2VLMD

The structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
184
Chain Sequence
b'QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVKDSDVYITDSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JM22 TCR ALPHA CHAIN
molecule tags Immune system
source organism Homo sapiens
publication title The Structural Dynamics and Energetics of an Immunodominant T-Cell Receptor are Programmed by its Vbeta Domain
pubmed doi rcsb
total genus 33
structure length 184
sequence length 199
ec nomenclature
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vlmD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vlmD02
4BQ9A 2EC9T 1MFDH 3MV7D 4LCYA 1AQKH 3EO1A 2V7HB 3RUGE 1BZ7A 3ULVH 4YFEA 3ZT7A 3UX9B 5KS9A 4YHMH 1AGDB 1HHHA 4N9OB 3UTTD 4X80H 2XKUA 2YD4A 4L3CA 3RWEB 1IE5A 2Q86B 3U30C 1UKQA 4POYA 3NMEA 4BJLA 4IEFB 4G9FB 3FN0H 4LDEB 5F89A 2ITDA 4BQ6A 1G6RL 1IEBB 5DQJB 1UWGH 3O45A 3B4NA 2ZCLH 3BH8A 3KVQA 2R2BB 1VDGA 1G9NC 2Y25A 3FONB 2XWTA 5SV4A 4XRCB 1KIQB 1HILA 3CX5J 3EYVB 4R8WL 5KS9E 3LCYA 32C2A 2NY1D 3NFNB 2EDXA 1EO7A 2H6PB 5FA3A 1RHHB 4WW2C 4GKNB 2YXMA 3LPGA 4GG8B 1YNKH 1AC0A 1U36A 2C9AA 4L1HA 3OKMB 4XCYA 3QNZA 4PRDA 4ZO6A 1KLUB 1YDPA 3KYNB 2NNAA 5F9WC 4XMLH 4Z7WF 2DIBA 4JFEE 4OKDA 3HE6C 2JTDA 3D9AL 1F11A 3PQYD 5EBWA 2ZJSL 1XT5A 4GQ9L 5GS0H 3IJHA 1U8JB 4M43H 1KFAH 5E2VH 1XGQA 5J6HA 5I8KL 2JLLA 4S1SL 1ACYL 3OAYH 3BZDA 5I6XB 3JV4A 3WDHA 3BI9X 4DKFL 3HPLB 3VXMD 2A6DB 4LSDA 1T7XA 2VO5A 3H9HA 4EOWL 43CAB 4N1HB 2CGRL 1I7ZB 5D1ZC 3R4DA 4JO4L 5DI8A 2DQCH 1UXWA 4UOW1 2XN9D 3IFOB 4PJBA 5DFVD 3OPZH 2V5MA 2DQFB 1FGNH 1CK0H 2JB5L 1LDPL 4PJ9A 3T4YB 3TNMA 1P6FA 5L2JA 1IAKB 3P4MB 3EOTH 4CU6A 1UKTA 2YN3A 4AENB 4GJTB 3PP4L 4NNXA 3UZEA 5I15L 4M93B 2AERT 1QBMH 1N5AA 2K7QA 4ZQKB 5GHWH 3TESA 1DFBL 3FFCB 2F8VA 5C0RH 1QSEA 1XGPA 4KKAC 2G75A 4L3EE 4N5EC 4Y5XC 5KSBE 5EUOB 4F7CB 2EDWA 3ORJA 5INCA 1AKJD 1JPTL 4P2RB 4WNQB 1WGOA 3BISA 3OF6D 2CKBB 4PJCF 1Q0XH 1DVFB 1QQDA 2K3TA 1V7ML 3RWFA 3BZ4B 4MXWH 5IUSA 5D1QA 4G5ZL 4OLVL 1JNNL 2MKLC 3SDXB 1TZIA 5KS9F 1J88A 3UZVB 1GXEA 1JHKL 3MBEC 3P9WB 5GZND 5A40E 1C7TA 4ONHB 3U2SA 1CF8L 1JFQH 1QFUL 1D7FA 1UM4H 4ZQKA 1WFOA 2DTMH 1AH1A 3BE1L 1ONQB 1JBJA 1A6PA 1IARB 2B4CC 2BSTB 1KGCE 4OLYL 1NFKA 3D18A 1U8IA 1I8KA 5EIIB 3O41B 3JV6A 4FNLH 4KK8C 2OJZH 4QLRA 5CS7A 5BRZD 2Q7NA 5EA0H 1S7RA 4C56A 4R4BA 3WDIA 3B5TA 4BH7A 1WT5A 2EE2A 3GSUA 2F5AH 4OSUL 5I71C 4G80B 4JG1L 1JGLH 4OCYH 5KG9B 4Q9QH 4DKEH 1EFXA 4LRNH 1FYTB 2Y7QB 1TIUA 1TZIB 4LSQL 5GXBB 5KW9H 3CVHB 2R1XB 4OKVB 1RAMA 3QHTC 4K71B 3TYGL 3ARGD 4P3CH 1BLNA 5E6ID 2AV1B 3O8XB 4QXGH 2UZIL 1GGYA 3HR5A 5IROA 1YECH 3JWOC 5I9QC 3BZFA 3P0YL 1N5YL 4TSBH 1AHWC 3CX5K 1F3JB 2OI9B 3T08A 1ZSDB 1OCWL 3QEHA 3ZTJG 1PEWA 3RL1B 3LKRB 1L9NA 4ZXBA 4KPHL 1R5VA 3HAEB 3MYJB 1U8OA 1U92A 2FZ3B 5DVOA 4HLJA 4HBCL 4WV1C 2A6KB 2IPKB 1NFIB 3O6LH 3C5ZB 5DJ8B 1MPAL 2BNQD 3LMJL 3B6SB 1F6FB 5ADPH 4R7DA 4OGZA 1AJ7L 3WIHH 4JFDB 3G9AB 5H8DA 4NO2A 1K5NA 3FRPG 3VCLB 5MERB 3VFNA 1LVEA 5HDQH 4Y0GA 3GNMH 3WIIH 4CMMA 2KDGA 4G8GE 2B39A 1FNLA 4C57C 1YN7A 4EI6A 1FFQA 4M1DH 2R2BA 3EDFA 1FE8H 3BP5A 4PG2A 4WV1B 3V6ZA 6FABH 2AAVA 2DLHA 3VI3F 1SJHB 1NCAH 3MR9A 3D5OF 5GGRB 1VPOH 1OHQA 1WAAE 1U3HD 1BFVH 2ATPB 4JFXB 3R06A 4ONGH 4GKZA 2R1YB 3FQNA 3QEQD 3SDDA 2UWEB 2HRPL 3REWA 2HJKA 2JK5A 4TUKL 3ZHLA 1JZ8A 3QUZA 3VG0L 1MFEL 1CDGA 1HEZB 1CFSA 1AFVL 2HFGH 3W2DL 3H0TA 5ID1A 2VC2L 3T0AA 1I3GL 4H26A 4ZO9A 3STZB 3WJJC 1HSBA 3KAAA 4G8IA 5E9DD 4LRIA 5JXEC 2BHUA 3U30B 3BRFA 2O5XL 4U1GB 5DO2D 3RVVD 3HE7D 1DBBL 1NLBL 3RDTB 4X83A 4HWNA 4MXWL 3IDJA 3DUHA 1ZMYA 3G08A 5DF0A 3TBTA 2QHLA 3UPCA 4CVXB 5H35A 3SDXA 3H9HB 3S96A 4ZODA 4XP6H 3FJTA 2ICCA 2YSSB 3I50H 3VG0H 3G6AB 3U9UB 4YR6B 4XVUC 3NIGF 3LSOA 4GW5B 4BH8B 2ENYA 2R15A 1IBGL 1HWHB 3IJHB 3QZWB 3JVGC 5D2LE 5H2BB 4R4FH 1HQRB 5CZKA 1ZT7A 2DM2A 2GFBB 5M94B 1UENA 1RZGB 1QA9B 1R3IL 3M17B 3FT2B 1DEEA 1J18A 5GS2D 2JJTC 4XB7A 3QIWA 3MV8D 4NNXB 1CXFA 1FFNA 5F8RC 2JCCF 2CDGA 2OJEA 2I9TB 4YAQB 2WIIB 3EFDH 3MGOB 5JDJA 4R2GC 4PJ5D 2HTKD 3RGVD 1N7ML 5I1GH 5I17A 1FFNB 1BBDH 1M6OB 3MROA 3ETBF 3VXRA 4NC1E 1WJ3A 4BZ1L 4EDWL 3BDXA 3QDGA 3EZJB 3T2NH 3GSRB 4GOSA 4N9GB 1K8DB 2FCBA 4GAGL 1RHFA 5IK3B 5ICZB 3BH8B 4NWTH 4CVZA 1FYTD 1TMCB 1CFTA 3OX8A 4ODWB 3QUXA 4JN2A 3OJVC 4KPHH 2IMNA 2P8PA 5BMFH 1EBAA 2W9EH 2YD1A 5GZOD 1SVCP 2IALA 4LLQB 3VXNB 1WVZA 5DWUH 2D0HA 2GK0B 2YA0A 2I24N 1VACA 2MQCA 4HJ0D 3OSKA 5HGAA 3K4AA 4X0KB 3IXAA 3G6JE 4NQXB 4WENB 5F7FA 5FUOL 2CXKA 4R9HA 25C8L 4N0RA 1NEZB 5AZEH 3QO0B 3GJFH 5B38A 5GS1A 1NMBH 4HWBL 3ZKND 5MP6H 3GJEA 3BP7B 4Y2DA 2BK8A 1N0XH 3RQ3A 1YY9C 3GFUA 3VFMB 2VJXA 5IIEA 5TPWL 4Y2DC 3V2AR 3ZTJH 3S36H 4P2OB 3B9DA 1T4KA 1U8OB 4UIMA 4PJHF 4XWOD 2AABL 2AV7B 3OXSA 3DXAD 1QZ1A 4WEBL 1UYWH 1UXSA 4RMRA 4ZTOL 3DVGB 2J8UF 4YHZH 3ZDZF 4EVNB 1HNGA 1VSCA 3OXRA 3RY6C 2NY0C 1IAIH 4L4VA 2IG2H 5F44A 2EE9A 4ZPVA 1UM5H 5FYKU 4QTIH 1TQBC 4RZCA 2D7TH 2VL4A 3T77A 5C0JB 3CUPA 3MUGB 4JVWA 3DMMC 2OM5A 1ZT4A 3IFNL 3GMQB 1X4ZA 3IU3A 5CILH 5IROC 4AEHL 5C0EA 5JORB 3O4LE 1EJ6A 2VITB 1FL5A 4PP1C 2L4OA 5HYJB 3H3BC 5HHPB 1P84J 1ZGLA 4CL7A 4P5TB 4HWEL 1XF4A 1KBGH 2DQGL 2PO6C 5ADOL 4LKCB 4OZFG 3I3DA 3VDCA 4LLYA 1KCVL 3O41A 1FGVL 3T3PF 2AEWA 2D7TL 4N90D 1RZIB 1VFAB 4TSBL 4K94C 4LAQH 4EBQL 1BFSA 5A2LH 3DGGB 2X4PB 2F8OA 4OCYL 4Q9QL 1J8HB 2XN9B 2E5EA 4GMSH 2WNGA 1NC2D 4JPVH 4QXGL 3VA2C 5KBNC 4NGHL 3NABL 4OZ4B 2ADIA 4WFFD 1RUQH 4G8FA 1QSFB 1CD1A 5MHSD 4MJ4A 3UYOD 3ET9F 5BVPL 2E7LA 2AJ3B 3S5LB 4HWUA 5DT1H 5FM5M 4M5YL 3AS0A 5I73B 4YNYA 3S36X 3GI8H 1AP2B 1A1NA 4BFBD 3HI6H 4G6ML 4PJDA 2A9MH 3KYKH 5C0DB 1S7RB 3OKOA 3NTCL 2B1HH 5HHQB 2C3VA 3DHMA 4LMQI 4UU9B 1DQMH 5CJOL 2B2XH 4U1MB 3L95B 3IXTA 4PJDF 3S5LA 3RAJH 4P2QA 3IFLL 1RIVH 1EHNA 4P4KA 2DIAA 3QISA 1UZ6F 3DYOA 4EIGB 1X5GA 3SBWC 1HHGB 4ZUWA 1A4JA 3D69A 1FAKT 3WHE1 5HHPA 1ZA3A 5JXED 2XPGA 4DUXA 4NZJA 5L2KA 1HINH 4XVUD 4XC1H 4PB9L 5EORL 4OGXH 1HHIB 1I7ZA 4LIQH 2UYLA 4RGMB 2YHGA 4MQXC 5C0ND 1MCPH 2B1HL 1NGYA 2OP4H 4OI8A 1F58L 1LK2B 1JNNH 4RAHA 1LEIB 4KTEL 1QP1A 5BQ7A 3AMKA 1EEZA 1J9CT 4AT6B 3L3HA 4JM2A 1FL5B 1FBIL 1FNFA 1D5BB 2EDYA 5ILTL 5TPWH 2XXMB 2ARJB 1B2WL 1G0YR 4S2SB 4GRWE 3MFFA 3MX0A 5HJ3A 1T4KB 3QIWC 4P2OA 5KJRH 5F88B 1VGKB 2EDFA 5DD5L 4JZJB 5ANMB 4OF8A 2YA2A 3OKNB 2X4QA 1J10A 4WFGE 3ARFB 4LEXH 2VLJA 1UXWB 3MBEB 4G6JL 1HHKB 5A1AA 1NEZA 2F53E 4G3YH 1NGQH 5I16B 1AHWB 3IETB 4MQSB 3WS3A 3GIZH 2BY3A 3U7YH 4AJ0A 1Q0YH 4XP1H 3I50L 3U83A 2G60L 4H1LG 1KT2B 5DA4A 4X0KA 1H3XA 5D7JC 4KY1H 4OLWL 2CPCA 4L4TA 3SGEI 1MRCH 2DLIA 4DWHA 3MJ8A 4YHYB 4YO0B 5DEZA 5FKAB 3NZHH 3OHXB 4JDVA 2AP2A 4HUXA 4HKBB 1BP3B 5F89B 1UFUA 2X7LB 4KKBC 4QRPD 1NDMA 3TO2B 1A47A 1KBGL 2P47B 3QUYD 1QR4A 3VJ6A 4ZFOL 1PZ5A 2DMCA 5FAAA 3GB7B 4D3CL 1FG9C 4H8WH 4JRXD 2VR5A 4HJ0C 3B2VL 4BH7B 5A16A 1KJVA 2NXYC 2PCPB 4H88H 4YEFA 1AGBA 4JFOA 3TM6A 4E41E 1NCNA 1D9KA 4WW2F 1T0NB 5CEZL 4D2NA 1AQDA 1CICC 3ALXA 4M6NH 3MREB 3G04A 1IQDB 3WIHL 4RRPG 4G6KL 5ISZB 4OV6F 3B9EA 4IRSB 1LP9E 1JPGA 4O58L 3U9PL 4U6VH 4U0RB 5FO9B 3LQMA 4FTVB 1NBYB 2Z4QA 4FABL 1MCKA 5CLWA 5AWNH 4E41A 1VFMA 3QA3A 4EJ1C 4D94A 2LABA 4FQ1H 3U0TA 1Y6MR 2HKFL 4NKMA 1HQRA 1T5XB 3T8XA 5DDHA 3C60A 5FO9A 1FJ1A 2HVKA 5EU5A 3QCUH 3W0WB 4ODHH 1OY3B 3TVMB 5TDOB 3RWHB 4PP1D 5JW4M 3RAJL 4NRXA 4Q9RH 3MUY1 2VL5B 3KJ6L 1VB9A 5FDWA 2XZAL 3G04B 1DQLL 4FHBD 4BSWB 2Q1EA 5CMAB 4U6HB 3VXTB 3LD8B 4OCSL 4WI2A 1NFDE 4K55A 4JKWA 3RA7H 3E3QC 1MHCA 3RWJB 2GJ6A 4FABH 1QPXA 3VXRB 5HVWA 4NRXB 3W5NA 5D1QD 2NY1C 5GGRY 4WW2B 4K3EL 3UTSD 3MUHL 1PZ5B 4YK4B 4U1NA 1UJ3A 4ODTH 4U1LB 1MWAA 3WIHA 1UJTA 3HZKA 3ARBB 1CFVL 4ODVH 1E6JL 3LH2H 4ODHL 2AK1H 5I1AB 1YMHA 4BSVA 1Y18A 1NFDA 4JPIB 2ZUSA 4WI5A 4XP4H 2XZQH 4BQ8A 3KJ6H 2ITCA 4Y4FC 3GRWH 2H1PH 4LKXB 4FQXC 2WBWB 3QZWA 4GBXC 4HK3N 4HJJH 2P48B 3MRKA 2Q20A 1N5YH 2HH0L 3E6FA 1F4YL 1JTTA 2XG5A 3O4LA 1I7TA 4U7KA 3EOBA 3CCHA 3FB6B 3UMTA 4R7DB 2MWCA 1N3NB 1UZ6E 4LLUB 5D2LA 3ZE0F 1INQB 5K59E 1ACYH 2AJVL 4E5XB 3WD5H 4JN1L 1ZANH 2FDBP 1OT1A 2VQ1B 3CSPA 2J5LB 3WMSA 3ZKQD 1YN7B 3I9GL 5F7NC 3T04D 5MEQA 5F6IC 1UVQB 1NGQL 4JY5L 4NQDD 1N4XH 3O6LL 2AK4B 5CWSB 1I75A 1VA9A 1IGIL 2W9LA 5DGQA 1XMWA 2HWZL 3BP5B 5C3LD 4FQCL 3FT4A 2GTZA 1JYXA 1S9XA 1HEZA 1Q8MA 3GBLA 1GGIL 1TTFA 1URLA 3CZFB 4UT7H 1RU9H 1E6OL 3B3IA 1MJ7H 4LCIL 3TCLA 4ZFZB 3T0EE 2YC1A 2BNQA 3SKUD 2VXUL 3WNPA 4HIHB 4NKOA 4C4KO 1UQSB 3ZKMC 3T3PE 3IFLH 3T4AA 1QPPA 5ACMA 1BLNB 4YHLL 3V5HB 5D7IA 1DR9A 3KPNA 1BFVL 1J86A 1KJ3L 1HOCB 4HX1B 4TTGA 1F3DJ 4LVEA 5EIVA 1R5WA 5T3ZD 4Z7UF 2HJFA 4KV5E 3MLZH 3N9GL 3PWJB 1ZVHA 4X7FC 3WCYA 4MDJB 4N1EA 1BBJB 4HC1L 4M4RA 5JO5B 3NTCH 5C07E 5L2KE 4OZFB 2D7OA 4NQVB 1I7RA 1JE6A 1ADQL 1A0QL 3C5ZA 2A83B 4YHNB 4YIQB 1L9MA 3U48A 5DD6A 4WHDA 1RK0B 4PB9H 3O11A 5GS2H 3OJDB 4GW4A 3VE0B 2OXHA 1RZKL 2ADIB 2MQ3A 4PJFA 4D9RE 4OF6A 3HUJF 5JW5B 3U2SB 4JFHD 5DMGD 4W4OC 1BPVA 4M62L 3GBML 4JQVC 2EECA 3ARFD 5E5MB 2DQTH 2ESVA 3KJ4B 4S1RL 5TQ0H 2I27N 4HIJA 1B9ZA 1IC4H 2F19H 2XY2A 1D9KC 3IJYB 4JQVA 4PPTA 1MCPL 4MD5A 5IFAH 2HA1A 5DJDB 1ITBB 3WBDA 1S8DA 1FBIH 4MXQC 4N8PA 4LSRH 5IGXL 5TF0A 3MODL 4MX7B 2VUYA 2NTSP 5F1OB 5IESH 1KNOA 2YOCA 2VLRB 4Y19E 4Z7UA 1CFVH 2VZ3A 4DFHA 3VFOA 4Y8AA 1Q0YL 4M61A 4X4YA 1EGJA 1YEFH 5TQ2H 1D5IH 4EDWH 4LLDA 4JRXA 4H25B 3ZMRA 1RZGA 1ACZA 1KCVH 4XVSH 4Z95L 4MWFB 3TNMB 3ESVF 1S3KH 1T1YA 4FQLL 5LCVL 2B1AL 3VGAB 5KSVB 4F15C 3V7MA 4L9DA 1Y6KR 3C60B 3G6DL 3BWAA 3MCG1 4NFCA 2OL3L 4Z7OF 1JZ3A 1KPVA 2AJVH 4ELKB 2VDLH 5CBEB 2Z8SA 3ARDB 3NZHL 4PJ5A 2NLJB 3QUZD 5IR1B 4ZUTA 2DIJA 3HZMB 2FECI 5KSUA 2A2QT 5DD1H 5SWSD 5MHSE 4QKXB 2DQUH 5C92A 1ZGLB 1R3LB 4M6OH 2CIKB 1RY7B 3JSSA 5B3NA 4Z95H 4NQVA 1F42A 2YK1H 3ROOB 1BBJA 1QFHA 3F6IA 4NO3B 4U1JA 1A6AA 1OAQH 2WP3T 1DVFC 5FB8A 1AXSB 2F58H 5HGBB 1GZPB 3D39B 3MZGB 3QEGH 2VABA 3IF1B 2WWMD 1MAMH 5D2LF 2BNRE 4PLKC 2EKJA 4Q6YA 5TE7L 2PUQT 1C5BH 1J0JA 5D1QC 2AABH 3P4LA 1UT9A 3KPRE 4G9FE 4KUCD 5T1LA 1UYWL 4DTGL 1X5ZA 3PWPB 1Q9KA 3L3OB 2HT2C 2GCYB 4PYHA 5BW7C 4PJAB 1U8NB 3GJFK 4PR5A 4U1IA 5DRXA 1FGNL 3TN0D 1CK0L 2ICWA 1HXMA 3VXSA 3N1PC 2ZJSH 2NX5A 2DM3A 4HDIA 3BO8A 1R0AL 5IFHL 3HI5L 1H3GA 4Z7WA 4P5TD 4PY7A 3SKMB 1MAJA 5FYJE 2JCCB 4Y16D 2AJYL 3PP4H 3QDHA 1MIML 4UINH 3UTQA 4PRPA 3KPOB 3KLAB 4I48B 1INDH 2AK4A 1J8HD 5CWSA 2YPLD 4K3JL 3S8WA 2PXYC 2LU4A 3PUCA 3E0GA 3GBNL 4FMKA 3RJDA 3O2DA 3IXAB 2I9TA 3IKKA 3UJTL 4R4FL 2ZUQB 3KYNA 2IFGA 1BQLL 4H25A 4G9DA 4WHYH 1RZKH 3VMNA 4R0LA 1XR9B 2Q8BL 3RWGB 4GUPB 1JRHH 4AG4L 1EFQA 2RCSL 5ID0B 4LLWA 3Q3GA 1N2RB 1JZ7A 3QXWA 4HK3J 1LE9A 2J88L 4KTDH 4P9HH 4M62H 1SJVA 2QSQA 2ITDB 4XMPL 1JHLL 4PRPE 4UILH 5DUML 1EMTL 4ERSH 5BJTA 1FVCB 1I7TB 1EHXA 5FKPA 1HIMH 2V5RA 3TV3H 4PTUB 4JN1H 4DZBA 1OWWA 2XQYG 3DOSA 3O2VL 4LCWA 3C5SB 4JLRB 5C0FA 1S8DB 2ZG1A 3DO7B 3I9GH 3HZMA 2JIXA 5DK3A 1FZMA 4PJCB 1U58B 4IIQA 1A9EA 4IRJA 4O51B 4Z7NF 1IEBA 2RQ8A 4OCRL 3VGDA 1NSNH 3IAGC 3VFOB 3FT3B 2QQKH 4FP8H 2Z9TA 5E2UL 3RTQB 2VLRE 3OKNA 1T6WA 3K0WA 1MFAH 1BQHB 2X6MA 1PX4A 2VDOL 5DVLA 3TZVB 5C0IA 2HWZH 3D0LB 4BZYA 4HJGB 5LAXA 3KGRA 2Y4SA 2ZSWB 5IQ7L 2C3WA 1F3DH 1N4XL 1HIML 1A6UL 2B4CH 4L8SA 6CGTA 3IJYA 5GGVY 1A6ZA 1CDYA 3NZ8A 4QHNB 1F00I 4KJYB 4FQCH 1O7SA 3SJVA 2VDLL 2G9HA 3C2SA 1YEHL 4JHBA 1OW0C 5IQ9A 3K8LA 3DXAB 5FYJH 4TTDC 1GGIH 1FV1A 2CKBL 3BYYA 2YBRB 4HKBA 5JW4Q 1TPXC 4HCRH 5D7KD 3PV7A 4FQPA 4YO0A 3RWFB 1KG0A 1IGFL 1U3ZA 5CJ5A 2O5YH 1I1AC 4OZGB 4UTBL 3OR7A 4OFVA 5LJYH 2BOBB 3PL6D 1AGEA 4P2QD 4X6CB 4LCCC 5IJKA 4AL8H 2IAMC 5E2TL 2I26N 2IH1A 5J7CC 3B8YA 3THMH 5J6GA 3GMOB 2OP4L 5IJVB 1U3HA 3L5WA 4NM4L 2X40A 4ZTOH 1GSMA 2AXGB 4O2FA 1FH5L 2IAMB 2VLJB 3PDGA 4J3TA 4X6DA 3LRSB 4I5BA 1NBVH 2WUCH 3Q5YA 5BOZG 1BZQK 3VU2A 4PGBB 5TE4L 2A83A 3QPQC 5FGBA 4WI7A 4MZ3A 2VR4A 3G5XB 5IM7A 4M1DL 2EYRB 9CGTA 2GJZB 2YPVH 2VH5H 3HCVB 4N5ED 5F6HJ 3H7BB 3V0VA 4Y5XB 3VFWB 3PL6B 4JZNA 4NM8H 4MDJA 4KRPC 4JM2B 3U0PB 1ZS8A 3ARGB 4GXUN 1AGFB 1L6ZA 4HUXB 3T1WA 3V6OC 2HRLA 5IFHH 2AK1L 5IB5A 2PR4L 5EWIL 3BDYL 4HQQH 3O8XA 2H41A 3GIVA 1OP3H 4J6RH 5EO9B 3IDXL 3VH8B 3WLWD 4OIAA 5HDQL 5J13B 3AY4A 4O5LH 1TETL 3RRQA 3RGVB 1NAMA 2AK4E 4F7PB 1I3GH 3CFIC 2VQTA 4AIZB 3R8BB 2ILLA 1LEKA 3B6SA 2WK2A 4MQ7A 3S37H 2NW3A 2DMKA 1T03H 5EC1A 5ACLA 1FCCA 3EDJA 2HMIC 3I84A 3CMOH 3CDGB 2CXGA 1E27B 3B5HA 1FL3A 3A6BL 5DVMA 3L5WB 4U1MA 2E9JA 2H6PA 4HIIB 1ONQA 1P1ZB 5CCKH 1WC7A 3H42H 1U6AH 4UQ2B 4PJ8C 2Q8AH 5DQ9B 4JFDE 5E6ZA 3TFKD 2XY1A 1G6RB 5E8EB 1Q9LB 1MCLA 4JRYD 1DVFD 1Y0LB 2AV1A 3OKLB 1SBBA 1KOAA 1EA9C 3T77B 4LOUC 5C0JA 1IBGH 1KG0B 1N64H 4MNQE 3D3VE 4IOFD 3WXVH 1R3IH 2A0LD 4PV9B 4GAYB 2F5BL 2R0ZL 1J11A 5J8OA 4WGWB 3CFJB 2G9HB 5DJYA 3WIFA 4JPWH 4L3CB 3RWEA 5F6IB 5I30H 4ENED 3ULVE 4N68A 3BSZL 4JFDD 4FXKB 1KJ2A 3ULUC 3LKNA 5IQ7H 1YY8B 1ZHLA 2XFXA 4H0GA 4JAMB 3VXRE 4S11A 3ZYJA 5D7IE 1NFDB 4JPIA 3O9WB 1E4JA 5DJ2B 1F4WH 3TZVD 3NA9L 4P5TC 4I18A 4N0UA 2BVEA 3VXSD 3HB3C 5EZOL 4PTTA 2WWKT 5HXMA 3O3AA 2ICEA 1VEPA 1WZ1H 3CFDB 3WXVL 2VDKL 2UUDK 1JHTB 4HUKB 2QHRL 3BGMB 3O2WH 5L9DL 1QBLL 3EAKA 4PJIA 2NY4B 4QRSA 2ZG3A 3AFLA 4TSAL 4BQCA 1TTUA 4JRWA 3V5KB 3BFOA 1VFBA 1A2YA 3KPTA 2FJGB 4UOW0 4O2EB 4PRHA 4RGOH 3MZTA 4ODBD 5F97E 4NKQB 4XVTH 4D0DB 4Y4HA 4WHCA 4NYLB 1U3HC 4K3JH 2G75B 4BZ2L 5DRWA 5JDSB 5IK3A 2IC2A 4QHUA 4JDVB 4PJXA 4X6DE 4Y1AB 2ZPKL 5HHMD 1A21A 3B43A 2DBLH 4UZGA 4OZIA 4MD4B 2R9HC 3U7YL 5FA4B 4QXWA 5I2IA 1V05A 2VH5L 3VGHA 5D7JD 4LSRL 3I6LE 3KDMA 3PL6C 1YEEL 4GT7A 1BJ8A 3QNZB 4PRDB 3DXAE 1GIGH 1T22B 5DO2C 5EUOE 3S9DB 1NMAH 4LVOB 3C6LB 4RDQG 4HGMA 1OT2A 2DLTA 5GGUA 4WFFE 1CL7L 4TTDD 4MNGB 5GRUH 2W91A 2Z31A 4JG1H 2HTLC 3UJTH 4AM0A 3PF2A 3RUGA 3C08H 3MRPB 1ZAGA 1P84K 4NKDB 1G9MH 5ETUA 1K3ZA 2P4AB 3VFUA 3SKJL 4A6YH 5E5UB 3IDNB 2Y36L 3T1FB 3D9AH 1FORL 1CCZA 2GK0A 3SKNA 4Q9CA 3CFJA 3D2UD 1OTUC 4AT6A 5HYSG 1A6VL 3GHEH 2FD6L 1IGTA 2YUVA 1F4XL 4LF3A 5C0CA 1FVDA 4HF5H 1IKNA 2BJMH 2QKIA 3WFHB 1RU9L 4ELME 1ZOXA 4PJ5E 5DS8A 1CGUA 3MRCB 4KU1A 5F7WC 1B4RA 4LSTL 5CEXA 4HXAH 3GGWA 4XCYB 2UZXB 2EIDA 1QFWI 3RDTA 4GRWB 1HHIA 4KDTA 1YYML 3E8UL 4XZUA 3W9EA 1KCRL 3VFMA 5I71B 3MRRB 2CLVB 3H7BA 3V0VB 7FABH 5GZOC 1MI5A 2Y23A 1QR1A 3MBEA 4NN7C 3LEXA 1JMXA 3QWRA 3K81A 5FIEA 3V6OE 3DSFH 3VRIB 4JE4B 3MTRA 4JFQA 3BPCB 2FBOJ 4XCFH 2KPNA 2IAMA 2P46B 2VDPL 5FYJL 3EJYC 5FDYA 4YDLC 4JCLA 1UWXH 1VPOL 2DD8H 4O2CB 4TSCH 4QWWD 3WLWC 2PXYA 1IGCH 4Z7QF 2V7NA 1NAMB 3LKNB 4KRPD 3CXDL 4MHHI 3GEWB 3QI9A 4OLVH 1ZA3B 4X5XB 1SHMA 1UWGL 3OKYA 2JCCE 1HHGA 2J3SA 3ARQA 1ZEAH 5IB1A 3P4NA 2YUZA 2VR9A 1NCWH 2EDKA 3GMNB 4XCCL 2N7BA 5HBBA 3EW3B 1NKOA 3ROLB 2KQMA 4U1JB 4WY7H 1UWXK 4QOKA 1T80A 5GGVL 4XGZB 3SGJA 2AW2A 5DQ9A 3BH9A 3SKOB 2QBWA 4ENEC 4C56B 3DJ9A 4FFWD 1J87A 2PW2A 3KPRB 1UB6B 2WIMA 1QD0A 2YRLA 1JF5A 2BNRB 3VWKC 1W0YT 4AZ8A 5D71L 3TT3H 3U82B 1CFSB 1IJ9A 1S9WB 2G5BB 3DROA 3OR6A 1YEDA 2FGZA 4ELMB 5F7EL 2E8YA 2IBZX 1IL1B 3U6RB 3EBAA 1SJEB 4PJ8D 1B0WA 4GLRH 1KJ2B 3VRLE 3HLAA 1AGEB 1VGEL 1XFPA 3IDXH 1XGRB 4M8VA 4XXCC 3A67H 5E6IA 4JREC 3JV0A 2DKMA 3WEXB 5CIPB 3D39D 2BXYA 3S96B 5ESVB 4GSDH 5EULV 4DN3H 1YEGH 3WSQH 3WFEH 1FZKB 4OQTA 3OXRB 3MXWL 1BECA 4GMTL 3MA9L 4X5XA 3UCRA 5I1GL 3JWOL 4L9LC 1TJIL 3GSUB 4I77H 1LE9B 4TVSa 4Z8FL 2DBJA 2VXUH 1MPAH 4IS6B 5T3ZH 2R2CA 4JFDA 1KGCD 1S7TB 4JVPA 5DJZB 1GGBH 4NKDA 3MRHA 3U7AA 3W5MA 3GIZL 3D85B 2LE9A 4PJ9B 3T4YA 2OL3A 3TIDA 2FO4B 4GRWH 4X9IA 3UTPD 4MNQA 1UACL 1TJHH 5DXWA 1KCSL 1QHPA 2A6IB 4J7RA 5CSZA 2XYCA 3RNKA 1F4XH 4N8CH 4HIHA 4Y19B 4A2LA 2ESVD 5I9QB 3TCLB 1T21B 5FOBB 4PB0L 1H9VA 4PD4K 5D9SA 3DURB 1I3UA 1HXMB 3VXSB 1CXEA 3QXUA 3GGWB 2IQ9H 4XNQB 1U8LB 4QF1B 3JWDH 5T3ZL 1KEGL 4DEPC 4LIQE 4MAUL 5J1AB 1B6DA 1KCRH 2APFA 2DQJH 1H5BA 3MO1B 2MTPA 5D2NC 2PO6A 5J6HB 3MC0A 5FK9B 4AY0A 2XT1B 4HT1L 4K94H 1F5WA 1CF8H 3QDMD 4QRPE 5DLMH 2VLRD 1FL6B 1ZLSL 1KCKA 1N2RA 3TO4C 1KCSH 1QEWA 3K8MA 1HSAA 3UJJL 1KJMA 4XCFL 1CD0A 4HPOL 5CINH 3MRJA 2GJZA 3SDAB 4J1UB 3G6JB 5B39G 1K2DB 1XR8B 1MFEH 1A3RH 3B9KA 1RJYA 3NIGE 2D3VA 3BUTA 4Q9BA 4GLRI 2IFFL 2H26A 5D1ZD 4PBVC 3HMXH 3DV6A 2CD0A 5CD5D 1BZ9B 4TNWF 4JCMA 4YXHH 4QO1A 1KEGH 1R5VB 2CLRA 5DRNA 2LVEA 4NSKB 3O3AB 5I1JH 4G42B 1CFTB 1VESA 3L3KA 3S7GA 3RFZC 4HKJA 5IG7B 3QIWD 4BFGA 4S1QL 3BD3A 3J8F7 4HS3B 2IH3A 4XBPA 4PJXE 1BF2A 4DZ8B 1FZMB 4PJCA 5EPMB 3ARDA 1G7MA 2GY5A 2R39A 5DVKA 3GUTB 5CUSL 3ARBA 3TT1L 3U36B 2ZUVA 3VA6A 4XVTL 1FPTH 4CN4A 4NZTL 1JZ2A 3WFDH 3WKNA 4DJMA 2H2PC 4W6YB 3VXRD 3MRQB 4OLUH 3GKWL 4R90L 3G5YA 3QUMA 3ES6A 4RWYH 5B39A 2R2HA 4YGVA 3WN5B 1F8TH 1W72H 1DP0A 2C7UA 4YAQA 4YHOL 1XH3B 5EU7E 3STBA 1T5WA 4ZNEE 3D2UB 2B0SL 3GSWB 4JKPL 5DD3L 2L7JA 4ZPTA 3SDCD 2DJSA 3O81A 1A6ZB 3QUZC 5E4EB 1P7HL 2FH6A 1KB5H 3LH2L 4ZMAT 4WI4A 5FDWB 4DEPB 3HPJB 3C6SA 4LLUA 5D2LB 1BGXL 5ICYA 1MF2H 4U0QB 1A8JH 5KSBF 3FRUA 1L7IL 1U91A 4CBPA 5E8OB 3QCTH 1MNUL 4X4ME 1WWWX 1DQLH 2GI7A 4H1LH 3U9UA 1AO7E 3NABH 3QDGD 3T0VA 3U36A 2XRAH 3C6LD 4KKCC 2JKXA 4R96A 3K80A 2NY6B 4LCCB 3PHOB 4RQQB 3M8OL 2AXFB 2C1OA 1Z3GH 4JANA 4UNVA 1XGYH 5CBEA 1N64L 4OFKA 2F58L 2H9GA 5KSAD 1T2QH 3D0VB 1AGCA 5CZVH 2IAMD 1S7QB 5AYUL 5TGBB 4DVBA 1NCAL 4PY8I 2FHCA 4G42A 4RISL 2ATPA 4HWBA 5DEFA 1G7IB 3SQOH 2CRMA 4NO0B 2B2XL 1MI5E 3MR9B 2V2WA 5E1AA 3X17A 5AZ2H 3S5LG 2Z8VC 1IFHL 1ZHKB 3PHQB 3S88L 4OLEA 1RJYB 4GRLA 4RX4A 4AH2B 2ORBH 2HJKB 2JK5B 4U3XA 4JO1L 1GZPA 4G5ZH 4Z77B 3O6FB 3I2CL 4Q2ZB 4ZUSB 3FQNB 4W81A 5BV7L 1Q9LA 3JUZA 3MRBA 5TH2A 3QUMB 4NZUL 4LASL 1II4E 2FNBA 3AXLB 4X6BA 3BPNC 2I9LB 2MCG1 1CXIA 1FCGA 4OTXL 2NTFA 4HFWA 4NQCD 4YDKL 1JGVL 3QXAB 1MVUA 3U0TB 2DTML 4OZGE 4XNMA 4R97C 1MWAL 1CDCA 3BDYH 4HQQL 3BO8B 1IFHH 1P5VA 1BX2B 1UQSA 2NW3B 1BQLH 2IG2L 1RZ8A 2CUMA 1OW0A 3ZYZA 1CFQA 4AEEA 3W0WE 4JO1H 4ZAKD 1E4XI 3CFEB 4E0RA 3TNNB 4AEHH 2VIRA 4R4ND 1JK8A 4X6CA 2HN7B 2LV4A 5B4MC 1SEBB 1RFDH 1BM3H 3UC0H 5LBSL 2X9YA 5I1DB 3RWDA 4YXHL 3VXSE 4FTVE 3F12B 1G84A 3P30L 2ATKB 4X6FA 5KJRL 5F96H 2X4NA 1F3JA 5GGSB 2IPTH 3CMOL 4JM2D 1TNNA 4PG9A 4YXKL 4L8BA 4XNYH 3EYQC 4PJCE 1BAFL 1YEKL 3D25A 4Y4KD 4H5SB 1U41A 4YDJB 4FOMA 1BFOB 1YEJL 4HHAB 5GSVA 4XNQA 1QHOA 3JV5A 1J0ZA 3HS0A 3VFSB 3TBVB 1BM3L 4NO0A 3QULB 4HIJB 4UDTB 4APQC 3UZQA 3O4OB 4H1LB 5F21B 2XPGB 3VXME 2A6IA 3CJJA 4FFZH 3TO4D 3FB5A 5ECJE 2H32B 2GT9A 2BDNH 3MLXL 2Y6SC 5IBTL 4LLMA 1F90H 1RJCA 4UUJA 4M3JA 3HI6L 4G6MH 5HJ3B 1OWRM 2HLAB 5CIPH 2ZNWA 5J1SC 3HNTL 4U1LA 1NH6A 4L4TD 5F1NA 4KK6D 4ZD3H 4E9LA 2F53B 3ULUL 3O6KH 1JF6A 4QRTB 3X3GH 3BPNB 5TH2B 2LAAA 3ESUF 2WW8A 1CICB 3VXPA 4HH8A 3C87A 1GC1L 5EZOH 2VLRA 1YZZA 2MCPL 5I8KH 1D5XB 3KPQA 3IU4H 4PRID 2W07A 4DCQB 5HYQB 1WZ1L 3SDCC 4DGVL 4MAYA 3MLVL 1HCVA 3D18B 1NLDL 4HGKC 4PJAE 1E4XH 2R4SL 3PV6B 4P2RE 1WZKA 1KCUH 1MCFA 3QUMH 5HYFA 1A7QH 1BWWA 5TFSL 4CDGC 1MCWM 4HAGA 3HG1D 2IQ9L 1DLHB 3RY5A 3HZYB 4KDTC 5ITFB 5DJ0A 1T1XB 3TP4A 3H2WA 2CIIB 2ZOLB 3O0RH 4P5KA 2ZUUA 5EU7C 2CJUH 4P2OD 3CGTA 5DYOB 3ARED 2ZSVB 2Q6WA 5DK2A 4X4XA 5L2JB 4BM7A 1T89C 3D87B 5D5MA 3ZDYF 1EV2E 1Z2KA 2H2PD 3UYRL 3JWDC 2I9LA 2FX7L 4JPKL 3RA7L 5DJCA 5GGSA 1T3FA 5JORA 1RD6A 5DD1L 3VRLF 1CXKA 5C0EB 4HUWB 1I3RA 4MXQD 4P5MB 3MRJB 3SDAA 3FQUA 4DQOL 1PLGH 1T5WB 2EDJA 2A74B 3G5VA 4GRLB 4JFEA 1E6JH 4FQ2L 4TUJB 3TPUA 4PJEB 4K7FB 3MRNA 1RULL 4ZYKB 4OT1H 4E42B 3BQUA 3KWWB 2YWYA 5HHVH 2FBJL 2GUOA 3MACL 3MO1A 1VHPA 4KHTL 2GAZB 1D9KD 2PTVA 3IAQA 3U79A 3AM8C 2JJTA 1INDL 5D2NB 1CIUA 4J8RA 3WUZA 1IAOA 4OIBA 4F7MB 2MNUA 4L8SC 1Q1JH 3RZWA 4PS4H 1N6QL 4PJ5B 3T09A 1EH9A 2J6EA 3MOAH 3PABB 4OJFL 1GOFA 1WTLA 2G2RA 4HZLB 1JZ6A 5GPRA 4P46A 4JGJA 1VADB 2YD3A 5CEZH 4ZAKC 5IW1A 3ZZ1A 1FFRA 3NFSH 3NCYS 4X4MA 5CJOH 1RULH 1FFPB 3ULUD 3MBXH 1CE6A 2K9UA 3P9LA 2FBJH 4GAJH 4FRWA 5C0CD 4KC3B 1XF5B 4UT7L 3P0VH 5CJXC 4EZMA 4UDUB 4RMUA 3T0EC 5I19L 2WINA 4TSCL 3GI9H 4ONFH 1KTRL 1Q9WB 5DJCB 5MEPA 12E8L 3WO3B 2NY7L 1SMAA 2IBZY 5IB2B 4FNLL 4G7YL 5ESVA 4P23A 3AUVA 5DDHB 1IM3B 3ILQC 4JO2H 1TZGH 2QL1A 2ORBL 5EFIB 4I0PB 1G7HB 4F37F 2BSSB 3JTSB 2ZSVA 3HE7B 4NQTA 4MAUH 3CK0L 3IDYC 3KWWA 2YPKA 4LSQH 2ZG2A 3U6RA 4JHAL 1T1XA 2GJJA 3GSNB 1QYGL 1TLKA 4YXLH 4OD3L 3LEYL 4YDKH 3OR6B 4XCCH 1LGVA 1YC8A 1OF2B 4MJ6A 5JMRA 4LLAA 5IMKA 4WW2A 4C59B 3FRUB 2VXVH 5F8QC 1REIA 5F88A 4K2UL 1I3RB 1WSST 3GDBA 2V7HA 5HGAB 5DMIL 3GSVA 1EEUA 3MRDB 3UROR 3WUWB 5I8OL 4U7SA 5E03A 1MFAL 4NFDA 3I3EA 5E00A 5DRWB 5DJYB 4FQJH 3ULSB 1JHKH 5EOQL 3O6FD 4G8FB 2CO6B 5CIPA 5EUOF 1X5IA 3QYCA 4HWEH 2AXHA 4LK4A 5IMMB 5EO0A 1A7RH 3TLRA 3FB8B 4OM0H 4QT5A 3G9VA 5E95B 2NW2B 5DJXB 2GY7B 1F6AA 4JQIH 3CZJA 4NQCB 4YFLI 4WUUA 1G9ML 2Z4QB 4RMVA 2APWA 3ZE1E 1RFDL 5IEKA 5IFAL 4PJ7B 4XTRD 5D7SL 4GKSB 3NFPA 3BYTA 4NN6B 4S10A 4CNIA 4WU5B 1MRDL 3M1BB 3RL2A 4IRZH 3KPLB 3O8XC 3D3VB 2NY2D 3F5WB 4ZSOA 2R23A 1C7SA 2IADB 5TF1H 3VRIA 4WO4B 4M43L 3WE6A 3P30H 4JM2F 1BAFH 3VD3A 3QP3A 3QQNA 5HHXH 3I02A 2MHAA 5FUZL 5DT1L 5LVEA 1PW3A 2FWOB 4LL9A 4NN7B 1NBZA 1U3YA 4TUKH 3WUWG 1UM6H 1AO7A 1CS6A 2YSSA 4YXKH 3V6ZB 2HLFC 3KPMA 4XWGL 3QFJB 4KI5C 4P4RA 1H5BB 5FFLA 2GEEA 2NY6D 4HEPG 5I1KL 2P5EE 2RHEA 4G7VH 4QRQB 1LO3L 3VI3E 5E9DA 2LU7A 4OD2A 5BRZE 4FMFA 1WBZB 2DQUL 5E99H 1VCAA 2JE8A 3LY6A 1IGYA 3CXDH 4LPCA 3WE6B 1OAKH 4EIZC 4RFNC 4NHCH 2X4SA 3KR3L 4U6XA 4YHLH 2FIKB 4IHOA 1QFPA 2EO9A 2ADJB 1T0PB 3ARDC 3W39A 4P9MH 4D9RD 3VXQA 4OCWL 5IOPB 3KNBB 4PRAA 3QEHB 4XC3H 1NCCH 1V7NH 2Z35A 2DAVA 2BRRL 4I3GA 4P59H 3M07A 3AAZA 4BA8A 2FEDC 3S37L 4DFIA 5K59F 4XCEA 5HD8C 3OKEB 15C8L 3MSPA 5GIRA 1MQKH 1HQ4A 4OAWA 4OTXH 5CLTA 1MOEA 3BSZH 4GQPH 1Z5LA 1PKQB 1MRFH 4G8GD 5B3JE 2BVPA 2EYSA 1FZJA 2Q6WB 1ZT1B 1CG9A 1JPST 2HP4A 3LKSA 3SDAD 2UWEE 4DUVA 3OMZA 3PDOA 1LD9A 1U93A 1IGJB 3CFCH 1ES0A 3QIBD 4Y4HD 1PD6A 3X12B 2QQQA 1AO7B 3MRIA 5EZLA 1LO0H 2VZ1A 5MERA 3TVMA 5DK0B 3Q5OA 5D1ZA 1M7DA 2W65A 4F33B 5BRZB 2DQDL 3BQUD 4RNRB 4H0HB 4X6CE 1HN1A 1MELA 1NCBH 4KK5D 5IESL 3WFDL 5A2KH 1JWUA 1BJ1H 1MIEH 4J23A 2ZUTA 5EIIA 2FYYA 3QG6A 3LEVH 1DLFL 4IOIA 2EH8H 3KPSB 2NZIA 5I17B 1AI1H 7CGTA 4R96B 4I0PC 2Z8WC 4EUPH 5EH1A 2NY5L 2VDRL 1UJ3B 2V5TA 1KB5L 1WWBX 1MJJB 1XGTB 5CZXD 2AK4D 1KB5B 2DF3A 2XRAL 1ZV5A 4CW1B 2BNUA 5IB4A 1I8MA 1MF2L 3A6OA 1MHCB 2Z31D 2B1AH 5EO0B 4D0BB 3DX6A 1MNUH 3LQAL 1VACB 3QDJD 5AZEL 5CP3H 2WWKO 4M7ZB 4PJXB 3CFBA 3O3EB 4K7PX 4AIXA 3DETD 5J3HC 2J8UA 5F9JB 3NCEB 4RISH 5DJ6B 4KKLD 5C3TA 3BJLA 4PJ7E 2R0LL 4NC0B 4KZEL 3SPVB 4GH7B 4S1SH 3SQBA 2CH8A 5LXGH 3RWIA 1SVZA 3K1KC 3HNVH 4OCXH 3HRPA 3Q6FA 1MCRA 3FFDB 3RZCA 4ACPA 3AROA 1WC7B 4LKCA 5IHBA 4FQ1L 4PLNC 3LQZA 1UM6L 4L8BB 1RURH 4IRJD 3PXHA 4PJ8B 5HSFA 4PRPB 5E00B 3QWRD 1J0YA 1QBML 2JB5H 3OTTA 3C60C 1XAUA 3QG6B 3CNKA 4U3CA 4I4WA 4IJ3C 5BMFL 1MCIA 1FN4A 5FGBC 5HHOA 5D1QB 1VGKA 1U0QA 2P5EA 2BJML 1AGBB 4JFOB 2BVUA 2PCPA 4LCWB 1WBYA 3FCTB 4KMTL 4L29A 5BVJB 4FXGB 1I9IL 4HG4K 1DUYB 1MQ8A 3GSXB 1XGUA 2VERN 4C56D 3RKPA 5JUEL 4QHUB 4XPFH 4P57A 4ORGA 5EBWB 3V6OA 3TGXA 1X5AA 3OJ2C 2XZCH 4CJ0A 1T20A 4NJ9L 5T1DL 4UIMB 4OCNC 4OD3H 3MA7B 2HJLB 4WI6A 5LWYH 5JW3H 1U8NA 2EDEA 2VXVL 1B0GB 4I4WB 2X4RA 3PP3K 3V0WL 5MENA 5K9JH 3BXNA 1FVEA 1JHTA 3LN5A 1KCLA 1BZ9A 3LEYH 4WW1A 1OTTC 3QIUD 3PWNA 2JCCA 3BE1H 3FFCE 1T2JA 2VSDA 4TUJA 5BVPH 4QEGA 3BKMH 4WDIB 1CU4H 5GJTH 1JUFA 1QSFE 5H94A 4X7TA 2Z0BA 5DUMH 2W0FA 1BVLA 2J88H 4KTDL 4P9HL 2Z8RA 4OSUH 4YK4C 3IDUA 5GS3A 2D4FA 4HIXH 5GGRA 4X4ZA 1OSZA 4PRNB 3RX5A 4J6RL 4HZAA 1GGTA 1LILA 1T1YB 5KVEH 3FFCD 1N59A 4I2XA 3NCMA 1OLLA 2FO1A 1A7NL 1RUKH 3X3FH 3MLUL 1TTGA 4Y7MA 1MCOH 4X99A 4DAGH 1MY7A 1W72B 4HUWA 3HNTH 3WN5C 2VKWA 2Y7QA 1GZQB 4LPUA 1XGRA 2NXZB 3UEZA 4W4OA 1KUMA 1K5NB 3KHOA 2VDNL 5HYJE 3KJ4C 5HDBE 1W8OA 5F6HI 2KUTA 5TF1L 1KB5A 4WI3A 5ITFA 4KRPB 3SCMD 2Y06L 2FSEA 1R3LA 3OZ9L 1CFNA 4Y19D 1D6VH 3G5ZA 4WO4C 3FQTA 4JFEB 4NRZB 1AJ7H 5D7LD 1MUJA 3CDCA 3QXDB 3EYVA 4P2QE 3KYAA 3LRSA 2BZDA 3F5WA 4I5BB 3QXVA 4MSWA 3I6KB 5ERWA 2R0LH 3BEWA 3DVNA 4KZEH 4P5KB 3ZO0A 4ZUUA 3JWNC 4JHWH 5HYJA 4GKZB 5EZJB 5C0GB 3FZUD 4CVUA 3SE4A 4UTBH 1HH6B 3ARZA 2JIXB 3VFTB 3NACL 1BOGA 3LN4A 4U1HB 4X4XB 1HZHH 1P4IH 2AI0L 3F7QA 1AE6L 5FCUH 2WM0A 1FRGL 1DEDA 2YBRA 5FKPB 4AYFA 4W68A 1UWEL 3QRGL 2XV6B 1Z5LB 4B7IA 2ZCLL 2RBLA 4JR9L 3GMPB 1JGDA 5FYLH 1QLFA 5JW5A 3VFNB 1YN6A 3BAEH 5DD0H 1S9WA 2G5BA 3TEUA 3FTGA 4X9HA 5D7JB 4RCAA 1JYWA 1IAII 4U33A 2FX7H 5SX4I 1KENL 2QQLL 1PX3A 3VFRB 1IGML 2WAHA 2EE3A 3TZVA 2P8LB 4M6ML 3DX7B 1WFNA 5AWNL 3H6JA 3IFOA 3QG7H 2YD8A 3DETC 5J3HD 3FB7B 2XA8H 3KS0H 4GBXD 4YZFF 1B4JH 1CFQB 1WFUA 2D7PA 2YEZA 4QRPA 3LRGA 5L6YL 1D3CA 5JHDA 5DHVH 4UNTA 1A1OA 4RMQA 3RGVA 4F7PA 1TCRB 2K7PA 4OFPA 4NQXA 3HR5B 4MVBD 1TJGL 1CWVA 3U4BH 3G6DH 4H20L 2BY2A 5F3BB 4WJ5B 4ODSL 3E6HA 1FVCA 4NQDB 5EZJA 4MGXA 5C0GA 1JNLH 3T2QA 1Z0MA 1EXUB 3AVEA 4QXTA 4APQD 4G8EB 5I73C 4RFEB 1RVFH 3C9NA 3TVMC 4X6FB 4LEXL 3KNBA 3QUXD 3LRHA 4NCC1 4NO2B 3VWKD 3ECBA 2NY2B 1RIHL 2WP3O 2WUBL 3HCVA 3MJ9H 4FFZL 2V9TA 3QXDA 4NP4L 4M3KB 5FYLD 4OCLC 2R56L 1FORH 4JVUA 1T7WA 1F90L 2A6KA 1INQA 4OIIH 1T7VA 4EXPX 4X6DB 4Y1AE 1A6VH 3GHEL 1IKFH 3D0LA 2CIKA 3DNKA 3C08L 4ZO8A 1NC4A 1WCBB 4MS8C 3V6FB 4PGDB 4KFZC 1A4KA 3NH7H 5SWQB 1FPTL 2Y36H 5FV2A 5C09D 3MLUH 5DJAA 3DRQB 4ZXBC 2ZUYA 2WBJD 5C6PB 1Q0XL 3FONA 1CD8A 2DQIH 4JFPA 2D31A 1DBKL 1RJLA 4Q0XH 4DW2H 3BKCH 3BKJH 4NWTL 3HUJB 5CFHA 4WFHE 3UTPE 3R0NA 3K4ZA 2ZCHL 3TIEA 4QYOB 3K2UL 2EXYC 1AY1L 1ORQB 4A6YB 5DWUL 4U6YA 3C6SB 2D9CA 4J12A 3EO9L 3Q3GB 1KYOJ 4MSWB 3GSRA 1RUPH 1T66D 4WIQA 3AREC 3C5ZC 5DMIH 3VFRA 4RA3A 3WO4B 5JR1L 5T33H 3L5JA 3IDIB 4DGYH 1ZLWK 4LHUA 1NGZB 4GG8A 1K9TA 2DQIL 1O5DT 2X9WA 1JGEB 1OF2A 1JL8A 2C26A 4FQJL 3OGCB 4Z7OE 4I48A 3SCMC 3FMGL 5L9DH 1S7QA 5T1DH 1QFOA 3OAZH 4Z77A 4QT5B 1PQZA 4FTVD 5IVXE 4GO6B 5FO8B 4MLIA 5CD5C 1I8LA 1JPSH 2GFBA 4F9LC 4XHJC 4N0YH 2N4IA 5FYLL 2C7UB 2X1XR 2ED9A 2R2HB 4YGVB 2AJUH 4JDTL 2Q86A 3ULSA 1D5MA 3MCKA 4HH9B 4BQBA 4Z76B 3MRQA 5AG9A 1BQUA 1X5YA 2B7DT 3KXFE 3QI9B 3O11B 2DTSA 5F71A 1XGQB 4JRYE 4OBSA 1GAFH 4JY4A 3ZSSA 1T1ZA 3HPJA 1I9EA 3IGAB 3OAZK 2Y07H 4U2YA 4WO4D 1YY9D 2A9NL 4JDZB 5ERWB 2ED7A 3QA3B 3FOLB 5CILL 1ZK9A 3IRZA 3PIQA 3D2UA 3GHBH 1NJ9A 4LPXA 3IDJB 5GJTL 3SE3C 4QXUL 3SGKA 5ISZE 3HC3L 3PGFL 1QR1B 5F1NB 4I18B 5DZOA 5D93C 1S7UB 4KDWA 5DMKB 5L8LB 4WWKA 2BFVL 1IEAB 4HMEA 2X10A 4PREA 4GSDL 4URTB 3P73B 3T4AB 1KT2A 2COQA 2NY4C 2W65B 1DE4A 3MV7A 3MBED 5GZNC 4HFUL 3QO1B 5E1HB 3ABZA 1LO3H 2R1YA 4HLZG 3R1GH 1CYGA 3VFGH 5FXCH 1WBXA 4A6YA 3QNXA 3P11L 5EOTB 1NC4B 1WCBA 3L3JA 5L8KB 3IDGB 3QULA 3GI9L 4ONFL 3FOMB 3TIEB 3PWPA 3EOAA 2JJWA 4PJAF 3WSQL 3TF7C 1NGWA 1RK1A 3DV6B 5B21A 1RUMH 5SWSE 4AQ1B 1S9XB 4WUKL 8FABA 5L88L 5EO9A 2IPTL 3JWOH 1TZGL 5GIRB 3DX8B 5T1KB 1A6WL 3I6LD 4TULH 2V9RA 4WDIA 3BEVB 4MNGA 4HIIA 2AKRB 1L7TL 1OAXL 3ZHKA 2RR3A 2DKUA 5CSZB 4ZOEA 5J9PB 3MJ7A 2Q3AA 1Q9OA 3AREB 2A1WH 1SEQH 1JWUB 1FH5H 2E9IA 1QSVA 4Q0XL 4YDIH 1RZKC 3SY0A 3QH3B 4DVRL 1SYSA 3PQYE 4N8VA 5CJXA 3T2OA 1I8KB 4WUKH 1U8MB 4UT6H 5D70H 1S5IH 1WAAA 3ARPA 1OAYL 4N0FA 1G6VK 2J7LA 4L5FL 3WXWH 4XPTH 1JGLL 4PJEA 1YC7A 5IVNA 4APQB 1TETH 2GTZB 5JHDD 1AD0B 4HC1H 2NR6C 4I0PD 1JN6B 3MLTA 1TCRA 4F9PC 5HDBF 2AJZA 3F7PC 5F1IA 4WNQA 1ETZB 2QV2A 4PJ7F 5KAQG 2YPLB 3K7UA 3VG9B 3HG1E 2E8ZA 5KG9A 4B50A 3QIBA 1B90A 4BFIA 3HMXL 3VGGA 1M1SA 4YUEH 1U8HA 3KLHC 5C6TL 4OLZL 2BVOA 5DD5H 4QGYA 1DDHA 1WIOA 2JJVA 4HPYL 4NBXB 2ZSWA 1GC1C 3LHPL 4RA0C 2V2WB 3QXTA 1K6QL 5D8JL 5E1AB 2N56A 1FZOA 4BZ1H 4KROC 1PSKH 3CU1A 2FL5A 5EU6E 3MRKB 4JM2C 3DVIA 3K1DA 4WUUB 5IEHA 2GYSA 3QEGL 1H8SA 1NKRA 4MYWB 4KKNA 4YWGL 2ADGA 3ELAT 1MHPH 4DGIL 3ARXA 4OBRA 1ES0B 2AJ3A 4OZGF 4Z78A 2CK0L 1CG9B 1A7QL 4LARL 5TFSH 4I77L 1JNHA 1P7KA 1NFDF 5FUCE 3TBYB 3VGEA 5E6IB 3S34H 5KAQF 2OI9C 1CIDA 4JHZA 4QOKE 4FFVC 3IKCB 2AJSL 2RCSH 6FABL 2EXYD 3QQ9C 3O6ML 1GOGA 4IRSC 2UWEF 1LHZA 1EERB 4LPYA 4JZOB 2O26U 1X5JA 5IHLB 3QUYC 3I6KA 4XXDB 2V5SA 2V2XB 5HHVL 3WFCH 1EMTH 5D7LE 2F54D 5ENWB 2IEPA 5DR5H 5IOPA 1CLOL 3LPFA 4MAYC 4XBEL 4ZSOE 3MV7E 1KIRB 4OFIA 3O2VH 5F7UA 4JFQB 3B83A 3ARDD 2E7MA 3LD8C 4XX1E 1NGXA 1UB6A 2GITB 4ZFGL 3P9MB 1GCFA 4QY8A 4X9BA 1QSED 2EEAA 1AIFB 4XH2A 4ZS7L 3W9DA 5SWSA 3O4LB 5IHUH 3T3MF 2JJSC 5DK0A 5SX4H 2Q8BH 3EYUL 5F9DC 3VMOA 4NC1C 4Z7VA 3QHFH 4EQ3A 4QRRB 1NMCC 3D39E 5AUMB 3CH1A 1L7TH 1OAXH 4UILL 1FLRH 4FQQB 4WY7L 4MB4A 1CICD 4Y4HC 1T83C 5TE7H 1FIGL 4M02A 1OSZB 3QCUL 5IF0B 1GOHA 3S35L 2MSPA 3U4AA 5KOMC 2R1WA 3DV4A 3GMLB 3OF6A 2P5WD 5D71H 3WO4C 2J8OA 3FAWA 4Z7VE 5E8NB 4RX4D 1FO0A 1PY4A 3FAXA 3VXOA 1PYWA 3K74B 1JGVH 5GRWA 1ROWA 3B9AA 3QWOB 4EEEA 1AI1L 5I75B 4K07A 3U46B 2E27L 3STLB 3NCJH 4RDQF 1OP9A 3EFDL 4GFTB 5DTFA 5FYKE 1FGVH 2APBA 3CCHB 3FB6A 5TDOA 4OI7A 1VGEH 1IQWH 1LEIA 5CZXC 5BVJA 5EU4B 4LEOB 4WWKD 4GRMB 2YXFA 4PJXF 1TJGH 3U4BL 1CXLA 3EGSA 4PRIB 2GAZA 3RWIB 4KI5E 5IP4A 5D9SB 3SGKC 3HC0A 1JJUA 2HMID 1FG2B 4XMKH 3CVIH 2P8PB 4HWZA 1FV1B 3EO0B 2YRZA 5B38B 3O3DB 4M7JH 1QACA 1T1WB 4OZHA 2F5AL 3ULVC 4EDXA 3GK8L 2E6PA 4RRPA 4M7LH 5CGYC 3HFMH 3IJSA 4HF5L 5C71A 2P24B 1MCWW 1RZ7H 1S78C 4HV8A 4QNPF 3S97C 3S98A 2E7BA 4XWOC 8FABB 2OMBA 5ESQB 4LNRA 1FNHA 5FHAL 2X4UA 4ZPTB 1ZHBA 3L3HB 2OL3H 1LK3L 2A6JB 5EO1B 4XAKD 2HFFA 3M45A 3QNXB 5EOTA 4TVPL 1I9RH 5HI3D 1QSFA 1F4HA 3RVVC 1OGTA 3MLYL 4F58H 1N0XL 2NLJA 2DLGA 1FSKB 5DA0B 4IRZL 4C4KT 4PJHB 3HE7A 4QRSB 3INUH 1OARH 2VDML 3HTLX 1H3WM 5CZVL 2FX9L 3I75A 3TZVC 1M6OA 1K4DB 4NPYA 3IAPA 5L2KB 4LVHB 5DHYA 1KYOK 2CLZB 3BT2L 4ZAKB 2P7TA 4ESKA 3BAEL 4NYLA 2DN7A 2BVQB 4R26L 4R3SA 5FUZH 4GAYA 1IGJA 1DDHB 3VGFA 1UG9A 3VFVB 3S88H 3DGCR 3ZKMD 2JB6B 3CLFH 4FQXA 4I9WE 1U8HB 3MMEB 2PKDA 2R4SH 4O5LL 1YNLH 3DBXA 5IMLB 5EBMA 1Z9LA 3LQAC 3RVWD 1W0WB 4TULL 2ED8A 1G7JA 4M7LT 1T83A 2AEQH 3QT2A 3LN9A 4LBEA 4ZS7H 5MI0C 3O4OC 1CVRA 4NO0D 3P3YA 3V8OA 4S1DC 3CFDA 5F1SA 5I1JL 2E6JA 3BUYA 4PP2B 3PWJA 3MUJA 2D0GA 1EZVY 4S1QH 4DK3A 4UV7L 4LPTA 3RY6A 5D1XC 3DRTA 4EI5A 4MD5B 3O3UN 4Z78B 4RZCB 1CGSH 2H32A 5D7IB 5HHXL 3O0RL 4XAWH 4F9PA 5JNYA 1SJXA 2NX5B 3NGBB 4MAYD 1FO0H 2GJ6E 5I76A 1HQ4B 4OAWB 1INEH 4U6TA 2WMPA 4OB5L 4CRPA 5DMYA 5HHME 3HRZB 5F3HA 2HT4D 5GGTA 5I8CA 5EZLB 2E7CA 1OVZA 3QQ9D 4PFEA 1JYNA 5FV1L 2R4RL 5DD6B 3MGTA 4XBGA 3H9ZA 5C6TH 3PDOB 4OGYL 2WINB 5K9QG 1NFIA 2LTQB 3CSYB 5L0QC 4MNQB 1EO8H 2X9XA 1E4WL 5LBSH 1DQDH 1G1YA 3QNYA 4TNWK 1PDKA 4PG9B 2VABB 3IF1A 4JPWL 1VENA 3OKDB 2VLMD 1MCOL 4C54A 4G8GB 4FQIH 1OB1B 1LEGB 4Q6IB 4YUEL 1GGBL 4ZOCA 4H88L 5IJVA 3UTTA 4QYOA 4OLZH 5GRZA 2KBGA 3MXVL 4LP4A 3BESR 3O8XD 2AEPH 5T5NF 5BO1H 4LVNB 3E2HB 3CFKB 3L3GA 3NA9H 4HKXA 1UACH 4X8XA 3PWLB 1CXHA 4FQLH 35C8H 5LCVH 3UJIL 5KSAB 1CE1L 1QBAA 3RHWF 1GPOL 4K7PH 2I07A 3BZEB 4Y2DD 1IAOB 1RSFA 2XKSA 1IGTB 4MMZC 2BC4B 3P77A 5F7DA 1WV7T 1YQVH 3RL1A 4FP8L 5K9QI 1ZSDA 4NZDA 2YKLL 4JZNB 1OTSD 3TO4A 3TBVA 3IDNA 4Q9RL 4F7TB 4TOYH 3SO3B 4U2ZA 5H37H 2DLFL 4NNPH 1Q72H 1N8ZB 4PG2C 1U6AL 4PJHA 1X9QA 3QEQE 1JIBA 4PRHD 3G6JF 4WWKB 5E2JA 1BWMA 4O9HH 3PNWB 3RVTC 2XZAH 1KJ2L 4WU5A 1FYTE 2NXZD 4H8WC 4B0MM 1TVHB 1BJMA 4ONHA 3OKKA 4KGJA 3H9YA 4OV5B 1AD9A 3UBXG 4YHIB 2CDGB 4OQTH 2I5YH 2VLKA 4AH2A 4M7KH 3TBWB 3QR2A 4YNYB 5CP7B 2VQUA 4JDZA 1R3KA 3JV6B 4DVRH 3QDJE 4CMHC 4F8QA 3V8CA 4ELMF 4Y1AA 3RIAK 4G7YH 5CJQL 2NY3B 5HGHA 3EYFA 3EOBB 1XIWD 4APQA 5DEFB 3CLEH 3CC5B 3QUYB 1LP9B 2VLME 4O9HL 1XGPB 2EDHA 3GMOA 4JFHE 1ZLWH 1NBVL 3VD5A 5J89A 3T2NL 4JANB 3ULVD 4UDTA 3N06B 5IKCB 3MFGB 5MP6L 4PJ9D 1G7LB 5HHOE 5KSAC 5HYIA 3BZ4A 4FZEH 3QIUB 4DN4H 1SM3L 4E41B 3WFBH 3UXFA 1DN0B 4QNPE 4U1NB 2PW2B 2HFEB 4PLKD 4KQ3H 4OUUA 3DXAA 4J3VA 1PLGL 5K93A 4HS6A 4I3SL 3GO1H 4W6WB 5E7FA 1HXYB 2F53A 3BMWA 5I8EB 2M26A 4JQIL 2IQAB 2ICWB 5D6DC 3NCBB 2A6DA 5T3XL 4P99A 2BFVH 4JFXA 4P2RA 2EZ0D 3Q48A 3CDYA 5IV2A 4HSQA 1CLZL 2CDEB 3DSFL 2J4WH 2IGFH 3GJFB 3TYGH 3VXNA 2OTPA 3CH8A 1ZLVH 3KPOA 3WV0A 4E0RB 3EO0A 3VH8G 1I8IB 4RAUB 1E4WH 2VDPH 1MHPL 5FO8A 5IBTH 1RZ7L 4XCNA 5L2KD 4K3DH 1I9IH 4PGEB 2EDBA 3SQOL 3VFUB 5E2UH 1CLYL 1ZLUH 4MDIB 3C5SA 1IAKA 3P4MA 4ONOA 1EK3A 1NUNB 3LKOB 3RVWC 4TVPE 1ZVSA 3MROB 1MREH 4G8IB 4YX2L 3HA0A 3RDTC 3TYFB 1Q9OB 4LHUB 3MLSL 2YD2A 2QSVA 4ZYKA 4KJQD 1B0GA 1HYRC 3F65A 2GSIA 2MCPH 4YQXL 1IC5L 2IPKA 3HFML 1X4YA 1QO3B 3UP1A 5I66A 3PIQB 5IB3B 5HGBA 3HI1B 1QSZA 2VWEC 4Y8DC 1U8QA 3AMLA 4S2SA 5HPMA 4WTZA 3QHZL 1TQBB 3KPRD 1Q9KB 5D5MF 1SEQL 1UA6H 5H2BA 4S1DD 2VIRB 1YEGL 5KANI 5FKAA 5L8JB 1A02N 1CTOA 5T1LB 4HZLA 4Z76A 2VSCA 3EHBD 5K9KB 3TPUB 5EUKA 2NR6D 1X4XA 2F54E 5KS9B 1F45A 2IJ0C 4Q74A 5DK2B 1QRNE 1V7MH 3GSOB 3EZ8A 2EDDA 1QTYT 2UY7A 1BREA 4HS3A 1D5ZA 1DQQB 4K71C 4JB9L 1JPSL 2A77H 1WCQA 1S7WA 3GRWL 4HS6B 3PWPE 3ZE2F 5C9JA 4R7NA 1NC2B 4JY6A 5C07A 4N1CA 5D7KE 3O2WL 4NGHH 4ZDHB 2VLKE 1UCBH 2EDTA 3P9MA 3WFZA 1UA6L 4KMQA 4L8CB 4BKLB 4DN3L 5TQ2L 2IPUK 4OI9A 4RGOL 1DBAL 1BD2E 2EIBA 4NKIH 2ARJA 3VWJA 1KJMB 3UC0L 4L3AA 1YN6B 1CR9H 1RZJL 3LKPB 3LPWA 3L95A 1I1AA 1WK0A 4HXBL 1T3FB 3ZKSD 1RPQA 3ROOA 1YY8A 1N6UA 1J8HE 5GS1C 3JBG7 5I1CH 2HVKB 1I8LC 1FJ1B 1WLHA 1CVSC 5C2UB 2X89A 2C4XA 1RIUH 1FLTX 1JNHB 1P7KB 3BJ91 4PV8B 2H2SC 4JZJC 4YHNA 1BD2A 2ZOKA 2H9GB 5IVXA 3DYPA 4MXVF 2D7QA 4F7CA 1NANI 3SDYH 4YHIA 4JO4H 5CHNA 3OKKB 1VEMA 5DEGA 5LGKA 4QHKI 3LEVL 3VXUE 3S34L 5E8PA 5INDB 1T04B 1IQDA 4JRXE 3BGFB 1GL4B 4JEGB 4R2GB 1T03L 4YHKL 3BN9C 4KJWC 5LAXB 5L88H 2VLLA 4MA3A 2OTWB 4JO3L 3FTGB 5IKCA 3ALPA 2J4WL 4J3UA 2IGFL 5C0BE 5A16B 1WTGT 4PJBB 2ZKHH 1EIBA 4XPAH 3QIBB 1RMFL 4LCUA 4JGUA 2RAMA 3H42L 2W1NA 2C1PA 3RU8H 4TVPH 4TRPH 2YA1A 1CLYH 1SJHA 4X6CF 3E8UH 1A1MB 5I30L 2X42A 4UB0L 3L9RB 1L0XA 3TA3C 4P4KC 1AD0A 2F74B 5HDOA 5C0BA 1XIWC 1GH7A 5L6YH 1G6RA 4NQUA 5EU6A 2CR6A 1ODAA 1OAKL 2EZ0C 4F57H 5CJBA 4JO3H 3MJGX 3WJLA 4FA8A 4X80L 4BUGA 3BRDA 4NJAL 3SE4C 5B3JF 1G7QA 4G8GA 1XR9A 4B7LA 4XPTL 2CRYA 1R3HB 2ZUQC 3IFPB 5ELIA 2DQTL 4D9QE 4YPGA 1NCDH 4P59L 5I1DA 1A6TA 1ZGLM 4IMKC 3U1SL 4WHTB 4X7CC 1F3RB 1JP5A 3UPRA 5EA0L 3VWJC 2VC2H 4RBPK 3CFKA 1M4KA 2DQFA 3L3GB 3QDJA 1N3NA 5JUEH 3AY4C 2GKIA 1XGYL 3IDMB 4C83A 5CKAA 4YHZL 1F8TL 1W72L 5C07B 3VG9C 5IGXH 3GJEB 2D7NA 3S36L 5E08L 5A3IC 1QEWB 1HH9A 5E9DB 3EDDA 2YC1B 5MEOA 4PJBF 1JRHL 1W72A 5I76B 4HDIB 3MV8E 3L3DB 1LO4H 3AGVA 2ESVE 4FZEL 4DN4L 1I7UA 4NQDA 3MRCA 5AZ2L 4JB9H 4Z7WE 4OUOA 1KTLA 1S7VA 3UJJH 3CPLB 5FHBH 3UO1L 3ZSTA 1P4LA 4XP5L 5T1KD 2E6QA 3ZL4L 3PHQA 2AJXH 3DVGA 3E1F1 4OKVA 2CKBA 1T89A 3F62A 3H9SB 2BHYA 3VFTA 1AGDA 5DFTA 3T0EB 4L9LB 4YFDB 1N6QH 5MEQB 4NN5B 4GG6E 1RZ8B 3HI1A 1W0WA 4MVBC 3MCLH 3T0BA 4AM0B 4P0DA 4WO4A 4GXVL 4QHNA 1QO3A 1G9MC 1G0DA 2IANE 4RQQA 2CMRL 2VLLB 4MA3B 3LMJH 4EI5B 2CK0H 1WITA 3QXAA 4ZFFB 4PS4L 4RAVA 5C09B 4L3EA 5KSBA 1P6AB 2CGRH 3HE6D 1LO5B 1U3HB 1LK3H 4FFYL 1N6VA 4POZD 4PRBA 4TPRH 4ISVB 4LHQB 1YEHH 3KDMB 3N1MC 2KH2B 5C1MB 2DDQH 3NA4A 5TGBA 3OPZL 4EN3A 2BOBA 3BMVA 1LNUB 2EH7L 3BPLC 5B22A 1DBJH 1U58A 4RMTA 4UQ3A 1T20B 2WBKA 2MOVA 5FEBA 1D5ZB 4XVJL 1M05A 2V5YA 4X9GA 4JY4B 2NXYB 3DIFB 1CLZH 3BWAB 1RUKL 3X3FL 5IW3A 3KHQA 1DFBH 2YKLH 4BUHA 4KKAD 4NDMB 2FEEL 4PUBH 3IB4A 5GSRB 4JFZL 4PY8J 5C70A 1OLZA 1U8PB 1H3UA 2V17L 5T1MB 4MQXD 2DLFH 1T0NA 4L4TE 4XHQA 1G7MB 4LSTH 3QEQA 3SDDD 1XCTB 1QYGH 2ZKHL 2AJUL 4JDTH 4R0LB 2HH0H 1AD9B 4X7TB 1GVIA 1R5IB 1KIPB 1A9BA 2CDFA 5T3ZE 4PGDA 1MWAB 3G5YB 2CLZA 3NACH 3FO1A 5C07D 4WFHD 3KLAA 3SCMA 2CLVA 4RIRB 1NC2A 4JY6B 1I1YB 1UM4L 2Y5TB 3N1FC 4P2OC 5C0NC 2NW2A 5DJXA 4F8TA 1S7SA 4LRNL 3CU7A 4Z0XB 3MNVB 4JR9H 4Y2OA 5EU3B 4FZ8L 2BERA 2CRIA 4ZPVB 4NHUB 3HAEH 3T65B 4AG4H 5BZWB 4F37K 3T0EA 4LMQE 1ZHNA 1C5DB 1IGIH 2MKWA 1A6WH 1FRGH 1TNMA 1J12A 2PYFB 3VE0A 3CFBB 2W9DH 3O3EA 1RZFL 2AGJL 2L0DA 3LIZH 2A77L 4AEFA 1AQDB 4NKIL 3OB0K 2PTTB 4Y4FA 5JOFB 2NY6C 4HUUB 3CPLA 1IT9L 4NQEB 1A7PH 2NXYD 4RSVA 3SE8L 2YD7A 1UZ8A 2XTJE 3Q1SL 3HC4H 3IJSB 1DQJA 4PLJC 4M48H 4P4KD 5TDPA 2BSRB 1X5FA 3D39A 4P3CL 3DRQA 5JIKA 2ZP0T 3RTQD 1K8IA 1EUTA 2VAAA 1DBAH 5GGUB 1HKFA 1LO5A 1HH9B 2BOCA 1F13A 3MLXH 3STLA 2X7LA 4NSKA 3RNKB 2IBGA 1BVZA 3H0TB 5ID1B 3ARFA 1HOCA 3GM0A 4M6AA 3F58H 3SKMA 4GKNA 3MRRA 2YZ8A 3O9WA 5FHBL 3UO1H 5C86A 4JZJA 4Y5VA 3KYMB 5JW4R 4ZS6C 3ARGC 3AS1A 4AIZA 1WBZA 1AKJB 4IDJL 2CO7B 4HXBH 4OZIB 3E2HC 1G7QB 4JG0L 2CSPA 2G60H 3OG4B 3Q1SH 4M1CD 2QKIB 3WFHA 5JQ6H 5FM4A 2A1WL 5SWZD 5GRXG 1MAKA 1DL7L 1FE8L 2OS7A 3EJZC 4N5UA 5TJWK 1NGXB 2GITA 2W92A 5BQ7B 3ULVL 4G43B 1CBVL 1XGUB 4WFED 2B5IC 5HI3C 1AXTH 1E4KC 3MNVA 3KS0J 1PKOA 1H15A 5F7YC 1MFBH 5I8EA 4UQ2A 4KDVA 1K85A 2XKNA 1MHEB 2OSLA 4LSUH 5ACZA 5MENE 3HZVA 4NUGL 2VDNH 4KV5F 4Y19A 4Z7UE 1SJEA 3RVUC 3EDKA 5EB9A 2O93L 3DBXB 3RP1A 1CGTA 2X4QB 4R8WH 3EYOB 3NOIA 4OFDA 1KNOB 1NCCL 5JXAH 3SDXE 3VWKA 5ANME 3ILQD 3D3VA 5LQBH 1QUNA 4M7ZC 5EZIL 1GHFH 3VRJA 1EJOH 2UYLB 5DJZA 3U0WL 2EDQA 2BSTA 1MQKL 3BIKB 2W60A 1Z9MA 3ZT5A 4QTHA 3ZDYE 2JF1A 1RMFH 1N26A 1IVLA 4KQ4L 1YNTB 5GSRA 2WSKA 4POZC 2BRRH 4QY8B 4YR6A 3O6KL 1NPUA 1PJ9A 2Z91A 5I1AA 2WBJA 5JIPA 3EYFB 5JR1H 3E3QE 3I2CH 4P5MA 1AY1H 2EYSB 1QQDB 1FDLL 3MNZB 3NCFB 4LFHG 4U1HA 1UWEH 3QRGH 2HVJB 3AC0A 1ZWIB 4BFIB 5I1LA 3ULVF 4XP6L 5D6CA 2I60L 2WLYA 4KKLC 4G9FD 3BGMA 5I15H 5GHWL 1NMAL 2JIXD 1KCUL 4ZUUB 3UTTB 1R24A 2W60B 4DGYL 4NFBA 1CL7H 1YEEH 4DTGH 4PGBA 2W0FB 1EUUA 5ALBL 2V2TA 4BSWA 2BVOB 1E27A 2HYMA 4X98B 1PY9A 3KPLA 5FOJA 4K8RH 4N0YL 3RHWK 5DHVB 3VD9A 1N7MH 5DC4B 1MCBA 5HY9A 5E5MA 2D7MA 5HI5D 1R24B 2C3VB 3LEXB 4R2GD 4L3ED 1EGJL 3MLRH 5F3HB 4LGRB 1M7XA 4OZIE 4NKMB 2DJUA 1MIMH 4UINL 5CUSH 3TT1H 4IM8A 1EO5A 2DYPB 4IIQC 2Q87A 4HK0A 4PJGA 4LSVH 3RGHA 1RVFL 3MJ6A 2BVPB 1YMMB 1JV5B 4WCYH 2AJXL 4EI6B 3B9KC 4M5YH 1N59B 2X70A 5LGHL 1JNLL 1RIHH 2WUBH 4P57B 5DD3H 4NZTH 1YEIH 4CVWA 2XN9E 5IBUG 3MLSH 4L4VD 1NGPL 3BUYB 4PP2A 3I85A 2HTKC 3L5XH 3QHFL 4AENA 1I9JH 4D3CH 5CGMA 1B0RB 2VZSA 2HLAA 5J13C 1WBYB 3FCTA 1C5CL 5C08D 2P5WE 1RIVL 4NP4H 4NQEE 4KHTH 3CDGA 4KXZH 4RMWA 2NCMA 4G6FD 3WHXB 5E4EC 1MCCA 2D03H 4YXLL 2EE6A 1EHLH 4M8QB 3BP7A 3W82A 4X9FA 3B8SA 3K46A 3Q2CA 4UAOB 4KUCF 4ODWA 5GGQL 3TYFA 4K8RD 3B3IB 3PGCB 3CH1B 1JNJA 5TE6H 2VDKH 1JGUL 5J56B 1BIHA 1YPZE 3GSQB 2E7LC 2FGWH 3P73A 3RUGB 1KEMH 1MEXL 4NQEA 1VKXA 2DWDA 5BOPA 1J1XL 3CUPB 1T2QL 2CQVA 3MUGA 4NUGH 3NCJL 4X7SH 3BW9A 5IMOB 3V6BR 4AMKL 1OGTB 2OR8A 1P5UA 1MH5A 1T6VN 1NANH 4PGCB 5DSCB 4JN2B 2BOCB 3F7RA 3ARFC 2P43B 2PN5A 4KHXH 5JXAL 4NHUA 3T65A 3MOQA 4JFZH 1CT8A 3L7EA 5DURB 5BXFB 3PJSA 2MHAB 4G9DB 5KANG 4PJIF 1ZHBB 1EJOL 1QNZH 2QADC 1ND0B 1IAIL 4R4BB 2GJ6D 2QQLH 4Y5VB 4FG6C 1FP5A 4NJ9H 3V5KA 3OAUH 3L3IA 3NGBC 3P40A 1H5BC 1OAYH 4TNVF 5LGJB 4M6MH 3SDAC 1FFOB 3DO3A 1RHHA 5E94B 1HHJA 1G7IA 4W6XB 1P53A 1MLCB 3LIZL 1T22A 5I1CL 2EEBA 1XEDA 5HYSA 3NFPB 3ZE2E 1ZA6A 2NY0D 3TFKC 1KPRB 2H8PA 3H3PL 3OG6B 3HC0B 1YPZF 3KYOB 4QRUB 3NIDF 3GBMH 3QDGB 2HRPH 3FRPA 3RZCC 3LKQB 5T1MA 4CADB 1V5JA 2GUOB 5ISZD 5KSVA 3A6CH 1C8PA 3UTSE 3RIAF 5J06A 5D1ZB 3RKDD 1ZHNB 5I1EL 4DAGL 3C09B 5ICYB 4GG6A 3STZA 4ZFFA 3T0WA 1P7QB 5T3XD 3RX8A 1WFTA 4Z0BL 3MA9H 2X4UB 3IS0X 1QVOA 1F97A 1LMKA 5I0ZA 4GUPA 2QR0A 3FHAA 1JF1B 1QA9A 2HG5A 2EDOA 4PJIB 1ZHKA 5IWLA 1T1ZB 3F58L 2AQ3A 3H3PH 3QDMB 4U6YB 3OWEA 4JAMA 5E99L 4GG6B 4BKLA 5EWIH 1X5LA 2CR3A 4MD0B 3MACH 5TDNB 1FFPA 3DV4B 3GB7A 3LB6C 1A3LL 4P3DA 1LO2H 1JI1A 3HC3H 4NC2B 4NT6A 1LO0L 4CADA 3PWVA 3GUTA 1A22B 3QDME 2OZ4L 4R6UA 1M05B 3OV6A 4IRJB 2WBJB 3MQIA 3UAJC 5DYOA 5F9WB 2ESVB 2VXQL 2DWDB 4L1DA 3G08B 1Y0LA 3WLBB 1UEYA 4MJID 5F7HA 2FJFA 1G9NH 4E41D 5FO7B 2VOTA 1MLCA 4U4BA 3V52H 3T0DA 3P11H 1S9YB 1BVKB 3BP4B 4UB0H 3UTSB 3DUUB 4CU8A 3WNNA 5C7XH 1RZIA 1VFAA 4GW1A 3TPKA 1TXKA 1IC7L 1I4FB 2SEBB 3NAAL 1A5FH 1UB5B 2BC4A 3P77B 5F7DB 2V17H 3DYMA 3QWOA 3JXAA 1S78D 4DCQA 5ALCH 5HYQA 3CVHL 5BO1L 3VWKB 5FCSH 3VWJD 5DLML 2ERJB 5ANMA 5KVFL 1LNUA 5EBLB 2IFFH 5CEZD 1UCTA 1X3DA 3VJ6B 3D1MC 4KQ4H 4WTXA 3C9NB 3ULUH 3U0PA 3FHQA 4NO3A 3HZVB 2GQHA 5FGCE 4TYUA 2GK2A 4F15B 4YBQD 3UBXB 3V7AG 2PYEB 1LE5A 3UTZB 4H26B 4HEME 1P4LB 2IWGA 4MCYA 4DGVH 3ILPB 1SMOA 1LK2A 5IHUL 4NWUH 4F7MA 3EOAB 3BVNB 5F70A 2N1KA 3SJVE 3QAZC 1S9KC 5MEOB 1CGXA 3W0WD 3QJHA 1NL0L 4L5FH 3WXWL 5IEHB 2CJUL 1EZVX 1GRWA 4YDLB 5C0BB 4Q7DA 3MCLL 4ALAH 3REVB 1ZANL 2VB5A 3J7HA 1TFHA 5J4MA 5CSBA 1U8IB 2A74A 1I7RB 2NYYC 4Y2DB 4JRXB 5K9OB 3GBNH 3ZHDA 3TBSA 3X13B 2ATKA 3EYSH 3Q6GH 2X70B 4PJDB 5BZDA 1IKNC 2XOTA 2GTWA 3FOLA 2VQ1A 2VN7A 1NCUA 3ZE1F 3GMRA 4RFNB 1PG7W 4KI1A 2W38A 5EG6C 2DYPA 4K8RL 2P5WB 4TVPD 3BN9D 1FC2D 1OD7A 4BSJA 4MHHG 4LLMB 5ITBH 3T0XA 3UTSA 4DKFH 3EJYD 3R1GL 3VFGL 4HH9A 3WFBL 1JWSB 2HT4C 4I18C 3NPSC 4TUOB 5SWZE 4TSAH 2FATL 2VE6A 3GZKA 3MV8A 5CHNB 3CZFA 5KTEH 4O51A 2ITCB 5CEYB 5JPMB 1J1OH 1J8HA 1K8DA 5GQBA 1J8KA 3KXFD 3PWUB 2DI8A 3OJDA 4U6VL 2VMFA 1KELL 4M1GH 3MRHB 2C5DC 1NGPH 3FQXA 4RIRA 4P2YA 2RFXB 3DUSB 3OGCA 5ICXA 4M7LL 5LGHH 3O4LD 5SX5K 3HN3A 3MLZL 3N9GH 1MCQA 1MJUL 2VLKB 2AJSH 3F6LA 1QLFB 3FT3A 4F3FA 2O61A 1SBSL 3MLYH 4X7EC 5E6YA 4EBQH 1GZQA 3K2UH 2ZZUT 1FZKA 2VITA 3N85H 3T2PA 3VXUA 4I13B 2QSCL 4LASH 1MWAH 1GHFL 3VI4E 4J4PD 5C08B 2D03L 3G5ZB 4DZBB 4L8CA 3PP3H 2APVA 4JO2L 2BVTA 1BVKA 4AIOA 1JK8B 5DZNA 5H37G 1JWMA 3G6AA 4NPYB 4UOJA 5DI8B 2XZQL 3QJHB 4LSSL 1V3KA 1XCQA 5C0CE 1A9EB 4O02H 3F7YB 4PY7B 4PJFB 4UQ3B 1P2CA 3OAUL 2AV7A 4ODVL 3PHOA 4JHAH 1E28B 1MJ8H 4KVNL 4OCWH 3VFSA 1U95A 1J1XH 1ZA6B 1JUFB 5CBAA 4ODXB 4PBXA 4RGNB 3QQ3A 2EYTB 4OLXL 1KTKE 3CK0H 1XF3B 2GSIB 4XNXL 1GAFL 4JPVL 4IRSA 4P23B 5J1TC 2H1PL 4HKXB 1CQKA 15C8H 2NTFB 4HFWB 1QG3A 1HSBB 4L3EB 3MJ7B 2EIZA 5KSBB 1MLBA 3QSKB 2BMKA 1QSEB 3MRNB