1J8RA

Binary complex of the papg receptor-binding domain bound to gbo4 receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords PYELONEPHRITIC ADHESIN
publication title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor.
pubmed doi rcsb
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 1j8rA00
4Z3HA 4Z3FA 1J8RA 4Z3GA 4Z3IA 1J8SA 4Z3JA 4Z3EA
chains in the Genus database with same CATH superfamily
3OB0H 3T4YA 1R3LA 2IWKA 2I9TA 4EJ1C 4L1HA 3BGAA 4G82A 1JRHH 2Z31C 1CE1L 3IF1B 4XAKE 4NM4H 1GYAA 1HK6A 1CDHA 4Q6IC 1BZ9A 5AW4B 2XYCA 4LEXH 5F7MC 4UOW0 4OB5L 4ZYKB 1NEZA 1RFDH 2A6DA 5FYLH 2NY0B 1WBYB 1ACYH 2QTVA 5BVJB 3TYGH 5FO7B 3X14A 1QFUH 4KK5C 5KSBB 3ATEA 5IG7B 3GXFA 1FRGH 3RDTD 2Q6WB 1TQCB 3QXAB 2IBZX 3SE4C 1S7TB 1EFXB 4R6UA 4Y1TA 2IANE 4HJ1A 3QQDA 5MHSD 1GJWA 2DQ6A 2IGLA 1I8LA 4GXVL 4Y4KD 5FA3A 1BYNA 4XNYH 5AYQA 4EUPA 4TLSA 5C07E 4Q0XL 3IMTA 2X4RB 3VD2A 5IGXL 5D7JB 1NFAA 4NP4L 5HDQH 4X0KB 5B21A 5TGBA 2CRIA 3VXTA 2W0FA 2P5ED 1NBVH 2H9GA 1NBCA 1NCAL 5I15H 1NBZB 1B6UA 3SBWC 3NIDB 3RYMA 1KCRL 3NCYS 4PJ9C 3LXBA 4P59H 2J6EA 4KDTA 3U4EB 4B0MM 1CWVA 2Z4TA 1PSKH 2F6AA 2XVGA 3CD4A 4YXKL 3DHMA 2VZOA 3A24A 4B97A 2EQDA 5D70H 3FRPA 3MRIA 1A2YA 1BFOA 1BVLA 3IDIA 1C5DA 1W8EA 4IKNA 5D7KE 2EVJA 4B95C 1JV2A 4JPIA 4MZIA 4K8RL 4UQ3B 5E1QA 1MQ8A 2AKRB 4WEBH 2W59A 5KANI 4JFEA 5ABDE 1TTAA 3VX0A 1NCTA 4HOXA 1ZMYA 5E1GA 5JMRA 3C6LD 4HKZB 2JFCA 4WY7L 1LO0L 5GS2D 3VH8G 3F7RA 2DQUL 5C0GB 2B16A 1ZS8B 4ZS6D 2GJRA 4O5LL 5JIIA 1I8LC 4ACTA 5E2TH 3UAAA 4F33B 5GGVY 1HZHH 3WN6A 1GOHA 1T7WA 4PBXA 3EHBC 1RY7B 1QWUA 4P5MB 1OPOA 3ABLB 3AFLA 1FGNH 3LH9A 4PY8J 2X0VA 6TAAA 1JBJA 3CFEA 5JYLA 2J1XA 5E9NA 4Z7UA 3FQWB 4QRTA 1NEZG 4F9LC 4OJFL 4H13C 1CL7H 4Y9GA 1OAZH 2YZ1A 4EIGB 5LG1A 1WHOA 4ZMWA 2ESVE 1U3ZA 1MI5A 2NY4B 1AGDB 1D5MA 4KDTC 2EXWD 5FECB 1EANA 4UINH 2AITA 4HUWA 1U8KB 1RUML 3J7HA 5EO0A 5IQMA 5KVFH 2EJ1A 2YC1A 2HJFA 2BSCA 5DCCA 3AS3A 3CXDL 4X9HA 5K69A 5DQ9A 1TQWA 3P77B 2NUTB 3G6AB 4KOCA 5IJKC 4RISH 4PTUB 1T22A 1QVOB 1V8HA 5C0IA 1KGJA 4WEEA 4NNXB 4LSVL 2H8PA 1RK1A 3SDXB 3W9EB 3JVFC 3LKRB 1P5UB 2NY3C 3G6JA 5F7UA 4YUEL 1XQ4A 4KX7A 2Z65C 1V10A 1KJVA 3OZ9L 5E9DE 3BVWA 4XODA 4H8QA 4L8SA 3AT8A 5BOJA 4K9EL 4OCLC 1VKXB 2UXFA 3TT3H 3CC5A 2XN0A 4XHQA 3HW7A 5BZDB 5D1QA 1JDAA 3NIFB 4RGMB 3RHWF 4CN4A 4B7IA 3BWUF 1HE7A 1WGVA 1X5IA 3HB3B 4ETYA 5BNXD 1ZV2A 2B0SH 1MG2C 3FRPG 4OD1L 1DJHA 3IKKA 2DS4A 5C1MB 4R7VA 3STZA 4HK0A 4AW4A 4ORGB 3S4SG 4UM8A 4WI0B 1Q94A 1UT9A 3I6GB 1AGCB 2YPLA 3WYRA 2VMDA 3KPOA 2KZ1B 2WINA 1FL6A 2J3SA 1M6OA 1F3RB 4QMEA 1FBIH 4AUUA 1A6AA 3S34H 2JTYA 4MMXB 5LBGA 1AQHA 2ADFH 1J18A 4L4TE 4WHYG 1OGAB 5DLMH 4I0PD 4ODWA 4PLKD 1KMGA 2EUXA 3P0YH 1N6UA 4F58L 1QFWH 2OCJA 3HG1E 2BP0A 4N24A 1EGJL 4XP5H 3LPPA 4JM2D 3QCTH 4R8WL 1Z5LA 2YMXL 4HIPA 2FX7L 4IU2A 3V5DB 3V4LA 5J6HA 3D34A 4S11A 3OJDB 5TDOA 4M8UA 1NBYA 4M6AA 5ENWB 2J72A 2BMKA 1KNOB 3KLDA 5EU7E 3V6ZA 4NQXB 4WEMB 4MD0B 5D5MB 4LKCB 4ZMPA 2Q87A 1LILA 3QYMA 5C6TH 2WO3B 3MBEB 3ARWA 1NCWH 4LGPB 5IZ7A 2EIKB 3RVWD 3PL6D 1JNLH 1ORQB 1INQA 1SQ2N 1KEGH 4OI8A 4B9YA 4L8SC 4PCKA 4WKZA 3MJGX 1VB9A 3K5RA 3PJSB 4M00A 4W9DC 1EBAA 4WI9A 1LD9A 3SBPA 3AUWB 3MJ9L 4NJAH 5D1QC 2WKGA 5KYYB 1GMIA 3PHOB 3FUFA 2F08A 2K70A 4LO9A 3F7VB 3NJIA 3TO4B 4P9ML 1BZ7A 3L4YA 4KNSA 3TNNB 4XAWH 1R3IL 2EDHA 3QCVL 3K46A 4YDMA 4NI3A 5CGBA 1QKZH 2ITEA 1QFPA 1FLTX 4QJ3B 4ZOBA 4ZNEE 4NJ9H 5GIRB 4DFIA 2IGFH 4PRPB 1FNAA 3WUWA 1X5YA 2X40A 4PJFE 4OFPA 3KLLA 1IFRA 1MAMH 1AC0A 1S5IH 2Z0UA 1U8QB 2OYPA 2ZICA 2DQIL 2XZCL 1TJMA 2FJGA 5JORA 2JSFA 1RUAH 2G5RA 5D2LB 4K07A 5ID1A 4LVNC 4BWUA 2VLRD 4BEIA 3C6EA 4Q74A 2HFEA 35C8L 1OB1A 3V8CA 3DSNB 4I18B 5H94B 3T0VA 2MPAL 1YEGH 3FUEA 4XVOA 4I3SL 1PL3A 1TITA 4FQCL 3X12A 3KPRE 2C4XA 3NJXA 3ZJAA 1G1KA 3PWUA 4CVZA 2GTWA 3GJFB 3KCPB 4NUJA 3QORD 2ADIA 4N8PA 5IQNA 4Y4KC 4KQ3L 3L6FA 5AZ2L 4NSKA 3LKOA 4ZUWA 4JFHD 2Y1YA 4BFGA 1KLUA 3K2IA 4HZLB 2JIXD 2Z8WC 4BXVA 5KYXB 3TN0D 4I3RH 1NMCC 3BX7C 1QI3A 1NGYB 2J1YA 3LKSB 4ZTPL 1F3JB 1CYWA 1OP9A 3GDBA 1XF5A 3NAAH 1F4HA 2OMUB 2PCPA 4NP9A 5EOQH 2VGLM 1NC2A 3RY5A 1S3RA 5IK3A 1CICB 2D7TH 3QYNA 3HZKB 3BIAX 2HVKA 1B4TA 4B9FA 1IM3B 1B4JH 1NCOA 3BC9A 3LS5L 2EIEA 3DX8A 1U2YA 5I8EB 2X1WL 1MQKH 1PD1A 3UPAA 3V7AE 4KXDA 4DH2A 1XGPA 4U1SB 1KJ3L 3WNKA 1EVUA 1SY6H 3IS0X 3KDMA 3IGAB 2BNUA 1MCSA 2H26B 4XP4H 2X2UA 1VFBA 3X13B 2A99A 2M83A 2KZWA 5JIQA 2WWKO 3N44F 4JLRB 4LCWD 2VCOA 2A9ML 4JMXA 3Q3GB 4P2RA 3ARUA 1KGXA 2XWCA 1QI5A 2CJTA 4FG2A 2LFEA 3RVUD 4UCFA 3DMMB 3V95A 4DOHE 1NDGA 1ZKAA 1GTNA 2R4SL 3ZDWA 3BAXA 3C6LC 4JFFE 4OVUA 4FA7B 4UQ2A 3LY6A 2QZ5A 2MOQA 3HZVA 1JWMA 2WBJD 1NGXA 1AXSB 4ZS6C 1K72A 5BUPA 5I17B 4D9LL 4PIBA 3FFOA 3PAUA 4RSVA 4LRNL 3G04B 5D9SA 3UTSA 3GSOA 4G7SB 3IDJB 1JZEA 3VFMA 2LLGA 2VSCA 5JXAH 5CEZL 2JQAA 1IM9A 1QTPA 5GISH 2NY6B 2A77L 3GMRB 3CWGA 4KXCA 1RURL 5FV2A 5AOJA 2V5MA 3S48A 2YGNA 3D85A 3CH8A 2W65B 3I3DA 1JHTB 1MFAL 1MFBH 2OZ4L 3FH8A 3ECBB 3L7FB 1MCPL 3S96A 3S3DB 2OULB 1IBZA 2CIKB 3CVHL 1E4HA 4ZAKD 4PTTB 1UXWA 2F7IA 2IOIA 4GRMA 3QG6B 5CJ5A 1I1YB 2EXWC 3AAZB 3S98A 1YEDA 1AQMA 1CDJA 3P30L 4J3BA 4ELMA 1K2DA 2HJKA 2F74B 5G55A 3C9NB 1ROCA 2AP2A 4PJFF 3PFQA 3BUYB 5FO9A 4HXAH 2P7TB 2X89A 1TCRA 3T2QA 1IL1B 1NAKL 1R6VA 3B3IB 1JN6A 5HJGA 1D5ZA 3QZBA 1DBKL 2F7OA 3U83A 4UQDA 1OK0A 4Y2OB 4MGXA 5E2WH 4L8CB 4Z3IA 2FX9H 2ZUTA 1W0WA 5FO8A 4A7QA 2Y0SA 4D7PA 3JWNE 4WU5A 3VFOB 2WSKA 4TTDC 2OTUA 4JY6A 3KPNB 5J0BA 1M1XA 3ALPA 4HWNA 4QR7A 5D7LB 4FXLA 3A4AA 2UZIL 5LDUA 1YC7A 5FUCC 4M1GL 4NHUA 5F89A 3TEWA 1LWHA 3APMA 5C09B 4AL8H 1HNYA 3U48A 3KYKH 4AMKL 4PJCA 4Z8FL 3WTUA 1M7IB 3R8QA 1B0IA 1S7XB 1U8OB 2WLLA 3GWJA 5E00A 5FYKH 1D7FA 3FFCB 4L3EE 3FU9A 2F61A 1F02I 3H42L 3CX5K 3P0VL 1H15B 2WXRA 1SN0A 3IFOA 2FBOJ 3NP4A 3UERA 1L3NA 2B77A 2X12A 1L6ZA 4PSRA 1HHIB 4OZIB 4KDVA 3BQUD 4GSDL 3O0RH 4GKLA 2BCKA 1MXGA 2EIMB 1GGBL 2GAZB 5EBMA 2R1WB 4GQQA 5CP7B 4GIAA 3OJ2C 1XCXA 1ZVNA 4WO4A 3IVKA 1A8JH 2LGNA 2OYMA 4UM9B 5FUOH 5JIHA 3BAWA 1CBVL 4E9RA 1WG3A 2DLTA 1U93A 3LXUX 3K81A 3Q8FA 2P9RA 1I7ZB 3LB6C 3BPCB 4DTGH 4H7VA 4Z7NE 2CBPA 3BSHA 2ZP0T 5C70A 2VC2B 1FJ1B 2C3VB 3IETA 3PL6C 3RVWC 1ED3A 4RIRB 1ZVHA 2PYFB 2F54E 2JIXA 1H8LA 3VRIA 2OL3H 4HULB 4LPTA 5CWSB 1HWWA 4OFQA 2BSED 3F65A 4TQEH 5A43C 2XFXB 1AGEA 5T33H 4BQ9A 4G7YH 3T65B 4LVHB 1J1XL 4Q52A 3TCLB 3T3PB 3MCLL 4XGZB 3V2AR 4DGVH 2HLAB 5ANHA 2JKNA 2A6JA 1Y07A 1KN2H 4QOKB 3STLA 5F1SA 4E2OA 4I2XB 4DPRA 4PJ8D 1LGVA 3W82A 3MGOA 5CEZE 5JIPA 1BZQK 1F1GA 4I0CC 3QXDB 1T3FA 2F53B 4Y9BA 5F1OB 4L29B 4GBXD 3VACA 4P5KA 2ZXEB 4R26L 4JY4A 4U0RC 3B7SA 1CLYL 1L6PA 4EZLA 4HWEH 1SVZA 4IDJH 1PZAA 2WOYA 3CZJA 3NRQA 1I31A 4KKQA 4RMBA 2FDBP 4WO4C 4HPOH 3DXAD 4Y5YA 3MREA 2E6QA 1KPVB 4P2QA 2VDQH 2IQAA 2CWRA 2FEDD 5DZNA 5FYLD 4KKRA 4Z7VB 4PY7B 1BPLB 5C8JB 4U6HA 4GW4A 5EMYA 3QORC 1JNNH 1XSIA 2XBDA 4NXKA 3LIZA 2E59A 2Q3ZA 2VLKB 2PWGA 1YMMB 2YD7A 3QNZA 3WE6B 4MXQC 1MCOL 5E4IA 1FN4B 3GKWL 1EAPA 2P43B 4FLRA 4IQHA 3TN0C 5ITBL 1XF3A 1DSFL 2QSVA 1NWPA 4LBAA 4K5PA 5E6IB 4UDUB 1CJYA 4MS6A 1N26A 5H2BA 4QHMB 1MPAH 2EKSA 2Y2WA 3Q9QA 3GSUB 2C9RA 1DTUA 3BVXA 1HQRB 3CX5J 4MQXD 1J1PH 4P5SA 1NAMB 4LLQB 2JKTM 3HOGA 4JG1L 4KVNL 4DGYL 4AT6B 1EO8L 1EV2E 5EBWB 3ZTCC 3FC8A 2EKJA 4GAYA 4O51B 4KFZC 2ZOKB 4PREA 2ZAHA 5ICXA 5D72H 4RX4D 4XBGA 4DVRH 5HJ3B 3QZWA 2Q86B 4N8UA 4F7PB 3JWDC 5DD0L 3GMMB 4YO0B 2H1PL 2OMZB 5C0AD 1FLRH 2V17H 3BIBX 4GP4B 3ARTA 4ALAC 1U30A 4Y5YC 1UWFA 3D18B 3MRHA 2QQQA 3RVUC 4K73A 4ZO6A 5SV3A 3HC0B 1NCBH 4DN4L 4G6KL 4PJ5E 3J27A 3LJ3A 4LCUB 2JK5A 4Y9EA 3RKDD 1HHGB 4FNQA 1BBJB 5A6LA 3SHSA 3H3PL 2WBJC 3N0AA 4GUQA 3LEYL 2APXA 1T6VN 2WZ5A 2OXGB 1NFIB 4UQBA 3CZFB 4PUBH 1U21A 3QC5X 1G9EA 4ECNA 1VFAB 4X5WA 4IRZH 2H6OA 3U0WL 4FNLH 4UUJB 3QW9A 1A4KA 4HLZG 5EU6B 1TETH 1T20A 2O5YH 3LH2L 1IEBA 2CK0L 1FV1A 1GOGA 1TSHA 4N1EA 1QA9A 4KROD 4CDHA 4NBYB 5B1BB 5D1ZA 3EOAB 3DX7A 4NLHA 4F7TB 3K1DA 4A7GF 1UT2A 1Q9KB 1UYWL 2EO7A 4GRWB 5I9QC 1YC8A 3RGVA 3ELQA 4TRPL 3HE7B 2JLLA 3LHPL 1N5AA 1H0DB 4N22A 4AKPA 3ARED 4P9HL 1B0GB 2G5BA 3IGUA 1FSKC 5HI5D 1EA9C 4MQSB 3F7YA 1OVZA 3BKCH 1LM8V 3G5XB 3UBXI 5DF0A 5K39B 1UUSA 1OOWA 2KZBA 3WKYA 1CTOA 4X7DC 4DUXA 3CAFA 4EI5A 1KTRL 1WEJH 1UACL 2MKWA 3SGDH 4X4ME 1A4CA 3WS3A 3SPVB 3RQ3A 3GJFK 5HGAA 4KJWD 5J06A 3FHAA 3FFDA 1XIWA 2CHWA 2WWKT 5I73B 4LF3B 1QEWA 1E4XI 2BY3A 1W72B 1J9SA 2VR6A 3VGDA 2RB8A 4U1IB 4J3OH 3FHQA 2YD0A 3L1FA 4X8CA 3RWCB 4LSRH 4GP8B 3FCSB 3QZWG 2YGQA 1RD6A 2VM4A 4A6YA 5ADPH 4FG6D 3QYCA 4YHPA 3D0LA 1CVRA 1V3LA 4PGEA 3CDCA 5D1ZC 3KPMB 3FK3A 3FKUS 1Q9OA 3BKML 1RZKL 4U1HB 4E9SA 2CO2A 3GIVB 2EVFA 1QPPA 4KRMB 2D03H 4Y7MA 4GAJH 1L7IL 3S88H 3EO9H 5FKPB 5HHQA 5FHAH 5C0BB 4HJ0C 1RUQL 5DYOB 3TCTA 4ZYKA 4I9WD 1GR7A 3CLEH 3VGHA 5EEZA 4PLJC 3QJFB 2WBKA 1QLEH 5BVJA 4F2MB 5FO7A 4Z7WB 1Y1UA 5DJDB 3G9AB 5AAMA 1XEDA 2OMWB 1U92B 2O6FA 3QXAA 5DUJA 3NTCH 3CFTA 5CINL 4AUJA 1S7TA 5HYSB 3WGVB 5LG6A 3QI9B 3HI1A 5DVMA 1Q0YL 1HZLA 1NANH 1HI6B 3UAEA 2ZF9A 1ZT4A 3MROA 5CZKA 1E5YA 3DI3B 1P5VB 4YDVA 5AAPA 2WXLA 2G30A 4G80B 1BJ1H 1IBYA 2CGRL 1JZ7A 5D7JA 2VDPB 2VZSA 1JDCA 5JNYB 2WZPD 2D2OA 3H0TB 4IKIA 3TOPA 1BW8A 3IBEA 1KCSL 4H20L 5J7CC 5I6MA 4YVUA 3VD0A 4HJGB 5JHDB 5BO1L 3X3GH 1O7DE 4C4BA 4CVUA 4XP1L 4XPTL 5DJXB 1OF2B 3ZHFA 3D33A 4PRDB 4A39A 3MKKA 1N18A 4JBSA 4QRSB 3SYAA 3GZOA 1LL1A 4R4BB 4G9FE 3D9AH 3JV0A 2R69A 4N2FA 5GRZA 1G6RB 2BSRA 5AALA 2ZAIA 5FLUA 3V0WH 4YDZA 2R2CA 1IGMH 1XCQA 4YBHA 4WU7A 5L0QB 1RI8A 1L5GA 4LASH 3RA7L 2FSEB 5HHMB 4RDQG 2ZYSA 5C0AA 2FAUA 3RDTB 1ZE3C 3SGKC 1I9JH 4WK0B 1FHGA 2OYKA 3T9WA 1M42A 3P3TA 5AWNL 3IXAA 3TWCL 1YNTA 4AQ8A 1ORSA 3E6FA 1U8LA 3RFZC 3RU8L 2B7DT 2ZWLT 2J2ZA 3QXVA 1BIIB 5AAMC 2J4WH 2YK1H 1TU2A 3L7EB 3OAUH 3I6KB 3ILEA 3MX0A 5L8KB 5FUZH 4AYID 4Z18A 3PWLA 4PRIB 4F15C 1VCBC 2EC9U 4XN8A 1KTJA 5LGHH 5HYJE 2FO4B 3WKQA 4A2FA 4HYTB 2P5EB 3EGXB 1TFHA 5DQDH 2DRUA 2PTTB 3AS2A 4L18A 4F27A 3UEQA 5LXGL 1UQSA 5I1HH 4PWHA 3GD1C 2WXJA 1M9WA 4U1LA 1X5ZA 3FU3A 5IB1A 3UABA 3WIIL 4I4WB 5C0CE 5L2JB 3CX2A 3WNIA 5DRWB 1FP5A 1T83A 4MD4B 5ANMA 3EGDB 3WO4B 4BRJA 3JQOB 2R2BA 3BDXA 4E0RA 3NA4A 5GS1B 3CJJA 3SCMD 4K9JA 4ERSL 3MHZA 4JFDA 3SOBL 2FD6L 5I1IL 3NEOA 4PD4J 5HBBA 1TJGH 4JO1H 5I1CH 2UXTA 3APDA 4BXSV 4WTWA 3I6SA 3VSVA 1CF8H 3N85H 2ZXGA 3P77A 3UIYA 4WWOA 1J9RA 5CR8A 1CFSB 3II2A 4H4NA 3ZE1E 4PTUA 4F2EA 1NCGA 2WO4A 3F85A 1YUKB 4IBTA 3SDXA 3CDGA 3B3BA 2ZCKH 4PRAB 2G3ZA 1T1XB 1GA2A 1T0MB 1RIVL 3RKDC 3EJQA 1GY2A 2GJJA 4HUVA 3JV6A 2VL5A 3HJEA 1I1AA 1U0QA 4JL2A 1VJSA 4DP9X 1S9KC 5TK2A 3PU7A 4P5TB 3AGWA 4CMMA 2MOGA 1GZQB 1II4E 1RJYB 3CFNA 4FI7A 5DJYB 2QZQA 1E4WH 4UQEA 1AO7E 4GQRA 4Z76B 2QQLL 4BE5A 2DD8H 4ORGA 3GTNA 4W9ZA 2NX5D 1UKTA 1MVYA 2G60L 4QCIB 4UT9L 2CJUH 1GCFA 1ZHLA 3B7RL 2AXWA 1AANA 1YN7B 5HSFA 2D8KA 3WL9B 2XN1A 3HFFA 4XMLH 1OXYA 5IVXA 2CBOA 1LWRA 4GSXA 4JCMA 2JKWA 4LBEB 4K5NA 2BJMH 2EYRA 2FCBA 5E0QA 4AV5A 5GZND 1CDIA 2LVEA 5T3XE 4HUKB 2Z7YA 5GJSL 3O6ML 5F7DB 3IAPA 1CFTB 2CNYA 2H3NA 3V5DA 3FUIA 4AXWB 3B83A 2XYBA 4GUCA 1S9WB 2F9BT 1LK3H 1PNCA 2YD3A 4DGIL 1J8SA 1T2QL 3OJDA 3O3BA 4XH2B 5FCUL 2Z91B 2BNQD 3IDNA 5BZZA 5D5MA 1XZWA 4LQFH 1W91A 2GHZA 3U46B 1NCNA 1ORQA 4H1LH 3FONA 4BSVA 3VFTB 3GBNL 3QA3A 2J8UB 1CR9H 3PJSA 1I1AC 4OZIF 2AW2A 3CIAA 1KCVH 5KYYA 3PHOA 2WZPA 3GNMH 5FHBH 1BEYL 2G4EA 4PB0H 4BFJA 1NJ9B 3A23A 4QRQB 3TO4A 1SVCP 3TNNA 3C5SA 5DEFA 2VDPL 2CUHA 1PZ3A 4I0PB 2UV3A 5MP6H 2F7RA 2JKLA 1KJMB 1A3ZA 1NSNH 3I3BA 1KGCE 2YQGA 3MXWL 3MCYA 4LOEA 4XZUB 5FYKD 4IIZA 3RZCD 4XPGH 5GIRA 4WJKB 1TNNA 3ATAA 2J1KA 5EFIB 4BE6A 3DURB 3MV11 1E28B 5F9OH 3WIAA 1QSFD 2C9UA 3NABL 4RWYH 4U6XB 4F7EA 1AYRA 4CC4C 1W8NA 4EZJA 3O6FD 2IG2L 4YFLF 4ZFGH 4GG6B 4TSCH 1E4JA 3HI5H 1WYJA 1TVHB 3DUHA 4M9PA 5D2LA 3QAZC 2YEZB 1F90H 5IVOA 5LCVH 5DA0B 2Q2EB 1CDBA 3D50A 4UOZA 3DSNA 3EDFA 3FAWA 3HS0C 5H94A 2YOAA 3HR6A 1GXEA 1A6UL 5DUPH 2PCFA 4TNVK 4RAHA 3ZE1F 4JFXA 2QPSA 3D3VD 1SOSA 2L3BA 2ARJQ 3W11D 3U79A 1V7NL 4JFZL 5DR5H 3A0OA 2HT4C 2EYSB 3P3YA 4JFEE 3VXRD 3PDDA 5KYXA 4FXGA 4JJ5A 5AKSA 1N2RB 3PAYA 4OCMC 4DSYA 1MEXL 3QIUD 2OMUA 4NC0B 2AXFB 1ZIBA 2HTLC 4OM0L 1MW1A 4ZX4A 1E43A 3LRSB 3VO0A 1IM3A 3H2WA 5LAXB 1C16A 2N3JA 3NSCA 4WW1B 1KFAH 4HKJB 5IB4A 4Q9RL 4KXAA 5J12B 2OK0L 4QHLB 4JCWA 1ZHNA 2EDYA 3EH3B 3LD8C 2BOLA 4WUKH 5IMKB 1L3WA 4Z7UE 2VLRB 1SY6A 2VLLA 1OARL 3VJ6A 4MBRA 4X6BA 4TLKA 5TPWH 4H0HB 2O26U 2V3FA 1UWEH 2WMPB 4Y4HB 2XXMB 4MSWB 4LB8A 1LDSA 4RQQA 3RWHA 5IOKA 4WUUB 1MI5E 4J6IA 2DQHL 3S37L 3MLUH 3FOLA 3BJ91 5AW9B 3VE0A 1XGZA 3PGCA 1USQA 5KN5A 2J1WA 3BCFA 5JUEL 5LUMA 1UFGA 3VXQA 1Z0MA 4X5XB 1MH5B 4UANA 1OP5H 2A0LD 5SX5H 1A02N 2JCCA 1RZIA 1YLBB 3NZ8B 1EDQA 2QQKL 5I17A 3CVCA 2E9WA 3QDGD 4F3FA 2NR6D 2ADGB 4XVJH 4HHAA 3PE9A 4B53A 3G04A 4QRUA 4LNVA 2HWZL 3UL4A 2ZP9A 2VMJA 5KBNC 3G6JE 1WFUA 4FXGC 4WTQA 3RL1A 3UH8A 2QMJA 1DJZA 3GMRA 3LN9A 2KI6A 5E2VH 4OTXH 2AEQH 5I71B 2W65A 3MDJA 2F7PA 3VQMA 5D1QE 2ADJB 4M29A 4TQIA 4HS3A 1EWHA 4Y1AA 3VTTA 1B2YA 4AQAB 3NPZB 1JCKA 1HNGA 1KWKA 1O6SA 4K3DL 4LCWB 1A7NL 3B5GA 2XNAB 1MWAH 2YPLE 1EHAA 2CE6A 3E9TA 2P80A 2DIAA 2AXGA 3MNWA 2EICA 3ABMB 1CLOL 4OLUL 3P73B 1MOEA 2P7TA 3FQXB 4ZD3L 3Q5OA 5I1KH 4UT6A 4L1LA 1IL1A 2VWEC 1HSBA 1GCYA 3GI9H 2FH8A 2ICCA 1CE6B 1FF5A 2O5ZL 4DP4X 3MLZL 2YRBA 3NIGB 1E5AA 4M7ZC 1AQDB 3GKZA 2O6CA 1RHHA 4GRWF 1P7QD 3BE1H 3RIKA 2P5WD 3DX3A 4M62H 3GMNB 2KMWA 4QXTA 1G4RA 5T8IA 2GI0A 5DD6B 4MA1B 5L88L 3IWVA 3HMWH 1DVFD 4DZBA 3NEEA 1R9FA 1RZ7L 2BXYA 3CCHB 1CFMA 1M7IA 4GT7A 5C0JA 4C83B 5MHSE 1XH3A 2CNZA 4NAMA 5J11B 4FQLH 1XCTA 4X7EC 1YNKL 2NY6C 4BBWA 5EOCH 2ID5A 1DUZB 4NQCD 3AMKA 4ZAKB 3IJ9A 4N0RA 3EOTL 4AYGA 2AEWA 5J6GA 4BK4A 1CI5A 5KVEH 3P3RA 2IQ9H 3BPNB 4JO4H 1EO7A 5AYUH 4AVJA 4ZFOA 1JPFA 1P9MC 3V0EA 1LMKA 4H2CA 1JL8A 1QSFA 1OV8A 5CR1A 3U4BL 3DTUB 5D93C 1R5IB 4UIKL 3U6XS 4CL7A 4LPXA 2GAZA 4TULL 4TSAH 3L3OB 3B5HA 1QHPA 1HNFA 1A9EA 3QFDA 1CGWA 4H44C 5CP7A 1U58A 3DOSA 4XPAL 2ZXCA 4RCAA 5B7FA 4KKBD 2MCPH 4YBLC 4UM9A 4D0DB 3T2PA 4LLAA 1W2KT 1THAA 1NOLA 2ZE0A 3ARVA 3VXUD 4N25A 4PVBA 2YPKA 2QDWA 2EH7H 2HPTA 2IMMA 1FJ1A 1MCHA 2C3VA 2WQRA 4M43L 3VXMB 3MPCA 4ZMLA 2X4TB 1IFHH 2HRPH 5HDBB 1XX9C 3X17A 5EG6C 3ZYIA 2I7SA 2PMZA 5FLVA 1CU4L 3WTVA 1IAKB 5LKNA 3HLKA 2EDNA 3IDGB 4WVRA 2C34A 3LN4B 3GSXA 3L5JA 3QPXH 4J3OD 1URIA 4ZS7L 2WN2A 1IC5L 4MXWL 4Z7WF 5D4QA 1M1SA 3JT0A 2RCSH 2ICES 4PRBA 5CU9A 2R29H 1BOGB 3L1OH 4BKTC 4EI6B 2A9AA 1HSAA 3TZVD 5C97A 1KT2A 1QABA 3BQUB 1E40A 1E9PA 1SXZA 4J3TA 2B1HL 4OZFB 4QOKA 4HLEA 4AEHH 4UT7H 2ZKXA 5D4JA 5CGTA 1WQVT 3U36A 3HLAB 3BGMA 4HSCX 1PG7W 1TFPA 5CJBA 2XZQL 4HWZB 3DGCR 4NO3A 4L29A 2WXPA 5HGHA 1C8PA 1D9KD 3OL2A 4UDTA 3O6LL 3QDMD 2CDEB 3BKJH 3UJTL 3WXWH 1XF2B 1YQ2A 1N0LB 2CHXA 4WHDA 5I24A 1I1RA 4DKAA 2VIRA 3REVA 1L9MA 3KXFA 2OSLB 3LSOA 1QNIA 4XC3L 4YHML 3B2XA 1FFNA 2H2PD 4PY7A 3QJZA 1KB9J 3ZTEA 1K8DB 4N1HB 3ARYA 4CU6A 3EYOB 3D2UD 1A3RH 4P2RE 4WSKA 4M48L 3FQYA 3SZ6A 1YMMA 1EEYA 2N59A 3LQZA 3NRFA 1KZYA 1A7PL 3ZKXB 2DBJA 3JTTB 4JRYD 1OAXL 1HS6A 3WFZA 4EAEA 2DQEH 4GW1B 3SDDB 4EOWH 3QIUC 4XMPL 5E6IA 4UDUA 4PYGA 2DW5A 1GZPB 5KVGE 1A0QL 1NKOA 1QWNA 2DDQH 1NCCH 4ZW7A 4CRPA 4PJ8B 3HAEH 5FUCE 4ZDHB 2APFA 3IDUA 1NAMA 5E8PB 1NWOA 4ONHA 4YFLI 1TNMA 3UTSE 4UTBA 4QRRA 4AT6A 4MZ2A 5EBWA 1JMXA 4ANUA 2FZ3A 2WYIA 3CFMA 4MMYB 3FUHA 1Z3GL 4NPJA 4GYBA 3PP4L 3G08A 1Q8MA 1IAII 4IGBD 4Q9QH 3JWDL 4XOAA 2Q86A 3TFBA 4M56A 3UTZA 4F7PA 4PB9H 4F9PA 4YO0A 4UV4H 1CK0H 4ALAL 1IT9L 4QXGH 1UA6L 5A7BA 3EG9B 2NY1B 2DQGL 4R7XA 2QHLA 1ZRUA 2JV6A 5AVUB 5JDSB 3MOBL 4H26B 3GF8A 4N8CH 4ELME 2ZOTA 1ETJA 4FNUA 2WQSA 1PLAA 3VVVA 3SPCA 1HHGA 1ET5A 1C7TA 4L1BA 3UO1H 1YN6A 3HKFA 4P48A 4RMWA 1KIUA 1SYVB 3LIZL 3O9WB 2Y36H 3CSPA 1I8AA 2OXGA 2DLEA 1NFIA 2NR6C 4ZFQA 3VGAB 5BW7C 1UB6B 5DZJA 3FMGH 1TZIB 2RQEA 1BIHA 4F91B 2DIEA 3F58L 2HTKC 2W8CA 5CS7A 5DSCB 1AR1B 4BA0A 3ZZLA 3MA9H 4UMSA 1CLCA 4BH8A 2LU7A 5AZEL 1GSMA 5E94B 4JM4H 1Q9KA 2F0CA 2X87A 2RIKA 3DBSA 3PPSA 1RZ8A 4FD0A 5F9DC 1LP9B 2I27N 2BHYA 4U1GB 3NFNA 1H0DA 4JFOB 5IEHB 1L6XA 1KV3A 3GMLB 3NCBB 2TRHA 3OGOE 3V4VB 3SJVD 3HEIB 2VZ3A 2ATKB 2VZTA 4N0CC 4F9PC 1BCIA 4I88A 3ARSA 3IJSA 4RFNB 1MRFL 2D4FA 2F19H 3FO0L 1WA1X 1ID5I 3CIQA 4PVLA 1ETB1 2JJVA 4HPHA 5I8OL 2JKIS 3K8MA 1LO5B 3U7YH 2B4CH 5FX3A 1J8HD 3SPVA 3WNLA 1EHKB 4M4RA 5DHYB 4KRLB 3S5LA 1IGCH 4AQOA 3STBA 4Q97A 3C5JB 4Y16D 4CJ1A 1W72A 1J11A 3PG2A 4YPGB 4LGSB 4U1IA 3MJ7B 3K4ZA 5CJQH 1HCVA 2W80C 2E7HA 3UYRH 2XZZA 1NL0H 4KROB 4U1MB 1BQLL 3Q8AA 4M7LL 1Z9PA 5E9AA 9PCYA 5EBGA 3FOMA 1M2VB 1O9WA 2R51A 4AEIH 5CZXD 2MHAB 3DX9A 4XVTH 2L0DA 2JKJA 1UXSB 2V5TA 4N5UA 4QXUH 4E9QA 3A22A 4KFMA 3KPMA 3P11L 3L4TA 3IMBA 4ISVB 1JGDA 3R06B 3AREB 3QR2A 2NQDA 3DJTA 4LEOB 3KPSB 1T2XA 3LX9A 1E27A 3ZZSA 1EX0A 5KBPA 1ZVYA 2VN6A 2CLZA 4YJZL 5EN3A 1JZ5A 3R0MA 1KTDB 1TG8A 4H8HA 4D2NA 4KZDH 4U0QB 4XCCH 3QRGL 3SE9H 2Z8RA 5JW4N 3ASWA 1CD8A 1RIHL 1U92A 2WGNB 3ES6A 5GJTH 3S35H 5HYSA 3QI9A 1PYWB 4CMHC 4PG9A 1HI6A 1ZDSA 4JM2F 1JPSL 3L4VA 5JA9A 1WUZA 3AQDA 3B9KD 2KPNA 3LZNA 5B1AB 2L04A 4EXKA 1DVZA 1SBBA 4ZMNA 1BFVH 4P2QE 4BIKA 2VXTH 4CU8A 1OZUA 4MAUL 2RACA 5J1TC 4D9RD 1EZVX 4ZZFA 1AI1H 2OJZH 2PO6A 1MJ8L 1OPGL 3KWTA 4J3OC 4K94L 4M7JH 3FDWA 5IB5A 5DRZB 4JFWA 4BKSC 3HBGA 1AOHA 5KS9A 1KIQB 1M71B 4Y2NA 3VFRA 1OF2A 2J6WA 3TF7C 1WSST 3SZKC 1QG3A 4QRSA 1IUZA 4YQXL 5J6SA 4PLNC 5DZAA 1B0WA 1AE6H 2BP5M 2X0WA 2NOYA 2DN7A 3TXAA 4JO2L 4IGBA 1G6RA 5FFLA 2YKKA 1BM3H 3S5LG 4A66A 2DKSA 5HGGS 2VN4A 4K5MA 4ZMTA 3DVGA 1U3HD 2NSMA 1OAKL 2FSEA 5SWSD 4NM4L 4X4XB 4BDVA 2EDKA 1SJHA 3WG7B 4LEXL 4OGQC 3UMTA 2ZWKA 1RFDL 2HFTA 3KPPA 3KLHD 1HKLL 4QHUB 4XVSH 4YAQA 4ZFZB 1DP0A 4BELD 4DP5X 3MV8D 5DHDA 1ACYL 1BIIA 3TYGL 1PEWA 1QFUL 5LAPA 4YDKH 4XPBH 1OTUD 5ACLA 3I6KA 1FRGL 2UVEA 2X4NB 3NZHH 4PRIA 3D87B 3O8XD 1BV8A 4BFEA 1PW3A 4BFFA 1SXSA 2VXQH 4WI7A 4A55A 3OQ3B 1T1WA 5HDLA 1XTLA 3TV3H 4X9BA 4JHBA 4XNYL 1A5FL 3OZLA 1KJ2A 1KC5H 4HK3J 3ZIYA 1HAWA 2BVUA 5J89A 3BN9C 5E95B 2GSIB 2O6DA 5DJCA 1I7TA 3FF7A 1KY6A 2MH4A 2PO6C 3QVAA 5TE6H 2C1PA 3MRQA 4M3HA 1EJFA 1H5BB 4MD4A 5HDQL 1BD2D 4AQ1C 4XNDA 1FH5H 1NBVL 3X1BA 3IGFA 1G5GA 1HEZA 2V7HB 1HYSC 2OS7A 3T8XB 5I15L 3CC1A 4PJAF 5EIIB 4F93B 5GS1A 5IBLD 5IJBC 3NA9H 3DK2A 5H37A 5KYWB 1XXDC 2CH8A 2VITB 3HR5A 4P59L 3EXJA 1PSKL 4YC2C 1LE9B 1BVKB 3SJVA 4IGBC 4N2CA 3OLEA 5L0QC 2R7EB 1YYMH 2VN7A 5D70L 4I1NB 3O6KH 3T04D 1CFSA 5FWRA 5D6CB 2QLVB 4K2UH 4GY4A 1E5UI 1I9IH 1FG9C 2WLIA 3LNFA 3QDAA 2PW2B 4KQ4L 5EOTA 4WEBL 1JF1A 4ZQTA 5CIPB 4QI3A 3ROOB 3QNFA 5I8KH 2DL2A 1UCBH 3LHAA 5AENA 4AYBA 1HIMH 3L1EA 3VYOA 3NZUA 3TC9A 1T2JA 4XNZC 3OB8A 1AHWB 1BZEA 2JMRA 5D7SL 1R0AH 1NKGA 3AVEA 4N20A 1PAZA 5E2TL 5I74B 1GZQA 1MLCB 3T3MB 3NK4A 1HZHL 5I6XC 3A6BL 1IGTB 1N0XH 4Z76A 2XSKA 5JW4Q 4G8GD 1O9VA 3GS7A 4QCIA 4JG0H 3SCMB 4ZFFB 5TF1H 1FGNL 4K7PY 4NGHH 2FR4A 1J5IA 3M86A 2CZNA 3HE6B 3SKNB 1L9NA 1SF5A 4MNHB 1I1CA 4LLVA 5IB2A 3WL9A 5D4IA 2GJ6B 2J25A 3NIGF 3WY4A 2APVA 2BIHA 1F4YH 3MLRH 1CL7L 4JQIH 1OAZL 3DJSA 1XD1A 1WZMA 4EZMA 3WDIA 2VDLL 3MC0A 1BP3B 3VAEA 4OUOA 2BSTB 3H55A 1FVDA 1P84K 5EWIH 2FQGA 4UINL 3DHUA 3C60D 4IHOB 2O5XH 1NGWB 5GGRB 2DEXX 5DWUH 5KVFL 1ID2A 3CXHK 3L13A 4PWEA 4IK7A 5KYUA 4DN4H 3FB8B 1YEHH 4RISL 3SPHA 3TV8A 5JOFB 1AKJD 3T4AB 4F7MB 2GJZB 2W81C 3U46A 1GW6A 4WZ9A 4AZUA 1S7WA 1ZD6A 2M1KA 3FCTB 1DQMH 2MFNA 4DPAX 4B9GA 1U8MA 2AQTA 3ETSA 4OUUA 3VFTA 2Z0BA 3DECA 3SBQA 5ISZB 4HMEA 4DEPB 2PYED 1JYVA 2HUEA 3T09A 4R7LA 5H37G 3O41B 3NBNA 3BVUA 4R5XA 4HFUH 2EDDA 4NRYB 1OAQL 1ND0A 1TO5A 5EF2A 5CZXC 1NJ9A 2XBZA 4QRQA 3W0WD 3QQXA 4O2CB 4YFEA 4OGXH 1XT5A 2B0SL 2V2TA 4L1TA 1ZLEA 2UWEA 3MUGB 2WB7A 4XN9A 1KCBA 2G3XA 3TIDB 4LE8A 2IDTA 3L4CA 1F2XK 4XZUA 3UTTD 3PRZA 4JFQA 3RG1C 2CO4A 3FUKA 1X9LA 1NCUA 1FBIL 1PJ9A 1ZANH 3S34L 3V10A 5EFIA 4AENB 1MIMH 4G1MA 2ADFL 3H9SA 3DJRA 1E28A 4YNYB 5DLML 5HDBF 5IBTH 5I6PA 3QIWD 4NAJA 4PVMA 3DVNA 3EJSA 3KJ4C 3P0YL 5HHOD 5B4MC 1FO0B 1QFWL 4P2CG 4XP5L 5G2NA 3NIDE 4GG6A 3QCTL 2X70B 1DN0B 1HXMB 1TVHA 3TVMB 2WB1A 2WVVB 5IMOB 3D39B 4DPCX 1QRND 1FNFA 1J87A 1TIUA 3I84A 4HXBH 3D0AA 1WTGT 2NW2B 4L1DA 5E70A 1OP3K 4CBPA 4HG4K 4DERA 4POYA 1B4RA 1Y18B 3DV6A 4CN1A 1U8JA 1B9KA 1I3GH 2OMXA 3GSNB 43CAA 1WFNA 2A5UA 2JQZA 2C3GA 1DJWA 1QFWM 2GPZA 2WNKA 4FYRA 5C0AE 4DPBX 4A1RA 5C6TL 1NCWL 2K1MA 4DN3H 3KWXA 1BF2A 1JNLL 3CV5A 4EN3D 3WTTA 1KEGL 4JKWA 4W81A 4RGNB 2R1XB 1YYLH 2BDNH 3FTSA 3DWTA 2ZUQC 3GGWB 5D2NA 3SYOA 4BZ2H 4O00A 3LPOA 2C4FU 3MRJB 4AYFB 4CVWA 1CT8B 1FC1A 2EEXA 4NJAL 3RPIA 2IFFH 5AUMB 1BD2A 3RZCB 2VM3A 2DLGA 4WK4B 5KG9A 1KENL 4WW1A 3K2MC 12E8H 1IO4C 4XAWL 2OX5B 4NN7B 5FGSA 3WE1A 3VM5A 3W1ZA 3TBYA 3O6FB 1ZHBA 3DVIA 4PP1C 5ANME 5JW4R 3ARFD 3UO8B 1JPGB 1G1OA 4FABH 1U95B 1PAMA 1PZCA 4O02B 4YZFE 1MAML 1U8PB 1S5IL 5FGCB 1U3YA 5C0ND 4MD5B 4J23A 4MJID 4WUUA 4KAQH 1RUAL 4JFDE 3ZYZA 2CLRB 3KLHC 3AGVA 5HYFA 3FYEB 3BP5B 3BW9A 3VI3B 5I18H 3NDYE 1U91A 4B27A 4CUCA 4Q14A 3QARA 2GCYB 3CFQA 5CD5D 3ABZA 5F71A 3VXRB 2VLJB 2ZSWA 3O8XC 2A73A 1TYJA 4LSPH 1HH9B 5AW6B 1HJBC 4PJ6A 2I9LA 3CN3A 2OL3B 2ADGA 1BZDA 3RL2B 3FXIC 1HWHB 4NNPH 1IQDA 5DK2B 1RXLA 5HJBA 1OW0A 5D2NC 4DF9A 3G3LA 4PGDB 4U1JA 3UOAB 4I3RL 4YSPA 2LLLA 3T0XA 5CFHA 1YDPB 1HILA 1QSVA 1B0RB 3NAAL 4GH7B 2RHEA 1UJ3B 5EOQL 3EH5B 4IS6B 4Q9CA 1F0LA 3FQNB 1AZZC 2ADJA 3GHEL 5AVTB 1FNHA 1B4JL 2YSTA 3QHTC 3T6XA 2OAAA 4ZW3A 2AVGA 5E2JA 3KBHE 1MQKL 4F8QA 4LPVA 2QVKA 3PABA 2OMNA 2EIBA 2XT1B 2EVIA 1SY6L 4PJHF 1D5BA 5A2BA 5J1AB 1TUPA 5FC9A 2IOMA 4JN2B 1KG0B 4XP4L 4BINA 3P73A 2ZOOA 1MCEA 2VDOL 4LDLB 4MBOA 4AIZA 3IK2A 5IVXE 3FF8A 3GINA 4X7TB 5EU5B 3MMEA 1AKJA 5AZUA 4FQIL 3O4LB 3TT1H 3VFSB 1E9QB 1DJSA 3EH4B 4K5OA 1H6UA 1RU9H 2DF3A 2CIIA 4S1DC 3RWFB 2XG5A 4M02A 4KMLB 3OM3B 4IMKA 2XN9D 4Y2DA 1LP9F 4KDWA 4TUOA 5I82A 3A21A 2PYEA 5T1LB 3RX9A 1E6JH 3PXLA 1AZUA 3CSTA 3B43A 4KXZI 5DD6A 4HJIA 4N68A 2YRZA 4HUXB 5CN3A 3M1BB 3WFHB 3NSYA 4JZNB 5B3JE 4K8RH 4OF6A 3NVQA 1UH3A 3R19A 3NP3A 4G2AA 3W0WA 1OW0C 4NKOA 4YR6A 2XVBA 4OGAD 3CDZB 5CSZA 5JLZB 4O2FA 1DO5A 3H2PA 2ENPA 1K9TA 4MQ7A 5GZOD 2V0AA 2DQUH 1MF2L 3IAQA 4UNUA 1MFBL 3ZKNC 2DM7A 2WYTA 3QUKB 3PWPD 1A7RH 4OLYH 4N9GB 1KCKA 3FSOA 1MFCH 2SODB 5ACZB 2F1BA 1ETZB 5H8DA 5HHOA 3LN5B 1G7HB 3GTTA 4EBQL 1MFMA 5JO5B 5F8QC 1FYTD 1WCQA 2H0EA 2X3BA 2EABA 2XG4B 3C60C 5AKVA 4N5EC 1QRNA 4HV8B 1TLKA 1JWSB 4RA0C 3M7OA 5TK4A 4E5XG 2DJ4A 5F7AA 4HXAL 1E2VA 1P7QB 4LLDB 2P5WB 4WFHD 1YMHA 4LMQI 4IKLA 5KN5B 4FAAB 3ULUC 1SLUA 1IBHA 5FFGA 3AU1A 4PJXA 4AI7A 3VXMA 5T1JA 5DA4A 5D2LE 5E2WL 1DVFB 2FX9L 1UM6H 2WSDA 4IMKC 4Y2DC 3DC0A 1NZRA 2MTAA 2XX0A 3MJ6A 2MSPA 1IAKA 2DMHA 2HX8A 3SKOA 1B90A 4RH4A 3ESOA 1RPKA 3ZQWA 4C56B 4J39A 4NQCB 3TBVA 2DBLH 3VI4B 3O3DB 1OT4A 4ANKA 4LSVH 2P45B 1UB5B 4UMGA 3F5WB 3KYKL 3BESR 2LE9A 3MOAL 3S37X 5C3IA 1JJUA 3HRZA 4MJ5A 5IROA 4F7CA 3VFVA 2YXWA 4JRXD 1OTTC 1NMAH 1O6TA 5FYKL 2DWDB 1YEEH 1WA0X 3AB0B 5HVGB 4ZFOL 3ARZA 2FEJA 4XNXH 3EFFA 2F18A 4NS0A 4IOFC 3NGBB 4Z1PA 2JE8A 3QQ3A 4PJGB 3EYVB 4DK3A 3QDJB 3BZFA 4NQQA 1SRDA 3UBGA 1WS8A 1E7UA 2P8LB 4M5SA 2XV3A 3O0RL 4P3DA 3VXUB 2CKBB 3DO4A 1XF2A 1TJIL 1N0LA 4G42B 3U9WA 2WBXA 3C2AH 3EJYD 3OWEA 1S7RB 3GYRA 2C8NA 4MNQD 1IBFA 1CI3M 3AM8A 5FUOL 1PLGH 2VUYA 3BWSA 4P8QA 2I07A 3C8KA 3P4NB 3IDMB 3OKKA 4JO8A 3RUGB 5EN2A 2FBJH 5ITFB 4DTGL 3M1CA 3OR7B 1EGJH 1JZ6A 5F44A 3EYOA 1UZ8B 4C4KO 2DQMA 2VWEE 2YQBA 5F0MB 3D05A 3N06B 2Q7AA 4FCHA 1Z1WA 2UY6A 3JTTA 3CHOA 5F88B 1NFDB 5CP3H 1A1OA 1CFNB 3QJXA 3W57A 4G71B 4N6QA 1TPXB 2X6VA 3SGJC 5DVNA 3EJUA 3QQ9D 2JCCE 4TQEL 4ZPTB 3HZMA 1UH4A 5DFAA 3TZVB 3KZ8A 4KX9A 1OM3L 5T33L 5HDRA 5C0FB 1U8HB 4ZDHA 3LV3A 1R5VB 3HRZC 5IROC 1ONQB 5BUAA 1YYCA 4KK9D 4FADA 1T4KA 1W6LA 1D5XB 5LBSA 3IE4A 4DGVL 1ZLVK 5J9PA 2BIQA 3KE0A 1D9KB 2FJHB 1KN2L 5EIQA 3QDMB 2XVLA 1UGKA 4JDZA 1HHHB 3A67H 2O61B 5K9KB 2FEEL 5K9QI 4ODXB 3TNMA 1OCZB 1A47A 3PS6A 4P9MH 4NPKA 1SYSB 4XC1H 3ZDYB 3U4AA 4EVNB 1H8SA 4Y1AE 1QLEB 1TMQA 3S36X 5SWQB 2KDYA 1KACB 2HZHA 2XJKA 2F58H 1MVUA 4HWEL 2W88A 2Z7ZA 4IDJL 3HKZA 3RWGA 3S5ZA 2YUZA 2B1AH 2AV7B 4RDBA 2Q10A 3AM8C 5D96B 2RD0A 4W4OA 2X3CA 2VDQL 3I2CH 2QFPA 3HNSH 3DUSB 3UC0H 4WFED 2AJ3A 2AK4D 1OOAA 4MXVE 3O9WA 1OKEA 4X6DA 3TPUB 3JV4B 1VGKB 1JNNL 2VUKA 2BNQE 2XZCH 2EIJB 2XI9A 4YBQC 3BP6B 2W95A 3JWNH 4JO3H 1UB6A 1TZIA 2X41A 5EDSA 4KZCA 1D5IH 1IGIH 2VERN 4X4YB 4OZHF 3AUVA 2R9HD 5I5MA 3G5ZB 3LDBC 1CQKA 1YEWA 2QL1A 2G3MA 4NN5B 2FECL 3B9VA 5GZOA 4DP1X 5LGYA 5CHNA 4U4IA 3QSKB 3L5XH 5E94A 1XWVA 4HS6B 4MWFB 4KK8D 4HCRH 4AQZA 3O3UN 4NBXB 1S9YB 1J1PL 5FV1L 1TVBA 4I1PA 4JFOA 3CHSA 4MFHA 4MS8C 5HI3D 3GMLA 2AV1A 4GSRA 4G8EB 4L0PB 4X5QA 1Y7VA 5KSVB 1WBXB 4ZTPH 1MLBB 2X7LB 4NLAA 5FYKE 4DVRL 2WWMC 1GJIA 4LAJH 3WMSA 4U6YB 4QGTA 4Q6YA 2QMKA 2YGVA 1QSFE 5I0YA 1FLRL 1DQQB 1SXBA 5DHXB 2W60B 1Z9MA 1JRHI 1LO5A 3KNBB 1VEPA 3WMQA 4W4OC 3BLBA 3CTTA 4A67A 1NCBL 3P9LA 5DHYA 2QKIB 5AYTA 2K3HA 4BUGA 3T0ED 5AD0A 1JZ4A 2XZAH 4ZSOE 5LGKA 2L8AA 3C5JA 4FFZA 2OMVB 3RBSA 2J55A 4PW9A 5DT1H 2IH3B 1CGUA 4JHVA 5DC4B 4PUBL 4HKXA 1DQLH 5G5DA 4IRZL 2PF6A 3L3GB 3LEXB 4HSAC 4F37K 3RTQD 2E47A 3V9CA 1ERNA 1UXSA 3QE5A 1TETL 2X1OA 3CFCH 4JRXA 5GZOC 3VWJB 2BHUA 3R06A 2ZSVB 5MERA 1BDYA 3QUZA 3EIFA 3KPSA 3FT3B 3ZT7A 4JFPA 1BZOA 3P02A 1SHMA 3AITA 2MKLC 1ZA3B 1WAAA 5GRVL 5F6HI 3FO1B 5CEXA 4L3AA 2YEVB 3DO3A 3T3PE 4ZPVA 4YHKH 1UVQB 4DCQA 2I24N 1HL4A 1O6VA 3MRBB 2YXMA 3BUBA 1LLAA 2GUOA 1R75A 4EN2A 2BZDA 3VB8A 1V3KA 3B9DA 3N2JA 4BK5A 3MTRA 3BKCL 3OKMB 4BUQA 3N40P 1IJ9A 1ITCA 2D0FA 2Z35B 4AOFA 2CCWA 1DYZA 1FH2A 4K23H 2R1YB 1WEJL 3AS1A 3GZQA 4Y16B 2OXHB 2XV6B 3LNIA 4RVBA 4WWKD 1WC7A 3U2SB 3P30H 3C09B 2B4CC 2WWNA 3QUMA 5HPOA 2VQ1A 1G6VK 3KXFE 1XV8A 3PHSA 4X6EB 3SDAD 5I6OA 5GGVH 4AYDC 1P4LA 4Z23A 3G9VA 4NDMA 5HDOA 2IAND 3U9UA 5C0DB 5AL0A 4LOFA 1EFQA 2C26A 5BZWB 4PEEA 4PJDE 2DQJH 3RWEB 3WDHA 1GAFH 4LSRL 4LRIA 1IKOP 4V2BA 4F80A 3OR6A 4ZQKB 1M71A 3UPCA 5ADPL 3GO1H 4ACPA 5ALCH 4LESA 1Z66A 3QUZC 3DX2A 4NT6A 2UZIH 3RWIB 3WEAA 3ILQC 4JANB 5DEGA 2EVHA 2EDFA 1VRSA 2A9DA 1NFKA 2WWOA 3A4FA 3SGEH 2EO9A 4HIIA 4AMKH 5JPNB 3S88L 4F24A 4S1QH 3EO9L 3BLPX 5E6UB 4PJIB 1I8UA 1CL7I 3DIVA 3V4UH 5FHAL 4X4XA 3KM1A 1T1ZA 4QRRE 4Z7QF 2P46B 4NN6B 1RCYA 3EJYC 15C8L 4BK5C 1X7SA 3GSRA 5BPPA 1RMFH 3CLEL 4KUCD 4D8PB 2WIIB 4ES9A 3P0VH 1C8QA 1OAUH 1YUHA 3B9KB 3JYBA 3BDYH 5D7KD 4H1LB 1AGBB 2X4NA 4HIXH 1J5CA 3NTCL 1Q4NX 4OV5B 3FCBA 1UURA 2NY7H 3UTQB 3DUUB 4Z7OB 2K7QA 1RSFA 3T2NH 4FFVD 1MHEB 5DVOA 2KDGA 2GSIA 1FG2B 1MCCA 5HYQA 4XBMA 4R4NC 3LVEA 2BWQA 4LRIC 4WSJA 3H53A 2V7HA 4HC1H 2IAMA 3VI3F 2B8OT 2B3IA 3X3GL 2EXYC 1PZDA 4QY8B 4KMQA 2Y5EA 3RX7A 1U3HB 4HIJA 4A7UA 4M3KB 5SWSB 3EW3B 4TLUA 4QNPE 5AVZB 2B39A 2K6YA 5F1NB 2YD5A 1FYHB 1J1XH 1E5ZA 3HTLX 2ESVD 3V0WL 1IGML 2XTJB 5D6CA 4LASL 1GVIA 1EMTH 3D0VB 1I9JL 3PGFL 1QFWI 3EZ8A 4D9QE 5I0ZA 4X2UA 1SNRA 1BQKA 3DRQB 3V5KA 2PW2A 3ZE0E 1X5GA 2P8PB 1U8IA 5CIPA 3ROOA 4YK4B 3U1PA 4OIAA 2NUPA 2BK8A 2J4WL 2YK1L 3QEQB 3OAUL 1WAEA 3P0GB 1HHJB 2XY1A 1AHWA 4HH9B 3FTVA 3MLYH 5GGUB 5BV7C 3F64A 3QIBA 1B2WH 4IMLA 5LGHL 3NCJH 2EDQA 1MLCA 4NZFA 5E9DD 1WZ1L 3VWKB 2R4RH 5DQDL 1IGTA 4LSUL 4M6OH 3V55A 2XA3A 4EQ3A 5I1HL 1TZHB 2CHDA 4XMWA 2R0LL 4C4KT 5B7MA 3CLFL 3MRFA 5HVFB 3WTSA 5CXPA 3GSVB 1EQWA 1CN4A 1GYCA 4PJDF 3PNWB 4KK8C 2GJ6A 4JNXA 4BFIA 1D3CA 2IAMC 1HAUA 3OSVA 5DEZA 5FFOA 1N68A 3OGCB 4UAOC 1NH6A 4AG4H 5IR1A 3CFDB 2IH1A 4NRXB 5HI3C 5I1JH 4PHZA 4DEWA 2HG5B 2BSTA 1IBGH 3JTBA 1NIBA 2XU9A 3PPEA 1TJGL 1NGWA 4JFYB 1JGEB 4JO1L 3GS4A 4YHIA 2XQ0A 4L4TD 5DUMH 5I1CL 1CFVL 1CF8L 3N85L 4LNRA 3T6ZA 2XPGA 2RR3A 3HG1D 4BSWB 3Q43A 5EC1B 1KGIA 3FB8A 4R7DB 4KVNH 5JOFA 4KU1A 5FW6A 3BH9B 4BHUI 1YA5A 2X4OB 3HZ3A 2HVBA 3T4AA 2PNDA 4QO1A 3I75A 4WWKA 4YLCA 3K6SB 5MEQB 1OAYH 3FCTA 3NDZE 4KI5D 2ZCKL 2EUVA 3KM2A 5TE4H 3T0EC 5ISZA 4HJEA 4I5BB 4R4FH 1WAPA 3CSYB 3DYMA 2GK0A 2WTRB 3OVUB 5DD0H 1E5CA 2H1PH 1JWUB 4G8GB 5CLXA 4D3CH 3QIBC 3TPKA 2A74B 4P49A 5FEBA 1A65A 3NQKA 3CPLB 4HWBH 3ZKMC 1G9NH 4WI3A 1OTSC 2CXGA 1WA2X 4GXUN 1FZKA 3RTQC 4PMFA 5TE7H 4G6KH 3WKPA 2BW4A 1YPZE 4RSYA 2WXFA 4Z3GA 4JRYE 1SUHA 4X6FB 3TIDA 4DKDC 1CCZA 3H3PH 5IM7A 3AQZA 3NFPA 1YY8A 3DRTB 3TBYB 2E7MA 2Z1KA 4KNTA 2ZXDA 4ANVA 3E8UL 4XMLL 4PJ7A 1SEQH 5J13B 1K6QL 1XBDA 1YCSA 2BJML 1I8IA 5FDYA 5KS9E 1TYEB 5AVWB 1DN0A 1HXMA 2VZVA 3TVMA 1E6OH 4L48A 1N8ZA 2WVVA 4Z5RA 5IMOA 5GGSY 5MI0B 4LLUB 3QQNA 4EIUA 4AV4A 2V9RA 1LK3L 1PTZA 1FFPB 4JFUA 3T5WA 1UYWH 5ILTH 2NW2A 8FABA 5IT2H 3H54A 1U6AL 3UPRA 5B1KA 5K93A 4KOBA 3GSNA 3LRMA 4GO8A 5DJ0A 2X6AA 3J2PA 3G5VB 4WWKC 4OZGB 2NY5H 3BVDB 4WW2B 3NEXA 3NYKA 3HCVB 1LEIA 1QW9A 1MZZA 1NPUA 2B3RA 5CUSH 3SDAC 1KB5A 4G6FD 1JZDC 2O72A 2YAMA 4PJGF 3KPRD 4DVBB 1AMXA 4P2OD 3A5VA 3INUH 1CR9L 3LEVH 1M6UA 4ZMXA 4OR1A 1Q0XH 5BUGA 2X4UB 1S8DB 1KCVL 4MMZA 3FQTA 5D7IA 4PRIE 2WQAA 3GNML 4ATWA 1AY1H 5FHBL 2ORBL 1KBKA 2W0KA 4Q2ZB 3P4MB 4B96A 5L2KB 3V0JA 4M61B 2K8MA 4NKDB 4B9PA 3WEMA 2ZUSA 3QIWB 1NSNL 5EUOA 1MCWM 4EO5A 3H9ZA 1I3RB 3HBQA 1H6FA 2Y06H 3NCYP 5PAZA 3C6SA 4GRLB 3W39B 1JPGA 1DDTA 1RZGB 2AANA 4GNKB 4JK0D 4J3OF 4X5RA 5F9OL 2V6HA 4RWYL 3PREA 1NBQA 1NIEA 1SXCA 4MD5A 4GKZB 4TSCL 3HI6H 3HI5L 3PP3H 2LOEA 4ZO7A 2P5PA 2WIMA 2CLRA 1F90L 1TKWB 3ARDA 4R84A 4E36A 3ZQ9A 1QBBA 4G9DB 5LCVL 2YO3A 2H2SC 4RZCA 1MCJA 2F8XC 2R23B 3SJVE 3PWJB 5KSAA 1J05B 3U7AA 4EN3B 3Q13A 1L7IH 4IIQA 5AEAA 3QUXD 1XH2A 3LNHA 5DUPL 2H6PB 4F1SA 1G9HA 2VLJA 5IFHL 4EZKA 2FGWH 1DLFL 1NCHA 4KRPD 3T8MA 3ZTNH 4M1DH 1KY7A 1MXDA 3MRCB 3JVGA 3RL2A 2CDFA 2XQYK 5DK2A 3I9GH 3N42F 5E1HB 5DR5L 1MNUH 3HMXH 4JFFD 1MFVA 3TO2B 3BKYH 4WNQB 3NSXA 4XP6H 4QYOB 4BFBD 1TTBA 3GBMH 4MMZC 1YDPA 3QJVB 4N2LA 5IHUH 4PCTA 2VXSH 1JGIA 5CINH 3OG6B 5HTSA 3QG7H 4J4PA 1TTCA 2Y1AA 2Y5QA 3SDCD 3MYZA 3UG4A 2RAMA 5F21B 2JXMA 2OJ1A 3DROB 3IM1A 5GGTA 1ZWIA 3ARFB 3CN1A 1J5HA 1MHCB 3FNKA 3LKNA 1KFAL 5EIVA 1YPZF 3LZPA 3UX9B 1FAKT 3IPEA 3BOVA 2EYTB 3MYJA 5BS0D 5F70A 1N5YH 4J8RA 2GI7A 3MLPA 3S3BB 5JR1H 1KG0A 1XSOA 3NJHA 3CFKA 4JG5A 3K0YA 2R8SH 5T3XH 3IMRA 3ZHLA 2D7PA 5TPWL 1I3VA 5D1XB 1UWEL 5I8CB 2IOOA 3H7LA 4XP1H 1DR9A 5KS9F 4LHUB 4TUUA 1T0PB 4ETQA 3O0LA 3ARDC 3DTXA 3O4LA 1IAOB 3KH4A 3MLUL 3RURA 4LHQB 1X5FA 1I9RH 2E9GA 1RLBA 1E3XA 5KSAC 3BWAB 4FKHA 4IIQC 5I30H 1UWYA 5T1LA 3APCA 1UXLA 4FQHB 1BJ1J 4HFWB 4N2GA 4PHXA 3B7UX 3ZDZB 3HS8A 4HUXA 2Q2LA 3WFHA 4OLEA 3RKPA 3FJTA 1SOQA 5L4JA 3AROA 2AJXH 3SPIA 5F7HA 1OB0A 4B50A 5JLZA 3HAEB 1T80A 2EUZA 3MRGA 2UY7A 5JTWA 5DTFA 4GMSH 4J4PC 4TQ8A 4OTXL 4HUUB 1CYGA 4IEFA 2AEQL 2FT6A 4YHZH 2W94A 4EUPH 4IU3A 5J56B 5IV2B 1OT2A 4JDVA 4N9GA 4YZWA 2OCFD 3IJ7A 4S0SD 4L3ED 4YHYB 1G7HA 1YNLH 2UWEE 2WXQA 5C08A 2XG4A 1MWAL 1NMBH 3B9AA 4G8IA 4ZXBB 2O6EA 4HV8A 4NZUL 3AT0A 3KVPA 3OKEB 2DJUA 1RUKH 5LLIC 1EIBA 3MRDB 3H9SE 4YE4H 3Q8EA 5I1KL 1N67A 3EZJB 1DCLA 2XN9B 3OHXB 4AK1A 1FORH 2J6EH 4OF5A 3UGEA 3GI9L 4C55A 5B1JA 3DK0A 1MFDL 4I77H 1CC3A 2FD6H 2X2JA 2ZG1A 4UV7L 4APQD 1Y6KR 2NW3A 1DEDA 4KI5C 2FATL 3BAEH 4N85A 2EH8L 2UZPA 1MUJA 1ZLUH 1DUYB 1GGCL 3BE1L 3MV8E 5EU7C 1Z3RA 4U3SB 3GC3A 4P2OA 1BQSA 3VCLB 4M62L 4C56A 3VI4A 1VGEH 3O3DA 3HMWL 4WHYH 5HPMA 3ZRFC 5D6DA 2WLHA 1WS7A 2DYPB 2F54D 1GH7A 5M94B 2ZUVA 3JT2A 1BJMA 3PDOB 1PVHA 3PWPB 4FQLL 4XT1C 5MEPB 3T08A 2JB6B 4NUQA 5EOCL 1XHHA 4CA4A 5D2NE 1F4WH 2EE3A 2QV4A 3JYCA 4Z7IA 4MB4A 3BPLB 1VACB 3OJVC 2FECI 5KVEL 2YLKA 3OWRA 3TU6A 1FYTB 3KPQB 4E42B 4JO4L 1BD2E 5IHBA 3QDJA 2DLIA 4QHNA 4Z0BL 4QRFA 5KWYC 3D12B 4YMPA 2CKBA 5ABZA 1KELH 4TSAL 4OCXH 4G42A 4ZMVA 1S7RA 3T1FA 5I0VA 2HN7A 2BINA 2PW1B 1BF8A 2W07A 1E9OA 1EVTC 3LQAH 5CBEA 3RUGA 4EF3A 4KITB 5B1JC 1JK8B 2V2WB 4FQXD 4XNQA 2B15A 3ATDA 3UAJD 1KXTA 2EH7L 1RJZB 4YHNB 4P57B 5GJSH 3K71B 1NGZB 2Y9RT 4R83A 1IFHL 2WZAA 5EEUA 5F3HB 1AXTL 1T2QH 3CFBB 2BS9A 4P2OC 4G83A 4PJBB 3ATBA 2FX8H 1JZGA 4JREB 1DDHA 5CILH 4ZPTA 3V0GA 3LRKA 2GTZB 4M5ZL 1Q1PA 4P4KD 3QWOA 5C0FA 3QPXL 1U8HA 3OKOB 1HCFX 4WHTA 1Q1JL 1W15A 2H0FA 1WFTA 2LU4A 1D5XA 1MCIA 2RCSL 4LDEB 2VT0A 5ESQA 4QTHB 5I66B 3L1OL 5IB3A 4IK6A 3GXTA 2OMTA 3TA4D 1MAKA 4LIQE 3ME0B 4AEHL 3EO0A 4X99A 5BS0A 2D3LA 4WI8A 3BZEA 5T1DH 3TX4A 1XR9A 4Z7OF 1RULL 5IW6B 2VMFA 3QB7C 4OH2A 1Q72H 2DWXA 3VFPA 2XIDA 2UWEF 3BKJL 4R3SA 3WXWL 5IQ7H 2EDBA 4OFDA 2G0LA 3KG5A 3VG9B 4JPVL 4MYPA 1X6LA 2G9KA 1OP5K 5SX5K 1I8MB 1SLVA 4ODUB 3GXPA 1NEUA 3WY2A 1HKFA 1UD4A 1ZT7B 1PIFA 4MAYA 4WJ5A 4JAMA 3TJPA 1E2ZA 3F05A 1VGKA 4KRPC 4X8JB 1FC2D 1AYOA 2FO8A 2N01B 1EEZB 3BP6A 4JZOA 5GSRB 1A3RL 5I16A 3ULUE 3BUTA 3HUJB 4PJ5D 5AVVB 4KKCD 4XI5C 3SGDI 4GS7C 1W0VB 4X9IA 3VD9A 5IWLA 3VXPB 4B5ZA 2DQEL 3AG1B 2OJEB 5AB1A 5TH2B 2ERJB 3X3FH 4EOWL 3V7AG 2PYEE 3QUYD 4ZMOA 1KXVA 2HJLB 4XR8C 2LAGB 3V4PB 1CG9B 2Z34A 4ZUUB 3UZEA 5J4MA 2DDQL 1NCCL 3R8BB 3THMH 2EIZB 4E41A 4NO2B 5AG8A 4URTB 1JXJA 4GQPH 2QPUA 1V7NH 3V6FA 3OLDA 5TF0A 3QQ4A 3US0A 3W0WE 4IBUA 5DMKA 2WGXA 4TVPH 5CEYA 2ENQA 5FGRA 4AVIA 1U3NA 1KOAA 1RZJH 2A83B 2X7LA 3LPFA 3SDYH 2WUBL 4HK3N 3KGSA 2IXQA 4OM0H 3F7KA 4ZZKA 4Q9QL 3Q7JA 4IRSB 5DMYA 3ASOB 3SE8L 3MUUA 4LPCA 4PB9L 4R96A 2VSKB 3C12A 4UV4L 4RAUB 2W60A 4Q9RH 1NGPH 2AK4B 5HHOE 1SFDA 3KNBA 1MW0A 1TQTA 3GJEA 1MJJA 4N8CL 4TOYH 5C0EA 3C87A 4B9KC 4LVOB 1QRNE 4DKTA 3O4OC 4Y5XB 1SEBB 2L7JA 3AW5A 1DN2A 3UO1L 4MAYC 5ID0A 3SQOH 4Y8AA 4NRZA 4HIEB 3HPJA 1F11B 2IH3A 5GGRY 2Y36L 3PF2A 1G7MA 4O2EB 3S37H 2NYYD 3M17A 1U8NA 3ERXA 1G7JB 3IE9A 4PJXE 3FMGL 3L3GA 3LEXA 3L95A 3VXME 1WTLA 1EDHA 2FSDA 2XBTA 3ZMEA 5IWLC 2ZF8A 3N0PB 3NOIA 4FHKA 5E1AB 1T1YA 3MCG1 4NN5C 5ES4B 1H8OA 1QACA 3VWJA 4OCYH 5IFJA 2KZKA 5B8CB 3UZEC 2QSCL 1X5AA 1TDQA 3OKDA 3MLTA 1ASQA 5GS0C 2WQ8A 4JDTH 4W9LC 4QAWA 1I9EA 4NFBA 1M05B 4OKDA 4KC3B 4I89A 2BY0A 3L81A 1I75A 4N9OB 1T6WA 3C5ZB 4NQSB 3FU5A 3I02A 4N0FB 1A6ZB 4HEPA 4L4VB 1RZPA 4XVUC 3V79C 5FB8A 4XO9A 4PV8B 4QRAA 1ZV9A 2F19L 3RWJA 1DHKA 1KIRA 2HMIC 1H3GA 5EB9A 3E1ZA 3U7YL 3EYQC 4APQC 1IJNA 1CQYA 2B4CL 4MAZA 4FQ2H 2CALA 3FHEA 4YDJA 2VYRE 2HT2D 4K5LA 3ZT6A 1SMAA 4X80H 3K6IA 1CLOH 1M53A 3JXAA 4BJLA 3L8QA 2LLNA 3N1MC 3KWWB 4FLQA 4JZJB 2ICEC 3U30B 2YBRB 1MHHA 3NCWA 4HMDA 4JHUA 1K5NA 4QT5B 1HDMA 4FXKA 5C0DA 3UYRL 3BO8B 4N0YH 1NL0L 1JP5A 4XO4A 3FW6A 2IVFC 4Y5VB 4AEIL 3ZRSA 1U36A 1C5BH 4XVTL 1DVQA 2RGSA 3M1OA 2GW5A 3W37A 2OPCA 1CDYA 3C08H 4QXUL 5KVGH 4UYQA 4YDLB 4FL4C 1H8NA 3JUYA 2VDRH 1P1VA 5K59E 4HGWB 2IWFA 3RWIA 3TLRA 4JANA 1ZSHA 2V3DA 4WW2F 3NJKA 1FE8H 3BP7B 5TDPB 2QPEB 5JPNA 1RZ7H 3S36H 1LNUB 4PJIA 4BRVA 1WCBB 1Y0LA 4JGNA 1GGUA 4A2HA 4LEEA 5AW5B 2NY2C 4CVXB 2QADC 3KGTA 3UYPA 4JE4B 4LCCB 1X7QA 4G9FD 2XKNB 1NUNB 5DEJA 5GQBA 2J57A 1T5KA 3L3IB 1GIGH 2VMCA 5KJRH 4XCCL 3W2DL 2PWHA 3BEWA 3QJRB 1AR2A 5FF6B 4XB8A 3L5IA 1A6TB 1P4UA 2LT9A 3ECWA 4PRHD 4UIKH 5GJTL 3S35L 4X5LA 1S7UB 3QUML 2CO7B 4KJPD 4QLRA 4M7KH 3DUUA 3QFJA 4POZC 3REWB 5A3IC 3L3KB 1W16A 3GPEA 1QQDB 2OI9C 1AACA 1VHPA 5C07B 5L9DH 2PCYA 4KHXH 3AS0A 4Y19A 4FXKC 2R27A 1FG2A 1M9SA 5EOCJ 5ESVA 1IFGA 1AI1L 2GC4C 2OJZL 4R7NA 5HYJD 4X6DE 5F0LB 4NO5B 1CIDA 4M7JL 5FM5M 4M43H 5IESL 4PWGA 4HEPG 3K4DA 1GTFA 1ILSA 4HC1A 1EJ8A 3DDGA 1MCDA 5C0CD 4MDJA 1AXIB 3SEPA 3NCXA 4L9LB 4M93B 4Y2LA 3FB5B 1PD0A 2GITB 3KBFA 3FUMA 1XO8A 1AE6L 1BXUA 4YFDB 5E4EB 2JI3A 1BM3L 4FA8A 4GKSA 1XGQB 4M03A 5MEND 3BGFB 4S1SH 3UZQB 4P23D 1IZKA 4XVSL 5F9WC 3DNKA 1R46A 3SBRA 1ZXQA 1PDKA 1W9XA 2AXJA 2WXNA 1CD1A 2BP3A 3QEQA 2RBLA 4YDKL 4WO0A 4JQVA 1G9MC 2BFVH 1FPTH 3NZHL 2Z31D 2OV0A 2B59A 5BV7L 5DRNB 2QLYA 3BHBB 3ARGD 3KYOA 4WCYH 2B9BA 1KCWA 3NN8B 3IJHB 3BXNB 2J20A 3TV3L 1B3IA 2BOBA 1KC5L 1I4FB 2NXYC 1BA9A 4JFSA 3RTLA 4KK5D 1DSWA 3GBDA 2FLMA 2XKSA 3EGSB 4B9CA 2ATPB 1CXKA 3P69A 5C9KA 5TE6L 2AQ1A 3PQYA 1TSRA 5BRZA 3T6WA 3VRLE 4M4PA 3MV01 3LKQA 2BS8A 1AO7D 1CDGA 1YEJH 2ICWA 3TWYA 1A4JB 2C1OA 3OGCA 5AOLA 2Z6FA 2ESVB 2J5LB 1WT5C 3MZGB 3NA9L 4NOBA 1QHOA 4HZ1A 4Q58C 3OZKA 2OTWB 4JRXE 1SJMA 4ATTA 2V37A 1IVTA 3RNKB 5H4YA 1JGEA 5LO7A 2GQHA 4LLYB 5L6YH 4AJVA 4KKLC 1U9KA 4RMUA 5ERWA 1YYML 2VDKH 1OD7A 1XB6A 4BSWA 1XMWA 1WAAE 2WQWA 3SY0B 1DANT 5T3XD 1HFUA 4X4YA 4K2UL 2XA8H 1JZFA 4FP8H 3NJLA 5DC0A 4ZUSA 3PWVB 2V9UA 1I9IL 1USZA 2O1AA 4FQ1H 3UG3A 3GMOA 3GXUB 5ETUA 1P2CB 3MO1B 4HLZH 5E9DB 2HFFB 4LT7A 3SQRA 1DE4B 3N50A 4JQVC 2LU5A 4LCYA 5IF0B 4PP2B 1HIML 4FDWA 1IT9H 3V7MA 1ZEAL 1R0AL 1QUPA 2NYYC 2WKLA 1T5XB 3EFOB 2XWBB 2RH0A 2BSSB 4HWBA 4L3CB 4ONGH 1WF5A 3MSPA 3T2OA 1D7DA 1E67A 2X1QA 4FF9A 4JG0L 1SJEB 5JHLA 4NGHL 4XCNB 3LIZH 3L5WB 2XXGA 1HL5A 2EUWA 5ICUA 3ZHNA 3Q6GH 3GSWA 4B0MB 1JK9A 3MLRL 4L4TB 1F4YL 4KH9A 4JQIL 4RAVB 1X9RA 2CSPA 3FU0A 4UOQA 4P46D 4E9TA 5I75C 1O9ZA 1KGCD 2P24B 3PJLA 3N44B 3HG1B 3EHBD 4PR5B 4EDWH 2CBQA 3BZ5A 4MX7A 5HVWA 4FE9A 3WKMH 1QSEA 2FTAA 2PWFA 5EWIL 2G2RA 5EBLB 4G43A 1E7VA 5B7EA 3OKNA 2Y72A 4LLUA 3E6HB 1OHQA 5DD1L 4FTVA 1OGSA 5DWUL 1JUFA 1FFPA 4TQPA 3ULSB 5KVDE 1F97A 2A6IA 4KO6A 4MJ6A 3UZVA 5T1MA 4FQQA 2R0KH 2E9JA 2ETWA 2O4EA 5T5NG 4PRHA 1YEHL 2PWEA 4P4RA 5AW2B 3RRQA 1YSOA 3FO2A 3L4XA 1AD0A 4MVBD 1BGXH 4NKMB 1DQML 2D31B 3H3BC 1XH0A 1E4XH 3IEAA 4OKVA 5F0PB 1MRFH 3ARPA 3J8F7 4HFUL 1BMGA 5IJDC 1PZBA 2CO3A 2VDNH 5JW4M 3S0PA 3KHOA 3OMIB 5L2KA 3GB7B 2LAAA 5I2IB 1G9NC 1OP4A 4JFED 1OL0A 2NY3D 4J1UB 4OGXL 5DJ2B 5L4MA 1I7RA 2ZUWA 1DQDH 3HG2A 4Z77B 1JGVH 1NQBA 5AVSB 2X1PA 4D0CB 3VRLF 2XWXA 4GRLA 4Y9CA 3S3JA 4JKKA 1MIML 4X83A 1O7DC 1ILUA 5KBKA 2ITDB 4PJFB 4IJ3B 5IBTL 3EH2A 2BIIA 2ZCHL 5MENA 5IUCA 1FWXA 2AJZB 3SB3A 4MCZA 4P23A 2FJUB 2Q7YA 4GKNB 1A7QH 1FZOB 3IJYA 3CZKA 3L3DB 3EKCA 3PWJA 4HXBL 1D6EA 2CGYA 3UG5A 3WN5A 4G6FB 4KJYA 3ECVA 3KPRB 2H6PA 4I13B 1CIUA 2NQCA 1I3GL 1F1AA 1MI5D 1CD9B 4AZ8B 1LK2A 2NY5C 4DN3L 2O30A 4NEHB 3NK3A 2QJDA 3PIQB 1YYLL 2BDNL 3IJEA 5GRUL 5H35A 1K4CB 3TO2A 3HMXA 4BZ2L 3T0EE 1J8KA 3BEVB 4NQVA 3SOTA 3GMPB 4HCFA 1C1EL 1E3FA 2Q1EA 3TESA 3V0DA 3SQBB 4BFNA 1SM3L 3DROA 2Y7QA 1JNHB 3T3ME 1YJDC 3KLSA 12E8L 1VF5C 1UD8A 1OANA 4HS8H 3O3EA 2EYTA 4Y4FB 3TBBA 1F41A 4HEMA 1EJ6A 4XNMB 4KZEH 4JRLA 2CUAA 3MFFB 4A6YH 5IIEA 2GJ6E 3K6NA 3OC5A 5GRJH 5ICZB 4NPYB 5D1XA 3MBWB 1I8KA 4XCEA 4OQTA 1ADQH 3QUXB 4LHUA 4P23C 2GC7C 2JKRM 1KB3A 3KWVA 2YPLD 2APTA 3F12A 4KAQL 5EH1A 5E23A 1XGUB 4E9WA 1OHZA 4H8WC 5ESAA 2R2EB 4XN4A 5I18L 4JUTA 4DOHB 2YMOA 4JHZA 3WN5C 4MCYB 4BV1A 1HT6A 2X0UA 3MUZ1 4PBWD 2PN5A 2ZG2A 4JFFB 1ZE3H 1OAKH 1P4IH 4JHWH 4WV1B 1Q9LA 3ARGC 4LSPL 4M6NH 4MHHI 3IDYB 4PSPA 3TA3A 3BZ4B 2B5IC 4K71B 1HKLH 5TQ2H 3SDCB 4NNPL 3IFPB 2ED8A 2WXOA 2ZWYA 4CSPA 1CXHA 3O3AB 5IHZA 3D7PA 4XOEA 3M8OH 1BX2A 4PWJA 1MREH 4S1RL 2X1XR 4N8VB 2AAAA 4QDGA 4B3VA 5GGTL 5IMMB 4TS6A 4XN2A 4G1EA 3WDJA 1DQJB 4YGAB 1F4XL 5IV2A 2DWTA 2Q3XA 5CKAA 2ENYA 1CFQB 3WIFB 1A5FH 3P2TA 4P46A 4G5AA 2YJQA 1M7DA 5TD4A 3RNQB 4GFXA 5C9JB 4FEIA 1ZHKB 4GPVA 5CNHA 3V5HB 4ZXBA 2E76C 4TVPD 3WKNA 1VZHA 1J86A 3X11A 5KW9H 4N2OA 5IEKB 4WFGE 5FCSH 2XXFA 3O2VH 1UD5A 4GINA 3MRDA 2YARA 3L9EA 3Q6FB 3OHXA 4PJ7E 2WQXA 3QH3B 4GUOA 4AEFA 1OSYA 2H32B 2L7QA 1FHNA 2E86A 3QWRA 4OF3A 4YGVB 5DD5L 3TT1L 1RU9L 4PI2A 2R69H 32C2B 4NUPA 5EZJA 2E7LA 3TJHC 4OAWA 4ODHL 3F7LA 3O2DA 4HIHA 3RHWK 1SHWA 1LVEA 1Q9WB 3EBIA 4H8PA 1E6JL 2EEDA 3PXHA 4LEBA 4HWUA 3TA3C 1DJIA 3VFWA 1FAIH 2EVGA 4HBQA 4FQJH 5F9JB 1WWCA 2CPCA 1CUOA 4GUPA 4KQ4H 3WOVA 4BFKA 4DNLA 1KTKE 1EXHA 3PDOA 1MCBA 4UZGA 1IKNA 5MEPA 5AW0B 2GUYA 2BWDA 2YRLA 3LZFH 5TFSH 4ZX3A 2ZUXA 3ARBA 3I50H 4LHUG 3EOBA 3W5NA 4L3EB 5I1GH 1VACA 4PM1A 2A6KA 5D7SH 1ZSDA 5D7IE 1ZTMA 2Z92A 3OXSB 4L3FA 4P46C 1A7RL 2MRYA 3A6BH 3CZEA 4OLYL 5CCJA 3BRFA 3HC2A 1MFCL 4J2QA 1HXYB 4O58H 2OSWA 4GSQA 4PIRF 5EUOE 3Q48A 5B38B 1XSKA 2BVOA 1NC2D 2OBGA 4R2GD 3IKCB 1E3ZA 3BLKA 3WHXB 3RJDA 2V5SA 4FNPA 5F1IB 1JK8A 2V2WA 2JH2A 1ODAA 2VDLH 2Y2YA 4H8VA 4KKNA 1KWGA 4MVBC 4HOMA 3K71A 1NGZA 4ONFH 1TOXA 4ZRGA 1UM6L 1A1MB 3L4UA 3ETBF 5F3HA 5LB1A 2F54B 2GIXA 2IBZY 4NZRH 4EUPG 2NNRA 2YPVA 2B2XH 2VLJE 4P2RD 1GMEA 1KTCA 2DBLL 4H0GA 2WKOF 2WYZA 1SXAA 4AYSA 1BZ8A 2DQFA 3OKLA 3I6LD 1WIPA 4WI5A 5BQ7A 1TTFA 3N1QC 4NQDA 1FNSH 1IKNC 2EEAA 4XXDB 1X5MA 3TBTB 3ZXAC 2IPKB 2DWEB 1AOZA 3ARBC 4QTHA 5I66A 4MNGA 1NMAL 2XWJA 1ZLWH 2BHZA 4TTDD 2PPDA 1YEEL 4G70B 1FL5A 2FL5A 3ME0A 4OY9A 4P99A 4OSUH 3ETBJ 1IBBA 4XNXL 1OAQH 4UIMA 5JQ6H 4HBCL 4GAFB 4HETA 3MV9A 2JWYA 5DI8A 3UTSD 1T04A 1YECH 2QELA 3FN9A 3BI9X 1KTLB 5AQ0A 4IRJB 3FQUA 3GT6A 1ZVSB 3IU4L 1KPUA 3KL3A 5F6IC 3UC2A 1IM9D 5EU4B 1QLRA 1X6NA 1J9CT 1E30A 2DKMA 2VABB 3MLXH 4FQXB 5J1SC 3C2AL 1X5XA 3CVHB 3D85D 3BT2H 2Y4SA 3VD4A 3BSZH 1PLGL 4MRCA 4HGKC 3LNDA 2A9NH 4PJ7F 4HH8A 4DIXA 3LQAC 2FBJL 4H5SA 2PXYA 1XAKA 3P4OA 3LAFA 1KYOJ 3EJJX 2AEOA 4P4KB 2CCLA 1NLDH 1OGTB 2A38A 2E9BA 2G9HB 4KUCF 4V1DB 4KI5E 5IVZB 2CJ3A 2X89D 3GMQA 5C7ZA 1FFRA 2OJEA 5FKAB 3WJMA 4GAGH 2BFGA 5FOBA 3CDFA 3LB6D 1CG9A 3V4PA 3MGAA 2CM5A 1KCLA 3TIEB 4NO2A 5CGMA 2QGBA 3BH8B 2R39A 2PPCA 5IQ9B 4YLQT 2WANA 3NJMA 3F00A 5IBUG 3Q44A 2H3KA 5AVRB 4Z78B 3MRMB 4HALA 2CDGB 1A4BA 2A2QT 3N43F 1WFMA 5IP4A 4L2LA 3A67L 3MXVH 3BVNB 4KTEL 3RGBA 5D7IF 3V0HA 4IRSA 3TBSB 1TQBB 1JZ2A 3R4DA 1KENH 1PY0A 2X4SB 2BSDA 4MDIA 4NM8L 1JVLA 1HC1A 4ODTH 4XC1L 3VDBA 4OD2A 3VRJB 1FNEA 2F58L 4P2AA 3VW3L 2YAQA 3IFNH 2B1AL 4BKLA 2PP7A