2VLMD

The structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
184
Chain Sequence
QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVKDSDVYITDSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Dynamics and Energetics of an Immunodominant T-Cell Receptor are Programmed by its Vbeta Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords JM22 TCR ALPHA CHAIN
total genus 33
structure length 184
sequence length 199
ec nomenclature
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vlmD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vlmD02
3RGHA 1F4WH 2BSED 3RGVD 3UTSE 5K59E 1CZ8H 1IAII 2BSSA 4DTGL 4ZO8A 4HEME 3RWCB 2ZJSH 1BJ8A 3CXHK 3WDJA 4WFGD 1INEH 3MRNA 2OJZH 3VE0B 4PLKD 1JTTA 3RGVA 2IPUG 4JRYD 5EO1B 1XF1A 1E27B 4EUPG 1WAAE 1ZK9A 2DQCH 3D85D 2Q6WA 1EK3A 4EQ3A 4XXDB 3TBSB 4FQXB 3QIBB 1KFAL 5H35B 5CD5D 5TH2A 3CX5K 1JIBA 2PTUA 4TVPD 2LE9A 2WUBL 3TNNB 4IMKA 3OPZL 5TDOA 1OQXA 4XBPB 2EEDA 1KJ2L 4JRXD 4QXUH 5IG7B 1LILA 3MNWB 3D87B 1AGCA 4HWEH 1U3HA 1AXIB 2BCKA 4JY4B 3T0ED 3ZO0A 5CSZA 3VXMA 5BRZA 3SE4A 3MRFB 2D7TL 3FN0H 1U3HD 1MOEA 5IMKB 1NAMH 5JXAL 5DHXB 2P8PB 4ODBD 2ZPKH 1N6UA 1KN4H 2NR6C 3NA9H 2COQA 4NNPH 1FYTE 2G75A 2LABA 4NFBA 3RBSA 5FUZH 1RPQA 1DLHB 4PGCA 5FM5M 4Z8FH 3G9AB 4P23C 4F3FA 4L3AA 3RBGA 4LFHG 3QPQC 2DBLH 3MCKB 1FYTA 4FZEH 4PP1C 3LEVH 4G43A 2IAMA 4KZEL 5ESVB 3X3GL 4LKCA 4ONOA 1F11B 2P4AB 2MQ0A 4F7CB 3RL2B 5HDLA 1MCEA 2GJ6A 3ABZA 3BKYH 5F7FA 4ZAKC 1DUZA 1JMZA 3MV7E 1UB5B 2G60L 4NQCE 5K59F 1GC1L 1H5BC 5I1AB 2R8SL 3GMRA 1CF8H 4ODVL 1AGDA 3UJJL 3QCVH 1XIWC 2J6EH 3GSQA 3UJTH 3REVA 1W72B 5E9DB 1DSFH 4PJ5A 5JPMB 4ORGB 4DEPC 1F8TH 3D39D 3KJ4C 3WL9A 4M7KH 1AJ7L 4Z0BL 3N1FC 2ZNWA 1UVQB 2R0WH 1ZLVH 5FECB 4Q9BA 4YHKL 4CBPA 2BNRE 2K3TA 4K23H 2QQKL 1OAZL 3S35X 3AS2A 1M71B 1UZ8B 3MX0A 5GISL 3KLHC 1FFPB 4XB8A 1UZ6E 2A77L 3KDMB 2OR7A 5HY9A 4NDMB 4U2YA 3AGVA 4G8GE 3K4AA 1MFNA 2FCBA 2VLRB 3V4UH 3WFBH 2X1XR 1R3HA 4NQUA 2W9DH 1KB5H 4YO0B 3U4EA 3QQ4A 4R4FL 1X5FA 1DQDH 5C08D 4PGBA 3RDTA 1T04B 1TETH 1ZS8B 4ZFZA 2QQNH 3L7EB 2GJZA 3IS0X 1DEEA 4IRSB 1ULVA 4PGEA 1G7JA 4KXZH 2YHGA 4JJHA 4XPTL 4QHLB 4JFDA 4G42B 5DA4A 3P0GB 4HBQA 3LQMA 4MCYA 3RWJB 5LAXB 2V2XB 3T3ME 1OF2A 3QIUA 3VE0A 2IQ9L 4X6CE 1LO4H 1OAXH 2XG4A 4L5FL 1KPRB 4LSVH 2C3WA 4P59H 3H9YA 2R9HD 2C7UB 4O2EA 3N1PC 1TJHH 4YWGL 1U8IB 4XAWH 3VJ6B 2CJUL 4NT6B 2IH1A 2R23B 3QI9B 5DMIL 5KW9H 3KWWB 5DEZA 1G6VK 4POYA 2APWA 1ZVYA 2F53B 4QO1A 3MLYH 5TDOB 3B5GA 3GB7A 3OB0H 2R56H 1VERA 1A6AB 2V7NB 2XPGA 5IMOB 3BFOA 4KKNA 1IBGH 4OZFG 3LHPH 4Y19A 1TQCB 4DQOH 2WAHA 4X98B 4G6AC 1H0DA 2G5BB 3GJFA 3FOLA 1AH1A 4I5BA 2NY0B 3SHSA 3QUYB 2NX5E 4MQSB 4XZUB 1LD9A 2DJUA 5JA8B 1KEMH 3MJ9A 2J5LC 3K8MA 4K7PH 4KGLA 5DMGC 1A47A 5HYJB 3SDAD 3G6AB 1P7QA 4MQ7B 5C8JB 4PRAB 5CEZH 5CEYA 3MA9H 3ROOB 1LEGB 2JCCA 3RJQB 3TN0A 5IVOA 1YMMD 4GAJH 3C6LA 4NWTH 3BOVA 3DGGB 1U3HC 4LASL 32C2B 3MRDA 1I1AC 3H9HA 1C5CL 1QFHA 1E28B 1F11A 1CGSL 3OGCA 3H0TA 4HXBH 4O2FB 3QT2A 2FR4A 3MV9A 1ONQA 3WNKA 4XBEH 1BZ7A 1N6VA 4TQEL 4KMTH 1W0VA 3JWOC 4LCUB 1P9MA 5GRZA 4P57B 4QLRA 1G7LB 3NA4A 3S3PA 4KDTC 2B5IB 1YUHA 4OM1L 3ARGC 4PGJA 1T20B 3EO0B 1AO7D 5C0CD 1UM4H 4P2QB 1MJ7L 4LDEB 2OZ4L 1N8ZB 2C3GA 5LBSH 4K9EC 2FH8A 3N1GC 1S7WB 5JDSB 1A6UH 3G6DL 4RIRB 3DRQB 2XZCH 1SBSL 1HKFA 1KELL 4OSUH 1OGTB 1JPGA 3RWDB 2EDTA 3C2SA 3WLWC 3TLRA 3DWTA 2V9RA 3VWKB 4M7JH 3QNYB 3CUPB 1W72L 5A2IH 1IM9A 3AY4C 1HH6B 1UZ8A 4KHTL 5DDHB 1GC1C 5IV2B 5TF0A 2NY5H 4G8EA 4JR9H 3V6ZA 4MYWB 1IGJA 5DD5L 3O8XB 4NDMA 3IDUA 2DQEH 3C5JB 1FL5B 2EO1A 3U46A 4RDQG 2DICA 1HHHA 1LDSA 1RVFH 1QFWM 3IYLW 1T04A 3U83A 4U1MA 2EKSB 1BAFL 1L0YA 3GBLA 2DB8A 4LARL 3CC5B 1D6EA 4P3CH 5IFHL 1UCBL 3RVWD 5DD3H 1AXSA 5B38A 3FRPA 2EDJA 2FJFB 3GJFK 1YEEH 2X4SB 4S2SB 2RB8A 1U93A 3LKOA 3VH8B 4UQ3B 1XR8B 3PGCA 4NNXB 3JBG7 2X7LB 4JO3L 4WUUB 3WIFA 3GSNL 4HK0B 5DTFA 4N1HB 2VSCA 2D2OA 2QSQA 2FEDD 1UXSA 2WANA 1NQBA 1XR9A 5HHPB 1CGVA 5FYJH 3VXRA 4LSSH 3NCJH 5CJOL 4LDLB 1INQA 3UTTE 4EKXA 3QIUD 5F88A 2W60A 4BQ9A 1MPAL 1XGTB 2P5EA 3VXRE 4K3GA 4EVNB 5GS1B 1H15B 4IRJA 1HZHL 2XIDA 5HYSA 2VABA 3Q3GA 2W9DL 4HJGA 4ZOEA 3CLFH 3V0VB 2Y36L 1MHCB 1EEYA 3ARGB 4NC0B 4QHNA 3I9GH 2H41A 4ODUB 1P7KA 2J8HA 3SO5A 4P4RA 4MJIE 1J8HE 1EVUA 5HHVL 3F62A 1P69B 2JTDA 3WFHA 1L4IA 1QSVA 4AJ0A 2JIXB 3WNLA 4R90L 2DKUA 4Z7OF 4RGOH 2VDLL 4FG6C 5I1DA 4XMLH 4MAUL 4UQ2A 4DCQB 1YQVH 5K9JH 1IEBB 5FYKU 3VMNA 5TE6L 2HAZA 4HH9A 4K3JL 2ADFL 3HC3L 4ZPTA 1KXQE 4PJDE 1FVCB 1T6WA 1KF9B 4YDIH 5E8PA 1S9VA 5KZCB 4PRID 4DKAA 1VB9A 2X05A 1AGCB 3PGDB 2W1NA 1KGCE 2BOCA 1AE6H 4M93B 1XF5B 1IL1B 1SM3H 3VFSB 5DJCA 3B9KC 4XHJD 2YD6A 3H0TB 4F15C 4O2FA 5FA4B 1CXEA 3KGRA 3FQTB 1NC4D 3DVIA 4IJ3C 2FJGA 3RTQC 2BNUA 5EZLB 2CPCA 2VQUA 5DJZB 1QSEA 2UWEB 1F3JB 5MEOA 1S78D 2VAAA 4HZAA 4ZUSB 3MV8A 1A9BA 1EFXA 3DXAE 4OLYL 3MACH 4Q2ZA 4FFWD 2V2TB 1ORSA 5IMLA 3Q2CA 5HPMA 1BWWA 3GGWB 2X4TB 2BY1A 4GUPB 1E6JL 4U0RB 1JZ5A 1E4KA 4CDHA 2Z8RA 1INDH 2Z8WC 5DVLA 3SCMD 1X9QA 1A7OH 3MR9B 1KV3A 5DC4B 3WBDA 1WF5A 1J9CT 4GKZB 5EO9A 1CE1L 3MOBL 4U7MA 1G0YR 1IKFL 2ZWLT 5I19L 3MMEA 4OZIE 2EDKA 4M43H 4G7VH 3U46B 4QTHB 4NO2B 1C1EH 1RIUH 2BMKA 1E4WL 3MLUH 4OIBA 4WO4C 2ZCHH 1OAUL 2OTWA 3EYSH 2YD4A 4M03A 5E9DE 5JHLH 1CG9B 1JF5A 4DN4L 5C0GB 1CL7I 4WI5A 5BRZD 4NSKB 1HYRC 4PRNA 2EKSA 4M1CC 4KJYB 2LU3A 4WV1A 2BCKB 4JY4A 3B6SB 4XNUL 4N8VA 5F8QC 3G5XB 1MI5A 5T3ZE 4LCIH 4GMSH 1OARH 5DJAB 4S2SA 2H32H 1B6UA 2YSSB 5CEZD 4K07A 4HUUA 4MNQB 2VZUA 4UQ3A 4WFFE 3VFPA 1OP3K 1KENL 5DD0L 4P46A 3W9DA 5GJSH 4U49A 3DETD 5GSRA 5L2JB 3U1SL 5DJ6B 4L8DA 1FJ1A 4V1DD 4I4WB 4PRHB 4JM2B 2NW2A 2YBRA 1FYTB 3QQNA 4LGPB 2Q8BH 2ZCKH 1QSZA 4WJ5B 4ZFZB 2OQJA 4NNYB 2ERJC 1UH4A 4OBRA 3S6CA 5D1QC 4LKCB 2JELL 5C70A 4J3SA 3VDCA 3BKCL 3O6FC 5D7KD 3L3KB 5IP4A 5GHWL 4UAOB 1TJGH 1ZGLP 3ARGA 1TFHA 5DT1H 4YGVA 3NA9L 3QG7H 1IT9H 4QRTA 4GFTB 1R3IH 1ZA6B 2M26A 5D96C 3QIWA 4M7LH 1GVIA 5F8RC 1H3GA 3FO1B 2AGJH 2EIZA 3TWCH 3VWJA 3P4OB 1IGIH 4DW2H 2BVYA 5E2UH 2F74B 4FQIL 1DP0A 1U2HA 2O5XH 5I1DB 1I3GL 3S37H 3VWKD 4R97C 1T5WA 3ZKNC 2DM2A 1ZT1B 4M9OA 2DRUA 1JPST 4LSRH 1CLYL 1FE8H 5KW9L 3SOBL 1F6LL 1A6AA 4OLWL 4NHUA 5C0AD 3ZKXC 5EBWA 1J1XL 4X8JA 4ELMA 4HG4K 3LB6C 4TTDC 5TDNA 5M7QA 3ZT6A 3M17A 2YD7A 1R3HB 4Y2OA 4GXVH 3HG1A 1FG2B 1SJHA 2IBZY 4QY8A 1YA5A 2UUDH 2AQ1A 3IAGC 1S7VA 4POZD 2J12B 2APFA 4PBWD 2UWEA 5F7MC 5HYJD 4WWKA 3GBML 3D9AL 5CP3A 2D0GA 1Q72L 4Z5RB 2NTFB 5GJTH 5IWLC 4BQ8A 5ANMA 1D5ZA 4C56E 3GMNA 1K4DA 1JPTL 1TPXB 2JJSA 4PR5B 4X6CA 3VXUD 5E8EB 2HLAB 3VFTA 2J4WH 4C59B 2RHEA 2QHRL 1FPTH 4EDXB 1JYXA 1DQDL 4P2CG 4GAYA 2Y25A 3IDJB 4PP2B 1NAMB 1UFUA 5FYJD 1U41A 4D0DB 1S7XB 3F12B 4NC1C 4P5KA 5DVOA 1KNOA 1JI1A 3MUHL 5B39G 4XP5H 4LCUA 1RZFH 1TTFA 1ZE3C 4FXKB 1YQ2A 3V6OC 2MQ3A 1G7LA 1HNFA 1AIFB 2IADA 2EDDA 5F1NA 2BSRA 1A7NL 2I24N 2EZ0D 3BRDA 1JYNA 3ALWA 1QP1A 2FIKA 2OTWB 4HKZA 4S1DD 5TF1L 1GXEA 3STBA 5CINH 1MRCL 1TENA 1KC5L 1RUQL 4RRPG 1KLGA 4OCXL 2DTML 3V95A 3UPRA 2F58H 3FQXB 5I2IA 5DRXB 3ULUC 5KBNC 5INCA 2WUCH 4PJBE 1RV6X 2EH8H 3P30H 2ZUSA 2G9HB 3JVGA 1O0VA 2OR8A 4DVRH 5D1ZD 1MFEH 1N64L 3QO0A 4KK6C 1LEGA 1NEZB 4JFDD 2CLZA 2CXKA 1XGQA 2Y07L 1NCUA 4JFZH 5DJ6A 2NX5B 3CSGA 4BFBD 4E5XB 3D69B 2ITDA 1UENA 3VRIB 4NNYA 2J8UE 3HE7B 4YFLF 4LLUB 1EH9A 1AFVL 1N6QH 5E7FA 3LKPB 4PJIF 4G7VL 4PV9A 3NCMA 4K71B 1AXSB 1FFNA 3RA7L 5EOCL 2HFGH 1R3KB 3U7WL 4BFEA 3MRHA 4DJMA 4ODWA 1SJEA 1QSFD 1X6LA 3TCLB 1AXTL 1KTKE 2VUOA 4X6FA 1ZA6A 3V52L 5L2KD 5T3XH 1QEWB 3M07A 3SCMB 3RY6C 5TE4L 5TFSL 1F58L 6FABL 1AQKH 4ENED 3LN9A 3QHTC 1CU4H 1I7TA 2XZQL 2WLYA 2Y5TB 3UJJH 5JW5B 1A3RH 5I1LB 1NGZA 2GK2A 1LK2A 4EVNA 3PWPD 2H8PB 1KENH 1IC7L 3VFGL 3UMTA 2XWTB 3UTTB 4I18A 2EYSB 4RBPH 4GS7B 3BX7C 3SDCB 3QCUL 1ZSDA 4P4RB 1CICC 2H26B 3EYFA 1RJYA 5E8DL 5D7JB 3BHBA 5E56A 1A64A 3IF1B 3EOAA 4BSJA 5FOBB 4UT9H 5C0AA 1HHGB 4OD1H 3MA7B 3MRMA 3LOWA 3I6KA 3WS3B 2X4PB 4Z7OE 1WZMA 4UDTB 2C3XA 4LLYA 1U8LA 4M7JL 1QFPA 3X12B 3S98A 3EHBD 1MFBH 2P49B 5CJ5A 1HN1A 3KJ6L 4NN5B 1FNSH 4JR9L 4LCWD 1OAKL 5KSVB 4HGKC 4XCCH 4LSTL 3DRQA 3ULSA 1JNNL 2H2SC 3H6JA 4PJCA 4Y5XA 4UV7L 3WN5C 3P4NB 1LNUA 1Y18A 2OJEB 1ACYL 3DUSB 1WSST 5EU3B 4BYHA 1F02I 3A67H 5BVJB 2ZOKB 4G8IB 3UZVB 2VO5A 4UB0L 5KVMC 3FB8B 3ZE0F 3OJMB 2Q86A 2FJHB 4D3CL 1WAAF 1YEEL 3MLRH 1IE5A 4N68A 3SGEI 4LRIA 2DN7A 1QRND 2FL5A 1QNZH 5I1KH 2GT9A 2C4XA 3HPLB 3QSKB 1CFTB 3RU8H 4BSWA 2A9NL 3TO2B 4WO4D 1OPGH 3QG6A 3BN3B 1HEZB 2AJXH 3KS0H 5HHMB 5EU7E 3RKDD 3MXWL 5CEXB 5IVXA 4GRMA 5IIEB 4UQ2B 4HH8A 4KDTA 2WP3T 4XGZA 3HC0A 4OM0H 3QJFA 1WT5A 2AXFA 5IW1B 3CLFL 4NO2A 4XPGL 3FRUA 1T1ZA 4MJ2A 3RX7A 3H7LA 4J8RB 3EUUA 5HSFA 1T83C 1CFNA 1FCGA 1WWBX 4NJAL 1Y0LA 3TPUA 3CZFA 3ZSSA 2W65B 3BESR 4GRWH 3P4MB 4U1HB 4OF7A 4KMQA 4EBQL 5ILTH 1HIML 4JM2C 1YPZA 4IRSD 1RZJC 3G5XA 4JFFB 1MI5B 1P7KB 2GY5A 1DANT 3ULUE 3FFDB 3P40A 4PJGE 1A1NA 2IBBA 2XICA 4XAWL 4X6FB 3OKLB 2NQCA 1YJDL 3RWFA 1OARL 2IG2L 5GGVY 4L4VE 4X80L 4LSVL 3MV8B 3NH7L 4NHCL 2KDGA 1J05A 3V4PL 4ONFH 3HKFA 5DD6A 4LHUB 3K7UA 1N5AB 2IANA 1JN6A 3FB6B 3CVHL 5F7KC 1DFBH 3OKOA 1G7HB 4PRHE 5FYLD 1F8TL 2DM7A 5GS2H 2HRPH 1K8DB 3GGWA 4OZ4B 2IPUK 1TCRA 3GJFH 1MEXH 2KUTA 5LXGL 2P24A 3TZVB 4KVNH 4Y5YC 4AENB 2JB5L 5FHBL 4XPBL 5T5FL 4A6YL 1BOGA 4LLDA 2JELH 3RWIB 4GG6A 3QDAA 1VFUA 5AZ2H 4ZDHB 4U1IA 3MYZA 3BPOB 4O5LL 5L7XH 1Z3GL 3SJVA 1KB9J 5DJXA 1T1WB 4NZDA 1NCTA 3BZDA 3IGAA 2LTQB 3QH3B 2NMSA 3SJVE 2VAAB 5BS0B 1RK1B 3MOAL 2NY5L 4HSQA 4UNUA 3HS0B 2P5WB 4TRPH 4HGMA 1FL6B 4FXGA 3NVQA 3NIFF 1KBGH 2UWEF 2XKUA 4CW1A 1AQDA 2EECA 5L9DH 1YPZF 4LNVA 4XC3H 3D2UD 4JN2B 3BO8B 4NOBA 3CDYA 3EYVB 4OCSH 4FN0A 3LRHA 3AB0B 3NFSH 4PRBB 1T5XB 4OT1H 1JWUB 4P46B 3W9DB 4HUVA 4DN4H 5I0DA 1MI5D 3AC0A 1XEDA 5GIRA 4L8DB 3BKML 4NM4L 1H3PL 1JF6A 4NO5A 5BVJA 4I4WA 1AJ7H 2UZXB 3O11A 4JM2A 4QHKI 4YHYB 4YDVA 4IBLT 2OQJB 3CFEB 4F7PB 4NCC2 3VG9C 2O5YH 2CDFB 3B2VH 5A2JH 3X14B 3KPRE 2AW2A 4Z7UF 3DROB 1OM3L 4U3HA 3THMH 4LSQL 4NBYB 1D5ZB 4ETQB 3BP7A 2AJZA 2NNAA 2LV4A 3NABL 3V7AG 3T4YB 1UYWL 2EDLA 4NZTH 2IPKA 3QUMA 2ESVE 3QBTB 5I18H 2Z4QA 5E94A 2V17H 3O41A 3RWCA 4OD1L 1XF4B 3BWUC 3QUKB 4HGWA 3MNZB 2B1HH 3IFNH 1KOAA 5HDOA 3RNKB 5EO1A 3JV4B 3KPSE 3CMOH 4ZPVA 3SO3C 4XXCC 3BQUD 1L7IH 1YEJL 1FAIL 5KSBB 1P84K 1MHPH 2Y9RT 1B88A 2ENYA 4XH2A 4GW4A 1C08B 5GS3A 3SKNB 2E7LA 2DL9A 1S5IL 5D70L 2X4UB 3QPXH 1MFAH 4XI5C 2ICEA 5DVMA 3V4VH 4NP4H 4R9HA 1CDIA 4YLQT 4F2MA 3FQRB 1CFBA 2QKIB 4AIXA 4Q9QL 4OGXL 4P46D 4U05A 3WJLC 4AMKH 4UB0H 1JJUA 1TZHB 5DRXA 1MHHA 4LCIL 4PB9L 3HC3H 1UXWA 4P48A 2F58L 1T2QH 5EU4A 4WW2C 3L9RB 3QCVL 5F9WB 3DJ9A 1CCZA 4PJAB 5IR1A 2R8SH 4NQXA 1JGUH 1R24A 4ZO9A 4HS8L 1UJ3B 2CLZB 2CXGA 1S7TB 5T3XD 4QHUB 3IKKA 5JR1H 4EOWL 3WUWG 1U2CA 5EUOB 3BGMB 5GGTA 1HI6B 3BP4A 3B8YA 3C5ZB 5HI3D 4LLUA 5D93C 4IOSD 4LFHD 3OGOE 2AK4B 2AEQH 3FQNB 2CGRL 4MAYC 2WK2A 1E4XH 2I07B 1R0AH 1F2XK 1N0XL 4P9HC 5IBTL 3RWEB 1QO3A 1MY7A 4AEFA 3GBMH 2HTLC 1OSZB 4ODWB 4GMTH 3T2NL 5K9KA 1Q8MA 3KXFD 4R8WL 2YPKB 5K9QG 2BVUA 4XP9H 3QEUA 5EORH 3I50H 3U6RB 3HAEH 5JIKA 1I8MA 5EOCJ 5A3IC 2VISA 3KPSB 3B3IA 1ZHLA 4N0RA 4JO2L 3OKYA 2WLZA 3MBED 1HYSC 4P4KC 3I2CL 5F6HJ 4X9GA 1QYGH 5IOPB 2AERT 1FE8L 5F97E 1V8HA 1UEMA 3PL6B 3R06A 2FD6H 5HGBB 1AKJD 4AT6A 2LAGB 3BPOC 5TQ2L 3GUTB 2DQDH 4B53A 4M7KL 2HFEB 1RY7B 4F57L 2OR9H 3FRPG 2FECI 2HA1A 3HI1B 3QO1B 5KSBF 5SWZB 2EXYC 4JO3H 2Q6WB 4FTVA 2CR3A 1KTLA 5GGQH 1HXMA 3EOAB 5FOBA 5AYUH 3F6LA 2A2QT 3TBSA 5IHBA 5JW4M 1J5OH 4P23A 1LEKA 1X7QB 2IADB 4HIHB 4CUCA 1KJ2H 4P5TB 3LD8C 1FZKA 3J8F7 4Y1AA 2EDHA 3JXAA 2CDFA 4JGMA 5H2BB 3AROA 1ZHNB 3GSWA 1D5IL 3BP7B 1WEJL 1GPOH 3ZKMD 4J3OC 3CU1A 1ZVSB 4HEPG 4G42A 2ADJA 2YRLA 4IRZH 2IPKB 3UPRB 5GRVK 5DSCA 5KANI 2W0LA 3DV4A 3QUKA 3C9NB 4X7CC 4X5WB 4Y4KC 3UTZA 3NCEB 1K2DB 4Q0XH 5J11C 4NNPL 5CEZL 4K94C 2HMIC 4GRLB 5FK9A 4L4TA 4ZMAT 1BFSA 5FV2A 5DQ9B 4G9DB 5IHUL 1Q0YH 2OSLB 3VJ6A 2Z31D 2WBKA 4HWZB 1QPPA 2XWBA 3ALPA 1V5JA 5F7EL 1ND0B 4PJHF 2ICEB 2X2YA 2OP4H 4X4MA 5FO7A 4D3CH 1A6ZA 3DARA 4YQXL 4PD4K 4EI5B 5T3XL 1Z9OA 3P11L 4YE4H 3D25B 2XG5A 1CIDA 2CD0A 4XVUD 2D31A 5EOTB 2R9HC 1Z2KA 4ODTL 4HCRA 3BZ4B 1QLEH 4JZJA 2FDBP 4AQOA 3G6AA 1FZJA 4NQXB 5JW4Q 5KN5B 5F96H 4I0PA 3T3PF 2JCCB 5A16A 4Q9RL 2GUOB 4YHYC 1B0WA 2Z92B 2AJ3B 3SKMB 3S4SG 3RIAK 5TE7L 5B3JF 3VFVB 2BXZA 4OKVB 4OUOA 3SGKA 2O93L 1MCCA 4NC2B 4KC3B 1L7IL 1QG3A 2A6IB 4ONGL 15C8H 3FTGB 3LSOA 3I3EA 4NUGH 1G9MC 4PBVC 3SDDA 5KSUA 4ZUUA 5A2KH 4I8DA 5GJTL 1BP3B 1DQTA 1FORH 3WFBL 2DQEL 1R3IL 3BWAA 1LDPL 4X6DA 1RJYB 3OKLA 5T3ZL 5LQBH 2R2CA 5IK3B 3BHBB 2VN4A 4ZFOB 2RCSL 4XWOD 4YDIL 1CYGA 4XRCB 1J11A 2FL5B 3L5WB 4OZIA 3OZ9H 2YXFA 3L7EA 4OZGA 3MRMB 2GYSA 3F58H 3QULB 3RVUC 1WISA 4LSRL 2YPLA 5C9KA 3KJ4B 4B50A 3VGAB 4PJHE 3WUWB 1U91B 1PVHA 1J1XH 4EUPA 1IC1A 4U6YA 3BMWA 3BZEA 4GXUM 3LKQB 3CK0L 3LQAC 1KC5H 1NKOA 1RUQH 1WBYA 5KSAC 3NCYS 2DYPA 3MXVL 4M6OL 4NRXB 5F9JB 3VXSA 5CJBA 3FONB 3KLSA 1F42A 1YNLL 3VW3H 3LS4H 4IMLB 5BW7C 3TO4A 3D18B 2A6KA 5JXEA 2DMKA 3TT1H 1T1WA 3VGGA 1UADC 2E3VA 1Z3GH 5D5MA 3IFPA 3RY4A 2NY4C 1U58A 1PLGH 1V05A 1MUJA 2DQUH 4RFEA 3HS0A 3RQ3A 4L1HA 4YHML 2E7BA 5ITBL 2XTJE 4UT7L 4G6JH 3IU3A 5IB2A 1LE9A 1JHTA 3SCMC 2R1YB 2A6JA 1AQDB 1XGPA 4V2CB 2J4WL 5D1ZB 1ZLWK 3W0WE 4CU7A 4P4KB 5C0JA 1HEZA 3LMJH 4N0YL 5DR5H 2IANE 1IAOA 4KPHH 2ZCLL 5IB3A 4LLWB 4YX2H 1RZKH 5KS9B 2B20A 4LHUA 4MA1B 3RZWA 1A5FH 4JAMA 1WIUA 5EBGA 3MO1B 1A6PA 4LL9A 4I3GA 4NQDA 5HD8D 4OCXH 1LHZA 1Y6KR 4G6FD 2DQDL 3REWB 5KAQG 1DQJA 4W70A 3IB4A 4FFYL 3X14A 3GSNH 4MS8C 3SE9H 5JHDA 3OAZK 1MFCL 1MH5A 1AE6L 4FRWA 3B9KD 4LAQL 1BQUA 5TQ0H 4FQPA 1CL7H 1IZKA 3SBWA 5EOTA 3WHE0 2I5YL 4JN1H 1NBVL 1B2WH 5IQ7L 3JUYA 4JFZL 3S34H 1C12B 5EBLA 3DYPA 4GKOA 4CRPA 5I0ZA 1A1NB 2Z35A 4YXLH 3V6FB 4DOHE 5ADPH 1TVHB 4TNVF 3MZGB 3CLEL 3HG1E 2XOTA 2AP2A 3O3AA 3CMOL 3LIZH 4K7PL 3AREC 4F9LC 3MNWA 3QWRA 3BRGC 4P2QA 5JOPD 5AUMA 2P47B 3PIQA 5FM5O 4NZJA 4OLYH 2XN9A 4RFOL 4XX1E 1RU9L 4P5TC 5E8OB 3U4BH 3VD9A 2QSCL 1SY6A 3WFDH 1I1FA 1IC5L 2P46B 3DX9B 4QTIH 3GDBA 3ULVF 3V5KB 4HJJH 5D71H 1EGJL 4M02A 2PN5A 5JO5A 3DX8A 2E7HA 4WI4A 5JLZB 2BVQB 1NLDH 4JKMA 1FL3B 3O11B 5GQBA 4F3FB 3TNMB 3DO3A 1G7IA 5IMMB 1F90L 1W0WB 5CGMA 1LVEA 5MEOB 1DVFA 4N0CC 1UKTA 5DFTA 4LVNB 1R24B 2FH6A 5EZIL 4ZFOA 2Y1VA 4LKXA 5E6IA 1IC7H 1SY6H 3VFGH 2EZ0C 3D39A 1ZLVK 4WY7L 3NCYP 1E4WH 4A2LA 5IFHH 3LKSA 1A3RL 1K3IA 5DD3L 4X0KB 4L8SB 1HSBB 4HCRH 1FL6A 1D6EB 3PWLB 3GHBL 4UINH 3PDDA 2FSEB 4UT6L 4JE4B 5J6GA 1YEDA 5IVXF 1CD0A 2IC2A 2NZ9D 5HGGS 3JV4A 3ZKMC 3LKRB 4NJ9L 4DUWA 3FZUC 3LKOB 1PZ5A 4JPWL 3H3PL 2DD8H 4PJ5B 4P2OB 5FHAH 1SVCP 4CN4A 1I8LC 1N3NA 4NZUL 5IBLC 2DWEB 4YO0A 1OD9A 2CRMA 3SKNA 2DQHH 4PLNC 4MA7L 2HVKB 3HUJA 3U36B 2GTWA 1BIHA 5T1MB 2BNQB 1I8MB 1LO0L 3GSNA 4AG4H 4NUJA 2NY6B 4Z77B 4XPHL 4CVXA 3QQ3A 5KTEH 3QCTH 4N8VB 4JFYA 1Q9LB 2A6JB 4Y1AE 5C07E 2BRRH 3IXTA 2Z91B 1CVRA 5JZ7D 4KFZC 4QOKB 3UPAA 3PWNA 4HIXH 2PXYD 4WEBL 2ARJB 3OR7A 2AEWA 1BJMA 4JHWH 1IGYB 3TO4C 1C16A 1JPSL 1KPRA 2DQJH 4F57H 4O2EB 4RMQA 2YBRB 3BDBA 1DBBL 1GJIA 1OQOA 2ZG1A 1NGPH 3L3HA 3T0BA 5TGBA 1CLYH 5HXMA 2EKJA 3AS0A 4BSVA 3I02A 4LHJB 2VDPH 2HYMA 1REIA 3FQRA 3GKWL 1P4BL 4PG2A 4Y19D 1UWGH 4O58L 4Y4HB 1EO8H 3SY0A 4RZCB 2IQAA 4YBQD 3TM6A 4GSDH 1P2CB 35C8L 1PLGL 3I9GL 4RGND 5HPOA 4JQIH 1GGCH 3EJZD 4FZ8H 3MV8E 3MXWH 1FV1A 3FQTA 4OGAC 2IGFH 1UWEL 1OAZH 1YY8A 1B6DA 1NGYA 2J8UB 4DZ8B 5EA0L 2AV1B 1EEZA 1S7RA 4NKQB 4LP4A 2VISB 4LQFH 4ZUVA 5CEYB 5ELIA 1N59B 4ZUSA 2OSLA 2NY1C 3A6BL 2JK5B 2X70A 3U9UB 1R0AL 1KB5L 2HT3D 2IALA 2JJVA 3ZL4H 1T5WB 3A6CL 4ZTOH 5FO7B 5JOFB 3S3SA 5HPMB 3W39A 2R15A 4WU5A 5JMRA 1I9EA 4X8JB 1QA9B 4ELMB 5MI0C 3VXQB 2DMCA 3MFGB 4P9HH 9CGTA 3ULVC 4M6NH 2BNQE 4NGHH 4NHCH 4P46C 1D3CA 2VLMD 1JK8A 2MHAB 2OL3A 3CFIC 3CXHJ 4M5YL 1SM3L 1YJDH 4J4PA 2BK8A 4LARH 5CZVL 4N0FB 1ZAGA 3AREA 1F4YL 1T1YB 1FH5H 1AO7A 5ITFA 1V7NH 2FD6L 3EOTL 1OAXL 3WNPA 1YMMB 4BKLA 3ILPA 4MJIA 3OGCB 3Q48A 2WNGA 1I7RA 1NC4B 1X5YA 2HTLD 1UH2A 3BAEL 3HE6C 4RIRA 3GMLB 4A2MA 1OGTA 3SDDB 1MWAB 1NFIB 4NO3A 3VA2C 5C71A 3VWKA 4ONHB 5T5NG 4WCYH 4AT6B 1M7XA 2H2PC 4LCCB 3LV3B 1E0OB 2IEPA 3NN8A 4YZFE 3CFDB 5DQ9A 4YDLB 2IH3A 3PWVB 5I18L 2UYLA 2O61B 3I3BA 3TH4T 4F15B 5C7XH 3BH8B 2BVOB 4XAKD 2BOBA 3QWOB 2GK0A 3Q5OA 3IFNL 4XP6H 3SE8H 5I75B 7CGTA 1T6VN 4WIQA 1OP3H 4N8PA 3ARXA 3GSNB 1UACH 3RZCD 3P2TA 2FLBT 1ZHNA 2HH0H 1KCVH 1BFVL 1ZLWH 2B1AL 4FQXD 2AKRB 3QUZB 3F7PC 2NY5C 3A67L 1FL5A 1BQHG 3BIKA 4J12A 1L9NA 3AM8A 4JRYB 1Q9WA 3E3QE 3NFSL 1F58H 1CXIA 4HJ0C 1Y6MR 3EZJB 3DV4B 4JZJB 1QTYT 3PGCB 4NNXA 3QIWB 3RL1B 4UIMA 1AQKL 3N9GH 4FQIH 4TUKL 4OFKA 3W0WA 2OP4L 1M05B 3NH7H 1ZEAH 3O4LD 4JGUA 1CFVH 5C2UB 4MA8L 1AGEB 1QHPA 2VZSA 2FHCA 2P5ED 3BP6A 3U0PA 4P3DA 2A6IA 2YRPA 4TUJA 4U7SA 2NYYD 2QQLH 2AEIT 5KSUB 3I02B 2YA0A 4ZAKD 4X6DE 5DUMH 4Z7VF 3LN5A 3X11A 5F7WC 3UJIH 4G6JL 1H3VA 4N9GA 2IQAB 4L29B 3QA3B 5JA9A 4UOJA 5AZ2L 3GIVA 3MCG1 3W9EB 3QDJB 2NY2C 2CUHA 4K8RD 3PWUA 5IROA 3QYCA 3BZ4A 3HI5H 4HUXA 5AYQA 3SDYH 4OZGF 2DQIH 5I1IH 1BVLB 1CXKA 1IGFL 1EPFA 4OQ1A 2BFVL 2VKWA 4JPKL 1C5BL 2DS4A 1GHFH 5E8PB 4F37K 5MHSE 4HUNB 1JPSH 4ZFFB 1B90A 5F6IB 3O6KL 3U79A 3AU1A 5C0EB 4DKFH 2GQHA 4XPAL 1WIOA 2PW2A 4IRJC 4XCCL 5DJCB 2FNBA 4HUKB 2ITCB 3MUGA 4KV5E 1MCBA 4EI5C 1H8NA 4QXTA 2MHAA 3ALXA 1A7NH 4KDWA 2AQ3A 1MAJA 4L8BB 3C09B 3MBXH 3V8OA 4ZPTB 3CSYB 4XNXL 1RIHL 3GJEA 1HSAB 3ECBB 4TSAL 3MYJA 4XRCA 1VACA 3ORJA 3CNKA 4NQCA 4JO1H 5AD0A 3TIEA 1U8QA 2JB5H 5FHBH 1I7ZA 1EAJA 1ORSB 3BUYB 3QEQE 5LGHL 1XGPB 4YDJB 5DS8B 1GCFA 1BBDL 3NFNA 4NQVB 2HT4C 1IM3A 1N5YL 1I7RB 3CSBA 4G8GB 3RAJL 1K3ZA 2R0ZH 2YD3A 1QSEB 4H20H 1NFIA 4RMUA 5B8CB 3RY6A 2Y72A 1G0DA 2AJXL 4KUCD 4QTIL 4W68A 3WXVH 2G9HA 1KJ3H 4GKZA 5DK0A 2F53D 3TZVC 3JWNC 2VL4A 4PJHA 3QXVA 2R1XB 1XGQB 4W81A 2A6KB 1KCSL 1P9MC 1M4KA 4LKXB 4R2GD 4ODXA 2B7DT 3E6HB 4N5EC 5HYQB 2J8OA 1XGUA 1VDGA 3DUHA 1HSBA 3TN0D 4CVZB 3VFOA 3Q6FB 1CIUA 1U8OB 3CFJB 4PJXE 1KTRL 1MY5A 5HYSG 4HXAH 5J6GB 2X9YA 1CT8B 5J89A 1MCHA 4X7TA 4X9IA 4F9PA 3NFPA 1TLKA 2YSSA 1XCTB 4GLRI 3MLWL 5FYLH 3BN9D 1CE6A 3FN3A 3O2WH 3RX8A 3S37X 3R8BB 5IW1A 3KPQB 4OCWH 1CBVL 3CH1A 1WEJH 2ENSA 1NMAH 2FIRT 3PHQA 2MTPA 2XFXA 3OKEA 4WO4A 3RKDC 2HLFC 3WN5A 4JFYB 3QDJE 3MACL 5DJ2A 5GGUB 3T0XA 3OKDA 5EZOH 5E8DH 4KI5E 2XKNA 4H25A 1CDJA 3NPSC 5E6ID 4FFWC 4JDZB 1PKQA 1RZ7L 2ARJA 3DOSA 2EC9T 5JHDE 1Q94B 5SWZD 5BJTB 4QOKE 1HDMA 4KTEL 4G5ZL 3JV0A 1IGCL 3SQOH 4XCFH 1N5AA 3CFBB 5AZEL 3MA7A 5E8NB 1I4FA 2XY2A 4HJJL 2N7BA 3CVIH 4K7PX 5FGBC 1K8DA 1EX0A 3O9WB 4PJEA 1QZ1A 1CU4L 1OAKH 3DUUB 5F89B 2FSEA 2FHFA 1EEQA 2P48B 4G3YL 2P24B 3TZVA 2WBWB 5DFVC 5D4QA 1OGAD 4LSUL 4L1DA 1Z9SA 4ZFFA 4TSBH 1AY1L 3FCTA 3TZVD 5BZDB 2FEEI 1YY9C 3RIAF 5JUEH 3MRQB 4P2QD 4JDTH 4OLVH 2KPNA 4OFVA 3NTCH 1FG2A 1OB1B 1I75A 1NGYB 2J8UA 5B21A 3BDYL 4BFIA 4KKLC 3SDCD 4U6HA 1T0PB 3KXFB 3L3JB 2BNQA 2W0FA 3AAZA 3M8OL 4KI1A 2FJHA 3HNSH 4FTVE 4Z6AT 3QJHA 5IF0B 5BMFH 4DAGH 2EXWC 2A0LC 4JFHE 1S7QB 5FYKE 2N56A 1N0XH 3D3VD 3TT1L 4G9FE 4JM2F 2OCFD 1TPXC 5C9JB 4ONGH 1HOCB 4QRPD 4XC1H 1H5BB 3PWNB 3MOQA 4P2RD 5E2TH 4GAYB 4PRBA 1TIUA 3BMVA 3KYNA 1S7XA 1BGXH 4RNRB 2ADIA 4JG1L 4Z7NF 4HK3J 5D6CA 3VRJA 3QIBA 5DUBA 2DF3A 4PD4J 2VC2H 5EH1A 4XGZB 4XPAH 3WS6A 5B3NA 5IJVA 1NC2A 1FNFA 3NZ8A 1YY9D 4J8RA 3JTTA 3TBVA 3AS1A 1G6RB 1MFAL 1F4YH 1EJOH 3IKCB 3OB0K 2YK1L 5T1KD 5ISZE 4F8TA 2J1KA 4MXQC 1YNTA 4YQXH 3EFFB 4PJDF 4BZYA 1YC8A 3T08A 3IFLL 1A9EA 5I1JH 4M9PA 4OCLC 3L7FA 5GZOC 1J0ZA 3GMPB 4UNTA 2VZ1A 2PR4H 5E2VL 4L3CA 2DQUL 1WC7A 3EKCA 4XNYH 3FO0L 5I1EH 1HINH 1SEBA 5BZWA 2IALB 3LQAL 2LTQC 4IOFD 4LAJH 2B1HL 1PQZA 3MNVA 4R4BB 5C7XL 3NIDF 1AKJB 3S35L 2AJSH 1N4XL 4R7DB 4JPIB 4NBXB 5F7DA 4XWGL 3NOIA 3D0VB 5EU6A 5A1AA 4RA0C 5FEBA 1RK0A 2C1PA 2Q76B 2DWDB 5SWSD 5IHZA 3DX6A 1FLRL 1WCQA 5D72H 1TVBB 5DD1L 2WM0A 1CTOA 3UTOA 5KS9E 3H9ZA 1NCCL 5I1AA 2C5DC 3RIFF 3IXAB 1A6TA 1BD2B 1A6VH 2BSTA 3DECA 4LEOA 1YYML 5FGRA 5DZLA 4HPOL 4GBXC 1W72A 3I6LD 1K8IB 3BVNA 4C4KT 4H5SA 4YPGB 5F7NC 3BXNB 1S7TA 4WEMB 3C60D 4JHAL 5C09B 1TVDA 4TUKH 3HZKA 3RL2A 3NACL 3P11H 4PJGF 1U8HA 1JNHA 2F54A 1NCAL 5TDPA 1EO5A 4PUBH 5A3ID 5KZCD 4UTAL 2XY1A 4LLQB 5IEKB 3OXSA 4LCCA 5ICXA 4BELD 2YPLE 4KKAC 3VXPB 5KVEH 3TBTB 3KPRB 5MEQB 3JWDH 3MLTB 3TJHC 1RJZA 4F7TA 3CLEH 3DVGA 2CMRH 1A0QL 5JPNB 4O5LH 2BOBB 3L3GA 3QWOA 3RWGA 3BPLC 1X4YA 4IOIB 3GM8A 4PGBB 3HE7C 2ZSWB 5C0AB 5DVKA 1JWMA 5HVHB 2AK4D 1EA9C 3C6LC 4LVHC 2QHLA 3MRKB 4S1RH 3BZFB 1MFEL 3W11D 1NUFA 5DO2D 3H42L 2DLEA 1X4ZA 2QADC 4NQEA 1FHGA 1QSEE 4U6XB 1TJIH 4U1SA 3BD4A 4WHYH 1RJCA 1WFUA 4KKLD 3CCHB 1F90H 3RDTB 3N85L 1I9IH 2FBJL 1EV2E 3RL1A 1XZ0A 3BPNB 1ZS8A 4CMMA 3NGBC 4JRXB 3FAWA 5F7YC 2GTZB 1YEFL 1BFOA 1MLBB 4NQSA 5DRWA 1LO5B 1G7QA 1MIML 1WWWX 1YYLH 5D6DA 4I0KA 4G9FB 4WTZG 1BEYH 1CGSH 5FUCC 2HKFL 3H9SD 3S4SA 1PEZA 3U48A 3LEXB 2AV7A 1NMBH 5TQ2H 2ICES 2VNCA 5DYOB 1FO0H 1HKLL 1CK0H 2EYRA 4NQCB 3JTTB 4OF3A 4TPRL 2XXCB 5IMOA 1A22B 5DMYA 3HAEB 2A73B 5IB4A 3WIHH 2XRAL 3HAEG 5CWSA 4TULL 2YKLL 1T89C 2X40A 3OPZH 3HZVA 5I1HL 2YS4A 5FGBA 2FO4A 4LVNC 1A9EB 1I1AA 4JN1L 3FT3B 3FB5B 1MEXL 4HV8A 2FX9L 1AP2A 1J18A 5EZJB 3WXVL 1V7ML 5B4MD 1T1ZB 2C4FT 3WFEH 5ID1B 5T5FH 4I77H 4M62H 4PJFF 1JCKA 4X98A 4Q9RH 3V6OA 3M1BB 1F4HA 15C8L 1F4AA 2BY0A 4NUGL 2IFGA 3CZFB 3BP4B 3ZE2E 3DGGA 4PJ5D 5L8KB 1NFDA 2FX8H 4JPVL 4B5EA 1FBIL 4TNVK 5GGRY 4RISH 5EIIA 4OCYL 3F7YB 2FYYA 1ONQB 4G6MH 3EYOB 2LU4A 2A6DA 2BFVH 3DVNB 1CE6B 1NGPL 1QLRB 4UV7H 1MCDA 2YK1H 4JEGB 12E8L 4FQQB 1PG7W 2DM4A 3SE9L 5HYFA 4NZRH 2B0SH 4MJ6B 1B0RB 1NCDH 5DQJA 5MI0B 2YD5A 2Z93A 4PJBA 5DS8A 4MLIA 1ZHLB 3FO9B 1IM3B 3QXDA 3WIIH 4KROB 4Z76A 2OMNA 5JDSA 4IOFC 1NGQL 3F6IA 3F5WB 2AJYL 2WWKT 3H8NA 3UJIL 1IAMA 4XCEA 3GHEH 1BOGB 4PJEE 4OIIL 4Z7QE 1QLFA 3MUZ1 3A0OA 3VW3L 3O0RH 2HJKB 4H25B 1KN4L 2JJUA 2ATKB 1FLTX 2AJSL 2VL5A 5KOVC 2DD8L 3S36H 1HHHB 2E9IA 1IZJA 3EDJA 4WDIB 3A6CH 2G2RB 1J0HA 1ZLSL 2N7AA 2MWCA 3U7YL 3K2UL 2VXVH 1NPUA 4MHHI 4YHMH 4LRIC 1BMGA 3ZE1E 4F7CA 4HKBA 5DUPH 4CL7A 1WCBB 3O9WA 5DQDH 4L3ED 2F54D 4JQVC 4GKNB 4R4FH 1I7ZB 3BUYA 4MWFB 3O8XA 2X4SA 1NLDL 3ULUH 3NFNB 4M5YH 4BH7A 4RWYH 1R5VB 4Y4FC 4OJFL 1C5DB 3T2PA 4N5UA 3LRGA 1ZT4B 1WBYB 3UZQA 4NRXA 1ZHKB 1XZ0B 1BZ9A 6CGTA 4UU9B 4WY7H 5EBMA 5MENA 5E4EB 5DRZA 3TPKA 4MNGA 2OR9L 2KQNA 5J1AB 1KJMB 5H37G 3X13B 4LSPL 1INQB 2PCPB 3UC0L 1S9YB 1HHJA 4OBSA 2HTKD 3MBEC 4HDIB 5E03A 2P5WE 4PGZA 4WO4B 4HHAA 3D85B 4M00A 5BS0E 4MNQD 5DJYA 4KWUA 2AJVL 1JNLL 1EEYB 1CDGA 1FYHB 2GJ6E 2DM3A 3VFOB 2D9CA 1FNAA 1H5BA 3HAEA 5IB4B 1UQSB 1MCOH 3IDXL 4YH6A 3DBXB 4XB7A 1W72H 1XIWA 4WUUD 1J1OL 5E5UB 3STZA 3DXAA 1XCTA 4YXKL 1KJVA 2RJMA 3CDGB 4WTWA 1F4XL 3K46A 4NFCA 3WXWL 1JBJA 5L7XL 2XT1B 1MSPA 3ZYZA 4JVUA 1IEBA 4XH2B 1PG7H 4PJEB 1TITA 2GUOA 4PGDB 2VC2L 5EIQA 4YHZL 4PJ9A 5MEPB 4DGIH 3VFVA 5HVHC 2GY7B 3HPJB 3WFHB 1QPXA 1NBQA 1UCBH 3ZLQC 4L8CB 1DR9A 3AXLA 2BHYA 1XF5A 4XNZC 1ETZB 5CMAA 1EJOL 2VLJD 1BX2B 1LDPH 3FN9A 1I1CA 4QRPB 3EIFA 4I2XE 3T2QA 3BKYL 1QR1A 7FABH 4X6CF 4X6DB 1UB6B 5I8CA 4ZXBA 2BY3A 3FFCD 3OZ9L 3IDGB 4I3RL 4C54A 3O3AB 2V7NA 2XPGB 4JB9H 5L0QC 4YUEH 1MF2H 1NCBH 5EZIH 3HUJE 5DEGA 4P2RA 4HC1A 3L3OB 4W4OC 4ELKB 4IIQA 3WLBA 3AUVA 3QUYA 3EO1B 1PKQE 3KNBB 4N90D 5AG8A 5CJQL 3L1OH 4NPYA 1RZJH 1KN2H 1OOAA 3ES6B 1JI2A 1T3FA 1LD9B 4LLVA 2ZPKL 3QDME 2FX9H 1JGLL 4YFDB 1AGDB 2Q8BL 3BAEH 3VXSD 1KIUA 2EC9U 2J7LA 2HT4D 2R39A 4PRAA 3SQBA 2ED9A 4Q6IA 4EUPB 4X4XB 4Y4HC 4F9PC 4P3WA 4E42A 3NAAL 5LWYL 1UJ3A 5EO9B 2F8OA 2H3NB 5KVGL 2BRQA 1RIVH 3LDBC 3K2MC 4Q2ZB 4RMRA 1AD0B 4YZFF 2V5TA 1VKXA 2APXA 5SV3A 1YDPB 4H5SB 4YPGA 5I8OH 2R1WB 3WEXA 5C0GA 4AK1A 4M5ZL 3LKSB 1I1YA 2RCSH 4DUVA 5JMOC 4X0KA 5HGDB 1WAAA 4AZ8A 1M71A 4ODSL 3OTTA 3MR9A 2CK0H 1OSZA 3U2SB 3ARYA 4HIIB 4LSUH 3G6JB 3QUZC 5F6IC 5C9JA 4NP4L 5HGHB 1QFUH 2ZCLH 1HHKB 4X4ZA 3RTQD 2EE3A 3V79C 4AMKL 3LKNB 3O6FA 2LVCA 3PQYA 2O26U 4ISVB 4WWKC 2VDRL 1Z5LA 5KVDL 5SWZA 1YN7A 3GMOB 2CIKB 4APQC 5L2JA 4Z7UB 1GAFH 2YUWA 3LN4B 2EE9A 4UUJB 4NQDB 3GHEL 1N26A 3EYQC 1YNKL 5T1MA 3UBXB 4ZUWA 1S9YA 4HKXB 2PYED 5EOQL 3UTQB 2R2BB 3SKUD 3V6BR 4QNPF 2XA8L 1LK3H 3D85A 1I3RA 3LPGA 1G6RA 4KK8D 3GSRA 4EOWH 4OQTH 4MA7H 3ME0A 1ES0A 3MLYL 4JFEE 3ARQA 5GSRB 3HNTH 2C7UA 2BSTB 1AHWB 1LO0H 1UQSA 4X7FC 4AG4L 1Q1JL 2NR6D 4YXLL 3ET9F 5EA0H 4P9MH 3QHFL 5TE7H 1S5HA 1YN6A 4OTXH 4WI9A 2EIZB 4FZ8L 3RZCB 4K8RL 3L95A 3N06B 1T7XA 1IM9D 1KJVB 1QHOA 4OGYH 1XGRB 4G9DA 3WDHA 5HDQL 1QFWI 3LEXA 3ULVL 3MREA 2JJTC 4ALAL 1T03H 2F54B 1NGXB 4YGVB 2HKFH 4M8QB 5DK2A 3GJFB 4XMPL 1PQZB 2UZYB 4R4BA 1XR8A 1ZTXH 1S8DB 1W8NA 4P9HL 3MCLL 5C86A 4Q58C 3D3VB 3QUXD 5FK9B 4WFHD 5TF1H 1GC1H 1ETZA 4GMSL 2X9XA 2C26A 3DX8B 3GNML 4O51B 2ED8A 1KCUH 2YD1A 3WJJA 4KZDL 1EERB 1ZA3B 1HYSD 4HWZA 4QY8B 2W60B 4PJ8D 4UNVA 4KV5F 4WRLA 1NSNH 2IFFL 4YHNB 3F58L 1D6VH 8FABB 1SMAA 1BD2E 4NM8H 5I1EL 5I8CB 1DN2A 2QQLL 4MB4A 3DI3B 1JUFA 4XVTH 3E6FB 1BQLH 5DUML 4WFGE 4NQEB 4JDVA 1J1OH 1SQ2N 3L3OA 2VLKA 4OI8A 1WTGT 4NRYA 4ZFOL 3CCHA 3MLZH 3KLHD 4P57A 3DURB 2WSKA 3U4BL 1GL4B 3RWHA 3OAYH 1B3JA 3B2UC 4JRXA 2X4NA 4OSUL 4TVPE 2D3VA 5J12B 4HWBL 1LO5A 5I15L 1ZMYA 5ESQB 4KQ4L 1KIQA 2PF6A 4ZUTB 2I60H 4JRXE 4ZXBC 1K9TA 5E5MA 3ZT5A 1VADB 4K2UH 4RGMB 4OB5H 4YHPB 2QV2A 3SPVB 2ZSWA 4MJ6A 3GMMB 4BQ6A 4GQ9H 4HPYH 4HXBL 3JWOH 4JKPL 1NAMA 5DR5L 5D1XC 4FHBD 2FJGB 1BAFH 1G1CA 5BXFA 1IGJB 5I8KH 5CIPB 4FXKA 3ARSA 4XBEL 43C9A 3UJTL 1EMTH 1FRGH 3BYTA 2FBOJ 3HZVB 4GRWB 3MRBA 1IGTA 1XF3A 5E6YA 1FYTD 4IEFB 4KMLB 4ETYA 3P0VH 2BDNH 1EFXB 3FT3A 1QD0A 2AAVA 1RUAL 3PP3K 3DO7B 3CFDA 4DKEL 2W59A 3UO1H 4IHOB 2W9EL 1MCPH 5D7IF 1IJ9A 1X5XA 1T0MB 3DMMA 2IF7A 5GXBB 3VDAA 3DV6A 3MQIA 2YPLB 4NN7C 5CBEB 5EO0A 2DQHL 1PJ9A 3O6FD 3FJTA 3DMMD 3G6DH 1JGEB 2I5YH 3EJZC 1CDCA 3HN3A 3MV7D 2A0LD 1DDHA 3V0AC 2FWOA 3MLXL 1DL7L 4PRDB 5CP7B 3WLWD 2DYPB 5SX4H 4KU1A 4WUUA 3H9SA 3FONA 1A4JA 1HZHH 5DEFA 2OZ4A 4MDJB 4Q6YA 5DD5H 1KT2B 1NGWA 3VGAC 1KTDA 3D39E 3R0NA 5D7IA 2V5RA 1JL8A 5DLMH 4YHLL 2FO4B 3MUJA 4PRNB 1BZ9B 1RZFL 5F70A 3T0DA 4NKOA 1DTUA 4MXQD 2Z93B 4V1DA 5C0DA 2CR6A 3QUMH 4L9LB 4ZUVB 2R1YA 3TH3T 2CLVB 5E99H 5SX4I 4H8WC 1DUYB 1RUML 4P3DB 4E41E 3QZWB 3RX5A 3F7VB 4NBZB 1FNGB 1RZ8A 2WUBH 1BBJA 4PJIA 5J56B 4L4VB 4R0LA 3RI5K 4QXGH 4XP4L 4DGVH 3TFKD 3QFJD 4LF3B 5C08E 1KB5A 4Y5VA 2WIMA 4DKFL 1MCJA 1U95B 5GRJL 5ICZB 3DBXA 2EDFA 2NY6C 3WIHA 2DIAA 1ZA3A 4AL8H 4X9HA 1UM6L 5E2WL 4POUB 4Z7VE 1FNEB 5F7UA 3CDGA 4U2ZA 1VFAA 1A2YB 1GGCL 4G7YL 4WW1B 1HHGA 1RUKL 4KKCD 1HINL 1IQWH 3V0WL 2DQTL 4U6VL 5EUKB 1MPAH 3TVMD 4DQOL 3OXRA 3PGDA 3SDCA 2ZUQC 3RIFK 1YZZA 5IW6A 3KYOA 1DANU 1SEQH 3KAAA 1OTSC 4Z95L 2YRZA 4J3XA 1NH6A 2HG5A 1KCLA 5E24E 3ULSB 4APQD 4B7LA 4Y5XB 1MJUH 4ALAH 3UBXG 2RFXA 4L8SC 5EBMB 5BW7A 3MV9D 4XTRC 4JHAH 1FZOB 5IFAH 2VWEE 2E8ZA 2VQTA 4L8BA 12E8H 1RJLA 5HDBF 5B38G 3G5ZA 3S37L 1HHJB 4UAOC 4ZXBB 1YECL 3N85H 4PV8A 4I13B 3ILQC 4NRZA 4UV4L 5KAQF 43CAB 5D1QA 3TYGL 1UACL 2I9TB 1DBAH 1YPZE 4HIEB 2ZUVA 5AD0B 4QRUA 2J6EL 3V5KA 2OX5A 5TDNB 2NLJA 3FFCB 4OI9A 1FFQA 1LO3H 4QF1B 4DZBB 4HLZH 5C09D 1FG9C 4GOSA 1EVTC 5BXFB 4ODHH 4HBCL 1NL0H 3SGKC 1MIEL 4XCYB 3BDYH 1C5DA 2DKSA 3OF6A 3NZHH 2NY3D 3LEYL 4DGYH 1QSFB 1YMME 2NTFA 3K1KC 4NO0D 2C9AA 3DO7A 3V7AE 3OHXA 4F80A 2X5PA 5CZKA 1ITCA 2X9WA 5HHXH 2CO7B 2HVKA 2R56L 3OKKA 4CNIB 3FMGH 1S7SA 1CBVH 3MRPB 5EWIH 4L4JA 4Z77A 2D7OA 4HF5H 4H26A 2YA1A 3C08H 3P4MA 4PJ8A 4UDUB 1M7IB 5I9QB 5FFLA 1TETL 2QTEA 1JYVA 1B4RA 4XPFH 4ELME 1LE5A 3VFPB 5BO1L 3NPSB 4UOW0 5EC1B 5IESH 5MERA 1UEYA 4QRPA 5GGTL 3H9SB 4KXZI 1FFOB 1IKNC 1MIMH 2DWEA 4TUOB 3SKJH 1RI8A 1U8PA 2AXFB 4FP8L 4M7ZB 1JHKL 4GW1A 2EDQA 4GQ9L 4YBHA 5DD1H 1AO7E 3HNVH 3C8KB 5C0CE 3GKZA 3OQ3B 4KDVA 2Z0BA 4HAFA 4E0RB 4F9LA 4NWTL 4PY7A 3R8QA 1JWSB 2HFGL 1EEUA 1II4E 5D5MF 2IQ9H 5J7CC 3QIWD 4KTEH 4OT1L 5LGJB 4YFLI 4QGTA 1JHLH 3L3HB 3DIFA 1Q9LA 4MQTB 3W82A 2Z91A 3O6KH 3OG4B 1UM5L 4D9QD 4WTZA 3MGTA 3IETA 3EFDH 5MP6H 2D7MA 5ECJE 2L0DA 1IAIH 3QI9C 1VGKA 5I17A 3LQZA 5E2JA 5I1CL 2ZP0T 3ARRA 3VXME 2UUDK 3AFLA 5DJ8B 3BPNC 3ZYJA 5JXAH 1DVFC 3VRIA 1G9NH 4GLRH 3BKCH 1HDMB 1UB6A 1J8HB 3G08A 1VFAB 4L4TE 3RPIB 2Y06L 3OJ2C 1I4FB 4JRWA 4U7KA 2CK2A 2NYYC 1G84A 1BBDH 4JM4H 1PEWA 1SJEB 3RHWK 4YXHL 3M45A 5C0CB 5JOFA 4LVHB 3I3DA 1F6AA 4PRIA 1FDLL 4QHKJ 5T5NF 4LCWB 1T3FB 1GHFL 1NDMA 3C60A 4KHTH 5CGYD 3GRWL 2WWMD 5BZDA 3MJ8A 3TBWB 5F7HA 4F7MA 5DQDL 5J13B 3P73A 4MD5A 2CIKA 1IAIM 6FABH 2ADFH 4Z5RA 1GOFA 1U3ZA 3U9UA 4PB9H 2DL2A 2IG2H 3SDXE 3G5YA 1S3KL 2FB4H 3D1MC 2NY0D 1OGAB 2YUXA 2EH7L 3B5TA 3KVQA 2CKBL 4HQQH 4X99A 2R1WA 3EYVA 4MJID 3E2HB 4BKLB 1J8HD 3S97C 4MXWH 5CD3A 4HIEA 4YHIA 3S5LB 1QVOB 1T5XA 3ZDYE 3T4YA 5BV7C 5ICYB 1U8OA 3CFJA 1PAMA 2BNRA 1P5VA 3U2SA 5I6XC 1XF4A 3CFKB 4U6VH 5AG9A 4WUKH 3Q6GL 3QXAB 3ROLB 4GG6F 3QFJB 3L5JA 4W4NA 3T1WA 3WJLA 1JNLH 2AEQL 4KK5D 4QRRD 4R7NB 3O45B 2IH3B 3PWVA 3D0LB 4KRLB 4GSDL 3ILPB 5IG7A 3O4OC 5E5MB 4HUWA 1XH3A 3ARGD 1T7YA 1FVDB 1U3HB 2FRGP 2Y36H 4M8QA 2VDQL 5T1KB 4J4PC 1XGYL 1F3RB 3O2VH 1MWAA 5D2LF 2R2EA 3MRFA 4K71C 5DHVA 2XFXB 4LIQE 3RVTC 4C56A 2VZTA 4M8VA 2NTSP 1PG7L 3B4NA 4U0RC 4QRQA 4PJ7A 1PDKA 4OJFH 4KAQH 3MRBB 4ZTOL 5JHLL 1DBAL 5I8KL 1KEGL 3MUY1 2X4UA 1C5BH 3X3GH 1MRCH 5HGAA 3ZE0E 4U0QB 3VWKC 1CD1B 2VRAA 4XMLL 4NM4H 2I25N 5LCVH 2W0PA 4J7RA 5C2BL 3LKPA 1JWSA 4LRNH 4MB3A 2F8VA 1BM3L 1H0DB 4NKDB 3CD4A 4RAUB 1LQSR 3TVMC 3PP4H 3C6SA 5F1IB 3FOMA 4QEGA 4FQHB 4PRDA 1U3YA 2XXMB 3O81A 2YA2A 2VQ1B 4NZTL 3DX6B 2E7MA 4MAYD 4MSWA 1A4JB 2I26N 3LQAH 5IVNA 4NOFA 1HILA 5FO8A 1NUNB 1ZWIA 1N64H 4R6UA 2IWGA 4YR6A 4J3WA 5IB1A 5F3BA 1D9KD 2E6JA 3O0RL 1CLZL 2AS5M 5BRZE 2SEBB 1BFTA 3DSFL 5CFHA 4K9EH 1SHMA 3T2OA 2Y5EA 4NN6C 5J8OA 4PYGA 1DQML 4GS7C 4JFFA 5FKAB 3G9VA 1MCKA 1LMKA 5CEZE 5I66B 3E8UL 1S9WB 4ACPA 1KIRA 1PSKL 3QUXC 5K9KB 3MV11 3FOLB 1HOCA 4M5ZH 3TWCL 2GAZA 3KS0J 4OB5L 3T4AB 4OZIF 3KHOA 1I3GH 4KK5C 5AWNL 2ZJSL 2VZ3A 3JWDC 1JNNH 4DFHA 4PTTA 5F72S 2GJZB 1ZHBA 1BEYL 4IRSA 1N8ZA 3ZTNH 1G1YA 2AXHA 2ICWI 5BQ7A 5I76B 3S9DB 2QL1A 5D7KE 5EO0B 4FXLA 1HXYA 1MQKL 2Y7QA 1MJ8L 4Y1AB 3MRLA 4PY8I 1I7UB 2CMRL 2UZIL 4GXUN 4HZLB 2HT3C 2DQTH 4OF8A 5CJQH 3BE1L 1RUAH 3P4NA 4NQVA 4FNLL 1KPUA 25C8H 4M3JA 4KK8C 4WFEE 1KTDB 4Y2DC 2IMMA 2XRAH 2EDBA 1JZ3A 5I30H 1AR2A 4QRSB 5E7BA 1FZKB 2WWMC 3MYJB 1L6ZA 3CC5A 5C0DB 4N8CL 4NKMA 3HPLA 4PRPD 2AV7B 3WHXB 3PABA 2P7TA 4Y19B 1QBLL 5DC0A 5C0AE 4H0GA 3ZHLA 5DSCB 2A83A 5FUZL 4PFEA 2V5MA 4EXKA 1FNGA 1RZ8B 3QXTA 5HDBE 5C6TL 1BBJB 2YR3A 4QRUB 1YEFH 3R0MA 3WO4C 1A6ZB 3RP1A 2ZCHL 2UWEE 1BJ1H 3I2CH 2FWOB 5D72L 2ESVA 4MX7A 4XXDA 4YHLH 5DLML 1RK0B 5IV2A 2Y6SD 4U1GC 3CVHB 1P7QB 1JTOA 1U92B 2VDLH 5HYJE 4S11A 1PY9A 2C3VA 4QCIA 4PP1D 1MCNA 4D94A 1KT2A 2D7QA 3TJEL 1UKQA 5GS1A 2L7JA 2AJUH 2GW5A 1EGJA 4LIQH 2VLRD 3LDBB 2AI0L 3PXHA 2UY6A 2HFTA 2DAVA 2HT2C 3E0GA 2R0KL 4OQTL 3HZKB 1NSNL 3MRGA 3V8CA 1U8HB 1LK3L 5FYJE 1CT8A 3P9MB 1OPGL 2PO6C 2HRPL 2ZCKL 4TNWF 4D8PA 4L3EA 1DCLA 1CICB 2XQYG 1GPOL 3EZ8A 5DJ2B 4PJGB 5IEKA 5GGUA 5JR1L 4RBPK 1FZJB 2G75B 2AXJA 4K23L 4GKSB 3FKUS 2ZUXA 4ZOBA 3ZSTA 4MXVF 2KL6A 3MLTA 4DOHB 5IB1B 4PS4L 5B8CC 3QIUC 3PHQB 43CAA 2VDKL 3HMXH 1A6VL 5DK3A 3ELAT 1VEMA 2C4FU 4MNGE 1TZHA 5ALBH 4M1DL 3TBYB 4KAQL 5C0BA 4G6ML 1I8LA 2XZAL 4RDQF 2WBJC 2R69L 3DIFB 3RUGA 4GG6B 4JQXC 4GO6B 3L9RA 3K3QA 4ODSH 4G8EB 3V6ZB 3CAFA 5FF6A 4DKDC 3U0WH 1UGNA 4XCYA 1DBML 4R97B 1KXTB 1QOKA 4KHXH 3HRPA 2GAZB 2O5ZH 5HHME 3HE6B 2X1OA 1QLFB 1TCMA 4HC1H 5HVGB 2NY3C 2Q7NA 4IDLA 1EHNA 3VXSB 5KANG 3WL9B 3SE4C 3HR5B 2HKHH 2GTZA 4NQSB 5DRWB 1LO4L 4WDIA 4G7YH 3GK8L 4U6HB 4PJEF 3IFPB 1D9KB 1B2WL 4PV8B 5F96L 4H26B 4PJ8B 3MLZL 2I9TA 3RWEA 3VCLB 1L0XA 1SYSB 1QSFE 1WCBA 5L2KE 4MAYB 5GSVB 5T1DL 1F13A 1JWUA 3IRPX 1JF1A 4HUVB 2Z31A 1E6JH 2JLLA 3DRTA 4OGZA 1DBKH 1MRFH 3CDFA 3TBWA 3U4AA 3P73B 3ZDZF 1YEHL 2MCPL 1CICD 4HF5L 5IGXH 3MV7B 2E9WA 3SBWC 1KLUB 3BEWA 2DLFH 1CN4A 4FFZL 4KRNA 4TOYH 4WW2B 3EDKA 5DJAA 2OI9B 2B8OT 5GPRA 2C1OA 1TMCB 3IFOA 3TBVB 1NCCH 1UKSA 3MSPA 4OZGE 3QFDA 4EI6A 3ILQD 4DGIL 4OCYH 4HPOH 1Q0YL 3O3UN 3CVIL 4R96B 5E99L 2VSDA 3QNXA 4OGXH 4W6XB 3ZKND 1L7TL 5CCKL 1GGBH 1OAQL 4I9WD 2PYEB 5F71A 5D2NE 3ARVA 1DQJB 3INUH 2AJVH 4WU7A 3ARPA 1OTSD 2YZ1A 25C8L 1J8KA 4LCWE 1D5MA 1ZV5A 2K7PA 1DE4B 1GOHA 1W8OA 5CJXA 4JQVA 4DEPB 1UM6H 1P5UA 5FYKL 5C0CA 2Y07H 5HHOE 5LXGH 3MLXH 1K2DA 2FECL 5L8JB 4RAVB 4I2XB 3PG2A 1AGFA 1OY3B 2C1PB 3GMPA 1RHFA 4L4TB 3DPBA 1HK6A 2VLKE 1UA6L 5JLZA 2JCCE 4WENB 1EHLH 2VB5A 3D9AH 3DSNA 1I1RA 1QRNE 2VE6B 2VIRA 5DJ8A 5E8OA 2R0LL 3CFCH 3T0VA 1K8IA 3D39B 1FDLH 3MODL 1GOGA 2ZKHH 3RPIA 3O8XD 3BGFC 3S5LA 3L3DB 2DWDA 5SX5K 3L3KA 4M6MH 2FBJH 4PG2C 5E70A 2ZG3A 1TZIA 2BVQA 1AD9B 4ZQKA 3MRRA 1FL3A 3PL6D 1IEAB 1O7VA 2J3SA 5I1GH 5F9DC 3OXSB 4BFGA 5JQ6H 2EIEA 5ICXB 1NEZG 1NDMB 1OTTD 5B39B 3KPRA 3QDGE 3MJGX 3O45A 1QKZL 5C0FA 1ZWIB 1G7PB 3S96A 4HUWB 5C07B 3VFRA 3RGVC 1YMHB 3D6GA 3UO1L 1S7WA 4IOIA 3S88H 3I84A 4Q74A 2P8MB 3BN9C 4KGJA 4ZUUB 5DHYB 5AYUL 3LIZL 1OM3H 3RPKA 4HDIA 3R4DA 5DXWA 3O2DH 3P0YH 3VI4F 3F12A 3KPLA 3QEGL 4M7LT 2EH8L 2YC1A 4AH2B 4P2OA 1A1MA 1DN0B 1W2KT 4EDWH 4L4VD 4Y4KB 3UEZA 4FQ2L 3IVKA 5ICYA 4JFFD 5IFAL 1RULL 1HXMB 2P1YA 3ARFA 1Z0NA 1P7HL 4JZJC 1V3MA 3L5WA 5KJRL 3MRIA 4MD4A 4ZYKB 5FYLE 1T7ZA 4NCDA 4JY5H 3KYMA 2AABH 3DXAB 1KLGB 4XVUC 3SKJL 3V7MA 3S4SB 5L9DL 4K8RH 1OP5K 2V5YA 4M6NL 4NGHL 2FATH 4WNQB 1XH3B 3HA0A 4U33A 3QUYC 4U6XA 2BC4B 3CZJA 4ZUWB 4M7LL 3C6SB 1YEKL 4P4KD 5K9JL 3VH8A 1MCWM 4DW2L 5JW4N 4KVCL 5INDB 1RUPL 1WWAX 3GSRB 4EI6B 3HC4H 4CMMB 4Y4HA 2V9TA 3I75A 4HT1H 8CGTA 3BKJH 4HFUH 5TPWH 5DMGD 3Q6GH 4YDLC 4FABL 2F74A 1UM5H 5GZND 3WNMA 4DGYL 4GBXA 4JPWH 2FX7L 4NM8L 4Z78B 3AY4A 2MFNA 3FMGL 2XTJC 3RDTD 1EEZB 2NY3B 3CDCA 3IU3B 4LPYA 3MLPA 1CFQB 4EI5A 2I27N 1NDGA 4XPBH 3TJHD 2OM5A 1EFXD 4UOW1 4Y5XC 3M1BA 5CWSB 5DF0A 2Q7YB 3BGFB 3OV6A 4FP8H 4XNQB 1MI5E 3KG5A 2MOVA 3HG1B 1IMHC 5IESL 4GG8A 2AVGA 3D3VA 1S7VB 1MCRA 5EIIB 1RURL 1T03L 1ZHBB 2DTSA 4DCQA 5GGRB 5K33A 4F58H 4XCNA 2H45A 4U3XA 2C3VB 2Z92A 3KPRD 3SKMA 3GMNB 5TE4H 5TFSH 1M1SA 4FQJL 1AD0A 4HKJB 3T77B 4EXPX 3GRWH 5C08B 4LU5L 2D4DA 4JFOB 4UI2A 1AO7B 1J87A 2ESVD 5E00B 3F65A 2CLRB 3LSOB 1T2XA 1ZSDB 4WU5B 3KYKH 4PG9A 5BVPH 3CH8A 3L5HA 4L9LC 4C58B 4AIZA 2Y4SA 5EUOF 3MBEB 4RX4D 3MROB 3VXOB 4BUHA 1QFWL 4I0CC 3PQYE 2A6DB 1CGXA 1IEAA 1RFDH 1JGDA 5ISZA 4DKEH 5E5RB 2X4NB 5IROC 2X4PA 3IJYB 1DQQB 1EJ6A 1K5NA 2MJWA 1TNNA 2J5LB 1F00I 2HTKC 3UZEA 3WHXA 3EOBA 1YN7B 3K74B 3ZZ1A 1YNKH 4Y4FB 4UT9L 2BVPB 5E0QA 4CU6A 4WV1C 5HHQA 2CKNA 1E4XL 2X41A 5FECA 5HI3C 3U1SH 2D0FA 4ZTPL 4F8QA 4PJ7F 3BD3A 3UTQA 1LNUB 1Y18B 2OJEA 3C2AL 4O02L 2ESVB 3PNWA 2H9GB 1ROWA 5L2KB 2ZOKA 5ACZB 4JFPB 2YC1B 2R69H 2UYLB 4H1LG 5C0BD 1ZGLB 2XYCA 1MFDL 4N8CH 3WJJC 3TO4B 4C83A 2Q86B 3BH8A 1GZPA 2UVEA 3WE6B 3MODH 3TP4A 3IF1A 4QXWA 3C8DA 4XTRD 1U8NB 4KJPD 4JLRB 1TNMA 4ELMF 4UV4H 4JO2H 3SGDI 3U30C 4RFNB 5F93C 1Z0MA 1OT1A 1XMWA 1WUNT 3WHE1 3K8LA 1A7PL 1QFOA 1A6WH 4GKNA 4JFXB 1P4IH 4MWFA 3ESVF 3ZDYF 3MRGB 4AEHH 2XWJA 2O5XL 3JV6A 3LY6A 3PWJA 3MRHB 5IQ9B 3VH8G 1H9VA 3MGOB 3RVXC 1Q38A 4J23A 4D8PB 3V5HA 1ZOXA 5IVXB 5LAXA 4FNLH 5D7LD 1OW0A 1Z9LA 5A2LH 1OF2B 3QAZB 4N1CA 2DJ4A 2AJUL 2Z31B 3HB3C 3LEYH 3GFUA 3QWQB 4LIQL 2VXTH 4LOUC 4PTUA 3UTPE 5IBLD 4PLJD 5I6XB 5MENB 4ZOCA 3K0WA 4MNGB 5EU6D 2NW2B 1NFDF 3MO1A 1UT9A 2GTWB 3O8XC 3HZYB 3FB8A 3WMSA 1RUKH 4I48B 1DFBL 3TPUB 5CIPH 3U0PB 1D5IH 1LK2B 1IGMH 3V4UL 1M7DB 1MH5B 3DHMA 5DHVH 3TA3D 3GB7B 1CFTA 2XV6B 4OFYD 2Z8VC 2E7CA 4CAGA 1NANI 3RTQB 2E9JA 2EDOA 2HJLA 4H8WH 5GGSB 4D9RD 3MRNB 3MLVH 3RGVB 3FO1A 2CKBB 4S0SD 3EBAA 1J05B 4NO0B 4NQDD 3FQUA 4GRMB 1T1XA 5C8JA 1S9XA 5CHNB 4M1DH 2IPTL 4FFYH 4RWYL 1GGIL 3GSOB 1RZIA 4PGDA 4G8FA 4YDKL 1M6OA 3TF7C 3U9PL 1WWCA 1OAYL 3D5OF 3GJEB 4PB0L 5AAMA 5JW3L 4W6YB 1I9RL 2QSVA 4X4YA 2PO6D 4JG0H 4ZS6C 3SPVA 1XT5A 4MHHG 1HE7A 5EBWB 1D5MB 3DX9A 3TEUA 5SV4A 3AXLB 3O9WD 3Q1SL 4XT1C 1NUDA 3LZFL 5CSZB 3NCFB 2ITCA 3MUGB 4U1JA 3S34L 3VGEA 5E2WH 3DUSA 4OCWL 5EU3A 4AIZB 1BQLL 4DN3H 1UC6A 4QXTB 3G6JF 4UTBL 5B3JE 4ESKA 1NAML 4X4ME 5ISZB 5JIPA 4LNRA 2CGRH 5IVXE 3BEWB 2B2XH 5DEGB 1K4DB 3FB6A 3G5ZB 3Q5YA 3GO1L 3EO1A 3KNBA 3ZMRA 4G43B 2HLAA 3DV6B 4K7FA 3DTXA 1H8OA 1JRHI 4OLUH 3TA3B 1PZUB 4OAWA 4U1NA 4X4XA 2EIBA 4CN6A 3QQ9D 1AD9A 5DDHA 5AWNH 4HULB 4R3SA 4M93C 1EXUA 4UMGA 5IIEA 3OJDB 4JKPH 2R2HB 5CGTA 2EC8A 4JFPA 5TH2B 4OCMC 4OGYL 5CP3H 2BY2A 2G60H 3B9AA 2BSRB 1ZGLA 4ZNEE 3SJVB 1SY6L 3LS5L 3N50A 1NGWB 5BOPA 5D70H 5ILTL 4ISVA 1AXTH 1T66C 3QH3A 4EBQH 1Q0XH 4ZD3H 4TQEH 3C6LD 1OTUC 3MV7A 1OWWA 1UJ3C 4JM2D 5J3HD 5GRUH 4WEUD 2OXGA 5GS2D 4JFXA 4HIIA 2BERA 2CIIB 4PYHA 2EXWD 1R3LB 2R2BA 5HGHA 1ZGLM 3PWJB 4NIKB 2HT2D 4O4YL 4WUKL 3ARED 5FHAL 4Z9KB 4YGAB 2OZ4H 3LKNA 3O6FB 1MCWW 4R0LB 4TVPL 3GEWB 4NQEE 3OKDB 3QO0B 5ESAA 5HHOA 3IAPA 2R0ZL 3LVEA 1QBMH 4N8VG 3CH1B 4HFWA 2H1PH 2NX5A 3EAKA 2XN9E 4P23D 3EJYD 1OD7A 3WS6C 2N4IA 1ZXQA 3MJ9L 3DROA 4PV9B 1MFDH 2HWZL 3D2UB 4OLZL 4GBXD 3WO4B 4FQ1L 4QHLA 3O3EB 5HI5D 3SY0B 2HH0L 3H3KA 1U8KA 2D03H 3ZTJH 3EYUL 2Z4QB 5E94B 2E5EA 2WMPA 5IHUH 4NN6B 3RI5F 3VXUB 5D5ME 3SDYL 1VPOH 1FNSL 5MENE 3IGAB 1M05A 3CFCL 3VFMA 3ULUF 5EUOA 1WV7T 5C07A 1D5BA 1YMHA 4L5FH 1ADQH 2P5WA 3QHZH 2B4CC 1NCNA 2QJDA 3VG9B 5IBUB 4OKDA 5DK2B 4BZ2L 1MRDH 2O5ZL 2NW3A 2H32A 4O2CB 2FX7H 1CF8L 3CMGA 4N0UE 3ARDD 2HKHL 1IQWL 3V0WH 5E1HB 5D8JL 3QA3A 3VGHA 1F45A 4NYLA 1B9ZA 2IAND 2IGFL 1AR1D 4Y4KA 4O51A 4G6KH 1JK8B 2OL3B 1UXWB 4X9BA 1T7WA 1TQCC 1YNLH 35C8H 4KTYA 2W9EH 3UAJD 4PJ9C 4RQQA 2CDGB 3V2AR 3VD4A 3KPSA 5F9AC 4RMSA 1KCRL 2QQKH 2OK0H 4XVSH 5D1XB 3X12A 5ESQA 2XTJB 5E08L 3EO9L 4KK9D 5DWUL 2FGWH 4ORGA 4ZUTA 1BVKB 4C55A 4F58L 3PL6A 3R06B 2V2TA 2BC4A 3QUMB 3ULVE 3BPLB 3OKKB 4FQJH 5AZEH 2VXUH 1EAPA 4HJ0D 4PRPA 4R4NC 1E28A 4HGWB 3B9KA 3PWPB 5IGXL 1T7VA 1NUGA 1WZLA 2JIXD 2VMFA 4QT5B 3T0EB 1QYGL 4N0YH 4MZ2A 3IDMB 1E4XI 3CPLA 4TOYL 4R3SB 3HE7D 1CZ8L 1A1MB 3SGDH 3HNVL 3BT2H 3MMEB 3HG1D 5LKNA 3KWWA 1IAKA 5SX5H 3QEUB 1CFQA 3BJLA 1WC7B 4EN3D 4HS3B 1EHAA 2YD8A 1SEBB 3PHOB 4YDJA 3QWRD 5T1LB 5CCKH 1CWVA 1R5WA 2OMBA 3G5VA 1YNTB 3WFZA 4HT1L 3SDDC 2IFFH 1ZEAL 2R0KH 1EHXA 5EU4B 1N2RB 2XZCL 4OZHF 3WUZA 4D0CB 1HH6A 3PNWB 4OZHA 4GRLA 2DYPD 1A14L 3TIDA 3BP5A 4QRQB 4PJAE 2EXYD 5I17B 1MAMH 4IHOA 4OD2A 3QDMA 1T0MA 2GITA 3DMMB 3IXAA 5D6DC 4ZOAA 1LO2H 4YNYA 5J13C 4ODXB 1F97A 3C6LB 2AABL 1QBLH 1KCSH 3WFCL 2AEPL 3ARBD 1XFPA 2MCG1 1A02N 2LU7A 2GI7A 4JZNB 1MHEB 2VYRE 3D2UA 3X11B 4RGMC 2HJFA 1BQHB 1KCVL 1W0VB 4J4PD 3OBAA 2RR3A 4LDOB 3MA9L 1DQLL 1BOYA 5TDPB 2HFFA 4JO4L 1T89A 2WV3A 2X7LA 3QDJA 4X5WA 3H7BB 4HFUL 3CXDL 4XVJH 3RVVD 2X44D 3PGFH 3INUL 4TVSa 3HI6L 4MMZC 5GZOD 4BK5A 4YR6B 1MLCA 3EOBB 4MD5B 4Y4FA 4OZ4A 3F7QA 3FQWB 2VH5L 1K4CB 1DUYA 1AC0A 2E9BA 1C7TA 4MVBD 5DVNA 4TVPH 3MRCB 4HKJA 3WN5B 2XZZA 3BZFA 4I0PD 2NY4B 4UT6H 4LLDB 3Q5TA 3UTSD 3H9HB 5ADPL 4HIJB 3NZHL 3BWAB 4NJ9H 2A9ML 2VXQL 1DLFH 3THML 5BV7H 4JRYE 4JZOB 2DLHA 4OCRH 2CKBA 4L9DA 3TV3H 2FHBA 4GAGL 5BMFL 2F5BH 1Q9OB 5F1OB 1FLRH 5IEHB 2Z9TA 3CSYA 4RA3A 3QEGH 2CDGA 4HLJA 5IJKC 1MLBA 1WBXA 3LRSB 4I0PB 4XCFL 5ALBL 2JKXA 5C3LD 2ADGB 3P3YA 1JRHH 5I76A 4YPJA 2PTTA 1I8KB 3SN6N 2ZG2A 1XIWD 1T21A 5I9QC 5KJRH 1MHPL 2DLFL 4Z7WA 2H6PB 4M1CD 1I7UA 2PXYC 3T0EE 2APTA 3EGSB 4RGNE 5C0IB 3UTZB 1OLZA 1QQDA 1IQDB 1QFWH 1FGNL 1VENA 3MV8D 2B1AH 4JHWL 5GIRB 4QT5A 3T0EA 4C56B 1U6AL 2AK1H 3SDCC 3CPLB 1WTLA 3QXWA 2CRYA 3V9FA 3WE6A 4RFEB 1VCAA 2D7PA 4I1NB 4FFVC 5IWLA 4JLRA 1ND0A 3TJEH 5HYSB 3ZHKA 4JY6B 4DAGL 4QKXB 3KPTA 4TSAH 4HS3A 1JZ7A 2A77H 1UZ6F 4ZODA 2HVJB 5ID1A 4EZMA 3PJSA 3O41B 2HJLB 1R5WB 2KZ1B 4PREB 1NC2D 4NKDA 3RVUD 4RGNC 4KQ3L 2NY6D 3MNZA 4W6WB 2OBGA 4Y8DC 1Q72H 1HH9B 2B4CL 2JIXA 2VLME 4LLWA 4NQCD 1J0KA 4KKBD 3FOMB 1U93B 5MERB 5DJ0B 3GSXA 5KN5A 2X4OB 1NEZA 4E9LA 1HILB 5C6TH 2V2WA 5E6IC 5IJVB 2VTFA 1JZ8A 3WCYA 2EEBA 4YNYB 3ZL4L 2QR0B 2GIYA 4AIOA 3BEVA 3KPNA 3TYFA 1AR1C 4FQQA 3IKCA 4HIXL 3W2DH 1MREL 4LPWA 5DQJB 4QHMA 4JFEA 5H94A 1NFDB 3Q3GB 2BNRD 1VEOA 4RGOL 3C5SB 1PSKH 5FA4A 2YPVH 4UILL 2YXMA 1YQVL 1KFAH 3CJJA 4EQ2A 2WW8A 4KVCH 4GRLC 3FT2B 4PJDB 3IETB 4Y2DA 4G8GD 2QEJA 3SE3C 4L3CB 2B39A 3OAUH 5FDYA 3H7BA 4XAKE 5T33H 3WKML 3O9WC 2HJKA 5KS9A 3N1QC 5IMLB 2X89D 4OZGB 1NCAH 2XN9B 3ESUF 3T0EC 1BWMA 4HCRL 4XP1H 2I9LB 2AK4A 2X09A 5KSAB 3MGTB 3TBYA 5IHZB 2XWTA 4NKIL 5JO5B 5I73C 3TT3H 1TVBA 3LKQA 3MJ9H 5F3HB 4FS0A 3FCTB 4D9LL 4Z7WE 1RURH 4C4KO 5GISH 4HIJA 1DBJH 2DOCA 4PJXB 3WFCH 1X3DA 1CLCA 1W0WA 3VXUA 2A74A 2PKDA 1DVFB 2NY7L 3TVMB 5KS9F 2P43B 2BNUB 3C60B 4P0DA 1C12A 1UCTA 4RISL 2VDML 3UTSA 3O4LE 4MNHB 3MJ8B 4HAGA 1F3JA 2R0LH 4BQCA 4N1EA 2MKLC 5E2TL 1FZMB 3OKMB 4WWID 4X7DC 3SDAB 4TTGA 5IOPA 3JVGC 2CIIA 4LASH 2L4OA 1SBBA 4M48H 2X4TA 1T21B 1EBPA 4GUPA 1PFCA 4LCWA 2ORBH 1F4WL 2DQCL 1G7MA 1AHWC 1QVOA 1TZGL 3EYSL 3WIIL 2NX5D 5K9QI 1T4KB 5D93B 4N9OB 3BE1H 4TSCH 5D8JH 1WK0A 2BNRB 1JGVL 1EXUB 1P1ZB 4HFWB 3P9WB 4PLOB 1RAMA 4Y4HD 1CDUA 4WWKB 1CDHA 4IRJD 3IFLH 3SKOB 1WZ1H 4RAHA 3QQ3B 1KG0A 4H1LB 2LVEA 2LQRA 4WHTB 4L8SA 1O5DT 5ALCH 5CJOH 3DX7B 1NCWH 4Z7VA 3IXTB 1X6NA 3O6ML 3CGTA 3TO2A 3U7AA 4F33A 5CJ8A 4LEXH 4X7SL 4PRPB 1U3JA 4O02H 3QFDB 1R3LA 4BJLA 2R4SL 1NMCC 3ROLA 2VXUL 1BLNA 1WFOA 1G7QB 3DSFH 4MLSA 4G9FA 1TVHA 3QNZB 4FFZH