1J8RA

Binary complex of the papg receptor-binding domain bound to gbo4 receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYELONEPHRITIC ADHESIN
publication title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor.
pubmed doi rcsb
molecule tags Structural protein
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 1j8rA00
4Z3GA 4Z3EA 1J8SA 1J8RA 4Z3JA 4Z3HA 4Z3FA 4Z3IA
chains in the Genus database with same CATH superfamily
4NWUL 2VH5L 5FM5M 5LGYA 1T3FB 3BDBA 2XZQH 4PGEA 3BEVA 3LEVH 1TEGA 5FHBL 1ZTXL 2EDDA 5MENE 2Q7AA 1MCHA 5L6YH 3TF4A 3BD5A 2ZUUA 4JO3H 1R3IL 4NGHL 5IK3A 2YBGA 2YD2A 1QFWI 3P3UA 2V3DA 3OR7B 4GBXA 2G3NA 3BW9A 3HJEA 1ML0A 1CLCA 3NDZE 4LLDA 4M5SA 3CN1A 2D7PA 4M1GL 1IJNA 1DJGA 3IF1A 2HKFH 2XWDA 4X5RA 1ET5A 4WHTB 2P42B 2OTPA 4IK6A 4FQQB 5DJDB 5DGQA 1P4IH 1FVCA 3I85A 5EPMB 5IJKC 1MRDL 3QFJD 1GGUA 4ZODA 1RIVH 2WMPA 2F54D 1QBAA 2ZD0A 3MNVB 1A1NA 4MAYD 4S0HA 1JRHH 3ZXAC 5M7QA 1LDPL 3OG4B 3RVVC 3OPZL 1BAWA 1PQZB 3LOWA 4YDZA 3FB6A 1YNTF 3UZQB 1HCFX 2W07B 2CLZA 1HKLL 4KVCL 4C58B 2CMRL 1AZNA 1CXIA 2F19L 5EDXA 3LNIA 1EEYB 3QIBA 1HHHB 4LSQL 3KLLA 3GJEB 2EEDA 4JZNA 3BWAA 4M62H 2J4WL 1ADQL 1JFQL 5I1LB 1FVDA 1FO0B 3MJGX 4F7EA 4Z7NE 3BZEA 2CCLA 4U1KB 1JG9A 3BZ5A 3O4OB 5C0CA 3CVIH 5C0EB 4Y4HC 2OZ4H 4PN6A 5INCA 2H6UA 1EMTH 3VXTB 3KWTA 5F8RC 5GSRA 4PHXA 5J06A 3FTZA 4N22A 2P24A 1G1OA 3NCMA 1JN6B 1X5XA 1KULA 4HDIB 4A2HA 2F5AH 3TTSA 1VSCA 4D9LL 5IWLC 4FZEH 4ZXBB 2JCCB 5ITFA 1NEZB 5GS1B 1KEMH 4P23B 4E42A 3FUFA 2WTRA 1I7RA 1TTFA 5E00A 4NNXA 2I9LA 5SWSD 3C5ZD 5IHLB 25C8H 4PWJA 3LDBC 5KVEH 4C56E 1BFVH 3QFJA 4IU2A 1M7XA 3UTPD 2HTLD 3DETC 4KV5E 4N0FB 1UXWB 2F54A 3HFML 5G4NA 3RUGE 5F9OH 2ED9A 4MAYA 1NEPA 4NBXB 4NNPH 2X12A 2PTVA 3DO7A 4F58L 3EYVA 1L9NA 3KPRB 3RZWA 4V1DE 4ZAKD 4AQAB 2PYEB 1NBQA 4UNIA 4BK8A 3WHXB 5JPNB 2PYFA 1OW0A 1NGQL 2P48B 4HUWA 4HPHA 2R7EB 4HJIA 5KSAC 1KLGA 1J10A 1CGYA 5FECA 4OCYL 4LLYA 1R5WB 5B38G 1MOEA 3L3GA 4BWTA 3BVNB 1DJXA 1X9UA 4HAKA 4OLUL 2JJWA 5KWYC 3R1GH 4JN2A 4YAQB 1JL8A 2R0LL 2XG5A 3EO0A 1CD8A 3SDAA 1EPFA 1L9PA 1ZDQA 2BHYA 4WKZA 3S36X 3V6ZA 5FW6A 3L3JA 4P5KA 3FB5B 3G5XB 1G6RB 5AW6B 2F58H 4JFDB 4NUJB 5GGSB 5IOKA 4EDWL 1UQSB 5T33L 3I84A 4HVBA 4OQTL 4BK4A 1Y1UA 1JNHB 2DM7A 2FJGA 2NDGA 2VLLA 5SWSA 2FL5B 3C5ZA 3U9UB 4ODSL 2OXHA 3IDXL 4G9FD 2JKSA 3I3DA 5HYJB 2ZUXA 3FU3A 3T65B 3S2CA 5I75C 3C60D 1AGEB 4WGKA 2IF7A 3H7BB 2FEEI 1YYCA 3DTDA 1NUGA 1PKOA 2V17H 2GT9A 3GHEL 5E2VL 3KHOA 1LK2A 3RWHA 2IG2L 4UZGA 4KQ4L 1YPZE 3OHXB 4Z7WE 5BS0D 4MQ7A 1E6JH 1MREL 4I0PB 2X6AA 1LWRA 2YHGA 3ASNB 2C3VA 5IMOA 4ZAKA 4HK3N 2EIDA 4NNYB 4AL8L 3CDZB 1WZMA 2WJ5A 1KTJA 1VF5C 3FUNA 3LEYH 3FYIB 1L5GA 3NSYA 5EDSA 1AZUA 3UBXA 4J8RA 1G9ML 2HT4D 3U7WH 6CGTA 4UZSA 1UM6H 3O2VH 2BVTA 3OTTA 1BQHB 4ZFZA 4FEMA 4YJZL 4IRJC 5IG7A 1J8KA 4E0RA 5DWPA 4QRAA 2F8XC 2WLIA 2ZXEB 4HH8A 2BZCA 3D69A 4PJHA 1I53A 1AQDB 1KJ3H 4IMKC 1KLFB 3C08L 3EUDA 2YGVA 4Y1AE 1P7KB 1FL3A 3PGDB 1MAML 1QRKA 1CL7I 1RFDH 4NC1C 4PJ9C 4POUB 1F3DJ 2B5IC 2UV3A 4Q4EA 5FUCE 5D93B 3OL2A 1FO0H 5I0ZA 2ROXA 2Z0UA 5EZOH 3NA9L 5D70L 1SLWA 2W1NA 2BFVH 2Q3XA 3RZCB 5I6XC 1QHPA 4U6HA 1BXXA 3EFDL 1N9PA 2J1WA 4E41E 3LHAA 4Z9KB 2ICEB 3HNVH 3SE9L 5DVPA 1KCUL 1T7VA 1JD9A 1YY8A 2DQGH 2MQCA 4G9FA 5CEZL 3C60A 3OKDA 4BXSV 3ECWA 4JGJA 4ALAL 2F15A 1PCSA 1OM3H 4LHUD 4NBYB 3CH1B 2R4SL 1WD8A 2ZUSA 3AM8A 3GSNB 3ENEA 4JKNA 4AENB 2FAUA 3EH1A 5BS0A 1DSWA 5DT1H 2FZ3A 4JFUA 3QDHA 4JVUA 4A67A 2C4FT 3ZDXB 1Z9MA 3PHQA 1N2RB 5EF0A 3NCCB 4DHLA 2YSSB 1IGCH 4ZPVA 1CBVH 4HKJB 1IX2A 1Q9LA 3QEGH 4HH9B 4JG0L 2OZ4A 1A6TA 3RJDA 1ECZA 3GSVA 2X4RB 1EAOA 4NRXA 4A7SA 5LUMA 2R2BA 1E27A 4MNQE 4GXVL 5F1OB 1MN4A 2WLKA 3HA0A 4Z7QF 1TQCB 3MMEB 4FG6D 5E23A 3FH8A 2NT0A 3GMRB 4CSTA 2X3AA 1P5VA 5D2NE 2EVFA 4CMMB 3K8KA 3POHA 2VB5A 1UXSB 2IIJA 2FSEA 2VABB 3JYBA 5K5YA 5CD3A 5D2LE 2ZQKA 1ZLEA 4BKSC 2R0ZL 3GSWA 1KT2B 4WNQB 5TDNB 2B14A 3WIIL 1GC1L 4UANA 1YZZA 2ADIA 4H40A 5IIEA 3MRCB 5IW1B 3NACH 4X5WA 3T3PB 1AS8A 3QNZB 1EBAA 3ULVL 3DI2B 3ZKSD 4AC2A 4HPOH 3BN9C 5I0WA 4LVEA 5KTEH 1G6RH 1G7LA 3TL5A 2ORBH 2X44D 3NESA 2BOCB 4Z7AA 4AMWA 2VSMB 3OQRA 3DYPA 4LHUA 2Q8BL 4FHBD 3EYSH 1BM3L 3ISYA 3IGLA 4XVSH 3H9ZA 3PNRB 4JB9L 3ROLA 5E5LA 3CC5A 1KCSL 3B7UX 2VDNH 3CSTA 3CVHH 4WHYG 4WTZA 4XCFH 3WJMB 3MUUA 3FO0L 4MJ2A 4OCLC 4XMUA 4PJCE 3V7AG 1TU2A 4UINH 1QTPA 3QJRB 4TNGA 3V5KB 1CI3M 2BY3A 1WAAA 3NK4A 3COOA 1KZYA 4WFHD 4CNIB 1GHFL 1T3FA 2UXTA 4HCIA 1XBRA 4UYPA 5E2UH 3ARTA 5DS8B 4UQ3A 4M6OH 3ALPA 3VM7A 4XI5C 2QHRL 3FFCE 3AS3A 2X6MA 1OTSC 1NCGA 2ISDA 3U0PA 1MQKL 2EVIA 2J1XA 3D9AH 3X14B 2IDCA 2VDLB 3L45A 3OR7A 1T1XB 4Q52A 5ANHA 3VXRE 2KLSA 2ICES 5B3NA 3JV4B 4QJ4B 3VYPA 3FQ1A 1HH9B 1T22B 3N44B 4ZXBD 4XNDA 1AHMA 2QGDA 4WHTA 4P23D 4FQQA 3TIEB 5A6MA 4A04A 5DJDA 3MCLH 5IROC 5LWYL 4ZMQA 1T83C 5EPMA 2J72A 5JW5B 1UZ8A 4O5LL 1YUHB 1N3NB 1CE6B 3OJ2C 4L1DA 4RETB 3MNVA 2OMXB 1RZFL 1A2YB 2YPKB 2Z64C 2YAFA 3DSFH 4LVOC 1L7IH 3KPRD 2VR7A 1PQZA 1NLDL 3EDKA 2JWYA 3UZQA 1OLZA 2W07A 2Y1VA 2PYED 3DX8B 4DTGH 4RFNC 1EEYA 3F05A 1HHHA 1I4FB 5LBSL 1TNNA 3GNML 3GJEA 5IB4B 1KBGH 3MLZL 5I1LA 1ZEAH 3GSNH 4PYHA 3RHWK 4PTTB 4C59B 2DIJA 2X0WA 3EBAA 4OJDH 4U1KA 5K9JH 1XSIA 4LLWB 3IEAA 3TTYA 1U58B 2AQQA 1L0QA 2EDNA 1CFNB 3ZRFC 5I1KH 3NOIA 3BRFA 1R3HB 2V2XB 4OF7A 3UEZA 3WXVH 5C0EA 4IHBA 2GABA 4OSUH 4XZUA 3WL9B 3ZMNA 4OGQC 1F5WA 3ZL4L 4B3VA 3BRDA 4OZIF 3VXTA 4PW9A 2J6EL 2CA3A 4K8RH 2UZPA 3F7LA 2WZ0A 3RGBA 1JGUL 2DYSB 1JN6A 4NRYB 3SQBB 4HDIA 1ZCRA 3SD2A 5FKPB 2OV0A 3L2MA 2R0WL 3L4TA 1MCOH 2QQNL 3QZLA 3RWJB 2JCCA 4ZXBA 5GS1A 5C3IA 4P23A 2Y36L 2QELA 4JKKA 4JPIB 1ZJAA 2B3IA 1TTAA 5I6KA 1LP9F 4WGWB 2GJZB 2JKNA 2KBGA 2N1KA 1Z3GL 2H0EA 5MHSD 4N0FA 5CKAA 5JHBA 1UXWA 2BIOA 1I1RA 4FI6A 1MFDH 3F5WB 4DEPB 1X9QA 1QSVA 1U8JA 5CILL 4I0PD 4RA0C 1JBJA 1YCSA 3DNKA 3KPRA 3FU9A 1A25A 3R18A 4H1LG 1S3KH 3R4RA 4AQAA 2WTOA 2PYEA 2E46A 2ZUWA 4WWPA 3RB5A 3WHXA 3MFFB 5JPNA 2WWNA 2A6KB 5ANMB 3WOVA 2XZAL 2AJYL 1HU8A 5GGTL 3PWNB 1B0WA 2R7EA 4HYTB 4C4KO 2WZPA 1AMXA 4JM4H 4PJEE 1R5WA 1NMCC 2WB1A 7CGTA 5K93A 3MCKB 2C8NA 3BVNA 3MTXA 3CN2A 1ZLSH 3II2A 2NPLX 4YHKL 3WCYA 4NM8L 4YAQA 3M46A 1KYOK 3L5IA 1NGWB 2EDTA 2IALB 2OLDA 3VG9B 3FB5A 3G5XA 1G6RA 4MCMA 4XPFL 2UZXB 3RZCD 4P5TC 4AJYV 2Y2YA 4F80A 5HDOA 3APFA 1U2YA 3V6OE 1UQSA 3EDJA 4PY7B 2X2UA 4P2RE 3X11A 3UADA 1JNHA 4G3YH 1SZNA 4J23A 1MHHB 1USZA 2DI7A 2FL5A 1RIHL 2WY3B 3I2CL 3U9UA 4BQ8A 2V2TB 1ZLVH 1MRFL 1DQIA 3T65A 3UPAA 1RZ7H 2WLHA 1AGEA 2EILB 5ICZB 1A6ZB 3H7BA 4P07A 2OK0H 2ED8A 2GK2A 4FDWA 3OHXA 3LXAA 3QDGB 4PV9B 1YEJH 4I0PA 4LE8A 2NRDA 3GSXB 3T0ED 2R2CA 4DVRH 1MCCA 1BQSA 4HHWA 1HWHB 2XWCA 3CDZA 1G4MA 3BUBA 4NQCE 4QHKI 5GRWA 3X1FA 1NBZB 1HIMH 3TP4A 2QVKA 4FULA 4AQOA 5GS0D 4S11A 1X6NA 3BVUA 1BQHA 2DQHL 3MV9B 2LU5A 1FZJB 3N1QC 5E8OB 4DKAA 3DX9B 1PVHA 1DBML 1AQDA 3KLDA 1KLFA 4EF3A 1M42A 2PWEA 1P7KA 5HJGA 3G5ZB 3PGDA 4GB9A 1CDJA 4WGVB 3PPSA 3QRBA 1ADWA 4P9HH 1AZBA 3NH7L 4G42B 5ALCL 2O26U 2G60H 2BSSB 3RZCA 4IM8A 3ES6A 4Z5RB 3PXJA 2PPAA 4ZSOB 3NIFB 5GRJL 3KAAA 4DUVA 3BFWA 4OI8A 4BCXA 2YD3A 3IJ9A 1KCRH 2VC2L 4R90H 4F93B 1WFIA 2QVIA 2HKHL 1T5WB 3KBHE 1KTDB 5TF0A 4CW1B 4Z76B 5CJOH 4KKNA 1VJSA 1JPTH 3VQMA 3V6FA 1OAZL 1N68A 2VLKE 3D1MC 2MQ3A 5AW2B 3I02B 4R2GB 1A3RL 1EAPB 3CH1A 4AENA 3GSNA 1XGTB 5DZVA 4K9EH 4NQTA 4MS8C 5C2UB 1FVEB 3O6MH 2EXWC 3NG5A 1KIRB 2C26A 4IKJA 5HYSB 3GPEA 2KHAA 3ULVF 1N2RA 3QQNA 4KUCD 2YSSA 4GI6A 4LSPH 3W3BA 4HKJA 4HH9A 4A2LA 5KJ7E 4B9PA 1ZDSA 5DD3H 4Z0BH 2X4RA 2E7CA 1HI6B 4XO9A 5IBTL 5I1JH 2HLAB 5E24E 3GB7B 2B8OT 3MMEA 4KMTH 1YSOA 3PJLA 3BPCB 3LV3A 5DTFB 3GMRA 2P8PB 4PS3A 5IHWA 4ZFGL 4CMMA 1CTOA 1EQWA 2Q86B 1UXSA 1YMMB 2LFGA 2VABA 1DLHB 3W2DH 1PFOA 5KJRL 4KJYB 3RKDD 5EF3A 1G9NH 1OT4A 2H3XC 3U4KA 4XNYL 1KT2A 4WNQA 5G4OA 5TDNA 1WK0A 3GBDA 1QP1A 3AS2A 2WXHA 3MRCA 4J8QA 2OR9L 5BUPA 2NDFA 1NAML 4M5YL 5IW1A 1HHIB 3PWPE 1NIAA 3UJTH 3ZE2E 3DIFB 2AS5M 1KPUB 5KEZA 4N1EA 1FAIL 3IMRA 2NLJB 2BOCA 1BOGB 4MAUL 5C0GA 5BVPL 4UTBL 3U7YH 2YN5A 2ZXQA 1WA2X 3QJOA 1WICA 5LXGH 5HHOB 5E2JA 4KRPC 3UTTB 2E4TA 1GJWA 2QMKA 2YD0A 3FU8A 1MIMH 2X4SB 3WJMA 2WBJC 4GSDL 5FUCC 5DC9B 4GO8A 4XVJL 4NUMA 1CDUA 5GZND 3Q2NA 5ESQB 3V5KA 1DL7L 1HL5A 4CNIA 1U8NA 5DS8A 3L3OC 3PJSB 3GBMH 4YO0B 3U9WA 1U0QA 5ECGA 2XU9A 3HBZA 4MVBD 2EIZB 1R19A 3WAKA 3MCYA 2AC0A 1NMAL 1XFPA 1T1XA 2TRYA 4BRJA 4NKMB 3OAYH 1AY1L 3JV4A 4XNXH 4X7EC 4YR6A 4U4BA 4PRNB 3HG4A 2HZHA 1HH9A 1T22A 4KROC 1UD4A 2QPUA 4HWZB 3TIEA 4U3SB 4YZFE 1R3LB 1ZA3B 3CZUB 1MCFA 2ZX5A 1PY4A 2DZEA 5JW5A 3LS4L 3APMA 1FNFA 1YUHA 2F8IA 1N3NA 4TVUA 4HUMB 1CE6A 2GG1A 4XMXA 2OMXA 4H20H 4W9KC 1A2YA 4DNLA 5JUEH 2EEXA 4JQIH 4HIEB 1BFTA 3QDMB 3SDCB 5D2NC 1JXDA 3NRPA 4Z7OF 4HIQA 2FBRA 4HJSA 4BFJA 5HDQL 3DX8A 4HC1L 2I69A 4BQCA 3TU6A 1UT9A 4HJ0D 3ZMRA 1I4FA 3HAEG 5GZNA 3HN3A 5IB4A 5IUCA 1JHKL 1FL6B 4Z23A 2MIZA 3T9WA 3POCA 4LLWA 5FYJU 4X0NA 1U58A 2WXFA 1CFNA 4RISH 1XMWA 2HLFD 3I9GH 1R3HA 2V2XA 3WL9A 1XGPA 3SB3A 3FSOA 1SJEB 1N4XL 4G6JH 3TVMC 2Y7OA 4GQ9L 4KNSA 4FXLA 4NRYA 1RU9L 1MCSA 3H3PL 2FT8A 3D52A 1W9XA 5FKPA 3SQBA 3KG5A 4MJIB 4WK2B 1LLAA 4XPBL 3FQUB 2E27L 2YMXL 2BP8A 3HI5L 2BWIA 3QR2A 3UJJL 5CEXA 4JPIA 1NSNH 3ZX1A 3BVDB 5C07E 4ZUSA 2FX9H 1RUPL 2W9LA 4OR1A 2FX8L 3MLVL 1QABA 4H44C 4AQ1C 4LSTL 1UD2A 4GQRA 4I3SL 4ZO9A 4BELD 3QPQC 2CDFB 2GK0B 1E7VA 1C16B 3GRWH 4M43L 3SOBH 1EDHA 3QISA 3P3YA 4GI8A 4J3OG 4PRPB 2QQLL 5DHDA 3Q5OA 5L7XH 1MNUL 1ITCA 5ALBL 4QKXB 3ABGA 3W39B 3MFFA 2DLEA 5ANMA 3DUHA 2EKSB 4XHJC 4CN4A 4H0LC 3PWNA 3MV9D 1PLCA 4L3CB 3IYLW 4XXWC 4PRBB 3TCTA 5F7MC 3MCKA 4QNPE 5DRZB 5DJ2B 5I15H 1YY9D 5DEJA 1NGWA 2IALA 1KBVA 2L04A 3MXWH 1OAYL 4F33B 5CP3A 4NHCH 1YEHH 3JVGC 1BVKB 5D7JC 2UZXA 1G9HA 5C0CE 4BZ1L 4K71B 4N86A 2L7JA 4JBSA 3KL3A 1KGCD 3P9LB 4ETYA 1CFMA 2GTWB 3X3FH 5HGGS 3MBXL 3NCYP 1JGEB 1MHHA 2V2TA 2IPTL 2QFPA 1MJ8L 2PF6A 3ZOAA 1HZHL 5I23A 4G80A 3A4DA 1RZIB 5ICZA 4QYAA 1A6ZA 2WCSA 3KR3H 3LRSB 4LKXB 4F9LA 4R2GD 4JAMB 4C54A 3BAEH 5CCHE 3OSKA 1HQ4A 3QDGA 4LVHC 4PV9A 1NUNB 3VMOA 1KB5L 3GSXA 5DZAA 1P84K 2D2CC 3QFJE 3Q8EA 4JR9H 3H2PA 4ONGL 4W9LC 2YAEA 5D96C 1NBZA 1MFUA 4UT6L 4WO4C 1FSKC 4AKOA 5HSFA 5HVFB 1LTXA 3MV9A 3ECVA 4OIFA 4PQXA 3OAYK 3KZ8A 1FZJA 5E8OA 4N5UA 1E4JA 1MEXL 4M29A 3P2BA 1BMGA 5IVXB 2D8KA 4NFBA 4QYOB 1W0WB 5BO1H 3F7PC 2XWEA 1FG2B 3G5ZA 1YMMD 2X89D 1CD9B 1EH9A 1T5XA 1NA8A 4Z7NF 4G42A 3VMPA 5BV7C 4BZ2L 5KANI 5DMKB 2BSSA 4KY1H 1J9SA 4MNGB 2HTKD 3N5AA 4UV7H 1BAFL 4Z5RA 4KH2A 3B34A 1QSEE 2M26A 1OCWH 4ZSOA 4QXGH 5J12B 4JQIA 2NXZC 5LNDA 4ZNCD 4PLJD 5I73C 1R24B 2HSIA 4CW1A 1T5WA 1JZIA 1KTDA 2XV6B 4Z76A 4PS7A 2EO7A 4M3KB 1TCMA 1RZGB 4A66A 3I02A 5KAQF 4P06A 1EAPA 4XH2B 2QDVA 3E38A 1M05B 5SWSE 3RGHA 1BV8A 3X17A 1GW0A 1XGTA 1XGYL 4JFSA 4LSVL 2DWTA 4OBSA 1FVEA 3UTTD 2VO8A 1KIRA 2CDEB 1XR9B 3WXWH 5HYSA 3NZUA 3UTPE 3U6RB 4FMFA 2NQ3A 3L95A 1XF4A 2EO1A 5B8CC 3RUGF 4W1TA 4CMHB 2DQEL 2OI9C 4QO1B 5IREA 1HI6A 3LKOB 2YWZA 3FMGH 2H2PC 1VEPA 2EDHA 3GB7A 3OJVC 1VACB 4ELKB 1IAOB 2M83A 2PCPB 4FCHA 2P80D 3P4MB 1HJBC 3BPCA 5DTFA 2P8PA 5FX3A 2J5WA 2OMYB 2Q86A 3WUZA 1YMMA 2X89A 2C1PB 3Q9PA 2MJWA 1Q72L 1AFVH 5CJ8A 2EEFA 3IKCB 3E6FB 1SFHA 5TK4A 4CDHA 5BW7A 2D7TL 5I9QC 5EOCH 5ID0B 3LJ3A 5J8OA 3SE3A 1KN2L 4NPJA 5HHXL 1DJYA 1MCLA 2BRRL 4BJLA 1XZ0B 5I1IL 5JW4R 5E6ZA 5LN8A 4D0CB 3GSUB 1HHIA 3CJJA 2R69H 1TCRB 3DIFA 1KPUA 2WNXA 3IXTB 3LB6C 3QIWB 3OAUL 4ZK8A 5L0QB 3PL6C 4RGOH 1BOGA 2W38A 4Q0XH 5BV7L 1SXSA 1ZTMA 3SDDB 1B0RB 1RUQH 3CWGA 1DN0B 3TGXA 3KJ4C 1U6AH 3R4DA 5HHOA 3QDMD 4KQ3H 3SDCD 4PJFB 1SDAB 3UTTA 4YSUA 1GZHA 1UXMA 1U42A 4NQXB 3ZGIA 1EFXB 2X4SA 1ITBB 4R0LB 1A3LL 4DP1X 5ESQA 5BS0E 5JXAH 1YPZF 3H53A 4Z7WF 4Y1SA 2D03H 3UTZB 2J57A 2ZKHH 3BFQG 4LPUA 3HNTL 2P80A 3ZKXB 3V4VL 3PJSA 3V2AR 3NSXA 4W9ZA 1QR4A 4P49A 4YO0A 4H25B 2H1PL 2JJSA 3FUJA 4LCUA 5DFVC 2CLRB 4BFOA 4EOWH 4G7QB 3A21A 4NKMA 4FQCL 2ZUQC 4MJID 3HUJB 4YC2B 1L0YA 2FTAA 4PRNA 3S3DB 3BI9X 3K4AA 3B2VH 4QRPB 1E3ZA 5FLUA 4PEEA 1E8YA 5DFAA 4HWZA 1O7DC 3MUZ1 4U3SA 5IV2B 1R3LA 1ZA3A 4LQFH 4MKMA 4EBQH 4KPHH 3G7TA 5DURB 2J8UB 5IBLD 2VXTL 1EO5A 2E6JA 3BLKA 2J12B 4OZHB 1Q0XH 1GW6A 4HIEA 1RI8A 4NOBA 3QDMA 4WNJA 3SDCA 5GGUA 3TYGL 4AIZA 3NJMA 1PSKL 2CO2A 3AW5A 4PRPD 4URKA 7PCYA 1CJYA 1PZ2A 2I07B 15C8H 3VFSB 2HRGA 3GMQB 3VYNA 6TAAA 3UZEA 1BZEA 4L8BB 2MMXA 4DPAX 1FL6A 2Y7SA 4AXWB 2NY1C 1CUOA 2AW2A 5BNXD 4XVTH 2XZCL 1K72A 4UAHA 4WV1C 2AANA 1SJEA 1WAAE 3S5YA 3EOTH 2XTJB 2KERA 1WG3A 2I60H 4MJIA 1QASA 5FOBB 3FQUA 1JXJA 2AK4B 2VZSA 3MGAA 3SHSA 4CDGC 4HJGB 4L3AA 1IC4L 3AQZA 1SOKA 1X7SA 3D25B 5D2LF 3AXHA 1E5UI 4QTFA 4F57H 1JDAA 5IT2H 3BSHA 1JGVH 4A6YL 4KTDH 2OXGB 5EO9A 4CKQA 4YDLC 1VLXA 3HW7A 2QFRA 2CDFA 2GK0A 5EORL 4XAWH 1C16A 1ETJA 3HMXL 1NCJA 4Q7DA 1DTUA 2Q3ZA 1ZV2A 4WI7A 3UYRL 5KVMC 4P9MH 4PRPA 3QHFH 1MCJA 1C5DB 2K9FB 2EKSA 5FCUH 4URTB 4CAGA 4L3CA 3QXDB 2QQKH 2X1OA 4HMCA 4XNQB 4B60A 1NIEA 4KKAD 4X9FA 4PRBA 5CGBA 1ASQA 4I89A 1THAA 2R15A 5DRZA 4CC4C 4PJCF 4U6VH 3NP3A 3LN5B 5DJ2A 4BSVB 1ESOA 3IDGB 3VFPB 4WFHE 4F33A 1E67A 2ID5A 4YBHA 1A6UL 2BWQA 3IDNB 2OL3B 2JQAA 3IJSB 5F7DB 3Q5YA 3P9LA 3E9UA 2HVKB 3QI9B 1A6VL 5B4MC 2QV4A 1FZOB 1BJ1J 4RAUB 1JGEA 4TN9A 4PS4H 2E9JA 4YHLH 4E9LA 2QPFA 3IXAA 1RZIA 5DLLA 2JCCE 2XVGA 3LRSA 4LKXA 3MA9H 4JAMA 2COVD 4KTGA 3FH5A 4R5TA 3IBOA 2NT1A 3PWLB 1F41A 2ITCB 3U83A 2QSCH 3WNKA 3MLRH 3QK0A 5B38A 5GJTL 2NY0B 4NSKB 1INEH 3KPRE 3TIDB 3ILEA 1GGIH 2GHZA 3WSQH 4EZLA 2XIIA 2NX5B 5I16B 4EN3C 1KXHA 5J7CC 2PYEE 4S1SL 3IM1A 5IVXA 2AEPH 4QYOA 1QUPA 1NFKA 2Q87A 1YJDH 2A9NH 2YR3A 3E0GA 3WGUB 2FWOB 3RTLA 3AVEA 3PFUA 3QSKB 1ETZB 5DMKA 4M3HA 4MNGA 1IEBB 2ATKB 3LIZA 2CAKA 4AVIA 5HHVL 4MJ5B 5CUSL 3IGFA 2DMGA 4HIPA 2F7QA 4G5ZH 1RJYB 2YXVA 1R24A 1JHTB 4HWEH 1A7NH 4JFDE 2DWYA 3QIWD 4JO2L 2VDML 4RMTA 1F1DA 2XQBH 2XN1A 1RZGA 1I1FB 1WIUA 1EERB 1P69B 4WFED 3SDDD 3GKWH 4P4KB 4XH2A 4TUKH 5AVUB 1M05A 2VR4A 2ENYA 4ZDHA 4Q14A 4Z3FA 5L8JB 4GXUN 5HYJE 3QIBC 4NIKB 3GZKA 2CDEA 1XR9A 4JFWA 2G5UA 3TBYB 1EFXD 3U6RA 4ODVH 3PWVB 5MHSE 3VFGH 2ENSA 1F4XH 1EVTC 2E7HA 1N6QL 7FABL 2H3KA 3LZFL 1FYTD 4QO1A 1UXLA 5I2IB 3LKOA 3EFOB 3LKSB 3ERXA 4ELKA 3LY6A 2O6PA 1I1AB 1IAOA 2PCPA 1BZ9B 4HJUA 4JRXE 1KELH 4NP4L 3WS6A 3NBNA 1YO4A 4Q9QL 1MFCL 3RDJA 2C1PA 3WN6A 5EZPA 5C6TH 4I9WE 3RIFF 2Q20A 1FGVL 2GPZA 3E6FA 4OLVH 1XD1A 4PJEF 1KEGL 2RCSL 1K6QL 5ID0A 5I5RA 2X0VA 4HEPA 4QRPD 3N55A 4JHZA 5I0XA 1DZBA 1AC6A 2WXIA 3K2IA 1KCWA 3RFZB 1SJVA 2HT3C 1XZ0A 4D0CA 3GSUA 3MZTA 1AGFB 2V0AA 4GAYA 1TCRA 4YHML 4LSRH 3IXTA 5DURD 4MAYC 3QIWA 3R0MA 4KXZI 2X41A 4ACPA 1D7CA 1KPVB 1QAWA 2QLVB 3SDDA 4HWUA 1B0RA 2J20A 5EC2B 3T08A 1DN0A 5IMLB 1M6OB 3IKKA 1Q94B 3U6XA 3BPLB 3MOBL 4PJFA 3ILPB 3FL7A 3O2WL 3QC5X 4R7NB 5I8KL 3QB7C 4KQ0A 4NQXA 2G0LA 1DDHB 1EFXA 4Y2DB 1ZHNB 2D3VA 3B2UD 1H3TA 4R0LA 4NFCA 1KMGA 2A0LD 1O7VA 2FECL 2JKRM 3N42B 1JNLL 1I9IH 1NZRA 3B83A 3GI9L 4YLBA 3UTZA 3ZDXE 5EEWA 4MMZB 3PDDA 1CG9B 3EYQD 3SDAC 5TQ2H 4KKQA 3OWRA 3WNJA 4NAQA 2D3NA 4Y16B 4H25A 2XI9A 5JA8B 5IVOA 2CLRA 4TV3A 1HN1A 3SKJH 3UGXA 2XTJD 2BW5A 4LXFA 5DRXB 1KSRA 4ENED 1KGIA 3HUJA 2OP4H 1SDYA 3AREB 2VAAB 1NPJA 4HV8B 4QRPA 2AK4D 4O02B 4QY8B 1QBLH 3MRBB 4AIOA 5GZOD 1Y6MR 4PBVC 2EVJA 2HTLC 4X83A 5IV2A 4RWYH 5KVDH 3D5OF 1BIIB 2QPEB 1EHLH 2DQMA 4MXQD 2J8UA 5DXWA 3HB3B 4XAKD 4XP4L 1SJXA 2R27A 4ATWA 3APNA 3IETB 1F97A 3BVXA 3ROOB 3T3PE 5I1CH 3CZNA 1MXGA 4FP8L 2V9RA 2BVQB 3RE0A 4R4FH 4TPRH 3P9MB 4KAQH 3HC3H 4LAQH 2I07A 3V55A 3M45A 4YHOH 3VFSA 2ZP9A 5CBAB 1CYGA 2OX5B 3GMQA 1WIOA 1OF2B 4OKVB 5DFWH 1JTPA 4L8BA 3CFKA 4AXWA 1IBGH 1KTBA 1X5HA 2BS8A 2Z9TA 1KWGA 4UI2A 4GLRI 2IEPA 1H19A 4KGLA 1NUDA 1D9KD 3H9HB 1IGFL 2WLZA 1Y18B 3LMJH 2A9DA 3WKQA 4EKJA 4E9VA 1XD0A 2NYYD 3CFCH 4ZMZA 3F04A 4U1NB 3EOYG 1B4RA 2EINB 3IDMA 1TLKA 1X5AA 2HN7B 5FOBA 1JPFB 4YDIL 3QI9D 2AK4A 3FF8A 2BX5A 3VX1A 4K3GA 3SYAA 4HJGA 1P4UA 3NSFA 5GZOA 1YC8A 2WWKT 4OFPA 3MRNB 3D25A 4MA8H 1J9QA 3DECA 1EO8H 4KRMB 3AM8C 4AM0Q 1BD2B 2F08A 3EJQA 5DI8B 3BLBA 2OXGA 5LHDA 2ZOOA 1J88A 1NANI 2TAAA 3EJZD 2NY5H 4P99A 2MCG1 5F97E 1LGVA 3ZE2F 1RPKA 1UM4H 1AMYA 1ZS2A 1BQ5A 4M48L 4M7LL 4OGYH 4N8VG 3SGJC 4GQQA 3TONA 1C5DA 2R83A 4NHUB 1ZGLB 2XZQL 2NY0D 1Z9OA 3ZIYA 3QXDA 4JN1L 4XNQA 1XX9C 2NX5D 3TASA 2X2HA 2CHZA 4N20A 1D9KA 1A9VA 4JO3L 4PJ8B 4IK7A 2FX7L 2J3SA 2XKSA 4C4UA 3LN5A 4KO9A 4JRYB 3IDGA 3VFPA 3CBKB 1M71B 1B90A 3ARBC 3IDNA 2OL3A 4A7QA 2HKFL 1A64A 2OYMA 1SEQH 3IJSA 2VL5B 5F7DA 1G94A 2N56A 4Z0XB 5IHHA 3DHUA 4Q6KA 2HVKA 3QI9A 4HD5A 4TVPD 4DGWC 4WW1B 5TJWK 4JO1H 1FZOA 2K8MA 4RAUA 5DQDH 2ZJSH 3TJHD 2VZ3A 1MG3C 3CX2A 4NQUA 2LV4A 3UABA 4F3FB 3DX1A 3FS9A 3CSPA 4P4KD 4D8PB 4O02H 4Q89A 3QS2A 2HFFB 1M7DB 4PRAB 4YZFF 1H15B 4IKNA 2OS7A 2Y23A 1JAEA 3VXOB 3AS1A 4YUEH 1OGTB 3NYKA 3PWLA 2ITCA 5CCKH 5C0RH 4Q2ZB 5DJYB 1TIUA 2D2OA 2E7BA 2HKAA 1YUKB 2EXSA 4KZ0A 2H0FA 5AZEH 2JTYA 1CU4H 4NSKA 3TIDA 3NEXA 4ANUA 4EI5B 2VN4A 1GH7A 5I16A 2NX5A 2PTTB 4G6ML 2OZ4L 4XO8A 3D4ZA 2XXFA 4AUYA 1EMTL 3V0EA 4DQOL 3HJ0A 2B1OA 1RHHB 2ZPKL 3VDCA 5HHQB 5H35B 4PM1A 5I18H 2FWOA 3GIZL 2AQ1A 3WGVB 3P77B 3BVTA 4FZEL 4KJPD 2BS9A 4LEBA 4CSZA 1IEBA 1KCLA 2ATKA 4XB3A 4ZMOA 5EWIL 4B3EA 5CO1A 1M7IB 2EDJA 1R0AH 2KC0A 4LP4A 4MJ5A 3ETBF 25C8L 4JZOB 4N2AA 5JW4N 4NUGL 3NJHA 5ESAB 1RJYA 2IGLA 4QWWC 5HVHB 1BFVL 2CD0A 4OT1H 3S36H 1JHTA 1HHJB 1DFXA 1UWEH 4YGVB 2WYIA 4S1RH 5F9OL 4NNPL 4EZMA 1I1FA 4NN7B 3EZJB 3KPSD 3NJXA 4P4KA 4L5FL 5E03A 1NJ9B 1L6ZA 3H1ZA 2A74C 3DPDA 1D6EB 2JB6B 3OAWA 2N7AA 3TBYA 4Y2DD 3PWVA 3D07A 3QDGE 1T2QH 4LPCA 5EIQA 5I2IA 4S1DC 4IBQA 3EFOA 3LKSA 3K5RA 4K3JH 1BF5A 4PREB 1OAXH 3IWVA 3GBEA 3KJ6L 3LTVA 5FUOL 2AXHA 1BZ9A 4NWTL 4XCYA 3VD4A 1MCKA 2NQCA 5IHUL 3CTTA 4Y16D 1FHNA 2CXKA 3NFSL 3CLFH 3MV9E 5J1AB 2DQCH 1A9EA 3S4SG 2JVUA 2V9TA 3BQVA 3G6DH 4RDQG 5JPMC 3FKUS 2GTZB 2PW2B 3SODB 4QNPF 4NJAH 1NH6A 5DEFB 2BLFA 1ZVNA 4LLMB 4C83B 2ZUVA 1KGXA 2XWZA 4K55A 3RFZA 1WBXB 1F3DH 2B08A 3DC0A 2ZZUT 1AGFA 1CIUA 2BP3A 3ZQXA 2V17L 5IY5B 1KPVA 4L0PB 4ZSOE 3HB3D 2VWEE 3NIFE 5F0LB 5EC2A 4JUSA 1E6JL 3UTOA 5IMLA 1M6OA 1FG9C 1Q94A 3D0LB 3JWDL 1F18A 1OP3K 5JQ6H 1CLOH 5JPNC 4LDOB 4R7NA 1F58H 5SX4I 4Y2DA 1ZHNA 3U7WL 3BWZA 4W6WB 1UM6L 3O2VL 4BGDA 2MNUA 2X1XR 1BDYA 2ZX9A 1YEDB 4F37K 3ELAT 2XPYA 3QUZB 4XNBA 5DK3A 4MMZA 1CG9A 3P4NB 1BHGA 4RGMC 3EYFB 3QW9A 3CZGA 3VXPB 4CADB 4A55A 4X9IA 1RFDL 2UVEA 4Y16A 1B3IA 3BT0A 3BIBX 4HFUH 5EZOL 2KPWA 1CURA 4HD9A 4NN6B 4UNUA 3MRKB 5CJXA 1P4BH 4ODUB 1N7MH 2GSGB 3F58H 3TC9A 4ISVA 2IBZY 2HT2D 3AREA 2VAAA 2QTVA 4HV8A 3HNVL 4MZ3A 4O02A 1YMME 4KJWC 4QY8A 3WV0A 1WZAA 1OAJA 5EV7A 3ULSB 2XOTA 1T5KA 1NCIA 1BIIA 1HKFA 3CG8A 4FYRA 3SGKC 1OM3L 4JHVA 1BD2D 1ZMYA 2LOEA 3FN0L 2GUOB 3QIUB 3F7VB 1PIFA 5CU9A 1FPTH 3IETA 1D5IH 1DFBH 4WWOA 3ROOA 4APQC 4BV1A 4D7BA 4N2GA 2R4RL 1H0DB 5L88H 3GXDA 3AXIA 2BVQA 2XACC 5KS9B 1A6AA 3QEGL 1CBVL 5FV1L 1DQJB 3HBGA 3AMKA 3TT1L 5I28A 1EZLA 2KT6A 3HZKB 3P9MA 1DEEB 4M9OA 5CBAA 4AY0A 1EJFA 2OX5A 3ARZA 4OKVA 1OF2A 4FLSA 5HHOE 1AYOA 2UX6A 3FSVA 3ESUF 4HCRH 3UTTE 5GRVL 3H9HA 3D48R 3WTTA 3ARFC 2OMZA 1JYWA 4PJ8D 1JI2A 1Y18A 4PW3A 5AB2A 2OJEB 1PZAA 2HUHA 3CU1A 3VQLA 3DJTA 4JRYD 1T66D 1WJ3A 3IGAB 4U1NA 2KYIA 2A9AA 5JHLA 2V5TA 4HK0B 2ICEC 3BQUD 2G2RA 1HWWA 1CFBA 2HN7A 1EHXA 1JPFA 4L18A 3U7AA 5KTEL 1NC4B 1G6RL 1HYRC 1GGCH 2ORBL 3MQIA 2VDKB 5I1HH 2YAOA 4YSDA 3MRNA 3ZE1B 4HJTA 5DRWA 5B1BB 1BD2A 4G7YL 4LVNB 5DI8A 5CR8A 3EYSL 5TE6L 3D85B 2QMJA 3QAZB 2P8MB 2VR8A 1F90L 4J3OD 4LIQH 3RX8A 3ZHFA 4XCFL 1YEKL 1VEOA 3MXVH 2IDFA 5FK9B 1IB5A 3N1PC 4K8RC 5F7FA 3DJRA 2IOIA 3HS9A 2DPKA 5CFAA 4R8WH 3Q5TA 4K2UH 4NHUA 4H8HA 1ZGLA 3KLHD 1TJHL 4OIBA 4EI5D 5JZ7D 2G5BB 1IMHC 4YXLL 4JDEA 4N26A 3DV4B 1HNGA 4PJ8A 1ULVA 4OD3L 3MLUH 1J1OH 4OCNC 4NZFA 2FNBA 2EYRB 1NLBH 3ARYA 4JRYA 2APSA 2E56A 4E9TA 1E50A 4NCDA 1M71A 4FFYH 1RULH 5F1KC 3UJIH 3BQUA 1V7NH 5LO7A 4JO5A 3T6WA 4Z0XA 3GHPA 3IN0A 1QYGL 3F6JA 4Z95L 3U30C 1XT5A 3MCLL 1JGIA 4WW1A 1RUKL 2Y7QA 4QJ3B 2EQDA 2X10A 2JELH 5BOPA 1W80A 3FT9A 4KDVA 4ADIA 1K8DB 3RGVC 4MJIE 3RWEB 4F3FA 2ZOKB 3J2PA 4DP8X 5KVGL 3E1ZA 3WEOA 4D8PA 3IU4H 3F83A 5FA4A 2HFFA 1M7DA 4PRAA 2UYLB 1AXTH 1H15A 3RPIB 1A0QH 5JDSB 2X5PA 3KS0H 3UAEA 3VXOA 4DTGL 3RVXD 3SO5A 2IV8A 1OGTA 5E6RB 2WO2B 2E9GA 2Y7MA 3MDJA 5C1MB 2FWUA 4Q2ZA 5DJYA 1ZEAL 3GSNL 5AOKA 1QI3A 2LTQB 4X6CB 5K9JL 4RH4A 4MYWB 1WA1X 4H5SB 4X80L 4EI5A 2PTTA 3WXVL 4YE0A 5BOZG 5J3HD 1HC1A 4PRPE 5BRZB 4UTCA 5IFAH 4AMKH 1DJWA 4RGNB 4RZKA 5GS0L 3L1OH 3CZJA 5JORB 4DPCX 3ARXA 1RHHA 1T89A 3QHZH 4CU8A 5H35A 2DJSA 5C2BL 4NZUH 1UWGL 3RIAF 3S8GB 3P77A 4BHUA 4FQJH 1MFEH 2X3BA 4RLDA 3KW8A 3DDGA 4G59C 1X44A 1M7IA 4GEIA 4LRIA 4WO0A 1MY7A 1OGAB 1CE1L 1WAAF 2PN5A 5ESAA 1W6LA 5DO2C 4DO6A 1HHJA 4YGVA 1VAHA 5T1DH 2OSXA 5EUKB 1MFDL 5AB0A 3GI8H 4FFWC 4O58L 3N0PB 4X5QA 1NJ9A 3V0WH 1AHKA 1BEXA 1S3KL 4E5XG 1D6EA 2JB6A 1KYUA 2A1WL 3O9WD 2VDKH 2ARJQ 5CP7B 5I71B 4F2MB 3FZUC 4OLWH 4P9HC 3FYEB 2GVYA 3FN3A 3HRZB 3RVWD 1LEGB 4QRTB 5DCCA 4HETA 3A4AA 4Z3TA 2CO3A 4PREA 1ZLSL 1LD9B 1UOWA 3CZFB 4UUJA 3L4UA 2H1LM 3NEOA 2QADD 3E8VA 5FGCB 5GISH 3T09A 4G9DA 4A7UA 2EICA 5DHYB 1V8HA 5J1AA 5T1MA 4KTEH 1VGKB 1TEYA 2ERJC 2GTZA 2PW2A 5F44A 3CE1A 1PX8A 4K9EC 5IVXE 5DEFA 3S35H 2VGLM 1MJ7H 3GC3A 4LLMA 1CT8B 4C83A 2Y1YA 1WBXA 5B1JA 2VDLL 4GIPD 3C6EA 4MNGE 4HF5H 1HFUA 2G75B 4L8SB 3UAJC 1E8XA 2FHBA 3QIUD 5D8JH 1YEJL 1U8PB 3X3GL 4DVRL 4JHBA 4PP1C 3D0LA 1HHGB 4Y5YB 3HRPA 4LCIH 3VD5A 4F8NA 4GG8B 4LCCC 4NT6A 3QFGA 1HIML 1TQTA 3V10A 5LNGA 4I4WB 1HYSC 5F9JB 2JCCF 1G9NC 1MFNA 1G7JB 1M7UA 1FFTB 1A5FH 2KUTA 2BOLA 4LOUD 3C6LC 1YEDA 2DB8A 4M7JH 3O3EB 1X7TA 1MCWW 3ELQA 3EYFA 3VXPA 5MI0B 3SO3B 3OGOE 4CADA 3ATFA 4FRWA 3SEPA 4PY8J 1YEEH 1I8AA 5IHZB 2G60L 2W0PA 1HINH 1CDCA 3KL5A 3UH8A 2BP5M 3AT8A 1VFAA 3MRKA 3S7GA 3F7RA 2GSGA 2YD9A 2WBXA 4HK3J 2C3XA 1DBBH 3G5WA 3K8MA 1OP5H 1KCRL 4R90L 1KB9J 1NC4D 5CJOL 3ULSA 2X4NA 1J0JA 4CKVX 1MW1A 3O3UN 2DF3A 5MEOB 1S7VB 1R34A 3D85D 3QIUA 2BNQB 1E4XL 3F7VA 3D09A 4M5TA 3FB7B 3O6ML 2D9CA 1H0DA 4LLUB 4FA7B 5KS9A 1DQJA 5F2FA 1PF3A 1WS8A 3HZKA 1LO0H 1DEEA 5K1JA 3WN5B 2P52A 1IAMA 3NIDB 5E2TH 2WV3A 1MFVA 2HJKB 3I75B 3ETBJ 2J5LC 4MQXD 4XBPB 1Z66A 3V5DB 3CGTA 3HN8A 3L13A 2NR6D 1G4RA 1YY9C 2AQPA 4IBTA 3P4OB 3BJLA 4OAWB 4K3EH 3WNMA 3OLDA 1J1XL 2AXJA 4LF3B 3W2DL 1CF1A 3SE8L 2OJEA 5HGHB 3DPBB 1YYMH 1P2CB 1G9NL 5AOZA 1VCAA 3IGAA 2E74C 1MCIA 1QFHA 1T0MB 4UIKH 4HK0A 4L29B 3BZDA 4UNTA 5FA3B 5AW7B 2FSDA 1XVSA 3UJTL 3OXRB 1KF9B 1UJTA 4RFOL 4RQQB 1NC4A 3IBEA 3QQ9D 1W0VA 4RCAA 4XE0A 1BF8A 3MRJB 1NDTA 1PEZA 1WGVA 3E2HB 3U7YL 3HE7B 4IS6B 4EIGB 1KNOB 4X4MA 3HUJE 1NIDA 5DC4B 4BH7B 4QRPE 3IK2A 3AFLA 3D85A 1NEUA 3OR6B 1Q0EA 1Z5YD 2E7MA 4Y4FC 2YPVH 4AEIH 3HHMA 1VZIA 1W8NA 2J8UE 3RTQC 5FK9A 5FEBA 3UAAA 2W80C 3QJFB 4PPTA 3GZQA 3LH9A 4XGZB 3CX5J 3Q0HA 4OZHE 3BJ91 4X7FC 3ZZ1A 3KBPA 3DHMA 2QT6A 2LU4A 3L54A 3UO1H 3K2MC 4G8AC 2NR6A 2G5BA 5BRZD 3CC1A 4UV4H 3DV4A 4RGND 3DSNB 5A6IA 2EYRA 2C34A 3V4PB 3JT2A 1WTLA 3OKNB 3SE3C 3GTVA 4XNXL 3ZDXF 5FYKU 5AQ0A 1UM5H 4NQEB 4X5LA 1UACH 1W8EA 3B4NA 1OGAD 1JXGA 4MSWB 2FGWL 3BSZA 2XTJE 3FXIC 2IBZX 3E7JA 1A7PH 1HWGB 1K8DA 4H20L 4GRMB 2DH2A 5JUEL 3VU2A 3MU3A 4JQIL 2ZOKA 3CHQA 2AK4E 4IU3B 1BMWA 5AG9A 4WWNA 4ABWA 1JNJA 3CLWA 4M3JA 4BFIB 2UYLA 3ATAA 4G2AA 1GS6X 4NLHA 3RPIA 4Z1PA 5JDSA 3UC2A 2XWJB 4IGBD 2R2EB 2WM0A 3O8XD 3KPQB 4ICXA 5CFHA 4JG1H 1PG7H 4ETQB 4X6CA 3T3PF 2AJZB 3CMOL 3ALWA 4H5SA 3CUPA 3ZTCC 2JJSC 1R5VB 2VH5H 4UQDA 1AI1H 1OP5K 1LHZA 5BRZA 3JTBA 2PP9A 1BG9A 2AJUH 3DX3A 5DEGA 4OI9A 5JORA 5FHBH 3IPFA 4G6JL 1UJ3C 5A3IC 1R3IH 4TUJB 4EVNB 2H3NA 4KUCF 3MI6A 1I9JL 3PV6B 2X09A 5IFJB 1NSNL 1YAZA 4M1GH 1OGAA 3RDTB 2PNDA 3TPKA 4DKTA 3D51A 3T8XB 2CPUA 2ZUYA 4R5XA 1INDL 5LG6A 2I5YL 2YWYA 3C8DA 3K6FA 1AGCB 5EUKA 3ZW3A 1AD0B 1I8LA 1P9MC 1BQRA 1V05A 1RQ5A 1T0OA 1I85A 1VESA 4KNUA 1J1PL 4G43B 4HLJA 5L7XL 3U1SH 3GK8L 1LDPH 3QARA 4P2OB 4YH6A 4NBZB 3RX7A 4IGBA 5CP7A 3OPZH 4F2MA 4KUZH 3FT4B 3O8XA 2M1KA 2K9UA 3N44F 4KVCH 3HRZA 2C9UA 3C87A 1LEGA 4QRTA 4WSGA 3KLSA 4FYTA 1Q38A 4QT5B 3WNOA 2VN7A 1GTNA 4AQ8A 1LD9A 1ADQH 3CZFA 3T1FB 2G5RA 1JV5B 2ZWSA 4XCEB 3BUDA 5I15L 2D0FA 1UH4A 3GWJA 5I74B 1JF5A 3MXWL 4XC1L 5AW8B 1YEHL 5HP5A 4DJMA 5DHYA 3B5HA 2KZWA 3SBQA 3VGEA 2NX5E 4UOQA 1VGKA 4NFDA 2XXMB 2DIBA 2GIMA 4MWFB 3W11D 3X3FL 5BQDA 2QKIB 2UUDH 5BQ7B 5BMFL 2IAAC 1CT8A 4DN4L 3NJIA 1OTUD 3FCTB 2YRPA 2YPVA 3QRGL 4MCZB 4QRRE 3U25A 3KGSA 1F6AB 2PPCA 4M7ZC 5BO0D 2G75A 1REIA 2I26N 4L8SA 4FERA 1KJMB 3BAEL 4W6XB 4TVPE 1U8PA 1U8OB 4MBRA 1HHGA 4Y5YA 4ZI8A 2QPDB 4GG8A 1X5LA 4AE1A 4C8XA 1F3JA 1MWAB 3T2NH 1RY7B 4I4WA 5F9JA 3ZZLA 3NTCH 3DYMA 1NCUA 4F1SA 1KYFA 1SOSA 4N0YL 1NGQH 3K3QA 1A66A 3MNZB 2JK5B 3GLAA 2IADA 4HCFA 5I5JA 3VWKC 1WSST 1FE8L 2X6VA 1I31A 4JRWA 4TTDC 3S4SB 4MB1A 4DZBB 4P5RA 4OLUH 5IHZA 5CBEB 2R0LH 4KY1L 4HMEA 3UEQA 2CK0H 2NW2B 4UV7L 3CNKA 5KBDA 4NC0B 1OCWL 5PCYA 4OVUA 3TBWB 5IR1B 4M6NL 5IQNA 5E9DB 2UZYB 5FYJD 2QSTA 1J05A 2DLTA 3C5SB 4IOFC 2VQ1B 1FFNB 4YDKL 1EBPA 2F7IA 2MEJB 2AABH 2XT1B 3HE7D 3DVGB 3CHRA 3ARGB 3IDXH 1SJHA 35C8H 1S7VA 2EYTB 5K9KB 5MEOA 4FHKA 5H4ZA 2BNQA 5IOPB 4GXFA 3MRRB 3FB7A 3Q6GL 4KXAA 2RTTA 4LLUA 5HDBB 5BZZA 2IG2H 4KQ4H 4G72B 3G04B 1MREH 4N1CA 3WN5A 4R5VA 5HI5D 4FNLH 4AL8H 4TLUA 1UA7A 2P43B 3FMGL 4KKAC 4NUPA 1NBYB 2HJKA 3I75A 4IBVA 2DEWX 2HYMA 2GJ6B 2F2HA 1WH0A 1G9MH 3BPOC 1N67A 1QI5A 3KDPB 4XBPA 4Y4KB 3UZVB 3V5DA 4AMXA 5GS3A 1IGYB 4DGIL 2NUPB 2H41A 3P4OA 4OAWA 3AACA 4UM8B 2QZQA 1SY6H 2XY2A 4K0OA 4LF3A 4LL9A 5HGHA 3DPBA 3RI5K 1P2CA 1E30A 2EIJB 4U7MA 1G5GA 5EOCL 4G11A 4KMQA 3QRFM 3I9AA 5J12C 1SMAA 5HI3D 3HS8A 3C09B 3FOLB 4B7LA 4DIXA 4L29A 4NQED 4GKLA 4PJIB 2C9XA 5FA3A 3Q3GB 4WEBL 2ZG1A 2K45A 3OXRA 4RQQA 4KZEH 3PAUA 2VRAA 4WI2A 2DKMA 3I3EA 2WSDA 3MRJA 4Q0XL 3EW3B 1KCUH 1RUQL 3HE7A 1RP8A 4IS6A 1KNOA 5CEZH 4BH7A 1IM3B 1U6AL 4GRWB 4LMQI 4P59H 5DZJA 3ECBB 3F7YB 3BVVA 4ALAH 2L7UA 1GOGA 3OR6A 2CJSA 4H0IA 1TLMA 1QEXA 2R4SH 2NY2C 3IDYB 2YUXA 4GYBA 4LDCA 2DLIA 1AG6A 5DU7A 5JXAL 4XGZA 3NIFF 1NOFA 2D03L 4JG0H 5L4FA 1ZLUH 2NSQA 2ZKHL 2H2SC 1UUSA 1CI5A 3AMLA 3WS6C 4DF9A 2UUDK 3VRIB 2O61B 4Q6IB 4CN1A 3GMNB 3QR0A 3ESMA 1XGQB 1B88A 2HVBA 3DSNA 1A6WL 5DVOA 3V4PA 1D5ZB 3OKNA 1H3PH 5A7BA 1ZE3H 3Q44A 4PV1C 1PDKB 3B2VL 3ZK0A 2EDFA 2EVGA 4NQEA 3SPVB 1I3UA 6FABL 2G3ZA 2R0ZH 2OJ1A 3T2QA 3WIIH 5L0QC 1GC1H 4KPHL 2X88A 3SDDC 2MFNA 2H0PA 1SBBA 3LIZL 4K3DH 3OB0K 4GRMA 3VA2C 3CV5A 1Q0XL 2BIMA 3FPXA 3BKMH 4IU3A 2PXYB 3FTUA 5EUOF 2XV3A 5IZ7A 4GKZB 3MLPA 4JG5A 4BFIA 4L1LA 2Q8BH 4NQSB 4N8VA 1BM3H 1GYCA 15C8L 4JB9H 2XWJA 3BAJA 4P2OD 4WI0B 3U46B 1BD2E 4U3HA 2R2EA 3KPQA 3MBEB 4J1UA 4NQVB 3ZKXC 3LQAC 4FKHA 4ETQA 3PGFH 2AJZA 5JHDB 2XWXA 3H6AA 4F9PC 2PPEA 2QSQA 4XVTL 4LU5H 1GHFH 3D39B 1FNLA 3DX7B 2IBGA 3C6SB 3EADA 3FO2B 3MREB 1MQ8A 1MCQA 2ZXCA 5J1TC 4FYQA 2YGNA 3EOTL 5HD8C 3P0YH 2VE6B 4FFVD 4YC2C 1MQKH 2I60L 1BQKA 4UILH 3AQXA 4WUKH 1CYWA 4HBCH 4P48A 4TUJA 5JOFB 4EVNA 3RILA 4BHUI 3PV6A 2XJLA 2V7NB 4NN5B 5AUMB 1QFPA 2GQHA 2IAMB 2Z7WA 4JRYE 3U82B 1KBKA 2G4EA 2VZ1A 5I0YA 2YD5A 3T8XA 4F57L 1OSYA 4KTDL 5M94B 1S8DB 4U1GC 1AGCA 1T21B 2V33A 1AD0A 2Y5TB 5LWYH 1NQBA 1NGYB 5D4IA 2DICA 4XAWL 3CSBA 1A8ZA 1NPUA 4PBXA 1BJ1H 3FO9B 2Z7ZA 4TUUA 3HR5B 1SXAA 1YJDC 4P2OA 5IW6B 4X4ZA 1XF5B 5FCUL 1NLDH 3FT4A 2XNAB 1SY6A 3G08B 5DRNB 4GRWH 5K9OB 2QQKL 2AAAA 2YC1B 4QT5A 3ZY7A 5LBSH 1BQLH 3BEWB 4J4PD 5AKTA 3SGDI 4OV5B 3PWJB 3T1FA 1JV5A 3CBJB 2Z92B 4XCEA 4U6VL 3SPCA 4ZT1A 4AQZA 2C4FU 3CSYA 5EU6B 3T2LA 1OALA 5F1NB 2F9BT 3ZL4H 4FF9A 3FBKA 4AEEA 8PAZA 3DBSA 3A6CH 2NUTB 3ZGHA 3V9FA 4MWFA 1JGUH 3QWQB 3B3IB 3MAWA 3WD5H 2QKIA 3L7EB 5E9DD 5BQ7A 5HYFA 4M61B 1KENL 2R0WH 2PR4L 2QQNH 3BMVA 4PS4L 3FCTA 2W65B 2NCMA 2Y36H 1VEMA 4X7TB 2P9RA 2RGSA 3ARGD 4PVLA 3MA9L 2ODIA 4ZS6C 1ZLUK 4WJ5B 1W91A 2WBKA 4OFDA 3MROB 3VWJC 1A7QH 4G6AC 1U8OA 2WVVB 3BYYA 3BPNB 1RUAL 4R96B 3HEIB 3RNKB 1MWAA 3MLRL 2KH2B 2GCYB 4K7PY 3VI3B 4BD4A 2QHLA 1INEL 1KYAA 5IFHH 1GGIL 3B9KB 3WSQL 4A2EA 2GJ6D 4Y4KD 2AJYH 4J4PA 2BMKB 3RVUC 2DH3A 2JK5A 2AEPL 3VD2A 4ES8A 1MAJA 4NLAA 3UP6A 3KVDD 3Q01A 4JQXC 3S4SA 3S48A 4NKIL 1XIWC 3B5TA 1A4JA 2Z31C 3GJFB 2Y72A 3FHQA 4NM8H 3VXQB 4JPSA 2NW2A 5A2AA 4Q4IA 1R46A 3D4GA 2AZAA 5EU7C 3TBWA 5IR1A 1U2HA 4GJTB 1JXFA 5E9DA 1EAJA 1GIGL 2LLNA 2WXPA 3K6OA 3QXWA 4G5ZL 4DUWA 2UZYA 2ZG2A 1A7NL 2VQ1A 3BKJL 1FFNA 1AR1B 2XQBL 2E7LA 1HEJC 2PCXA 3D50A 1RIHH 1YQVH 5DR5H 2D73A 3DVGA 3ARGA 3CFTA 4NYLB 1IM3D 1PZUB 2EYTA 1NFIB 5K9KA 2CO7B 2BK8A 3FOMB 4D2NA 1I7UB 5IOPA 4LIQE 4L9DA 3MRRA 1J48A 1KXVC 4WI4A 4MJJA 1FN4B 4ODVL 3VFGL 3G04A 2X9WA 3DWTA 3TJPA 1NBYA 5HY9B 4R7XA 1U8CA 2GJ6A 1JZFA 3UO8B 2DLHA 3UZVA 4Y4KA 3EO9H 3VGBA 3FHAA 1IGYA 2NUPA 4EXPX 3FT1A 4UM8A 1XAKA 5IB1B 2WXNA 1ZVHA 1DBMH 4JCMA 4ZMNA 5C6TL 4KNTA 4OLVL 4DFIA 4ANKA 3KE0A 3CHSA 2EDXA 4IRZH 4JHAL 2Y5QA 4F7MB 2R0KH 4PVNA 2IFFL 3FOLA 3NH7H 3HE6C 1YEIL 1WLHA 3JWOL 4PJIA 3TJHC 3Q3GA 1T0NB 1K4DB 1S7RB 1ZV5A 3N41B 4LSRL 4L3EB 4OLYH 1AIZA 2OL3L 2WLNA 2OMWB 3V0IA 4JPVL 3QP3A 1EDQA 4AEFA 3KXFB 3VGAC 4PGJA 3DDFA 3WELA 4XN7A 5IVXF 1IM3A 4MFHA 1E9PA 1RJLB 5AVXB 3DOSB 3ECBA 3F7YA 1OAZH 1F3RB 1MDAA 4U3CA 1DQMH 4GUCA 2WN3A 1A3RH 3C8HA 4N3TA 2C9RA 1JERA 3FQWB 1IAKB 4QCIB 4ZG1A 3M8OL 3MBED 1JMXA 1I1AC 3TM6A 1YRKA 1H5BB 1T4WA 5JHDD 5KS9E 2CPCA 3BFOA 5TQ2L 4A68A 2VN3A 5IBTH 3VRIA 1ONQB 2IANB 2Y6TE 4Y5XB 3D39D 3KWVA 1JVOA 4MMXB 5C09B 4Q6IA 2O61A 3GMNA 3ZQWA 1SOQA 3OMIB 1XGQA 3OPUA 1JWMB 3SKJL 4KY2A 3QBTB 4YBLB 1CDIA 2FIRT 1D5ZA 2IOMA 3RBGA 3BUQA 1GY1A 3VVWA 2V9UA 4N0CC 2OP4L 1A7RH 1G7MB 4FL4B 5KJRH 4S0SD 1PDKA 4HLEA 2NY5C 3FUDA 3SPVA 4OW6A 2EDKA 5IQLA 2IAMD 4RMSA 3OKLA 3F64A 1V3MA 4RWYL 4MB5A 2XDHA 4AOFA 2XQYG 1QFWH 3LKPB 4FXGC 5D55A 3GJFH 2OR9H 3TS8A 4M5YH 1NAMH 5AB9A 3D7PA 4R7DB 3LRLA 2WP3O 3G6AB 5JMRA 3AQDA 1H3WM 4TVPL 1FAIH 1KGWA 1NMBH 1WUZA 2PXYA 5I1CL 2K8QA 3SPIA 3A67L 4GKZA 4UTBH 4WTQA 4R4FL 2HFTA 4PLKD 4NQSA 5I19H 4FA8A 4KAQL 3ZE1E 1I7ZB 4DEUA 5DMGC 4KKBC 3IMVA 3U46A 4X4ME 4WI0A 3QJXA 3H9YA 3BYTA 5MEPB 3VGHA 5D71L 3MBEA 5SV3A 2VXUH 4MMZC 3MOAH 3NRFA 5JHDA 2HRHA 1DL7H 2DM4A 1X5GA 3LMJL 3D39A 1QZNA 3MUHL 3FO2A 3MREA 3N3EA 5EU6D 3AXLB 3AB0C 4LAJH 1HOCB 1MCEA 2DQ6A 1J86A 2NYZA 1FL5B 1UT2A 3AREC 2Y69B 2JIXB 3Q1SH 1FLRH 1BGXL 2LT9A 3MX0A 1JV2B 4N5EC 1T7XA 3C2SA 4HIXL 2V7NA 4JFTA 5AUMA 2IAMA 4FQXB 1AY1H 2EXYC 3TEYA 3RPBA 3FRUB 3GM8A 1F6LL 1EO8L 3E3QE 1UC6A 4DP0X 5DQJB 4BQ6A 1S8DA 2Z35A 1T21A 2Y5TA 3V4LA 1F4YH 4FQ1H 1NGYA 2HH0H 2NY5L 2HRLA 3L81A 3LS5L 4L1BA 1ZSHA 3DJZA 3FO9A 4A2FA 2EDYA 1X5FA 1IGTA 4Y7OC 2E9WA 3BWUC 4N2BA 3HR5A 1PX3A 3ZKND 5E08H 5IW6A 32C2B 2W9EH 3NJGA 2R1XB 5KBLA 3HUJF 5GRUL 2XNAA 4X5XB 3G08A 5DRNA 3FDWA 5I76B 5K9OA 2X3CA 4HC1H 4WWKD 3WO4C 3B9KD 4DERA 2YC1A 5F1IB 4IRZA 4F7TB 3BEWA 1RZJL 3HVNA 4OV5A 4K5LA 1JHKH 4GI9A 4ZMPA 3PWJA 3PDOB 4U1SB 4YSRA 2J8UF 2Z92A 1SM3L 3OLGA 1G1CA 3L4WA 4MX7B 4OZHF 5EU6A 3ZUCA 1Z5HA 4FTVB 5F1NA 4Y5VB 4EKXA 4M1CD 1WQVT 4FJYA 4FKEA 2XKUA 4OKDA 5AVSB 3VXUD 5HJBA 1A1MB 5FLVA 1H8LA 1N4XH 1WCQA 2D4FA 3AY4A 2NUTA 3TT3H 4X98B 5BRZE 3B3IA 4OIAA 1RU9H 3L7EA 1A14H 3P3TA 1XEUA 4M61A 2FO1A 4JMXA 4Y8AA 2ZJSL 4P3CL 4NZ8A 3NPSC 2E27H 2W65A 2GFBB 4ZUUA 1S5IL 3UJJH 2N0KA 3RU8H 1LO3L 4X7TA 3BRGC 5I1AB 4IRSB 3SPJA 5AD0B 4O02L 3WKPA 4WJ5A 4E5XA 4XTRD 4AITA 3MLVH 3MROA 1OGAE 5A40E 1SMOA 4XN2A 3RNQB 2WVVA 4JQVC 1RZPA 43CAB 1AO7D 1PLBA 4LSTH 3L9YA 4I3SH 1M56B 3SYOA 2J56A 5CCKL 4G1EA 4HMDA 4R96A 3RNKA 3RL1B 1SDDB 4M43H 2GCYA 2V7HB 5GRYA 2AXWA 2I25N 1EJ6A 3VI3A 4WWKA 3M86A 4AZ8B 3B9KA 5ALBH 5AWNL 4YSTA 3TO2B 5C3LD 5G55A 4LLQB 2BMKA 3LD8C 1C8QA 4W81A 1XGUB 3JT0A 4U7SA 3D34A 4F2ME 4PH8A 2ZX7A 5T5FA 1ODAA 2F1BA 4YVUA 3KPMB 4JKMA 2IH3B 4HP5A 4X4XB 3TESA 4WW2A 5I18L 3GJFK 2VW4A 4B0MM 2VJ8A 3UFIA 4RSYA 5C6PB 2FH6A 3VXQA 1UURA 1GKEA 2YA2A 5TDPB 3TPUB 5ES4B 5ECJE 1QACA 1F1AA 4IKIA 1R0AL 5FGSA 2DJ4A 1EZSA 5FGCE 3QC6X 4G8FB 4BINA 4QGTA 2BIHA 1FFPB 3FU0A 1CL7H 4OT1L 3S36L 4L3ED 2JKXA 4LGRB 3MBXH 5JHLL 4S1RL 3VXNB 4MZRA 2WWMD 4R4ND 2RQ8A 3KXFD 3QUYB 5TQ0L 4NYLA 1MJ8H 1OAKH 2ATPB 4XWOC 2ZF9A 1NFIA 3FOMA 1D5BB 1I7UA 4LRNL 1LE5A 1FN4A 4LOFA 1WEJL 1A65A 3QYNA 1KB5H 4I18C 5FFOA 4ONGH 4IBLT 1T2QL 1FORH 2VERA 5H37H 5HY9A 4UT6H 4DQAA 2JV6A 1V55B 2A6IB 5FCSH 2G2PA 1BYPA 2YBRB 1T89C 2IAND 5GPRA 3CFQA 5C09D 4PAZA 4MJ6B 3RWIB 1SHMA 2IQAB 5IB1A 1OZTG 3CLFL 3N1FC 3PGCB 1SXZA 1I7TB 1L9RA 3QWOB 4QI3A 2JTDA 3O3AB 2RH0A 4OF5A 4F7MA 3JWNH 4NJAL 3IRZA 2ZXGA 1OTTC 3QJTB 5DLMH 5HVHC 1T0NA 1TETL 3S2AA 1BAFH 1S7RA 2ROYA 1JJUA 4L3EA 4AVJA 4QXWA 4O00A 3KGRA 1J8HB 2OMWA 1QPPA 3KXFA 2JQZA 1G7PB 5ABAA 1WWAX 1RJLA 2B7DT 3DOSA 2ZOWA 5JQ6L 4Q9BA 4JPKH 1CLOL 3IJEB 3BOVA 4L4TB 2OTWB 2VMJA 4YSAA 1A22B 3AC0A 1DCEA 2A83B 2BJMH 2VQ4A 5E7BA 1IAKA 3QHTC 2HPTA 2B4CC 2O5NA 4YBQC 4QCIA 4AUJA 3BGMB 2BNQE 4QD2E 5A2JH 1H5BA 1SMDA 2DQEH 4DO5A 4AT6B 4K7PX 4HIJB 3FRPG 1ONQA 2IANA 2UY6B 1B3JA 2L7QA 4Y5XA 5C09A 1EVUA 4MMXA 3NIDE 4HFUL 1NKGA 2CCWA 3FJTA 2Z93B 5IP4A 1JWMA 2RACA 4PBDA 3FK3A 4NQQA 4X2UA 2IPKB 5E6IC 1N7ML 4JDTH 3F58L 2JIXD 4G8GD 1I3RB 1G7MA 4YDVB 4BFFA 4QHPA 2P5EB 4AW4A 1V3JA 2HMID 4FQXD 3VTMA 4JFQB 3IS0X 2KL6A 2VISB 4JO4H 3PJNA 1KN2H 4QLWA 4XO3A 5F71A 3LKPA 1RPQA 4JNXA 2OW7A 2BRRH 4ZTPH 5FGRA 4DWHA 4R7DA 3G6AA 4B7IA 5CD5C 1PG7W 2AAVA 1OSPH 1E9OB 1FPTL 3LKQB 1D5IL 1DFBL 4GS7B 3W57A 4DFHA 1TPXB 3AS0A 4DPBX 1I7ZA 3DMMD 3EH4B 1U21A 4BE5A 2WBWB 5E1GA 3S34H 3STBA 2X87A 1KBBA 1U3HB 5K69A 3QUZC 1UEMA 5D7HA 5DUJA 2B15A 4LPVA 3EAKA 4N3UA 1CLZL 3DO3A 3WTVA 4EDXA 3TO4B 2LFEA 4KXDA 4P0DA 4RDBA 4WTXA 2CBOA 3HNTH 5KSUB 3VW3L 4ZX3A 3AXLA 4FTVD 4JDVB 1H3VA 5D7LB 2MCAA 1HOCA 2N1TE 1E5ZA 2H1PH 3T77B 1FL5A 2WO3B 5KYNA 1RURH 4G8GA 2JIXA 4JGNA 1JV2A 2H32H 1P6AB 4X8CA 4L4VB 3IDUA 4FQXA 4PG2A 1GGCL 3FPYA 5D1QC 3F3HA 1VGEL 2DMHA 3FRUA 3N42F 3SE4A 4D0BB 3HZMB 3QIUC 1UH2A 5DQJA 1MY5A 4NQEE 4I5BB 4I48A 3DVNB 1GR7A 3ZMEA 2WKOA 3B9DA 4LIQL 4JKWA 4DZ8B 5H37A 3T8VA 4MA7L 1JE6A 3EYOB 5TD4A 3FW6A 1UD8A 3O6FC 1PZ3A 3DMMA 4R8WL 2J1ZA 32C2A 3TYGH 1Z0MA 3FAWA 3H2QA 4X5XA 1HXMB 1PSKH 5DVNA 2ED7A 5JIQA 2YRLA 3WUWG 5I76A 3ARDB 2WN2A 4EXKA 1YNTB 5F1IA 4N2OA 4HT1L 3CBRA 4EO5A 3QCTH 3O11B 3PDOA 4U1SA 5LAXB 2BIQA 2NZ9C 2O30A 1J1OL 3K80A 4J3UA 5G5DB 1NLBL 1ZV9A 4IOSD 4OZ4B 4N68A 2I7SA 3PU7A 4MX7A 4FTVA 4Y5VA 1RULL 1NM9A 3A6BL 3U2IA 1R4XA 3UJIL 4NC2B 3SZ6A 1A1MA 1V7NL 4NAMA 4X98A 1G7HB 1DQKA 4PJ7B 3GTNA 3JUZA 1M2VB 3PQYB 4OGXL 2VERN 1RAMA 2ZWYA 4ODHH 3BVWA 2JELL 3SCMB 5T3ZD 3EHBD 2GFBA 4IJ3C 4UB0L 3QAZC 1SLUA 4EIUA 3QUYD 5I1AA 3X2QB 1HDMB 3DJSA 5AD0A 3IU4L 4KKLC 3MA7B 4M02A 1A0QL 3RNQA 3HC0B 1IIIA 3B1UA 43CAA 3WTYA 4PU2A 4XO4A 4YGAB 1TZHB 1VDGA 4QF1B 3HMXH 1SDDA 1WZ1H 4I0KA 2V7HA 4CVXB 4YSPA 3UYRH 3EXJA 1CFVH 3FSWA 2FJUB 5F6HI 4AZ8A 3TO2A 4YSCA 4ENZA 2P26A 2RA1A 4LLQA 4MDRA 4GG6B 5IFAL 4YSOA 1XGUA 3BEVB 3S9DB 3NT0A 4MJHA 4PYGA 4AK2A 4IOSA 3QHZL 3KPMA 2XPZA 3E3QC 1F02I 2IH3A 3MRGB 4X4XA 3OHMB 4XR8C 5D7EA 3RA7L 4NZUL 2HFGH 4FLRA 1PAMA 4FQJL 5LN4A 2MRYA 3TPUA 1AQHA 2CZNA 1S7WB 1Q8MA 3B8YA 4TYUA 4LSUL 3QQ9C 5FWQA 4GSQA 2YXFA 2Z8VC 2XTSA 2ADJB 1E2WA 4G8FA 5E1IA 5D9SB 1FFPA 3IAGC 2HB0A 3PXHA 1A6VH 3N85L 5T1DL 1J8HD 3VXNA 4GRLB 5CEZE 3V4UL 5E9NA 4AGMA 2VXQA 3QUYA 2AJVL 1UWFA 3IFNL 3S3CB 5JDJA 1D5BA 3RIFK 3OGCB 3NVQA 4L4TD 2VDKL 5F9WB 5AOIA 4OLWL 3BDYH 4OD2B 4NENB 4IBWA 2YGOA 2CR0A 3EH3B 4HKZB 5B22A 4FKKA 4FJ6A 4LK4A 4Z7UB 1GXEA 4ZUTB 1KBWA 4H8WL 3VD0A 2A6IA 2D7NA 4O9HH 2NNCA 2VLRB 1L6XA 3BCFA 4MJ6A 2CU9A 2FUTA 5I8EB 3RWIA 3WEAA 2IQAA 4MQSB 5C0BB 2ZT9C 2VUYA 3PGCA 4S1SH 2YARA 1I7TA 1QKZH 4KTEL 4J3OF 3QWOA 4V2CB 1QNZH 5CU5A 3O3AA 4BDVB 1JTOA 1TITA 2GUYA 5B1CA 2BWDA 3MSPA 3WFDL 1MJ7L 2P5ED 1X3DA 1X9LA 1G87A 4B95C 5F8QC 4OCWL 1J0HA 4H2CA 5HHVH 3ZUNC 3IPBA 1V3LA 1J8HA 4HF5L 1L9SA 4XWGH 3VDAA 2DD8H 1G7PA 1IFGA 1KCBA 2VLJB 3EOBB 3PFQA 3V9CA 5JIMA 1ZANH 3MYJB 4LCIL 3US9A 3IJEA 1JZ8A 1X5MA 3BSZL 4L4TA 5FFLA 3PS6A 3QZWG 2OYKA 1Q1JL 2A83A 4GQPH 2FATL 4YFLI 3ZT5A 1SN2A 1A5FL 5ACMA 3BGMA 2CM6A 1XXDC 1JDDA 4XMZA 4M7JL 1KOAA 4UOJA 5HDBE 1ACCA 7FABH 3LZFH 3TO4D 4AT6A 4QAWA 2CR6A 1E5BA 3GXIA 4HIJA 1ZPUA 2UY6A 2JJVA 4UQCA 1YEEL 3NUKA 2LGNA 1TJMA 2DMBA 5G4MA 3ZTJG 2ARWA 4O2FB 1HINL 3CFDB 4XXCA 1IEAB 2Z93A 5AW4B 1ERNA 2GJ6E 2FGZA 4NP4H 3UCQA 2IMNA 1N18A 3KVQA 4Q9QH 1MFCH 2IPKA 5EOQH 1I3RA 3HOGA 4QAMB 1EGJA 4YDVA 1FGVH 3MRPB 1P0SE 2P5EA 5FF6B 2E7DA 2RCSH 1KEGH 1P5UC 4KO7A 4L4VD 3U0WH 5FM8A 5FYLH 5LXVA 4JFQA 2VISA 1LM8V 1R47A 4F91B 1ANUA 4L8SC 4IDJL 1HTYA 5CGTA 3ATBA 1QR1B 1JZHA 2C3WA 2NY3C 2VCOA 5LBGA 2DWEB 3VFWA 4PJIE 2ZCKH 1E9OA 1ZIBA 4YHMH 4OF3A 5D7SL 2D4DA 3IJHB 3AGVA 4OCXL 2EH8L 1T0PB 3QEQB 1G6VK 3EDEA 4XBEL 1LO0L 3KD4A 2C3VB 4JM2B 3VO0A 4AYMC 4MXWH 1S5HB 5I8KH 1J0YA 2X1QA 4GRWE 2G30A 4OF0A 1PU0A 2A73B 4J8RB 1WWWX 3ARDD 5DDHB 1J5DA 3VNYA 5CZXD 3B2XA 5MI0C 4U1HA 3TO4A 4Y19B 3C5XA 1XH0A 1JNLH 4HUKB 2FJHB 5EFIB 2BIPA 3WHE1 1E4KA 1YYML 3QPXH 2NY6D 1CXKA 1XCWA 4JDVA 1LO5B 1OAQL 3JQOB 2LU3A 3ZT7A 2PETA 2NZ1A 4ZOCA 1W8OA 2H1XA 3KDMB 4L4VA 1IE4A 3PQYD 4N85A 3SCMD 2YO3A 4A1RA 5J9PB 3WNLA 5T1JA 4D0BA 3HZMA 3BD3A 5ADOL 3TA3B 5DC0A 3C60B 2P7TB 2P8LB 4I5BA 1N8ZB 3DVNA 2F7PA 2Y7NA 1T1YB 1SF5A 4DZ8A 4YXHH 2YPVL 4AEIL 3EYOA 1U8HB 2WOBA 3BXNB 2LABA 1UADC 1XB3A 1H6EA 4TNFA 4S0TD 4UIMB 1MIEH 3PUCA 1UG9A 2YEVB 1ACYH 1HXMA 4GIOA 3WIAA 1VFOA 3ARDA 4ZX4A 1YNTA 2VITB 3HHSB 3IFPB 4WCYH 3UO1L 2EUVA 1E27B 3VH8B 3CFIC 3U1QA 3O11A 5LAXA 3TZVC 4MQTB 5HI4D 1RUMH 5G5DA 1TJGL 4NO2B 4WNSA 5F6IC 4CA4A 5FYLD 2WSKA 4OZ4A 1IBYA 1HZKA 5JHDE 2ZOLB 1JVKA 4G7VL 5KS9F 4L2LA 2BCKB 1UACL 3HNSH 2R39A 3D39E 3LN4A 1G7HA 4E68A 4PJ7A 1M2VA 1N0XL 3S37X 3BHBB 3PQYA 5EZIL 3CXDL 3H4FA 2JKJA 3BCDA 3AQYA 4XOEA 4YDIH 3SCMA 2A99A 3K8LA 1A7PL 1FBIL 3INUL 4GRLD 3TWCH 3SZKC 4LPYA 4Q97A 1O9VA 3QDJB 3O6LL 4LPWA 2Q6WB 4WAFA 3N40F 2X2JA 5KBMA 3MA7A 1JVLA 1AKJD 3BISA 3HC0A 3Q6FB 3GLEA 4E36A 1FGNH 2BP0B 4QF1A 5AOJA 3PYCA 4LZKA 4CVXA 3D12B 1EZUA 5I26A 4N90D 2NNRA 4Y4HB 1KGYE 4M48H 3VRLE 4M7LH 5C0FB 1FH2A 2X9ZA 1GPOH 2Y4SA 5AAMC 3JV6B 1AI1L 3TXAA 4GG6A 3ZE1F 2AJUL 3LZQA 2VLRD 2E86A 2FT7A 2WANA 2XBDA 1ZOXA 2FBOJ 4FQHB 4JN1H 3X12B 4UQ3B 5F96L 4Y89A 1E3XA 5C0BD 5C0DB 2NY4D 3MRGA 5A2KH 3GKZA 5J13B 3I6GB 1BVNT 3U0PB 2IPUG 4K9JA 4JLRB 1GSMA 3WIHH 5BXFA 2FX7H 1WZLA 1TVHA 4V33A 4MRBA 1R75A 1AG0A 2ADFH 2FYVA 3LDBB 1OV8A 5HHNB 1S7WA 4N9OB 5I1JL 1F56A 1I8UA 5EU6E 5H8DA 3UDWC 2ADJA 3RVTD 3L5XL 5D9SA 4XX5A 1TMQA 4GRLA 1XXFC 1H6UA 2WGNB 4PCSA 5DK0B 1THCA 1E7UA 1UZ8B 3X1GA 2VLJD 3EGXB 4ACTA 3IGKA 3Q9QA 3CZKA 3OGCA 1ZXQA 5JHMA 3MJ8B 3S88L 4RMRA 3U1SL 2EC8A 1Q9KB 3PRZA 1BEYL 1KXQA 1T7ZA 5BVJB 4KUZL 3CX5K 4OIIL 4OD2A 4NENA 1ZK9A 2V8LA 4HKZA 5I1DB 4Z7UA 4ZUTA 1QRNB 1FP5A 3Q48A 2FNWA 1BJ8A 1D7FA 2VLRA 4XMPL 5I8EA 4G6MH 5C0BA 4XZUB 4UBDC 3VI3E 3M88A 5BZXA 1OE2A 4DQOH 3WTSA 5J56B 1X5JA 2ZPKH 3QUGA 4BDVA 2GSMB 2YS4A 5E6UB 4HXBH 1D7DA 1YVLA 5I75B 3GIZH 1NTDA 3RDTC 3FONB 1WT5A 2XICA 4HHAB 3L17A 3V4PL 5EWIH 4CC1A 1AP2B 2W9DH 4AL8C 4UQAA 2KKQA 3IU3B 2Y3NA 4NUGH 5FDWB 2VLJA 1G9MC 4HOWA 3EOBA 2AHIA 3STLA 2XFGB 2XVKA 4DPRA 3VUAA 3MYJA 1GYWA 4ABUA 4PWHA 2DMCA 5FYKD 2MPAH 3W0WE 1R33A 1U8JB 3H6JA 3QEQD 2D0GA 2JKLA 2Z8WC 4L5FH 4PLOB 4IRJB 2VO5A 4JM2D 1WRFA 3T2NL 4BWUA 3NTCL 5C8JB 5D1ZC 5JOEA 1UKSA 2KS0A 4KKCD 5H2BB 5I6MA 1L7TH 1OK0A 4PJ9B 3QCVH 3ZR5A 1A9BB 3KYKL 4Y19D 2VUKA 4U6TA 2Y06L 1F13A 3KJ6H 3AG2B 4NM4L 5FUOH 4NWTH 4O2FA 3VI4B 3CFDA 1IEAA 2CK0L 2XX0A 5IHUH 4TQHA 2O5ZL 1JF6A 4ALAC 3UBGA 1U93B 3NFSH 3JZYA 2K70A 3BAKA 1TSRA 3IB4A 3QQ3B 3MRPA 5FF6A 1A8JH 3HG1B 3WDIA 5KVFH 1USQA 3X11B 3U79A 5LCVH 2AABL 5IBUG 1G1YA 2FUQA 1Q9WB 5I5IA 3F12B 1N0LB 4XB8A 3TA3D 35C8L 1QR1A 2DWEA 2P46B 4BFEA 4ATTA 1MCBA 4XOBA 2VM9A 1UOKA 4KK9D 3IJHA 4O2CB 3MRQA 4KK5D 4RX4D 4N28A 4XPGL 3QEQA 1PLAA 1NWPA 2F5BH 3JWDH 4JM2A 4N2LA 1FNAA 4FNLL 3KXFE 1PD1A 4XOCA 1S5HA 5I8CA 2JMRA 1RVFL 3II1A 3L1FA 4ZW7A 2A73A 5DDHA 3WIHA 5CN3A 1QHOA 4FG2A 3GXMA 2TSAA 4UT9A 1R5IA 3WNPA 1Y7VA 4LARH 3O4LB 3Q05A 4Y19A 3MODL 1GC1C 3DBXB 1SY6L 2FJHA 5EFIA 1L9TA 3S3JA 1T6WA 3LZNA 3ULVC 2BFGA 2CG9X 1LO5A 3KM1A 3D06A 3L9RB 3SKUD 4L23A 1SXBA 1K4CB 2IANE 5IJCC 5C09E 3ES6B 2GI0A 2XQYA 2E9IA 3KDMA 1IE5A 4KZEL 3D4YA 3DXAB 2DEYX 2EE0A 1NKRA 5J9PA 2FQEA 5FAAA 2YAHA 1WFNA 4F5CE 5B7FA 1YC7A 3RVVD 3TA3A 4P59L 3QDJD 1K2DB 1CVSC 2P7TA 4X7SL 3V6FB 2P8LA 5E7FA 3PAYA 1N8ZA 5MP6H 2RB8A 4TQIA 3FTSA 5JQIB 5LDUA 1T1YA 1WGOA 3FN0H 4AV5A 1L9MA 1U4FA 3HR6A 1U8HA 3BXNA 2MCPH 3T0EB 1A3ZA 2R4RH 3ARRA 2HLEB 2AEIT 4UIMA 5AL0A 5DVLA 1BBDH 3TT1H 2X9XA 3BIKB 4Y4HD 1DBJL 5DGRA 1SQMA 2VITA 3HHSA 3IFPA 4GOSA 2EVHA 3VH8A 2DI8A 1I9RL 2D31B 3CIQA 1EEUA 1MWAL 3QUXC 4OF6A 2AXGB 2J88L 3LV3B 3OBAA 4NO2A 4WFGD 3MLWL 4KMLB 4J3TA 1H3PL 2FO4A 3QJZA 5DJ6B 3C09C 2ZOLA 1E65A 1FDLH 3LZLA 3NIGE 4KRNA 2BCKA 5IJKA 5I6LA 1D7BA 3DIDA 2G0KA 3DETD 3NIDF 5F88B 3BHBA 1QD0A 3PDGA 3LCYA 4FQLH 1PZSA 3LXBA 4K3DL 4LVOB 1T2JA 1CGVA 3MUGB 2QEJA 2MNWA 1WYJA 1OL0A 3BKML 1M4KA 3QDJA 4I3GA 3TF7C 3OJMB 1EUTA 2Q6WA 5C0GB 3NA4A 5HTSA 1G9EA 1X5YA 4RFNB 4KI5D 2MPVA 4G7YH 5TE6H