2VLMD

The structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
184
Chain Sequence
QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVKDSDVYITDSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JM22 TCR ALPHA CHAIN
publication title The Structural Dynamics and Energetics of an Immunodominant T-Cell Receptor are Programmed by its Vbeta Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 184
sequence length 199
ec nomenclature
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vlmD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vlmD02
5HHNA 4ZPTB 3VFOB 4PJEF 2VERN 2J8HA 1Z5LA 2GCYA 4Y4FB 4ELKA 4X6CE 1VFUA 2BSSA 5DGRA 2C9AA 1IT9L 3LV3A 5JXEC 5IHZB 1FE8H 4QHUB 3HPLB 3U48A 5CCKL 1F6LL 3IYLW 2BNUB 3EO9L 3HPJA 4JFPA 4O9HL 3GSUA 1DFBH 5CZXD 2H3NB 3U36B 3T0BA 1BF8A 2R1YB 5I8OL 2FECI 3EDFA 2UUDK 4MLIA 5EZIH 4FFYH 4NRXA 5D2NC 4WGVB 5E08H 2IH3A 2PXYB 5DJXA 1DL7H 1KC5L 2XPGB 3EIFA 4ZUTA 5L6YL 4N8CL 2DJSA 3MLWH 4J4PD 4AQ1B 3MNZA 1KCVH 3HE6C 2IPTH 3IDYC 1JK8A 2XG4A 1WVZA 3P30L 4OLWH 4HX1A 3JTSB 4XGZB 5CAYB 4GRWB 2AJXH 3NPSB 1LDPH 1NFKA 3KYNB 4J8RB 1JPSL 1XH3A 4KK9C 4Y4FA 3ESUF 3JWDH 2HT4C 3MRRB 1IGMH 5IHZA 4PYHA 2DD8L 4QHUA 3HPLA 4C54A 3O4OC 2IBBA 2BHZA 2FZ3B 4XP5H 3ET9F 1RQ5A 1IAKA 3CDGB 4G6AD 1V3JA 2H3NA 3HUJF 4DVRL 3DURB 2VN4A 2ZSWB 3BPOB 3FO2A 4MJ5B 2OXGA 2YUXA 1YEKL 3D2UA 1UQSB 3OR6A 2PXYA 3LIZH 3DGCR 2JK5B 3BYYA 4YQXL 1IC7H 1MCLA 3WXWL 2ZG3A 4QNPF 2IBZX 1A3LH 1KCSH 2VLME 4NO3B 1EGJL 4WGWB 2Z35B 3M8OL 4ISVB 3ARUA 1CU4H 1RFDH 4XGZA 2GHWB 2CUIA 1MFCL 2O5ZL 5I1KL 4NP4H 3KYNA 1OTSD 4J8RA 2WUBH 4NKMB 1QBMH 1E6JH 3ARVA 5HYEA 2B5IC 3BVNB 5D1XD 1WIUA 3X3GL 3QDJE 1C7TA 4LAQL 2Y25A 1YEFH 7CGTA 2NY4C 2FZ3A 4K23L 2QV2A 4J6RH 2UZXB 2C3GA 5C0BE 5IW1B 2VLLB 3CDGA 2Z31A 4JANB 3MOAH 2F19H 3DURA 2AK4E 2ZCKL 2ZSWA 4EIZC 4L3CB 4WY7L 3T3PF 4PJEE 4MJ5A 3DRTB 1UQSA 3CSBA 3KPRE 2JK5A 1SJEA 4NBXB 4TPRL 5L9DH 1A7NL 2R56L 5DR5H 4JHBA 2M2DA 5EFIB 5JOPD 3H6JA 2UWEF 4AEEA 4DQOL 3K7UA 4NO3A 2Z35A 4UU9A 3VFGH 4Q9RH 3X17A 4ISVA 1LP9B 1SMAA 5BZDA 1ZTXH 5CINL 5HY9B 1EEUA 2F54E 1GC1L 4UOJA 3BN9D 1MPAH 4NKMA 3SGKC 3O2WH 1U41A 2BSTB 3LN4B 4NZUH 3T0EC 4OCSH 3MLPA 5IW3A 1KJVA 5L2KE 4JKLA 1VHPA 2OZ4H 1A9BB 2X9WA 1ND0B 5IW1A 5GRUL 2VLLA 4LMQE 4JANA 4YHKH 3AMLA 3LB6D 4L3CA 3BT2L 4U1LA 1OARH 2NY6C 4WI2A 4KJYB 3BW9B 1QSEB 2BXZA 5CJQL 4A2LA 2IPKA 3PP3K 1U2CA 2ZUUA 4AL8H 1FDLL 3GJFH 3VU2A 5EFIA 4KY1H 1TVHB 2VKWA 2YKLL 2BVPB 3V6FB 1F4AA 5DURD 3HUJE 3MLXL 2RQ8A 2OCFD 3OZ9L 4GOSA 4P2QB 2GIYA 5EWIL 5GRVL 5I75B 4JG0H 4GAGL 4K8RD 1DANU 1A6VH 2X1WL 3DUUA 3CLEH 2BSTA 3LN4A 1EGJA 4U31A 1T2JA 1SM3H 4AEIH 3BKJL 3U0WH 1T0NB 5F7EL 5KS9F 4WW2C 1G7PB 2QQLH 1M7XA 3D85D 4XVSL 4EI5B 3K2UH 1A9BA 1ND0A 1NPUA 3QWOB 1OP3K 3LN9A 2BY3A 1N6UA 5J1TC 3BFOA 2NYYD 3KJ6H 1YMHB 4NM8L 2WQRA 1F8TH 3M45A 1WV7T 3U0TB 4KJYA 3BW9A 1QSEA 1LQSR 3Q1SH 2D0HA 4P46B 4P2RB 2WP3O 1CFTA 2BMKB 3VDAA 3Q3GB 4OLXL 4G6JH 2B4CH 1RZFH 1KIPB 1TVHA 1X5YA 3LS4H 4IJ3B 4UDUB 2PO6D 3V6FA 4M7LT 3NCYP 4P2QA 4NNYA 4R4FL 4WEBL 3OKLB 4FTVE 3B2UD 5ILTL 4YXLH 5C0AE 3UTTD 4GRWF 5SWSE 2XOTA 1GXEA 2FGWH 2VH5L 3FB6B 1VEMA 1O5DT 2A2QT 3HG1D 1QFHA 1TVDA 3NIFF 1ZKAA 1G7PA 2A6IA 3NFNB 4OZHB 1OGAA 3SE8H 1FYTE 2NY4D 3THMH 2UWEE 1UWEL 5MENE 3QUYC 4NQCB 1MF2H 5B38G 5E9DE 1YMHA 3L5HA 1TJGH 1ZEAL 3HZMB 3U0TA 1X5AA 25C8L 2VDPL 2DWDA 3MV9E 4P46A 2VKXA 4P2RA 3RGVB 3WS6C 5BS0B 4MD4B 1JRHH 1KIPA 1N59B 4Y5XB 5J13C 3ZKQD 1NGWB 5JZ7C 2FLBT 4NT6A 2CIIB 1CTOA 4HF5H 3OKLA 5FGBA 1RUKH 2YK1H 4KDTA 5EU5B 4OCXH 2G60L 3FB6A 3P4NB 1FC2D 5C0CB 3QWRA 1ZANL 5HHPB 4JZNB 4DUXA 2CR6A 4J3OC 3UPAA 5I74C 3NFNA 4ZUVB 4ZS7H 2YRPA 4OZHA 1DBJH 4M6ML 1YEHL 5DD3L 4OM0H 2VDMH 5ALBL 1DBKL 2OM5A 4LCWA 4NQCA 2UZYB 2NY0C 4Z7VF 3PJSB 1XR9A 3UYPA 1Q0XL 4YE4L 1VPOL 1JF1B 1NCWH 1JN6B 4EQ3A 4GAFB 3A6OA 3O81A 4PBVC 3KLSA 1EHLH 2VZ1A 5I1HH 3HZMA 1YEJH 2FECL 1MCNA 2HN7A 2Y07H 4NC1C 3AUVA 1MCIA 5J8OA 3N9GL 3V0WL 2X5PA 2FD6L 1UEYA 5BS0A 4MD4A 4V1DD 1D5XB 2HKFH 1FO0L 1AR2A 1N59A 4EI6B 4Y5XA 4AMKH 5I73B 4I3RH 3SCMB 1NGWA 4MA1C 4Z7QF 3QXAB 2UV3A 2CIIA 5FM4A 2V9RA 4JN2B 1EO8L 4HIEB 5E2JA 4U1NB 2YPVL 4M7ZC 1NCCL 1A7PH 1T83C 4PJBF 5EU5A 1Z9LA 3MRIB 1ZLSL 3P4NA 3PABA 1NMAL 4JZNA 1FSKB 5GS0L 3PWLA 2J6EH 5I8EA 2HJLB 1J5OH 4ZUVA 3VRLF 3TT1H 5TE4L 12E8L 3LD8B 3C5ZB 1A1NA 3C08L 2ZKHL 3RVVD 4XPAL 1KB5L 2JJSC 3PJSA 5F9OL 3VXMA 4F7PA 3FQWB 4AEFA 1PX3A 4GRWE 1NAKH 5IR1B 5I17B 1OWRM 4HIXL 1P9MA 2WBWB 5E2UL 2FX9L 2FEEI 3NIFE 4RGMB 3E8UL 5F3HA 4LKXB 3WO4C 3MXVH 5D8JL 1UADC 8CGTA 3GI9H 2CGRH 2VXQL 2AV7B 5T3ZH 3RL1B 4K9EC 3SCMA 3SKUD 5MEOB 1AY1L 1TMCB 3X11B 4OCYH 2ITCB 3QXAA 3LVEA 4JN2A 4HIEA 1D9KC 4U1NA 3MODL 4LSDA 4YH6A 4MXVE 4X6EB 1BFVH 5ACLA 3MRIA 3RWIB 4W81A 5IT2L 4E0RB 1PEWA 5DK0B 1J11A 3R06A 4N9GA 1MVUB 4YWGH 3FQUB 3GSQB 3RIFF 1MQKH 5EC2B 5HHOD 4JO1H 4TSAL 3CPLB 8FABB 4M7JL 4MNGA 1I9RH 3OJDA 4LDOB 3FQWA 3S3PA 2MJWA 4QTIL 1SJHB 1F90H 2IGFL 4HBCL 5IR1A 3PG2A 1GGUA 3OTTA 3QPQC 1JMZA 1CD9B 1JJUA 3LPFA 2NXYB 4N8VG 3NPZB 1KB5B 1TTFA 5DMGD 2FIRT 1N64H 3Q5OA 1UWXK 5T1LD 3RX7A 4K3JL 3S35X 2W1NA 4YHZH 4TRPL 3HMWL 3O6ML 4WFGD 1TPXB 2AV7A 3RL1A 5MEOA 3KYKL 3VH8A 2EEBA 3TIDA 4FP8L 2RIKA 4I8DA 3MV7D 3MRBB 4X6EA 4LQFH 1YJDC 3RWIA 4E0RA 1FO0A 2AK1H 5C08D 5GZOC 1AXSB 1J0YA 2A1WH 4JN1L 4PGBA 3FQUA 1YMMB 4X9GA 1W8OA 3C8DA 1CGVA 4NO5B 5C0IB 2VXSL 5HI4C 1CBVH 3CPLA 4OZHF 1RZIB 8FABA 4KMTL 5CIPH 3TNNB 2ESVB 3LKSB 1E4XI 5E03A 1UZ6F 1LP9E 1CT8B 3B5HA 4O51B 3QCUL 3RGHA 3VFTB 1E0OB 1SJHA 3F58L 1RZJH 3V0VB 1DCLA 2WWMC 2P8MB 1ZSDB 4I3SH 4UB0L 1KB5A 2FX8L 1FGNH 1U91A 4I77L 3VRLE 5F96L 3C8KA 2JJWA 4TSCH 4JFEB 4U1KA 3IFNH 4KMQA 4H8WH 1PKOA 3VXSB 4OCNC 1J8HD 4NFBA 2XN9B 4UTAH 3RY4A 1HHIA 2P5WA 2FWOB 4XVJL 4MJID 4JPVL 1JV5B 1FIGL 3MRBA 4N0CC 1A64A 1MWAH 4S0TD 1AXSA 3HNSL 1MCDA 3DETD 1QSEE 1YMMA 1S8DA 1G9NH 3C6LB 4NO5A 5CGTA 5C0IA 4P4KD 1RZIA 5KVFH 1HH6B 5E1HB 2ESVA 1SJVA 3N85H 2E7CA 1CT8A 4O51A 3KPTA 4P2QE 1QFPA 2LVEA 2P1YA 3MYZA 3V0VA 1LO4H 1B0RB 4PJIB 2BHUA 2P8MA 1ZSDA 2LAGB 1GAFH 1NCNA 3EJYC 3GGWA 4JDZB 2I24N 3AY4A 3RNQB 1H5BC 4JFEA 4YXHL 1Q9LB 1T1WB 3MV8D 4QTHB 3VI3F 2XN9A 1I9IH 2CO7B 3AGVA 5FUZH 2MTPA 3ULUE 2FWOA 5HI3C 4OLEA 4WNQB 1AO7B 1JE6A 1JV5A 4LCUB 3NCJL 3ALPA 5ID0A 1NSNH 1VKXB 1WSST 3HC0B 3PQYB 1JBJA 4N0RA 4TUKL 1CICC 5HGHB 3C6LA 1CGSL 4P2RE 5K59E 3EYOB 2IC2A 3ES6B 1CLOL 2YPLD 3P0VH 1HH6A 2H1PL 3PGFL 2OXHA 1P6AB 2BSRA 3LN5A 3IXTA 4OFYA 3ARRA 4HFWA 4PP1D 5DHXB 4FZEL 2AI0L 1E4WL 3EFFB 4XP9L 1IAOB 1B0RA 4PJIA 4NHCL 5GGRB 1BPVA 2SEBB 2IEPA 1JNNH 2ED9A 4JDZA 4MQXC 2A83B 4OZHE 5D70H 3U4BL 2BY0A 5FOBB 2AXFB 4PJ8B 3QDAA 4HKZB 3BRDA 1Q9LA 1T1WA 1UZ6E 3KJ4C 5FHAH 4LCWE 4NQCE 3FN3A 5FDYA 4P9ML 4HC1A 1AO7A 1EEYB 4CL7A 4LCUA 1EX0A 1VKXA 3HC0A 4K3EL 1TITA 3SDAD 1A02N 5IW6B 3PQYA 3L5XH 1CDUA 5HGHA 1W0YT 4DGYH 3U4AA 4YX2L 4LLVB 2F9BT 3BAEH 3EYOA 3WCYA 5BS0E 1J1PL 4JFYB 3FB8A 4YHML 4NFCA 3MLVH 3VDBA 1IJ9A 1U8JA 1BBJB 4KVNH 1L9MA 1VCAA 3EFFA 1CLCA 2PXYC 1IAOA 5F6HI 4D0BA 1N5AB 5GGRA 3AB0C 4XCCL 4L4JA 3LEYH 3A6CH 5F7DA 2A83A 5FOBA 3B9KB 3CXDL 2AXFA 2NY1B 4PJ8A 4GMTL 3ZKNC 5TDNB 5HDOA 4YJZL 2NW3A 1IVLA 1MHCB 5E8DH 1J1XL 5DJ8B 3BE1L 1EEYA 3MLZL 5TGBB 2OL3H 5L8JB 3NGBC 4JFZL 4N0YL 3V52H 5IW6A 4GO6B 2PN5A 3VFWB 1G1CA 3OV6A 3TO4D 5TPWH 1HILA 4M7LH 4L8BB 4LHJB 4LLVA 2GFBB 5ITFB 3IU3B 5D96B 5EORL 1DE4B 4JFYA 3S98A 3PWVB 1YY8B 4MA8L 1F4WH 3VI3E 5A1AA 4UAOC 4ZXBD 5CEZD 5I15L 3RA7L 2Q76B 4UT9H 1BBJA 1TZGL 4NBYB 1GGYA 2Y06L 1RU9H 4XP6H 3RI5K 4X8XA 3DI2B 3VCLB 4ALAL 2BNQB 3PIQB 1N5AA 1A1OB 3OB8A 1UJTA 2DLTA 4XH2B 3BX7C 3CK0L 2FEEL 2NY3D 2R23A 3H3BC 4WI7A 4M5ZH 4AIZB 3B9KA 4OZ4A 3NTCL 1QPPA 2GUOA 4ODVL 1A7QH 1MHCA 4MNGE 1V7MH 1DVFD 5DA0B 5DJ8A 4NDMB 2QSTA 2OI9C 2XZQL 4OLZH 3L7EB 5IHUL 1OSPH 5TGBA 3QIBD 5D6DA 4EKXA 2PYED 3SKJH 2I07B 3VFWA 4JQIL 4XMPH 2VXTH 4L8BA 1HNGA 2GFBA 3AS3A 5HGBB 4I13B 3IU3A 1DE4A 2OR9L 4RISH 3PWVA 5EBMB 4QOKD 3K2MC 2AGJL 4QCIA 5LJYH 5E94B 4NN5C 3VCLA 1LO2L 5D1QC 2BNQA 3PIQA 1BEYL 1PLGL 1FLRL 3DV4B 1A1OA 4WO4B 1KT2B 2DQCH 1A6UH 1KN2L 4PJIF 4CU8A 3OAZK 3MOBH 2RBLA 5E2WH 5H94B 1EERB 2QSVA 2X4PB 4HIHB 4AT6B 2VMFA 3PL6D 3MRCB 2Q1EA 3E1F1 4OIIH 2DDQH 1T1XA 5BXFA 4JQVC 5J12B 3L7EA 4JM2B 2P43B 5F7NC 4Q9CA 2I07A 1JYVA 1WWWX 4GAYB 5F8QC 1CIUA 5DDHA 4EDWL 3MX0A 4D9QD 5I18H 1OAUL 1YA5A 3GBNH 4EN3D 2OQJA 5HGBA 2GT9A 4Z0XB 1PY4A 4L4VD 3M17B 4QRQA 4H88H 5EBMA 2YA1A 3JWOC 5E94A 1U3ZA 4JKWA 1E4XL 4DOHB 4HV8A 4XXCC 4XNXH 5ADPL 3N1MC 5DK2B 1HIMH 3DV4A 4KH2A 1KT2A 1EVTC 4TNWK 3C87A 3LHPL 3NACL 4QRPD 3RDTB 1YMME 4X80L 5H94A 2X4PA 4HIHA 4AT6A 4F7TB 2C26A 4IDLA 3T2NH 4J3VA 1GH7A 1JHKH 2ESVE 2VLJB 3BWUC 4OFIA 4HWEH 4JM2A 3VFMA 2D9QB 3D6GA 3B5GA 4RGOL 3MGOB 3S36H 3TNMB 4GAYA 5GJTL 1XF2A 4JRWA 1HH9A 4NUJB 4OSUH 2DQDH 1M4KA 5C70A 4EI5C 1P7HL 4Z0XA 5FA4B 4LCCC 4KROB 3L3HB 4YLQT 3U9PL 4JFEE 5C0GB 1RIVH 1DUYB 2QQNH 1RK0B 4K7PX 3G5XB 4XVTL 5LAXB 3VXSE 3QFDB 4ZFOB 2XN9E 2IAMD 2EXWD 4OLVH 1S7RA 1X9QA 4JEGB 3TN0B 4H1LB 3G6DH 3ARPA 2J12B 3U1SL 4JG1H 1H3UA 4MHHI 4M7KL 2E27H 3RDTA 4NO2B 4U1GC 1FNAA 4F7TA 3I3BA 4FQIH 3T08A 2NZIA 4R96B 1QPXA 5C0FB 4P0DA 1B6DA 2VLJA 3RP1A 1ACYL 3G9VA 4HPYH 3BRGC 1MJUL 1L0XA 3C2AL 4Y5VB 4E9LA 1HXYA 3HN3A 4LSVL 1AHWB 3EDKA 4I0CC 1KJ2B 1MI5D 2I60L 4UINH 3T1WA 2AJUH 1F6FB 1I7RB 4LHUD 3MGOA 3TNMA 4PJIE 3VW3L 3GMRB 4CVUA 3MBXL 4DAGH 3FT4B 4NUJA 5DLML 2IFFL 4U1MB 3CXHJ 1ZLVK 3IDXH 4XX1E 4TVPD 4WHYH 5LKNA 4XHJC 5FA4A 4XP1H 3L3HA 1DUYA 3KAAA 1RK0A 2DM2A 5E1AB 5KZCB 3G5XA 1P4BL 4G43A 3UROR 1EFXD 3QFDA 4XCEA 4QY8A 4ZFOA 2VL4A 5I0ZA 1TQCC 3TN0A 2H2PC 3QISA 1AO7E 4H1LA 4RFEB 1TXKA 2LTQB 1ZLWH 1FNGB 2UYLB 3RGVC 1I1FB 1RIHH 3PQYE 3C60B 4NO2A 2FATH 1HSAB 4P2OB 4BH8B 4W6YB 3DHMA 1WZ1L 5I8KL 3ULVE 1JI2A 4R96A 5C0FA 2B1AL 3PDOB 4LLMB 2R4RL 4FFVC 4KU1A 4Y5VA 1ZGLM 4M43L 1AHWA 3C5JB 4LSPL 1FL5B 4GXVL 1I7RA 3ZDYF 5HSFA 1A1MB 1OAKH 3GMRA 4NQDD 3FT4A 4KMLB 2EC8A 1CK0L 1I1AC 3GMOA 4TTDC 5DJZB 1R5WB 3SOBL 4ESKA 5BJTB 1ES0B 4JO4H 3QUXB 1WFNA 1TZIB 5E1AA 5HYJD 5BZWB 4QHNB 4BQ6A 4FQXA 4JDVB 2PTVA 3QUMH 5GGVL 1A9EA 2X4QB 1D5MB 1R24B 3UZQA 1FNGA 1RURH 4M1CD 1IAII 1I1FA 3TVMC 4OB5L 1AC6A 2ZCHL 4BH8A 1KV3A 1WAAE 3VG0L 4H0GA 1VA9A 3RQ3A 1QNZL 3NA9H 3P11H 3RX5A 3PDOA 4LLMA 4RMTA 4MDIB 3C09C 3LRSB 4JRXD 4R4NC 3ROLB 5FEBA 2C3XA 3C5JA 3MOQA 2ZCLH 1FL5A 4JM2F 3CZJA 3MJ8A 4MB5A 1A1MA 1CR9L 4AEHH 2XTJD 3TCXA 5JIIA 4MCYA 4HCRH 3C5ZC 2R39A 1A14H 1H3GA 5DJZA 1R5WA 3VFNA 1JZ4A 2DQUL 3QUXA 4CVXB 4YFLI 3WDJA 5BZWA 5F7MC 1SBSH 4JDVA 5A2KH 1TJIH 1X3DA 3O3EB 2CKBB 2X4QA 3K80A 4M62H 1D5MA 1WWCA 4IRSB 4I18C 4ONGL 3GSRB 3T0VA 5AAWA 4F37F 4JAMB 3WFCL 4OGZA 2HLFC 3VD5A 1R3IH 5ISZB 1NCBL 1DBBL 1L6XA 5KJRL 2EH7H 3MGAA 3V5HB 1GIGL 4JY6A 5DMIL 5TQ0L 3E2HB 4MDIA 1EMTH 2WBJD 3I85A 4BJLA 5LGHH 2VWEC 3SE9H 3ROLA 2B1HL 3FRUB 4U6HA 3QUZC 4JZJB 5DFVC 2KKQA 3RI5F 1Z3GH 5FYJL 2BNQE 4GAJH 4LSSL 2NY7H 4RMUA 1GPOL 3GRWL 1S9YB 4XHJD 1T03L 3IRZA 4AZ8A 1HZHH 1PKQA 5LBSL 3HKFA 4CVXA 4J12A 1W72H 1B0GB 2ZJSH 1QOKA 1OAZH 2JB6B 4LHUG 2Y6SD 3WV0A 2P7TB 3N1QC 4ELMB 3O3EA 4KI5C 3CIQA 2O5YL 4JKPH 5D71H 1DBML 4BFBD 1V7NH 4PJHB 2NXYC 3GSRA 3DMMD 4M5YL 2MCPH 4I9WE 1F58H 1VFMA 1YNLH 2D7MA 3OAUL 1ZHLB 4JAMA 5ISZA 4KKNA 4UQ3B 5ICYB 2GJ6A 2KZ1B 1TIUA 3ZKMC 3V5HA 2Z8WC 2ADJB 1ZV5A 5DFWH 1FZOB 1W2KT 2CH8A 2EIBA 4ODHH 1MAML 2ITDB 1H8NA 2AXHA 4Y7MA 1BQHB 3JUZA 2R0KL 4HMDA 4HPOL 1QACA 3MLRL 2W9DL 5KTEL 3HRZB 4YK4B 5F9WB 4LHQB 1S5IH 5T1DL 1E4KC 5IMLB 1Y6MR 1S9YA 1BF2A 3AU1A 4EXPX 4QWWD 4RQQB 4BUHA 1NC2D 1X5IA 2IG2H 1EAJA 4WEUD 1RVFH 4X7SL 2DIBA 1L0YA 4JO3H 1XF3A 3AS0A 1B0GA 4ZTOH 2JB6A 5F7FA 1MFDH 2P7TA 4LVOC 3MSPA 4PJHA 4HS6B 1ZHLA 1NEUA 4L3EB 3BJLA 4QXWA 4B7IA 3IAGC 4UQ3A 5ICYA 1NBVL 4UQ2B 1RZKC 5DD5H 1B4JL 2ADJA 1IKNA 1FZOA 3JV4A 4LVHB 4S1RH 3E3QE 1BQHA 4DOHE 3ZO0A 4LASL 2A9MH 3CDFA 2VC2H 5A2JH 3HRZA 4UV7L 5BW7C 4ZPVB 3QHZH 2WINB 5IMLA 3ROOB 4YDIH 3INUH 4RQQA 2JIXD 1KN4H 2QQQA 5DUMH 2PKDA 3NH7H 4M1DH 1UWGH 2QADB 5T33L 1TETH 3GIVB 5JOFA 4F57H 3VA6A 5GS1B 2VLJE 3IFLH 1MELA 4YNYB 3GRWA 5IEHB 4WFHD 1K85A 1CF8L 2ZPKL 4UIKH 4ETQA 1F4YL 1A3QA 2GQHA 3MBEC 3WBDA 4HS6A 4PJDA 3GBLA 4L3EA 2HT2C 1FE8L 3AS2A 1XZ0B 3CSYA 1MIEH 1LO0L 1TJHH 4N90E 1VSCA 5JW4R 4JLRB 1Z0NA 1YUHB 5HPOA 3NMEA 4JZOB 2YOCA 5JIHA 4WHTB 1AJ7H 3FOMB 2CRMA 1MVFA 5EZIL 4FFYL 4ZPVA 2WINA 1ORQB 2HRPH 5E08L 1N2RB 1OW0A 4O2FA 3BKCH 3ULVC 1DL7L 2DOCA 3MLWL 1MFAH 4LCYB 3L3DA 1KCVL 1NCUA 1QBAA 1MUJB 5IROC 3GIVA 5JHLH 2PUQT 4NRZA 5E6ID 4OLWL 3S6CA 4KJQC 4YNYA 5IEHA 3BDYH 3OJMB 1YEEH 5HHVL 1QTYT 3N0PB 5IEKB 5HXMA 1XGYH 4KRPB 5EU4B 1N0LA 1U8HB 3RVUD 3JWDL 4R26L 4UOW0 1IGML 5JPNA 3T77B 4JJHA 4GS7B 2LU3A 4NRYB 1XZ0A 5C3TA 1U92B 5F9JB 3QAZC 3HS0B 2V9QA 2J4WH 5DS8B 4JLRA 3QIUB 1S3KH 1YUHA 3BSZH 2G5BB 2IANB 4FABH 2OTWA 1Q9WA 4YC2B 3KPSD 4GKNA 5DXWA 4WHTA 3RWEB 2AAVA 3FOMA 4WW1A 3PNWB 4UBDC 1ORQA 2DQEH 4P5TB 3D39B 4OT1H 1YJDH 1KTLB 1LO3H 1IC7L 3UO1H 1DEEB 4XI5D 4LCYA 4ODSH 2PW2B 4X6DF 1MUJA 3VXNB 4HLJA 1A3LL 1KCSL 3DYMA 3MUGB 4HUVB 1UVQB 5T5NG 4FFZH 1J0HA 4I0KA 2OJEA 3IJHB 3MLUH 1T20B 1A5FH 2NW2B 5EU4A 4NP4L 1G9MC 4KRMB 3SO5A 1NUGA 3IKKA 1E6JL 1IAIL 1U8HA 4QF1B 2HFTA 1ZWIA 5BMFH 1CD8A 4NZRH 3QEHB 3ARBD 3T77A 4NRYA 2E7HA 1U92A 5F9JA 5LCVL 1FNSH 5DS8A 1ZMYA 5EIQA 2IANA 2F19L 3I02A 1BWWA 5D6DC 4X83A 3LQAH 2HTLD 2NXZD 3PNWA 4ORGB 2MFNA 4P5TA 3VG9C 3ZSTA 1KTLA 2OTUB 5DF0A 3IXAB 5J6HB 3BI9X 4JKKA 1DEEA 1OD7A 5L9DL 3L95B 1MCPH 2F53B 2NPLX 2X89A 3K8KA 3VXNA 4JGMA 3MUGA 4R0LB 4HUVA 1UVQA 3VFGL 4Q9RL 1JWMA 4O00A 2VDOH 5EN2B 5TQ2H 1BZQK 1T20A 4R7NB 2YC1B 4LEXH 2NW2A 5C2UB 1EH9A 1MPAL 3NA4A 3R1GL 1QSFD 3BQUC 1KXVC 4QF1A 3G08A 4OCSL 1Q94B 3WUWA 3ARDD 3OB0H 4QGYA 2HT2D 4PJDF 5AZ2H 2XKNA 4X9HA 2ORBH 1J10A 1QLRA 4HK0B 4BSJA 1KPRA 3WNKA 3AM8A 1O7SA 2EYTA 4YHKL 4Y4HA 4AIOA 5T1KB 1QVOB 1S7QB 3QP3A 3U4EB 5KVDH 1FCGA 4N8PA 4AH2B 1BMGA 1OARL 5CJXA 3U7YH 4DGIH 1NFIB 4X8JB 3MZGB 3U7WH 1CQYA 2OTUA 1UH3A 5J6HA 4N0UB 4W70A 1AE6L 2ADIB 5ISZE 5JIKA 1MEXH 2XXMB 2GJ6E 3RWCB 1RIUH 1BJ1H 2DLIA 2F58H 4AJ0A 4K55A 4MB3A 3GMMB 3L1OH 3EYQC 5EN2A 5HGAB 1HHGA 4JE4B 1II4E 2YC1A 4HAGA 4R7NA 4WO4C 1PZ5B 4JQXC 1KB9J 5JA8B 3TH2T 5EIIA 4NQSB 3U2SA 4NN6B 3CLEL 1Q94A 3VFUB 3TPUB 1SM3L 4NN7C 4GBXC 4AEIL 3U0WL 3HE7C 1VFBB 3JSSA 2QQLL 4HK0A 2VZVA 3K2UL 1PYWB 3KPLB 4Z0BH 4ELME 5T1KA 3U4EA 1S7QA 2YHGA 3KJ6L 4AH2A 4UBDD 3P73B 4PJHE 4JPKH 1F8TL 3AREC 1NFIA 4X8JA 1NC4A 3SJVB 3NZHH 3QG7H 4N0UA 5GGUB 1I4FB 2ADIA 4PGDA 4ZO9A 1QFWI 4RBPH 5FM8A 3T04D 2Y5EA 4MNQA 4G6JL 1ZS8A 2B4CL 5SWZB 1RZFL 5F3BB 2EH8H 3LS4L 4HUXB 1UCBL 5FA3B 4GG6A 3GBML 3GMMA 1MJJB 3K1DA 3RZCB 3S3JA 2DI7A 3L5JA 1FNFA 1PZ5A 1A4KB 3OPZH 4PJ5B 4NQSA 1J0ZA 4NM4H 4X98A 4PV8B 1QQDB 4MJ6B 4RFOH 3VFUA 1M71B 5C07A 3MJ6A 4GG8B 2NR6D 3ME0A 4YHIB 4F7MB 2P5ED 1JGDB 3THML 4BZYA 5FYJE 1PYWA 2GAZB 3FT2B 4M6NH 3KPLA 3FO9A 1MF2L 4Y16A 2V2TA 5IESL 5I71C 4GRWH 1I7UB 1H3PH 3P73A 5C9JB 1EXUB 4JHZA 3PV6B 3SJVA 5GGUA 3BDXA 2HFEB 4L3EE 3DYPA 43C9B 3LZFH 2FO1A 4LLQB 1JRHL 1GZQB 1EBAA 4FG6C 5SWZA 5F3BA 4OI8A 5F89B 4HUXA 2KH2B 5FA3A 2OR8A 3RZCA 3SDXB 1MJJA 1BECA 4WHYG 3TBTB 2F8VA 3VDCA 2I25N 2HVKB 4MCZB 4WFFE 4LL9A 4F7CB 1LEGB 3TIEB 4PJ5A 4H25B 3GJFA 3S5LB 2YK1L 4PPTA 4W6XB 3BQUD 4PV8A 4MJ6A 2V6HA 3EO9H 4U6YB 5INDB 2EZ0D 5A16A 1XCQA 2H2SC 4ZS7L 4ZAKD 1DBJL 4YHIA 5GQBA 4F7MA 1JGDA 4WI4A 4LPVA 3EYUH 2GAZA 1R5VA 4UOW1 2W9EH 3R8BB 4U3XA 1MRFH 4GRLB 3MRPA 1NCWL 4IRZL 3VWKB 1KC5H 1M7IA 4RDQG 4UUJB 5L6YH 2FEDC 4XC1H 2C3HA 1EHLL 1I7UA 1YEJL 5EOCH 5IB2B 5C9JA 1EXUA 2Y07L 2BVQB 3PV6A 1OVZA 2BDNH 2P45B 1UB6A 3HB3C 3UJIL 2P48B 1XR8A 4LLQA 1GZQA 5F9DC 3O3AB 4PR5B 2HKFL 5F89A 3JV5A 4TNVK 1WCQA 2DBLL 1S7XB 5E8NB 1J05B 3KXFB 1JPSH 4ONHB 3TBTA 4HEME 2RFXA 5JW4N 4POZC 4F7CA 1LEGA 3TIEA 4LSQL 3S5LA 1S7TB 1A7PL 5FV1L 5E4EC 3C60C 2L7JA 4NO0B 4D9RE 4P2OC 4HULB 5HDLA 1P4IH 2FHFA 4GBXD 5INDA 1C5DB 2FBJL 2WK2A 1J5OL 5IFJA 2NTFB 1R3LA 2YEZB 4GW4B 3TT1L 3MROB 2YD1A 3SGEH 2YR3A 5D7IB 1XGRB 1Z9SA 4PV9A 4XT1C 2IWGA 4WWKB 1YPZA 4YO0B 3VWKA 3KS0J 1L7TL 4UUJA 4YQXH 1NAKL 5KANI 2BVEA 4KVCL 4M8VA 3WXWH 3Q6FB 3QBTB 3NIGE 5IB2A 3SGJA 4YFEA 2BVQA 1JVKA 1FL3B 3IJSB 1EGJH 5BCAA 3MRHB 5F6HJ 3M8OH 4ZUWB 3IFPB 1T7XA 3O3AA 4DN4L 1MFCH 2O5ZH 3MXVL 5E8NA 3KXFA 4B7LA 5T3ZL 1RK1A 2GJJA 4GG6F 3DUHA 4DVBA 2IANE 1LEIB 3JWOH 1C8PA 1UH2A 1S7TA 2P49B 3SE3C 3QDJD 4NO0A 4K23H 1AKJD 5GIRA 1MY7A 3DGGB 3D39E 2A0LD 4YWGL 1H3WM 4L8SA 4YFLF 2EDJA 1C5DA 1EJ6A 2NTFA 4IOFC 4CRPA 4GW4A 1MQKL 1BGXL 2YEZA 4PGCB 5C0BD 3MROA 5D7IA 1XGRA 3H2WA 3BDBA 4WWKA 2XY1A 4YO0A 5DJ6A 2APXA 2A9NL 1F90L 1FVCB 3GO1L 3KPRD 5IBLD 3Q6FA 1U3YA 1AIFB 4YDKH 5CS7A 2R56H 1S78D 1FL3A 5DRWB 2XY2A 5IB5B 2A73B 5J4MA 1A6ZA 3PWJB 3MRHA 3FN0L 2AQ2A 1N64L 43CAB 1GVIA 3IFPA 5D1ZB 4FG6D 5HVHB 4YHZL 3UPRA 1GC1H 4G9DB 3SO3B 3C2SA 3E6HB 2BCKB 4IRSC 3ULUH 1WIPA 1LEIA 2DYPB 2C7UA 3EBAA 1MAKA 3L3JB 1MIMH 2BHYA 4Y4KB 3KPPB 4LOUC 3S96B 3RVWC 2AK1L 5L2KD 4WHDA 4OLUH 4APQD 2BJMH 1S7VA 3DGGA 1I9JH 4E5XB 2F74B 4TULH 1A6AA 5DHVB 2AJZB 3BT2H 2FDBP 3MA9L 1SMOA 5MI0B 4JZJC 4P9HC 3HR6A 4Q6IB 5CJQH 1FVCA 3LCYA 1AIFA 1H0DB 4LARH 1FDLH 4ZFFB 1RZJL 1F2XK 5DRWA 2YKLH 4Y1AB 2A73A 3PWJA 43CAA 3MLXH 5D1ZA 2D31B 4TSCL 1NMCC 4PJ9B 3LKOB 4Q6YA 4G9DA 3IFNL 3UBXB 4H8WL 5KVMC 3EOYG 3TYGL 1RAMA 4EOWH 2BCKA 3GUTA 2DYPA 4G80B 1MY5A 1DQDH 4POZD 2AW2A 3T0WA 2CO6B 3BKJH 2AKRB 4Y4KA 3KPPA 3S96A 5A2IH 5GXBB 3M07A 4X4XB 3KLHC 5C71A 3P9WB 1G9NL 2CIKB 4N0UE 4E5XA 2F74A 3QIWA 5D72L 5DHVA 4WEMB 2RHEA 3MXWH 2AJZA 3TA3B 1BFSA 5KVFL 4XPHL 2EIEA 4DEPB 3N85L 4YGVB 4GG6E 2MNUA 5M95B 1NCDH 4Q6IA 2CLRB 4PJGB 1YPZF 4CKVX 1XIWB 1H0DA 5DEZA 3D69A 3RTQB 4M8QB 1GAFL 4Y0GA 4Y1AA 3CDYA 1CXEA 4PRAA 5IB3A 2PTTA 2I5YH 2D31A 4R4FH 5CZVH 4WEBH 3TPKA 4ZFZB 3LKOA 4I3GA 2FR4B 4FTVD 5C0AD 3I6KB 4CU7A 5SWSD 3KDMB 3VWJD 5FUZL 1ZE3C 2OSLB 4G80A 4WI5A 3ILQC 2XIDA 1N8ZA 3X13B 2AKRA 1NSNL 2ENYA 4PS4H 4X4XA 3VD7A 3AXLB 5EPMB 1XCTB 3SJVE 1T89A 5HPMB 2CIKA 2Z92B 2EC9T 3D3VB 3TA3A 1U3HB 1CDYA 4X4ZA 5SWZE 1JZ8A 5K9QI 1P2CA 5D7IF 2WIMA 1JPGB 3GMLA 3ABZA 4PJGA 4XP4L 1XIWA 4OGXL 4PJ5E 1VENA 4M8QA 1C12A 4ERSL 3ULSB 2CDGA 1JNNL 4QXUH 3VRJA 4Z7OE 5ITBH 4ZDHB 1I7TA 3WN5B 5GS1C 1DSFL 2AV1B 1A4JA 5FGCB 3DARA 1G7JB 3KDMA 2OMNA 2OSLA 5DRZB 3X13A 1FVEA 2Z93A 2MPAH 3SDCB 3RVWD 1YEHH 3AXLA 5EPMA 5DD3H 2Q8BH 5B8CA 3O6FC 3L5XL 1HDMB 4Z78B 3ZYJA 5ALBH 1DBKH 2Z92A 4DGYL 1Q0XH 5IV2A 1ACZA 3D3VA 1U3HA 3OGOE 1CYGA 1YZZA 2WMPA 3SDXE 1JPGA 3GEWB 1NBQA 3O4LB 4KVNL 2FH6A 3QRFM 3QI9C 4RGNC 4KTDH 1YQVH 2Y9RT 1BJ8A 2VDLH 3V0WH 4Y4FD 2W92A 1VDGA 3ULSA 2D7NA 3IDNB 5EZOL 2EDTA 1DTUA 4ZTPH 1GGCH 3UZVB 3TZVB 2DKSA 3ZHLA 2QHRL 4HDIA 4ZDHA 3WN5A 2Q87A 2YPVH 2AV1A 1ORSB 3OXRB 4A6YB 1KEML 1G7JA 5E8DL 1XGQB 3OGCB 5DRZA 3ECBB 3D2UD 2ED7A 3RY5A 1F11B 5TE4H 3SDCA 5DVKA 3QNYB 4KJWD 5IFAH 5CZKA 4Z78A 1FBIH 4FA8A 5TPWL 4GS7C 1INEH 1KB5H 4M7LL 4IDJH 5GGSB 2HWZL 4P23C 3QIUC 4ZODA 2AJYH 2M8XA 3SKMB 1T66C 1F4WL 4OCMC 4I0PB 3KXFE 4U1IB 4UT9L 4MVBD 5EOTA 5IBTH 4XP6L 2VRAA 4MX7B 1VACB 4QHLB 3E8UH 5CJOL 1MNUH 4WU7B 4WUUB 4BZ2H 3IDNA 5D8JH 3DROA 2VXQH 4HXBH 3TZVA 1AY1H 1QR4A 2EDNA 1AC0A 4M5ZL 2P42B 3B9AA 2Z31D 4DZBB 4DFIA 1ORSA 3OXRA 3HI6H 5D7IE 5IT2H 1V7ML 1XGQA 3ILQD 1I3RB 2KZWA 3ECBA 3QEQB 4OLZL 1F11A 1OSPL 4RRPA 3UYRH 4P59H 3QNYA 4BFGA 1J8KA 3OKKB 1FZMA 4XMPL 4X5WB 1UKSA 3RUGF 2VXTL 4Y5YC 3FT3B 5KSVB 3BYTA 3WDHA 1WJ3A 4WI3A 1A22B 5B39G 3SKMA 4RISL 5J06A 1ZVHA 2B39A 4I0PA 4U1IA 5DMJB 4RAUA 2HFGH 4IOIB 3UZEA 4MX7A 1VACA 4QHLA 4PJGF 4WUUA 4IIQA 4K3JH 3WS3B 2DQCL 2GY7B 3BPLC 3WHXB 2QR0B 1QHPA 4F9PA 5E2WL 4O2EB 4R0LC 1ZT4B 2V7NB 4XB7A 4DZBA 5C2BH 5F9AC 5J9PB 2DDQL 3ZKXC 4ENEC 1BVKA 4UNVA 1I3RA 3CCHB 3QEQA 4MDJB 2EDEA 3BKYH 1SYVB 4J1UA 5AD0A 1MCWM 2AQ3A 1MAJA 4HUUB 3OKKA 2ZZUT 4KMTH 5IVOA 4J4PA 5I18L 4HJGB 3MA7A 5GRYA 2GY5A 2I9TA 3GSNB 3FT3A 3V6OC 4I48B 5KSVA 2FCBA 1T7WA 4H88L 4LLYB 3WFBH 3F58H 4D3CH 1UB5B 4IOIA 4UB0H 3ZTJH 4I77H 2FX8H 2GTWB 3MNWA 4HC1H 4XNXL 3V7AG 3WS3A 5B38B 1ZA3B 4M6AA 3WHXA 2A74B 4U2YA 2ZUTA 2H45A 4JJ5A 5I1DB 4XCYB 2DIAA 4NWUH 3BGMB 1ZT4A 5I1LB 5IVXB 2V7NA 1XT5A 3EHBC 3ULVH 1JHKL 5J9PA 5D7JC 3H9SB 1K8DB 3CCHA 4HWEL 4NN6C 4H5SB 4MXWL 3RKDD 3NZ8B 3LQZB 2RR3A 3U82B 5KSAC 4HUUA 4HWBA 3ZT6A 4MA7H 4PLKD 4OSUL 4U0RB 2DQDL 3OBAA 2EKSB 4GKSB 4HJGA 2AVGA 2XZZA 4KKBC 3GSNA 4PJXB 4X7EC 4Y1AE 4I48A 3RY6A 4IMLB 1DEDA 5EO9A 5IVZB 1BX2B 3WJLA 4LLYA 4P2QD 1MHHB 4FQPA 4XNMB 1UB5A 1CE1H 2GTWA 4OLVL 1PEZA 2EIDA 5B38A 3G6DL 4OIAA 1IEHA 1ZA3A 3BIBX 4ZFGL 2MQ0A 3T0AA 3LRHA 2A74A 1OGAD 5I1DA 2E27L 4XCYA 2C1OB 3BGMA 5IVXA 1FLTX 4PGEB 3ARTA 1PBYA 4K7FB 3BH8A 3PV7A 3H9SA 3F5WB 5FO9B 2JKXA 4HPYL 1K8DA 3PDDA 1WISA 4H5SA 3CFBA 4PJGE 5D2NB 4OFVA 1CGSH 3LQZA 1X5FA 4UINL 3RWJB 4ZOAA 5IQ9A 2AJUL 5KOMC 4XPBL 5FF6A 4U49A 4P46D 1LE5A 4P2RD 1CLOH 4P4RB 3PGFH 2VIRB 1PVHA 3QSKB 5KAQF 4GKSA 4FXGB 3IDXL 3HE6B 4IMLA 2PYFB 4XP1L 4FZEH 1BX2A 3G6JB 5EUOA 5IVZA 1E4WH 4FOMA 5DURB 1MHHA 3KPQB 4XNMA 4NHCH 4PB9L 4XNYL 3WSQH 2B8OT 3BIKA 3T0DA 1YN7B 4P3CH 3REWB 4HSQA 3QWRD 4N5ED 3U4BH 1EHAA 2E9WA 3GNMH 5JXEA 3FCTA 1K4DB 4NZJA 4CNIB 2DTMH 2E6JA 1JFQH 2R15A 2FATL 1IZJA 5HYQB 4XBEH 1Y6KR 4PGEA 4LCWD 4NQCD 3D3VE 5EA0H 4WENB 5GS0C 3F5WA 5FO9A 4YDJB 3EFDH 3GDBA 4KKLD 4Y2DC 5CILL 1R3KA 1Z6JT 4B53A 5HHXL 5D2NA 1A7OL 3RWJA 3RJDA 4P4RA 1OAKL 1J1PH 3ARGC 3QJHB 5FM5O 4FXGA 3G5YB 3S36X 3HE6A 5I8CB 2DS4A 3B5TA 2PYFA 5DO2D 3G6JA 4XTRC 1HHKB 3D87B 4JO4L 3N1PC 2AXGB 3G5VB 4GRLC 5H37G 5FGCE 1P4LB 2G9HB 3DX9B 3QUML 1WFOA 3W11D 1AR1C 5GZND 4XC3L 1A6WL 5GGVY 3F6IA 2B5IB 5T5NF 1FQ9C 1RURL 1S9WB 3HG1B 1K4DA 4BH7B 5I76B 2NY4B 3WLWD 5HYQA 2ENSA 2VNCA 1J1XH 4FFWC 4OD2B 4JCLA 5I1JL 3HMXH 3VXMD 3ZYOA 3JVGC 4JFHE 3P11L 4YDJA 1TTUA 1F2QA 1JGUH 2C3VA 2H8PB 3RWFB 3BUTA 4YHLL 4PRHA 2ZCLL 2XWBB 1FGVH 3TFKD 4KDVA 4RIRB 5EORH 5D9SA 4AEHL 3QJHA 1KIQB 3G5YA 4HCRL 3RA7H 5I8CA 1A14L 5DHYA 5E2VH 4BSVA 3SCMD 2OYPA 4YIQB 1HHKA 1Z2KA 3G5VA 5JDJA 2XZAL 3WNMA 4D0DB 1BREA 1P4LA 3WIFA 2G9HA 2HTKC 1TJIL 3DX9A 1FG2B 4M62L 1KJ3H 3T0EB 1P53A 4FQ2H 1R3HB 1S9WA 3NTCH 4ODVH 3HG1A 1OP9A 4YBLC 2FB4H 1YN6B 1R3IL 2YMXL 5E56A 5HYFA 3SDYL 2GSIB 3OJVC 2DM7A 5IVXF 1H15A 4LF3B 3WFDL 2WP3T 5DJDB 4H20H 1EMTL 2CSPA 4HK3J 3SE9L 1J0KA 3RWFA 5BVPH 1MCEA 5DJCA 4GAJL 2VZSA 1KCUH 2XWBA 4K94C 3L3GB 4RIRA 2F5AH 4WUUE 3FB5B 5I2IB 5FUCE 1MCWW 3ZSSA 4KV5E 1MCQA 3BP5B 3D18B 5IHLB 4YIQA 5GJSL 1T22A 1N7MH 4D0DA 5EUOF 1RV6X 2ZJSL 3SPVA 3SGKA 1FG2A 4MQTB 3MJGX 3QEQE 3T0EA 1OM3H 3U46A 4JKPL 2IFGA 3BP7B 1D3CA 1V7NL 1R3HA 5IJKC 5IGXH 4O02H 4MAYC 4CN6A 4WW2B 1F58L 2VLKB 5FDWB 2R29H 3ARXA 5HVHC 1YN6A 4QXGH 2V5TA 4LSRL 4OQTA 2GSIA 3RU8H 5D7LD 2V9TA 4HH8A 3SDDC 4LF3A 1KPUA 3VJ6A 5E5RB 3I2CH 5SWQB 4PRPB 3H0TA 1PW3A 3VA2C 1HE7A 4LK4A 3B9DA 1P7QB 4H1LH 3L3GA 3FB5A 5I2IA 4MZ3A 1ITBB 5DI8B 5IOPB 5DZNA 1KENH 4CVWA 5DJ2A 5SX5H 3C9NB 3Q5YA 4KXZI 3BP5A 5MI0C 4JO3L 1NBZB 4ZTOL 2P5WD 3G6JF 1ZOXA 4WIQA 4BFIB 1MFDL 1KYOJ 1F45A 5TJWK 3DXAB 3FQRB 4OM1H 4F9LC 5J0BA 3LHPH 3HI5L 5ANMB 4DTGL 3NACH 4X80H 3BP7A 4KKAC 2XFXB 1KJ2H 2XWTB 3E6FB 1TFHA 1YMMD 3WNLA 2E6PA 4M61B 1A21A 4WW2A 2V5SA 5A43C 2VLKA 4EQ2A 4F7EB 4PJ9C 3D0VB 4S1DC 5DD5L 3QUYB 2APVA 4OKVB 4RGOH 4PJAB 4UI2A 5SWQA 1JZ5A 4MD0B 4PRPA 4S1RL 5DGQA 5FB8A 3ZE2F 3PHSA 1WWAX 5E8OB 1OP5H 2A9ML 1P7QA 2H9GB 4M03A 5DQ9B 5L88L 5DI8A 5IOPA 1F97A 2IQAB 4JFED 2HKHH 1EIBA 1N6VA 4DEPC 1KN4L 5DUML 3LH2H 4M1DL 1NBZA 1QRNA 2XN9D 5IVXE 1TETL 4BFIA 3CMOH 4PJFA 5F88B 4MXQD 5HVFB 3H9SE 3DXAA 3FQRA 3LMJL 3MV7B 2CXKA 3RTQC 2XFXA 3J7HA 4UIKL 2XWTA 5DMKA 3IDIB 3GSWB 3IKCB 5I74B 1T2QH 3CLFL 1CQKA 4PJXE 4C83B 1OD9A 1XGPB 3D0VA 4LSVH 4WTXA 1I8IA 3QUYA 5B4MC 2NY0B 4OKVA 5EUOE 2I60H 1D6VL 4OFYD 2GITB 4PJAA 1T6VN 4MD0A 1I1RA 5CKAA 5F1KC 5JW3L 2FLRT 4L8CB 5E8OA 2MQ3A 5DLMH 4K9EL 5HDBF 2H9GA 2QEJA 2HJFB 4ZQKB 5DQ9A 3WS6A 3EOAB 1T6WA 4GMSH 4I1NB 1SVZA 1P4BH 3BKCL 4BQ8A 1JNLH 5DSCB 4OTXH 2CKNA 4XMLH 2BOCA 2IMNA 3WFHB 1MFAL 2YXMA 1T5XB 4KHTH 4MA1B 1X4YA 4NBZB 4RX4D 2X1XR 5JHLL 2R1WB 1AO7D 4C4KT 3LEVH 4M7ZB 4PLJC 1YEEL 4X9FA 4KI1A 2VQ1A 1XGYL 3PQYD 5D2NE 3UDWC 3V4VH 4RA3A 2VDNH 3IDIA 3VH8G 1AXTL 2KUTA 1VFAB 3GSWA 3IKCA 2ZSVB 1KTRL 4C83A 1XGPA 2VSCA 5GRJH 1IAIM 5LG1A 3G6JE 3JWNC 2GITA 3MFFA 5D93C 1DP0A 2J4WL 4D9LH 1S3KL 3BSZL 5DD1H 4L8CA 5E6ZA 1JHLH 4FABL 2CKBH 4XVUD 3ARYA 2HJFA 3PP4L 3SOBH 1FL6B 3EOAA 4QYOA 2AEWA 1RUPH 4OT1L 1YJDL 5DSCA 3KS0H 4PJ8D 3UO1L 1U93B 4J3WA 4KJPC 4QHKI 3WFHA 4JDTL 1T5XA 4ODSL 1FP5A 1I1YB 4IRJC 5HGDB 5C0EB 1D9KB 2R1WA 4YBQC 4FFZL 3GHEH 1T83A 4IOSD 4KKCD 3ZE2E 3MLUL 1PZUB 3L3KB 5HTSA 4KKAD 3VG0H 3GI8H 4PRHE 1IE5A 1VFAA 2ZSVA 1QNZH 4DZ8B 4WW2F 2NZ9D 4S1DD 2YPLB 3FO1B 3RWDB 5FO8B 2EDLA 2JJSA 2ICES 2DKMA 1TTGA 1VEOA 4O58H 4M4RA 3LKNB 3L7FB 1G0XA 3BKMH 4D0CB 1IC4L 1JNHA 1GJIA 5DZOA 2XKSA 1P5UA 4HWNA 2X70B 3LQAL 4Z6AT 2Y5TB 1N4XH 2Z8VC 1LO5B 1FL6A 3HG1E 1BJMA 2HT3C 3B9KD 1EO5A 2NY1D 1U93A 1T3FB 4HT1L 2BZDA 1MCPL 2XA3A 1I1YA 4ODUB 5C0EA 1D9KA 4NPYB 4PJFF 4DK6A 3L3KA 5HDBE 3WFCH 3S88H 4LEXL 2VN7A 3SDAB 1AI1L 2CXGA 1DBBH 1YDPA 5KJRH 5L2JB 4EDXA 4DZ8A 1JYXA 1GIGH 5DMIH 4AM0B 5AZ2L 5IBUB 1MH5B 4N1CA 4LLWB 3FO1A 5CZXC 1LK3H 3RWDA 2B1HH 4OUUB 5FO8A 3CFJA 1BFTA 3FRPA 3LKNA 4PP2A 5FYJH 3L7FA 4RWHA 4LSSH 3TF7C 1KACB 5LWYH 2BNQD 4JR9H 5BO1H 1PGRB 2X4NB 4D0CA 3GRWH 1HI6B 5DD0L 5KVDL 4RBPK 3T0EE 4BA8A 1T03H 4NHUA 1NDMB 5EZLB 4C58B 4DGIL 4PBXA 3U7WL 3K74B 1VADB 5MEQB 2EKJA 5JNYB 1T3FA 1BD2B 1KF9B 2CLZB 2DB8A 2P24A 4RWYH 3MREA 3O9WC 1RIUL 1HSBB 2F58L 4XX1G 4NPYA 4M5YH 3L1OL 3OAUH 4I9WD 2QBWA 1CE6B 4YAQA 1JF6A 3TO4B 5L2JA 2VB5A 3ZTJG 1I75A 3MJ7B 4XZUB 4FQJH 4AM0A 2YUZA 4LLUB 1MH5A 4ZNEA 4RA0C 1MCHA 4LLWA 3LDBB 4QRRB 3MRNB 2AJVH 4G6AC 5HD8D 3BD3A 4ZXBB 1J7VR 4HPOH 1WT5C 3CFIC 2QSCH 4KFZC 2W9DH 5T1DH 2X4NA 1DJSA 3RVTD 2Y7QA 1HI6A 4HBQA 1IARB 1CCZA 1T04B 1VB9A 3UTOA 1M05B 1NDMA 3EJJX 5EZLA 5L0QC 4JPKL 1T7YA 3FN9A 4HIJB 3MR9B 1H5BB 2VLKE 3MRLA 1VADA 3QG7L 5MEQA 3MQIA 2Q20A 5AEAA 3V4UH 5JNYA 1BD2A 2CLZA 4DW2L 1X5KA 1IM3B 2FL5B 3UTSB 4YBQD 4JM2D 1OTSC 3PWPB 1EEQA 4PRPE 1MFBL 1X7QB 5I16B 5D1XC 2XNAB 2VQUA 3OPZL 1YY9D 4LRIC 1NBVH 2COQA 4NM4L 3U30C 2VITB 3MJ7A 2UUDH 4RFOL 4KGJA 4ZS6D 1AFVH 1Y0LB 3EDJA 2WLYA 4PJCB 4LLUA 1ZT1B 1G6RB 1PAMA 4QRRA 3MLYL 5A3IC 5FYJU 1QRNE 1DQQB 4XWOD 5F1OB 2X4UB 1H3XA 3DLQR 3DXAE 4ZD3H 5ANME 1T04A 1U8IB 1WCBB 4YPGA 1FYTA 3S4SB 1U8PB 3RDTD 1T21B 3FO0H 5JHDB 3QXVA 2VR4A 3MR9A 1H5BA 5HI5D 3DX8B 1MCJA 3O3BB 4KDWA 5I30H 2NY5C 3KWWB 5E9DA 1CF8H 5D5MB 3KJ4B 3NCEB 2FL5A 1IM9A 3UTSA 1T2XA 1F4YH 3BN9C 4PJAE 1U8QB 3STZB 3PWPA 5BV7B 1OQXA 3MV9A 1X7QA 5I16A 2XNAA 4DKEL 1HYSD 5TH2B 1JIBA 1IRAY 4TUOB 1CICA 1LO0H 3K81A 4HKBB 4PJCA 1GRWA 2WBKA 4KROD 4V2BA 3HZKA 1G6RA 4L4VB 4WFGE 3QEGH 3LB6C 1DQQA 4UTBL 2YPKB 2X4UA 3EYUL 4YDLB 2W9EL 5GISH 1A6PA 3TN0D 3ARWA 1MRFL 4PLOB 5DC0A 3MV7E 5JW5A 3AB0B 3B9VA 1UC6A 4GW5B 4XC1L 1U8IA 4MQ7B 3LRGA 1WCBA 3S4SA 5KG9A 4Y88A 1U8PA 5JHDA 5EOCL 4QRPB 5ADOH 4PG9B 2BDNL 3DX8A 1ZHNB 1KEGH 4L9DA 3EAKA 3O3BA 4JFDB 3K4ZA 5D5MA 5HHVH 4NFDA 3O9WD 4ZPTA 3VFOA 5DT1L 3ISWA 4K8RC 3O45B 1U8QA 3STZA 3NGBB 4R26H 4K3DH 2VOTA 5TH2A 4NC1E 4HGWB 2BNUA 4UNUA 3SBWC 1P4IL 1PSKH 3U36A 3QQ9D 4B41A 4UAOB 4FQXD 3RPIB 2R1YA 2NYYC 4RSVA 2IAMB 4FHBD 2WAHA 2XPGA 1JGLH 3RIFK 1RHHB 4MQ7A 3TM6A 1JYNA 3IRPX 4QRPA 2O61B 4PG9A 5LGJB 1ZHNA 2PO6C 2HVJB 1MHEB 3JTSA 4JFDA 2G5RA 4AY0A 1A7RH 1B0WA 1FN4B 3B2UC 3O45A 3BESR 3BZDA 2OI9B 4KGLA 1IAIH 2DMBA 1OLZA 3MRRA 4LPUA 3JWOL 4M3JA 4LHUB 1RI8A 1FRGL 3MRQB 4HGWA 5LCVH 3F6LA 2DQTL 1OSZB 3OQ3B 4R4BB 2KPNA 3QUXD 3QXWA 1OAYH 4RMRA 2WLZA 1K5NB 5A3ID 3PP3H 3RPIA 2GKIA 1EFXB 4NN5B 1IL1B 4G8EB 1OGTB 5D1QB 4XPFH 3NCMA 5JMOC 2JELH 4YDKL 2Q8AH 1X5HA 5GRVK 1NBYB 5LGJA 1MHEA 2YPLE 3HNTL 4MAUH 4NOFA 1FN4A 4OZGB 1NAMB 3KHOA 1X5GA 1T5WB 3R1GH 2MSPA 2IPUG 3ULUL 3BVNA 3RHWF 4LHUA 5CJ8A 5KBNC 5EO0B 1MIML 1J1OH 5JPMB 3MRQA 4OLUL 5DD6B 1OSZA 2BJML 4R4BA 3GMPB 2VSDA 1I9JL 4PJCF 2X4OB 1I8LC 1K5NA 35C8L 1BHGA 4TULL 2CJUH 2E9JA 4XNQB 5J7CC 5F1SA 3DRTA 3KR3L 4G8EA 4ZUUB 1OGTA 5D1QA 3P0GB 2R9HD 1ROWA 3NFSH 4HMCA 2DLGA 1AE6H 1YYLH 3WIHL 2YN3A 4LARL 3T09A 1NBYA 5ISZD 4HS3B 2GJ6D 3O41B 5FCUH 1HN1A 1EZVY 4LCIH 4H1LG 1LP9A 2X1QA 4ZNEE 2AEIT 4X5LA 5HY9A 4OQ1A 4XCNB 3HCVB 3IETB 4OZGA 5F7UA 1NAMA 4JQVA 1T5WA 4X99B 5HHMB 1QFWM 4EOWL 1YQ2A 2GI7A 1ITCA 1DQDL 1DQTA 2W60B 3RX8A 1HQ4B 3S35H 5ESVB 1QR1B 3UJTH 3F7YB 4P57B 1K4CB 5JPMA 1A3RL 3H3PH 1IQDB 1OPGH 2DJUA 5DD6A 5FO7B 2DQGH 3CXHK 3RVVC 3GMPA 4LCCB 1QHOA 4OGYH 2X4OA 2C4FT 4JFQB 4WFEE 1BD2E 1WTGT 4XNQA 3MXWL 3P9MB 3MACL 5F44A 2LU7A 4XXCA 4ZUUA 4HHAB 2RAMA 4JREB 1NCDL 4HZLB 5CBEB 4PJ7B 4LAJH 4U1GB 3HNVH 4XMKL 2EDHA 4HS3A 1UCBH 2BVPA 3O41A 4X7FC 3RPKA 3GBMH 2I26N 4QT5B 4QRRE 2I5YL 5CZVL 4XCNA 5HYSB 3HCVA 3IETA 4TSBH 1G7MB 4CMHC 4UIMB 3CGTA 1GGIH 2WV3A 3QFJB 5ESVA 5B3JE 1QR1A 3F7YA 1T0NA 1J86A 4JHWL 4P57A 1K4CA 1S7WB 4PS4L 3HC4H 1IQDA 4EI5A 4V2CB 4NNPH 1N5YH 4MWFB 3C5SB 1YEDB 3QWOA 4LCCA 2B2XL 5FYJD 3IDJB 1JUFB 3HA0A 1ZT7B 3BRFA 1WZLA 3P9MA 5CEYB 5IESH 1IILE 1S9KC 2AJ3B 2XA8H 4OBRA 5IK3B 4MXVF 3UTSE 1TQCB 2MOVA 2XZCH 4HHAA 1B6UA 3PWPE 1WIOA 3VFRB 3P3YA 4HZLA 3DMMB 4MSWB 3CD4A 5DMGC 5CBEA 2BMKA 3Q3GA 3DVGB 4C59B 4L3ED 4PJ7A 5EDXA 3VFSB 1YEIH 4UDUA 3UC0H 4R2GD 4QLRA 4I5BB 4PJCE 2HP4A 4QT5A 4QXUL 3FTGB 5ITBL 4LDEB 3QDMB 5HYSA 2F5BH 1G7MA 3WIHA 3JWDC 4WFFD 4GKZB 1QFUH 5F1IB 3QFJA 1LVEA 1KGCE 1N3NB 1S7WA 5E99L 2MPAL 3BEVB 1I1AB 3C5SA 1INDH 2Q8BL 5JHDE 5AG9A 1YEDA 3S34L 2QADD 3IDJA 4XXDB 1ZT7A 1XF4B 2UY6A 4IRZH 5D5ME 2B20A 5CEYA 1K3IA 5IK3A 1CLYH 5I66B 3CFCL 3VFRA 4KZEH 2MHAB 1EFQA 5E6YA 4KTDL 4MSWA 1YQVL 3RGVA 2VDLL 3TVMB 1FAIL 3UJIH 3DVGA 1JTOA 3VFSA 5IMOB 2DBLH 4ZTPL 1GGCL 2ADFH 4I5BA 3FTGA 3QDMA 1LP9F 3MO1B 2EYSB 4U6XB 4HLZH 4LSQH 3C09B 1CDCA 4OZGF 4GKZA 4CADB 5F1IA 3GMNB 5C0CA 3IJYB 5HHPA 5FK9B 4D9RD 4FQ1L 3DETC 3QDGB 2FBJH 1N3NA 3BEVA 5H2BB 2KBGA 1AGFB 1I1AA 4P4KC 2QHLA 4FQLH 5IFAL 4QRPE 1FBIL 1G0YR 1INEL 2VTFA 4XXDA 4X7CC 4IDJL 4H0HB 3WDIA 1JF1A 4JFDE 4M00A 1JN6A 2DI9A 4NJAH 1UWXH 2AJYL 1L7TH 4W6WB 4GH7B 1AQDB 4KVCH 3MV01 2XICA 1BAFH 4U7KA 4GFTB 4EEEA 5I66A 4JFFB 1S7SB 4I18B 4KRPD 2MHAA 5IBTL 1MRCH 3EO0B 3TVMA 1KTDB 1YNKH 5J57B 1JMXA 1MNUL 3HAEB 4DN4H 1D5XA 4BZ2L 5IMOA 4EI6A 5FUOH 2VXUH 4HXBL 5ESQB 4PTUB 3MO1A 2EYSA 4U6XA 5DHVH 4N1EA 4ORZC 2X7LB 3HI6L 3QUZB 1DBAL 3WJJC 5TDPB 2A6JB 5FK9A 3QDGA 2UZIH 2EDBA 2HJLA 4P5TD 2OMBA 3OKDB 3UYRL 3H42H 1BGXH 5H2BA 1GGTA 3O0RH 4P59L 1AGFA 5CD3B 3C5ZA 3WFEL 5ALCL 5IQ7H 1BQHG 2XKUA 5IJVB 3BUYB 2X89D 1D7FA 5FOJA 4MLSA 3ULUF 2Z9TA 4HAFA 4OCWH 2A9NH 3GO1H 4PP1C 4FMKA 5I17A 4JFFA 1RZKL 1S7SA 4I18A 2HFGL 5E70A 3EO0A 3HTLX 3FN0H 4WTZA 1KTDA 2FYYB 4RZCB 4LKXA 2BNRB 5K59F 3HAEA 3BZFB 5JR1H 4OAWB 4TVPE 3RWHB 5ESQA 3X11A 4JRYB 4OV5B 2ITCA 2X42A 2Y36H 4PUBH 3AROA 4PTUA 1QBBA 4ZO6A 2P44B 3EO1B 4XB8A 5IFHL 1MLBB 5C2BL 4Y4HD 3RNKB 1LE9B 3QUZA 4HQQL 3PGCB 2A6JA 5DK0A 3SDAC 2NY2D 1MVUA 4JGUA 3ZT5A 4ACPA 3GSQA 4PY7B 3CX5J 3OKDA 3BKYL 5EC2A 1MCFA 5CD3A 3MA9H 1R5IB 5CHNB 5IJVA 3BUYA 2JJTC 3AS1A 2AEQH 3HR5B 1EO7A 4RFNC 2ICEB 2PCPB 1NDGB 1M1SA 4OZGE 3MUHL 3WFBL 4D3CL 4LVOB 1H8SA 2CD0A 1F4XL 1BJ1J 3MCG1 3UJJH 2B4CC 3MYJB 4HC1L 4PYGA 4RZCA 5TFSL 4TQEL 2BNRA 4EXKA 3BZFA 4MS8D 3VI4F 4LPTA 5I19L 1UM6L 4OAWA 3RAJH 3RWHA 5J56B 3TYGH 3RL2B 4JRYA 1JP5A 1NLDH 2DLHA 2H26B 4NWUL 3EO1A 3ULVL 1MLBA 3RNKA 2QSQA 3K4AA 5T1KD 1LE9A 4WTWA 3QNZB 4U1SB 3RIAF 4NCC2 3TO4C 1E4KA 5AUMB 1NC4D 5D72H 4HJ0D 1JGEB 1R5IA 5CHNA 3FAXA 4MA7L 4XPHH 3LDBC 3TNNA 2YD7A 3ARSA 4MNQD 2XWJB 3LKSA 1SEQH 4CW1B 3TT3H 3HR5A 4ZXBC 3VFTA 1AD9B 4AQOA 3MRMB 3OAYH 2ICEA 1NDGA 3QQ3B 5HHME 1QD0A 4CJ0A 2GK0B 1CE1L 2VABB 3MYJA 3MBEB 2NY3C 2ICWI 2ZUQC 4XAWL 3ILPB 1QFWH 4KK6D 3ARDB 5C07D 5F71A 4OI9A 2NQCA 4DUVA 3TC9A 3VXSA 3RL2A 2H26A 1DVFC 3VRIB 1U9KA 4YXKH 4Y16D 3QIBC 1BZ7B 1U3JA 3QNZA 4U1SA 3IGAB 1FVDB 5BW7A 5AUMA 4RNRB 4ONOA 4K07A 4KUZH 3T3ME 1JGEA 4MHHG 4PJ7E 4XNUH 5CSZB 5CLTA 1G9ML 2XWJA 4CW1A 1P5VA 5SWZD 3TJHD 1AD9A 4LRNL 3MRMA 3LKRB 3RZCD 4Z18A 4XP4H 3GSOB 3ESVF 1RZGB 4OGXH 3QQ3A 4ERSH 4A6YH 5IB4B 4PJ5D 3WSQL 2VLRB 5KSBB 3QFJE 1C08B 4DKDC 1P1ZB 2VABA 3MBEA 4P3CL 5IVNA 3RNQA 4NUGL 3VGAC 3ILPA 4K7PH 3GNML 5FV2A 3PL6C 3VXQB 1DSFH 2DTML 1JFQL 1V3LA 3R0MA 4QTHA 4AG4L 1IMHC 3CZFB 3O3DB 3I6LE 3QAZB 3VRIA 1F3DH 4XBEL 4WNQA 1MFEH 1T1YB 5EA0L 3WUWG 5BV7C 1BZ7A 3EFDL 4LPYA 3IGAA 3GIZL 1FVDA 3P4LA 1X5LA 1FC1A 1KFAH 4RNRA 5IP4A 3VI4E 4EN3C 2DICA 4OD1H 5F1NB 3DIFB 1RJZB 3ES6A 4UV4H 4LLDB 5JMRA 5CSZA 1E6OH 2K9UA 5EOCJ 5IROA 1BM3H 4YDLC 3QDME 3GSOA 1RZGA 3UTZB 1EHNA 5GGTL 4AENB 2VLRA 3G5ZB 2SEBA 4KI5F 1C08A 3H8NA 5EZOH 5KSBA 5C0CE 1P1ZA 5D2LB 4HH9B 2QHRH 3TBWB 1FFPB 4HKZA 3VXQA 3EYFB 1DN2A 2MKLC 1KEMH 3CZFA 4PREB 2P5EB 3O3DA 5B3NA 3O2VL 4HKJB 3HMXL 4OI7A 3VWKD 3LS5H 2D7PA 1ZVSB 5T3XL 1JGUL 4F37K 3WYRA 3DVNB 5FECB 2IPUK 1WAAA 1VGEL 2LU4A 3VG9B 5ELIA 5CBAB 5F1NA 3DIFA 1RJZA 1FGVL 2HWZH 4LLDA 3W5NA 2ATPB 5DFTA 5GSVB 2DLFH 1N26A 3MRJB 3KXFD 5E2VL 2IAMC 2EXWC 5F7LB 3JV6B 3UTZA 5CJOH 5AG8A 4QHKJ 3DHJA 3PUCA 4AENA 4X6CB 1UCTA 5D2LA 5EU3B 1PG7L 4NO0D 1KB9K 3BQUB 3QDGE 4PIRF 1KJ3L 4FQ2L 1SEBB 1ULVA 1DANT 3TBWA 1FFPA 5TDNA 4HWBH 3EYFA 3UEZA 5LXGH 4M02A 4PREA 2FB4L 3GSNH 1CDGA 1XEDA 4O5LL 1AGEB 4HKJA 5SX4I 3QH3B 3O11B 2YRLA 3BN3B 1TNMA 2OK0L 3EYVB 2KL6A 4L5FH 5C1MB 4H20L 5EO1B 3HFML 4JFFE 3DVNA 4R9HA 5SX5K 1YYML 2IJ0C 2FIKB 5BVPL 3WIIL 5ITFA 1KCUL 2F5AL 4KRLB 5K9JL 4KQ3L 4OD3L 1YY8A 4OGAD 5GSVA 4NJ9H 1EDQA 2Q76A 5J11C 3MRJA 2E7MA 4LU5H 5J1SC 4JPWH 3UTPE 5TE7L 3JV6A 1N7ML 2VWEE 5GGQL 4IEFB 4XH2A 1ETZB 5EU3A 4K3GA 3FZUD 3BQUA 5JO5B 1OM3L 3CAFA 1SEBA 4AIZA 5CFHA 4NN7B 4GBXB 5IGXL 4MB4A 4O02L 3HE7B 5DEFB 1BVLB 2R29L 5GGTA 1FAKT 3L6FB 1VERA 4QXGL 2MKWA 5T1MB 4NDMA 2R0ZL 1NGPL 1AGEA 3RU8L 3QH3A 3O11A 1DLHB 1NEZB 3VXRB 2HFFB 4DCQB 3EYVA 3I2CL 1I85C 1G9NC 4KI5E 5EO1A 4PGZA 4ZFOL 5ICZB 3AREB 4Y19B 1OTTD 2NLJB 2BNRE 1HK6A 3HMXA 5J3HD 3ULVF 5D1ZD 1KENL 5L7XL 1IGIH 5JUEH 1MREH 4JRYE 2R2HB 2DWEB 4ETYA 2DYPD 3RKPA 1HKLH 3K4DA 4WO4A 4JQXA 4M1CC 5F7HA 1ETZA 1FG9C 4OM1L 4Y4KD 5KSBF 5JO5A 1V3MA 3IDMB 4X5XB 5T3ZD 3PHOB 1KJ2L 4U7SA 3MRCA 4GBXA 3NAAL 3HE7A 4MMZC 5DEFA 3QIWD 3V95A 1BVLA 1RUMH 1OCWH 4Q74A 3L6FA 5FKPB 2VDKL 5T1MA 1IEAB 1T1ZB 4MXWH 3DTXB 1DLHA 1NEZA 4W4OC 1DUZB 4JY5H 2HFFA 3VXRA 4DCQA 5I71B 2ERJC 4L4TB 2XTJC 4G9FD 3ZLQC 5ICZA 1A7BA 3AREA 4K8RH 2HG5B 4P5KB 1EPFA 4WVRA 4Y19A 4Y1AD 2HJKB 1WAAF 2NLJA 1H9VA 2PF6A 1G9EA 2P8LB 3M17A 4LIQH 4LPWA 3VXTB 3ZL4H 5D7SH 2DF3A 4G7VH 5D4QA 2HKHL 1KELH 1WBYB 3LH2L 5I1CL 2DWEA 5DUBB 3KPOB 4JREC 5DK2A 3CMOL 3B43A 5DRXB 2E9IA 4ZFGH 5T5FH 3WFZA 1QYGL 3IDMA 4X5XA 3VXUB 3PHOA 3CSPA 2AXJA 3O2DL 1J88A 4MJ4A 3TLRA 3OG6B 2V7HB 1T2QL 3TA3D 1WITA 3DI3B 5FKPA 2WBJC 5C0JB 2AABH 1IEAA 3ZE1F 3QUKB 3DTXA 3MPCA 4JHAH 4XPBH 1XIWD 4L4TA 3CJJA 2HG5A 4P5KA 4P3WA 2ARJB 3GB7B 1HKFA 2HJKA 3H9HB 2P8LA 2NCMA 5C0GA 4GMSL 1CXFA 3OKYA 3VGEA 3VXTA 2CDEB 4LSTH 5LAXA 1JNLL 3KHQA 2Y6SC 4OTXL 4PB9H 4XNYH 4XMLL 1NKOA 1WBYA 5E5MB 1FNEB 3CVHL 4KHTL 3KPOA 5DRXA 5JQ6H 3LEVL 4NSKB 3DMMC 3P9LB 3W2DL 1X5ZA 2M1KA 5E4EB 1P6FA 3SQOL 3VXUA 1CD0A 3V4VL 2VDNL 5J6GB 2V7HA 3UAJD 4CJ1A 3D3VD 1U3HD 3BGFC 3F7RA 5GRJL 5CILH 1J87A 3QUKA 2W07A 5HHXH 1KJ2A 1A7OH 2ICWB 4D9LL 2E6QA 5DD1L 1I8KB 3REVB 2VLRE 1JHLL 5KSBE 5ACMA 3T2PA 4U1MA 2EEAA 2APFA 2CKBL 2ARJA 3GB7A 4Z5RB 2NX5B 4QWWC 4NCDA 3H9HA 3ARFC 1CDHA 2ICCA 1GL4B 3RVXD 5IWLC 2CDEA 1N0XH 1RUPL 5DQJB 3K8MA 5MERB 1K6QH 3WO3B 4B50A 5E5MA 3DVIA 1FNEA 3MC0A 4XC3H 4OQTH 1A6WH 4RFEA 5BOZG 2DQJL 2UYLA 1DLFL 3GHEL 4NZTL 5KVEL 2YD3A 3C60A 1EVUA 4P2OA 1HSAA 4P9HL 5HVGB 3RWGB 5IIEB 4GT7A 3GI8L 3EJZC 5LVEA 5JDSB 3CVHB 5F21B 5F6IC 5I1JH 5J6GA 2YSSB 1IAMA 3GSXB 3JBG7 3QHTC 3FHQA 1NCAH 3D0LB 2EDXA 4YHLH 5DHYB 4MD5B 4O58L 2ICWA 5HHNB 4FQCL 3O2DA 3BKML 4MQSB 3REVA 1I8KA 1GHFH 2GCYB 3S7GA 5LQBL 4PD4J 5D2LE 2BSSB 3GK8L 4Z5RA 2NX5A 3BEWB 3TZVD 1N4XL 4C56B 5BJTA 1ES0A 2A77L 1TZIA 2XZAH 4QHNA 5DQJA 5MERA 2GK2A 3J8F7 3ZE1E 2ADGB 1R24A 3RFZC 2KQNA 5EU7C 3SE3A 1U0QA 3STLB 4WWID 3RWGA 5AYQA 3S88L 4ZUTB 2FX7H 2YMXH 2EXYD 3CVHA 3SDYH 3MNZB 2YSSA 6FABL 3WFDH 4UDTB 2ZG2A 1UXWB 3EDEA 4L1HA 3LRSA 4HX1B 1LK3L 3D0LA 1AQKL 4AK1A 4I0PD 4Z9KB 3ZZ1A 4MD5A 2CK2A 4G3YH 1B4RA 1Q9OB 2QL1A 4YHPB 5LWYL 4JR9L 1XH3B 5BO1L 1U95B 4O2CB 4WUUD 5KS9B 5EU6B 3AMKA 4KK8D 5EG6C 2KQMA 3BEWA 4UNTA 1G7IB 4C56A 1V05A 5GJSH 3DOSA 5I9QB 1NMCB 4KZDH 3MJ9A 4RAHA 1IAKB 5E6IC 3P40A 4U6VL 4RWYL 1QZ1A 2UVFA 2ADGA 2CKBA 5L8LB 5KW9L 2XRAL 4IRSA 2IQ9H 3FO2B 3QEQD 2VISB 3L3IB 3VGGA 3D2UB 3OR6B 2YS4A 4XPGH 3RVUC 2J88H 3STLA 2X9YA 4BKLB 1GOFA 4F15C 5AZEL 5CSBA 4LSRH 5GRZA 4OFDA 5C3LD 4FQJL 1NCTA 4UDTA 1H3TA 1UXWA 4LLAA 5T3XE 2AJVL 5C7XL 3FRUA 4JZJA 2ZWLT 2B7DT 4JY4B 1Q9OA 2QSCL 3SGDI 5CD5C 4BQBA 3EOBB 4YHPA 1U95A 3O8XC 4O2CA 3S37H 4KPHL 5KS9A 4NKIH 5EU6A 4ONFH 1G7IA 3WXVL 3ARFD 5IHBA 4XI5C 4DGVH 4XBGB 1Q38A 5JA9A 2ATKB 5IF0B 2X05A 1QA9B 4J3TA 1TCRB 3V4UL 4ELMA 2Z31B 2YD9A 3HI5H 3NN8B 4ODBD 3F65A 4DTGH 5LGKA 3C8HA 4MNHB 3VXRE 2VISA 2EE2A 3L3IA 3W0WB 1M6OB 4BYHA 5CGYD 4BKLA 2BRRH 1SJEB 5E8EB 2XG5A 1PX4A 3EJZD 1QP1A 4Y19E 5C92A 3ARBC 2W9LA 4U3HA 5DJ0B 2AS5M 1EA9C 1AFVL 4KHXH 3IU4H 4UU9B 3TBYB 3OSKA 2W91A 2ITDA 4XPTH 5IB1B 3TJEL 5BZDB 4UILL 4WV1C 4JY4A 3RZWA 4ZG1A 2HTLC 2NXZC 3EOBA 5L88H 1WZMA 3IS0X 3DWTA 4ZD3L 3DECA 2W0KA 3OR7B 1KJVB 1G7LB 5D7KE 4XBGA 3FO0L 1V5JA 2ATKA 1P84J 3UXFA 5IF0A 3CH8A 1QA9A 4Z7VB 4LQ1A 3OL2A 1TCRA 1IKFH 5TF1L 1L0QA 3LMJH 5I30L 3NN8A 3H9SD 1U58B 1PDKA 2WWKT 1B9ZA 4MNHA 4U1LB 4BK5A 3UPCA 4Z7WB 3W0WA 1M6OA 4L4TE 3CLFH 1F02I 5E8EA 3ARDC 1UEMA 1KBGL 2UVEA 4UQ2A 1KUMA 4YDVB 2IPKB 3O6FB 1AGCB 1BQLL 5DJ0A 3W9EB 1D6VH 1OAQL 3WD5L 3TBYA 1IC5L 1LHZA 4RRPG 3VFPB 5JW3H 2V5YA 5IB1A 3QEGL 3D48R 5KAQG 4K9EH 4PJBB 3EOTL 1P7KB 3QI9B 4RGNB 5GISL 3DUUB 1QSVA 1B2WL 4HG4J 4KK5C 3ROOA 1MHPH 2Q3AA 2RCSH 2IALB 5JXED 3OR7A 1G7LA 3VXUE 2HMIC 4XAKD 5ADOL 4Z7VA 1KEGL 2BY2A 5GS1A 4HXAH 1A8JH 2FNBA 5BVJB 1U58A 2VDQH 3BPNC 2LE9A 4PG2C 4Z7WA 1AXTH 2R0WL 3NIDF 3QDHA 4K3DL 4YDVA 3O6FA 1AGCA 1ZXQA 2VL5B 1CFTB 3A6BH 1ZAGA 3QWQB 3W9EA 3HE6D 3ORJA 3HZYB 4P23B 1PSKL 3VFPA 3JUYA 5EULV 3FFCB 3P4MB 4Z95H 4NNYB 4JZOA 4PJBA 2BFVL 4K71B 5CD5D 1P7KA 3PP4H 1X6NA 3QI9A 1VGKB 2DRUA 2HAZA 4KK9D 4OCRH 3O8XD 1N2RA 2VYRE 5IUSA 2HT4D 1C1EL 1JGLL 2IALA 1PY9A 2DBJA 2EECA 4U2ZA 3BHBB 2A6IB 4QNPE 4JDTH 1S7UB 1OGAB 2ID5A 1QG3A 5ESAB 2J5LC 1UM4H 3FMGH 4ZMAT 4DJMA 5BVJA 4ELMF 1A7RL 5IEKA 4Z8FH 4R6UA 4PJHF 4PRHD 5BQ7B 2DWDB 4NC0B 5KANG 1TENA 2VL5A 3V0AC 2NX5E 4L9LC 1U6AH 2NR6C 4Y5YB 3HS0A 2XT1B 3HZYA 4P23A 3BO8B 3QIUA 3KYAA 2G5BA 2X6MA 1OAYL 5EB9A 3FFCA 3P4MA 4NT6B 1IC4H 3T3PE 1X5JA 1HQRB 3UBXI 3GJFK 3RWEA 1QBLH 1VGKA 1JTTA 1SBBA 1DQLH 3D39A 4XPFL 3LY6A 3ZTNH 2JELL 4F8QA 1S9VB 3TWCL 1YECH 3BHBA 3BPLB 5E2TH 2Q8AL 4HT1H 1S7UA 4GUPB 2PW2A 5ESAA 2V17H 2WZPD 2N1KA 3SE4C 3BD4A 4LCWB 1D5IL 1IFHH 1XR9B 2K1MA 4WRLA 3IJHA 4ZUSB 4MAUL 3VGBA 2BERA 3ZKXB 1AI1H 5CEZH 4J2XA 2BSED 3W82A 4NC2B 2HN7B 4NOBA 5BQ7A 1RMFH 3QZWB 5AYUH 3QEHA 4QRUB 2EZ0C 1J1OL 3A67L 4ZAKC 4C56E 4Y5YA 1UH4A 4QO1A 3BO8A 1N6QH 2J3SA 2FGZA 1UYWH 4G8IB 2CJUL 5DD0H 1HQRA 5E95B 2Z8SA 1MJ8H 4ORGA 5JXAL 1GYAA 3HZVB 3LSOB 3T0ED 4KK5D 3PABB 3NIDE 3PWLB 3IXAA 2IBGA 3NFSL 4XNZB 1S9VA 5I8EB 2HMID 1YYLL 3L95A 1Q1JH 3K3QA 4GUPA 4XCFL 1JZ6A 2F53A 4X6BB 4YFDB 3VMOA 4OJFH 1YC8A 1A1NB 3F8UB 4R0LA 3V7AE 5FCUL 4LCIL 4HW6A 1E4JA 4ZUSA 1G6RH 3VXMB 4F7PB 4G8GB 5D7JB 1K8IB 2BC4B 2NY6D 3N1GC 2AJSL 4Z7WF 5KSAB 3QZWA 3S35L 4DWHA 3OF6A 3ZKSD 3UJTL 5KS9E 5EU6E 4QRUA 1CGUA 2VZTA 5F3HB 4R90H 2OP4L 3VMPA 3H3PL 3V6OA 2AEPL 1OPGL 2DQGL 4EBQL 4CDHA 4OGYL 4G8IA 4AIXA 1QVOA 4N1HB 5EBGA 3NCYS 2HH0L 2JLLA 5CEXB 3HZVA 5K9OB 3LSOA 3MTRA 2XQBH 3R06B 4N9GB 5BV7H 1YNTB 1H8OA 4OKDA 2VLKD 2E7LC 5FYKL 4X6BA 4KXZH 4DW2H 3RWCA 3HNVL 1X5XA 3B2VL 1MJ7H 4MNGB 3H7LA 3OJDB 1NKRA 2EICA 5HGAA 1MFBH 4G8GA 1FHGA 5D7JA 4TSBL 4PRPD 1RULH 2CUHA 3BP4B 1K8IA 3DV6B 2BC4A 1GGIL 3NIGF 5GSRB 2VQTA 1P7QD 4HIIB 5KSAA 2VDRH 2V5MA 3TPUA 2A0LC 1FZJB 4DFHA 1VFBA 4YZFF 3MLYH 5DZLA 3HC4L 1OLLA 4NNPL 1N5YL 4GLRH 1QRND 3MRFB 3VH8B 2FO4B 3TIDB 5C8JB 1FFRA 4J3XA 3DXAD 2XA8L 5CEXA 2DM3A 5K9OA 5IBLC 1FO0B 2XZCL 5F97E 1S78C 3W0WE 1UJ3C 1YNTA 4PGBB 2E5EA 1I4FA 1QSZA 4PRID 5TE6H 3KNBB 1WBZB 4C4KO 3LOWA 1YEIL 2R0LL 3UC0L 2VZUA 1JPFB 2ICWJ 3FQNB 3QUYD 5D7LB 4Z7NF 2F5BL 1RJCA 1A4KA 4DKEH 5GHWH 2C1PB 4Y2DB 4HUKB 5K9QG 3BP4A 3DV6A 1QFUL 1QQDA 5GSRA 5A2FA 3ZHDA 4D2NA 4HIIA 4APQC 1M71A 1U91B 1LD9B 1FZJA 4GG8A 3ARGB 1GOGA 2YUVA 3C8KB 3A0OA 4U1KB 4HGKC 1INDL 4UTBH 3FT2A 3MRFA 4Z7VE 5JZ7D 2FO4A 5C8JA 3GHBH 1HHIB 2P5WB 4DKAA 4U0QB 1CLYL 4Z7WE 3TESA 3TBVB 5FM5M 1P69B 4KZEL 4R8WL 4K3HA 3S9DB 2HFEA 43C9A 1S8DB 3KNBA 7FABL 1WBZA 4S1QL 4Q7DA 4TVPH 1JPFA 1RJYB 3FQNA 2ADFL 4K94L 5DT1H 3SDXA 2NY0D 3ZT7A 4E41B 5D7LA 3ZDXF 4Z7QE 4TTGA 1NGQH 2HVKA 1MLCB 4MCZA 2C1PA 4H25A 5HVWA 4PJBE 4Y2DA 5DVOA 4RGNE 2EO1A 4U6YA 1LD9A 3GGWB 4IMKC 4MYWB 3ARGA 5FFLA 4FQLL 2XXCB 4CN1A 2MMXA 4LPXA 5C6TH 4LP5A 3LQAC 4LVNB 1RHFA 4GRLA 4LP4A 1RUQL 4NJAL 5BRZB 3V79C 1J18A 1NAMH 4EUPB 2L7UA 1BAFL