1K8DB

Crystal structure of the non-classical mhc class ib qa-2 complexed with a self peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords QA-2 antigen
publication title Promiscuous antigen presentation by the nonclassical MHC Ib Qa-2 is enabled by a shallow, hydrophobic groove and self-stabilized peptide conformation.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k8dB00
4PTUB 3S4SG 2E7HA 1EJ6A 4YUEH 3ZTJH 3ESUF 1RUAL 2YPLA 2X1QA 4BFIB 1S9VA 3PGDB 1TXKA 3M1BB 4JJ5A 1QLFB 1R3KA 1RUQL 1X5KA 2X4TB 4JCMA 3DRQA 5FDYA 4GT7A 4PFEA 5CP7B 4M6OH 3EO9L 2BSTA 2H9GB 4WENB 2P5WB 3BIAX 3FN0L 4HUKB 4WJ5B 4CW1A 1N6VA 3EHBD 2IH3A 4U6HB 1NGZA 3VRLF 3VFOB 5INDA 1PBYA 2XA3A 3BIKB 3EOBB 5JPMB 4DGIH 2YD4A 1IGFH 4RISL 3CC5A 3GSVB 4D9QE 2HH0H 4X80H 5IF0A 4DJMA 3LKPB 4X6DF 2VQUA 1JNHA 4Y2OA 2DQCL 4P3WA 2V17L 4L3AA 4PTTB 1MEXH 1INDH 3WIHH 3H0TA 5IOPB 2KQNA 1UH2A 4MNQD 3GMLA 4QF1A 4BM7A 2B4CL 1VFBB 5CJOH 1U8JA 1XGTB 1ZA6B 4ZFGL 3TA3D 3L95B 4BH8A 4XVJH 4ZFOA 1UM6L 4KHTH 3WFHA 1V7MH 1D6VH 1X5AA 3BQUA 1RK1B 5HGAB 1G7HB 1KIPB 4GQ9L 1UA6H 4HKBA 4HWEH 4XH2B 5T1KD 1AE6L 4TSCL 2EDLA 1HHGB 3LB6C 5ALBH 3K2UL 1FLRL 1E4KA 1FDLL 5DQ9A 4NRYB 5DRNB 5ETUA 4BZ2L 5I18H 1OTSC 3B9KC 2YEZA 3GMNB 4YHKH 1CDUA 5D1ZD 3P0YL 2G5RA 4NQTA 4NO0D 4UZGA 5GIRA 4X5XB 3OG4B 1WSST 1I7UB 2DQEL 5D2NB 5MHSE 2M1KA 1U3HB 4E0RA 2FB4H 3WXWL 4OZHE 3RTQB 1HYSD 1FL5B 3LKSA 3C60B 3TT3H 1XCTB 1ZVHA 1RHHB 3PP4H 3TO4A 2IG2H 1VB9A 2P1YA 3PWUB 4MNGB 4ZTPL 4NYLA 4N0YH 1CT8B 4U4BA 2ADGB 5DF0A 2BNRE 1S7TB 1N8ZB 2H2SD 1CLCA 1EGJH 3BPCB 3VH8A 2GSIB 1IC7H 5EUOE 5J9PA 3UTTE 3SE3C 3KS0H 4JHWH 4LNVA 4DW2L 4GKSB 5JUEH 3RUGA 1IGMH 4TVPL 3ZE2F 3BRFA 3TYFB 4GBXB 1T89A 4RIRA 4CADA 1FO0H 1I9RH 5DSCA 3FZUC 3SE8L 1K2DB 2UY7A 3S36X 3VXRA 3DRTA 1CDIA 1VACB 3HNSH 2ATPA 5D72H 4OB5L 4RA3A 1FFOA 1MWAL 4KHXH 5JW4R 1XCQA 2ZPKH 4XB7A 4NQSB 2AJVH 3OXSA 4XCNB 4HEME 3BMWA 2I5YL 2YRZA 1EXUB 1NGYB 2R2BB 4ODTH 3VXSB 3H42L 1HH9A 3OSKA 25C8L 4S1DC 1QBAA 4NCC2 5DT1H 5J12C 1YQVH 3KXFB 1IM9A 5FYJE 3O2WH 4KRPD 4HV8B 4QT5A 3QDGA 3HC3H 4B41A 3GMOA 4F33A 4JDZB 1W0VA 3JWDL 3BDBA 4PJFE 43CAB 2IH1A 5EU3A 3LD8B 5IB5A 3VXOA 4F7PB 2IPTL 1HOCA 1FVEA 4GG6B 1C5CL 4KTYA 3RWGA 4LHUB 4DKEL 2CQVA 4P46D 4NN6C 5AUMA 3L3GA 5DO2D 2V2WA 1N64L 5C0EA 1FV1B 2FHFA 3DHJA 1QRNA 4ZUVA 2R0LH 4XCCH 3QRGH 3VA6A 1IAOA 3HG1A 4GAFB 4NQUA 3RDTC 4E41A 1FORL 3CFEA 2Q8AH 3RWEB 2IQAB 3F62A 5HHOB 3ZL4L 5T5NF 3LSOB 4FG6C 2QEJA 3RWDA 4XNZB 3FRUB 4MQXD 1U93A 5EO0B 4LGSB 1A1NB 4PGBB 4AM0A 3QWRD 5HI5D 1A7QL 3FQUB 2D0FA 4YDLC 1J1PL 1IGCH 5E94B 1IEAB 4OSUH 2IAND 1A1OA 2HRPH 5BCAA 5IESH 4Y16A 5CEZL 1PD6A 1S8DA 3WS6A 3UTOA 2ZSVA 3SDXE 1RIHL 3RA7L 5ADOH 2J4WL 3C2AL 1JMZA 1BVLA 4HQQL 2F53D 3UO1H 3D87B 1SEBB 3UYOD 1FLTX 5KVGH 3B9DA 2B7DT 2RFXB 4LSVL 1KNOB 5C0AB 2D03H 5F1KC 1MLCA 2O5XH 4F3FA 1U8QA 4DEPB 2G60L 1K8DB 1H0DA 2JELH 1I8KA 2IEPA 3Q6GH 4LLUB 5IB1B 3PWJA 3KYMB 1N5AA 1FJ1A 4PJ5B 5ACZB 5J6GB 1PKOA 4YQXL 4KROD 5C71A 1X4ZA 1DVFC 3MJ8B 5AZ2H 2DICA 4RMWA 3LIZL 4DCQB 5DD0L 5B38G 3NCMA 5DVOA 3QWQB 2D0GA 1RJLA 1HCVA 2HWZH 4PJHA 3ECBA 4MB5A 2UVFA 3J8F7 1BJ1J 4UT6L 3LKNA 1MI5D 3FTGA 3MLZH 5DMIH 4LKXA 4XHJD 1IAIH 2MHAA 4Z7WF 1KT2B 1W0WA 3AB0C 1I9IH 3TWCH 5JW5B 3OHXA 4HXBH 3QHZL 5DFVC 5DJ0B 1LO0L 3QEQB 4WO4A 5C08B 4G7YL 3T4AA 3QNXB 1QFWH 1HSAB 2A6KB 1WFUA 2QSCL 1U58B 3MRDA 4FQXB 1CFSB 3AVEA 1RZIA 3RGVA 4M5YH 4Y4KC 1MCBA 4U2ZA 2V7HA 3DBXB 4XCEB 2ICWB 5IMKB 2PO6C 4YXHL 3T0BA 3EZ8A 3EYFB 1EZVY 3C2SA 4UIKH 4QLRA 3V0WH 5I6XC 4N8CH 4G8IA 3NCJL 4JRYD 1HEZA 5JNYA 5F1IA 5ICXB 3C6LA 1DQJA 5CGMA 4J8RA 2FWOA 3QH3A 3V4VH 1H15A 4M1DH 3AC0A 1GGBL 3Q48A 3X12A 3P11H 4JFPA 3MLXH 3UTZA 1YEGH 5TE6L 4ESKA 5IKCA 3LKOA 3QCUL 2VISA 1YJDL 1NFKA 3BP7A 4L4VB 4QTIH 2O61A 1N0XL 2NYYC 4LSDA 3UCRA 5F88A 1D6EB 3WHE1 1HN1A 2F19L 1WZLA 3HC4H 5ANME 5C2BH 4Z0XB 4E5XA 1C5DB 2DM3A 1DEEA 1J88A 5BZWA 2XKNA 3WUZA 1HSBA 1MCOL 4JY5L 1T20B 1L6ZA 4JFZH 1NBYA 1F42A 4NJ9H 3MLTB 3I84A 3MA9H 3HI1B 5HYQA 5L6YH 1WZKA 3HR5B 3M1BA 4MXWL 2X4TA 3WXVL 3D1MC 5TFSH 3CDCA 3BVNB 2C4FU 4PY7B 3HNVL 5CP7A 4GKZB 5TPWL 3WYRA 4RFEB 2OL3L 2F54A 1DBML 2H9GA 4R0LA 2P5WA 4WJ5A 1K4CB 3KPSE 4PRDB 2W9EL 3QCVH 1ACYL 4PREA 4H8WH 3VFOA 2E7LA 3BIKA 5HYIA 4R4BB 2DKSA 1I1YB 3OL2A 4YPGA 1EO8H 1S5HB 5MEOA 1KIRB 1RIUL 2IMNA 1J18A 3SY0B 4PJDE 1NSNH 4PTTA 4BFBD 5I30L 5DGQA 5IOPA 5DWUL 3NABH 5DD6A 3QUYB 2WBJB 1H3XA 4LLAA 3O9WC 1VFBA 4MDJA 4APQD 3U82B 1ZA6A 4B7LA 2YBRA 5FK9B 4PJ9C 1U42A 1O7SA 3DPBA 1YEJL 3BZDA 3DGGB 3S36H 3ZMRA 5JHDB 3ARDB 1UJ3C 3QP3A 4MNHB 1G7HA 1KIPA 4LL9A 3C8KB 2KDGA 1HHGA 2P5EB 3MXWH 4XP9H 2X4PA 3T8XB 3GJEB 1Q1JL 1YYMH 5DRNA 1XF5A 1T03H 3O6FB 2XWTB 2DAVA 5EU4B 5CAYB 1A47A 1ZXQA 1RZKC 4Z7QE 3BN3B 1FO0A 4UU9B 2ZUXA 3VGDA 1MREH 1PEZA 2X10A 4ZFZB 2X42A 4WWKB 1MRFL 4X5XA 1AO7E 1I7UA 2A77L 1U3HA 4W81A 2Z35B 3T1FB 3RTQA 3FN3A 3D85B 1XF3B 1R3JA 4FFWC 1RHHA 2DKMA 3A6CL 4OTXH 1N6QL 3ARVA 2H2PD 5ITFB 1CT8A 3SKOB 4HK0B 2BVEA 3TH3T 4DK3A 4EI5B 1S7TA 4H1LB 4BUHA 2CSPA 2GSIA 2EIDA 1KJ3H 3SQBA 2GJ6E 4OIBA 3FQWB 2OZ4L 1HK6A 4ZAKC 1CF8L 3TYFA 3M17B 5I9QB 1QD0A 2UWEB 4GMTH 1BD2D 4NWTL 1QLRB 1BM3L 4CVZA 1IE5A 2MMXA 1TITA 1VACA 5IM7B 5E6IB 4GJTB 4XNYH 1MHCB 4LVHC 3S97C 5ISZE 4HG4K 3L3HB 5DZLA 3SCMD 3KJ4B 5DHYA 1RURL 4MXVF 3HI5H 2Z31D 4PJAB 2OXHA 3MGOB 4JRXD 3CU1A 3ZDZF 2A9NH 4XCNA 2NXYC 3GBMH 1JI1A 3PV6B 4HC1L 2AEQL 3QBTB 4S2SA 4XMLL 1EXUA 1NGYA 4ELMF 3VXSA 2EDHA 2NY3D 1AP2B 3U0WL 5HYSB 4PJIB 5MEND 1ZHNB 2CR6A 3CFBA 2E6PA 5EUKB 5J6HB 2C3VA 5DRXB 1UYWH 1W72B 4I0KA 3ZSTA 1CS6A 1H3PH 1NDGB 4QRPD 3GSOB 2H32H 3B43A 3I6GB 4IRSD 2AJXH 1MQKL 2BVUA 4JQXC 1FZOB 4PP2B 3QIWB 2OTWA 3T2OA 4WV1C 1NLDH 1U8HB 1ZSDB 1ZGLB 4LHUA 1BEYH 3MUGB 2I27N 2MTPA 3QG6B 3ARGC 5I17B 1RUPH 5A43C 1J0KA 4I48A 5KOVC 1WEJH 1FRGH 5FYLH 5ITBH 2NQCA 4JVPA 5IVXB 2CK0H 4YIQA 5D7IE 3DUUB 1J5OH 1NCWL 2LAAA 5CCKH 3CVHL 4QNPF 2ED8A 1IQWL 4RNRB 4J2XA 1T83C 4ZSOE 3BRGC 5HHOA 3B4NA 3BI9X 3LSOA 1MJ7H 2VN4A 1VCAA 3BJLA 5EO0A 1A1NA 2XTJD 4LCWE 1E6OL 5F9WC 1K8IB 4FQPA 4ZDHB 3FQUA 5E94A 1QUNA 4KDVA 4GSDL 2HT2D 1IEAA 4RDQG 4G5ZH 1KCRH 3O8XB 4GKOA 1JK8B 4OF6A 5FYKU 3HUJE 1SEBA 2QQLL 4R7DA 4JO3L 4PRID 4ONGH 5C0AA 2RFXA 5DURB 4ONFH 2EXWD 2UVEA 3BISA 4U6XA 1U91B 1K8DA 5E2WL 3EZJB 5FM5M 3MBED 4LLUA 3VFVB 3KYMA 1OB1B 2X4RA 5ACZA 4PUBH 1TQBB 3R0NA 5J6GA 5ID0B 2R1XA 3QUZC 4RMSA 2BSSB 5SWZB 1GOFA 3MJ8A 5EOCL 2XTLA 1T0NB 2ZUQB 2OP4L 1UKSA 1FIEA 5FGCB 2Z4QB 4MDIA 4NCDA 3RL1B 3GBLA 4Z77A 1KCUL 2QBWA 3GSNL 4G9DB 1CLZL 3EO9H 4MYWB 1KT2A 3IDXL 4JFQA 1ULVA 5BQ7A 4UI2A 3UTSB 3JXAA 3FN0H 1CYGA 1WK0A 3ZKMD 1C7SA 1JZ2A 3G6JF 3QXAB 5DJ0A 3QEQA 3RJQB 5C08A 2BXYA 1FL6B 3QNXA 4L8DB 5E9DB 4XWOC 3QUKB 5IV2B 1P7KB 4RISH 2OR9L 4YBHA 2OX5A 1AD0A 1U58A 2NY1B 3UAJD 1ZT4B 2Z8RA 4MMXC 4FQXA 3IVKB 1CFSA 2ICCA 3CAFA 3HMXL 4Z76B 4A6YL 2DQCH 2VITB 2V17H 3BZFB 4LCCC 2CUIA 5C0CB 1DR9A 3ARED 3DBXA 4XCEA 2ICWA 4FQIL 2A1WL 1K9TA 3EDJA 2B4CH 2ITDB 3EYFA 3UMTA 2P47B 4KJQD 3DMMC 3QWOA 1YN6B 4ZFGH 5L2KB 3CLEL 3VI4F 3RJDA 5K9JL 1UM6H 5ICXA 1MRDL 2BXZA 2BJML 2OMBA 4GQ9H 1AE6H 4TSCH 4Y2DB 3MV8A 4WFED 1FVDA 1KJ2A 3LEVL 2W9DH 1FDLH 1IKNA 5E8OB 4OIIH 4YBQD 3PQYD 2LV4A 4M9OA 1CVSC 4OM0L 4L29B 4N5EC 2YN5A 1BQHB 5K9QI 4L4VA 1OTTD 3ORJA 3SDDB 2J12B 5E24E 4JAMB 2DQEH 4Z0XA 1FPTL 3JV4A 3WXWH 3FRPG 3QNYB 3HE7B 5F9OL 4L3CB 3OKLB 5CGYD 1MWAB 4Z7NF 2HFTA 4IBLT 1V7NL 3KLHC 2BP3A 1XIWD 4LVEA 1T20A 1U8MB 4ZTPH 3PWPA 4ZUSB 3VXMB 4JPIB 3TN0A 2VL5B 4P23B 5ESVB 2Q6WB 3MLTA 2AJ3B 1K5NB 3NVQA 1OAZL 1EHXA 4M1CC 4JN2B 3QIBC 1NMCC 2XNAB 3HR5A 3MV11 4DW2H 3D39D 4TVPH 5EU6E 2VXVL 3BVNA 4PY7A 1NMBH 4FXKB 5DEZA 4GKZA 2G2RB 4RFEA 2YN3A 1JYXA 1B4JH 3R8BB 1AXIB 1K4CA 4PRDA 3HCVA 4KVCL 4KGLA 2APXA 2AP2A 3L3JB 2BZDA 4FFVC 4R4BA 4ZXBC 1O0VA 4KVNL 5DEGB 1UVQB 4G6AD 3GSXB 2P7TB 4HMCA 4DGYL 3SGDI 4KXZI 3MJ7A 2YRPA 2X4OB 4P4KB 3R0MA 2I5YH 3NFSL 3RWIB 3O3AB 4WW2A 3QUYA 5JXAL 2X9YA 4H5SA 1U8OA 5BXFB 1ZLWK 2EDXA 1GGUA 3GHEL 5FK9A 1P4LA 3DJ9A 4OD1L 3FFDA 3ARDA 4R90L 2VLJE 4MNHA 3C8KA 1A4JB 2IPTH 1FNGA 2UYLB 2K3TA 2P5EA 3T3PF 3NCFB 1G9NL 4YK4C 2AW2A 1T1XB 1C5CH 4L4TA 1VFUA 2XWTA 5GZNC 1NKRA 4G8GD 5EU4A 3BQUC 1NDMA 5J3HD 1N64H 4X6DB 4UU9A 4ZFZA 4WWKA 3D48R 4PJ7F 4FQ2L 5JPNA 1FORH 1J8HD 1CFTB 2Z35A 1E4KC 2EXYD 3T1FA 2W9LA 4PRHB 3D85A 3QA3B 5C7XL 3P0VL 1XF3A 3QJHB 1QBBA 1MIMH 3TJHD 4GXUN 5B8CB 2NY0B 5HY9B 4M9PA 3TVMD 3SKOA 3DROA 4XP6L 4HK0A 1A6WL 1A7QH 3KPOB 5F7WC 2HFFB 4EI5A 1J1PH 4WI8A 2VXQL 3ARBC 2BERA 4NKIH 5HXMA 4Y8AA 2YUZA 5CEZH 3TO4C 2Y7QA 4KTDL 1RIHH 1TLKA 3RA7H 4YXLL 5I73C 3C2AH 5HGHA 3H3KA 4QGYA 4HQQH 2UWEA 2X9XA 3OB0K 4LSVH 4LCUB 5IM7A 4MA1C 5D4QA 1WBYB 2P8PB 5CJXA 1RZFL 3HAEH 2G60H 1MH5B 2FYYA 3E3QE 4PJAA 1NAMB 3EGSB 4UTBL 4OBSA 4NZUH 1DJSA 4YDIL 2W60B 2W0PA 4YQXH 5CBEB 3PV6A 3HS0B 4Y1AD 1AP2A 3ZKND 5HYSA 1ZHNA 2DB8A 2XWBB 4C56A 4ZQKA 5DD0H 3O11B 1ZHKA 5DRXA 1W72A 2D7NA 4Y4HD 3BZEB 4KI5C 1KLUB 1NDGA 5D5ME 2YA0A 1T6WA 4LEXH 3I6GA 3K74B 1BZ7B 5K59E 1AHWB 2DLIA 4AEHH 1FZOA 4PP2A 4TPRH 2HTLC 3RZCD 3O6MH 1Q9OA 5C0ND 3WFDL 3MREA 3ARYA 4JM4L 1UZ8B 2R2HB 3QIWA 3WNNA 3B2VH 2LAGB 1PKQB 4QOKB 1ZSDA 4EUPB 5D71L 1LO0H 2YXFA 4G7YH 5I17A 3QG6A 1OCWL 1WV7T 2MJWA 1AY1L 2XA8L 4HGWB 3DXAE 3V7AE 2QSCH 3OKMB 2VZOA 5FECB 4K3DH 3NZ8B 3EO1A 4MJID 1ES0B 4XBPA 3IDMB 3LS4H 3DUUA 4JZJA 4RNRA 2AVGA 4N0UE 3F7QA 2MCPL 4I9WE 1MVUB 2NTSP 1MAKA 4ZS6D 3IJSB 4HSQA 5T1DL 5FCUL 1UZ6F 3NCJH 1T2JA 5MI0B 4M48H 1K8IA 4NGHL 4UDTA 5DHVB 5HPMB 1ZANL 1RJYB 4KKCC 5D93C 1P9MA 4AL8L 4EN3B 5C0FB 1GZQB 1AKJD 4I1NB 1P2CA 5CZVL 2EDDA 5EC2B 3T1WA 4HUWB 1GGBH 1JK8A 3WDHA 1CGWA 5IMLB 1I3UA 1MJJB 4LPXA 3G5ZB 3C09C 3T0EC 4K9EC 4Y89A 5TE6H 4EQ2A 1R3LB 2K1MA 3QCUH 1YJDH 5GGSY 1Z3GH 1N0XH 4X0KB 1I75A 2QL1A 1U91A 2F19H 1DBJL 5DQDL 3CLFL 2B1HL 4IIQB 4JDVA 5MHSD 1OB1A 1G0DA 4GS7C 3ILPB 2ZCKL 5ID0A 1MCOH 4H0IA 4JY5H 4YDKH 1JMXA 4AMKL 4IRJB 4Q2ZB 5SWZA 5CD3B 2Q8BL 1T0NA 3LDBB 5GSVB 3MUHL 2Z4QA 4CDHA 2BNRD 2PYEB 2FBOJ 5GRJL 5I71C 4QWWD 3RL1A 5H2BB 1BF8A 3WXVH 5C6PB 4YFLF 3HNVH 3N0PB 1KIQB 2OL3H 3THML 4JO2L 3BZ4B 2D9QB 3IB4A 3IDIB 1ACYH 1BFVL 1QZ1A 5CSGA 2LFGA 3QXAA 4Y4FC 4L8DA 4KTEL 3BN9C 5IV2A 1P7KA 2PXYD 3OJDB 3ZDXF 4N1HB 3WD5L 3TBYA 4QXGL 5HHMB 3SQOL 4KZDL 2Q1EA 2ZZUT 4UT7H 1RIUH 4OIAA 3G04B 2VITA 3BZFA 4M43L 3FT2B 3TNMB 3MV7D 4YHIA 1PZUB 3RVWD 5I30H 5C0CA 3Q2CA 5DWUH 4WO4C 3C5ZD 2CIIB 2EECA 4YR6B 3VI3F 5L2KA 1S5IL 3GIVA 3NGBB 1YEJH 3CNKA 4HJJH 4WHCA 4YHML 4TSAL 3RGVC 1P7QA 4Z7WB 2BNQB 4XVTL 1NGPL 1CTNA 1EHLL 4O00A 1N0LA 3NCEB 3MRBA 3HZVA 1T66D 3VFRB 2W91A 1Q1JH 4KJPC 5E8OA 2A9ML 3K8LA 1WICA 4J3VA 3C6LC 4ZUUB 3WSQH 3EKCA 1BWWA 2YD1A 1CTOA 4R26L 1JZ5A 3SDDA 1MRFH 2CK2A 4KMLB 3S3PA 5DJAB 3EDDA 2AK1L 2CLZB 1IFHL 4L3CA 3OKLA 3IAGC 1MWAA 1KTLB 3LN4B 3U1SH 3I2CL 2YPLE 1TVBA 2FSEB 3D25A 3A6CH 2DD8L 3OAYK 3KDMB 1M1SA 1N6QH 4R4ND 5DJCB 1X5HA 5F7HA 1L0QA 3ARXA 4MAYD 3VXMA 4ZUSA 2VL5A 1JNNH 4P5KB 3SDAD 4JKLA 2Q6WA 4B5EA 2AJ3A 1JF1B 1CZ8L 1QPXA 2M26A 4JN2A 3HR6A 2XNAA 2APBA 1BIHA 5B21A 1DLFH 3MRLB 4HUXB 1CF8H 3T09A 3X3GL 3UBXB 1NEUA 4FXKA 2G2RA 5KW9H 2LVCA 4JFOA 5D6CB 1BM3H 1J9CT 5EFIB 1AQKL 1ZLSL 3W39B 4BA8A 5IQ9B 4MXQC 4NWUL 4FQJL 4NM8L 4K94L 1RURH 5A2KH 4GAGL 5DEGA 3CDFA 1VPOL 1UVQA 4DZBB 2VXSL 3U4AA 3GSXA 3I75A 2FO4A 3UJTH 4JO1L 3ULVD 4YZFE 5IQ7L 2X4OA 1LK2B 5BVPH 4R0LC 3HZKB 2AJSH 4HC1H 2AEQH 4S1QL 5KVFL 3E8UH 1NJ9B 4LVNB 1O7VA 1DCLA 3EYSH 2E7LC 5DDHA 4CNIB 2E7BA 4DAGL 4U1LB 3AS0A 3O4OB 2JK5B 4PIRF 2DWEB 1MQKH 1LO3L 4XP1L 3QHFL 1A4JA 4RFNB 1XMWA 3QIUC 2RCSL 2UYLA 2WIIA 2DJSA 4QEGA 4NO5A 3QPXH 1LNUB 5J11B 5E4EC 2EDRA 3AU1A 1FN4B 4YO0A 1FGVL 1CL7L 3DNKA 3ROOB 2DIAA 1G7JB 3H7BB 3LQZB 3QNZB 4K7PX 3UZEA 2E6QA 3HZMB 1ZT1B 3MRMB 1KGCE 3CVHH 1MRCL 2R29H 1CFTA 1NCAL 2HN7B 4M6AA 2NY5L 3QJHA 4DFIA 1Q9KB 4XPFL 1OP9A 1T0MB 3VFMA 2R69H 5HY9A 1E6OH 3RUGE 2P8MA 4U1JA 3GSQB 1JCKA 1UACL 3KPLA 1C08B 2NY4D 4K55A 3VXRE 6CGTA 35C8H 2VR4A 3DHMA 3ARZA 1J7VR 1X3DA 2AERT 1FZKB 3QDJD 3A6OA 3VWJB 4NZTL 4TNWK 4DTGL 1VDGA 4YX2L 3QUXB 2O5YH 4JO3H 2EDJA 4FZEH 2DS4A 2P8PA 4NRXB 4CMHC 4HD9A 4FA8A 3O3BB 1UXSB 5E2WH 5JW4N 1WAAF 2QADB 4PG9A 1QOKA 1BHGA 4RGNB 3RZWA 2W60A 4OZFH 4JKPH 4TUKL 5FYKD 1LD9A 5CBEA 3QDGE 3HS0A 4K2UL 1H3GA 3JWOH 2DQTL 3FL7A 5EOCH 4TUOA 4ODXB 3L5IA 2OP4H 4PRPB 3MLWL 4NHUA 3VCLA 2C3HA 3WNKA 3BZEA 4X5WB 4G6FB 2ZG1A 2IAMB 1GOGA 2PUQT 1KCUH 4LF3B 1BZ7A 3KJ6H 3GSNH 4XP4L 1N2RB 2V5YA 3IDXH 1GYAA 3FQNB 4I0PB 2Y5EA 1EK3A 1UZ8A 2R2HA 4I2XA 2VLKD 2XN9D 1QRNE 2QQNH 1PKQA 4QOKA 1U8LB 4EUPA 4PD4J 3HG1E 4E41E 4HGWA 5GGUB 2EYSB 3MFFB 2EIBA 2OR9H 5FECA 1Z5LA 3AUVA 5LBSL 4ZUTA 3OJMB 3BSZL 3IDMA 4UDUA 2FLBT 3LB6D 4RX4D 4A6YH 4ELMB 5DJXA 5IUSA 1JRHI 1TZIB 1OTSD 3B9KD 4FQIH 1DZBA 2A1WH 4X4ZA 5EH1A 1MY7A 3CCHB 1SYVA 4OGYL 3QDMB 1LEKB 3CLEH 3MACL 3O6LH 5TDOB 5K9JH 1B0RB 5GJTL 1MRDH 3QO0B 5DHVA 3VFSB 5A3IC 5HPMA 2E8YA 1RJYA 4UQ3B 3T2PA 4NKQB 2BJMH 4EN3A 1GZQA 4QXWA 4C54A 2C4XA 3T0VA 3LEVH 2FECI 4QRSB 2XWJB 4IEFB 4PJ8C 4XNZC 4G9FD 1MJJA 4X8JB 4DOHE 3DV4B 3I9GL 3G5ZA 1JRHL 4OM0H 3CUPB 1BLNA 1UG9A 1R3LA 2YR3A 4ZPTB 4O2CB 3DO7B 4ENEC 2R2EA 5HGBB 5KSBF 1FNSL 4M3KB 4X0KA 1RZGB 4U1GB 1T2QL 1FPTH 1AO7D 2DL2A 2CRIA 4IIQA 4KUZL 5F9OH 4DKFL 3FZUD 2A6JB 3VGBA 4QRRA 3RRQA 5FOBB 1G84A 1V7NH 2CKBL 5B4MC 2VZ3A 2PYFB 3LOWA 4M5ZL 1A9EB 2FECL 1FNAA 3RHWF 2X6MA 4IRJA 1BX2A 3C60D 4Q2ZA 4PJHE 3SPVA 1QFUH 4V2CB 1P69B 5ESAA 2ADJA 3H3BC 4E42A 3VDCA 5GSVA 4MGXA 1OAZH 2B2XL 2PYEA 3UPAA 1RMFL 5GGVL 3CD4A 1NGWB 5IMMB 2PNDA 2Z0BA 4UAOB 4GKNA 1D7FA 1L0XA 3VXUB 2Q87A 4K3JL 5SV4A 1KIQA 1LP9A 1EEYB 4S1DD 1FL3A 5AAWA 5I1LB 1MVFA 2FJHB 3BZ4A 1IBGH 4KVCH 4P3CL 1FYTB 3OKOA 3BDXA 5DYOB 4KVNH 4F7EB 5E8NB 3NH7H 1RZ8A 4P2QB 2P8LB 2B8OT 3OJDA 4DGYH 3EOAB 1ZLWH 3ULUE 2Q7YB 2QSQA 3MFGB 2YHGA 3NFSH 3FT2A 2FBJL 1W0YT 3SGKC 4D9RE 5F96L 5JXAH 2R4SL 2CIIA 2C3XA 4WI4A 4YR6A 4X7DC 5MEPB 1A6UH 1JWUA 4FQXC 1YYLL 1TVDA 3V8OA 4Z7WA 2BNQA 4HW6A 3ZKXB 2FDBP 1XGUA 2GJZB 1CICA 2PW1B 4FG6D 3KPNA 4JFHD 4LLQB 3SGDH 1G9NH 4KXZH 3KVQA 4KKLC 5A16B 4KQ4L 1NUNB 3ZYZA 5MP6L 1GC1L 3G6JB 2R0ZL 3KLSA 5EPMB 3V52L 1FYHB 4PB0L 2OZ4A 3X14A 4U2YA 5IMOB 3STZB 3V2AR 2NY2C 4ZNEA 5DMGD 3QXUA 3NIDE 3HRPA 4FQ2H 3QR2A 2O93L 4LQFL 4QHUB 5KSAB 2VLME 3IFPB 3QHTC 3V7AG 1IKNC 5C0IA 2AXFB 1BWMA 3P0VH 1KELL 1KTLA 3JV0A 4HK3J 3C6SB 1A6AA 2AKRB 3LZFL 1M6OB 2ESVB 3KDMA 5DJCA 1WF5A 4CBPA 4XP6H 2Y9RT 4NQCB 2FR4B 2W38A 4HAFA 4LCWD 5HHVL 5KZCB 1TCMA 4HC1A 4HS8L 3ES6A 1JF1A 1KXQE 3OKDB 3TV3L 4LSRL 2F54E 1IL1B 2OS7A 2P5WE 2JJUA 4H8WC 1H8SA 4XPTL 5C9KA 2XQBL 4HUXA 4OJFL 4KTDH 4XCYB 4YXLH 2BCKB 3UBXA 4P4RB 1I7ZB 5K93A 1DVFD 3EDKA 3TN0C 4HF5L 4LQ1A 5DXWA 5D6CA 5EFIA 3W39A 4RQQA 4HMEA 5IQ9A 1BPVA 2CJUL 5FYJH 3ZE0E 4Y5VB 4NQXB 4BFEA 1RZFH 1AJ7L 4TTDC 3NFNA 4JR9L 1Z9LA 3ZTNL 1KLFA 4DZBA 3EYQD 4HGKC 4UTBH 4YDIH 2PTTB 1XT5A 1LK2A 1AH1A 4LU5L 2JE8A 5HDQL 3HZKA 5CILH 2X89D 32C2B 3LQAL 5D1QA 1NJ9A 2ED7A 2HKHL 2IADA 4L4JA 2EKSA 1TMCB 2HMID 4PJ5D 5DFVD 3MOQA 2GI7A 1S78D 3CVHA 3QEUB 15C8L 2NW2B 4CNIA 3DGCR 3IDYB 2C5DC 1BFSA 1M4KA 4OGAD 1ZEAL 4U1LA 2EEDA 5TQ2L 2JK5A 4NBZB 4Y4KD 2AAVA 3BEWB 5IT2H 4WCYL 1SY6L 3WFDH 2PO6D 4WW2C 5F7KC 3FOLB 4M7ZC 4XI5D 1R3HB 3TA3B 1P4IL 1KTRL 4BQ8A 5D71H 5GPRA 1FFPA 4RFOH 2HJKA 1OCWH 1AY1H 2XA8H 3ARDC 3ROOA 1GL4B 5ESQB 3H7BA 3PXHA 3LQZA 3QNZA 5T1KB 5CKGA 1X5GA 1CXKA 3OKKB 1IAIM 4PJEF 2DLHA 3MRMA 4Z7UF 3BYYA 2HN7A 5IROC 2CGRL 1YMHB 2EZ0C 2MCPH 1BVKB 5D1ZB 4EI6A 2EE2A 3B3IB 3OG6B 3P40A 4JG0L 1V5JA 5FCUH 1T0MA 1QFWM 2MNUA 4NO0B 2NYYD 4NZJA 4OZFA 1MFNA 5ILTH 4NGHH 4M4RA 3CH1B 1ZANH 2WK2A 2J8UF 1S7UB 2H32B 1OSZB 2QQKL 5FXCH 1Y18B 2A83A 3GSQA 5CZVH 4HJGB 1FFNB 3A67L 4G42A 1V8HA 1INEL 4G6MH 1RUKL 1FZKA 2VABA 3VWJA 3WJJC 3QUXA 5KOMC 4FQ1L 2AGJL 4JY4B 5E5UB 2X4NB 4PJ7B 4PRNB 4AIOA 4XNMB 1ZLUH 5ALCL 1G0XA 4NRXA 2E5EA 1KB9K 3BKCL 1DBJH 3E2HB 3RAJL 3O3BA 1UXSA 4ISVB 2B1HH 2AQ2A 3VXSE 5D9SB 4OLUL 1ZT7B 2VDNL 2ZCKH 4OF3A 3ME0A 5CLTA 1DN2A 1I4FB 2ERJC 5IFJB 3HMXA 1AGDB 3KJ4C 2Q8BH 3L3DB 4JEGB 4PRPA 2DN7A 5LAXB 1N3NA 1T5WB 5GRJH 4IMLB 4PLKC 4X5WA 2IAMA 1DUYA 3NBNA 2GQHA 4ZOCA 1KG0B 4LF3A 1NBYB 1N2RA 3THMH 4JO2H 4Q9QH 3FQNA 1UM5L 4HS3B 3O9WD 3ALPA 4KRPB 5DVNA 2OXGA 2VDOL 4PJ9D 5IW1A 1BFVH 1S7VA 1U8LA 2XT1B 4KH2A 4RDQF 3CJJA 1JPGB 4KTEH 3NIGF 1NC2D 5GGUA 2EYSA 1JPTL 1S7RB 5HHOE 3GGWB 4HKXB 3QDAA 3WD5H 1BJ1H 1R3IL 3RIFK 4QXGH 1I3GL 5F7LB 3SQOH 4KZDH 3VFTB 3MNZB 4ELMA 5FB8B 5IJKA 1B0WA 4M43H 3VWKC 3S88L 2EDQA 3V6ZB 1TZIA 3S96B 1KB5L 3C8HA 2D0HA 4P46B 3GM8A 1Y0LB 4C58B 1JV5B 5DTFB 4J7RA 1A7PL 3EO0A 4FTVE 4YFDB 1LEKA 1S5IH 1B0RA 1UQSB 3QO0A 4YHMH 3VFSA 4UQ3A 1IGYB 2N56A 1EERB 4JZJC 2ZCLL 2DI8A 4XVTH 1NGPH 3GJFB 3VE0B 5BMFL 3QXVA 3D2UA 5C0AE 4QRSA 2XWJA 4X8JA 2A9MH 5HJ3B 3NZHL 4LP4A 3L6FB 3TZVC 1I85A 4CGTA 4KV5E 4ZPTA 4XVUC 3DO7A 2IANB 4R26H 3OAYH 5HGBA 3K2MC 5EUOF 3T0DA 2PTUA 4HKZB 4ZAKD 3VD9A 2W0KA 2F53B 2A6JA 2C7UA 5FOBA 2D4DA 3QO1B 5HGDB 1L6XA 1A9EA 4WUKL 1G6VK 4U0RB 1NUFA 3QXWA 4C83A 3L5JA 3SHSA 2KZ1B 3WUWB 1CZ8H 4RGMC 3VH8G 4WFGE 3G5VB 4Y5XA 3CX5K 2IPKB 2D3VA 1NGWA 5IMMA 3EOTL 2NXYD 4LEOA 4KROB 3ARSA 1CG9B 3PL6C 3VXUA 1UJTA 1U3YA 1OAQL 3UYRH 3QEQE 4P2RA 5C08E 1EEYA 3TNNB 2FJHA 1DDHB 1AQKH 4F2MA 1FYTA 4FQJH 3CSYA 5F89B 4NM8H 2VXUL 3MLYH 4K94H 3E0GA 4HBQA 4B53A 1M05A 4XT1C 5DYOA 2B4CC 1PG7L 4GAGH 4F7EA 2NPLX 1MI5B 5E6ID 1JHKL 1GHFH 2VXSH 2ITCB 4WWID 2E9WA 4JO1H 3EOAA 2BC4B 5GGRA 5IQ7H 4XC1H 1HZHL 1A21A 2WWKO 3DV6B 5CP3H 2Q7YA 2GIYA 4S1QH 5A2FA 5KVFH 5DA0B 1K85A 1NFIB 1JGLL 3ARGD 2FX7H 4MAUL 3F6IA 3MV8E 1K3IA 3LEXB 1MELA 2NY1C 5MEPA 4K7PY 1AD9B 2JB5L 2BRRL 3LMJL 4QRTB 1OM3L 1LO3H 4XP1H 2IMMA 2GJZA 3QHFH 2PW1A 2RCSH 43C9B 4UTAL 4KRNA 3RP1A 4L4VE 2Y23A 3GSWB 3O2DL 4JRYB 4V1DD 5I1GL 2HFEA 4I13B 2OYPA 1OAXL 1FGVH 4LFHG 1BBDL 3MUZ1 4MJ2A 4R97B 3V7MA 3RWJB 5KSAA 3OKNA 5DJDB 3PWPE 3IFPA 1NCAH 5DA4A 4EBQL 1DBKL 1OP5K 2NY5H 5D7JC 5M95B 3SDXF 4J1UB 3IDJB 4XPFH 4OD3L 4QCIB 2ZNXA 1MUJB 5EWIL 2W07A 1DQMH 2FIRT 4NQCA 1FGNH 2FR4A 3QFJD 3NA4A 4ERSL 4M8QB 4Z0BL 3OKDA 3T4YB 1XAUA 1UACH 4JPKL 4NFCA 4U3XA 1IL1A 1Q9WA 3S4SB 5DRZB 4GRLA 4U1IA 2V6HA 3ULVF 4KU1A 4N9OB 4XCYA 3SKNB 2BCKA 3GKWL 4LK4A 4NZTH 4WU7B 3RPIB 4DTGH 4AQOA 3O3DB 4YX2H 4ZFOL 4L9LA 2HRLA 5DJYA 3WEXB 4X7TB 5JOEA 5AD0B 1GGIL 3PGCB 4NQXA 1EEUA 2ORBL 3P30L 3K81A 2CH8A 4YHYC 3BAEL 2CMRH 2PTTA 2EEAA 3JWDC 4TUKH 3REVB 3IXAA 3S5LG 3PHQB 3NCYP 2J2ZA 5FEBA 3RI5K 4K2UH 2VXTL 5IHZB 2DQTH 4JZNB 1WBXB 4M6MH 2X5PA 3QEUA 4XWOD 1J87A 2E8ZA 5JIPA 4HS6A 1HXYB 5ELIA 2R1YB 2AV7B 2NW2A 2P5EE 2Q3ZA 1YNKL 4KDWA 1RUML 4L4TE 2IFGA 3BEWA 3Q5OA 5FAAA 1OQXA 4XP4H 4MNQA 5HYJA 4X6CA 1A22B 3DMMD 3FOLA 1X4YA 4APQB 1UB5A 1ZHBA 1R3HA 3TA3A 4U6VL 5JLZA 1SM3L 1CDHA 1J1XH 2NNAB 4IOFD 5LJYH 5F3HA 5ESQA 2BY2A 4M62L 5T1KA 3OKKA 4PGZA 5LBSH 1V3MA 4PRBB 4KI1A 4RSVA 1A6TA 3MR9B 4GG8B 3BJ91 1YY9C 3DIFB 1YMHA 1XGQB 1BP3B 2NX5A 4N5ED 4X9GA 5D1ZA 3T3ME 1OAKH 5DD5L 4OGYH 3QFDB 3CFKB 4NO0A 2CKBB 1S3KL 3BPNC 3KPQA 3MACH 1N5YL 5GJTH 2FJGB 3CH1A 1S7UA 4HWBA 1P6FA 3GMPB 2UWEE 4LNRB 4EQ3A 4F57L 2RJMA 5I1JH 3ZTJG 5L8JB 4ETQB 2R2CA 1PY9A 4LRIC 4U49A 2F58L 4HHAB 5BJTA 4PJAE 5IBUG 1HNGA 4LOUC 5JW4Q 4LDOB 4JY4A 2X4NA 4MD4B 4PJ7A 4PRNA 1FNSH 3QIBD 2OSLB 4MCZB 4JFDA 3CFDB 3U46A 1T2QH 4LDEB 5F7UA 5FYLE 4KUZH 1GXEA 3JUZA 1BD2B 1I1FA 5D9SA 3T0WA 4C56E 4MA3B 2BK8A 4M5ZH 2AJUL 1GAFH 4OFKA 1I4FA 1YNLL 3QXTA 3SCMB 5GZOC 1U8PB 2DKUA 1AGDA 2KZWA 4FFVD 4JM2C 3L3DA 4ZXBD 2Z31B 4HFWB 3WIFA 5IVOA 4JRXB 5LAXA 3WO3B 2B2XH 1JPSH 1RMFH 5GGVH 1DL7L 1OGTB 4P23D 2YD5A 3RWFA 1KG0A 2NY3B 2IALB 2KQMA 4NC2B 4PJDF 2GY7B 4MLSA 5DJ8B 4HS3A 4HPYL 1WWBX 5DJ6B 4QRPB 3N1PC 3WNMA 5IB3A 1JPGA 3SN6N 2BRQA 3LKQA 3BXNA 1NCCL 4KDTA 3ARPA 1S7RA 3GGWA 2W92A 2DQFA 3KAAA 2ENSA 3TH2T 2EEBA 1B3JA 1RJZB 1H5BB 1WIUA 1T7XA 3S96A 5GZND 3N06B 4P46A 3ULVL 5F96H 3VD5A 1JV5A 5DTFA 2R4SH 5DI8A 5F6IB 3O45B 4Z7QF 1UQSA 4Y5YB 1YYLH 3DVIA 2B39A 1IGYA 4LPYA 1YJDC 1CXFA 4Q58C 2QHRH 3W9EB 3GJFA 3VE0A 1D5XB 4KY1L 5FHBL 4PD4K 3WNLA 4KQ4H 4OV5B 1MCPL 1GC1H 3ET9F 2BVQA 5MP6H 2R0ZH 1QSED 3QWRA 4XB8A 2WW8A 4C4KO 1QNZL 3L6FA 4PB0H 1SJVA 4Y7MA 3WBDA 5EIIB 2N4IA 3ARBD 5I1DB 2IANA 5IFAH 1K6QL 2IFFH 3BHBB 4LQFH 4DVBB 4N90D 4OLXH 1A7OL 3FB5A 3MRFB 4HKZA 5SWZE 4U31A 3SDYL 2F53A 5BV7L 1KELH 4UBDC 1GZPB 5FGCE 4PRIB 3QO1A 3BPOB 5HGDA 3LZFH 2M2DA 2VH5L 1BGXL 1PY4A 2F8VA 4PYHA 5SV3A 3C08H 3WUWA 4HS8H 2NY0D 3G5VA 3MCKA 4IIQC 4LSRH 3ARUA 4PP1D 2PR4L 3CH8A 2IPKA 4AIZB 5E70A 3BWAB 2F5AL 2EE3A 4XPTH 3VXRD 2XQBH 1CG9A 5HDLA 3V0AC 3ULUL 2EH8H 4X9HA 4NRZB 4MSWB 4QTHB 1DDHA 5KSBB 5L0QB 2YSSB 2CJUH 1DANT 5F89A 4KI5D 4HT1H 3V6OC 1AJ7H 2ARJB 3ZTNH 5TGBA 1MI5A 3BP6A 1SYSB 4UV4L 1QKZH 3QJFA 5C0CE 5K9OB 2ITCA 2HTLD 4G8FB 1D5IL 2XY2A 5HDQH 3DV6A 2X1OA 5L2KE 4IOSD 3LQAH 2E9BA 2HKHH 3Q1SL 4B7IA 1NFIA 3U6RB 5FYKL 3BE1H 3RL2B 2DLTA 4K8RL 3RBSA 15C8H 4CKVX 2WLZA 3LEXA 1N4XL 1OAYH 3FFCD 1ZVSB 1ZEAH 1AD9A 1DFBH 5TQ2H 2VZSA 3MCG1 4N0FB 4QRTA 3IJHB 4KK9C 1EBAA 4OZIF 3PDOB 3LN9A 3AREB 5D7IF 2COQA 4JGMA 2ZSWA 4TVPE 1SY6H 5DC9B 43C9A 2E7MA 1L7IL 4LFHD 3WCYA 1JHTB 4LSQL 1P4IH 3GSWA 1QRND 4JRYA 4JPVL 4WFHD 1TPXC 5EIVA 4K23L 1BFTA 3NGBC 1AGBA 4KKCD 3O41B 4M6NH 1JFQH 2VIRB 4S1RL 1IILE 1BQLL 5E5MA 3H7LA 4M61B 1Z0MA 4XPHH 1F3JA 1CICC 1QP1A 3EJZD 3RWJA 5B39A 2GTZA 4WHDA 5E95B 5DJDA 5FV1L 1EHAA 3VXME 1AGFA 3T0ED 2M8XA 1MHEB 5HVFB 1CDYA 4NN7C 1NUGA 4J1UA 3IDJA 5SWSD 1KCSL 1MUJA 3J7HA 4F9PA 5TDNA 3U48A 4M8QA 4LASL 3F58L 2QQKH 2VDPH 4GW5B 3T4YA 1OLZA 3IFNL 4GMSL 3S4SA 2OLDA 1INEH 1IGTB 1L9NA 2DQDH 4MA8L 3SKNA 4D0DB 1ERNA 4WU7A 3WFBH 2XOTA 5IEKA 3O3DA 1GPOL 4X7TA 4FQ1H 2AGJH 2DRUA 1CD0A 3ALXA 4LLDB 5I75B 3PGCA 1RIVL 3T2QA 2XKSA 1WCQA 2RAMA 1B2WL 2R4RL 2AJZB 3BKCH 3D39B 3RAJH 5L88L 4OZGB 5TF1L 1DEDA 4KC3B 4L8SB 4OLUH 3H6JA 3HI6H 1WTLA 3REVA 2D31B 1MAJA 3FKUS 3FQTB 5ACMA 5IHZA 4FZ8L 2AXGB 4JZNA 1WBXA 2HLFC 4Y4FD 1EVTC 1YY8B 5H8DA 5L8LB 1RULL 3BN9D 3OZ9L 2A6IB 1HXYA 1JGUH 2R1YA 1CQYA 1MFCL 5E1AA 1FHGA 1CD1B 5ADPL 2DQGL 2Q76B 2MFNA 2B20A 2WINB 5D1QC 3TYGL 3RU8L 1V05A 3N1GC 5L2JB 4OLVL 1UM5H 3S3SA 4RA0C 3OKEB 4APQA 4JZOB 1JWSB 4WEBH 3MV9A 1NGXB 3GK8L 2DQHL 1XEDA 2HAZA 4QRQA 3O4OC 5IB2B 3U36A 1JPTH 1WIPA 4HH8A 1I3GH 4RFNC 2WIMA 5C8JA 4HJ0C 5FCSH 2WNGA 2G9HA 3MXVL 1WBZB 1GGTA 4GG8A 4XBGB 3DIFA 3PDGA 2NLJB 1XGQA 4G8GB 4GW1A 3VW3L 4GXVH 3EOYG 3WV0A 5GGVY 2ATKB 4D9RD 2EDEA 4HWNA 4PG2C 4WY7H 1A7PH 3QFDA 3FQXA 4KK5C 2CKBA 3DVNB 4H25B 4NJAH 2FJGA 5EC1B 1J8HB 3GM0A 5ENWB 1G7PB 1WC7A 3HKFA 4LNRA 4K71C 3QYCA 5BMFH 2EH7H 2BMKA 4XXDA 2YUXA 4DUXA 1MFBL 3BYTA 4ETQA 3O0RL 1SEQL 1JBJA 3TVMB 5GS2D 2WAHA 5IIEB 1KYOJ 5I74B 5B3JE 4UIMB 1A9BA 1LQSR 4MD4A 1JPST 3S6CA 1F4AA 4PJEB 2OSLA 4MCZA 3SEPA 1MJUL 3IDGB 4Z7UB 3U79A 4TNVK 3UPRB 2OJZL 3UROR 1LEGB 4KMTL 3MBXL 2YK1H 2NXZC 2VLMD 1BD2A 1VGKA 3TFKC 4MA3A 2HKFL 3W11C 5HDOA 4WI3A 1MFEL 3SCMA 3ZE2E 2J8UB 4BZYA 3B9EA 1P84J 2Z31A 4HFWA 4JRXA 3X11A 4BSWA 2UZYB 3GMRA 3I6LE 5CINL 3FB8B 4I2XE 1OGTA 2FH6A 4RGNC 2F54D 5F9DC 3EOTH 1E6JL 2BDNH 2CDEB 5TDPB 3PHOA 4Y88A 3GBNL 1PKQE 1F8TL 1OAQH 4QOKE 1MIEH 3U9UB 4Y1AB 2IALA 3IFLL 4XNXL 5MENA 1BBJA 1LO4L 1S9YA 2D7PA 2UUDK 2NY6C 2VAAB 1Q0XL 5DJ8A 3QEGL 2BVOA 2IGFL 3MMEB 4Y4HB 3RPKA 2NR6C 4GAYB 1YN7B 2VXUH 4QRPA 3KYNB 5SWQA 1PG7H 1Z9OA 4IRSA 2FEDC 1JHKH 4Y19A 4DGVL 3RZCB 4W4OA 3QIUD 5EBGA 5JOPD 2VDML 5D1XA 1HZHH 4EIZC 1HWGB 1CQKA 2NZ9C 1JNJA 1OPGL 1RJZA 2ZG3A 9CGTA 3P3YA 1H5BA 3IRZA 4PJBA 4YC2B 1OAUL 3S3JA 2A73A 3IKCB 4OKVA 4MAUH 3L3IA 1Q0YH 4MHHG 4MJIB 1J0ZA 1TJGL 4RMRA 3VMNA 2P44B 2X70B 1MCLA 2BRRH 3LMJH 2GTWB 1OM3H 2VE6A 1RAMA 3NACL 3W9EA 2DWDB 1D5XA 1RZJL 3QEHB 3VD7A 3V79C 3GRWL 4FS0A 3SO3B 2ZNWA 3O2DH 1F3DJ 4ZMAT 3CZFB 1QHPA 5I1GH 3REWB 2V2XA 1XFPA 1OAXH 3U30B 5J1SC 1OP5H 1BBDH 5KSUA 1AKJB 4HWZB 5EIIA 5I1DA 4QRRE 1M7DA 2ICWI 3BHBA 3RVXC 4DVBA 2I9LB 4ODSL 1OF2A 5T3XE 2ZWLT 4EBQH 1A3LL 3ZDYE 1MHPH 4LGRB 1DBKH 4TVSa 2NTFB 1GZPA 4PRIA 5TQ0L 1I85C 4O4YL 2PYEE 4LVOB 5EWIH 4DN3L 3V6OE 3EYUL 1J86A 3ZE1F 1EZVX 4M1GL 5CKAA 1DLHB 4ERSH 1ZTXL 4U1GC 1MCKA 4Z0BH 1QVOB 5F1SA 1M71B 1WWCA 3MBEA 4LLYA 4U1KB 4JPKH 1LP9E 4P5TA 3R1GH 5BS0D 4AIZA 1IEHA 2H3NA 2YKLL 4NSKB 2Z8SA 4FABH 4JDTH 2DI7A 3GUTB 4WHYH 1S7SB 4NRZA 3F5WB 4ODWB 3VXTA 1GGIH 1FH5L 2BNRB 4JFYB 5KSBA 1P7HL 4Y5XC 5HHME 4WU5B 4AENB 5EUOB 4JHZA 1BQSA 1CDGA 2ARJA 2H8PB 4KJWC 3GI8L 4UOW1 1U8KB 2HVKB 2JLLA 1DSFL 5K9OA 1SYSA 4X9IA 4KRLB 1UENA 3BAEH 5DK0B 2H1PL 3UC0L 4G8FA 2V2TB 3VXPB 4J12A 1YEFL 5K59F 5T1MB 4K3EL 4OI9A 3S34L 3SDCC 2APVA 1T7VA 4YHNB 4BH7A 4LLVB 4P2OC 1RK0B 3U6RA 1G9NC 4OFYA 4W6XB 2BNQE 4HGMA 4Z7WE 2BVYA 2PXYB 4BK4A 4XX1G 4JO4L 1UKTA 4RZCB 4D8PB 1ZVSA 4O5LH 1RUMH 1LEIA 4OLZL 5FIEA 4N0FA 1KTKE 1I1AC 1CDJA 3IJHA 3MV7B 1RPQA 2CLVA 3PDOA 3S35L 3AREA 4X4YB 1YC7A 4PR5B 5SX4I 1KPUB 1S7WA 1N59A 3C5ZB 3H9SA 5GRVL 4ZNEE 2WWKT 4AT6B 4U6VH 5F1NB 1SM3H 4Z7VA 1R0AL 1NEZG 3O41A 3BKYL 4XGZB 2ZOKB 2WUCL 5D70L 5GRVK 1DBBL 3K3QA 2XZAL 4BUGA 4PJ8D 3V4UH 3PQYA 4N8VG 5KVDL 5IGXL 5J89A 4LLWB 5GRUL 2NY7H 2IPUK 3UJJL 5I1EH 5DRWB 4Q6IA 4ENED 4NC0B 1G6RB 5DC0A 3D0VA 3BP4A 4H26B 1S3KH 4EEEA 1N5YH 4O2EB 4FTVD 1MLBA 2ICES 4P57B 4BQBA 3P4MA 4NNPL 3CXDL 1Z9MA 4RAUB 1BZ9B 3MRJB 5DQJA 2AEPL 1OW0A 5B4MD 1XIWA 4MCYA 1NLBH 1IGTA 5TE4L 1QG3A 2ZJSL 4JQVA 2F58H 4OCSL 4MAYB 5HHNA 1CD8A 3SDAB 4QHKI 5DLML 1PX3A 4LLDA 3U4BL 2ENYA 1YPZF 5CJBA 1F90L 3EJYC 4CAGA 4F9LA 2WP3T 5C0JB 2AJZA 3D39A 4GRLC 3BP5B 4F37K 5CWSB 4OZGA 2CDFB 5BVJB 4IJ3B 1JPFB 4L8SA 3SDXB 4FRWA 4M7JL 4D0CB 1TJHL 5AG8A 4L9LC 1X4XA 2D31A 2AJUH 4I3SH 1EUUA 3FQTA 3IFOB 1NQBA 5BW7C 5J1AA 1C5BH 2AXGA 3P9MB 5AZEL 1YY8A 4L1DA 1JHLL 5J4MA 4FFYL 1KB5A 1AGCB 2F74B 5IB4B 1DL7H 2VYRE 2R8SL 1Q9LB 1CD1A 1ADQL 4ORZC 3FT3B 3U4EA 2WINA 4I0CC 4MQ7B 4K9EH 1MNUH 3MNWA 3PWNB 2B0SH 3CFJB 1YEEH 1LDSA 3HFML 3RY6A 3OKEA 4DWHA 4JZOA 2QSTA 4K7FB 1JWSA 1JTTA 4HPYH 3W2DH 2Z93B 5HHXL 5JDSB 1MCSA 4KUCF 3GSUB 4U1NA 1NCCH 1QBLL 4PJCB 3BPLB 2LTQC 2VNCA 2FD6L 1X9QA 5KVMC 4KKLD 1OHQA 3S37L 4XPBL 3BKJL 3TA3C 1WBZA 4XBGA 3RVTD 4G8GA 3BGFC 4FMFA 2ATKA 2Q3AA 2AV1A 1UWEL 2NY2D 5EN2B 4TUJB 1GRWA 3VG0L 4ZODA 3MV8D 4MZ2A 1F45A 4H88H 5EC1A 4F8QA 5SX5K 5D96B 4LRNL 1NCDL 5I1AA 4KY1H 3BKMH 3ARQA 1G7LB 1MCPH 3RY4A 3OX8B 3TVMA 4GRWF 3JV6A 1QNZH 4U6TA 3MROA 1GJIA 1E4JA 3DUHA 4UIMA 4RGNE 2NY4B 1AXTL 1WWWX 1IKFH 1K6QH 3BH8A 1KF9B 3PWLB 3IDGA 3LN5B 1A7OH 3UPRA 1LEGA 3QDJB 2P46B 3D9AL 3SDYH 3LQMA 5BV7H 3PWPD 3TN0D 4PRPE 5CSZB 4HZLA 4QRUB 2Z92B 2VH5H 1BGXH 1OLLA 5D7LD 2DMCA 4TTDD 4NM4H 3BDYL 1EO5A 4MWFB 4IDLA 1HQRB 3DX7A 5FA3B 3FB8A 3WNPA 2CDEA 5TDPA 3VG9C 5FKPB 2C1OB 3ULUH 2X05A 4MXVE 3G5YB 4YZFF 3U9UA 4Y1AA 3FB6B 4G80B 4TN9A 1ZOXA 2YPVL 5FM5O 2VAAA 5KS9A 1KTDA 5EIQA 3KPPB 3K46A 2Z8VC 4N1CA 3MMEA 3AY4C 4Y4HA 4JQIL 5CJQL 1YN7A 1YEDB 4ELME 3CDYA 5GS1A 2GK0B 6FABL 3O2DA 1YMMA 3JTSB 1D5IH 1FSKB 5H94B 1QACA 2VLKB 2XN9B 4P9HL 2FGWH 5E8EA 2W65A 4CMMA 3Q1SH 1T21B 1YEHH 4JFFD 1TDQA 2YD9A 5GS2H 1OT1A 1VEMA 3U9PL 4KK8C 3IKCA 4K8RH 4KDTC 4MJIA 1N4XH 2BY1A 2R1WB 4POUB 1QEWB 2X70A 3KR3L 4XVSL 1OTUC 3FHAA 4NO3B 3RQ3A 2GTWA 4L4TD 3B9KB 4PJDB 1I8MA 2DWDA 2EZ0D 4OLEA 4P46C 3QUMB 1L7IH 3O6KL 2CO7B 2I07A 4LSQH 3VFNA 1IT9H 3CZFA 2PW2A 5B3NA 4JPVH 4O2FB 4K23H 4N0RA 3TCLB 3KWWA 1KBGL 1G9EA 1AKJA 1D5MB 2FATL 4S1RH 1VERA 2GT9B 4IMKA 3PIQB 2I9LA 4G9FB 4WNQA 2CR3A 1U2CA 4MQXC 2EICA 4JN1H 2NTFA 3HAEG 4QHMB 4QKXB 3VGAC 2MCG1 4X4XA 1KC5L 2VUYA 4PLJD 3O2VL 4KI5F 4C4KT 3VXUE 1AO7B 4GW4A 3F58H 1IC5H 4LASH 1M71A 2MPAH 4EVNA 4P2RE 3RVVC 4NQDE 3IFNH 2AABL 4K94C 4GMSH 3RKPA 1UADC 5D2LF 4X4MA 1ORQA 4NSKA 1I8IB 1R5VA 4MA8H 4WW1B 2OK0H 2VDLH 5CHNB 1CE1L 1HI6B 4U7KA 4NQVA 4PV9A 1GPOH 3O4LD 1S7SA 4OFVA 3F5WA 3MRHA 2DYPD 1GH7A 3TBVB 4JFYA 2VQ1B 4UNTA 2L4OA 1RIVH 5GJSH 4AENA 1L4IA 3PJSA 2H8PA 2R4RH 4EIGB 5L88H 4POZD 1U8KA 2XQYK 3TLRA 2HVKA 2EYRB 5I8OL 5FO9B 5DK0A 5FYLD 3EFFB 5EG6C 2V2TA 3VXPA 5J12B 4C56D 8FABA 5CBAB 4JE4B 3RNQA 4YHNA 4FZ8H 4LLVA 2Y6SC 4ZYKB 2Y06L 1RULH 3Q5YA 2XY1A 3OZ9H 4RMVA 2PXYA 1YUHB 1WT5A 2XG4A 3UTQB 4XAKE 4D8PA 5ADPH 2ZKHL 1YEKL 2DQGH 4I18A 3VWKD 3MV7A 3LEYH 3NIFE 3TYGH 2CO6B 4HIIA 4PJGF 3RU8H 5LG1A 3WJLA 4HX1B 4JPWL 3MGTB 4PR5A 2BSRA 1KPUA 3C5ZA 3Q6FB 1DTUA 1LO2L 3OF6A 5KG9A 3GK8H 1ND0A 2NY5C 5F1NA 3D18B 3VU2A 1LK3L 3KPRD 3MX0A 1T80A 1P5UA 5CUSL 2PN5A 4JFEA 4W68A 4P9ML 2IJ0C 1G1YA 3FONB 5CIPB 3VI4E 1QA9B 2HLAB 3HB3C 3MXVH 4NQCE 3SJVA 4PRAB 4LLWA 3PHSA 2FX8L 4CJ0A 4YDLB 4ZO7A 3TZVD 1F2XK 4XVUD 2PETA 4X6FA 5J56B 4OFIA 4U1HB 1IVLA 1G6RA 4KPHH 4NQEA 3FO9B 1EV2E 4H26A 3TCXA 3CU7A 3V5DB 5INCB 1NAKH 4P57A 3UXFA 4OZIB 5D7IB 1B0GB 4RAUA 1IQDA 4HUVB 4ZSOB 4M02A 3K8MA 1CK0L 4NCC1 2R56L 1MFBH 3CXHK 5DFTA 1MFAL 5DEFA 1CGVA 3O0RH 2OQJB 4UB0L 4MAYA 3SOBL 1SJHB 4F9PC 4CDGC 3SDAA 5GGTL 4LCWB 5IW6A 2VMFA 3OGCB 3LCYA 4R8WH 1H3UA 4ZO8A 2XKUA 1JWMB 3KPTA 4NNYA 1RSFA 5CD5C 4TTGA 1FZJB 3CPLB 1JYWA 1WGOA 1MCWW 3PL6D 4KKBD 4R6UA 5CWSA 2OJZH 5HYEA 2CDFA 4KMTH 5T5NG 1DVFB 4UILH 1JPFA 3TBSB 1W8OA 4D0CA 2HKFH 4OCYL 4YEFA 1T7ZA 1EAPB 4LIQL 1CWVA 1MFEH 5F7MC 3S8WA 1AQDB 3IFOA 2OI9C 3PDDA 1AR2A 3WIIL 3P9MA 1P5VA 1YNTB 2J88H 2UUDH 5GRWA 4JVUA 4QXUL 4MNQE 1AGCA 2F74A 5CINH 5HYJE 3V4PL 1AFVH 3VXNA 4X6CE 1SBSL 1E6JH 4L8BA 4NOBA 3GBNH 1F8TH 1GGYA 2JB6B 3IFLH 1B88A 1EEZB 4MQ7A 2G5BA 5GISL 1OWWA 1Q0XH 1JZ8A 1FC1A 3QEGH 2IGFH 3QDHA 1YDPB 4K7FA 1IC4H 5F3BA 1RFDH 4X6BB 3MA7A 4F8TA 3F7VB 5FKAB 4Y4KB 1D3CA 4PJCA 2NX5E 4DGVH 3D0LB 5E0QA 1GSMA 1UM4L 2D9CA 2PO6B 2VDMH 3P77B 4IHOB 2B5IC 3MYJB 1OPGH 3F7YA 3WLBA 5I6XB 3BMVA 1Z2KA 1OAUH 4Z5RA 5GS0L 1IM3B 1A1MA 4F80A 1P7QD 4J4PC 4Z78B 4S11A 1NAML 4M7KL 5EN2A 4P49A 4TUJA 1QSFA 2ADFL 4OAWB 5IEHA 3QZWB 3NIDF 3FT4B 5HTSA 4M7LL 4YBLC 1A4KB 5D7JD 5C0GA 4XNQB 1G7LA 4TVPD 1T22A 5IHUH 4PJ7E 4R7NA 5FOJA 2Y5TB 3IU3A 4JFDE 5C0BD 4KZEL 1QO3B 4NUJA 4MLIA 3N85L 5AWNL 1LDPL 1A14L 5DK3A 1DE4B 1OARL 3MRCB 1KPVB 5F1OB 1BFOB 2WWMD 1G0YR 4ODSH 1VSCA 2VWEE 3UZQA 3LN5A 1A3LH 3QDJA 4EKXA 2X09A 1T1ZA 4Q74A 3MOBL 4OF5A 5JHLL 5CSZA 5TQ0H 3MTRA 3BGMA 4QRUA 2Z92A 3K4AA 4DN3H 3IRPX 2I26N 2BVTA 1BJ8A 2EIEA 5EZLB 1ZTXH 3ZE0F 1HQRA 5FA3A 1B6UA 5CMAB 4YHLH 4HBCL 5C07D 3GEWB 1E4WL 2XYCA 5ICZB 1FAKT 2HYMA 2XACC 5E2UH 3G5YA 3UBXG 3IXTA 2VLRD 5D8JL 1QYGL 5A16A 4PTUA 3KPPA 1B6DA 5IVZB 2QLVB 1KJ2H 3GI8H 2GK0A 2VOTA 5FGSA 3UTPE 4BFIA 1DSFH 5DZNA 2PCPB 2NY3C 3PGDA 2H1PH 3UC0H 3F6LA 1YEFH 5H94A 1QLFA 3O9WB 2VLKA 2XN9A 3UJIL 4K3EH 4Q0XL 3S34H 2RGSA 1D9KC 5IG7B 1WZ1L 2E9JA 4PJ9B 3U83A 4N0CD 1UJ3B 4U6HA 1NC2B 1F6LL 1CN4A 1GC1C 4IRSC 5FYJU 3QAZC 4JO4H 5JPMA 3EOBA 4W4OC 2FL5B 4RX4A 1QEWA 2R0KH 2RHEA 4OLZH 5D1XC 2DMBA 2V9TA 5T3XL 3GSVA 3S35H 3TJEL 1YY9D 3B9KA 3LH2L 3LKPA 1FIGL 4HFUH 1OP3K 5CEZD 2IANE 2WLYA 5I19H 4NKDB 1EHNA 3ARTA 4OCWL 5FO7B 4O2FA 4URTB 1P1ZB 3TCLA 1XGTA 4HULB 3L95A 2F53E 3G6DL 3U7YH 2WUCH 3IETB 2XZAH 3LRSB 3W0WD 1RK1A 4G9FA 3LS5H 5HGAA 5I8EB 4XH2A 4I5BB 1CXEA 5KVDH 2XTJC 3GB7B 2Y07L 4QHMA 5GRUH 3UJJH 3PG2A 5SX4H 4NRYA 5A2JH 4O02L 3EDFA 4EJ1C 2HT2C 4FQLL 4RMTA 3DVGB 4OZFG 5JO5B 3GMNA 5C09D 3K80A 3OBAA 1HINL 4ZAKB 4NNPH 3CXDH 4CVXB 2VZUA 1JF6A 2AEPH 1NCBL 2ZCHL 5D2NA 4YUEL 1N26A 1NC4D 5TE4H 1I8IA 3WKNA 2ZJSH 4LVHB 4WW1A 1FL5A 5E1HB 5CHNA 2OR8A 3C60A 2WUBL 4OCSH 2EXWC 5GZOD 1XCTA 1JZ6A 2I60L 2W0FB 4JM2D 3FCTB 4XHQA 1MI5E 1G9ML 3PWUA 4MNGA 5DLMH 1ZVYA 3U4BH 3LQAC 3TEUA 4BFGA 3PNWB 3L3OB 3MBEC 1F90H 2VQ1A 4M03A 1U36A 4P5TC 2ADGA 3JVGC 2BSED 2YD7A 4G43B 2NXYB 1N8ZA 3CVIH 3BPCA 1QQDB 2EYRA 1L9MA 4YAQB 3ULSB 5FO9A 3IF1B 3EFFA 4M7JH 5EOTB 2BX5A 4GKSA 1TJHH 2P42B 4GBXA 5L0QC 1AR1D 4JLRB 2H6PB 1K2DA 3AMKA 4ZYKA 1JGDB 2IQ9L 4BKLB 3OV6A 5AZEH 3CX2A 4NDMB 3UBXI 2X7LB 2YUVA 1INDL 3WIHL 5F6HI 3GO1H 4YEEA 4MJ6B 3UTQA 2WBKA 4I77L 4WFFD 3ARFC 3I6LD 2R8SH 3VGHA 1ADQH 2XZZA 4WV1B 5JW3L 4NQSA 4JRYE 12E8L 4ZO6A 3LY6A 4XVJL 5T3ZL 4JKWA 3ARGB 1L7TL 3MGTA 4R2GC 3ZDXE 3HFMH 4H1LH 2R2BA 2I24N 1UA6L 4J3TA 1MSPA 1WQVT 3KXFA 2WV3A 4JG1L 4AQ1B 4HV8A 5EA0L 3WLWD 2ZUUA 2FD6H 4JDZA 4PGCB 1JN6B 43CAA 3FONA 3JV5A 4YHKL 5CIPA 2FNBA 3S37H 4GOSA 4XPBH 3BKJH 3G9AB 3E3QC 4F7PA 1QA9A 2HLAA 4UOJA 1EVUA 5FV2A 5F9WB 5SX5H 3TIDB 4V1DB 3DSFL 1CLYL 4YPJA 4GG6A 4HKJB 3EW3B 1KN2L 1UWEH 3D3VD 4U1HA 1CFBA 3I3BA 4KV5F 3TT3L 3VG0H 1Y6NR 3V5DA 5INCA 3RIAF 2Q86B 4OT1L 4OZIA 4ORGB 1FV1A 1B0GA 4LRNH 5E2TL 1NCDH 1EBPA 4N0YL 5IJVB 1AC6A 2P4AB 1GGCH 3HE6C 2N1KA 4N0UB 4HUVA 5IK3B 2X4SB 1EGJL 3RWEA 2IQAA 2OQJA 4Q6IC 5K9QG 1W72H 1SJHA 2FIKB 3QFJB 3MJ9A 4MD5B 3NOIA 4TRPL 5JUEL 3FRUA 1E27B 4QHLB 3BWUC 3TPUB 2ADIB 1JWMA 4PGBA 3TP4A 1VKXB 4XC3L 1I9RL 2YWZA 1AXTH 4KMQA 5JA8B 1FZJA 3CPLA 5JDJA 1OW0C 1TTUA 1XIWC 3DYMA 3QUZB 3VFUB 1CFQB 3D9AH 3IJYB 3QI9C 3QQ3B 4JQVC 5C6TL 4ZD3H 1UCTA 3TBSA 4RWYL 3AS1A 4OD2B 4I3GA 1EAPA 3A0OA 4MJ4A 1AQDA 3T65B 5I75C 1MCIA 4LLMB 4F9LC 3BDYH 1KNOA 4PPTA 3V6BR 1KXVC 3RKDC 4WUUD 4WDIB 5EO1B 1MCRA 2VQTA 5JZ7C 2X89A 5KN5B 3I6KB 3MV9E 3O2WL 5IB1A 3MOAL 3OB8A 1EEZA 4PJ5A 4YWGH 2YPVH 4W6YB 1YPZB 4MVBC 1NBVL 1YDPA 5F71A 4PBXA 4JQIH 3DI3B 5CJQH 4X6BA 1JL8A 3KLAB 4PLNC 3GRWA 4DCQA 1RUAH 3F7VA 4KK9D 4Y4KA 5FKAA 3WO4C 3WL9B 3D0LA 2PO6A 1RUQH 3MLVL 7CGTA 3DMMB 3P77A 4IHOA 4Z8FL 3MYJA 1YECL 4CU8A 2BNUB 4NZRL 3U9PH 5H35B 5JW5A 1IM3A 4ETYA 3GMMB 4FQHB 4WTZA 4OAWA 1CICD 3KR3H 3QZWA 1HSAA 2A6KA 3CDGB 3FT4A 4X5LA 5EOQL 3EJJX 3D69B 1A4KA 2OCFD 1EFXD 3WN5B 5KSVB 4QO1A 5E00B 4XNQA 4EDXB 3O6KH 3F12B 3TGXA 1EEQA 2Y5TA 1ED3B 5IMKA 4LHQB 4N9GB 4W4NA 2O5ZL 3H9HB 1KBGH 1DANU 2FATH 1BD2E 5ADOL 5BOPA 1PQZB 1KPVA 3MRCA 3UO1L 1CVRA 1BFOA 1WCBB 3WHXB 2D03L 3IT8D 1H9VA 3K2UH 1FLRH 4JRXE 5KANG 1X5XA 4BZ2H 3Q6GL 5C0RL 3QIBB 4YHOL 1NMCB 2EYTB 3P0YH 4FP8L 1FFQA 1TTFA 3R06B 3BT2L 1B9ZA 5MENE 5CMAA 4LAQL 1G7IB 2AABH 5AZ2L 1D6EA 1FNLA 2X44D 3WNOA 1C5DA 1CU4L 4WW2F 2RIKA 4GRWB 4QRPE 1EA9C 4ZXBB 2HWZL 2HLFD 2HVJB 4JJ5B 3DRQB 4Y19E 3ESVF 4BQ6A 1IJ9A 1QTYT 3PV7A 3BX7C 4P48A 3S9DB 4CW1B 3L9RB 5I8OH 3HI1A 4OUUB 4PJBE 5D1QD 1NGZB 2APWA 3ZKNC 5INDB 1OY3B 3O3EB 1ODAA 3TM6A 5IG7A 3CC5B 3FN9A 4PJ9A 1BVZA 3SE8H 4XMPL 5HI4C 1W2KT 4U0QB 5GS1C 4OB5H 4HXAL 3W82A 1MWAH 5C0NC 2FL5A 4YK4B 4HJ0D 4WI7A 1I1YA 2XTJE 1U8JB 3PWVB 4BH8B 3L7EB 1S5HA 1KIRA 3WFHB 3GHBL 3DARA 1OGAD 3FO1B 4LPCA 3SY0A 1LO2H 1QSVA 2BFVL 3H42H 1MCNA 25C8H 5HHQB 1I3RB 5FO7A 2WBJA 1LK3H 5K9KB 3MUJA 4XPGL 3WDJA 2DMKA 5CUSH 3IETA 5BRZD 4P9MH 5JHDA 4PRIE 2DBJA 2YEZB 3DGGA 3JWDH 2UWEF 5F7YC 4MB3A 4ZS6C 5I8EA 4ZTOL 1QSEB 2VDRL 5FHAL 2FX8H 1XGPB 3T8XA 3GJEA 5C2BL 5HVHC 3OQ3B 3U30C 4AG4L 3IKKA 1ACZA 3ARBB 5JXED 3O6FA 1MF2L 4HG4J 1A8JH 3R4DA 3DVGA 4DKEH 4L3ED 4IMKC 4HCRA 1EH9A 3H3PL 3TO4B 3MLSL 4JFZL 4ZAKA 2NXZD 4NYLB 3TFKD 1A6PA 1UFUA 1CK0H 3W11D 2R56H 5KSBE 4MA1B 3VH8B 4HIJB 3ZL4H 4UB0H 5J9PB 3SOBH 4U6YB 1A7NL 1Z6JT 2W0FA 5GGTH 1ADQA 5TFSL 1P6AB 3PNWA 5ITFA 2WM0A 4BYHA 1QR1B 2O26U 1IEBB 5EORL 4G43A 1JUFB 5KANI 1JIBA 3VXRB 4H1LA 3VGFA 3HRZB 4YAQA 3IAPA 5EOTA 5J0BA 1FFOB 3FQWA 2D4FA 1A5FL 5GRYA 4OCYH 2NY6D 4M93C 1XCQB 2J4WH 3K7UA 3M17A 2NR6D 4JLRA 1EO8L 2H6PA 4QWWC 5FM4A 4C57C 5KAQG 1QLRA 2AQ1A 1OVZA 1JGDA 3WIIH 2FEDD 5E6IA 4ALAL 1MHCA 3Q5TA 1P53A 2X7LA 3L3HA 1MFDL 3BEVB 4JQXA 4QXUH 5D2LB 2JIXD 3WDIA 4P2CG 3H9SE 1SBSH 2DTML 1BF2A 3MGOA 4WV1A 2NZ9D 4J3UA 1T89C 4F33B 3GMOB 4Z7VE 5GISH 3S36L 1XZ0B 5EU3B 3VXOB 2R23B 2JJVA 2VKXA 2PXYC 4PJIA 4WFEE 5JOFB 5EUKA 3FFCB 1WT5C 5J6HA 3MXWL 3LIZH 1LGVA 3PQYE 1HH6B 3RWGB 4I18C 3RVWC 3C8DA 4HLZH 4PGCA 3VD3A 5HPOA 2YC1B 3GSOA 3WJLC 4FN0A 4UT6H 2LE9A 4PS4L 4J23A 2FH8A 4WI5A 1QRNB 5EDXA 1MREL 4ZUVB 3TIDA 4V1DA 4GAJL 4UT9L 2GHWB 5GS0H 5F70A 1MQ8A 4HKJA 3CFEB 1NAMH 4M7KH 5DUML 1U8HA 3QHZH 1ZGLA 1FBIL 1J0YA 4RGOL 2LABA 3MUGA 3RVXD 3D2UD 2Q86A 1G1CA 3LVEA 1NCUA 4M7LH 3C09B 4PJGB 1YQ2A 3T0EB 4AM0B 5IVXA 4D9QD 5IJVA 4DN4L 1P4BL 5IK3A 1EPFA 2X4SA 3FO2B 5F9AC 5SWSB 4MQSB 5GXBB 2WSKA 1TENA 1M7XA 5L7XL 2FIKA 4KZEH 4F7TB 4YXHH 3D39E 2J5LC 3RWCB 3QFJA 2CRZA 3N85H 4HIEB 4OZGE 1IC1A 1E27A 1S8DB 1VFOA 4QHLA 2ZSVB 3N1MC 3TPUA 2ADIA 1OARH 1VKXA 3HNTL 1BVLB 1JGVL 1JZ4A 4GS7B 4ZDHA 2VC2L 3VFUA 1NMAL 5EOCJ 4CN4A 4P5MB 3UEZA 3MRNB 4EUPH 3O8XA 2ID5A 3MOBH 3SDAC 1S9WB 5JHLH 3HLAB 5I71B 3PWJB 3T65A 2A9NL 4LLMA 1O5DT 5HDBE 3WUWG 1T4KB 4KKAC 3S5LB 5CGTA 2CRYA 3Q0HA 5EZJB 4O58L 4G8EB 4HBCH 1C8PA 1E4WH 1NBQA 1TVHB 3MJGX 4NQDD 4P2RD 4WDIA 5EO1A 4Y16C 3W5MA 1WISA 4NOFA 5KN5A 3WS6C 3VFVA 3I6KA 3SDCD 1Q72L 4P2OD 4Y4FB 5DHVH 5D8JH 1YPZA 4YHZL 2P43B 3LKNB 3FTGB 4HWBL 2BSSA 4LKXB 2MHAB 4MMZC 3ULVC 3KLAA 1I1AD 5CJ8A 2AK4E 1NLDL 4G8GE 2JCCF 4ZPVB 2FEEI 3UTTD 1BEYL 4MXWH 1KUMA 3DMMA 4NO2B 4Q0XH 5I2IB 4G9DA 1WEJL 1Y6KR 2BNUA 3F7RA 5TPWH 1DBMH 3MRDB 1UH4A 3UTSA 2W9EH 3GMMA 1OP3H 4FQHA 1FL6A 5E9DA 4TQEL 3QUKA 3CDGA 2HJFB 5T3XH 3TJEH 1ZT4A 3IVKA 4G8IB 3WN5A 1FIGH 4Z76A 5KSVA 2FEEL 5E00A 4J8RB 3WFEL 4OFDA 3DUSB 1ED3A 4G5ZL 5BV7C 5E8DL 4OCWH 2ITDA 4N9GA 3X12B 3H9HA 1YN6A 4YJZL 3G6DH 5FYJD 3KYKL 1PQZA 3PF2A 1A2YB 1HIML 5B39G 1UWXK 3I02B 5IBUB 5HGGS 4ONGL 3WHXA 2Y07H 4Y2DA 5JIKA 1NFDF 3V95A 4FQQB 1A3QA 4E5XB 3ULUC 2XXMB 4FQLH 5K33A 3QIBA 3EJYD 5BZWB 1LWRA 4L29A 1NBZB 4BQ9A 4PUBL 1DQQB 1BQHA 2EYTA 5TJWK 1HINH 5CS7A 4JREC 4Y1AE 4CN6A 1G7IA 4JAMA 3UPCA 1NCBH 2A77H 2ZCHH 5KS9E 3B9VA 3QNYA 1KCVL 3B5HA 3HE7A 1FG9C 2WUBH 5HYQB 5J1TC 3DECA 2I60H 1ZHLB 2C3GA 4U1SB 4ZXBA 2D7TL 1G9MH 2HVJA 1WVZA 4F7MB 1U8MA 1YMME 4JPIA 1WFOA 5ESVA 4P23A 2F54B 3HMWL 1R6VA 4R0LB 5JTWA 1K5NA 4OQTA 4K8RC 3OAUL 3L9RA 3IDNB 3AFLA 4OUUA 4Z6AT 4PREB 1BIIB 3O3EA 2OZ4H 3GJFK 4FXLA 4XXCA 2NZIA 4MJIE 3BD4A 4YPGB 1HWHB 3P73B 4NWTH 4D9LL 1R5IB 5MEOB 2IQ9H 4PJXF 4D94A 1UCBL 1M7IB 4YXKL 3L3JA 3IS0X 3QIUB 5DD6B 4U33A 4I77H 1FSKC 3JZ7A 5HYJD 4WEMB 4UV7L 5JW3H 5E4EB 4MDJB 2A2QT 12E8H 3FAXA 3PWVA 2P7TA 2YBRB 1S9KC 3L7EA 3QISA 3NIGE 5T3ZH 1L7TH 4P4KA 3FO1A 4XMLH 3S7GA 3U0WH 4K3GA 3RWIA 4ZOBA 5HHQA 3O3AA 1I3RA 1B4RA 1CL7I 1IGJB 1PJ9A 1U8IB 5K9KA 2X4PB 3DURB 4JG1H 4A2LA 2W9DL 4J3WA 5BXFA 4OIIL 5EA0H 1XF5B 1JJUA 5GGTA 4XRCB 2YZ1A 4F58L 2ZUTA 2NX5D 2DL9A 3F7PC 4Z7OE 3GI9L 3UP1A 1FO0B 1QSEA 1XF4B 3DSFH 1CLYH 1XGPA 1Q8MA 4XMKL 4YFLI 3RFZC 2X41A 4JM2F 1T1XA 1KN2H 3UX9B 3ARBA 2E6JA 5B3JF 1FNEB 1R3JB 4X4ME 4OT1H 4U3HA 4I4WB 3INUL 4X6DA 2EC9T 2IC2A 5E2TH 1ZV5A 2EDTA 1NCWH 5EULV 2J1KA 1IQWH 4HIJA 1DQTA 1J0HA 4OV6F 3QA3A 4PRHA 2VTFA 4U6YA 4CMHB 2LQRA 4JFDD 4TRPH 1ITCA 3SKMB 5B8CA 4EDWL 2XFXB 2UY6A 3EFDL 3RWHB 4XC3H 5BS0B 1NMBL 2JJTA 1QR1A 2A0LD 4BELD 1IEBA 3KPOA 2HFFA 4H0GA 1JUFA 5D2NC 1B4JL 4CVZB 5FFLA 1U3HC 4GSDH 1KN4L 3HRZA 3RTQC 5C6TH 1F5WA 1QFOA 4CRPA 3C60C 5DHYB 1TIUA 4RWYH 5AEAA 4Q9RL 3BO8B 1CR9L 1FQ9C 1VHPA 5CEXB 4KJYB 4Z95L 2QQLH 1CXIA 1LMKA 3K1DA 1YZZA 4LCUA 4BZ1L 3MV7E 4S2SB 1DBAL 3BEVA 1WBYA 5D2LA 3CFBB 5F7FA 2IF7A 5T5FL 1MH5A 3QRFM 1I9JL 1NAMA 3EGSA 2C3VB 2DQIL 3C5JB 3MOAH 4GBXC 5I66B 4KK8D 1XZ0A 4JFEE 5F8QC 2R23A 1NBVH 2N7AA 1II4E 5JOFA 3FFCA 2XWBA 1OTUD 1QPPA 3O11A 2OTWB 1HH6A 2DM4A 3SJVE 4M7LT 3UTPD 3MLPA 1KLUA 1T5XB 4RWHA 3C87A 3MLVH 2AEIT 1WFNA 2YC1A 1T3FB 4Z8FH 4NQEE 1AHWA 1YECH 4I48B 5HI3C 1CLZH 4NZRH 4YIQB 3QQNA 1JNLL 3KPSD 3HA0A 5F7NC 2YUWA 1MIML 4PJ8B 3LD8C 1J0JA 3OKMA 1HILB 5EOQH 2Y25A 3NZ8A 4PJGA 3TBWB 3T0EA 1ES0A 3WHE0 3HMXH 3Q3GB 5TE7L 3ZDYF 3FO2A 5SWSA 4OI7A 5C3LD 5J57B 5I0DA 5DMGC 4NKIL 4F7TA 1MVUA 3RWCA 4FTVB 3B2UC 2X40A 4HIEA 2O5ZH 3IJSA 5LVEA 3RVVD 3HPLB 1KCKA 4R7DB 4ZFFB 1LP9F 5C0FA 5GGQL 1HHIB 3V5HB 3PGFL 4P5MA 5EC2A 3T77B 2UV3A 3MRNA 1CIUA 4HUWA 4U6XB 1EDQA 1S9WA 5IMLA 3HLAA 4NP4L 1KXTB 2WANA 2K7PA 5C0RH 5H37G 3ULVE 4YHOH 4NZUL 2X4RB 5I16B 2Y1VA 1K4DB 1MHHB 4FP8H 1T4KA 3S5LA 2R1XB 3BT2H 5EZJA 4LAQH 3O81A 3NTCL 4G8EA 1TVHA 3MQIA 4MJ5B 4E9LA 1CU4H 1X44A 5T1LD 4MDIB 2K7QA 4KK6C 3ILPA 2Y6SD 4Y4FA 3NA9L 3VFPB 4Z77B 4LEXL 4PJCE 3OR6B 1KCLA 3EYQC 4AEHL 5CD3A 4TPRL 3O6ML 4JFQB 4DEPC 5BQ7B 4IS6B 1NPUA 3B2VL 1WTGT 4ZPVA 1ONQB 4JKMA 2HMIC 5H2BA 1F00I 3BW9B 2GJ6D 1MCHA 1S78C 3FQRB 2VXVH 4NO2A 4Y8DC 2WQRA 5I2IA 1EAJA 3F65A 1QSFE 1AD0B 7FABL 4K3DL 4L5FL 4XMPH 1RZJC 1PSKL 4OGAC 5KJRL 5BOZG 3LS4L 2XZCL 3IDIA 4HXAH 5ISZD 4HUNB 1OWRM 1X7QB 3QWOB 4N68A 4XCFL 2HJFA 4XI5C 4LSPL 3HB3D 5IBTL 1HCFX 4M48L 3GHBH 3G04A 2NY2B 2F9BT 2BFVH 4H0HB 3TNMA 3DUSA 2OR7A 4MA7L 2VKWA 2YPKB 3MV8B 1OOAA 1FVDB 3MPCA 1KJ2B 5E2VL 4XPGH 3QDJE 1BECA 3GHEH 5F8RC 1A2YA 4LGPB 4OD1H 3RDTD 2N7BA 4R90H 3I02A 4QY8B 4ZTOH 5E7BA 1Z3GL 2VDRH 5FHAH 4FQQA 3VFRA 4AG4H 3JV4B 4LP5A 1MF2H 3ZKQD 5FYKE 5CD5D 1NBZA 2WQ8A 3H3PH 3MLSH 4ZUUA 1DQQA 4YDKL 5IWLA 4YGAB 1L0YA 3PWPB 3TN0B 4NC1C 4KGJA 5DJAA 2GAZB 3QQ9C 3P9WB 2CLZA 3WIHA 5D7LB 5C7XH 1IAKB 1A7NH 1ZHLA 3LN4A 3C5SB 2A74B 4U1SA 2FSEA 2GCYB 4YFEA 4F7MA 1ZWIB 4G6JL 2EO9A 1A6WH 4P5KA 2VLKE 2XN9E 4WIQA 5EORH 4HAGA 1CE6B 3OB0H 2VXQH 3HCVB 3IDNA 4G3YL 2P49B 2MQ3A 1BIIA 1A5FH 3MRLA 3OJ2C 5FUOL 4ODUB 1ORSB 3P73A 1R5IA 3MJ7B 4UT7L 3MRIB 5CZXC 4ALAH 1E4XI 2EDOA 1M7IA 1TJIL 1MFDH 2V5TA 4JB9L 3QIUA 1X5ZA 4WW2B 1A64A 4XAWL 2DTMH 3B9AA 4M7ZB 4H5SB 1U8OB 4JFFB 5E5RB 3OMZA 3MV9D 3P2TA 2D2OA 1YEIL 2C1PB 1P4LB 4HJJL 3FFDB