1K8DB

Crystal structure of the non-classical mhc class ib qa-2 complexed with a self peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Promiscuous antigen presentation by the nonclassical MHC Ib Qa-2 is enabled by a shallow, hydrophobic groove and self-stabilized peptide conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords QA-2 antigen
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k8dB00
4XCFH 2J88L 1BZ7B 3Q6FA 4K8RC 3WFCH 3FQWA 2BZDA 4N8VB 5GRVL 4IRSC 5FIEA 4F9LC 3OV6A 4XTRD 2BSTB 4QXTA 5EBMB 4ENEC 1IARB 5DD5H 5CAYB 2DF3A 4TUKL 4JPWH 1KENL 1FIGH 1YYLL 1F90L 3V6BR 3G04B 4NO0D 4X5WA 2EZ0D 1NC4D 4HWBH 3VFSA 1TJIL 1LO5B 3C6SB 4WEMB 1QBLL 5DT1L 5JZ7C 1OL0A 1BREA 4MA7L 1OWRM 2B4CL 3D87B 3TO2A 4UDTB 1AGDA 4KWUA 3VD4A 1DFBH 1U8HA 2D0FA 1MJUL 1IAIL 4RMSA 3LN4B 3IKKA 1NCAH 1HNGA 3P0VL 4PY7B 5F8QC 4QNPE 5EU6B 4JGMA 2NR6D 2BERA 2VLKB 4BSVA 3UPRB 4UTAH 3UPAA 4DN4H 5GRYA 3ARRA 1CLCA 2VXSH 2NY2D 2EDWA 5F89B 4ODWA 5IMOB 2F8OA 3G08B 5FB8B 4L4TE 5FV2A 4F15B 3HI6H 3DO3A 4FQXC 5I1IH 1ZXQA 4LLUA 4AYFA 2R56H 1LO2H 1F5WA 1XH3A 2BDNL 4PTUB 1N6UA 3EYFA 1DQMH 1IL1A 3O6FA 5FUOH 2DI9A 1UWXK 4X99B 1AR2A 1VGKB 4LLQA 3TGXA 3O3AB 1LO4L 4JKWA 3ZT6A 3UAJD 1D5ZB 3THML 5JW4N 4M5YL 2F5AL 2HMIC 1ZLSH 1PLGL 4LVNB 5ISZA 1XGUA 3W0WA 2KBGA 5K93A 5CSZA 1IGMH 1BAFL 4JFFB 4URTB 5E2TH 1HNFA 2LFGA 3AS0A 4CVUA 5J9PA 2DBLL 4QRSA 5DA4A 3GMNA 3LV3B 5EFIB 3BPLC 2FL5B 3BWAA 4XMPL 2B2XL 4C56B 1K8DB 5CINL 4GQPH 4NQEE 1RFDH 1AXTH 3MLUH 3QEUB 5E8OB 2XWJA 2YD9A 5DI8B 4RMRA 3WUWG 1L7TL 3HN3A 3ZKXB 3V6OC 2PO6A 3O41A 3LIZL 1YYLH 3OPZH 4PJGA 4R97B 3U2SA 3B8YA 2XZCH 3FQNB 3CXDL 3RY6C 2N4IA 1UJ3C 4UQ3A 5T1MA 5MENE 1FO0B 2X4SA 1XCTA 5MENA 1AY1H 2VDQL 4HWNA 1K6QL 3EOBA 1A7NL 3L3JA 5AZEL 1XF4A 4ZPTB 2DKUA 5DD0H 1BQHG 4F7PB 2GCYB 3BFOA 4LFHD 1YEIL 5FA3A 4YQXL 2CO6B 3QDMB 1PD6A 4CADB 1GRWA 3TA3D 1OP9A 2R2BA 2MJWA 3PL6C 1MUJA 1VFOA 3G5YA 5EBLB 3EW3B 1A9EB 3BVNA 4M7LT 4JE4B 2FJHB 4PJ9A 3C6LD 4NO5B 5IJKA 3WUWA 1UENA 4JZNB 3QB7C 1QRNE 5EBWA 3SHSA 1FL6B 1I9EA 3IF1A 5ICZB 4XP4L 4LARL 12E8L 4DWHA 5ANME 5E8EB 4FQJH 1P9MC 4FQXB 4PJEF 4DFHA 3KPOB 1JPFA 3Q5YA 1RIVH 1IBGH 2CKBA 3OTTA 3TBWB 3L5WA 1OSPL 2F74A 3HNVL 4HV8B 4XH2A 4AMKH 4J23A 1BWMA 4MVBC 2R4SH 3A6CL 5A16A 4HUWA 3C9NA 3SDAB 1IGML 1T80A 1UG9A 4OQTH 3K80A 5BW7C 2IPUG 1MFBH 3D69A 3RNQA 4XCNA 2YD2A 3QNYA 1KPUB 3R1GH 1SMOA 1A9BB 2B2XH 2MHAA 3PGFH 1EMTH 1BVZA 1G7JB 4OD3H 5I1JL 5JLZA 3EOTL 2HN7B 4OFKA 4PJ7B 1X44A 3MOBL 5C71A 3RVWD 4YBLB 5I30L 4WI7A 4Y1AD 5HHNA 4RGND 2A6JB 3EOYG 5J06A 4XPHL 1QP1A 3MRLB 4JB9H 5EULV 1GH7A 4NQDE 3RWFA 2YC1A 3L7FA 4OZHF 4KK5C 4IRZL 4XPGL 4Z9KB 1BBDL 3MQIA 4TTDC 1NEZA 2GJZB 3L6FA 5K9QG 1BM3L 3VFPB 1I1YB 3FQTA 2W9DL 3KWWA 2QQLL 4LRNH 4Z7UA 1IMHC 1EFQA 2HH0H 4D0DB 4TOYH 1SYSA 4KQ4H 3HC3H 5C2UB 3RDTD 4WY7H 3MRMB 3B9KA 3BAEL 3L3GB 1CLZL 4HJ0C 1KNOA 2Z92B 1KB5A 4NQDA 2V5YA 3FFCD 3MV7A 3PIQB 4NQUA 2C1OB 2CKBH 4U33A 1WCQA 5BW7A 2GJJA 1S7SA 1R0AH 1I7ZA 3WNNA 1X4YA 2ZUXA 2X9XA 1UM5L 3RWDB 3BD4A 4FABH 1EEYA 1LEKB 2NY5L 1EPFA 3D0LB 4LARH 4NCC2 4F57L 3MV9A 4C57C 1BD2B 3DMMD 3AS1A 1E4XI 2VZTA 3SY0B 4PGBA 3ZDXF 3MRNA 3GSRA 4POYA 3ARDA 2ZCKH 1UWXH 2C4FU 4LP5A 2DIBA 4KK6D 4XCYA 3S3PA 4ZNCD 1P9MA 2GTWA 1SJXA 2IAMC 2MPAH 4XB8A 1J8HE 2D31A 2Q86A 5H37H 2X4OB 1JFQH 1AC0A 2EH8L 4NQDB 2KDGA 3MLWH 1HINL 4NKMB 5SWSB 4EOWH 4JPKL 3VGAC 1UCBL 5D7JC 2JKXA 5D1ZA 4LHUA 4PJ9C 1EBAA 5DMGD 5F7YC 4XRCB 4D0DA 1NBYA 4YE4H 5D1ZB 4OCXH 5A2KH 2CIKB 3QIUB 3LDBC 4K7PL 3BEWA 3QDHA 4JANB 4XCEA 1NANI 4Y4FC 3TVMA 3P4OA 2F58L 2XTJB 3QO0A 4O5LH 5FYJL 3BHBB 3MRPA 3NCEB 5A2LH 4OM0L 5FO7A 1KG0A 2Q7YA 4XNZC 1ITBB 2Q8BH 2MQCA 1A3RL 4WHYH 1T6WA 1ZHKA 1FORH 2R2CA 3MLZL 3UTTD 1JYVA 4DKAA 3SY0A 4PREB 1JTTA 2AQ1A 2VDRL 4U05A 4YDJB 2E5EA 3IB4A 5DMGC 3MREA 4MX7A 3RWDA 5GRZA 1BX2B 4JY6B 5FGSA 4GXVH 1U8MB 2IANA 4LVEA 5KVEH 1KJMB 4OKVA 1C5CH 4U6HA 1J8HB 4OZIA 1IEBB 4WFEE 1VACA 2VLLA 1DBML 5I18H 1RJLA 4I3RL 4M43H 1NGXB 1T89A 1D5MB 4GAJL 3MCLH 2R4RH 2FHFA 2EEDA 2VL5A 2HYMA 3HI5L 4PRNB 4ESKA 4NNYA 2X42A 1I1FB 1ZLSL 3C9NB 4YPGA 4G3YH 1E27B 4YPGB 1FDLL 1NFDF 4YHNA 3PHSA 2C3HA 3MYJA 4HS3B 2CDGA 4ORGB 3L5WB 4RMUA 3VFGH 1SYVA 2FWOA 2NXZD 2V9RA 4MA1B 1QFUL 3LMJH 3RI5F 3L7EA 4X6FA 4OCSL 3ZE0E 1IVLA 4FZEH 3O11B 4YUEL 2GKIA 3L3IB 2EDTA 4OTXL 5GGSY 4DW2H 3TYGH 2ZCKL 3OJ2C 4JR9H 2BNUB 1UKTA 4WIQA 4FFWD 4M4RA 1CLYH 4KUZL 5MEQA 1EX0A 5LXGL 2R0KL 1L7TH 3ISWA 5JLZB 5EA0H 4K3EL 5LWYH 5GRUH 2V7HA 4KJPC 1JRHI 3FB6B 4GRLD 4I2XB 4CVXB 1JPGB 2GCYA 3SPVB 5KN5A 3L9RA 2YPLE 3GMOB 1F4HA 3HNTL 1Q9OB 3S4SA 1T3FB 5DA0B 2JCCB 1CXFA 3RFZC 1VADB 1JGEB 3PABA 1FZMB 1S9YB 2NZIA 2Y6SD 3SDAA 4O5LL 4U2YA 2ADJB 3QXVA 4OZ4B 3O8XC 4Q9RH 3MNZA 3D39D 1QKZL 2GQHA 4XTRC 1NDMB 2Z4QA 1MSPA 3QIBD 4MXWL 2PW1A 2AQ3A 3C2SA 2CXKA 4KJPD 3DGGB 3L5IA 4XBGB 4NJ9H 2ZZUT 3NZHH 3T77A 1I3GL 4GRLC 5DI8A 5F9WB 1LE9A 5I66A 1FRGH 4RAUA 1Z9LA 2EZ0C 5DD3L 2ZUUA 3OKNB 3KYOA 1KJ2B 1U8KB 2GI7A 2Y9RT 35C8L 2VJXA 3IDNB 3O2WH 3PWNB 1N8ZA 3MRNB 2Y6SC 5KANG 3BXNB 1N2RA 1NGPH 1PG7X 3ULUC 5MEPB 1SEBA 3OL2A 5CLTA 2A6IB 2I60H 2NR6C 5JIIA 2ADGB 4G80B 4HIJA 1J1OH 2IJ0C 2QADB 2AXFB 5IESH 1EGJH 2MTPA 3NACH 3QIBC 5IB1B 1YDPA 4KUCF 4K9EL 1XF4B 4XX1G 1G0DA 4OFIA 2B1AL 3IRPX 3L3GA 1EHXA 5E6YA 1SQ2N 2ICEA 2VABB 4FQXD 3VFRA 2GTZB 3I84A 5BMFH 1CYGA 5ACLA 1A7RL 2D9CA 2NMSA 4M48L 1SYSB 4OLXL 2EDQA 4Q9QL 1N64L 1OT2A 4CJ1A 1FP5A 1YN6A 4KJQD 2ATPB 1EMTL 4JJ5B 5T1LB 2J6EL 2HFEA 2AJVL 4PYHA 1UM4H 3IU3A 1QRKA 4UAOC 3VG0H 4YEEA 5F89A 4EN3A 3QEUA 4RGOL 3WNKA 1ADQL 3OAUH 4OBSA 5LBSL 3P9WB 2W60B 5K59E 4MZ3A 1CZ8H 1G7MA 1MAMH 1CU4L 2FX7H 4U1LB 3EGSA 3O6FB 4X9IA 3O9WA 2GW5A 4C59B 3LS4L 4GS7C 1I1AA 3QUZB 2CPCA 2R1XA 4OCRL 2UWEA 2D03H 3PWPE 3CDCA 2DD8L 4H25A 4JFDE 5C09A 5TFSL 5F1NA 1QFWH 3KS0J 1F4XL 3VMPA 5ABDE 1ZOXA 4L8SB 4QOKA 3DETD 3KPMB 1DQLL 4PLKD 5DEZA 5E94B 1MCEA 2VLRB 4XPAH 4MJIA 5TE6L 3LKNB 3VH8G 4QXTB 5EBMA 4PY7A 4HCRA 1JK8B 3RVUC 1ZT4A 1JWSB 2VMFA 3GGWA 4XH2B 1M4KA 1S7XB 5D7JA 3T3MF 3QG7H 3MFFA 5C0GA 4HZLA 1P84J 4M1GL 1T04A 4WO4D 3IDIA 2IQAA 1CN4A 1GPOH 4WU7A 1QSEA 5HVFB 5KSVA 4ODVL 1T5XA 2Q20A 4KDWA 5DC4B 4GFTB 3MLXL 3TFKC 4LKXB 4NJAL 5E5RB 1MIMH 4RX4D 2R8SH 2HVKB 2FGWL 3K8LA 5IB5B 1QQDB 3PL6D 4M62H 4GJTB 3ZT5A 3MLPA 2YA1A 5D72H 2Q6WA 4WJ5A 2XZQL 3SBWA 3KPRA 4JPKH 4OF5A 3CZFA 5IR1B 4WO4C 3C5ZB 4J3UA 5D7IA 4X5WB 1AXSB 2OSLA 2HKFL 5E9DD 1IGCL 2BOCB 4BK5A 2I27N 3NA4A 2BOBB 5D1XD 3FT4B 1FBIH 1PQZA 1T6VN 3TFKD 3QHFH 5TF1L 1L9NA 3BMWA 3S6CA 43C9A 4JDVA 3QUYC 3IVKA 1CR9H 1UWGH 1P6FA 5CP3H 2UWEE 3HCVB 1CFQA 1ZGLA 2O5YH 4JO1L 1BZ9A 3WFHB 4MCZA 2ERJC 3ARGB 1AI1L 1RZJH 3MACH 3WJJC 4R9HA 1NC4B 1MPAH 1ZEAL 3GMPB 4Y5XA 4Z8FH 2DJSA 2OMNA 4XNXH 1IFHL 2YPVL 4O02H 1NAMH 4YHLH 1R3HA 3N9GL 3O3UN 3ARFC 4PJ8D 2Y36H 2ZOKA 2DAVA 1N4XH 1A3LH 5JIHA 5LGJB 3L5XL 1H8SA 5J3HD 2Y7QB 4RGNC 3QCTH 3CPLB 1T1XB 3IXTA 3I02A 4HIIB 4KZEH 1LWRA 3NMEA 2P5WA 4LEXL 3DUUA 3GSQB 5J1SC 3H9SD 2H2PC 2A77L 4PJAE 1RZ8B 5LAXB 3QFDA 2AKRB 1DN0B 3QFJE 3WNLA 5DEFA 4I48A 3OF6D 5BXFA 4UB0H 2AJXH 2Z9TA 3OGCA 1INDL 2NY6C 1HILA 5L9DL 4ZO8A 3RTQC 2YRLA 3OR7A 2DQGL 1IKNC 3FO0L 1Q9WA 1VEPA 1Q9WB 2WBJC 2VNCA 1WIOA 4GRWB 4P5TD 4D8PB 2B8OT 1MCWW 5DMIH 4OI7A 3RL1B 4JLRB 5AAMA 1F8TH 1KFAL 4WDIA 5K9KB 4JFFD 4E5XA 3QEQB 1A4JB 1A5FH 3MA7A 3BP4A 5E00B 2IADA 4X7EC 3QRFM 4GRWF 3S88H 3CFJA 1F11B 5JOEA 3DUSB 1J0KA 2R1YB 4YDLB 5TE7L 4JHWL 1AH1A 4Y5XC 3ARXA 3BT2H 4P46B 4PGEB 3VJ6A 3WJJA 3X3FH 1KBGL 1KIQA 4W4NA 1EHNA 1NAMA 4AEHL 4EJ1C 4KDTA 3EO1A 5EC2B 1F4AA 3FONB 1OAUL 3D85A 3QUYB 1F3DH 4N0FA 3QCVL 3CLFL 1T7VA 5EZJA 1EK3A 2GK0A 4DUVA 2D7TH 1B88A 1MFCL 2AW2A 4N5EC 4PJ7E 2AJUH 1H15B 5CJXC 2O5XL 3WJLA 4MCZB 4D94A 5I6XB 2XPGA 3NH7L 5FCSH 3B3IB 3TLRA 2Y1VA 3BO8A 3EYOB 3LQZA 1PZ5B 3L5JA 1WK0A 5FM4A 3S35X 1A1NA 5CLWA 2X7LA 2P8LA 3GZKA 4JQVC 4G6AD 4KRPD 5I15L 1NLBL 3ZDYF 1HHHA 5EN2B 3QO1B 3VG9B 4N0FB 3QO1A 1LE5B 1NCWL 1Z6JT 3G5XA 3OJMB 1YUHB 4OZGB 5BZDA 1EAPB 1U3ZA 4Y16C 1MFDH 3T0BA 1IM3A 3HB3D 5EO1A 3QUXB 2F54D 3WL9B 4N5ED 3N85H 4P2RD 4BQCA 5DHXB 4MXVE 3GSOA 4TULH 3VCLA 5D7IB 1PG7W 4MXVF 1HZHH 1U3HC 4HKZA 3HE7A 4QLRA 5IVXA 5SV4A 1DQQB 1S9XB 3KPQB 4JFXA 3AM8A 3VG0L 3P0GB 4JFEA 3LN5A 4JCLA 1F97A 3H3BC 5GRJH 4DN4L 1UM6H 3BJLA 4G8GB 4OD2B 3BP4B 4JFPA 2I9LB 5DSCA 1QFWM 5AZEH 5GISL 3IXAA 5IGXH 1QNZL 4KKCC 3DUHA 1BFOA 2A6KA 3WIIL 1I1RA 1UVQB 4YDVB 5LQBH 2VKXA 3ARGC 3LEXA 4AEIL 2Q3AA 2V5MA 1GOHA 1LO2L 4KMTL 4QYOA 5GZNC 1ORSA 4O00A 1A4KA 2PCPA 1U3HD 3VXPB 3C87A 3HZVB 2H3NA 1S78C 3GRWH 4PJ7F 3DX7B 1IGFH 3D85B 4BQ6A 2NY0B 3MA9H 3MRRB 1MELA 3ZTNL 4FQ1H 3T2NH 1IGYB 2X4RA 3BKCH 4CNIB 3VJ6B 3PWPA 4PGEA 1CL7I 5I1HH 2FH8A 5J57B 2P24A 4LAJH 1RHHB 5CEZL 4KXZI 3B43A 5HYJB 2ZSVA 3ZMRA 2W1NA 2JIXD 5GZND 3NIDE 3PP3K 2OR7A 3ULUF 1OARH 4IRSA 3FCTA 5D7KE 1JUFA 4JDZB 3QFJB 3O8XD 4APQC 4HLJA 1WBYB 4L8BB 12E8H 5BXFB 1DL7H 4PRIA 1C8PA 1MHCB 1J7VR 1IILE 2CLVA 4O2EA 2FATH 2BP3A 4TNVK 1OM3H 4Y7MA 2KQNA 3OKMB 4JFHE 5MP6L 2P47B 1CFNA 3EIFA 4KI5C 3UBXI 4EN3B 8CGTA 4RNRB 3VW3H 4ZOBA 4RGMC 2OTPA 4Y5YC 2R4SL 2NXYC 3B2VL 2VXTH 3AU1A 2YD5A 4IM8A 5IHUL 4IHOA 3C08L 4ODSL 1BEYH 1GOGA 1KXVC 4K3JL 1K8IA 2EICA 2DQDL 4RSVA 4PTTB 5TDPA 1XZ0B 4IMKC 1DN0A 1IC4L 5ID1B 1PY4A 4DKEH 4LCWB 1LK2A 4Q7DA 2JJSA 1G7QA 5I75C 5FK9A 4U3HA 3J8F7 1JNJA 1ES0A 1NKRA 4JFOA 3QP3A 4RWYH 4NNXA 5IGXL 4OT1L 1K4CA 2VZOA 3TV3L 5F44A 3V5KA 4MD0B 5B3NA 1W0WA 4JRXB 4AK1A 1AI1H 1RZJL 4KJQC 2X89D 2R29H 3ULVH 4LCUA 2EDNA 3IFPA 3RZCA 2IC2A 4R97C 5DJZA 1GC1H 2ID5A 2VXVL 4FS0A 5I1GL 2IQ9L 4LU5L 4JHAL 1BBDH 3KPPA 1C5DA 3SCMB 5ALCL 4PRBA 4UNTA 3O2VL 3QDME 3MA9L 1P84K 5JMRA 3OKOB 3EYSH 5E5UB 5F7EL 3T2QA 4AMKL 2ZOLB 3NFNA 4YXLL 5GGTH 2IH1A 1A7PH 3BP5B 3JWDL 5F1KC 5CMAA 3KPSD 4OIAA 2AABH 1NEZG 5GJSH 3GGWB 1YMMB 3TT3L 3GMRA 4F8QA 3RIAF 4DJMA 3LQMA 1QG3A 1I7UA 4PGCA 1WC7B 1IC7L 7CGTA 1YECH 5M94B 1CQYA 5EOTA 3CH1B 4GSDH 3NA9L 4WU7B 5I8OL 4POUB 4G43A 5A2FA 3BGMB 4NT6A 3MFFB 1J0ZA 2EE2A 3O9WB 2QSQA 4RFEA 1MRDH 3TA3B 4EUPB 1FVDB 2VTFA 3VXTB 2J5LC 1P4BH 5TE4H 4CDGC 1FH5H 2YS4A 5AEAA 5JO5B 1LNUB 1JGUL 3IDYB 4N1CA 3O6LH 2GAZB 4N0RA 4MQ7B 4OQ1A 3HRZA 3SE9H 1HIMH 2YD8A 5EORH 3W39B 3WNOA 1UQSB 2YBRA 3BYYA 2DDQH 4EI5B 2F58H 3OX8B 1REIA 5L8KB 4PRDB 3Q6GL 4PJ5D 1J87A 2VKWA 3MRHB 5AG9A 2W07A 5HVHC 1UADC 3MRHA 4M1DH 5FO9A 4G6FB 3CVIH 5E08H 1T22A 1UZ6F 4R6UA 1SBSH 5J4MA 1EJOH 1KB9K 3CLFH 2JIXA 3EYQC 4ODUA 5D7LD 4CW1B 4F7EA 2XWBB 5IWLA 4PJCA 3BZEA 2JCCF 1HDMB 4IS6B 4JO3L 3E1F1 4ZO9A 3KYKL 4P5KB 2XNAA 2IH3B 4FFVC 4X6BB 5GGRB 2A6IA 4LGSB 3I9GL 4LCWD 2J6EA 1JGVH 5D5MF 3QUYD 1PVHA 4FFZL 3FT2A 2AJSH 2YUVA 2V17H 4PREA 2EH8H 4QRTB 5ETUB 4NRZB 1NLBH 3UC0H 4EN3C 1JE6A 4TSCH 5C6TH 3MJ6A 4M61A 4F8TA 4TPRH 5SX4H 4K3HA 3DX8A 5DJXA 3HFML 3ZHDA 5L8LB 4G9FB 2AXFA 2ZUVA 4YHOH 3JXAA 3S9DB 2RCSL 1IC7H 1MH5B 4XRCA 3HNTH 4TNVF 5E2UL 3GMRB 2DRUA 1J5OH 3V7AG 5J3HC 3U9UB 4Z76A 1WBXA 3CJJA 5FYLE 1D9KB 3U7YH 2VABA 2DBJA 3PWNA 1F6LL 1JNLH 4ODXA 1YYML 4W70A 5IQ9A 2FR4B 4QRPD 1JZ8A 1LE9B 2NW2B 4J3OC 3K1DA 4RBPK 2H2PD 4X6CB 4ZUSB 1F4WH 4UV7H 4HUXA 3KPTA 5D1QA 4M6AA 4PV9B 5E8PB 4IOFD 1J05A 3GSNB 3MV8B 4OLZH 2XTJE 5C0JB 3QUMH 4V2BA 5FHBH 2SEBB 2FD6L 3SCMC 4LVHC 2NPLX 2IPTL 1IGJB 4YXHL 3PABB 2F53D 2F5BL 4YBQD 3LRSA 2EIEA 1BIIA 4NPYB 3G6JA 3VE0B 3TO4B 1MJUH 3T1WA 4E41E 4M8QB 2H41A 4ZQKA 4ONFL 1H3PL 4FQQA 4KJWC 3QDJE 4OKDA 4XNZB 3QXDA 3X3GL 4MYWB 3IFLH 4UU9B 1IAOB 5KAQG 4Y5VC 1D5BA 4IOFC 1PSKH 3P73B 1KTDB 3FN0H 1E27A 3MNVB 5DTFB 4LMQI 5J6HB 3FN3A 4QHMB 15C8H 3V6ZA 4D9QE 3D85D 3WNMA 3DVIA 4HC1L 4L5FH 4P57B 4YFDB 3TYGL 2OJEA 4G6JL 4JQVA 5JHLH 5D7IF 5D6DA 5GS1B 3PGCB 1BQUA 3BUYA 5ADOL 2CR6A 2V17L 3V0VA 5F72S 3LPGA 1F2XK 1PYWA 1IKFL 5DC0A 3U46A 2JJVA 3H9YA 4BZ1H 1G9EA 1JWMB 1VERA 4C54A 1U36A 5H37G 2GJ6E 3WXWL 5IHUH 3KXFE 3H9SE 4K7FB 5HHVL 3T09A 4MA3B 3IDXH 2XFXB 3EFDH 4XGZA 5ADPL 3MJ9L 4PGDA 3DROB 2BVEA 1Q1JH 2PW2B 1IC4H 2LVCA 2PW2A 2VLMD 1UWEH 3TPKA 1J8HA 4P5TA 5MERA 3B9DA 4XP5L 1A22B 2UZXB 1N59B 1WIPA 1VFMA 1S7TB 4MAYA 2VOTA 5GS0D 5IW6A 4HIEA 1Q9KA 3MLUL 1JRHH 1FL3A 4YPJA 4FNLL 1QR4A 5FOBB 5DYOB 1G9ML 4RDQG 3TV3H 4CN6A 1EFXD 5E8PA 4WWKB 1S3KH 3KPOA 1WWCA 1MAML 2PETA 1A0QL 1YA5A 1UH4A 3JTTA 3W82A 3CXDH 1FL6A 2W59A 4XCYB 3CX5K 1LHZA 5DK2B 2F53A 1S7RB 1FG9C 4WI4A 4P59H 4AJ0A 2EDHA 5C0CB 5DSCB 1FN4A 3CSBA 2NY5C 4I3SL 1PEWA 4MQSB 5HHXL 5J12C 5A2IH 1BOYA 2B1AH 3DHMA 1FZKA 1KCRH 3DRTA 3ARGD 4FQQB 4POZC 5BJTA 4HWZB 5T3XL 4HKZB 5IEKB 5DUPH 3MR9A 1XCTB 1OT1A 4PJHE 15C8L 3QXWA 1DQDH 3VWKA 1MF2H 3BZ4B 2VLKE 3GSUB 4R0LB 3GSRB 1ZTXH 4M1GH 1XAUA 1S78D 4YGAB 5EB9A 5E2WH 1GL4B 5JPNB 3PNWA 5J89A 3U30C 1PW3A 3VGGA 1NEZB 2NW3A 3U9PL 4U1JB 1LDPL 1LO3L 5B38G 5EH1A 3JWOL 5I1DA 3QIBB 4POZD 2VQTA 1MWAA 1L0YA 4I9WE 4PJXF 2K7PA 4MAUH 1ZVHA 1NCNA 4OQTL 1FH5L 3OXRB 1AQDA 3K0WA 1Z0MA 5JXAH 2VDKL 1Q1JL 4W4OA 3BWAB 1TJGL 3IDGA 4JO1H 4UINL 3D2UB 3CH8A 4XP1H 2GFBA 2HTKD 5JORB 1DQJB 1FNSH 1LEIB 1N59A 4G9FA 3DXAB 4BZYA 2PR4H 2XOTA 4RX4A 1BBJA 4PJDE 1DANU 5K33A 2DLHA 2Y07L 2P42B 3B9KC 2H1PL 5H2BA 5D7LA 4X4XB 5GSVA 3O4LE 4M9PA 2YRPA 5SWQB 3DI3B 3QPQC 2DIAA 3DRQB 5I8EA 2BY1A 2DWDA 4YBLC 5DVLA 4XHJC 3LKOA 2Q1EA 2VYRE 2EEAA 1G7IB 4J3VA 3MLXH 3MBED 4HHAB 2PYFB 4XAKE 1AIFA 1RIHL 3BGMA 2VLRE 1MIML 1TVHB 2J4WH 3BPCB 4YHLL 5IM7B 4KKNA 3FQUA 2X09A 3BH9A 4Q6IA 1R3KB 4GXUM 1FLRH 1I75A 5KJRL 3L3OA 2W91A 5T3ZD 4LLYA 4XNYH 3T8XA 4HXAH 3GBNL 2FJHA 4PJ9B 4ZSOB 4KZEL 3FO0H 5GZOC 1HILB 4L1HA 5EBLA 2CRMA 2HN7A 3IDUA 3G6DH 3HLAA 1G7JA 3GNML 3O9WD 1A7QL 4OGYL 2CKBB 1DVFD 5FGRA 5CEXB 4JQIH 2XN9B 3B2UD 4I48B 2BVPA 3MBEC 3QPXL 5FUCE 1HEZB 2X4SB 1IC1A 4GG8B 1YEKH 4F37F 4QT5A 2C3XA 1LO0H 4LSRH 1ULVA 3RNKA 1KIRB 3BW9B 1NUGA 3MOAH 2A0LC 4YK4C 5F9AC 1FNEB 4L3EB 3SE4A 4RDQF 4HGWA 4LLVA 5I1LB 1JIBA 2DJ4A 4DZ8B 1OAKH 4Z7VA 1HINH 3V5DA 4GKNA 3UROR 4HD9A 4HPOH 2ATKA 3UBXB 1DVFC 1AGCA 1T20B 5T1KB 1BQLL 3JTSB 5IQ9B 4OZIF 2FR4A 5ICZA 2X4NA 1JTPA 5DRXB 1U3YA 3CFEA 1HXMB 3MBXL 4X5XB 4GW5B 5CZXC 5CEZE 2CLRB 3HC0B 4LSQL 3KHOA 1A3LL 1G7QB 1OB1B 3NFPA 5FYJH 1IAII 4OLYL 4Z78B 2EXYC 3WIFB 1RUAL 3BP7A 1G6RB 1X5ZA 3I50L 3NFNB 3FB7A 2WSKA 5DJXB 2AXHA 2R0WL 5IB3B 3F7VA 3QR2A 5TQ0H 1PQZB 4HUMB 1UJ3A 4PJHA 5T1MB 4D3CH 2N1KA 5DJ6B 3ET9F 2DQCH 4WENB 4X5XA 1FNLA 2O5ZH 2LAGB 4P99A 2NTFB 2GUOB 1JZ3A 3PDGA 1G7HA 3IFOA 3VXMB 4RA3A 2APVA 5CD5C 1CFSA 4H26A 2CLVB 4ZTOL 1TXKA 1AE6H 2Z8WC 4XMKH 3QI9D 2WINB 2VDOL 2R4RL 3GMQB 2XNAB 4CU7A 4HG4J 4Z7UE 4E42A 3VD9A 3U48A 4GRWH 5JIPA 5D7IE 4DZ8A 1IKFH 4NWUH 4P23D 4XCCL 5EUOE 4F7CA 1KJ3L 4PJAB 1N0XH 3DI2B 1KEGL 3U0PB 3EYQD 5C2BL 2F9BT 3ULVE 2APTA 2JIXB 2QQKH 3QDJD 4DAGH 4LP4A 3RKDC 3NGBC 2P7TA 1D5ZA 3FJTA 3N1PC 3FQXA 3BWUC 5DD1L 4YDIH 1XF1A 3WIIH 1AC6A 5CUSH 5ID1A 1NMAH 4QRQA 5IBLD 5TH2A 4MB5A 3CXHJ 3VA6A 4XNUH 2YPKA 2XN9A 4XP9L 1U8HB 3ZHKA 4ETYA 4DW2L 3PQYB 4PRID 1YJDH 4U6VH 5HDBE 5CJ5A 3NZ8A 2XG5A 3N1FC 2VC2L 3G9VA 3CNKA 1J1XH 3H3PH 4X9HA 1MVUB 1YNLH 3P11H 3C60B 1WWBX 4B0MM 2IMNA 4KKBC 1ZT1A 2XTLA 2HT4D 5I0DA 4GG6B 3RUGF 1FVDA 3PWPD 4U1GB 5DVOA 4UTAL 1T1YA 1J10A 5EZLA 2D7OA 1HKFA 2PF6A 4ODHL 2XN9D 2I9LA 1OTUC 3PJSA 1G9MC 1W72B 3MBXH 1M7IB 1AGDB 4MJ5A 4DTGL 4NRYA 2BSSB 1P69B 4N0UE 4TUJB 5SWSE 3PWJA 4OFDA 1FE8L 1AGEA 2ZSVB 1MRFH 3VCLB 1H3WM 3QDJA 3ARWA 2R56L 2NTFA 2NY4D 2BDNH 3F65A 2VQUA 2VR9A 3QQ4A 5D5ME 4JDTH 5E6ID 5J1AA 3UPRA 2DQUH 3GJEA 1MEXH 2FYYA 1R5IA 1Q38A 4YWGL 5ESQB 2DWEB 2IMMA 4WCYH 2BHZA 3VD3A 1OPGL 5KBNC 5KVGH 2OS7A 4PG2A 1OTUD 3WIFA 3SCMD 1YEJL 1A6TB 2H6PA 3QG6B 1MREH 4BSWB 2GY7B 4JFED 3U83A 1XT5A 1ZWIA 4QYOB 1MFNA 4G7VH 1ZANH 4B5EA 1KJVB 1NLDL 4ZG1A 2HP4A 1P5VA 2NY4C 4PJIF 1TZIA 4JY4A 2WAHA 1PBYA 3NACL 3JWOH 4I8DA 4XCCH 4LRIA 2VITA 3HR6A 2ATKB 2WINA 3GMQA 4JM2B 1VFAB 3FL7A 4PRHD 4QCIB 2BSED 3VI3E 3C6LC 4LF3B 5DS8A 4GAFB 3IFOB 3QHTC 1MCDA 1JPSL 4XNUL 4FFYH 1D6EA 3ULUH 4L4TD 1PY9A 1CGXA 4WI3A 5IHZA 2AJVH 5E7BA 2EIBA 3T77B 1LK2B 3FB7B 4HT1L 3ME0A 4GW1B 2Q3ZA 2Y07H 2AEPL 2G5RA 4WHTA 4OFPA 4U0QB 5EN2A 1MCOH 4Z0XA 1SMAA 5IFAL 4PJFF 1OQXA 1LGVA 5BO1L 3O6KH 4NKIH 3MV9D 1A1NB 4RWYL 4MVBD 1M05A 3PHQA 5JMOC 3QULA 1EEZB 4LKCB 4LPTA 3MV7D 3C60C 2BK8A 1R3JB 3KAAA 5GJSL 2JCCA 1NGYB 1S9KC 2IGFH 4PJFB 1HKLH 4F2MB 5FUOL 3OR7B 5IM7A 5TFSH 2J8UE 1DVFA 4CU6A 1AIFB 4DQOH 1A6AB 2G2RB 2OJZL 1WEJL 5I74B 4JDZA 1KPVA 3H8NA 3HS0A 1FQ9C 1TQCB 4GSDL 3VMNA 5CJOH 4NKDB 3RVWC 5CBEB 3K7UA 2DMCA 4GW4B 4ZYKB 3C5ZC 1A7PL 3FO2B 3RIFF 4CN4A 1BGXH 2G75B 3BZDA 5D7LB 5GSVB 2I9TA 2G75A 1Z0NA 4G42B 5BQ7B 1NDGB 3CSPA 5J13C 2F8XC 3K4AA 1UGNA 3ZDZE 1U58A 4IRJA 3MBEA 3QPXH 2CJUH 2J8UA 4GMTH 4XAWH 2C1PB 5DMYA 4PGDB 1YQ2A 1DN2A 5GRVK 1C7SA 2OR9L 2C4XA 1F90H 5I1CH 5BS0D 5I73C 1HIML 1BD2E 2V7NB 2FGWH 5HYSG 3ZDYE 3JV0A 3PGFL 1LQSR 1NH6A 1AFVL 3C5ZD 4ONGH 3SDXB 3AFLA 2OTWA 5I1JH 3AY4C 3S8WA 3UEZA 2DLTA 4QRRB 3FQUB 2XA8L 3OZ9L 5GGVY 2VE6B 3QQNA 1DEEA 4G9FD 5MHSE 1I8KB 3WEXA 3U0WH 2VXVH 4WUKL 5E1HB 1JPSH 3SDXF 4DFIA 4U1HB 1SBSL 5BRZA 1TQBB 2YXFA 1GGUA 2ZJSL 4ERSL 1MCKA 4G8FA 4KFZC 2D0HA 2IANE 1H5BB 2ARJQ 1FGNL 25C8H 4WFHD 5EU7E 3D0VA 3BZ4A 4KK6C 2H9GA 4WI9A 4U2ZA 4FFZH 1KCSH 1YY8B 5FO7B 4E41D 1T1XA 1D5XB 3TT3H 2GIYA 3BHBA 4NC1E 4JFZL 2UY6A 4PIRF 3T2PA 1ED3A 4ZS7H 2VSCA 3KPRB 1YEDA 1CLZH 5IW1B 2W0PA 4YHIA 5EU4A 5KSAD 5JORA 4PJ9D 4Z7WE 3GM0A 4W4OC 5IB5A 2W38A 3TO4D 5DJ2B 1YN7B 2RB8A 2F53B 3CX2A 1KN2H 3BDYL 3K8MA 3VFWA 2EIZA 1T21B 4J4PD 4PB0H 4F3FA 4P9HH 3EYVB 5IB4A 1ZWIB 3GO1L 4GAGH 5E9DB 2YMXH 3QPQD 4JFDB 1JGDB 4NFDA 3HAEA 4GLRH 3RY4A 1YYMH 4LEXH 1D9KA 4W81A 1S7XA 2DWEA 1B0GB 1FO0H 5IMKB 3JWDC 3MLWL 5CUSL 1JPTL 1NMAL 2AI0L 3D0LA 2IFGA 4GMTL 2RFXA 3ZTJH 2NY7H 3FTGA 4XI5C 1FVEB 1OAQH 5TPWH 4P46C 2Z93B 3NABL 3MOQA 4L8SA 4ZFOL 3C5ZA 3RUGA 3DECA 5JNYA 1UKQA 2Y5EA 3LEVH 3WE6A 1FZKB 4WJ5B 4M9OA 4QRTA 3I2CH 3SDCD 2EH7L 2FJGB 3O9WC 4YO0B 3TESA 2XA3A 3PQYD 4WW2C 4LCIL 4Y4FB 1L4IA 1SVZA 4FMKA 1GGCH 3TJHC 3AS3A 1PYWB 1BOGA 4ISVB 2BVUA 1J8HD 4YAQB 3EDJA 1YJDC 2DQTH 4J3WA 4OLZL 2EDXA 3VXUB 3W0WD 2XKNA 1BM3H 5TDNA 4H8WL 1A7OL 5FM8A 2YC1B 3L7FB 5F6IC 4LVNC 2YUXA 5B38A 1T04B 4HUKB 4QHLA 1ETZB 5C09D 2GT9B 5F7NC 2K1MA 3FO9A 3C09B 5C6PB 5IMMA 4F33A 4PJBA 4AIZB 3B9EA 3IU4H 4HPYL 4YDKL 2R9HC 1RZ7L 4JM4L 2VZ3A 3K4ZA 1YEGL 3O6FD 3MCLL 4YZFF 3HG1D 1R6VA 1FIEA 3IFLL 1BAFH 1CXEA 1CDUA 4HWEH 4UNVA 2Q7NA 4Y1AB 5HGHA 1PKQE 1KPUA 5GPRA 1INEL 1Q9LA 5CZXD 3IXTB 2H32B 3VE0A 2FJFB 3IDXL 2CO7B 2VLRD 4OFYA 1V3MA 5JHDB 1UWEL 3VRIB 4G9DA 3RIAK 2R9HD 4OSUH 3SEPA 2Y72A 1JFQL 4NYLA 2IFFH 3FHAA 3NCMA 5HGAB 2AGJL 1X5HA 4QXGH 3JV5A 3O3BB 3LH2L 4FP8H 2VXUH 4V1DB 5D6DC 4EUPH 3PGCA 4L8DA 4QTHA 4QRRE 1TPXB 3TWCL 4F7TB 5C8JB 5DFTA 4OCXL 2KKQA 3OKEA 5CD5D 1AJ7L 3VXRB 3GJFB 2EO1A 4ONOA 2NY0C 3B8SA 4PJEA 3BI9X 2EDDA 3PL6B 1A0QH 3BIAX 3ECBA 4RAHA 4K8RD 1JMZA 3AVEA 3Q5TA 4XWOC 4RMVA 3QH3B 1ADQA 1Q72H 4ENED 5C0IB 1YPZA 4KVCH 3MLSL 1A1MB 3GMOA 3BGAA 4FQCL 4R26H 3NPSC 2VDRH 1TZHA 3UBXA 5I0ZA 5IBLC 5F96H 5E4IA 9CGTA 2OTUA 4M1CC 3V5DB 1C5DB 3SCMA 3GSXA 4Y88A 3SDDC 5JZ7D 4XPBH 3REVB 5ID0B 5C0ND 4NSKB 5ID0A 4L3EA 1CGYA 3REVA 3UZVB 2VWEE 4H0HB 5SX5K 2YZ8A 2CKNA 4OUUA 3GRWL 2IG2L 3ARBD 1IEAA 1HSAA 1XR9B 2BVYA 1TZHB 2J8UF 5E6IA 5D9SB 3ROOA 1UFUA 1UCTA 1E4JA 3T4YB 3QUXD 1YNTB 1HYSC 4BZ1L 2HT4C 1PG7H 2PKDA 1B6UA 5E03A 1B4JL 4PRPB 1KCRL 3MLTA 4I0KA 1L9MA 3OKDA 1VCAA 3VWJC 2ADJA 5T3XH 3TIEB 1K5NB 1VFBA 1XF5B 3LKNA 4DEPB 4UT9L 4EOWL 2WIMA 5FYJD 5D6CB 3VRLF 1IGIL 4H5SA 4PD4K 1ETZA 4OUOA 4TVPE 2XV6B 4XVUD 5HHQA 4Q9QH 4DGYL 4HFUL 4U6HB 2FATL 3GI8L 2FEEI 1HYSD 4OFVA 4CMHC 5I30H 4ONGL 4KVNL 1T1WA 2DQFB 3TN0B 1NFIB 2ZKHH 3ULVF 5JXED 3PUCA 1NKOA 3RI5K 3OZ9H 1NBZA 4G9DB 3PP4L 4FG6D 1MHCA 2MKLC 3B2VH 2X4PB 1ADQH 4OZFA 3TWCH 3L3HA 3QFJA 5ICXA 2BC4A 4N1EA 4CU8A 1KGCD 2AV7A 2VDKH 4B7LA 1I9IL 5L0QC 5DUBB 3IU3B 4N90E 2AVGA 2ESVE 2W9DH 2QQLH 5SV3A 3PG2A 4X6FB 3SKMA 5HYJA 1T22B 3HC3L 4YHKH 1FGNH 1RHHA 4L4VA 3OAYK 4WY7L 1Q72L 2FB4L 4WW1A 1LEIA 1C5CL 5JXEC 1F3JA 2H26B 4OGXL 2CK0L 2WUBL 4MJ4A 4N68A 3MRRA 5DDHB 3D39E 1LDSA 2NX5A 2W92A 2O61A 4BQ9A 4HJJH 1NBVL 4HIHB 3BP5A 1B2WL 4LCCC 1RJLB 4WWKC 4MJ6B 3UTTA 2VH5H 1I85C 3MUY1 4OZIB 1VKXB 2IAMB 4JY5L 3T4YA 1NGPL 5T3XD 4XVJL 1BX2A 5I1AA 3WXVL 5L88L 2KPNA 1CICB 5F7WC 3BXNA 3TA3C 4NSKA 2F8VA 1B6DA 1N5AA 4OF7A 5D96B 1FL5B 3ES6A 4OTXH 2YMXL 2WM0A 3DX6A 2Y5TB 2BJMH 4MAUL 4L3AA 5BOZG 4JFDA 3FQRA 5B39B 2N56A 3LHPH 5I8KH 4WWKD 1YMHB 5JXAL 2PTVA 1JF5A 3EYVA 2ED8A 2YD7A 2V2TB 4R8WH 3IJHB 1T1ZB 3CC5A 4UT9H 1ZVYA 4KDVA 5IBUG 5JIKA 4RGMB 3MRGA 3TJEH 3VWJB 2B7DT 3X17A 5DHYA 3TNNA 5HVHB 4ZFGL 5CMAB 4G6KH 1A3RH 5DK2A 4LSRL 2EDOA 4PTTA 5D2LB 1XIWD 3BE1L 4X80L 1TTFA 3PDOA 4RRPA 5CZKA 4EDXB 5IBTL 1JNHA 1KXQE 3M8OH 1II4E 2ZPKH 4K8RH 5CHNB 5KOMC 3MRLA 2APBA 1V8HA 3ULSA 5AYUH 3WNPA 4PR5A 1C7TA 4P2OA 4NO0B 4PUBH 2A38A 2YEZA 1NC2D 5F88B 4YC2B 3RDTA 2XKUA 5IK3B 4U6XB 1MHEA 1T0MB 4GAJH 3SOBH 3TCLB 4LSQH 3QA3B 2DLFH 2W0KA 5L6YH 3TZVA 5JDSB 1CDHA 3ARVA 4U6YA 4BA8A 1RUPH 4IRSB 1OQOA 1WVZA 3S36X 1IC5L 4HXAL 3TN0D 2WBKA 4QOKE 5ANMB 3E8UL 2J88H 1J1OL 4D9RD 5IESL 3KYNA 3MYJB 4HS3A 1EBPA 4LIQH 3QIWC 4KRMB 4P2YA 4DOHB 1FYTE 2AP2A 1MOEA 1A6ZB 3EDEA 2UWEF 4EEEA 2HJLB 2V2XA 3W5NA 4GMSH 1I1YA 1U92A 4MCYB 4P3DB 3HZKA 4HV8A 4HKBA 1JF6A 5FM5M 4ODVH 5SWZE 3V7MA 2A9ML 5CBAA 2JK5B 5TQ2H 1KCUL 4IHOB 2QSVA 1DEEB 3O4OB 2B0SL 2E6PA 5INDB 4WTZG 2MQ0A 1IEHA 5D2NB 1OOAA 3RX8A 2AGJH 2FCBA 1U8MA 2QL1A 1T2QH 1WZ1L 1HOCB 4KTEL 1UACL 1CLOH 4BUHA 4NM8H 3ZTJG 3FO2A 4EIGB 2F54E 1K3ZA 1G1CA 4CBPA 2DQGH 4JFYB 1OGAB 3DYMA 3F12B 1HHIA 3RPIB 2HKFH 1IAOA 3ARUA 3DMMC 5DMIL 2P5ED 3UTTE 2DN7A 2VZUA 3CSYB 3RTQB 3SGJA 4YDIL 1W8NA 4ZPTA 3MBEB 3VXSE 4C56D 4W6XB 4F2MA 3QWQB 3E3QC 1TETL 2IAMD 1SEQL 5IVZB 3HMXH 4G6ML 2BMKA 4KROB 2DD8H 2RQ8A 4WFHE 5C08E 3S5LA 1A1OA 4ZYKA 4X7SH 1JYXA 2IBBA 4R96A 1OSZA 3WFBH 3OJDA 2EKJA 4LLWA 5E1AA 3K2UH 4CN1A 3DBXB 3HE7D 2OP4H 4NWTL 1INQA 1XMWA 1Q0YH 4Y16D 1YQVH 2DOCA 3HB3C 1S9VA 3GMPA 4Y5XB 1IFHH 2YPVH 5JW5B 4PLJC 5TF0A 1AE6L 3ARGA 1YEJH 2IPTH 5AWNL 1MCPL 1EEZA 5HI4C 2FEDD 1LP9B 5KVDL 1BD2A 3G5VA 2YWZA 1R3IH 4AQ1B 3ZKXC 1QFPA 2ARJA 1NLDH 3PHOB 4OD2A 5J6GA 3X3GH 4JDTL 1ORQB 2R1WA 2CDFA 2CRIA 4LVOB 5J0BA 5J9PB 3WFDL 2ZP0T 1UKSA 1HSBB 4PJGF 1A47A 2R23B 4YHYC 2JJTA 4HBCH 3FT3A 2ORBL 4PS4H 4DGIL 1D6EB 2VUOA 4XP9H 1EO5A 4PLJD 4R3SA 2DTML 3ZYIA 1GVIA 4J8RA 4Y5VB 4PP1D 1EFXA 3FO1A 3QIWB 2ZUWA 4P4RA 3RQ3A 2DI8A 2FEDC 5C07D 4G7VL 4G8FB 3IETA 4BM7A 3V8CA 3ULUL 3O6FC 3HAEG 2FIKB 4FTVA 3DARA 4NBYB 5DHVH 2HWZL 2CR3A 2Z31D 3UJIH 4K94H 1F02I 2NXZC 4LQFH 2HVKA 3S34L 2A9NL 3GJEB 4XZUA 4LSPH 4GKZA 4KZDH 4ZOCA 5BO1H 3UTZA 4J2XA 4KV5F 3LPWA 4PP1C 2FZ3A 2F53E 1N26A 5C08A 1I8IA 2IQAB 2A74A 1QFWL 1L6ZA 3UMTA 2HFGL 3LV3A 3MACL 1CL7L 1KV3A 4P48A 3LS5H 4EI5A 1MPAL 1ZEAH 4PRAA 4JFFA 1C12B 4KMLB 5L2KD 5ALBH 3QNYB 3VRJA 1KLGA 5E4EB 2J8UB 4WFED 1U8IA 2VIRA 4JFQB 1H3GA 1KIQB 1WGOA 3JV6B 1WV7T 1O5DT 1NBQA 1CWVA 1KACB 1TCRB 3T2OA 4G42A 5BQ7A 1OSPH 1HYRC 1HQ4B 5CJOL 2NY4B 2DICA 4DVRH 4H25B 1C12A 3SGJC 1KCLA 4X7FC 3VXOB 5DVNA 1N7ML 1MFBL 2C5DC 2UZIH 1QA9B 1VESA 1CE1L 1OAXH 1KUMA 1WZKA 4P59L 4I77L 3INUL 3M17B 2GUOA 1GAFH 1NGYA 5T5FL 1Y0LB 2C3VA 5BVJB 1I7UB 4D0BB 5D2NE 1BLNB 3E3QE 4DVBA 1D6VL 3R8QA 1ZGLB 3AMLA 1G0YR 3H42H 3WMSA 4UDTA 1I4FA 1TVBA 1CF8L 2XA8H 1Q94A 3W11D 1PKQA 2Y4SA 1Z2KA 2QQNH 5CKAA 3ARBC 3C08H 4ODSH 5LAXA 2YK1H 2XXCB 1I3VA 4QRPA 3L3KA 3MFGB 2GTZA 4X8JB 4J3SA 5EUKA 5FDWB 4XXDB 4L29B 3C8HA 4XXDA 3CLEL 3KPLA 3F7VB 4LRNL 2B1HL 2HKHL 3E6HA 4K94L 4PJAA 4TUOB 3UCRA 5DS8B 2HRLA 4PJXB 5TE7H 3VWJD 1PKQB 3C2AL 3LY6A 4HIJB 4H0IA 1MVFA 5FFLA 3VD5A 1BFSA 4H26B 5EIIB 1LP9A 1OB1A 4IEFB 1MNUL 3KPRE 4XXCC 4M02A 5C3LD 2AK4E 2FDBP 3C5JA 4E41B 5JW5A 3SOBL 2IALA 3ELAT 4RAUB 3MRIA 3M17A 5JW4M 2WQ8A 1Z9MA 2EE3A 3KPRD 1CT8B 5D71L 3V4PH 5IQ7H 2BNQB 4FQ2H 2FL5A 4Q58C 3MXVL 4JVWA 1D7FA 1K8IB 5D7JB 5CGMA 1EZVY 2XACC 4HK3N 4MLSA 3O2DL 5CP3A 1AQKH 3MODH 3BKJL 5HHOA 3VDAA 4UB0L 3QJFA 5KS9B 1BFVL 4YIQA 5JQ6H 3LAFA 5T1KA 1JF1A 4PLKC 4BUGA 2DL9A 2DM3A 3ARQA 4OF6A 3RJDA 3VRJB 3GI9L 1Q94B 1U95A 2EEBA 4LPCA 5ITBL 3MGTA 4KTYA 4R0LC 4AM0B 5DQ9B 4U7SA 1DLFL 5EUOF 4P9HC 2DYPD 1TQBC 3QIUD 1IAKA 3HG1B 3NIGE 4HK0A 4X4ME 5FB8A 1RZFL 1IGTA 2MCG1 1EO7A 4QOKD 3UTZB 3MJ7B 2EH7H 5F93C 1KC5L 4Y4HB 4QGYA 4UIMA 2FBOJ 4JFEE 4L4JA 5GSRA 5FYJE 2YK1L 2A6DB 1DSFL 1VB9A 2DQTL 3V5HB 3HZKB 2D9QB 4XVSH 2V9TA 2J5LB 3C6SA 4WI6A 3DRQA 4XPFL 5I8EB 5IJVB 3H7BB 3QIUC 3A0OA 3FO1B 3KYNB 4NNYB 1XGPB 2HRPH 1OGTA 4EN3D 1KSRA 2ICEB 5ANMA 4NZUH 3UJJL 1I7TB 4MNHB 5GGVH 3GUTB 3LZFH 2OP4L 2VIRB 4NWTH 4XT1C 1S5HA 3ZTNH 4FQ1L 3ARED 3BDXA 5IB2B 1C08A 4ORZC 3HPJB 1KCVH 3UDWC 4PLOB 4L4VE 2ICCA 5ICYB 4KKAD 2XWTB 5A2JH 1Z9OA 3QUZA 4Z95H 4AH2B 4LHUG 2ADGA 5FYJU 5C0FA 2FIKA 3KPSA 1TENA 1MJJB 5JR1L 3SE8H 2I25N 4HSQA 3WHXA 2EDKA 1X4ZA 3EYSL 1UB5A 3NAAH 4A2MA 4KQ3L 2CK2A 2W60A 2Y06L 5C9JA 5GGTL 2QSTA 2GK2A 2QSCH 1QSFE 1BFTA 1H8OA 4J8RB 4XCFL 2IPUK 5K9JL 1V05A 4QHKJ 5BZWB 1KG0B 5HPOA 5DQJA 1LO4H 4Z7WB 1I9JL 2R0KH 1F58L 1HSBA 3MRQB 4M6NH 3HNSL 3TVMB 5T1LA 2VXUL 5GGSA 4X98B 1GZQB 2HFFB 2Z4QB 1FJ1B 1MFEH 4MNGB 5DK3A 2QBWA 3ARFD 4PJ8C 3VH8A 3I75A 4OB5H 1E4KC 1BEYL 3NA9H 2X1QA 3GI9H 2XPGB 3UTQB 2RCSH 3BEVA 2BMKB 3HC0A 1JGEA 3FT3B 4YBQC 1BQHB 4XNMB 4PJCE 4YHZH 3UO1L 3LKSB 4O2CB 4HWZA 4XMPH 1ZK9A 3SPVA 3ZSTA 1F6AB 1JPGA 3QIWD 3JVGC 4LQ1A 3D39A 4NM4H 1ORQA 2R1WB 1AXTL 3DX6B 2EDYA 1QLRB 1ZVSA 3KR3H 5GJTL 3B9VA 1JGUH 5EC2A 2ZWLT 3SDAD 1YEFL 4HGWB 2Z31B 3I6GB 3D5OF 4FQLH 4ZXBC 1N8ZB 1AJ7H 2X4QB 4ZSOE 1UEMA 5KG9A 1QSZA 3OKNA 2E7LA 2C1OA 4JREB 4GG8A 4Y4HC 2YR3A 3NPZB 4GRLA 3IU4L 3O11A 2WBJD 3ALPA 1ZT7A 4EIZC 2NY2B 4O51B 1LP9F 1OW0C 1U91B 1CVRA 4HIHA 4NQCB 3BKCL 4UBDD 5I1HL 4ELKA 1FVCB 5B3JE 5L7XH 5M7QA 1RULL 1EJOL 4FQCH 5C0BB 3T0EE 4TN9A 2OZ4H 1V5JA 3SDAC 2J2ZA 3WLWC 2R2HA 4ZNEE 3QQ9D 4WW1B 4YQXH 1OARL 4JZOA 1RPQA 4GUPB 3TP4A 3DXAD 5JDJA 3EOAB 4ZDHB 4JO4H 4HF5H 1Q9OA 1AD9A 1N64H 1OAXL 4Y4HD 4RIRA 3FOLA 3MMEA 4KY1H 1FGVL 4KQ3H 3V6FA 2PYFA 3ARZA 3CFKA 1GAFL 1CTOA 5EC1B 1TZGH 1S7VA 4Z7QE 5FCUL 2WLZA 3AM8C 5DUML 2F5AH 4WU5A 5FYLL 1NBZB 4Z18A 4TPRL 2V6HA 5DF0A 2W65B 2DLIA 1S8DB 2XICA 3EO0B 4X4ZA 4BFBD 3MV7E 4PR5B 4YFLI 1ZHKB 1A9BA 1FNFA 4LGRB 2JE8A 3CDYA 4MNQE 4UIKH 1FFNB 1AD9B 3SO5A 3WXWH 1V7MH 4U1KA 2OJEB 2JK5A 3ARPA 5LGJA 3MROB 4HEME 1GGBH 2HAZA 4G6AC 2CD0A 1XF5A 5DTFA 1JWMA 3MLVL 5F9JA 3O45A 3R1GL 3WDHA 3KJ6H 1AP2A 1DR9A 2WNGA 4NC1C 1VA9A 1I8MA 2HA1A 1VPOH 3CFDA 4ZTPH 1VSCA 4OGXH 4NKMA 1IZKA 1VACB 2VLLB 4NC2B 2QHRL 4OZFH 3WLBB 4X6CA 3TVMD 4LSVL 5B22A 3V0WH 2J12B 3CVIL 4UILL 5E08L 1VGEL 4WTXA 4KXZH 5ISZE 3FRUA 5E95B 1DBJL 5D1ZD 3U9UA 4L9LA 5DEGA 5CWSA 1QLEL 3ZDXE 3GHEL 2Z31C 5J7CC 3HMXA 4Y19B 4FQ2L 2F54B 1QHPA 3DVNA 1KPRB 4WHYG 5FA3B 2PNDA 4JREC 4OCMC 3MV7B 3LB6C 5IFAH 3QEQE 3KPNB 5IROA 3FN0L 4L8SC 3TIDA 3U1SL 3UTTB 3P77A 3F7PC 3TVMC 5D2LA 1Y6KR 2GHWB 3VGAB 3BEVB 3DMMA 4NRZA 1JBJA 5ESAA 2HTKC 5D1ZC 5D70H 5HHPB 3VH8B 4ZD3H 2OQJA 2D2OA 1FJ1A 4J7RA 5SWSA 4KPHL 3BN9C 5I1AB 1T1ZA 2NY5H 4NQDD 4F57H 2YN5A 1D3CA 4M5ZL 4ZFGH 2YUWA 4AL8L 4CDHA 4RFNC 3GSNH 1URLA 3G5ZB 3MRCB 5EZIL 4DUXA 4V1DA 4PY8I 4P0DA 1BGXL 5DJDB 3RP1A 3AGVA 5D2LE 5I74C 5CJQL 5GGTA 4S1RH 3ARTA 3IS0X 5C9JB 4Z76B 4DK3A 4GRMB 1JWSA 5I2IB 1WTLA 1I9IH 3S37X 3SE9L 4K9EC 4MJIB 4RISH 4PG9A 2YSSB 4PJ7A 5T1DL 4GQ9L 1XFPA 1NMCC 4XPTL 4DGVH 1ZHBB 2HLAB 3QEGL 1TJGH 4P2RE 1A6VH 4XVSL 1K4DB 4MD4B 1KNOB 2Z92A 4KI5D 3WFZA 2CK0H 2WUBH 4Y1AA 4YXKL 4S10A 5INCB 2F5BH 5AAWA 1WF5A 2GITB 3KLHC 5IV2A 1OLZA 1YMME 3OF6A 3UTSE 4Z0BH 1CICC 1E4WL 1K5NA 2WWKO 5DFWH 5IFJB 1G7MB 3RVXC 4PJ5B 4WEUD 4BQ8A 1ND0A 4NZTL 5I76B 3RGVB 3MLTB 3H9SA 3B2UC 1U8JA 3RUGE 2A77H 3WXVH 4MLIA 1QO3A 3SE8L 4QRUB 3QEHA 1FLTX 4ZUWA 5IIEA 1KEML 1ITCA 1LEGB 1NFKA 1RZGA 5BV7C 4ELMA 1F45A 1MI5A 2DQJH 2ATPA 1IGTB 2OI9B 4M6OH 5EU6A 4U1SB 4HK0B 2CRZA 3B4NA 2CXGA 4P9ML 1EA9C 1CICD 1H5BC 3OX8A 1NFIA 4R8WL 4PGZA 3TO2B 3IAGC 2OTUB 2W0FB 5E99H 1TQCC 4JRYA 3C8KA 3MV01 4BH7B 4K71C 1K4DA 1FDLH 4IRJC 4PY8J 6CGTA 5EU7C 2V2WB 3R8BB 4H5SB 5GS3A 3RZWA 1FVEA 1LNUA 4I4WB 2XRAL 3RAJH 3MLRL 1CGSH 3QZWG 1N5YH 5TQ2L 1IZJA 3BE1H 3OKYA 4M6ML 1DDHB 5C7XH 2B20A 4HUNB 3DSNA 3TA3A 3GSNL 4EVNB 2ZPKL 4K8RL 3FQWB 4UTBL 4LCWE 4OCYH 3X14B 1U8KA 1U8OA 3B6SA 3LKRA 4NOFA 4QF1B 1X4XA 5LXGH 3QHZH 1QBML 4Y0GA 1IEAB 4M00A 4QXWA 5DLML 1T21A 2ADFL 2Z91B 2R2EA 4HPOL 3IGAA 3H9ZA 3W81A 4G8GD 3IFPB 1YQVL 1BQLH 3PE9A 3KLAB 5CEYA 4X6DE 5IOPB 3GSXB 2BNRD 4X0KB 3WO3B 4U49A 3QUKA 3V4VL 3SGDI 4FXKB 3OKEB 4JZJB 1T0NA 4P23C 3I2CL 1HXYB 3WFBL 4L3CA 3SO3C 4Z0BL 2FIRT 5FKPA 2Q8AH 2HJKA 2NNAA 4NZTH 4NCC1 3ZSSA 4GXVL 2FH6A 2JTDA 3BX7C 1WT5C 3BESR 5FHAH 4U1SA 3EJZD 2ZCLH 3QUZD 4FZEL 2BNUA 5LVEA 1HH6A 1ZLWK 3RHWF 4YR6A 3D3VB 1KOAA 3V6OA 3O0RL 4APQA 1QEWB 4JR9L 3V6FB 4DKFH 3P4LA 1HZHL 4L9DA 4KKLC 3WKNA 1KCKA 4H88H 4DOHE 1QO3B 1MY7A 1CK0H 3GBNH 5C9KA 4P9MH 4H8WC 4RNRA 4NBXB 4S0TD 4TNWK 3AREC 5DMJB 5GRJL 5KSBB 4NGHL 3OG4B 4KKBD 2A83B 3LKPA 5FK9B 4IDLA 1KIPB 2VLKA 4BSVB 3O45B 2X4RB 1MCWM 3U4BL 3UJTL 5FO9B 4JPVL 2EYTA 4AG4L 3RWEA 4H1LH 5FKAB 3VDCA 4S1SH 1P1ZB 3QUZC 2I24N 4OD1L 5BV7H 4ZFZB 4FQIH 4JHZA 3EO9H 3VFOB 1CFTB 2UVEA 3VGBA 2V5RA 5D2NC 1NANH 1CFNB 2VZSA 3FTGB 4FQHB 3LEXB 1ZGLP 3K2UL 1IAIH 1IGYA 2F15A 3RWCA 1UVQA 4YDVA 1RUKL 4N0CC 4NKDA 1J1XL 3Q2CA 2CMRL 4P3CL 4PJBB 1FNGB 5KW9H 2VDML 4HQQL 4HCRL 3ZYZA 2BRRH 2GT9A 3K74B 2BXZA 2O26U 1D5IL 3MMEB 4ZO6A 1A4KB 2PCPB 4NT6B 5CJ8A 3KPQA 2E7CA 4N8VG 5C08B 1NGWB 4WW2B 3RUGB 4HMCA 5JW4R 2HT3D 1BOGB 4ISVA 4I3SH 2PXYC 4LKCA 4QRRD 2I60L 5C3TA 3SDYH 3HG1E 4NC0B 3WL9A 1BECA 1E4XH 5DJ2A 5F6IB 1NSNL 2FJGA 4YO0A 2ILLA 1TNNA 1FVCA 3DURA 1P7QB 4G8GA 1OGAD 1EO8H 4D3CL 1YEDB 2DQHL 1P6AB 3STZB 4GAYA 3D18B 3ZKNC 1AGFA 1FFQA 4WGVB 1RJYA 1RK0A 1JGLH 2D31B 2Z93A 5HPMB 1RMFH 5B8CC 3RL2B 2EIZB 4KJWD 2YD1A 3PV7A 1JMXA 3CVHA 1H5BA 4O2FB 4UBDC 1E28A 3U36B 5BZDB 1ODAA 3RZCB 2EDFA 3F7YB 1PG7L 5TGBA 1L6XA 1CXIA 1BZ7A 3Q6FB 1B4JH 4PJBE 4YHIB 5EU4B 3S96B 1CD9B 4M7LH 4AH2A 1HHHB 4EBQL 4U1HA 4P2QD 3QYCA 8FABB 2ADIB 1DBAH 3DWTA 3P40A 3HE7B 3PXHA 4M62L 5IVXB 4XP6H 1U8QB 3MGAA 2ZG1A 1X5IA 1JZ6A 1RVFH 4O2FA 2PYEA 4S1SL 3B9KB 5B4MD 4RMWA 3D0VB 1YN7A 3LS5L 1IM3B 2NXYB 5F6HJ 4Y2DB 3I75B 2DJUA 1H9VA 3I6LD 3D3VD 3D18A 4UOJA 4OV5A 5ALCH 4NKQB 3FRPG 4X6DB 1FBIL 2AEIT 3ORJA 3OR6B 2VDNH 3IAPA 1T89C 2BXYA 4HT1H 4RAVB 1QACA 3WS3A 4NN6B 4ODTL 1KB5L 1T4KB 1C1EH 1YEIH 3B3IA 1EIBA 5SX5H 2VDMH 4HQQH 4ODHH 2VL4A 2OTWB 5B4MC 4WW2A 2J7LA 1UT9A 5GS0C 1MCCA 2BSSA 2QTEA 3CSYA 3RTQA 1MRFL 3HS0B 5BRZB 3F5WA 5E00A 3GBMH 3MUZ1 3F5WB 4NJAH 1B90A 3H6JA 3HPJA 4XPAL 3SE4C 4Y5YA 2FX9H 4OLWH 3KYAA 3VXQB 3VFUB 4G6FD 2BY3A 2OLDA 4DQOL 2X70A 1WEJH 3LKQB 4WHDA 4KMQA 3RGVD 1X7QA 1FCGA 2IAND 5HHOB 1B2WH 5INDA 1F00I 1A6UH 5DJ0A 4S1DC 3OGCB 3DOSA 2PTTB 2F74B 4PRHE 3IFNL 4Z0XB 1WFUA 3D9AL 4X6DA 5CJBA 3CMGA 4XVJH 1LO0L 3FB5B 5DD1H 4LCCB 5DRWB 4N8CH 4OV5B 1R3HB 2AKRA 4O51A 4LNVA 5C7XL 4IOSD 4XAWL 4Z7QF 1A6WL 1Z5LB 1XF2A 1FZOB 5DT1H 5FYKU 3RL1A 1JZ4A 1GGIL 4OD3L 3PXJA 5D72L 2I26N 4NHUA 1J0JA 2M1KA 3R4DA 3SGEH 2Z31A 3I6GA 4KHXH 5E9DE 1RJZB 3TBVA 2EO9A 4HZAA 5EU3B 4MA8L 2VB5A 1BF2A 5BRZE 3DSFH 3ZKQD 5I73B 5KSAC 1K2DB 5GGVL 4XPHH 1F8TL 5IMLA 4YFEA 4NUJB 4K3DL 3JSSA 5EO0A 3BN9D 3TO4C 3VXMA 3QISA 4YIQB 2APFA 3WS6C 4LK4A 3CVHL 1BVKB 4MDIB 3BPNB 3LEYH 1B3JA 1KJVA 4EZMA 2YPLA 1N4XL 1IQDA 1AXSA 2AJSL 3T0XA 5HYSA 2K3TA 1KJ2L 1EVTC 3T0AA 5IR1A 2P48B 4JZJA 2L7JA 4X5LA 1AQKL 4WHTB 4PRHB 3MV8D 4M5YH 1BD2D 2Z35A 4J1UA 3WKML 1U41A 4NQVA 3FFCA 2BVTA 4J3XA 4XNQA 2X7LB 4JFZH 5FHAL 4JAMA 4NBZB 5E2TL 1AHWB 4Z95L 4R4BB 3MZGB 5J1AB 3VXNA 3ILPB 4O58L 2X4NB 3O0RH 3B9KD 5FYKD 1V3KA 1U3HB 2UY7A 4MD5A 2EE9A 3OB0K 1U6AL 2GK0B 4ZPVA 3O3DB 4XBPB 1QA9A 1QFOA 1WFTA 4WFGD 2WZPD 4CVZB 5K9JH 3RVXD 4OGZA 4U1MA 4BH8A 4HH9B 5I1LA 3QI9B 3FONA 4TUOA 3RWJB 1X5LA 4X9BA 4A6YA 3QWRA 4EDWH 5JOFB 3LN9A 1HHJB 1A5FL 3MRBB 4OI9A 3D9AH 2A9MH 3M45A 1HEZA 1DE4A 5CP7B 5LKNA 5I1CL 3S88L 4ZFOB 5DRZB 3VFOA 3WO4B 2BVOA 2JJWA 1KLGB 5FEBA 2E8YA 4PJDF 4U1GC 2NY7L 4I5BA 4Z77A 3H3PL 3ZE1F 5CSGA 5GZOD 3X12B 3HLAB 3FHQA 4HKXB 2HVJA 1XF3B 1DEDA 3RVTD 4WDIB 2I07B 3F6IA 3P4MB 3CX5J 4Y4HA 3BJ91 4PJDB 2P7TB 3I85A 4RFOL 4WUKH 3B5HA 1R24A 4EXPX 5L7XL 4PJDA 3H9HB 3EDFA 1CDGA 5DUBA 2H8PB 5DJYA 5EPMB 3RBGA 3H0TB 4HIXL 1YZZA 2A0LD 1AO7B 3WD5H 1NCUA 3IYLW 4U3XA 4APQB 4HGKC 4JG1L 1UA6L 1T1YB 2ARWA 1KBGH 4FQJL 4QRQB 1DUZB 1KJ2H 4TNWF 3UP1A 2X5PA 3AXLA 4I9WD 5E94A 2P1YA 2VLJE 1UJTA 3LSOA 4LBEB 4N5UA 4WCYL 5INCA 3VFMB 1T1WB 2DQFA 3HNSH 3TN0A 3V8OA 4HS6A 5I1KH 5FYLH 2X2YA 4JN2B 2BFVH 2FSEA 2OZ4L 2GEEA 5D93C 4N9GB 1A3QA 3CPLA 3DXAA 4B53A 3DXAE 4HH9A 3BP7B 1P7KA 3PV6B 3QUKB 4LLDA 4FOMA 4HF5L 4BZ2H 1DBKL 5I9QB 5MEPA 4C58B 1OVZA 3PWVA 5KVDH 3GO1H 4GAGL 4XMLL 4P2OD 5JTWA 4XWOD 3MRIB 1PKOA 4RQQA 2ZUSA 5MEND 5MEOB 1HXMA 2MWCA 2Z91A 4G5ZH 5B8CA 1CLYL 2B5IC 3ROLB 1QBBA 3DTXA 1QNZH 4HAFA 1NCCH 3T0DA 4MB4A 1RVFL 3ARFA 3DBXA 4TUKH 4YR6B 4P2QA 2QHRH 1SY6A 5T1LD 3QI9C 4IOIB 4LLMB 4LSVH 1OSZB 4HLZH 1AGBA 3E6HB 1QRNA 3DMMB 5D7SL 2CLRA 3ESVF 3NCYS 2AQ2A 3RJQB 2CQVA 2R23A 3P0VH 4KQ4L 4Q9RL 2D3VA 3T2NL 1QKZH 3MNWB 3U4AA 3LD8C 5EZOH 3K2MC 2CDFB 2E7LC 1G9NC 2J1KA 1B0RA 3BAEH 3X11B 1JHLH 4P2QE 2Q6WB 4YH6A 1NPUA 5L2KE 3ECBB 5DZOA 4R2GB 5MEQB 5CCKH 5DHVA 1YPZF 2DL2A 5ISZD 3R0MA 1FGVH 4LEOA 5ITFA 1MJ8H 1RY7B 2OJZH 4XVUC 4BFEA 4QTHB 5FCUH 3KJ4B 5KTEH 1QLEH 2OL3H 3TPUB 5A1AA 1YEGH 4UZGA 1ZAGA 2NX5D 2BVPB 4IDJH 4N0CD 4OCWL 1TIUA 4LLWB 5E1AB 5MP6H 4D9LH 3CFCH 4OIBA 2VR4A 1ONQB 3WIHA 1T66D 3B9AA 1EVUA 3S97C 5DJ0B 5CD3A 4FG6C 2BFVL 3U1SH 1YC7A 2GSGB 2XZZA 3V9FA 3RNKB 1X5YA 3LDBB 5E8DL 1UYWH 4KTDL 5BMFL 1JI2A 1R3KA 2HT3C 1D5MA 4NUGH 2J8OA 4LSTL 4JFQA 1I85A 1FFNA 3BPCA 4RISL 5HDBF 2EKSB 4MJIE 3MLVH 4XMLH 5HHME 1P7HL 1FNSL 2XFXA 3O81A 4XGZB 2N7AA 2X9WA 3NFSL 3EO0A 2E9BA 3NABH 3IRZA 1T0MA 3LH2H 4ZAKD 3VW3L 4XB7A 2HJFA 2DMKA 5F88A 4W6YB 4RGOH 3L3OB 5DVMA 5T3ZH 3OXRA 2NX5E 4ONHB 3ZHLA 4M7KH 4O9HH 1GOFA 1CF8H 4JCMA 4XZUB 1EHLL 4P4KB 2JCCE 4NN5B 4HJGB 1JNHB 1BBJB 4H1LA 2GSIA 1E6OL 4X6EB 4GQ9H 3HE6B 4FTVB 4PV8A 3V6ZB 1ND0B 4G8EA 4KGJA 2FECI 4Y4FA 3MRKB 1AO7E 4H8WH 4KC3B 2CIKA 3QIUA 5EOQL 4ZAKC 4B50A 5DD0L 3I6KB 3Q1SH 1QSVA 4X4XA 4NN7C 1NMBH 3GSUA 1ZA6A 3IDYC 4HPYH 4TSAL 5D7LE 3N1GC 1CDIA 1EGJA 4XNYL 3SJVE 3VFVA 5D5MB 2X41A 5T1KD 3TIDB 1H8NA 1LK3H 1ZLVH 3DNKA 3OKKA 1G7LA 3FOMA 3VXRD 1CDYA 2WUCH 4QGTA 2NW3B 4U1NA 5TGBB 3MREB 1FL5A 3ES6B 3HRPA 1O7VA 2D4FA 4H20H 5C0DB 1B0GA 1SHMA 1TFHA 4EUPG 4YUEH 5I8OH 3SGDH 1YEKL 1U9KA 5L88H 1XIWC 4R0LA 3O6MH 4TSBH 1JGVL 5CJQH 4QKXB 4D9LL 1NCBH 3ARYA 5D1XB 1WAAF 3T4AB 1U42A 3T4AA 4FQPA 1MJ7H 1GXEA 4EDWL 1EAJA 1AKJD 1PX4A 5D8JH 1QD0A 1JYWA 3V7AE 3UTQA 1ZSDA 1KENH 4O4YH 2OQJB 1BFVH 3I6KA 5DYOA 1QBMH 1Z9SA 3OHXB 4MS8D 1FZMA 1S9YA 3EUUA 3LEVL 1N5YL 2XXMB 2B4CH 1J8KA 4LMQE 1T2XA 3MRQA 3RGVC 4Q6IC 2ZSWB 2RIKA 2X4OA 1T03H 2H9GB 1UC6A 3CDGA 3TBSA 5K9OB 1KPRA 4S1DD 1YEEL 3PWLA 4MXWH 3I50H 4OZFB 5IBTH 4D9QD 4NJ9L 3HAEH 2ZG3A 4HXBH 3QHZL 4JB9L 2LTQC 1A7OH 3OKLA 2Q8AL 1CICA 4R90H 1EEYB 1MCNA 5C0FB 5F1SA 4FQHA 5EU6D 1QFWI 1MI5D 2QADC 3CFKB 3L3IA 3V0VB 3EJYC 3I9GH 4H1LB 1RZKC 2EC9T 2NY3B 1N3NB 4JM4H 5EOQH 3QAZC 4TOYL 3GUTA 5HHQB 2XT1B 4M1DL 3RBSA 3LQAC 4K07A 3MRMA 5FXCH 4QHMA 3CUPB 5BS0B 4P3DA 1X3DA 4ZAKB 2VRAA 4CJ0A 3L6FB 5GS0H 3N06B 4P5TB 1KTLA 4NQCA 5AG8A 3ZE0F 4JRXE 3EJYD 3S37H 1IEBA 2W0LA 1JVKA 4CRPA 4FXGB 1NGZB 4OV6F 5E6IB 4N8PA 1F3RB 3QNXA 1IGJA 4OCYL 5KG9B 5A16B 4FP8L 3FZUD 3HR5B 3LHPL 5L2KA 4NO5A 3OKLB 4RFEB 4QHNA 4EI5D 3QDAA 4WNQA 1D5BB 4ZXBB 4PJFE 4OQTA 3U4EA 2BNQE 3N0PB 1MFEL 1M6OA 2HJKB 3UZEA 2VLME 4GLRI 1Y6NR 1JF1B 4U7MA 4V1DD 2XZCL 5IROC 1JL8A 2UYLB 4ODXB 1CQKA 5D7SH 4MMXC 4XCEB 4UUJA 4JZOB 4OD1H 3A67L 5BV7L 5JA8B 3OHXA 4KVCL 5CEYB 4YHZL 1K6QH 1WFOA 1KTDA 3FQNA 3G5YB 4JN1L 3U2SB 5DJCA 1B0RB 3SDYL 4ZUUB 4NM4L 3P0YH 4F37K 1CS6A 5D1QB 2BNQA 3Q5OA 5GJTH 3GEWB 3TH2T 1RUKH 1G9MH 1O0VA 4KRLB 5ACZA 3WV0A 2GTWB 4KJYB 3O3BA 5GQBA 3X14A 4YXHH 4LFHG 4HC1H 4L5FL 1JZ5A 2DLFL 5L6YL 3WUWB 3FKUS 1UB5B 1HN1A 3BVNB 2VERN 3BQUA 1IE5A 3MV9B 3SDCC 1MWAH 5I1EH 4X6DF 5JHDA 1P53A 4WFFE 2DB8A 1CG9B 3P4NA 3TJHD 3F58H 1PSKL 4I2XE 2IAMA 2EDEA 3U4BH 3UJTH 1CI5A 5DD6A 1XGUB 5I15H 1KB5B 2F19H 4OM1L 5F71A 4MJ6A 3WHE0 4ELMF 4KUCD 3D25A 3CZJA 4KTDH 4KI5F 3D1MC 3CK0L 3LVEA 3U82B 5J56B 5KVFH 1BZQK 4HBCL 5JHLL 4OZGF 3U7AA 4LLDB 1BVLA 1X5KA 1SJVA 4QRSB 3N85L 5GGSB 4L4VB 4X6BA 2XTJC 4U1IA 1G6VK 3RA7L 4Z7OE 3ZL4L 2GSIB 2XWJB 2H8PA 4BSJA 3HZMA 2ZG2A 3V4UH 4F7EB 1ZLUH 3MRDB 3U9PH 5JO5A 1GIGH 3C5SA 4EBQH 5EA0L 3REWB 3KLDA 5MEOA 5F7MC 4AIOA 3FN9A 1UXSA 4C56A 1QSFB 3LPFA 3M07A 5BVPH 3I3EA 1XF3A 4PJGE 3EZ8A 4OZFG 2P5EA 4LSPL 4U6TA 5AYUL 1TETH 1FC2D 2W9EH 3GKWH 4JKLA 4XP5H 4D9RE 4LLUB 5DQ9A 3GK8H 5ICYA 2NY3C 1L0XA 5EPMA 3MV11 2CLZB 4KDTC 1KT2A 4M7JH 3W39A 2FSEB 3F62A 4O02L 1EH9A 1SJEA 4ODUB 5GGUB 4CW1A 5HSFA 4CAGA 4F7MB 3Q1SL 2P24B 4HC1A 1QOKA 1WC7A 2JLLA 3R0NA 1MVUA 1EO8L 1U8LB 4CNIA 5AYQA 4PB9H 2E7MA 1VGKA 1F3DJ 1J1PL 4WFGE 3NZ8B 5E0QA 1F2QA 3RWJA 1FRGL 5HTSA 5F8RC 5DJDA 2A6DA 4OCLC 1OTTC 2BVOB 4XBPA 4NQTA 4ZPVB 4JKPH 2EC8A 4MD5B 4F3FB 2WBJA 2R69H 2IALB 3IF1B 2HLFD 4M1CD 5I19H 3TZVD 2HVJB 3SDDD 5T5FH 4Q97A 3GMMA 1Q0XH 4KAQH 4KK8D 5C0NC 2KL6A 1XGQB 5D8JL 1UACH 1W0WB 3MGTB 1DQDL 1ZTXL 1CFSB 3SQOH 3CK0H 4JVPA 4L4TA 1D5XA 3V79C 4ZFOA 3H42L 4HGMA 5FUCC 3P3YA 2P45B 3QUXC 5DZLA 2VN7A 3BKMH 2YPLB 1MLBA 4K7PH 4JFDD 4PRBB 5KS9E 2AEQL 1S7QB 4IJ3C 1HHJA 1W0VA 3BD3A 4LAQL 4GO6B 2VLJB 5CZVH 4ZFFA 1G6RA 4Y1AE 3TZVC 1GJIA 3GIVA 1SM3L 2L4OA 3HUJA 4KZDL 3ARBB 1P2CA 2M2DA 1FZJA 3WEXB 1MAJA 1T83A 3C2AH 2MOVA 1RJZA 1PJ9A 5I8CB 1EEUA 5CEZD 5E8OA 3SJVD 1ZE3C 3DSFL 4AIXA 4GRWE 3EAKA 1A14L 3KPPB 1AHWA 3RY6A 5HGAA 3JTSA 2AXGA 2D03L 1GC1L 5DK0A 5F9JB 2R0ZH 1F4XH 1MHHA 5TDOA 5AD0B 1K2DA 2LU7A 5TDPB 3NTCH 1JNNL 2E27L 4NQEA 3VG9C 2G60L 5F97E 1G9NH 3UBXG 4K2UH 4LIQL 5CSZB 4PB9L 2WWMD 4XVTL 4DVRL 4IRJB 4N0UA 4M93B 4JFOB 1UZ8B 3G6DL 2LVEA 1ES0B 3NGBB 3MUGA 2MFNA 5EIVA 4WRLA 2AABL 3QXAB 1JJUA 2VAJA 4YJZL 3AXLB 4Q2ZB 1CD1A 3DV4B 1QSFD 4YFLF 4H0GA 1HH9B 3MRJB 2CIIB 2IADB 1OAQL 2DS4A 2BY0A 3BKYH 1WZLA 2QKIA 1U6AH 2FNBA 5F3HB 1FPTH 2WWMC 1ZV5A 4LLYB 2XY1A 2C3VB 5HYJD 4A6YH 1IQWH 3CGTA 3AS2A 3WIHH 3WUZA 5GISH 1QFHA 2X1XR 3S34H 1IT9L 5E56A 4Y5YB 5HJ3A 1P4BL 3EYUH 4PRIB 4KKAC 2YWYA 4ZUVB 2CIIA 3UTSA 3C8DA 4MNGE 3C09C 2RBLA 4W6WB 1FYTA 3VXOA 5FOJA 3BZFB 3IETB 5C09E 5FGBA 1MIEL 3HI6L 5I1IL 3DV6B 4P4RB 3BPOC 5DFVD 1UXWB 3WD5L 1OCWH 4PGJA 2ESVB 5C0RL 2Q87A 3QSKB 2C7UB 1AHWC 5LGKA 4YDKH 4OF8A 3MRBA 1JHTB 3MJ9A 4XXCA 3SDDB 4LSUL 1MRCL 2VC2H 2A6KB 1R3LA 5HHOD 4MXQC 3CD4A 4U0RC 3QI9A 3E2HC 1T7YA 3JZ7A 1MNUH 5CEZH 35C8H 5T3ZE 5FUZH 2E9WA 3D39B 4NDMA 3CU1A 3JWNC 2RR3A 4Y2DA 4YHML 1CTNA 2FEEL 2NQCA 1P4IL 4PJFA 4JY4B 1JPST 5D71H 5DFVC 1BQHA 1ZA3B 3VXNB 1DQML 1CE1H 2G60H 1RUAH 4F9LA 5M95B 1X5GA 3WS3B 1UB6A 2ADIA 4XNQB 1AGFB 1RIUL 1TJHL 5E24E 2VLJD 4PRIE 2DQCL 43C9B 1SY6L 3STBA 4YWGH 2P8PA 1E28B 1NCCL 1R5IB 1W0VB 2CGRH 4X9FA 3U36A 4ZXBD 5FO8A 1QUNA 5EBGA 2BOBA 4AENB 2R0LL 3VWKB 2IBZX 3TN0C 5CILL 5HYJE 1OP5K 4MDIA 5EO1B 3KNBA 1WWWX 2V2TA 2R1YA 2OCFD 4WV1A 5F7LB 4OB5L 4Z7VE 5J1TC 4LF3A 1M7DA 3UJIL 1I3RB 5HGGS 3AAZB 5KSBF 2AJZA 3DO7B 1EZVX 5C2BH 2EXWC 3KPSB 4MWFB 1W72A 4MJ5B 4RFOH 4OFYD 2ARJB 2XWTA 4XWGH 3GFUA 5HI5D 5K9KA 3QQ9C 5E4EC 1S7RA 4B7IA 3GSWA 2XI9A 2WBJB 4X83A 4V2CB 3RWGB 4BKLB 1ZS8A 4MQXC 1YEFH 3QCUL 1U8NB 5FHBL 1DANT 2W9LA 4JHAH 4YGVA 4E9LA 2FHBA 2V9QA 5C0GB 3V5HA 4GKSB 3BT2L 2EXWD 3P9MA 3UTSB 4EI5C 3OJDB 5ERWA 5DEFB 5F7EH 1R3LB 3BISA 3LZFL 5TE6H 3RWEB 1A21A 4PJBF 3BPOB 2VLRA 1U93B 1XGRB 3QDGB 4XC1H 2A83A 4R7DA 2ESVA 1GHFL 2ZNXA 3KPMA 5J13B 1UZ8A 2CUIA 1AGEB 2X70B 4N0UB 3WFEL 3NPSB 3PGDB 1OWWA 3MJGX 3PWJB 4PRPD 4PBVC 5KZCB 4CMHB 2AJUL 1I1AB 3T1FA 5ICXB 2BSRA 4WUUB 3RPIA 2QJDA 5JQ6L 3MA7B 2NY6B 1FNGA 2P5EB 5FKAA 1OD7A 2ENSA 2DQUL 3KDMB 1IM9B 3HE7C 1WIUA 4GG6A 3U46B 4BELD 5K9QI 1D6VH 1J86A 2YEZB 5FDYA 5KS9A 4JFFE 3G6AA 3RWIB 3MXWH 4P2OB 5FA4B 1CXHA 1M1SA 2KUTA 5F3HA 3LIZH 1S7UA 1MLCA 5IB3A 1YPZE 3UYRH 4RAVA 1NGQL 4HUUA 3HMWH 5D93B 5HI4D 1UYWL 4M7KL 4O9HL 3TT1H 1HI6B 1AO7D 2FRGP 4Z78A 5JW4Q 2MCPL 1WBZA 4JM2D 3SDCA 2OK0L 3VGEA 4Y16B 1RK1A 5DGQA 3FT4A 4WI5A 3HC4H 2B39A 3MUGB 4JM2F 4IIQC 2P5WE 5FKPB 5F3BA 4FNLH 5DZNA 4KRPB 4X6CF 1QYGL 3GIZH 4U0RB 1YDPB 3O3EB 3TO4A 1T0NB 1BIIB 3T04D 3B6SB 3FQRB 5B39A 4FQLL 3TCLA 5SWZD 1QVOB 3W9DA 3IVKB 4FFYL 4WUUE 3GMMB 3OMZA 2VITB 4Q9BA 4XP4H 5AUMB 1P7QD 3QZWA 2FGZA 1RU9L 4JG0H 1D9KD 3VXSA 4C4KT 3IGAB 1DDHA 1WSST 4M3JA 1MCHA 3LOWA 3AY4A 2ZJSH 4ERSH 4X8JA 4HUXB 2GYSA 2HG5A 1SVCP 1MCOL 4ZUSA 2QR0A 1FCCA 4HFWB 4ZUUA 4TSAH 4PBWD 2Z0BA 3NIFF 5BRZD 1WBXB 3STLB 4OZ4A 3Q3GB 1P7QA 2MSPA 5GIRB 3FB8B 4Z5RA 3WFEH 3BIBX 2NY3D 4BFIA 4GG6E 1S7QA 4KY1L 1MLBB 3SKNA 1VADA 5HD8C 5BVJA 1UCBH 4O4YL 2UYLA 1Y0LA 4Z7VF 1X5JA 1IKNA 4KRNA 3SKMB 1YMHA 5F1NB 3MO1B 4YHPA 5F9OL 2X4TB