7QA 4U33A 2AV7A 5EEUA 1JFQL 2Y23A 1RUKH 3ZLQC 4EI5C 1D7FA 4M6AA 2JKJA 1S3RA 4WWKA 5CU5A 3BN9C 3NCBB 4DKEH 5IROA 3FB5B 3S98A 1JZ3A 4JJOA 3K6SA 2YPLE 1UXSB 3LEYH 4NQDB 1PEZA 4ZS7L 3M46A 4LRIC 5AALA 3WLWC 1WICA 3GMQB 3L08A 3IF1B 4HPYL 3SE8L 2J55A 1J1OH 1PFCA 1JZ7A 4QF1B 5IBUB 1ORSA 4LASH 1U8NB 5DTFB 1DANT 4IBUA 3PG2A 1G9MC 35C8L 3EJSA 2JV6A 4PRAA 5IKCA 3JWNH 3WIIL 4DUWA 2BSCA 3PLYA 5BVJB 4FQXB 3BIAX 3WXVL 1CE1H 2FEJA 5JW4M 3APFA 1JVKA 4RAUB 3S36X 4FXTA 4ELMF 1MHCA 3BGFC 4DP9X 1OAXH 2VXVL 3DX6B 3QJRB 4K2UH 2EO7A 3GNMH 1CLVA 2Z4TA 1NBZB 3LHPH 2F53B 1Z3GH 2HJLB 4HFWB 4LGPB 4CNIA 4MMYA 4KOBA 4H5SA 3W81A 1KJ3L 5FCUH 3EH2A 1MCWW 5D7SL 3US1A 4FS0A 1G9NC 3MBEC 4PJAB 5B3JE 1ZDSA 1PNDA 4QRTA 1D7CA 5KVDE 1YEDB 1MF2L 2LTQC 3M1BB 1DBJL 4Q6IC 4UTBH 3OAZK 1IEHA 3D1MC 4WJG3 3INUH 1G4MA 3HB3D 3L17A 3QIWA 2EE2A 1XGTA 2F54E 5D1XE 2CLZA 4M5ZH 4QOKE 3IDUA 5L0QB 1CFBA 1N6UA 2OMXB 2WOYA 1ZHKA 3QS3A 4I0PA 3PP3H 4L0PB 4AYMC 1J0HA 3N2JA 2R2EB 4U2ZA 4FG6C 3ES6A 4H0IA 3T0EC 4APQA 3VMOA 2EXYD 1WBXB 2Q3XA 3IS1X 5TF1H 3ZTNH 1BQRA 2DEWX 4TF4A 1KBGH 1S5HB 1QLEH 2BRRL 3K6IA 4NKOB 1GGIH 4PJ7E 2IEPA 5GIRB 1CURA 4S1RL 4DGUA 3QAZC 4YBHA 4NSKB 4NRZA 1T1XA 2R0ZH 3A0OA 3FF8A 3TCLB 2CRIA 3UTSA 1JERA 1QFWH 3QT2A 3O81A 5DUBB 3MA7A 4UYQA 1D3CA 2JK5B 2KYIA 2SODB 4AEEA 4WCYL 4BGLA 1OARH 1OWWA 4I48B 1BBDH 2B08A 3AU1B 1IC1A 2C3VB 5GRVK 2OXHA 5A40E 1VHPA 1MHEB 3LKPB 4RAHA 4G5ZL 4R4ND 5I1AB 2VSDA 4YSSA 4Z95L 2WWNA 4L37B 4HHAA 1X5HA 3BCDA 4FYQA 1HEZA 3RDTD 5IB1B 4RX4A 4BINA 3GMRA 3EO9H 1ZLUH 4LSPH 3MLUL 1S5IH 1XTMA 5EZLA