2VLMD

The structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
184
Chain Sequence
QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVKDSDVYITDSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords JM22 TCR ALPHA CHAIN
publication title The Structural Dynamics and Energetics of an Immunodominant T-Cell Receptor are Programmed by its Vbeta Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 184
sequence length 199
ec nomenclature
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vlmD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vlmD02
1KENH 5FOBA 2DMCA 3FAWA 4MNQB 2X4QA 4P5TB 2L7UA 5FAAA 3C6LA 4TRPH 5DA0B 2R8SL 2BNQD 3O2WH 1NC2D 1MCSA 2HJFB 3T2NH 1NGYA 4XMPL 1AP2A 1YUHA 5SWSE 3WEXB 2XG5A 4XC3L 5HHOD 5C09D 1I9JH 5CHNA 1XF5B 4XNMA 3CZFB 4U3CA 5DQDL 3SGDI 2O5ZL 1LEKB 4Q6IA 3TT3L 1A6TB 3LQAH 2E7CA 4PRBB 1JV5A 4HIIB 1GOFA 4PRDA 5EO1B 4P23B 5I17B 3MX0A 4ELMB 1RUPH 5D9SB 3R1GL 1I1YB 1ZLSL 4NGHH 4FQ1L 3V9FA 3OAZH 3R06B 1F97A 4XNYL 1HZHL 1ZT4A 5GGQL 1DN0A 5E2JA 2VQUA 2NZ9C 2DLFH 4PGBB 3QDGD 2XWTB 5KVGL 3WIIL 1IGTA 3QB7C 4LLQA 4OFYA 4PJ7F 3MRDA 3TZVC 3DHJA 1M7IA 1XGPB 3QHTC 4NC2B 4P4KB 3NAAH 2A77L 3F7QA 3M1BB 1BVZA 3K7UA 3L95B 4FXLA 4WGVB 5EBLB 4OUUB 2ZNWA 2G2RA 4XPTH 1VADA 4ONHB 1U42A 3ZSSA 4CVZA 4XTRC 1G7QA 3QDJE 3JWDL 3MLPA 2FB4L 5BS0E 5D71H 1AXTH 4UDTA 3CSGA 1MJ8H 3REVB 5EB9A 3SCMA 4JN2A 1HXMA 1IRAY 4PJAF 3V4UL 3VD5A 4HCRA 1R5VA 4AENA 3HRPA 4U7MA 4NM8L 5ID1B 2IPKA 5FKPA 3MLYH 1OSZA 3FRPG 3U7YH 1IC4L 4ZNCD 2ESVE 2GY7B 4KKAC 3BRDA 3VW3H 2A9MH 1OTTD 1MCKA 2SEBA 3VI3F 1F00I 2V2XA 4X6BB 2OR9L 2HFEA 4U6VL 1V7NL 3HA0A 2A74A 5EZLA 1FQ9C 3S98A 4CU7A 2DBLL 5D2LF 4D8PB 3STZB 2E27L 1WF5A 5E9DB 4OLVL 5DVNA 3T4YB 1FIGH 4I0CC 3CNKA 4OFKA 2HWZH 1AGDB 1OLZA 5HHXL 2ADFH 3FHQA 4X7CC 1YEGH 4P2QA 2OJZH 2YHGA 1U2HA 1ND0B 2BY0A 4IJ3B 3ULUH 5GJTH 2EDNA 1VFAB 3D3VA 2P8LB 4XWOC 3HHRB 1U3HA 5CSGA 4CU6A 4XB7A 3PXHA 4N1CA 3I6GA 2DWEB 3MCKB 4JHZA 4NKMA 4B50A 4Y4FC 4PBVC 4HDIA 3UROR 5JNYA 2NY1D 3G9VA 4MNQD 1BQLL 3PP4L 5IB1A 2B1AH 4P5TD 5I1GL 2F74A 4HPOH 3OPZL 5J89A 4XBGA 4IRSB 4JKKA 5B39A 3V0AC 4UOW1 4ORZC 2OZ4A 3LEYH 1A1MA 4WENB 1NFIB 4WW2A 3V8CA 4QTHB 1P2CB 1RURL 4U1IA 1RK0B 3SE3C 5F7NC 3HZMA 1YNTB 2X41A 3Q6GL 7CGTA 3DMMA 1KN2L 2XTJE 3BHBA 5T1MB 4PJIF 4X6CF 2OZ4H 2QADB 3O3UN 1MCDA 2X89A 2CR6A 4WU7A 4P23D 4UNTA 4I5BA 5I0DA 3HC3L 3O6MH 1JMXA 3FO2A 4J12A 3VG9B 4QRPA 3MRCA 4NO5A 5DEGA 4NWUH 1DQDH 1LGVA 1N8ZA 2BY2A 5I8CB 2DTMH 2BVQA 4UUJA 4F7TA 2GT9A 2VDMH 4NQEB 5J0BA 4H1LG 4OGXL 1JHLL 1K5NB 3EZ8A 2A6JA 4YE4H 2QADC 4LVEA 1LK2B 3LV3A 4AEHL 3BXNA 3O3EA 3ARGA 5I1CH 1BX2B 3IDYB 1N5AA 4P4KD 3QFDB 3FO1A 4NQXB 3VFNA 5ICZA 3NN8A 1J5OH 2LVEA 4WDIA 2OTWB 3QXDB 1J1XL 3ZYJA 5T1LD 3MOQA 4D9RD 1Q1JH 3ARTA 3NH7L 3D39B 5HYSA 4G6KL 1MLCB 4PY8J 5DUBB 5BO1H 1IT9H 3P9WB 3RX8A 3ULUE 3NABL 1KGCD 5D2NA 2X5PA 1N26A 2Y7QA 5F6HJ 3RKDD 4P2QE 3NCCB 3GSOB 3ZDZF 1BQHA 3GZKA 1FZOA 3P4NA 2MPAL 3IDYC 2E7LC 5IB4B 1EH9A 2EIDA 3MRRB 3D0LA 3BESR 5I15H 1JIBA 2N56A 3RDTB 3D3VE 3QIUD 4FQXB 1E27A 5FGCB 3UTQA 1ES0B 5I16A 1TQCC 3RX7A 1R3JB 1J8HA 4U6HB 2YPVL 1CE1L 2VQTA 4Y2DA 1GZQA 1OGAB 1A7PL 2OJEB 3UTTA 3DURA 1A6VH 1AXSA 2NY2B 2VLJA 4GXUM 4D9LH 3B2UC 3OHXA 4NBYB 2GFBA 4XHJC 2C3WA 3FTGA 3SKOB 3MV9A 4F3FA 1XZ0B 5LBSH 2BSRA 5IF0B 5CCKL 4MJ5A 4UV4L 5F3BA 5IJKC 1MOEA 5J4MA 4AL8H 3CSYA 4LSSL 2E8ZA 3S4SG 2WUBH 2BVEA 3S3PA 1C1EH 4PRHB 1QBBA 3WLBB 4OLEA 3T0AA 3O2VH 5C08B 1N5YL 2VITA 2JELH 5SV3A 2NY2C 4MB3A 4GKZB 5DO2C 4MCYB 1MRDH 4QRPE 5EU7C 3RVXC 3EJZC 4X4XB 1FNSL 3RAJL 4IRSD 1WFOA 3LB6C 4PREA 4TOYL 3CFCL 4HK0A 4Y7MA 2YN5A 5I1KH 4S11A 1TITA 4O5LH 3SE9L 1KSRA 1YYML 3MJ6A 5M94B 4DWHA 5IP4A 2YWYA 5CZVL 5C07D 1X5IA 2A83B 2C3XA 5GHWL 1U6AH 1S78D 3VE0A 4X98A 4G8GB 3NA9H 3GIZH 2J6EL 1JGUH 3GBNL 4JQXC 3BX7C 5T3XD 1MCRA 1S9XB 2VJXA 1I8LC 2NY5L 3B2VL 4HK3J 4UV7H 2PTTA 4RBPH 2JJSC 5JOEA 2AXJA 3DVNA 4KQ4L 1TZHB 5AUMA 4RRPA 4M00A 5M7QA 4D3CL 4LNRA 1OAUH 4LHUB 1EEUA 5CD5D 4EBQH 4QRSA 4RMTA 3PHQB 4F2MA 1FVDB 1IQDA 3TH2T 1K6QL 4EUPG 2PKDA 4NFBA 3WHXB 3MLUH 5D2NE 3QPQC 1BVKB 4FQPA 1EFXA 5B3JE 3ZYZA 2V7NA 4XPGL 1GHFL 1IGYB 2DQTL 1BREA 5JLZB 3HZYA 3RI5K 4OQTA 1X5AA 4FXKA 4BA8A 5IMOB 4OAWA 3U7WH 5EU5B 5T1KB 3DV4B 2GHWB 1J8HE 3TP4A 4JREB 3HG1B 3MBEB 5HSFA 1IAKB 5DTFA 43C9A 3GMQB 4OQTH 5HYJA 2VDOL 1NAMA 2AK4A 3MA9L 3UTTE 3UXFA 1JN6A 3TCLA 1UCBL 3LVEA 4Z0BH 4U31A 5K9QG 2P49B 1KEGH 2VLJE 2VISB 2CDGB 3C2SA 1A4KA 4GRLD 2D03H 3CUPB 4O00A 5IM7B 3DUUB 3FONA 1NAMH 5T3ZD 4NQCA 2QHRH 1QG3A 2X4SA 5KTEL 2GSIA 3BWAA 4XGZB 4UOW0 3RDTD 4D0DA 4LEOB 1FFNB 4FQXD 4M1CC 2L0DA 5EUKB 4EIZC 3GBML 2VLMD 5BQ7A 4G8FA 5LGJB 3IAPA 4U1HA 5DJ0B 2AJVL 4Z76A 1RJLB 2LFGA 2FECI 3OB0H 4MA7L 5H8DA 4Y8AA 4HAGA 3FZUC 3VRIA 3L3IA 5FUZH 3CDGB 3W9DB 1YEFH 1G0XA 4M7KL 4HMEA 1UACH 5F7YC 1UCTA 4TUOB 4UIKL 2AGJH 4JB9H 4UBDD 4LVNC 2XACC 3B43A 2ED7A 4M6NH 3SBWA 5ANMB 1IGCL 3VGAC 5CMAB 5DRNA 1ETZA 4ETQA 3VWKB 2UY7A 2OTUA 3LIZL 5DD0H 4U1KA 2I5YH 4GO6B 3RWFB 4YBLB 4UQ3B 3V4VL 2FNBA 3FMGH 5EZOH 1F4YL 1C5BH 1INQB 4HIHB 4HFWB 4J1UA 5DMYA 4Y2OA 4PRHD 2VLRA 1IVLA 3AXLB 4IS6A 5CJQL 5C08D 5C8JA 2IBZX 4WHTB 4WO4C 5ALCL 1Q9KB 1FP5A 2FEEI 2VN4A 2F8OA 1J18A 2DDQH 2E9IA 3MRIB 3FAXA 3P4MA 3UC0H 2E9BA 1FAKT 3IDNA 1BBJB 1TQBC 5IHUL 2J8UB 4XCFL 1UKTA 3WDIA 4BQ8A 4XP5H 2BVPB 5D1QC 3EO1B 4S1SL 4RGNB 1EIBA 5I8KH 4P5MB 3QWQB 5F9JB 1W0WB 4EVNA 1S7QA 5JHDA 3O3BA 3MRQA 1IAIM 3OJDB 3B8YA 3QCTH 2HFFA 3MUZ1 5GQBA 2XTLA 5C0BB 5D6DC 2FATL 4LHUD 5CEYA 5HYJE 4XCCH 2B1HL 2JCCB 2AK4E 3O9WA 4JRWA 1I8MB 2X4OA 2EEAA 3GHBH 2FJGA 3J7HA 5IESL 2I25N 1GIGH 4JZNB 3NCBB 1D5ZB 3KPOA 5F9OL 1CXKA 3IKKA 4RGNC 4EN3A 5TFSH 3MJ7A 4H20L 4I3GA 2E3VA 1KTLA 4NQCE 3EFFA 5E0QA 1QR4A 1XMWA 3KNBA 1QYGL 4XNQA 1OP3H 1BBDL 4JQVC 3TWCH 5JPMA 4L9LA 1PG7H 4LOUD 5HDQH 1JTPA 2W9DL 3VXMA 3EOBB 5ACLA 3CD4A 2Y5TA 2EXWD 1PFCA 4RGMB 3SKJL 3WFDL 5ISZB 1KJ2H 4PGEA 3WNNA 1Q9WA 2O93L 1DDHA 3MBED 4NM4H 4KK6D 1QO3A 1Q94A 3U4AA 3QSKB 4HWNA 3FQUA 2VDLH 1MCWW 3L3DB 3W9EB 1IKFL 3QZWA 4U1JA 5TGBB 1VERA 3DETC 1IM9A 3KAAA 1WSST 4ZUVA 2XKSA 5IBUB 3TN0C 1GVIA 4XP9H 3H3KA 5T1DH 1L9NA 1S3KH 1FCGA 2CUHA 4DW2H 4RGMC 4ISVB 3VFUB 5IFAH 4Z95H 2D4DA 3SDAB 4WCYL 5FGBC 5I6XB 5CJ8A 1YEDA 4HBCH 4HLJA 2AXFB 3QPXH 4D9QE 2VLRE 5IVNA 1UM6H 1KIPA 3RWDA 1OARH 3VFPB 5J1AA 4ZO8A 4GS7B 1EEYA 4Q9RH 1JF1B 2ITCB 1FNLA 1TJGL 4TQEL 2ZCHL 2WAHA 1HHJB 2UWEB 3S6CA 4ZPVB 3ULVF 1RZJC 2VL5B 3TO4A 1ROWA 2DMKA 2A38A 4NZUH 5INCB 3SDAC 3N1GC 1K2DB 1V7ML 2LAAA 4O58H 5CBAA 3VWKD 2JB6A 4LKXB 4K3EH 2H9GA 3M8OH 1PW3A 2MJWA 4R4FH 2P7TA 1S5IH 1QTYT 1TTUA 4GS7C 4Z77A 1NMAH 4FN0A 5JHDE 3F7YA 1QKZH 2JLLA 2HTLC 3MV7B 4KI5D 1NBQA 2DQHL 4X5XB 4DN3L 1CYGA 4LASL 3GHEH 1E4XI 1WZ1H 2HKFL 1WICA 1IFHL 3VMPA 1T5XB 5E2UL 2YD6A 3VXNA 5T3ZL 3KWWB 4R26L 4JR9H 3L9RB 4ODTH 4BKLA 1CGSH 4AIOA 3BP7B 5IW1B 3FOMB 2R69L 1TETL 2IQ9L 3IDGB 1FFOA 3TESA 3ES6A 2DL2A 3VD3A 3JTTA 4P59L 4Y5VB 1L6ZA 3LKNB 4R4BB 3S7GA 4YPGA 1NUDA 3VXME 3H6JA 1OVZA 3GSWA 3DNKA 3WLWD 3KYNA 2J4WL 4M4PA 2HLAB 4R8WL 3FQWB 1HHKA 3UPRB 5DVKA 5C0BD 1BGXH 5JIIA 1G84A 3G08B 4YHLH 3T77B 5HY9B 5DJCB 4X83A 4ONFL 2AJSL 4LBEA 3EYUH 4KDVA 1WBYA 2AV1A 3T09A 3CFBA 4Z7WB 4YDJA 5E8NA 3MR9A 2CK0L 4NCDA 3ZT5A 5EOTB 2F15A 3U0TB 1NBYB 5C0JB 1SJEB 4D0CA 3W5NA 4DKAA 4R3SA 3P9LA 1MFNA 3SGEH 5D72H 5AZ2H 3GO1L 3T4AA 5ISZD 2GITB 1NGZB 4PBWD 1ZT1A 1C08B 5HI4C 1EAJA 4LSRL 1QPXA 1ZGLM 1RV6X 4U0RC 3PWJA 5FYKL 4M1GH 4P2OC 4IRZH 3QQ4A 5D70L 4E5XA 3O41A 1T1ZA 1OB1A 2R29H 4OLUH 3UTOA 1JGDB 2B5IB 2YXFA 2ITDB 2E6JA 4PJ9A 4PTUA 4S10A 3PGFH 2RBLA 1GYAA 3K46A 4Q9QH 1MCWM 1W8OA 1RAMA 4NCC2 1Y0LB 5C0RH 5A16B 5ICYA 4L3ED 5CBEA 1UJ3B 3EOAB 1DQML 1B0GB 3VGGA 2BCKA 3D25B 4JVUA 4LU5H 3QHZL 2VDKL 1H8SA 3SKNA 1QOKA 4G9FE 3FN9A 4QTIL 1SVZA 2I9LB 2AJYH 5IFHL 2VQ1A 1WLHA 4PJFB 4HS8H 3U82B 3NPZB 4DZ8B 2FO4B 3O8XA 4IRJB 3V6ZB 2B5IC 3NCFB 3OB8A 4GAGH 2BSSA 3MGTB 5EUOA 2FH8A 3U48A 4ODWA 1S7VA 1B2WH 2IPTH 4KKCC 4U1LB 4EOWH 1EBAA 4TSCL 5EBMA 2FJHA 4NHCH 3W2DL 2P47B 4WJ5A 3WMSA 4CAGA 2GCYB 4KKNA 3U4EB 3HRZA 4MDJB 2MCG1 3QI9D 3OX8A 3MLWH 2XKNA 4BFGA 2CQVA 4NQSB 3GSXA 1CLCA 3QEUA 1ZGLB 1MCJA 4IRJC 4W6XB 1A7RL 4LVOC 1RVFL 5C0CB 4MQ7B 3FN0H 3F58H 3SGKA 3MV7D 3ZE0E 1OY3B 1FG9C 2CJUL 4B7IA 4OJFH 4EQ3A 3O45A 1JTOA 3IDXL 3MRPA 3SDXB 2MQ3A 2VL4A 4LMQI 2QQQA 4YDVB 3MRJA 2Q3ZA 4BH8B 1NDGA 4Q58C 1U8LB 5IMMA 1YMMA 4HPYH 1NC4A 1H5BA 3NMEA 3T1WA 4O2EA 1GGBL 2PO6B 3I9GL 3JVGA 4Y4KA 3EHBD 4JKLA 1CZ8L 3VXUD 4UT6H 3LRSB 5B4MC 4M4RA 1A14L 3K1KC 4URTB 2V9RA 2XFXB 1MCOH 2HMID 4YFLI 1QSEA 4JFOB 1RZFL 4FFWD 1QP1A 1KG0B 2Z9TA 4X5LA 1QRKA 2PXYB 1RU9L 1ADQL 1EHLH 2GJ6D 3D18B 2VH5H 3EYQD 3GRWA 4IMKC 4Y5YB 4HIXL 3MLSL 4FFVD 2HN7B 1MHHA 5MEOB 1F6AA 4C57C 3PNWB 2R2EA 3NFSL 4PRPA 3OKLB 4X80H 1XR8B 2R9HC 2IJ0C 1GPOL 5GGRB 2CXGA 3LEXA 4Y16B 5FYJU 4L4TB 1YY8B 5IV2A 2PW1B 3JV5A 4JPWL 4XCEB 1RZKH 4XT1C 3RVVD 1I8KA 1EJ6A 2EDLA 2VXQL 2VO5A 5J9PB 4RX4A 3TJEH 2BNRB 4DN4H 3EJJX 5CIPA 1UWGH 4OGYH 1INDH 1J12A 4LRIA 5F70A 1OTSD 3LN5A 5LVEA 1A1OB 3HMWL 4GQPH 5DRXA 4NZDA 1J0ZA 3LMJH 1YPZF 5MEND 5EUOE 3O0RH 4G7VL 3DXAB 5DZOA 1KNOA 5BVPL 2Z31B 2OMBA 2FGWH 1Z5LA 4NN6C 5CIPH 2Q76B 3IFPA 3OKKA 4JO2H 3T3MF 1DLHA 2Z91A 1P7KA 4RZCB 5BZDB 1WCBB 5I75C 2VKWA 4PJHF 4PG9B 2YUWA 5DRWA 5DT1H 2EO1A 1FYTE 3BPCB 5I18H 2Z8RA 4GMTH 3MBXH 4KQ3H 5F96H 3NACL 5GGVH 3ROOB 5KSBF 4RMUA 1LVEA 1CK0L 5IHZA 1WK0A 1YMME 1A7OL 3TA3A 3DO7A 1TPXB 4KJWC 4XPBL 1T04A 2BSTB 2FO1A 4DKFL 1CT8A 2P5EA 1WAAF 1S9KC 1D6VH 4ZTOL 3Q5TA 1X5ZA 43CAA 2WIIB 5C86A 2XRAL 5JW4M 5IFJB 4KKLD 1MQKL 3IB4A 4KDTC 3TVMA 1QSEE 2F19L 4HT1H 1HH6B 2P42B 5F71A 5J6HA 2QR0B 4OIBA 2DM3A 1XR9A 3G5ZA 5JQ6L 4RGOL 1YEJL 4PV9B 5HGGS 4TSAH 1A5FH 4POUB 3HNSL 4NKQB 2HG5A 3LZFL 5GRYA 1MH5B 3V4PH 1LEGB 1FO0B 1OQXA 5D7LB 1CL7I 3NFNA 4IOIA 3QJHB 3RBSA 5F9AC 1I7ZA 2PO6D 5BMFL 4PRPE 1KPUB 2NY0C 5JZ7D 2EH7L 4PJ5D 1BOGA 2HRPH 1HNGA 2IH1B 3DGGB 4TUKH 2KH2B 4POZD 4QOKD 4KHTL 4Y4HB 1HIML 4OLZL 4X4MA 5H2BB 2D9QB 4JDZA 3F6IA 4HQQH 1SQ2N 4XVTL 2NCMA 2W07A 3FRPA 1YC8A 5E1HB 1WZMA 1MFAH 2H3NB 3QNZA 4XWGH 4YDKL 3SKMB 1S9VB 2PXYD 2XN9D 1H0DB 5DHVB 4FTVA 2K7PA 3UAJC 4KV5E 2D7QA 3CZJA 1TJHH 3B6SA 1EMTL 1LHZA 1LD9A 4I4WB 2GSGA 4U7KA 1ZS8A 4DZBB 5DSCB 4Q2ZB 2I9TA 1OP9A 2X4TB 3WN5C 1U93B 3IGAA 4S0TD 4XVSL 3RPIA 5MP6L 4NQUA 2VLLA 1JZ6A 4Y16D 1KLUB 3FT3A 1RULL 4L4TD 3I50H 4QRTA 1H9VA 4TUJA 1HILB 5BV7B 2Q8AL 2XWJB 4OLYH 3U9UB 3HI1A 1T21A 1EAPA 4LDLB 5FYJH 2BNRD 5JA9A 2FYYA 4QF1A 1EJOH 3MNZB 1OF2A 3S37X 5DJDA 3PWNA 2VDPH 1SYSA 2Y06H 4L29B 3N1FC 5I30H 4M8VA 4PIRF 4YBQC 5DYOB 3PGDA 3V0WL 2GW5A 3T04D 4W4NA 2Z31D 2EDWA 2BOBA 1WT5A 1HYSD 2CLRB 3OGCA 3DROA 2R8SH 1FL5A 5CLTA 4HH9A 3U9PL 3MV8D 4XMPH 5IMLB 5FV2A 2CIKA 1OW0A 2W60A 1GZPB 2XXMB 3B9KB 3VFRB 3X17A 2P5EE 5EWIL 4XC3H 5EC1B 2UZXB 4WIQA 1DJSA 3GMLB 4NKDA 1UB5B 2ATKA 2DS4A 1K3ZA 5DQDH 2O5ZH 4PJBB 2WP3O 1EEZB 1S7TA 2YRZA 4KROD 3TT3H 2VABB 2NXYC 2WWKT 2H8PA 4RFEB 4FNLL 5I71B 3OMZA 1ZHLB 4LSQL 3R1GH 1ZLSH 1HOCB 4FQ1H 2YA1A 4XNYH 1HZHH 3NTCL 4NO0A 3BKYL 5GGQH 2GTWB 4F7MA 1U92A 1X7QB 4MJIB 1XGRA 2Y9RT 4NJAL 1D6EB 4PJGB 3TBYB 4WY7L 4F37F 3UTPE 3OF6D 3ZL4L 5FO8B 5KVGH 5F8RC 3WIIH 5IVXB 5FUCE 3PL6B 4U2ZA 1KT2A 4X4ME 4CN1A 1G7MB 3LKQB 4H1LA 2IC2A 5I71C 2A77H 4CADB 1DEDA 4NDMB 5BZWB 3MRBB 3RU8L 4MVBC 3N1QC 4L8SA 4FTVE 3JWDH 2DKUA 5ETUA 4WHYG 4CN4A 4EJ1C 3RGVB 1X44A 1KFAL 2I07A 4IDJL 5D7LD 5IG7A 1KIRB 3V4UH 4XNXL 4PB9L 2VZSA 5FO7A 5FYJE 32C2B 3BP4B 5K59E 3QO1A 4NM8H 3RWCB 5C0NC 1P69B 4Y4HD 4ZUTA 1IC4H 4G8IA 5IB2B 4EDXB 2EIZA 3WIFB 5EO0A 3SDCA 4P57A 4LSVL 3O2DL 2X42A 4XH2B 4LPXA 4RSVA 5TQ2L 2OR9H 4U6VH 1V7NH 3QUKB 2EKJA 2ICWA 3MOBL 5HD8C 2DBLH 3W82A 2VXSL 2E27H 1CGWA 4GAYB 3ABZA 4OLVH 5ITBL 4EKXA 4PBXA 4HFUL 4MAYC 1KN4L 3IJHB 5HHXH 3BPLC 3NIGE 4YHYB 4G43B 2EE2A 2P45B 4WHDA 3X3GL 4NRZA 4UQ2A 1K4CB 4P2CG 2UYLA 3O4OB 3R0MA 2A6DA 3QUZB 2KZWA 3LDBB 3LOWA 4BQ9A 3Q6FA 1MWAB 4RISL 4NP4L 5EU4A 1WIPA 4WTZG 3JBG7 2ENYA 3OR6A 4ZYKA 5D1XA 1ZT7A 3BZ4A 5F97E 4KZDL 3RWHA 1BQLH 3PP4H 1PY9A 5I1GH 4K7PY 3OPZH 3TIEB 3BQUB 3QUXA 5FCUL 2Y4SA 3GMPB 3LKPB 3WDJA 4HGWB 4GLRH 3LDBC 3B9KD 3BP6B 5DMGD 5EOCJ 3O6KL 3X13B 4ZQKB 1YN7A 4HUUA 1RURH 3KPQB 3FHAA 3Q6GH 4EQ2A 1KN2H 1HHHB 1NGQL 1G6RB 2YPKA 1JHKL 4Z8FL 1PZUB 3RY6C 4X0KB 1X4YA 2ED9A 3HC3H 4AM0A 4CNIB 3BP5B 3SE8L 3RJQB 4LLAA 1A6AB 4P4RB 5DWUL 2Y07L 4X9FA 1F42A 2ICWJ 3FO9B 5IW6B 4MJID 1P4LA 3LKRA 4EUPA 1RIVL 2BNQA 1JHLH 2HH0L 1NC2A 4OGXH 3LKSB 4MD0B 2NW2A 4UT9L 3I02B 4AEHH 3VA2C 5HHOA 5C09A 2ZPKL 3ZKNC 3KPPB 3AAZA 4WFED 1HWGB 3RZCC 1D9KB 4DGVL 2X40A 1M6OB 1J1XH 4WU5B 3C5ZD 5EBWA 3NH7H 2VB5A 5I8EA 1DVFD 2J8HA 2OR8A 4G6KH 1TZIB 3RGVD 3CFEA 1JZ8A 1ZHKA 1FGNL 1P53A 3NABH 5FA3A 4GG6F 5DJ2B 5DVOA 1XGUA 1BZ9B 3FB5A 2AJUL 2AQ2A 2DLEA 2MPAH 3L3GA 1U58B 2Z35A 2NX5B 3P9MA 4K8RC 3VXTA 2IFGA 4WNQA 1D9KC 3Q1SL 3QDGA 2NNAB 3U6RB 1LO0L 2P43B 2R0LL 5B8CB 3QDHA 4JHBA 3UPCA 1FL6A 1MAML 1U41A 4ODHL 1SHMA 3QBTB 5BRZB 3L6FB 5C6PB 1PEWA 3DV6B 4KRMB 2YPVH 1CE1H 3DIFB 3MRFB 5M95B 4R2GC 1A7PH 1ZHNA 2IQAB 3PABA 1PG7X 2NTFA 1JPGA 4R7NB 5I1DB 3AREA 1U8NA 2WM0A 1KJVA 1KOAA 4JJ5A 4W6WB 5DJ8B 1K9TA 1P4IL 4OI7A 3BH8B 3Q48A 2HJLB 1T1XA 1F58L 4UIMA 4YPJA 2DJ4A 4MD4A 5B8CC 4G5ZL 3QUZD 5CCKH 4UV4H 1MHCA 1P84K 4LSSH 1FNGB 1TCRB 3IF1A 3EKCA 1FO0L 4QRQB 3WNPA 4YGAB 5C92A 4P3DA 1N5YH 5GJSL 4YR6A 5FB8A 4YNYA 2BHYA 4X6EB 1YJDC 2BC4A 3HE6D 4FXGA 1RZGA 1LO3L 1FL3A 1MCBA 2ZG1A 1CLYL 3BQUD 1HQRB 1FNSH 3RAJH 3LS5L 4TOYH 3CFCH 5CHNB 4DUXA 1MREL 4XNMB 1A1NB 1YYMH 3SE9H 2DIBA 5CZVH 4DOHB 2BNQE 1I85C 1JWMB 5GHWH 4Q6IB 2WQ8A 4JY4A 4ZXBB 4LF3A 4MXVE 3O11B 2GYSA 4TVPL 2J6EH 4GKNA 1M1SA 3GBNH 4PRDB 3C6LC 3KVQA 4PJCA 1VGKA 5HHOE 5C09E 4YGVB 4JFZL 1AD0A 1WFTA 3HB3D 2NY5H 3B2VH 1MQ8A 2HLFC 1S9WA 2JIXB 4HWBL 4KQ4H 1VA9A 4WFGD 1V3KA 4D3CH 1R5WB 4YBHA 2YA2A 4K2UL 1K6QH 3NPSB 3NOIA 4KJQC 5BV7L 2BRQA 4YFDB 1T66C 3ZKQD 5JXED 1DBAL 5ACZA 1MJUL 4Q6IC 4GSDL 4MNQA 5BVJB 4P5TA 4XPGH 1GHFH 2DQTH 1JNHB 4MNHA 2HJFA 3BUTA 1O0VA 4YC2C 3WEXA 1PY4A 3QDGE 4PJDB 1VEMA 3HNTL 5DA4A 1XF5A 4R0LA 1DL7L 4UDTB 1ZA6B 1HQ4A 3NPSC 1LEKA 4OZ4A 5J13B 3HUJF 1HXMB 3AU1B 3DARA 1A6TA 4WTXA 2PCPB 4NQTA 4PRBA 2VDOH 5EZIL 3MA9H 5MHSD 1XCQA 4YHNB 4HIIA 3HMXL 1XF2A 1BM3L 1PJ9A 1YEIL 5EO1A 1UCBH 4P23A 4AENB 2XTJC 1W8NA 5I73B 3GNML 2IPKB 5FKPB 4ELMA 4QT5B 5D9SA 4HKZB 1I1YA 2BXZA 3PWPD 3TT1L 4XAKE 3R06A 1A9EB 4APQB 2D7TL 4G8EB 4X9IA 5KTEH 4PGBA 2XWTA 2A74B 5EZLB 1UEMA 3SCMC 4P46B 3GBMH 4GQ9L 5HVGB 2ZG3A 4Y1AD 2AJVH 3HAEG 1XGPA 3QEQB 4P4KA 3M1BA 3L95A 4MA7H 5EBLA 4OUUA 2B39A 3M45A 2BJML 4GXVL 4O51A 3N06B 1AHWB 4ONHA 3DVFA 2R1XB 4M7KH 3NCJL 1AFVL 2FEDD 4UIKH 1F3RB 5DRZB 3VXRB 4XNZC 3REVA 2XZAL 5KS9B 2XICA 5C3TA 1Q0XL 4P46C 1HE7A 2UY6A 3LIZH 5DC4B 2HVKB 3V4VH 3BIKA 1MI5B 5ID1A 3KHOA 4PJCE 1F4YH 4P5KB 2W65A 5EO9B 3SQOL 5AAWA 4HJ0D 5F7KC 3RTQB 3OL2A 1AHWC 5KANG 4MJ6B 4NNXB 3U79A 5CJQH 3QIUA 3O4LB 1CDBA 4QXWA 5ALCH 1IILE 1FIEA 1JI1A 3MRMB 4PLJC 1D5BA 3T0DA 4HD9A 3X11B 1Y6NR 2FX9L 3JZ7A 4D8PA 3STZA 4WW2B 1F4WL 3G6JA 1CGTA 5E9DA 5CD3B 3T4YA 3MYZA 4H88L 4D94A 4MNQE 5IHUH 1AGDA 2B0SL 4XCFH 3AVEA 3BHBB 1UJTA 5DMIL 2FX8L 4ZXBD 4S1SH 1YQ2A 3IKCB 5J6GA 4V2BA 5CJXA 2P44B 4LARL 1ND0A 2Z8SA 1JNNL 1F8TL 2NXZB 4C55A 1VFAA 2P8LA 3CFDB 2JIXD 3RWGB 4U6XB 2IBZY 5JDJA 1ZLVH 4IMLB 4WW2C 2FATH 2BVQB 2EDBA 3GMOB 2DWEA 2B1HH 2EYSA 4ZMAT 1FFPB 3BPOC 3MCKA 3UEZA 3RA7L 3ZMRA 3DMMC 4OZIF 4K9EL 5IESH 3REWB 1P7HL 1T7ZA 4ELME 1MWAL 1V3LA 5F9OH 1I3RB 1JRHI 5C6WH 1FDLL 3U0WL 4H8WL 4H20H 1N5AB 4IRSA 1ED3B 2VDQL 2H2SC 1YEEL 3U30B 1QYGH 1BBDH 1P84J 4DVBB 5I76B 1YDPB 1NFIA 2W9DH 5ESQB 5L8LB 1WUNT 4QTHA 1P2CA 3IJYB 5FYKU 4YXLL 3ALWA 1RK0A 2D7MA 3IS0X 3SKJH 3WFDH 1YNTA 3Q3GB 3T3PF 5T1MA 2BK8A 5DVLA 1F11A 1IKFH 1BQHB 3P4NB 4D9RE 1O7VA 4XP4L 1WTLA 4JM2D 4CMMB 3DOSA 2Y6SD 4MCZB 1E27B 5C2UB 3UTQB 2AI0L 1KGCE 5I16B 4APQD 4PJEF 5CGYC 3WXVL 3UTZB 1S7WB 4NQEA 1J8HB 4WCYH 1K5NA 2GK0B 5LJYH 1R0AL 1AR1D 3PIQB 4NZTL 5D2NC 2OQJB 3UTTB 1BX2A 2ZG2A 3QEQD 1MCNA 3QFDA 3K4ZA 1DCLA 2C5DC 1YNLL 1MNUL 1TJGH 4TQEH 3QXDA 2ZCHH 5HDBF 4ZOCA 3MV9B 3G6JE 5H37G 5E9DE 1MLCA 1PG7W 2CDFB 4MJ5B 1FC1A 2DQFA 3VXRD 4NT6B 4Y2DC 1V7MH 4WI6A 2YD5A 3ZE1F 4GRLA 3CLEL 1EXUB 4MS8D 3VGFA 3GSOA 3BZEB 4NFDA 1MI5D 2VITB 4JFHD 5IB4A 5ILTL 2G75B 3RTQD 5EA0L 3RDTA 2QL1A 4DN3H 2DQHH 4FQXA 4WWID 4LASH 1J0KA 3O4LD 2OYPA 4BJLA 1ES0A 2HKFH 1IFHH 1JBJA 3K4DA 5E2UH 1R3JA 5T3ZH 5LAXA 4U6HA 1A6UL 4R26H 4A2MA 5LQBL 3RJDA 3L5WB 2ED8A 1T7VA 2ZUSA 4E9LA 1JYXA 3S3JA 3CCHB 2R69H 1TETH 2IQ9H 4RMVA 5DD5L 4JFDB 4M1DL 4YX2L 1VSCA 2DRUA 5E7BA 4P59H 2D9CA 5AUMB 1RHHB 3SKOA 2DM4A 2IMMA 2VZ1A 1XZ0A 2NXZD 5IF0A 1YJDL 1KCUL 4CVUA 2J4WH 4TNVK 5F7MC 1R5IB 4R8WH 1HSAA 5B21A 1CCZA 4U1MB 4PRID 3ZKMC 1XCTB 2LU7A 4PRHA 3WLBA 4JO4L 4KGLA 4ONFH 1EFXB 5C08A 2AJSH 4JQXA 3BISA 1KACB 3UYRL 1EZVX 1LP9F 2DYPD 3D6GA 3CLFL 1ONQB 4QHLB 4GKZA 4MCYA 3AS3A 1TNMA 2LTQB 3ULSB 1ZA3A 1T7XA 4BUHA 4X4XA 5HXMA 1JVKA 3OAYK 1WZKA 2CK0H 4M03A 5LCVL 4F58L 1U3JA 5E8OA 4NQEE 1A9BA 3OG4B 3TNNB 2F5AL 4XI5C 5A40E 3GO1H 4G8GA 4K71C 4MLSA 3LAFA 4EI5D 4JO3L 1S9XA 4LSRH 5FYKH 2LTQC 3QG7L 5D70H 1E4JA 3QP3A 4NGHL 3FONB 3D9AL 4J3XA 3B8SA 5FCSH 4LHUA 3RFZC 4HGMA 4RDQG 4RMWA 4JPVL 2ENSA 2B2XL 3WHXA 3VRJB 1DQMH 5BQ7B 3LPFA 3QHZH 1BWMA 2VDKH 3S35X 4QTIH 5C70A 5T3ZE 3BE1L 3VDAA 5IK3A 1EGJL 2UZYB 5IFHH 1J0HA 1H8NA 1MCQA 1YN6A 2NLJB 3L3IB 3ZDXE 2JJTA 4GG8B 5B38B 5FGCE 1CXHA 5IMOA 2M2DA 2VLME 2H32B 5EU5A 5T1KA 5KSUB 1A3RL 1ZSDB 4HUKB 4LRNL 3QH3B 3MBEA 5FDYA 1OGAE 3GMQA 5T33L 4TSCH 5DRNB 3B9DA 1G9NC 3W2DH 1KTRL 2IADB 3HS0B 2VISA 1RUML 4GOSA 1U8OB 4I2XA 3CUPA 2VLRB 3DUUA 2W0LA 5ELIA 4IS6B 1A7RH 1RVFH 4HCRL 3TBSB 4FQLL 4XGZA 4LEOA 1FFNA 1RZ8A 2CJUH 2O26U 3PWVB 3SBWC 3IDXH 3ALPA 1G9MC 4X9GA 4IEFB 5LGJA 4PRHE 5TF1L 2Z92B 3H9SB 4OFPA 2W1NA 5DJ0A 4HGKC 4GAFB 3MUHL 5C08E 5HHMB 1RJLA 4ZFGL 1XFPA 3RY4A 1BD2B 2YOCA 1RUAL 3W9DA 3CDGA 1GGBH 3I9GH 4JRYD 4JFDD 4TUOA 2XY2A 1CZ8H 4IOFD 1AGCB 2MSPA 1JWUB 1T3FB 4WFFD 3MRQB 1A14H 1IMHC 3ARWA 5FYKE 4DEPC 5CMAA 3VWKA 2P24B 1RZFH 1FNEB 4G8GE 1HYRC 5E5UB 4D0BA 3RWFA 3PV6B 4UQ3A 1INQA 1V3MA 2K7QA 4HIHA 4HFWA 1RU9H 1ADQH 4Q6YA 3SGEI 5DURB 3AXLA 3EBAA 4HIXH 4FRWA 2YZ1A 3S5LB 3MLSH 4WHTA 4PP1C 4U3HA 3OKDB 4JQIL 5DLML 3EFFB 4LGPB 2F5BL 3UTSD 3KNBB 3MRIA 2CRIA 5GGSB 4CW1B 5DUML 4ZAKB 2CGRL 8FABB 4CDGC 1GPOH 1X5XA 2NR6D 3A6CL 4RAUB 1BBJA 2IAND 4Z9KB 1T2QL 4MMXC 4JPWH 1Q9LB 5GRVK 2J8UA 1Q9WB 3EO9L 3L3JA 1VACB 1HSBB 1TVBB 2BVPA 3EO1A 2VXQH 3DSFL 4HC1L 2BHUA 5DC9B 1W0WA 4EZMA 4DUWA 4EN3C 1HEZB 4YXHL 3RIFK 3TJHC 3HMWH 4BZ2L 2OR7A 3OJDA 2XT1B 4I0KA 4L8CB 4G7VH 5C0BA 5BVPH 4L9LC 1AGEB 4MSWB 5DK3A 2JCCA 3V5HB 1I8MA 1NEZB 4JZNA 4YE4L 4G80B 1D5ZA 4I2XE 3MNVB 3BT2L 3OAUL 5ABDE 2EDYA 2D0FA 3RWDB 3WL9B 3TFKC 1VENA 4DKEL 3M17B 4NUGL 4GRWF 4HF5L 5D7IF 3P77B 3NACH 3C60B 3EOBA 4OFVA 2OL3B 5ISZA 2L7JA 1Z3GL 2V2WB 3BH9B 1CK0H 3H42L 5KJRL 4CU8A 3STBA 3VXOB 5CBAB 1EDQA 1A7OH 5DHXB 5GGTL 5IROA 4XPBH 3L3DA 3W9EA 1F4XL 2ARJB 4IBLT 1GGIL 4OBSA 4LK4A 3S37L 3K8LA 4ZTOH 5TGBA 1QA9B 4OZGB 3RVWC 2XRAH 5ANME 1JNJA 5D5MB 1MQKH 4X6DF 1F3DH 4RIRB 2F19H 4ISVA 3VFUA 4PLKC 3SDAA 3TO4C 4Z0XB 3SY0B 5LGKA 5JQ6H 4RGOH 2AXFA 3MRKB 3WO4B 1YEJH 4L5FL 3H9SD 4PJ8B 4KMQA 3VFPA 3HNSH 5HHMD 2APFA 2EDRA 3LZFH 1HHIB 1JF1A 3CFKB 1L7TL 3ES6B 2ITCA 1I7RB 1BD2D 3BGAA 4QHUB 4N0CC 5CLWA 5F7FA 3FFDB 5BMFH 1B9ZA 1HHJA 2UWEA 4LCYA 1MIEH 4PPTA 2EH7H 4ZPVA 2VDNL 4NCC1 1QR1B 3INUL 4LNVA 2CO7B 4KHTH 4KH2A 1HIMH 3RUGB 5INCA 4OLZH 2J8UE 1K2DA 3CVIL 1HHKB 4Z7UF 1WFUA 3ZDYF 4BZ1L 4OCRH 3MLRL 4LKXA 3E1F1 4XVTH 1VFUA 2ZSVA 5E6ZA 1WISA 1ZOXA 4FZEL 1U8PB 4RGNE 4N8PA 3DWTA 4YDKH 2X1OA 2WANA 2BP3A 4YDIL 5DMKB 4FG6D 3MV7A 3KPMB 4X5XA 4YQXL 3CFBB 1EMTH 1T5XA 5C0BE 1UG9A 3MR9B 2JCCE 3KWWA 1LWRA 4GW4B 3BDYL 1INEL 3L9RA 4ZAKD 5MP6H 5GPRA 1KTKE 3BP7A 3OQ3B 1RULH 5IW1A 2RCSL 4V1DB 3MMEB 3IDGA 1NANH 1F3DJ 1R24B 3BUYA 2Q8AH 4ELKB 4Y5VA 4WWKB 3BKML 3QQ4B 2FECL 4BYHA 3LKNA 4R4BA 2NY4C 5ISZE 3V0WH 5F89B 3UBXB 1IAII 4OGAC 2HLAA 3FQWA 4U2YA 3DJ9A 5ADOL 1CG9A 2HT4C 2GJ6A 3KJ4B 1AC6A 5I2IB 5HY9A 3T77A 2HYMA 5DJCA 3U9PH 4H0IA 3FQTB 1CDUA 2BOCB 1MUJB 2J7LA 3AMLA 3ZE2E 1G0DA 3BPNC 1YECL 5EWIH 5E7FA 2GKIA 3WE6B 2DIJA 1KLGB 4Z7WA 4XPFL 1LDSA 1OPGL 1J05A 4PJ9C 1W72B 1G7LB 5EOTA 3ZLQC 1BVLB 4F15B 4Z7OE 2ZCLL 1NBYA 3U0TA 5C0JA 4GKSB 1OCWL 2N7AA 5E2WL 5HGBB 1KELL 3C60D 3VWJB 3E3QC 4FNLH 5E5MB 2GITA 1NGZA 5DD1L 1C08A 4WJ5B 5JXAL 1V3JA 4LSQH 3HZKB 1KEGL 1WJ3A 3W0WB 5L6YL 2XKNB 3BKYH 4OIIL 4PJXB 2ITDA 4U05A 4NJAH 2UWEE 1CS6A 5DJ6B 5MEQB 3H2WA 4WY7H 3ZL4H 5FDWB 1OM3L 1MHEB 1Y0LA 3WS6A 5A16A 2VC2L 1SBSL 1UJ3A 3GUTB 3EOAA 5JA8B 1B0GA 3D25A 4KK8D 4WFHD 4UNUA 2CRZA 5TE4L 15C8L 3RU8H 5DR5L 5KG9A 2I9LA 3WFHA 1NC4B 1OSPL 2CH8A 2JF1A 3MV7E 4PJ8D 4PJFA 4WTWA 4DZ8A 1G9NL 2FO4A 4IRJA 4N90D 4HUNB 3V6ZA 3R0NA 3SJVB 4Y4KB 5AYQA 3K4AA 3MGTA 3N1MC 1KFAH 4IDJH 3N85L 3QCVL 4XNXH 4U1LA 3O2DA 4PB9H 4HMCA 1WZLA 4OCSL 3LQZB 2YRLA 4OSUL 2GCYA 4JFPB 3U4EA 2QQNL 4LSVH 3O2DH 1CD0A 4MB5A 1G9ML 1ZGLA 3VFVB 3MJ9A 3JVGC 4Y4KC 5C0CA 4MQ7A 3UJIL 1MHHB 3MOBH 3P30L 1A4JB 2VXSH 1XH3B 3SDXA 5ITBH 4HFUH 4AMKL 1KN4H 2GJ6E 4BH8A 5C2BL 1U8LA 1NLBL 3SDDB 3K2UL 4WI2A 3X3GH 3MNWB 4JG1L 1P1ZB 5C9KA 1T22B 2PO6A 4Z7WE 5D7KD 3G6DL 2C3VB 3DVIA 3ISWA 1RZKC 3PE9A 4QOKA 4N8VG 4WWKD 3T8XB 5F72S 4RISH 4NP4H 5SX4H 4QO1A 4I0PB 3QIBD 2XFXA 2XOTA 2V9TA 1KNOB 4JFOA 4A2LA 4M7LT 1PVHA 4Z7VF 1FFRA 4KZDH 5IQ9B 4EEEA 5HGDB 2PXYA 2H6PB 4NQDB 1P7KB 3D18A 2EECA 4TN9A 2Q8BL 1EHAA 5FCUH 4Y5YA 4LLWB 3NA4A 1V8HA 2HN7A 5DRWB 5KSAB 3D85B 5MEOA 3F5WB 3O6KH 3PNWA 4LRIC 2EDKA 5TDNB 3SO3B 4PJ7B 3CC5B 3OKLA 2KPNA 5GGRA 2Z4QB 4JPIB 4Y16A 1BPVA 4L4TA 3E0GA 1YY8A 1NGQH 2PW1A 4JG0L 4ZO9A 3MFFB 1E4XL 4XCEA 3BRGC 1XIWD 1CXIA 1JHKH 4Z8FH 3VWJD 3ARSA 1J1OL 3G5YB 4PJFE 4LCCB 3UDWA 2F8XC 2BNRA 1WBXB 4UAOB 5HPMB 5L2KB 1KJMB 3NCMA 3SE8H 1A22B 5DWUH 5KSAC 2Y07H 3W0WD 4PJAB 5GZNC 2AW2A 2DLTA 1FZJB 5A43C 3RX5A 4FQ2L 43CAB 2Z31A 3AS1A 4I48A 3TVMB 1RIVH 1CFSB 2HH0H 2Q76A 3MV01 3RVUC 2JJWA 4UT9H 5J6HB 4FHBD 4OD1L 4WHCA 2X10A 1XR9B 5J3HD 3OKMA 3WDHA 4RZCA 1ULVA 5BZDA 3BAEL 1WCBA 4UAOC 2CLVB 4PG9A 4KJPC 4RNRB 4DGVH 5C0CE 3AB0C 3OSKA 4U6TA 5K9OB 3IXAB 1YC7A 3BPCA 4OI9A 1IGML 1I7ZB 3SJVD 1JZ7A 3SDXE 3ROOA 3TVMC 1DBBL 1FGNH 3NCEB 3MO1B 4LIQL 2PN5A 2AJUH 4JDZB 4QHKJ 5IBLD 2PR4L 3RHWK 1UQSB 2ICWI 4YEFA 2OL3L 2RB8A 1G7PB 2BSTA 2IGFL 2N4IA 3Q1SH 1LO0H 2R0LH 3QUYD 4QOKE 5GSVA 4X99B 2WIIA 1MAMH 4ODHH 4XRCB 3GKWL 3S88L 1HH6A 3C08L 3F62A 1CTOA 5HYEA 5FUCC 3BN9D 2QR0A 3O3AB 1T03L 3IGAB 3B4NA 4OZFG 4PV9A 4W68A 2ADIB 3FT3B 4UU9B 2IEPA 4ZOBA 1P4IH 4QRTB 1MH5A 1LEGA 1H3UA 1H3PL 4FOMA 4TUJB 1FO0A 3SDDD 5J57B 2WBJD 4U1GC 4H26A 3QDAA 1F58H 5E70A 1N64L 4ZUSB 2CO6B 5D7LA 3K8KA 1Z2KA 3QJHA 4G5ZH 2FYYB 4HMDA 1ZTXL 5DJDB 5BCAA 3C6SB 2WWMC 1NFDF 4PJIB 1WVZA 4X6CB 1U8MB 2IH1A 3DTXB 1FO0H 4L4TE 3PJSA 4Y4HA 3ALXA 1F6FB 1L7IL 2HJKB 5GS0C 4GBXD 3CIQA 5H2BA 1IC5L 3KPSB 5GJSH 1FL5B 3QIWB 4MZ3A 5AZEL 2H3NA 2BNRE 5KW9L 1LO3H 4X7SL 3P40A 3DX8B 4NBZB 5JW4Q 1IGIL 1H0DA 1CLYH 4WUUD 3LS5H 3T65A 3GFUA 1QLFB 3DXAE 4I4WA 4X7DC 3DBXB 4TNWF 3WKML 1MREH 4DZBA 3D85D 5DSCA 4Q2ZA 1H15A 2G9HB 5HI5D 4KKBC 4XBEL 3OXRB 2ORBL 4C83B 5DHVH 4OZHA 1KXTB 2X4TA 1U93A 3L3OB 4HWBA 3BGFB 4TVPH 4QGTA 1KLUA 2H8PB 1WT5C 1IC7L 2X4NB 1BJMA 4JFZH 2ADJB 1HILA 5EORL 1AIFA 3EGSA 1OW0C 2XWJA 4HWBH 3U9UA 3V6OA 3OXSB 3BI9X 2EYTB 4OKVB 3MNZA 4L29A 2B8OT 4K2UH 5BV7H 3U0PB 4JCLA 2MQ0A 4N5ED 3JUZA 5DYOA 1DBAH 1MJUH 4GSDH 2KQMA 1NEZG 4NHUB 4EXKA 3T0VA 3O81A 1N6VA 4H1LB 2CLRA 4LPCA 2IMNA 3KG5A 5L7XL 2OI9C 3N9GL 3UZQA 3GJEA 4IOSD 5IMLA 3QWRA 1GZPA 3B9KA 1MCEA 5E95B 5EC1A 1NLDL 2QSTA 2XA3A 1MRFL 5EN2B 3HMXA 3HNTH 3UMTA 5E03A 1DL7H 3ARFB 4XCYB 3H7LA 1M7XA 2H2PD 4PJBA 5E6IB 1EEZA 1KJ3L 1AI1L 5FUOL 5IG7B 2OXHA 5EZIH 2VABA 3QQ9C 4ONGL 3HMXH 4MQXC 1BM3H 1YEIH 3ZKND 5CP7A 4RFEA 1W72L 3QO1B 4JZOB 4U1SA 3GNMH 1HHGB 4LL9A 4Z7NF 5SWSD 1ZHLA 1NCCL 5I1HL 4UB0L 4NBXB 3NIFE 4Z7QF 3TT1H 3SDCB 2IALB 3BEWB 3NZHL 1LILA 1G9EA 4L8SC 1QD0A 5D7LE 2GTWA 3D87B 3WXWL 1X7QA 3BIAX 4K07A 2D7TH 4MJIA 3OKOA 4Q9BA 3ORJA 4PJGA 4HV8B 3TBYA 5FO8A 4AH2B 1BEYL 1Z6JT 4JY6B 2EEDA 3I3DA 2HA1A 5IVXA 2DMBA 3PL6A 4GQ9H 2EXYC 2WBWB 3I3EA 3FB8B 5JOPD 1G7MA 3LKQA 5L9DL 1QEWA 35C8L 4NDMA 1AJ7L 5BZWA 3MRBA 2BJMH 3FL7A 4GXVH 5A2KH 3KYMA 3SDCC 4L9DA 5EIQA 3WD5L 3NCJH 1JCKA 1UM4L 3NIDE 4UQ2B 1AFVH 5IVOA 1PX3A 2OP4L 1SJXA 3RGVA 2XZAH 4G9DB 3HC4L 3Q6FB 3BOVA 4Y88A 1BLNB 1Q0XH 3EYOB 4QHMA 4OZHE 1BWWA 2AEPL 2LU4A 4OD2A 4KRLB 3PDOB 5D1XB 32C2A 3BP4A 1ZT7B 3RWCA 3S4SB 3B83A 5IB2A 3SQOH 4EDXA 1AC0A 1T2JA 2A1WL 3WIFA 3QDJD 2G60L 5H37H 1CDIA 4XH2A 3KPSD 4JEGB 3V6OE 3QIWD 4PP2B 4PR5B 3QUKA 2OS7A 3SN6N 4H5SA 2GY5A 2CDEA 3BD5A 2FX9H 1F4WH 1YN7B 4GAYA 3IDJB 4H88H 3DLQR 4JGJA 3GRWL 1ZXQA 2B0SH 5D1XC 3WNKA 3X3FL 3IJHA 5DMIH 1IGFL 2FX8H 3GM0A 4G43A 4L4VB 2ESVD 4MHHG 1VGEL 1GC1C 1IKNA 3OKYA 4LARH 4HHAB 1K4CA 1JNNH 1F8TH 3QUXC 3T2QA 3QUZA 2EICA 4ZSOB 1A02N 1RPQA 1MWAA 3KLDA 4PJBE 2C1OA 2WWKO 1GOHA 5DFVC 3RA7H 4EUPB 2KQNA 5AD0A 4YJZL 4K9EH 1NC2B 1CI5A 2D0HA 5IW3A 4NWTL 5TQ0L 1NCWH 3BJ91 1MWAH 4DK3A 1FDLH 3MUJA 3U0WH 3BW9B 4H8WH 1DSFL 2YN3A 3TIEA 3BQUA 4YHIB 2VDQH 3GMPA 4OQ1A 5MI0C 1YEEH 2AABL 3LKPA 5C0FB 3AAZB 4FP8L 4MJIE 2UZIL 3BP6A 2DQCL 3V7AG 2R15A 4PJGE 2O5XL 3ILPB 4ZQKA 4JDTH 2HTKD 4ODXB 5IVXE 4YXLH 3H7BB 1OP5H 4DGYL 3KPQA 5FO9B 5I8EB 2NY6B 3ARFD 4KHXL 1JZ2A 2NW3A 5HHNB 3TC9A 2W92A 5I9QB 1HHHA 2EDJA 5E6ID 3UYOD 1G6RA 2OCFD 4JJHA 2DICA 3CMOL 3I2CL 5ALBL 5I66A 4WRLA 4W4OA 3W11D 5I1IL 3RNKB 4X0KA 1F90L 3LD8C 2O5YL 4XVUD 4CNIA 4XP4H 1LO4L 3K74B 3BP5A 1A6AA 3OG6B 4P4RA 3TCXA 1U8KB 3FO9A 5JXEA 2E6PA 1P6FA 3KYKL 2AI0H 2UV3A 3RL2B 3C9NB 5IW6A 3HN3A 2I26N 1FL6B 3WXVH 4NO3B 1TXKA 5KN5B 3LKSA 1P9MC 1VFOA 4LLUB 1I3VA 4NKOB 3TH4T 1R0AH 1ZHNB 4MD0A 4NZTH 3I02A 4CVWA 3C09B 3L5XL 2Z8VC 1U8NB 4GRMB 3KPPA 3HI5L 4J3TA 4F7CA 5F1IB 1D9KA 1P5VA 1MNUH 1YNLH 5F1SA 1M6OA 1T1XB 1WWCA 4UIMB 5TDOB 5DXWA 1FSKB 2VZ3A 1T1YA 1TZIA 1B4JL 5DJ2A 3V0VB 2VZUA 4XMKL 1T5WB 3PWPA 3CLEH 1ZHBB 3SGDH 4GJTB 1KB5B 3LHPL 4YR6B 1U58A 1OWRM 5ILTH 1JZ5A 2NX5A 4ODBD 2FWOB 1KIQB 5EA0H 5K33A 1CFQB 3U6RA 7FABL 1NCNA 4P9HL 1OGTB 3VGDA 5B8CA 3GSVB 4MWFB 5BRZA 3L6FA 3ULUD 2V5TA 1A6UH 1CD8A 1KCSL 1DQJB 3DV6A 3QR2A 5LQBH 4QWWD 2AXGB 2CXKA 3DIFA 3S35L 5I1LB 3MXVL 2IQAA 4P2QD 5IEKB 4R7NA 5FGRA 5GRXG 2W9EL 4QKXB 5I1DA 4YZFE 1R3KB 4XX1G 3CVHB 5DD5H 4M1DH 4CJ0A 2EE6A 5DJ8A 1OTTC 3VGBA 4YX2H 1A6ZB 1PBYA 1U3HD 4L4VD 1AD0B 2EEBA 3BH8A 5DD6B 2HJLA 3TBTB 1QRNB 5GS0L 3EOTL 3ESVF 2EDFA 3PDGA 2J5LC 4KK9D 4G6AD 1YJDH 1KCUH 2BY3A 4RAHA 1FNGA 1TCRA 1I85A 3ARBB 4QRQA 5F7LB 4YHPB 5C0AB 4JO4H 4FABL 5IJVB 5E8PB 4KY1L 3UYRH 4WFGE 3CLFH 4X6EA 1RZIB 4MNHB 2B20A 4MB4A 1C5CL 5GGVY 1TJIL 1HQRA 2XI9A 3RNQB 2DJSA 2JK5B 1DANU 5EZJB 5LCVH 2CPCA 4F58H 4R0LB 1A1NA 3IFNL 4QNPF 5JUEL 4QCIB 5F9WB 1HQ4B 1JWMA 3VRLE 4OZ4B 2F5AH 4ZXBA 2NY1C 2NY6D 3O11A 2IAMB 1XCQB 4M9OA 1XF2B 3ARUA 4P5TC 1GH7A 2EH8L 4JO3H 3KLHD 2QJDA 4YGVA 4QRPD 5SWZB 3QG7H 2JIXA 1ZVYA 4PLNC 3D9AH 4S1DD 1R5WA 4Q7DA 3BSZL 5MHSE 4R0LC 4LLDB 4JPVH 2D7OA 3O6LL 2B2XH 5F9WC 1EGJA 3K81A 3TH3T 3BZDA 1QZ1A 4OM0L 3ARGD 5BVJA 2CIIB 4RFOL 4JFXB 2DQUL 4P23C 1JNHA 3BE1H 1MPAL 1EGJH 2NX5E 3I6KB 4O51B 4N8CL 4PJDA 3EOYG 5CGYD 5T1LB 3TYGL 4JFEB 5BRZE 1A3RH 1ZA6A 4LRNH 1CICB 1KCLA 1I3GL 5E94B 5T33H 4NUJB 3AU1A 1U91B 1U8IB 2PCPA 4YHNA 3TBVA 4KUCF 3U46B 3SE4C 4XXDA 3AROA 5EG6C 3BIKB 1M4KA 3GJFB 5EOCL 1RUMH 4P4KC 4QT5A 3BD4A 4HKZA 2W65B 4JM2A 2CKNA 3QIUB 1A9EA 3MODL 4HCRH 3AC0A 5I1JL 1C8PA 1J86A 4APQA 1Q9OB 4G8EA 4FQLH 1WTGT 3QJFB 1D5BB 3O6FB 1EVTC 2OBGA 1OTUD 1CFVL 2AEQL 3MJ8A 4MJ2A 2H26B 4P46A 3ELAT 3G6JB 2NMSA 1XGTA 5TF1H 1CDGA 5ESVB 2IWGA 3SKUD 4ZFGH 3QEQA 1LDPL 1F6LL 3HC0B 4RA0C 3DX6B 1AHWA 1RUAH 1DQQB 2R2BB 5A1AA 1RHFA 5J6GB 2R1XA 3QIUC 5DVMA 4K3HA 3IFLL 3RWJB 5DRZA 3VXRA 1QRND 5KS9A 5FF6B 4DOHE 2BERA 5F7HA 2EYSB 3PXJA 5E8EB 2HVKA 1MI5A 3ARBD 1WWAX 5IMKB 1OAZL 4TTDD 4P5KA 2FIRT 2WIMA 5EO9A 3RTQA 4KRPB 4MJ6A 2ZUWA 5C0AD 4NNXA 2X70B 5DHYB 3O4LA 5A2LH 4YXKL 5CJXC 4O4YL 1N3NA 4JQIH 1EFQA 4IJ3C 5DLMH 3MRMA 2F5BH 4P0DA 3X11A 1MF2L 2DLGA 3MXWL 5EU6D 1GC1L 5ITFB 3C8DA 5DUMH 4X6FB 5C07B 2CGRH 2R0KL 2NTSP 4U0QB 3CDYA 3A6CH 4HC1A 5CD3A 5HDOA 1T2QH 1E4KA 5DZLA 3EO9H 4MXQD 2DQJL 2IAMD 3WUWG 4DGIL 3IKCA 3DSFH 4HC1H 1F11B 5DUPL 4PJDE 2AV7B 4ENED 4KUZL 5SWZD 4IRSC 4YXHH 4BZ2H 3CFDA 3F7PC 3RWGA 1SMAA 2Q7NA 3K1DA 4U6XA 4N0RA 4IMLA 4PGJA 2GTZB 3ULVD 1S78C 4MQSB 3QFJB 3GMOA 4JZJB 1FFPA 2K1MA 2VR5A 4HKJA 1V05A 3ZHDA 1NUFA 1EK3A 2YC1B 3H9HB 1UVQB 4JLRB 3REWA 3GIVB 1I3RA 3BT2H 3OAUH 2QQLL 2R0ZL 3ARVA 1LO5B 1ED3A 1UWXK 1A2YB 5AEAA 4OT1L 4DKEH 5CD5C 3VG9C 4NUGH 3UZEA 5I76A 4M02A 5AYUL 1YDPA 4DVBA 3UZVB 4HF5H 4NN5B 1QHPA 2E7HA 5ESQA 5GGTA 2AK4D 3IJYA 4JFED 2LAGB 3GBLA 4YHOL 4F9PA 1GOGA 3Q3GA 1RK1B 2YWZA 1Z3GH 1CICD 2DQFB 4EI5A 3QEQE 3H42H 5KJRH 3OGOE 4GRLB 4N5UA 4M5ZL 1DLFL 4L8BB 5GGTH 3RPKA 3ESUF 1LNUB 3LQMA 4NQCD 1F4XH 1SEBB 1GGIH 4JHWL 3S37H 5D7JB 2VKXA 4CMMA 2IFFL 3VXRE 5MEPB 5I19L 1UXSB 4MCZA 5KS9E 4NN5C 5FXCH 2B4CL 4PY7B 1IARB 3RRQA 5T5NG 3UTZA 1S7WA 3O6FD 3S8WA 3L1OL 5LAXB 2R1YB 2GK0A 1MI5E 5E5RB 4DAGL 1AO7B 4JFHE 3PIQA 3F7VA 3F6LA 1DUYB 2OQJA 2X2YA 3FT4B 4L5FH 3JTSB 4GRLC 5JIPA 5CEZD 5B3NA 4WI5A 3O4LE 4BUGA 4KXZH 1AGFB 3TLRA 1L7TH 4HZLB 1CBVL 3EDEA 2EDEA 4UOJA 4WVRA 3RDTC 4FQXC 1IZKA 4ODSL 2VDNH 3INUH 3V2AR 2CDFA 5A3ID 4DTGL 5TF0A 4RFNB 1JI2A 4NT6A 3BN3B 3MLVL 4ZUWB 4TTGA 1QFWI 1HSAB 3CVIH 4ZO7A 4BZ1H 3MLRH 4R4ND 3LEVL 5GRUL 1EXUA 4FZEH 1HNFA 3BZEA 5T5NF 4XC1L 1PAMA 5CGTA 1BECA 2G75A 3O3DB 4YDIH 1YPZB 4KRPD 2ZZUT 4M7ZB 4UBDC 4J6RL 5EOQL 4YQXH 1EUUA 2Q3AA 1ZA3B 2DIAA 1LMKA 2XNAB 3VG0L 5IEHB 1KB5L 5LKNA 1IBGL 3IU3B 2AQ1A 3LY6A 3BDYH 5E8OB 1INEH 3L5WA 2BMKB 1A9BB 4OGZA 4A6YB 5HGAB 2DD8L 1K4DA 2RCSH 3CCHA 2XZCL 4PJHB 4XB8A 3MRHA 4JFDA 1I1FB 2EO9A 3BKMH 1MRCL 1OOAA 1RHHA 1UA6L 5KSBB 2AJZB 4BFIB 4CBPA 2A6KB 3O9WD 3QWOB 3CVHL 4IHOB 1X4XA 4JFQB 2WZPD 1G6VK 1R5IA 4KTDL 5K9JL 3ULUF 4U1MA 4N68A 5B39G 5F1OB 5HJ3B 1XCTA 5J12B 5ADOH 3QFJD 4HKXB 1MCIA 2YR3A 3A0OA 2COQA 4J23A 3CXDL 4QHLA 1ONQA 1QUNA 1RZ7L 1YECH 5IK3B 1LO2L 3ZTJH 3ULSA 2MMXA 1YN6B 4XPFH 5JR1L 1Z0NA 1OPGH 1ITCA 2ICEB 3ILQD 2IANA 4RQQA 3STLB 2ZUTA 5HGHB 2ZCLH 4LEXL 5IR1B 1OCWH 2YZ8A 5E2WH 3TNNA 1KELH 5J12C 1NGXB 5DD1H 3VI4E 3AMKA 3EJYD 5JXAH 4Q74A 1YZZA 3VFWA 2CD0A 4I2XB 4Y5XB 5L6YH 4OIIH 3DRQB 1U95A 2VWEE 2JJTC 4BK4A 3QYCA 4WW2F 5D7JD 3IT8D 4R97B 3MV9E 4P2RB 4PB0L 1OM3H 3HZVA 2EXWC 1D7FA 1KUMA 2VC2H 1QHOA 4JREC 3IYLW 1RZ8B 3MFGB 5I74B 3MBEC 4PYHA 1SBSH 2MHAB 3VRJA 4KK6C 3V5DB 2EC9U 1JYVA 3JWOC 3ULVL 4YWGL 2D0GA 5TE4H 15C8H 5D4QA 1XAUA 1G7IB 5DR5H 1AO7D 2N7BA 2BVYA 1UENA 4Y5XC 1OSPH 2VN7A 2NLJA 1G9NH 3FB6A 4NOBA 4GG8A 5B38A 2H32A 1JRHL 1RJCA 5KSUA 1ZSDA 1GJIA 2XXCB 3N85H 1Q0YL 3QH3A 4PFEA 3QCVH 1QBML 1ZAGA 2FBOJ 1TVHB 4ZNEA 5FYLD 5FV1L 4OCSH 1JL8A 4OSUH 2X1WL 4DUVA 4G9FD 2BDNL 3D48R 4OTXL 2H32H 4D0BB 4OV5B 5HI3D 3V79C 4KI1A 3K0WA 2IADA 3HS0A 4JFDE 1U8OA 5E2TL 2QQNH 3MLTB 4FQHA 1G9MH 3S36X 1J11A 1CQYA 3TBSA 1GAFL 4M6AA 3UJIH 2QTEA 3TIDB 3P30H 2MKLC 4Q9CA 3V8OA 5ERWB 3PWVA 2APBA 2FH6A 4I8DA 4GUPB 4JAMA 4AMKH 3VWKC 2D7NA 2Z92A 3H9SA 5B3JF 3S97C 2Q1EA 4YBLC 5C2BH 2X9WA 1NLBH 4OCXL 3RQ3A 3L3JB 1G1CA 3K2UH 1AGBA 1QFHA 2BY1A 5INDB 1BD2A 2X1XR 1VCAA 4KI5C 4JG1H 4R6UA 5CEZL 3ARZA 3G6DH 5FFLA 5ENWB 2X44D 2IANE 1AGCA 1JWUA 1T3FA 1NBZB 2JJUA 3QA3B 1DUZB 1I9IL 1IM3B 1X3DA 4UNVA 2P24A 1FNEA 2HVJB 4LVHB 3PV6A 4ODVL 1AY1L 4BM7A 1I3UA 3P11L 2ZUQB 4ACPA 2Q8BH 3WFCL 1G7HB 5DJAB 3P0YL 3S5LA 1Y18B 3OKDA 1OQOA 5BXFB 1I1AB 3IDMA 2APVA 5FKAB 5D1ZB 3WLWC 3GSRB 3PQYB 4CW1A 5GGSA 4MA8L 1AQKL 4ZAKA 8FABA 4RAUA 2XZQL 4GMSL 5CZXD 5DFWH 4JG0H 4LVHC 1Q9LA 1E4XH 4Z18A 1WIUA 1VACA 1HSBA 4YDLB 1TVBA 4J3SA 1J1OH 2A6IA 1DTUA 3DX9B 1W0VB 3ROLB 4FA8A 1HEZA 2IBBA 3LCYA 1C5DB 2YKLL 1NUNB 3KPTA 5T3XL 3ZTNL 4L8CA 5GS3A 4M48L 1BF8A 4L3EB 4FQ2H 1AGEA 4MDIA 4ZNEE 2ZOKA 4P2RD 4MSWA 4OM1L 1B0RB 3V5HA 5D6CB 3LRHA 1NEZA 3HLAB 4OD1H 3AY4A 2D3VA 1G0YR 1FVCB 1S9YB 4G80A 3MNVA 3O8XD 3BAEH 5IROC 5JHLL 4I18A 1IEBB 3WL9A 4KMLB 2QSCL 2HT3D 3CPLB 3M17A 1IGMH 2E7BA 3L3KA 1U8JB 4LCYB 3P77A 3QEHB 3C60A 1II4E 1A7NL 2OL3A 1DBBH 1A64A 3H9SE 2ARJQ 3KLSA 2V2WA 5EBGA 3BH9A 4LIQH 3ME0A 5HHME 5BOZG 2A0LD 5I6XC 3VXOA 1FBIL 3QI9B 1BD2E 2PR4H 2ZSVB 3BZFB 1NH6A 2OL3H 1SBBA 4XPAL 1FYTD 2ARJA 1I4FB 4KJYB 2IGFH 2EZ0D 2ZSWB 1PEZA 5F3HB 1QA9A 4OZGA 1JUFB 5C0GB 1PSKL 3B5HA 4ZPTB 1UH3A 1G7JB 4KWUA 5D5MA 2VUYA 3GKWH 4RIRA 5SV4A 3S88H 3C08H 2K9UA 5SX4I 5B22A 1T03H 4Z0XA 3NGBB 3SY0A 1YMMD 1CN4A 1IQWL 3MRKA 4XP6L 3QI9C 2Q86B 4PJ8A 1GSMA 1YNKL 1HHIA 1H3PH 4LDOB 3CFKA 1I7RA 1N64H 3BUYB 3VXUB 4QHUA 3FFDA 4P2YA 2V17L 1S7XB 1QSED 1ZTXH 2EIBA 3PWLB 1T0PB 1QR1A 4YLQT 3WS3B 4FMKA 3RUGA 1L7IH 1IC5H 4MA3A 3I6LD 3N0PB 5FK9B 1CG9B 2GJ6B 5FYLL 1U8PA 5AZEH 5KW9H 4HWZB 4X7SH 3EHBC 4Y8DC 1IGIH 1WV7T 5DMKA 3KPMA 4GKOA 1IJ9A 4Y5VC 2W0PA 1UH4A 3WKMH 1I1AD 1J05B 2VRAA 2HMIC 1T6WA 4XBEH 4FFWC 5D1ZD 4GW4A 2ORBH 3PQYD 4RMQA 3OKEB 4V1DA 3MMEA 1IC7H 3EYQC 5EORH 1IE5A 1R24A 4L3AA 5BW7A 4GT7A 4M3KB 4A6YL 4ELKA 4WWKA 4LIQE 5MENB 3MTRA 1GL4B 4WGWB 4U1NB 5IOPB 4GG6B 2CRYA 3NCYP 4TSBL 4DKDC 2PYFB 3HE7B 3KJ6L 4FQIL 5F89A 3UBXA 3ARDB 4G42B 4WEMB 2XIDA 3DUSB 5HBBA 2BX5A 6CGTA 3RVVC 2YD7A 5I2IA 5L7XH 3FQTA 3N9GH 2BOCA 3DI3B 1MUJA 4KK5D 3OTTA 5KG9B 1FV1B 5CJBA 1NLDH 1OTSC 5GIRB 3WFHB 2X4PB 1MRFH 3WE6A 4OZGE 3PDDA 1KLGA 4R7DB 1UZ8A 1W72A 1G7LA 5D5ME 1BVLA 4HW6A 1CVSC 1AI1H 1KJ3H 4GKSA 4WFHE 5FUOH 1J8KA 3QZWG 3WS6C 5DQJB 4ONGH 5HGBA 1QACA 3VWJA 3TA3D 5E5MA 1UJ3C 1W72H 2I60L 5A2IH 3RI5F 1VB9A 1NAKL 4LQ1A 3LS4L 4N90E 1NCCH 3T0EB 3ZYOA 1CF8L 1KCVL 3GEWB 4UB0H 5I1HH 4F7EB 3HZKA 1NMBL 4TULL 2D31A 5D7SH 3NZHH 1M71B 3W0WA 2P48B 3JWOL 4PJXA 3WXWH 5GISL 5DJ6A 5MEQA 3DYOA 1BEYH 5FDWA 1MHEA 3MZTA 1DFBL 3B9AA 1TMCB 4NZRL 3RUGE 3WNMA 1T0MB 3GUTA 2AK1L 5L9DH 1HDMB 35C8H 4WV1B 5F7EL 1AJ7H 2R4RL 2XWBB 4J3WA 3DO3A 5FHBL 3BVNB 4N9GA 3WD5H 4JM4L 5IBTL 3DYPA 4YHZL 1UM4H 5HVHB 4HUVB 4MHHI 3MA7B 3SJVA 3VXQB 2OP4H 2OM5A 4KKLC 2Y36L 4PJ5B 2I27N 5BOPA 3HC4H 2DTSA 1DE4B 4QOKB 5JPNB 1HKLL 1N59B 4LMQE 1REIA 2VAJA 2AEPH 3I85A 1FN4B 5CINL 2BHZA 2PNDA 3LQZA 4KU1A 1YYLL 4V1DE 1FORL 4N1HB 4JFPA 2YEZB 5D7KE 2A1WH 2G60H 3T0BA 2XN9B 1UGNA 3GSQB 3QUYA 3GB7B 2VNCA 4LGSB 3VFVA 2BRRL 2PO6C 4HAFA 4YHKL 3QRGL 5JZ7C 4ZUUB 1L6XA 1A4JA 1CQKA 1R3IL 1XH3A 4POZC 2W9LA 2APTA 4CN6A 5IB5B 5FYJD 4QYOB 3GRWH 3E3QE 3VFMB 3X3FH 1IGFH 25C8L 1RJZB 3SDDA 1VGEH 2J3SA 2YSSA 2C9AA 2PXYC 3MNWA 1J0JA 1P1ZA 5DS8A 1T22A 2X4UB 4Y5YC 2C3VA 3MOAL 2EE9A 4OLWL 3GMMB 3T8XA 2GEEA 3D2UB 4MAUL 4I0PA 1WCQA 4Y16C 4I48B 3HE7D 1T7WA 4M7LL 3ARDD 5TQ0H 3MV8B 4NWTH 3JV4B 1VKXB 5IQ9A 5HGDA 2H6PA 4NQDA 1DSFH 3OKMB 1K85A 3W0WE 4WUUA 3UDWC 2AABH 4PJXE 4LLWA 2ARWA 4FP8H 2UZIH 2DQCH 5KSAA 1VESA 3D85A 2O5XH 3F5WA 2CMRL 3ARPA 2DWDB 5TDNA 5J7CC 4J4PD 4PJ7A 1CTNA 3ZE0F 4KROB 3CC5A 4F33B 4DGYH 4U4BA 1Q8MA 1NDMB 4KHXH 3HCVB 2Z4QA 2H41A 3AS2A 1URLA 1XGYL 2Z31C 3JV6B 3QXAB 4JPIA 4X4YB 1HYSC 3MFFA 3I2CH 3CMOH 5ALBH 3SHSA 5I1IH 3CK0L 1MVUB 1FFQA 3G5YA 4EDWL 4LCCA 1F90H 2O5YH 2RAMA 1WBXA 5DJXB 3I75B 5F7DA 3DPBA 4IIQA 3T0ED 1LO4H 4XBPB 1KJMA 5HPMA 5L2KA 3SJVE 2NYYD 1PKOA 2QSQA 5E8DL 4PJAA 3WJJA 3KYKH 1YY9D 2H1PL 1FZJA 5DJZB 2Y23A 4KROC 5SX5K 5GSVB 1H3TA 1KLFA 2GAZB 4HUWB 1E4WL 5HVFB 1T83A 4FQJL 1CFSA 1DR9A 1S7SA 4AQOA 1EHNA 4D2NA 3T1FB 4MYWB 5DK0B 3CH1B 5GGUB 5DC0A 1GGCL 3L5XH 1DQLL 4NNPL 3HAEB 1IAIL 1PYWB 1T89A 1TPXC 2DQIL 3HI5H 2CLVA 3G5VB 2AEWA 4RNRA 4FS0A 5F44A 1D3CA 5D2LA 2NY3D 4H26B 5K9OA 3IXAA 4X9HA 5JQHC 5DJYB 5T5FL 1MCHA 1MIEL 4OCMC 1B4JH 1N0XL 4B53A 3DSNA 3VJ6A 3EDFA 3PJSB 2RFXB 3MO1A 3Q5YA 2BVTA 4XMKH 1JWSB 1I1RA 3ET9F 3P4OB 2MKWA 3LHPH 4OCRL 1UQSA 5K9KB 5EFIB 1G7PA 3IAGC 4Z78A 1HXYB 7FABH 3IXTB 4OD3L 5EUOF 4P48A 4P9HH 4BSVB 5KVEH 4X99A 1WIOA 4IDLA 3OZ9L 3T65B 4XRCA 1KCSH 4OZIB 2WSKA 3QXTA 4MD5B 1H15B 1A3LL 3S35H 3MXVH 4PGCA 1HK6A 3VD9A 3O3AA 4Y4HC 4OZHB 3MRLB 5GZOD 2W9EH 1QSZA 2ADIA 4NQDE 1NKRA 1FG2B 3IRPX 4WUUE 4UU9A 1AIFB 5GRVL 5GS0H 1AR2A 3EGSB 3EOTH 4WI9A 4ZUSA 4PJ7E 1JPFB 2BVOB 4PRAB 1U8HB 5ID0B 3C6SA 4PJIA 1EO7A 3MACL 1U8MA 4X6CA 2KKQA 3WYRA 3DTXA 3FCTB 1P7QB 1PKQB 3QT2A 4C4KT 3D2UD 2HJKA 3LRGA 3QDJA 1X4ZA 3KPSA 4FABH 1BQSA 1ZE3C 1RY7B 4KY1H 2VTFA 1F2QA 3QIWA 4JN1L 1MHPL 2P5WB 5AG9A 3LH2L 5IWLA 3GJEB 5L2KE 3DX8A 1C5CH 2VIRB 5BV7C 1TJIH 2VXTL 2ADGB 3ETBF 5HHQB 4ODUA 4PJAE 3V6OC 4PJEB 1CXEA 5E00B 1QLFA 3BMWA 5GS2H 3DBXA 3C2AL 3IFNH 5JUEH 1N6QL 2G9HA 2CK2A 3OXRA 4C83A 4KVCL 3L3OA 5F6IB 4N0YL 5CP7B 3NFPB 3VI3E 2EH8H 2X4NA 3QAZB 4M61B 4U1SB 5C0EB 2ADJA 2FZ3B 2ZKHL 3WKNA 2DL9A 3WUWA 4W6YB 3HI6L 2Z93B 3B9KC 5D2LE 1BIHA 1JPSL 1W0YT 5DMGC 4JKPL 3OXSA 2EYTA 4OKVA 4LP5A 3U2SB 3ARXA 4QXTB 3BSZH 3OKOB 4HJGB 3O6LH 3U0PA 2KUTA 3P0VL 3V6BR 5E4IA 2MNUA 4OM0H 1I7TB 4NHUA 5F6IC 4RFOH 5SX5H 2HT2D 3MYJB 1T7YA 2DQUH 4OCWL 3KLAB 1QEWB 4S2SB 3RWIB 3QAZC 4FFZL 2O61A 1MPAH 2W0KA 4N8CH 2DOCA 3KYMB 3F65A 3C5ZB 4KV5F 5EN2A 3C5SB 1C12B 1J9CT 2ZJSL 4H1LH 4HUMB 3TYGH 4K3JL 1DVFB 3THML 3TZVB 3BKCL 3ARFA 3C8KB 4XCYA 5JOPE 1ZWIB 4ORGB 1I3GH 3R8BB 5E6IA 1VEOA 3CAFA 4AZ8A 1CD1A 5F21B 3PL6C 4QHMB 4OD2B 2F54B 2IH3B 4NJ9L 4JZOA 5EOCH 3TNMB 4AEEA 1HHGA 5JORA 1YQVL 4HBQA 1FLRL 2WINB 2IALA 2X1PA 1P6AB 3BEWA 3C5ZC 3MODH 1HWHB 5I1JH 3QQNA 2OMNA 1DVFC 1CGYA 2EKSB 4HV8A 2KDGA 3RGVC 4PJIE 4AH2A 4H5SB 4RWHA 4X6CE 4JY6A 1CFVH 2CDEB 2AEQH 3N1PC 4DFIA 1A6WL 3FB8A 3ARED 2YPLB 5FECA 2VUOA 1LP9B 4MNGB 1IAOB 3KPSE 3MJ9L 5KOMC 1LDPH 1NCBL 3GK8L 4XAKD 4CVXB 4LLMA 5EIIB 3WUZA 4QGYA 5KVMC 2YMXL 2W59A 3IFLH 2JJVA 3OKNB 3QCUL 4HWEL 4ZS7L 4G9DA 2MCPL 1VDGA 3QQ3B 1BLNA 3EYOA 2C1OB 4PG2A 5TH2B 1ORSB 2W0FB 5J56B 3PDOA 1EX0A 3KPRD 1P7QD 5AD0B 1OAZH 2XQYG 3S4SA 3HE6B 3CMGA 4FZ8L 1F3JA 4YHYC 1J0IA 1IKNC 2AAVA 3KYOB 4YXKH 4O4YH 4P9ML 4PP2A 2P5WD 4PR5A 3HR5A 3O4OC 4FQCL 4K7PX 3QUZC 4Y4FB 4K9EC 4ZTPL 4OF0A 3GSUB 1MF2H 2HRLA 3MXWH 1GC1H 2GIYA 2Y5EA 2R0KH 3IDJA 5TJWK 4H8WC 3ZDZE 1EHXA 4LP4A 4CKVX 2NW3B 2C3GA 4W70A 1BZ7B 1A3QA 1W2KT 2E6QA 3TV3L 1EEQA 2DQJH 1TDQA 3HE6C 4ZDHA 5I66B 4L4VA 4DGIH 3W5MA 5DUPH 4HHAA 3BQUC 2MTPA 5JIKA 1ZVHA 1VFBB 3L7FB 1HI6B 4JHAL 4KUZH 1I9RL 2DI8A 5JIHA 5E1AB 3V7MA 3WFEL 12E8L 4ZSOA 1B6DA 4R96A 4KVNL 3RP1A 2IG2L 3QUMB 4U33A 3B3IB 1OT1A 5K59F 1PQZA 3GSNB 1M7DA 1MEXL 1DZBA 3M07A 4W4OC 3HB3C 3BW9A 2QQLH 3RBGA 4YHIA 2R0ZH 1KPVA 2FHCA 4QRUB 4EUPH 2FD6L 2KZ1B 2NZ9D 5C0FA 4N1EA 4OT1H 4F7CB 3DVGB 5CFHA 5AYUH 3ILPA 4RBPK 3ECBB 4UT7L 5JXEC 4ODXA 1S5HB 3H7BA 1ZV5A 3GKZA 4JDVB 4NOFA 2Q6WB 5FO9A 1QFUL 9CGTA 3TZVD 4YHOH 5IB3B 4X5WB 5HHNA 1T1YB 4QLRA 1P9MA 3E8UL 1FGVL 1UKSA 1JYNA 3NIGF 2EDHA 2R2CA 4XTRD 4M5ZH 1DLFH 2HP4A 3PWPB 3RNKA 2F54D 2J8OA 3LN4B 4N0FA 1DBML 4HXAL 3DYMA 4JHWH 4PTTB 1GCFA 1A21A 1U8QB 2IFFH 1U8KA 5I19H 2Y72A 3GMRB 3QXUA 1LQSR 1OAKL 1JGLL 2B4CH 2X7LA 3C9NA 3RL2A 3HPJA 2NY7L 2KL6A 1N2RB 4Z5RB 4BH7B 1AKJB 1CR9L 3L1OH 4Y1AB 1VHPA 4NO3A 1NUGA 5KN5A 4NKOA 3MUGB 4LLUA 4LSPL 4DAGH 4NC1E 1FLTX 3G9AB 4KKAD 2YPLD 2PW2B 3IETB 1TQCB 4K94L 4GRMA 1CBVH 3ARRA 5F1IA 2EC8A 5TDOA 2DKSA 4PY8I 4LSTL 4ODSH 3VH8B 4DTGH 5F6HI 3MLVH 1T20B 3V0VA 2LQRA 5IQ7L 1T5WA 3VU2A 4PGZA 3LEVH 4E42B 1N0LA 1RIHL 4L4VE 1ZHBA 5GRUH 4OI8A 1KB5A 4XC1H 5ICXA 5KVFL 3GJFK 4XWOD 4J3UA 4DJMA 3OB0K 2FEDC 2FWOA 1KIQA 4J6RH 1CFBA 1CFQA 1T0NB 4L1HA 5EOQH 4ZSOE 1NJ9B 1RMFL 1I1CA 2A9NL 4LSUL 5E9DD 3VG0H 1KB5H 1OGTA 1IBGH 5DEFB 3GSVA 4R9HA 1WEJL 4MWFA 1ZMYA 3GDBA 4LKCB 4Y4FD 4HK3N 1DQJA 1U3ZA 2AXGA 4NRXB 5GGRY 5I1LA 2DD8H 5J06A 1DBKL 5IEKA 1BIIA 4HJ0C 2XZCH 4PD4K 1R3KA 5H35B 3CVHA 1NGPL 3MGOB 1A6ZA 3QDMB 3FFCB 3T2PA 3IDIB 4GRWB 5DD6A 3TBTA 1QRNA 1MRCH 5D7IB 4NIKB 1U0QA 3P73B 4E0RB 3EYVA 1UA6H 1BFSA 3B9VA 3VMNA 1IL1B 1N7ML 3CVHH 5LG1A 4KTDH 5K9JH 2QKIA 3ARBA 4DCQB 1UYWL 4YHPA 4OF8A 3MLZL 4ZXBC 2WK2A 5C0AA 4G7YL 5IJVA 5E8PA 3S36L 3VXSB 4L3CB 3CXDH 4AYFA 4I3RL 1EERB 1RZ7H 1RZIA 3W39B 5IKCB 3X12A 1IGJB 1LO2H 5L0QB 5FEBA 2C4XA 2J2ZA 1JTTA 5EU6A 3RNQA 5JR1H 4X6DB 3D69B 2JK5A 3QNXB 5EZJA 4LEXH 5FGSA 1F13A 1ZLWK 1ODAA 4JRXB 1JNLL 2QADD 4QCIA 1I8IB 3KS0H 3PUCA 5TE6L 2IAMA 3KR3L 5I1EL 3TBVB 3WIHL 3IVKA 3EO0B 1MCLA 4XXDB 5SWZA 5JOFB 1ZGLP 4JM2B 5L0QC 3GGWA 2R0WL 4KXZI 1MSPA 4NYLA 4CRPA 4GW1A 4P49A 4MZ2A 4PB0H 4NQED 3ZKXB 1IZJA 2X6MA 4CJ1A 5IVZB 4LLDA 4QHNB 4Z7UB 1AQDB 1OP3K 4ZFOB 5J13C 3MJ8B 1RD6A 4I9WD 1TTFA 5E56A 2CIIA 3ULVH 1XGTB 4YWGH 4JFXA 1AKJD 3SE4A 2VYRE 1CGUA 5I73C 4ONOA 2YRPA 3I6KA 1I9EA 4JM2C 3EAKA 1HKFA 2Y6SC 3TPUA 5T1LA 3D39D 4XAWL 4JFEA 3R8QA 4LFHD 1JRHH 4APQC 3ZKXC 1Q0YH 3TO2B 1CICA 1JP5A 1JFQL 1QBMH 3OJ2C 4K7FB 1QFWM 5E94A 3CJJA 4NUJA 1U91A 1U8IA 1AR1C 4G6FB 4MXVF 1MFEL 2BDNH 2XPGB 4OTXH 3U46A 3RY5A 1C16B 3B2UD 3GJFA 3RIAF 4YFEA 4PGDB 5E2TH 4LVNB 4XHJD 1JF5A 4I77L 2VDRL 3KS0J 1SY6L 1QRNE 3VGAB 4LPYA 1CLOL 1GAFH 1N3NB 2BFVL 6FABL 1Q9OA 3GJFH 4MX7B 4XPHL 3QJFA 3O6FA 4RMSA 1OGAD 1NBVL 2H26A 4PYGA 2JB5L 3ZT7A 4YAQB 4YIQB 3EZJB 4OF5A 5C0AE 5ESVA 2NY2D