3VE0B

Crystal structure of sudan ebolavirus glycoprotein (strain boniface) bound to 16f6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
DIVMTQSHKFMSTSVGDRVTITCKASQDVTTAVAWYQQKPGHSPKLLIYWASTRHTGVPDRFTGSGSGTAFTLTLNSVQAEDLALYYCQQHYSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for differential neutralization of ebolaviruses.
pubmed doi rcsb
source organism Sudan ebolavirus
molecule tags Immune system/viral protein
molecule keywords Envelope glycoprotein
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B01
1JGDA 3K1DA 3MOAH 4OCRL 4Y5XC 3WXWH 2AS5M 4YHNA 1YN7A 5JO5B 3H9SD 4OZFA 2VLRD 4QWWD 1R24B 5TE6L 2BY0A 2EZ0C 1YPZF 1UCBH 1QFWH 1X5ZA 3OKEA 4YHML 1J12A 1U8OA 5D93C 4NQEB 4Z7OE 1KTRL 4G6KL 3ARBA 1DL7L 2DTML 2AJYL 4JFHD 2GTZA 3MMEB 4MXQD 5C0CD 4JFFD 1UJ3C 3HI5H 1QD0A 4KKLD 4O5LL 1AD0A 5C0AB 1NAKH 1YPZB 3QIWB 4A6YB 4ELKB 3FL7A 5DUML 5T1LA 2NYYD 3FB6B 2VNCA 4HQQH 4WY7L 4K3GA 5CUSL 4NO2A 2GUOA 4NNPH 4OZGE 3VXRA 1RHHB 4LHUA 5EO0A 1PZUB 4DZBB 3EO9H 3DYMA 5GGSY 3P30H 4RFOH 3CCHB 3FFCE 3EBAA 4KY1L 1TQBC 1SJXA 5FK9A 5E2TH 5C0FB 3NGBC 5IUSA 1NGZA 2BVPA 1SJEA 1HI6B 5EOQL 5DHVH 5C0BE 2MOVA 4MA1C 2MTPA 3QUXD 1QQDA 2VDRH 1KGCE 3NFPA 3W11D 1CGTA 1NCCL 3WNNA 3U48A 5KANG 4TUKL 1F90H 4ZMAT 4RFEB 4PJHB 1RIHH 5FOBA 2KZ1B 3WLWC 1LDPL 4NQDE 1P7QB 4NZJA 2YD9A 3WO4C 4OZHB 4E0RB 1JYXA 1IBGH 1HKLH 3H9SE 3PV6B 4MD0B 2NY4B 2YBRB 5KS9F 2X4UA 1H3UA 3JWNC 1EGJA 1IKNC 3S5LA 5I6XC 3VFPB 2DLEA 1JZ5A 3KGRA 3TJEL 4JZJA 1YEJH 2APFA 3PL6B 1WLHA 3LH2H 4WI3A 2D7NA 2Y36H 1G7QA 1G7PB 3MNZA 1EHLL 3QSKB 3VXMD 2YRLA 4KROB 2H3NB 4FA8A 1XF5A 5FYKE 5HHMD 1XCTA 1NCBL 1CXFA 1T04A 3BKYL 4M48L 4W70A 4MDJA 5IV2A 3VXSB 5SWZE 3QA3B 4KHXL 4GKSA 4XCCL 2VLRB 1NFDE 1R6VA 2NY1C 4G7YL 3AMLA 4PRPE 1ZLWH 3V8OA 2NY0B 1MREH 4AY0A 4KJPC 3TZVA 2LAAA 2VDOL 3NIGE 1DQTA 5BXFA 4I13B 3OKMB 3C5ZC 1OP3H 1ZLVK 3GMOB 4S1QL 2YD5A 1MH5A 2F54B 3QYCA 3JTTA 1AGBA 5DZLA 2XFXB 3RJQB 3WLBA 5HVGB 1NLBH 1Q9KB 1YEFH 5C2BL 1OW0C 3CFIC 1YQVH 1R3JB 1X4ZA 4M6AA 3IVKA 1IZJA 1H0DA 1X9QA 1TZGL 4OAWB 2V2TA 1I7ZA 4DGYH 4F7CA 1D5IH 1P84J 1S7XA 2VZVA 3L5XH 4XWOD 2EH8H 5GRJH 3BFOA 2HA1A 3KXFE 4XP5H 5HHPA 5INDA 2XZCL 4P2OC 5FUZL 4F8QA 4Z7OF 4MB5A 1I7TB 1T7WA 2J88L 4M1DH 4ZXBD 2DLFH 2XPGB 4Y1AB 1WBXA 4GMSL 1ACYH 4JRXE 1GH7A 2DD8L 3P9LB 2V9TA 2QADD 4DZ8B 4KK6C 5GSRB 1YEGL 4XVUD 4LBEB 4PV9A 3QXDB 2FDBP 2BY2A 3RVTC 5GS2H 1U2HA 1EEYB 3GSRA 5ICZB 3O2VH 4H1LH 3FQRA 4YHZL 1Z9MA 1I1YA 2HVJB 4TVPE 4L8DB 4NHUA 5E00A 2BSTB 5DUPL 4LVEA 1CG9A 4HS8L 2UZYB 4Y8AA 2K7QA 1TVBB 4JFYB 3VWJD 5ITBL 5LGHL 1A1OB 4WTZG 1QFOA 3MLYH 5T33L 3W9DB 1T1YA 2MWCA 1H3WM 5ITFB 4AENB 4UTAL 1S8DA 3KPMB 1MCIA 3HZKB 3REWA 1D6VH 5E8PA 5BS0E 3FRUB 3P0VL 1I9RL 1EO8L 3FCTA 3CSBA 2JCCF 4OD2B 1MIEL 1WWWX 3EDDA 3WFHA 2VDPL 3IXTA 1H5BA 3FAWA 4JPWH 1LMKA 5E94B 4CU8A 5CKGA 4NM8L 1MRFL 4RSVA 3VI3E 1OTTD 1A2YA 3FO1A 2PTTA 2DLGA 2A74A 4PJ9C 5FXCH 5IJKA 3AB0C 1EO5A 2PW2B 2AV7A 4XMKH 4WUUB 3NCJL 3MRJB 2DMBA 2CUIA 2MHAA 5JW3L 3LKNA 4ZFOL 4HMCA 5C0RL 4P59L 5JORB 2XZZA 3DO3A 3HPJB 1MHHA 4FZ8H 3L3OB 3CK0L 4MJIB 3IAQA 1WBZB 5JIHA 4EUPG 3C8KA 1TETL 4YPJA 1JPTH 2FX8L 3SKOA 1V8HA 3FQUA 5I8KL 1S5IL 5EBGA 2JCCB 3OKDB 1BBJB 1DANU 1FSKB 4OLWH 4BYHA 4OFYD 5GJTH 2FR4A 5CUSH 4JHAH 4KZDL 2D0FA 5FOJA 4XNXL 4HLZH 2YD3A 3MLRH 4EIZC 3U0PB 4QRSB 3I50H 1OAUL 3RGVB 2FIKB 2Y72A 3MRHA 2AXGA 4YX2H 1L4IA 1A6UH 5E2TL 3EJYC 1E4KA 4CDGC 1UT9A 1ZT4B 5INCB 5DTFB 2ZOLA 3O6FB 1FO0H 3QRGL 2ZCLH 1G7LA 5AEAA 4N90D 4GRMA 4Y19A 4U1JB 1NCDH 2VR5A 5DDHA 4S1SL 3DGGA 3Q1SL 4GLRI 3H8NA 3NFSH 2FSEA 5IJVA 3QJHA 4JANB 2P8PA 1AE6H 1AKJB 3RJDA 3MRRB 1J8HD 4X9FA 4DVRH 1NSNL 3T0DA 4RISH 1HZHL 3MJ9A 5IQ7L 5B38B 2IBZX 3K81A 5K9JH 1NGXA 4ZAKB 1MI5D 3MGOB 1JYNA 3BDYH 4LCUB 2LU7A 4LLUB 4M6ML 1CFVH 2CIKA 2H2SD 2WUBH 4TQEL 4PJCE 3LN9A 3DURB 4P3DB 3ELAT 1EA9C 4YDJB 4E41E 4WENB 3WHE1 2Q8AL 4OLYH 2VOTA 1J0IA 4XCCH 5BZWA 1DVFA 32C2B 5T1MA 5FGSA 3Q6FB 3IU4L 2IJ0C 1MREL 3L3HB 3MRLA 3HAEH 3FB8A 5GS3A 3CX5J 3U4EA 1CGXA 3D85A 4XBEH 1VACB 2YC1A 3GO1L 3G08A 2NY5C 1NLDL 5ID0A 3GDBA 5DVKA 1NGQH 2DQGH 4BUHA 4CVZA 4M6NH 1J5OH 2XQYG 3I84A 2JB6A 3GB7A 4EDWL 1F3DJ 5MHSD 4ONOA 1RJCA 2QTEA 1CLOL 1YPZA 4MMZC 5BS0A 1TZGH 4H8WH 4RAUA 5E4EB 2IH1B 4FTVD 2J2ZA 4ONFL 2EH8L 5GRJL 1A21A 4AMKL 1M4KA 3AM8C 3QFDB 4FXKB 3MRDA 3EOTH 3C08H 1TVHB 5K9OB 4NQDA 8FABA 3FHQA 4M5YH 2VXVL 4YHLL 2I9LB 5CILH 5IOPB 1OGTA 1C7TA 1ZS8A 3G6JA 1L0QA 2EICA 1I9IL 2HKFH 2WV3A 3MRCA 3ECBA 1FFNA 4ODXA 3WHXB 2DLFL 4GRLD 3CMOL 5BV7H 1ACYL 1L7IL 5FO8A 4F8TA 3AC0A 4RGND 5D9SB 2AQ1A 3TH3T 4RNRB 3VCLB 2O5ZL 1KB5A 5KVMC 4LK4A 3DUUB 1XH3A 2IAMB 4QXWA 5F6HJ 1ZT7B 1J18A 1U3HC 4HC1A 2I60L 2G2RB 4X4MA 4ZXBB 3QIUB 4KK8D 3EYUH 4O4YL 3PE9A 4M7KL 2Y6SD 3PQYE 5D6DC 5DRWB 2VR4A 3LDBC 4XP6H 4CGTA 3RIAF 5D8JH 2WLZA 4I77H 3QO1A 5GRZA 2Q6WB 4GAJL 2Q8BL 2E7LC 4FNLL 4QHMA 4CAGA 4KTDH 1UJ3B 2DTSA 1MY5A 4MLSA 5J3HC 4HC1H 5D7IA 4JFDA 1OM3H 3AS2A 1MFCH 4Y5YA 4WGWB 1EBAA 3VXUE 4LLMB 1U8JB 5ERWA 4JRXA 4G42B 2OL3B 3VFVA 1TTGA 3S35L 4E42B 3I02A 3ZMRA 2FIRT 5GRUL 4LRNH 2HRLA 1EFXD 5EBMA 5E5MA 4XMKL 2Q86B 2AXJA 1YMHA 1ORSA 1ZT1B 4PJHF 5DRXA 1E6OH 3V6FB 3CU1A 3L7EB 4O00A 1UH2A 4NN5B 2YD8A 5C6TH 2B0SH 2ADGB 4LCCB 4I2XE 4UOJA 3NIDE 3WKMH 4OD3H 4JN1L 4FXGB 1CF8L 3RNQA 3SDAC 2E9WA 4W6YB 1HK6A 5I8KH 1RJLA 3FZUC 4DN3H 5SWQA 1DQDH 1CYGA 2KUTA 1YECH 1JPGA 1YMMA 4LARH 3EUUA 4QRQA 4TSBL 4Y16A 1ZVSA 3ZKMC 5EZLB 3CSPA 4LRIA 4ZFOA 1KN4L 2BSSB 3TWCL 1IM9A 5E4IA 2FL5B 2QKIB 3BN9D 4PY8I 1MUJB 2I25N 1U8KA 3PV7A 4PREB 3HC0B 2FJFB 4C55A 5TFSL 4NQCD 4J7RA 2JB5L 3SGDH 3VRLF 3UTTD 3MBXH 2J8UB 5IWLA 4IRZL 4Z0BL 1AQDA 2AJUL 2QR0B 3VE0A 5IW6A 3UTSA 3T2NL 4Z7WF 3JXAA 2CXGA 3KPSA 3TCLB 1P5VA 4ZO7A 3HR5B 4UB0H 2XG5A 1CDIA 4RGNC 4WFED 3S36X 5M95B 4QXTB 1WICA 2DB8A 3TBWB 3RVWD 4KK5C 1M05A 2R2EB 4I48B 1X4XA 4ODUB 1KPRA 3HC4H 5DD1H 4EBQL 4DKEH 5EZJA 1T22A 4HEPG 3U0TA 1FZJB 1VADB 2HT2C 2RFXA 2HT4C 3QPQD 1S8DB 2AQ3A 1ZHKA 3MCG1 4G9FD 4LQFH 2XZQH 4JRYB 5D1QA 4JR9L 5C0AA 4ZUTB 2E9IA 1CFVL 5IMOA 1DBBL 2CLRB 4K3EH 1DFBH 15C8H 1NAMB 5DHYB 5E2WH 3M45A 1BOGB 1JWUA 4Z7WA 5EUKA 4PRAA 4BSJA 1IGIL 1YEIH 4G6AD 3ZO0A 2GUOB 4DOHE 2HG5B 2OZ4L 3C9NB 3VRIA 4X6DE 4H88L 2R0ZH 1A7RL 1FH5L 1D6EB 1T89C 1DQQB 1CBVH 3MJ7A 4FQLH 2R8SH 1VEPA 1PY4A 3HPLB 3UP1A 5FV1L 5A2FA 2MHAB 3DHJA 1IGTB 3WIHA 3BEVA 3QCTH 4M7LH 1NUNB 2BHUA 4Q6IB 4M6NL 3CVHB 3DRQB 4S0TD 3P4OB 4X7DC 5AWNH 1I9EA 1N3NB 1KTLB 4RWHA 3RVWC 4ERSH 3RTQA 4MNQD 4FQQA 4NCC1 3U36A 3NZ8A 2HYMA 1FG2B 5EU3A 4LAQL 4H8WL 2ZSVB 2CJUL 3V0AC 2YBRA 5F9AC 4DKDC 3MQIA 1DE4B 4XP4H 1OAXL 3ARGA 5F3BA 3WJLC 2FR4B 3WIHH 3RWIA 2J5LB 2D7TH 1Z2KA 2PXYD 1AO7E 2OK0H 5FYKL 3MOBL 3VGHA 3KHQA 5D7LD 4OF8A 1FGNL 2FB4H 4ISVB 4MA7L 5E8DH 1G7QB 3L5WB 4KRNA 1FL3A 1ONQA 2WUCH 4POUB 3CFCL 2JE8A 3F12A 1XF5B 3V7AG 3RWDA 4JKPL 4U4BA 1WFUA 1G1CA 1L7IH 1UEMA 2COQA 2W07A 5D5MA 4ESKA 2QQLH 2IH3B 1BFOB 3M8OL 1GGIL 1HN1A 1TPXC 3LV3A 4LKCB 5KVDH 2A73B 3I9GL 3ULUH 2H6PB 1FL5B 3O3AA 1NGWB 4MXVF 1JPST 1ZVYA 2MPAL 5I66A 5KSBA 5HGDA 5TDPB 5D6CB 5HPMA 5CP7A 2Y1VA 4IJ3B 4M7LT 1YNTA 3O9WA 5DJDA 5EUOF 4P4KD 3TPUA 4Q0XL 2H1PL 1KXQE 2H26B 2XXCB 2WBJA 2AK1L 5JPNB 1TJHL 2BVUA 4I77L 2X4SA 4JB9L 3RVVD 2VDLL 3F7PC 4PB0H 2APBA 2IGFL 3DTXA 5E70A 5CJQH 3L3DB 4WNQB 5DJ6A 1KCUH 1AXTL 3W9EA 1D9KD 4KJQD 1D5BB 1JMZA 2W9EH 3G5ZB 3S4SB 1ZA3A 4GRLB 3R4DA 4IIQC 3OBAA 1G7HA 4FQ1L 1IT9L 1BJ1J 3ARDD 5DGQA 4NWUH 4ETQA 5JLZB 5T3ZL 4FQIL 2G60L 3V4PL 4F7MB 5BO1H 5IESL 3CDGA 3UXFA 4PJGA 1WF5A 5IBLC 3QUZB 3TN0B 2J1KA 4ODVL 1QSFB 1HOCA 4D0BA 5FYJL 4R7NA 3ZKXB 3RY4A 5F70A 2FD6H 5CEZL 3L3GB 5E2UH 3O6FC 1LQSR 3V0WH 2P8LB 2NY7L 2B0SL 4P99A 4Y5XB 3QDGD 5E9DB 3WKML 1UVQB 5JOPD 4PJFA 2V5RA 3HUJA 4LPUA 1HSAA 3O45B 4BJLA 3MROA 4RMTA 4L29B 4F9PA 5GRVK 1EFXB 5T1KA 4DN3L 5CEZD 1K85A 3TJHC 2CLVB 1TLKA 2OCFD 1YECL 4PGEB 1R3KB 3SDAB 2P5EB 3MV7B 3N1PC 4C56B 4XB8A 3TESA 2DBJA 1WJ3A 3GJFK 3KYMA 3FFDA 5FGBA 4XMLL 1P84K 1J0YA 1D5XB 3W0WA 1I4FA 7FABL 4MXWH 5J56B 4PJIA 1DUYA 2F5AH 3WDHA 3FRUA 5C09A 1U8MB 3LS5H 3ULVH 2EYTB 1YA5A 4PJDA 2AJXH 3DV4B 3I6KA 4NO0A 2Y07L 4PJ5D 3C6LC 5DYOA 4UTBH 3BEWB 2HLFD 4PGDA 3KPPB 3SBWC 1ZGLB 4UQ3B 1EUTA 4AZ8A 3JWOH 4KKBC 1L7TH 5DD3H 3IFNL 1T5XB 1UB5B 4YNYB 1ZE3C 4R97C 3OKOA 4MA8L 4X98B 1XIWD 2NW3A 4NQEE 4XNQB 1LHZA 5I1JL 3OJDB 2M8XA 4JGMA 3LN4B 2I07A 4FFZL 1EEUA 1GOFA 1TZHB 2GAZA 5IW3A 1Y6NR 2DM7A 4JAMB 4WW1A 5TQ2H 5HYJA 4GAYB 5IIEA 4JRWA 4JO1H 2DM4A 5BMFH 4OIAA 2HMIC 4WEMB 4XNZC 4ZUWB 2NW2A 4KJYA 2F53A 3UJJH 1DBBH 4MZ3A 2VDQL 5EU4A 1YUHA 3O8XA 4BZ1H 5IHUH 3MCLH 1X6LA 3EW3B 1S7UB 3VGBA 5B3JE 1HH6B 1BREA 1IL1B 2NLJA 4Y8DC 1K5NA 3RWJB 3I02B 1YY8A 2VLJB 2ATPB 3QXAA 5F72S 1URLA 4X7TA 3H0TA 5T1LD 2GTZB 2BDNL 1YNKH 2ZOLB 1X5LA 4OFDA 3VFRA 4HF5L 2AJVH 3IRZA 2BOBB 3MZTA 4NQXB 3D39D 4CMHC 4LHJB 1KIRA 3L3IB 4MCZA 1KACB 4FXGA 2DQEH 1T1XB 1FNAA 1MCJA 5D1XD 5J6GA 3EJJX 4PJEB 1HCFX 1UB6A 3ZDZF 1GZQB 4NPYB 1I3RA 1OAXH 4C83B 4GXVH 1FO0A 3QNYB 5FK9B 2NY2C 1A7PH 3RFZC 2YD7A 3MOBH 4MD4A 4FQXB 2Q1EA 3VFOB 2VLRE 4CW1A 3LKRB 4Z7QE 4DK6A 3BRDA 5KS9B 4HG4K 5KTEL 1A6TB 3SDCC 1MJJB 2AKRB 2GKIA 3BMVA 4ZOBA 4L8CB 1F8TH 2BMKB 2XQBH 4HIXL 1CLYL 4QRRB 2AVGA 1A1MB 5E9DE 1AHWC 1NGPL 3VJ6B 3R0NA 3SQOL 2VZ1A 3QDJB 3ZT5A 1CLZL 4HH8A 1A3RL 5FHBL 1KYOK 2Z91B 3MRGB 3NIGF 3KYAA 4CU7A 1JYVA 1T21B 1INEL 2PCPA 4Q0XH 1ZEAH 1IC5L 5EOCH 2F54E 1G7JA 4PJ7B 3ARPA 2H32H 4Z95L 2PYFA 3V5HA 2QHLA 3CGTA 2EDLA 5B38G 2I24N 2OI9B 4HIIB 1WQVT 5IBUB 4M8QA 5C0JA 2AXFA 2FWOA 4FFYL 4ZTOH 3CPLA 3MV8A 2JJWA 4P4KA 1RK0A 3V7MA 5ANMB 5IVNA 4NN5C 3EFFB 2EDRA 4ODWA 5FB8B 4P23D 2VDKL 4DWHA 3JV6B 1MJ8L 2PYEA 2VSDA 1JPFA 5J13C 5DVNA 1W0VB 2X7LB 4Z7VA 2E27L 4HXBL 4HUWA 1Z9LA 5F9OL 1QTYT 2F58L 4OZIF 2VN4A 3MRDB 1FNEA 3T77B 3BP6B 4Y5VA 4NP4H 5F44A 5GS1B 1NUFA 2EIEA 4MXQC 5JIKA 3THMH 4PJBE 2A6JA 2XICA 4R2GC 1FNSL 2AJ3B 2IPTL 2NY4C 4URTB 5GRYA 4AM0B 1QLRA 4R3SA 5DMJB 4N1HB 4PRID 3IFOB 4F57H 5KSAA 3OB0K 1HHJA 3FOLA 2QLVB 1JGDB 2C26A 1RU9L 1D9KB 2IQAA 4AT6B 1ACZA 4MQXC 1MFDL 5TQ0L 4X4YB 4YDLB 3UJTH 4Z6AT 2A1WH 4Y4HB 5ALCH 3QHTC 4QNPF 1J9CT 5E2UL 1F4YH 5LBSL 3B2VH 3OKEB 4LSSL 2B4CL 3WS3A 4P2QA 2M26A 4G80A 2Q3ZA 2X44D 1KJVB 3IFLL 2WP3T 4JFXB 1LP9F 3BGFC 3LKSA 3ZZ1A 3SE3A 1G9NC 3MA7B 1N59A 1QFWL 4OFVA 4YHMH 4BM7A 4JM2C 4N9GA 1K4DB 4QEGA 2ILLA 1BBDH 2VXUL 1LEKA 4XVUC 3DARA 1UWEH 5J8OA 1I3GL 4RZCB 3RVUC 1QZ1A 1N64H 2FEDC 3IDJB 5K33A 2DLTA 1EH9A 5LG1A 1XIWB 2J8UE 4POZD 5KSBE 2VERN 5JHLH 3HG1B 3CDCA 4U1LA 2R39A 3EJZD 1IFHH 4XP1H 3QEQB 2R0WH 1EHAA 5ETUB 3MLVH 4WY7H 5CP3A 4DW2L 5C0EB 1U3ZA 1ZLSL 3RRQA 2CRZA 5FECB 5KSVB 3VI4E 3GSRB 5ICZA 4GRWF 3WNOA 1S9YB 4ZS7L 4UTBL 1JWMB 1SJVA 5E00B 3AMKA 4BSWA 2X1OA 2F9BT 1CGSL 4MS8D 4PJXB 3U1SL 4JG0L 4NO0D 4R2GD 1K4CA 2PXYC 1HXYB 4LGPB 1ITCA 4NNYB 1OAYL 1P7QA 4J3UA 2AJSL 2AEPL 2XWJA 4HBQA 4OIBA 2VZUA 2P4AB 1C5CH 5IVZB 5B39B 5D72L 4HAGA 4UQ2A 5IVXB 4O2FB 4GG6E 4G9FE 2C1OA 4JFPA 1KG0B 5BMFL 4XBGA 4YBLB 3TO2B 3MUJA 4R4NC 4ZO8A 5F7KC 2LE9A 1MAML 1BJMA 3QCUL 2FJGA 4P3CH 1JZ2A 3PGDB 3QXWA 4X4ZA 5DJ2A 2Q76B 1HQRA 3VXPA 3TN0D 5J0BA 5E6ID 5J9PA 4LLVB 1F11A 4EN3B 4GAGL 2YD6A 2VL4A 4FFVC 4KUCD 1CK0H 1IGFH 4Z7QF 1U95B 3BP7B 1HOCB 2KQMA 4P46A 1H3TA 5DQDL 4JLRB 3TT3L 5GGUB 1A9EA 1EMTH 1B2WH 4JPVH 4RFOL 4P5TC 3ARRA 5A3IC 4G43A 1CT8B 3H9ZA 4K8RH 4LLYA 3TBYB 4HKXA 1O0VA 3QWOB 2W60B 4TPRH 3SDXF 1P7HL 4QY8B 1YEFL 1LO5A 2X1PA 2DLHA 4LPCA 5C2BH 2LV4A 3AGVA 1YQVL 1II4E 1I7ZB 2AJZA 1RIHL 1A7OL 1R3LB 3E6FA 5C0DA 1CD0A 4NCC2 3TFKC 4KKBD 5INCA 1J1OH 4X8XA 5CSZA 4CNIB 5DQJA 1RK1B 1KXVC 5HHPB 4TSAH 3REVB 1IRAY 2HLFC 4FQHB 3SDDB 2DQTH 5C0AD 1QR1A 3MUZ1 4ZUSA 1TQCC 2GFBA 4XNMB 3KS0J 1F00I 4Q58C 3OMZA 4L4JA 2PN5A 2Y36L 3O11A 3QQNA 5F8RC 3MSPA 1WZMA 3SQOH 4XB7A 1KENL 3BUTA 1EEZA 2W92A 5TDNB 3HE6D 2DD8H 5EPMA 3O4LE 3ARTA 2APTA 5IB3A 4P5TB 4QHKI 2VAAA 4UUJB 1OB1B 5GPRA 3HHRB 1YEGH 1W72L 3TIEA 1WBYA 3ULVD 2AXHA 3RUGF 4NQTA 2R69H 4KHXH 1BWMA 3UPCA 35C8L 2X4TB 4PJCA 3KJ6L 4MCYA 2X4NB 4HWZA 2W0LA 3QEUB 4X0KB 5I1DA 4I3RL 5FO9B 5A2IH 3MLPA 4A6YL 3PWPA 1RJYA 1H3PL 4Q2ZB 5GS0D 5LGHH 3TBTA 3P9WB 2XQYK 4KHTL 2CK2A 5FA4A 1NLBL 1MWAL 5IVXE 2ADFL 5E8OA 4L4TE 4AJ0A 1IL1A 1MCDA 4KK9D 5DWUL 2D9CA 4YUEL 4WRLA 4BH7A 4LBEA 4LVNB 4PV9B 4OKVA 3V79C 2D03H 1ZLWK 2K1MA 3SGJC 1QSED 3LKQB 4X7SL 2BVPB 1I1YB 4KMQA 1F4YL 4KGLA 2BSTA 4EUPA 1ZMYA 2P5WD 4L3CB 4JFOB 1DBAL 4C4KO 4S10A 3RVVC 2FHCA 3GSOB 5I66B 2BVTA 4HWUA 4MJIA 2ED9A 1EZVX 1Z0NA 5I8OL 1GSMA 1ZHLA 3RZCC 2ENYA 4P2QD 3BX7C 1RZIA 3RX8A 1R3HB 3U6RA 2YUZA 4LSTL 5I1CH 4OD2A 3BO8B 2Q20A 1VGEH 1TCRB 3FB7B 3DRTB 3W9EB 1RZ8B 3KDMB 5BRZB 3OR7B 3G5ZA 5F3HA 1N6QH 2D31B 1WITA 4X5LA 4YC2C 1KBGH 4CADA 4UTAH 3HNVH 1JNNL 5A1AA 5ADPH 1I8IB 4IOFD 3B9VA 4R0LC 5I73B 1FC1A 4X6FB 2C1PB 4LPYA 3HE7C 2A0LC 4AQ1B 3DROA 2AJSH 5EUOB 4RMQA 5JW4N 4OB5L 5DZOA 4H20L 1HHIB 4P57B 4K94C 5D72H 5JDJA 4RIRB 5DK0B 2VIRB 3UJIH 2EDHA 4XCYB 3SE8H 4IMKA 3GBML 3M1BB 5IT2H 4ODSH 1LWRA 5ERWB 3GUTA 4JFZL 3PWLA 3SGDI 2NY0C 3VXUB 3JTSA 3HA0A 5DJZB 4LCUA 1BQSA 2A77H 3V7AE 4HUWB 2DYPD 3QT2A 3R1GH 5CBEA 4OM0H 3DPBA 3Q5YA 5AUMB 2E5EA 43CAB 3LEVH 4CN4A 5FO7A 2Q86A 3V6OA 3V8CA 3O4LB 5ALBL 1CTOA 3S88H 2WUBL 5AAMA 1T83C 3SDYL 2VABB 5D7IF 4GW4A 3P40A 3BZEA 4Y19B 4GBXD 5F89B 2R2BA 1CK0L 4TUOB 1QYGL 3LIZH 4K3HA 3QWRD 3OKLA 3TC9A 2KQNA 5D4QA 1BX2B 4OZGA 3VXRE 1U58B 1RMFL 3D85B 4ZFZB 4UIMA 1GL4B 1RJLB 3MGTB 1P7KB 2VQ1A 4LSUH 1AHWB 1ADQA 1KNOA 3BSZH 3BJLA 3AU1B 3SKJL 3UAJD 3X13A 1FO0L 3QRGH 3T0EC 1FPTH 4IEFB 2UY6A 4JG1H 3HZVB 3FHAA 4BKLB 5JQ6H 5J7CC 3F8UB 2WIMA 2XTJE 3MLZH 2F5BH 4S1SH 1KT2A 3Q1SH 1A6WL 3VGFA 1XIWA 4OLXH 1J0HA 5DEGB 2JELH 4HJJH 4X6DB 1I8KA 4WW1B 1K6QL 2GW5A 1FV1B 1U8PA 4BQBA 2AI0H 4UV7H 4QTIH 8FABB 1GCFA 1I1AA 5LQBH 1EVTC 2GHWB 3L95A 5IF0B 3FFCA 2NPLX 2HFFB 1XGTA 4ODTH 1U8QA 4RFEA 4N8CL 1NUGA 4P2RD 5E8PB 5IQ7H 1MHCB 2YS4A 1INDL 4JFQA 5T3ZD 1RUMH 1WC7B 3D2UA 3ULVF 3RX5A 5FKAB 4NKIL 2GK0B 3JZ7A 3QUKB 1J88A 3QR2A 3TBVB 4MMXC 5EZJB 5IVXF 5IFHL 2EEBA 5CEXA 1V05A 3QDMA 2W0FB 2VXQH 3PJSA 2GEEA 4MJIE 4YPGA 1DVFC 1XH3B 2EKSB 4WO4D 4NNYA 2DQJL 2R0LH 3GMQB 2A74B 3LS4L 5EU7E 4U3HA 2GSIA 1KJ2L 5HI5C 3SO5A 1AH1A 4OCYL 1WCBB 2XWBA 2Y7QA 3U0WL 1NMCB 4YHIA 4NQVB 4QHLB 3HPJA 3RWHA 1CDBA 2Z8VC 1A4JB 1T7XA 3HI1B 5JHDD 2ZUXA 5SV3A 4LRIC 4XBGB 4G5ZL 2HT4D 1DBKH 4EQ2A 4XZUB 1N4XL 5H2BB 3HTLX 2Z8SA 1RUPL 4HW6A 1ROWA 3PQYD 1HDMB 3CLFL 1NGQL 3SKOB 4CVXB 4WHYG 1GZQA 4NPYA 4LFHG 4Z7UF 4S11A 3PP4L 2ZUVA 2B2XH 2MNUA 3WIFA 2IMNA 5KOVC 2BZDA 4PLJC 3CMGA 4QYOA 1CLOH 3BW9A 3WE6B 1JZ8A 4Q9RL 3QDJE 4XAWL 4N0YL 1KOAA 3U30C 2C7UA 1FFRA 1UYWH 4U1KA 5BJTB 2YR3A 5DS8A 3BQUB 5BW7A 4XHQA 4NNXB 2IAMA 2AXGB 4XNYH 4XXCC 3E2HB 5I76B 4QRRA 3NAAL 3D69A 4NJ9H 2VXVH 3WXWL 1MRDL 1C8PA 1VSCA 4LSRH 3UCRA 4GAFB 3WJLA 1CCZA 3A67L 1CT8A 3QIWA 5ISZE 3IDXL 4MGXA 1VB9A 2NR6C 5I0ZA 1AQKH 4MB3A 4BZYA 4ACPA 1T0NA 4WU5B 4MDIA 3GKWL 4NN7C 2Q6WA 3U9PL 2O93L 1AO7B 1KCVL 3MBEA 1MCPH 3DX9B 3EJZC 3F7VB 1ONQB 4K7FB 5EO0B 3O4OC 3ZHKA 2IPKB 1IM9D 4YR6A 4MJID 4XXDB 1UXSB 4QRUB 1FCCA 2D3VA 5E1HB 1VGEL 3QWQB 5B38A 5CZKA 1EVUA 3EYUL 4OZIB 4LKCA 2L4OA 4M7ZB 1AIFB 1NL0H 4KJWC 2PETA 2OJZH 4XNMA 1YN6A 4KMLB 4YBLC 2P24A 5HY9B 3VH8A 1EEYA 5DI8A 4QXGL 1KB9J 5HPMB 4K7PH 1FIGH 1BD2D 3KPOA 4PJIF 5AZEH 2EC8A 4NHUB 1HHHA 3LY6A 4PRPD 3OR6B 5TE7L 1EEZB 4U05A 1FLRL 4KTDL 1MY7A 2W38A 5J1AA 3RI5K 2FEEL 3T2QA 4PJ7F 1I3UA 2AABL 4MA3A 5IR1B 4HUMB 4PRIA 4I8DA 1D5MA 1LE5A 4JO3H 4GRLA 1NFDF 1F5WA 1Z3GH 4U2YA 1ZANH 2XN9A 4QRQB 1NMAH 3LMJH 3RIFF 4KTEH 2HVKB 3GKZA 2AGJH 3MJ6A 4HIJB 1WTGT 2ZUQC 4NRXB 3E6HA 4U0RB 4LQFL 4PREA 5IMOB 3ILPB 4OF7A 3LEVL 4WJ5A 1UH4A 2NXYD 5DJYB 4GS7B 3MRJA 3MLTA 2HFEA 5GGRY 3V6BR 4PRAB 3B9KD 1R5VA 2W0PA 1ZXQA 2UYLA 5E2WL 2G9HB 3HMXL 4HUXA 3OKNB 3PWUB 4HBCL 4IHOB 1ZS8B 4AH2B 1UEYA 1FP5A 5IHZA 5GISH 5MERB 5A2KH 4M02A 4AEIH 2WINA 1CE1H 3RIFK 2XWTB 2R8SL 4F58H 3SOBL 4P9HC 1BFVH 5IQ9A 2JB5H 1S78C 4JQVC 2JJSC 3MBXL 4ODHH 3G6AB 4F15B 5DJCB 2XTLA 4M7LL 1HXYA 3W0WB 2F54D 4TOYH 4YXKL 4FQQB 3U36B 4QRSA 4DGVH 3H3PL 5IMKB 3ARGD 5JUEL 1IKFH 4QGYA 2IPUG 2DM3A 2V7NB 1FAIL 1I7TA 2CKBH 2FGWL 5GGVH 5DRWA 4WUKH 4OCMC 1OTSC 3CFEA 3UEZA 4L4TD 1HSBA 3QUYA 4YHOL 4JPIB 3GI8L 1BLNB 4KQ3H 4PRNB 2R29L 3WIHL 2FJHA 3ZE0E 2H8PB 3W11C 5FYKH 4UIKH 4L3EA 2YA0A 4JPKL 4PY7A 5DGRA 4NSKB 3BP4A 1RFDH 2J4WH 3HPLA 2MQ0A 3HS0B 2J88H 4WFGD 4X98A 4YHKH 2EE9A 4OT1H 3TZVC 1SEQH 4OZIE 4PB9L 15C8L 2QQLL 1FCGA 2DMCA 1JZ3A 5JIPA 3U7YL 5I1AA 2DQJH 3MRBB 5IIEB 3FO9B 8CGTA 3G9AB 5ICXA 5I1HH 2B1HL 4XWGH 2OZ4H 4XPBH 3NH7H 5L7XH 4R9HA 5IK3B 3LN5A 4HWNA 3PHQB 4NGHL 1AI1H 4YHZH 5EU4B 1WT5A 2BNRD 4ELMF 3OAUH 1PQZA 2A9NH 3VGEA 4PJEE 1HYSD 3OGOE 3L3DA 5KOMC 3JTSB 1H5BB 3MLYL 1QSVA 5DJ6B 5E94A 1LEGB 1KFAL 4YXLL 1CGYA 2ZPKH 4RWYL 2A83A 4QTHA 2VLJA 2ESVB 3WJJA 3EYQC 3GJFB 4L8BA 4NHCL 4APQD 1FNGA 4LCIL 2DDQH 3MV11 4XAWH 4JFDD 3H9HB 1VACA 4WUUA 1B0GA 1KPVA 4FTVE 3BPLC 1ZGLM 3SGKA 5CHNA 1PY9A 1T3FA 2HJFA 4FQHA 2VDPH 3KPRA 1CDHA 1ZLUK 1DBMH 3U9UA 1FVCB 3S96A 3VXSD 1U2CA 4P4RA 3ALXA 4NJ9L 1QBBA 4HCRL 2ZUTA 3EJYD 5FYLE 2BOCA 4WFGE 4R90L 1P7KA 3NCJH 2VXTH 3C87A 1I3RB 1Q38A 1ES0A 4FXKA 5J11B 1P4BH 3TT1H 4EQ3A 3B3IB 4OZ4B 3PL6D 1NFIB 1UVQA 1NFKA 1UC6A 4OFKA 3V6ZA 3VFPA 1JI1A 2R9HD 1JTPA 3QI9C 3QIWD 4JY6B 1HHGB 4NN7B 1IAOA 2GITA 4MCYB 5ANME 3GSUA 4J12A 5IWLC 4F7TA 5A16A 5CKAA 1DN0B 5KN5A 4OLWL 2I5YH 4Q2ZA 4CMHB 5FKPA 4RGOH 2HFFA 3HKFA 1DUYB 4ORZC 4EI6A 4OM1L 3UTTE 3BPLB 3WFCL 3C5SB 4FP8L 7FABH 1V7ML 3STLA 3F7YB 3IDIA 1T21A 5D1XB 4XNUL 3G5XB 3F58H 1CXIA 3N85L 1QSFA 3ULVL 4U3XA 1AKJA 2X1WL 5H8DA 4R7NB 4BK4A 4D9RD 3C9NA 2PXYA 2AABH 4JCMA 4BH7B 2PTVA 3KYOB 1DQQA 4Y4FA 3VDBA 1NKRA 4ODWB 1HIML 2NY4D 2X4PB 3WYRA 3PL6C 2CDFB 5ESQA 4M43L 4NRZA 1CFTA 2R4RH 1P9MA 3LN4A 2CDEA 3QO0B 2P5WA 1JNLH 2Z92A 2V9QA 3MRKA 1S9XA 3BPCB 4FQ2H 1DLHB 2C4XA 4WI9A 5LVEA 3KLSA 3O8XD 1XGYH 5CEZH 4NZUL 1U8OB 2F53B 1ORQA 1KCRL 3SGJA 1WVZA 3WFEH 3BDYL 4UDUA 3U6RB 3NIFE 4H8WC 1C12A 2OTUB 3RVTD 3I3DA 1E4KC 2ADJA 5D1XC 1OAZL 4LFHD 5GHWH 2IAMC 2VYRE 1GHFH 2KZWA 3G08B 2EIZA 4JY4A 3IJYB 3ULUD 5I1GH 3UBXA 3H0TB 4FFWD 3PF2A 1CFSB 5FUOL 3VU2A 4XP9L 2VKXA 1JUFA 3IU4H 2F5AL 2FH6A 2GJ6E 4HQQL 2BXYA 3ULVC 1BFOA 5J1SC 2BC4A 2DQDH 3ARFB 3QNZB 1UZ8B 3QEGH 4X9GA 1LP9E 2AJXL 5GS1C 3WSQH 4X6FA 1D5ZA 3T65A 3O3AB 4G8EB 1FHGA 5MEQA 3IKKA 5ACMA 3KLDA 4OCSH 3B8SA 4HK3N 2NW2B 1H8OA 5F88A 1IAKA 3IFNH 4NN6B 2YK1H 1CDJA 1CDYA 4FQXD 4RRPG 3RGVC 4MD4B 2VLLB 2QSCL 1IEBA 3QPXL 1HH6A 5D9SA 4HHAB 4OZFG 3VH8B 4TTDC 1IBGL 4NT6A 5KSAC 3VD5A 5I1IH 1IGCH 2HKFL 4FS0A 5C0AE 3VA6A 3W5MA 1BEYH 2CKBB 4FN0A 2CRYA 1KCSL 3CZFA 4WFFD 1PKQE 2Z4QB 4OSUH 1PYWB 3O3BA 3W39A 4MS8C 5JORA 4OGZA 4HV8A 4D2NA 4EI5D 4NO5B 4ZUVA 1BF2A 1XF3A 5L9DL 4NC1E 4YGVB 4FXLA 3S5LG 1A3RH 5FHBH 3KPQA 5IB4A 4OZGB 3NH7L 5D1ZA 3LZFH 4X4ME 3RQ3A 2VLME 3JVGA 4M48H 1GC1L 3LKOB 5FM5O 5LXGL 1TZIB 1UJ3A 5L6YH 3FN9A 4TN9A 1OGAD 4O4YH 4U6HA 4Z7WB 3I2CH 3MV8B 5HJ3A 3FB5B 3A6CL 2FYYA 5C0BB 3SDAD 4WW2C 2VITB 1ZA6B 2BERA 5IHBA 1LO4H 1NMBH 1QLFA 5ESVB 4MXVE 3VFTB 4RGMB 1U3JA 1AGBB 1AGDB 4MZ2A 2VDKH 1Q94A 4LCIH 4XHJD 5CINH 2E27H 1ORSB 1H0DB 1FZMB 1FYTD 3O6FA 2DJ4A 4XRCB 1I4FB 5ISZB 3GMMB 5MERA 2Z91A 4LLYB 1U8MA 4EJ1C 2W60A 3RTQB 5HYSG 4BQ6A 2F53D 3LHPH 2JIXB 1MFEL 3BT2L 3ZDZE 4Y4HA 2PNDA 4X6BB 4N9OB 3RNKA 1MIML 4AG4L 1DE4A 3SKUD 1RD6A 1OARL 2AK4E 3GM0A 1ZGLA 4NUJA 4EZMA 2XQBL 3RA7L 5LBSH 5FYJE 3VFSA 1FSKC 5J11C 1E0OB 4LLQA 4LSSH 1L9NA 2X5PA 2OR9L 4J2XA 1RY7B 4UBDC 4OLVL 1FAKT 5E2JA 5MP6L 4OCNC 1FVDA 1AP2B 2OQJA 1DCLA 1JHLH 3UTQA 1P53A 3TEUA 2FO4B 5L88H 4WCYH 3LD8B 4XZUA 4R26L 2EO1A 3G04B 1PSKL 1MPAL 1TJGH 2P5ED 3MV7D 5ETUA 4C56D 1I8LC 1OF2A 2WANA 1MCOL 2DF3A 1V7MH 3ZYJA 3ILQD 3RL2B 1QACA 2VAAB 2R2HA 5HGDB 3GGWA 5TDPA 2R0WL 3RVUD 2GSGB 1RV6X 3PHOA 5ITBH 2DN7A 5HGBB 1ZLSH 4Z77A 3BE1L 2ICWI 1NEZB 4JM2D 4HXBH 2Q7YA 3D18B 3VG0L 4X0KA 1QLEH 3FO9A 4YE4L 4NP4L 4RFNB 3HR6A 4JZJB 1OWRM 1OCWL 1EK3A 1SM3H 2IC2A 5AZ2L 1QFUH 4ZDHA 4Q7DA 5HHOB 3GSQA 2PKDA 2H32A 1MRFH 4F37K 5E8OB 2CQVA 1BOGA 2A1WL 4MCZB 5ALCL 2LU4A 2D0HA 4FZEH 5DMIL 5K9OA 4IOIA 5I2IA 3IFLH 5JW3H 3MFFA 1J05A 4BFGA 4LPXA 1MCKA 5FDYA 3AUVA 1YEDA 5F1KC 1KIPB 1SYSA 3C8KB 2UWEF 4DAGH 1S9YA 1DBJL 4H5SB 4JGUA 4YK4C 4KK8C 3BEVB 5EBWA 1G9MH 2QADB 2X4QB 3IKCB 4KJPD 1R5IB 3PWVA 3T4AB 5E6ZA 5FIEA 4GW5A 3RL1A 2NY1D 1K4CB 3KPLB 1F2QA 4GAGH 1CGWA 4XP9H 4MX7B 3WDIA 1IFHL 3P73A 4XP1L 1T0MA 4M8VA 2Q3AA 1JFQL 3DVFA 5DT1H 4JZJC 4U1MB 5D2LA 4YXHH 4I3SH 3QCTL 1CDCA 3ARGB 2NTSP 4GQPH 2YA1A 3PUCA 1KB5H 2O61A 3D0LA 4O2CA 1VFUA 3SDCA 5F9JB 1FL3B 3MUGB 2YA2A 4PJEF 1GZPB 4HIIA 3T3PF 3DV6B 2FSEB 3EYFA 1GPOH 5F1IA 2XN9D 3AROA 3KPPA 4Y5YB 3T3ME 5FB8A 3NFSL 3KVQA 5FM5M 3UC0L 1FGNH 3RVXC 2VC2L 1H5BC 3RDTA 1OLLA 2P5WE 5BOPA 3T0XA 4QRTA 2CIIA 2QSQA 1LO3H 4MNQB 3MLSL 3BP6A 4Y5VB 3JWDL 3O2WH 3KXFD 1ZV5A 1TNNA 5K9JL 2E6PA 5ELIA 5EO1A 3X11B 4AQOA 1BAFH 5K9KA 4GG8B 5C9KA 5L9DH 1HXMB 4ZQKB 5HPOA 2ZNWA 3HMXA 3FT2A 1VGKA 1Q0YH 3A6BH 2YUXA 3W2DL 2IALB 4XAKE 3EO0A 4KU1A 3DNKA 1CFTB 1AD0B 1TJIH 2H1PH 1GC1H 1MCFA 3MRLB 1A6ZB 4RA0C 5DRZA 3PP3H 1ZVSB 3WD5L 3JVGC 1NMBL 4G8GA 3TIDA 5DFVC 3D25B 1KB9K 1AXTH 1BQLL 1ED3A 3GO1H 3SKMB 3HC0A 3CCHA 4X9HA 5HVWA 3FKUS 3JUZA 3MREB 1P5UA 3B43A 5D7JD 4MHHG 5I18H 3HG1A 4IOSD 1XGUB 3UTSB 1CLCA 3QUYD 3RP1A 4DUXA 4OCXH 4K94H 4Y2OA 1QSEA 3EOAA 3FQTB 1RZJL 4OCLC 1S7WA 3LKQA 4GQ9H 5IBLD 3B4NA 3LVEA 4WI2A 1NQBA 3C08L 5AYUL 1EIBA 1PG7W 4C83A 1FO0B 5T1KB 3C5ZB 4M5YL 3F5WA 3K0WA 3MOAL 4GW1B 2VZ3A 2E7LA 2R23B 4ZD3H 2FD6L 3V0WL 2FZ3B 2MCG1 3PABB 2CSPA 2VZOA 5TE6H 5FHAL 3BXNB 5DRNA 4PTTA 1HQ4A 3BKML 5TH2B 2ZKHH 2A6IA 3AVEA 3HE7D 1NCTA 1QR4A 1MCWM 2XWJB 1S5HB 4G6KH 1NEUA 3GK8H 1EJOL 1X44A 2XZAH 3MNZB 4ZUTA 5ACLA 4KK9C 1YYLL 2EYTA 2DJSA 4O2FA 4I4WA 4LSQL 3T8XA 2FH8A 4HS3A 5MEOA 5DJ8A 1T4KA 1PSKH 2E7BA 4HMEA 3RDTC 5KAQG 1UG9A 3UTOA 4MDJB 3ZT6A 4GBXB 1F2XK 1B0RB 4YPGB 1DSFL 1QBMH 3BKCL 4ENED 5IMLA 4KKCD 5IKCA 2FJGB 5DEFB 1A5FL 3TJHD 2BNUB 2Z4QA 1HINL 1NCAL 1ERNA 2P8PB 2JIXD 4KHTH 2EE6A 4H25B 4XC3L 3SE4C 3RWHB 1FGVH 2UWEE 2WZPD 4GJTB 5EG6C 1GGUA 4XPAL 3KPRD 3VWKA 2NZ9C 3B6SB 4MB4A 3MRPA 4PJBA 1KPUB 5F9WB 4XXCA 3OXRA 4FQJH 3PHSA 4NQCB 4QKXB 2L7JA 5IW1A 5I1EH 5B39G 2BSRB 3OHXB 3CFDB 1M6OA 4MA8H 1F4WL 1RZIB 3WIFB 4KTYA 2IMMA 4OB5H 3WE6A 3B3IA 3OPZL 4OZ4A 3AAZA 5BCAA 3S37H 3V5DB 2F8OA 2O5YH 2FHFA 4U6TA 4JRYD 2VITA 5GRUH 3RWIB 2DM2A 5TQ2L 1BD2B 3EIFA 3PWJA 1A64A 2IQ9L 2NLJB 3X3FH 1NDMA 1DVFB 3IETB 5JXAL 2CRIA 4U49A 1UCBL 2JK5B 3Q6FA 4QOKE 3BGMA 4G3YL 5FO7B 5KVEL 2JJTA 1KJ2A 4DAGL 1DL7H 2DTMH 3X12B 1YDPA 2EC9T 2UVEA 4ZFGH 3VFRB 4KDTA 5GZOC 3MCLL 1LK2B 1QVOB 1U93A 3JV4B 4U0RC 5J1TC 5ALBH 4Q97A 1UQSB 3MNWA 1NKOA 2CKNA 3IS0X 2K9UA 5D71L 3QXDA 5DUMH 4LARL 1T1XA 3LQAH 3QDMD 4R4FL 4YJZL 2VN7A 2D4DA 5BS0B 3ORJA 1GC1C 2OYPA 2HJLA 1DLFL 3EO9L 3L5JA 3KYOA 3ZHDA 3GBLA 1JNNH 5E1AA 2EDQA 4P5KB 1QP1A 4WO4C 3GMRA 1DP0A 3DO7B 3DXAA 3OF6D 1JWSB 1J86A 2AJUH 3S3SA 3R06A 4LOUC 1FPTL 1A6TA 2WQRA 1OOAA 3AREB 3OGCB 4XX1E 4CVUA 3S4SA 4F15C 2R2EA 3MLZL 4NC2B 3BISA 1LO2L 3ARED 3G04A 1J8HB 4HH9B 3WL9A 3B5TA 1BQHA 1OP5K 4Y5YC 1OTUD 3EO1A 3GGWB 3UJIL 4J3WA 3C60B 4P2RB 5FUCE 3C8DA 5T3XD 5E08L 1A6VH 3QULA 3ESVF 4AIOA 1INDH 4KDWA 2A77L 3BRFA 3BWAA 2X05A 2HN7B 3UZVB 2VQ1B 3ULVE 4XBPB 1K9TA 5CJ8A 4GG6F 3CDFA 4M00A 1F6AA 1WBZA 4BKLA 3VRIB 3BD4A 4NRXA 3BKYH 5HHOA 4BFEA 2Z9TA 5FM4A 3BESR 2H41A 3VMPA 3WUZA 2CMRH 4MJ6B 1OSPL 3PGDA 4Z7VB 2NX5E 1OQOA 3AXLA 4X6DA 4Y89A 1QUNA 1XCQA 3CH1B 4WV1C 5HTSA 2G9HA 1F11B 4EN3A 2VDOH 4HS8H 5CD5D 3C6SA 1JGVH 4G5ZH 3TNNA 4LSUL 3SPVA 1A02N 2JJTC 3BSZL 4YO0B 3QQ4B 1MHCA 1RZGA 3ZDYE 4PJXF 4AT6A 3V52H 1YMHB 4HUUA 3TN0C 2HTLD 3K4AA 4C57C 3TH2T 3TBVA 2IAMD 4U1KB 4QO1A 1X5IA 3T4AA 2NTFB 3BIKA 5C08A 1T2JA 4HWBH 4ONHA 5ECJE 5ADOL 4WEUD 3S8WA 3NGBB 4X8JA 2DYPB 3D69B 5IROA 3CUPB 2OX5A 1WFOA 2UY7A 5GIRA 3ABZA 4GXUM 2D7TL 3U79A 1MFDH 4N8CH 1LEKB 3UJTL 4M1CD 5FUZH 3VXMA 4Y4KA 4R96B 1YMME 5IB2A 1T0NB 2YPLD 4M1DL 4WU5A 4UT6H 3REVA 1TZHA 2GAZB 4W6WB 2E8YA 1X3DA 1B90A 4DOHB 4PGBA 1H15B 2G75A 4YHYC 3ME0A 1BECA 4I2XA 1YYLH 5C0CA 3RX7A 5L8LB 5E4EC 2BHZA 1MCPL 3SE4A 2J8UA 1LE9A 4U6VH 1N64L 4OZFH 1JPTL 5JMRA 2MPAH 4OZIA 5JHLL 4UNTA 2B20A 3HE7B 2DOCA 5J12C 5D2LF 4P5TA 1DSFH 3BKCH 2LVCA 1MJUL 5KBNC 3IB4A 4DW2H 4U1IB 5I76A 2BNQD 4V2BA 2BFVH 4NZRL 3H2WA 4S1DD 1OGAE 2MSPA 4XRCA 2CR6A 25C8H 3KPNA 1KCUL 3V5KA 3IFPA 5JR1L 4XPAH 1FYTA 3O6FD 1PZ5A 4LSVH 3S35X 4PR5B 1S7TA 2R4SH 3D6GA 2ZCLL 1JI2A 5F9DC 3V4UH 4NWTL 4WUUD 2VL5B 3ROLB 5I1EL 3A6OA 4X6BA 4Y0GA 1NCDL 5FGBC 1QRNE 1YNLL 2AEPH 1F4WH 3M17B 4ZXBC 3K8KA 3HAEB 3N1GC 1BQHG 1AR1C 1MCHA 1MCBA 4KRPC 5J13B 3AU1A 3TZVB 1Z3GL 1VFOA 3QIBD 4MQXD 5BXFB 3TIDB 5C07A 5SX5H 4OTXH 2VUOA 4XI5D 2XV6B 3S4SG 2PW1B 4XPFH 5KSUB 4RAVB 2XFXA 2NY2D 5BOZG 2NY7H 2OSLB 1JP5A 4L3ED 2ZOKB 4P2OB 1IGTA 4HS6A 1R3KA 4IHOA 1OF2B 3BGAA 2C3VB 4TQEH 1X5FA 3GMLB 3U83A 4F7EA 1NFIA 4EOWH 3S34H 4OZGF 1VEOA 3VXTB 4LEOB 4YDKH 5HGBA 3H42L 2VH5L 4Y4KC 4U1GC 1PKOA 2O5XL 5KVGL 1UACL 4QHUA 2J6EL 2VXSL 2AJZB 5A16B 3S97C 1PEZA 2GJ6D 4NKMB 1BFVL 2DKUA 3LS5L 3F6IA 1WSST 4ODHL 3UTTA 1NLDH 4IRSD 4IMKC 4WU7A 2Y07H 3GSXB 2W1NA 3ZDXF 2ZCKH 5IM7A 4GSDL 4M5ZL 3SDDA 1T0PB 2E8ZA 4GRLC 4WJ5B 4IIQB 5DJYA 5F71A 4Y4FD 2AERT 1IC4L 1R5VB 3OF6A 3DXAD 3RY6A 4IRJA 3QEQD 5E8EA 2H8PA 4YHOH 1E6JH 3RUGE 4R3SB 4ORGB 4PRPB 1NEZG 4MAYC 4UIKL 5EU6A 3RBSA 2NY5L 4FFZH 5CILL 4IMLB 2SEBA 4QYOB 1H3XA 1F97A 2XWTA 3C5ZD 3RKDD 5B8CB 1MEXH 1I9IH 4WWKB 4JO1L 4DN4L 3MXVH 2X4QA 3IKCA 3L7EA 3IAPA 4GO6B 5I16B 5TJWK 2OI9C 3CFKA 3QO0A 4M6MH 5D2NA 2ZG1A 3CU7A 3B9EA 5I1AB 1EO7A 3FCTB 3M1BA 5I19L 2ADGA 4LCCA 5DURB 4BQ9A 5ICXB 3HB3C 3EDJA 5JXEA 5DJZA 2OP4L 5KZCD 1FN4B 4LCWB 3QHFH 1OSPH 4XPBL 3G5VB 5FFLA 3MFGB 3AAZB 4Y2DC 4AEIL 4ZUUA 1WK0A 2Z31A 3SJVA 2ADIA 4Z9KB 4GKZB 5CEYB 3F6LA 4N1CA 4NKQB 1WFNA 4MDIB 4GMTH 2BK8A 3LKNB 4A6YH 3DOSA 1H3PH 1U8KB 2DWEB 3SDXE 1WEJH 4OCWH 4PJGB 3ALWA 1WAAE 3VW3L 3F65A 4YR6B 4EN3C 3HC3L 1U58A 4BH8B 4XXDA 4C54A 4QGTA 3QXUA 2X1QA 1G6VK 4YZFE 2YD4A 3OAYK 1CVSC 4KRPD 1QVOA 1X5YA 4NHCH 5E6IB 1J1XH 2DDQL 3VXNB 3L3GA 1AGEB 1TVDA 4JFOA 3RDTB 4XGZB 3O4OB 3SBWA 4FQXA 4KQ3L 1NC2A 3VFOA 2Z35B 2DJUA 4PJFE 5L2JA 3Q2CA 3LEXA 4I48A 3KPOB 1MFBH 2YXFA 4KPHL 3NTCH 5DD6B 3PL6A 2XA8L 1B3JA 2NQCA 4LRNL 4GG8A 3P4NA 1T22B 4HGWA 2X4OB 2BMKA 4LEXH 5LWYL 3FFDB 4FG6C 2XY2A 1I1AB 5FYLD 4V1DE 4K23L 3QP3A 1CE6B 3WO3B 2IALA 4NZTL 1VHPA 5ESAA 4PLKD 3ARVA 5EWIL 1UZ6F 1HHGA 4Y4KD 1UM4H 3MV01 5C0IA 1H9VA 3FT3A 4OD3L 2O5ZH 3HUJE 5I1HL 1CLZH 4KI5C 5L7XL 3DIFA 1U0QA 5FYKD 4BA8A 4K9EH 3VXPB 2R9HC 1C1EH 3OKMA 2P49B 4OIIH 4XTRD 4JJHA 3F7YA 2F54A 5JTWA 3QULB 3MJ7B 1OD7A 5BRZE 3T0WA 5CP3H 4HFWA 4ZTOL 4NBYB 3TO4C 4XNUH 4Y19E 5EORL 1QRNB 2Q8BH 4Q9QL 4BK5A 4R6UA 3RKPA 3EHBC 3VXRD 5H35A 1TIUA 4Z0BH 3O3DB 4HC1L 5HGGS 3UZEA 1LVEA 5EC1A 2F58H 3HZMB 3DVGA 3KNBB 3VFGL 1VCAA 1WV7T 2EH7L 5KSAB 4I3GA 1IKNA 2R23A 1U9KA 4X5XB 4NKOA 4QRRE 4XH2B 2RGSA 1GGCH 3OJ2C 4X4YA 4G6MH 4LQ1A 2OJEB 3BPOC 1CXLA 1MCSA 3ZTJG 5CSZB 4CNIA 1BVKA 4DKEL 1ZSDA 3RUGA 2FHBA 2W9DH 1WGOA 5TQ0H 3GMMA 5DS8B 3R8QA 3BZ4A 1BWWA 4J3OC 3T1WA 1B9ZA 3EDFA 1S7SB 1EERB 1QR1B 3UTPE 3F12B 4UZGA 4JR9H 3MLXH 4JM4L 5DLML 1K8DA 3ARWA 3RNKB 5D7KE 2C3HA 3GHEH 2IH1A 2A73A 2V17H 1N5YH 2OL3L 1AHWA 1KNOB 4L4VE 4Z78A 3NABL 1WCQA 3X13B 2FNBA 4NOFA 1MI5E 2MMXA 2O5XH 1I75A 1WBYB 3VWJA 5FUOH 2X4PA 1MVUB 1SY6A 3TNMA 2ITCA 4M03A 2OQJB 2RR3A 4Z76B 4QRUA 1JZ4A 5TFSH 2K7PA 2Z92B 5JMOC 3N85H 3T3PE 4PGBB 1T89A 3NCYP 1YPZE 5IEKB 5MEQB 3DTXB 3HNSL 3QIUC 4HFUL 4S1RH 4DTGL 1IMHC 4WNQA 2FX7L 3E8UH 1JBJA 2RQ8A 1BGXL 2JKXA 4HPOH 5IMMB 5HI5D 2IFFL 3JSSA 2WP3O 4RNRA 5DI8B 4PJDF 1D5BA 5F88B 3GNML 4HUKB 1OAQL 5DC4B 3CXDH 1A1MA 1A1NB 2EDKA 1JHKL 5D7JA 2GIYA 1JTOA 2PW2A 4RAHA 4TUJA 4PJAB 3KYNB 3UDWA 1BMGA 4WIQA 4K71B 5DD1L 1BJ8A 5J4MA 3LQZB 1T6VN 2A83B 3DMMA 2OMBA 1XF4A 2YPLB 4ZSOE 2R2CA 5J57B 2P7TB 4X6CB 3CZFB 3FQNA 2HWZH 1WCBA 2XWBB 1EAPB 4NQVA 2PO6C 2FWOB 4ZUVB 1RUQL 4XVJH 5DJ2B 3G6JE 4G8EA 5CZXD 1LGVA 2EDFA 5GHWL 4KRLB 3VXUD 5I9QC 5KVDL 5DD5L 4YAQB 5D7KD 3UPRA 5GS0L 4OFYA 2ZSWA 1KJ2H 1P1ZA 4LHQB 3ISWA 5I1GL 4Z7VE 1FFPB 2ORBL 2R0ZL 3VGDA 3U0WH 5KAQF 2ARJB 4ZTPL 3TLRA 2V2TB 1T1WA 3MODL 4FQLL 3NZHH 3MRIB 1EPFA 4H5SA 3PWUA 5DRXB 2AW2A 3G6DH 2RCSH 5ESVA 5EN2B 3QDHA 1GOHA 2HLAA 4N8PA 1FORH 1GAFL 3HRZA 4KKLC 2IQAB 1OTUC 4OCSL 3VXSE 3B5GA 2CKBA 2XPGA 1VENA 4YHPA 3MRRA 4TPRL 3EO1B 3AS3A 1V3JA 2WWMD 2XRAL 4HK3J 1UYWL 1IT9H 4WTWA 4XP4L 4RGNE 1H8SA 1QFWM 1ZHNA 4NYLA 1N8ZB 3L9RB 3KWWB 5HHVL 2YMXL 1RAMA 1JV5B 4FQIH 4LDLB 1TDQA 1KCLA 5B3JF 3MOQA 2YKLH 4TSAL 5LJYH 4MQTB 5TGBB 4P57A 5IEHA 4I0CC 3EYFB 2OBGA 5BZDA 4I5BA 4NZTH 1AGFB 1QNZH 2KDGA 3QUXC 3FT4A 3MRQB 5EWIH 4PRHA 3ZKSD 1EXUA 1UM4L 5ITFA 3PWLB 5I8EA 3VFTA 2CXKA 5I0DA 1KENH 2FGZA 5B3NA 3AXLB 5DR5H 2OXGA 2P5WB 2C4FU 5IVOA 3ARDB 5I15L 3UPAA 4IOFC 3X11A 1UWXK 3C6SB 4KRPB 3TNNB 1S7VA 4LIQH 1JGUH 3VDCA 1NAML 4IDJL 1VADA 2DBLL 1RIVH 4XMLH 3IJHA 2X89A 3LAFA 5F89A 1MCOH 3PWPB 4KVNH 3ARYA 2DLIA 5EORH 4AK1A 1C12B 2OTUA 1QG3A 5JHDE 1SBSL 1EHNA 5DHVA 1A47A 4NUJB 4KXZI 4YFLF 2PYED 4PRIE 5BVJB 4L8SA 4FQ1H 4KAQH 2ICEB 4LP4A 5FCUH 2HG5A 5KZCB 1BM3H 3UYPA 2ESVA 4PJEA 5GJSH 1UM6H 4Y4KB 4R4BB 4YDIL 1UM5L 3I6GB 1EV2E 2IANE 3U2SB 3KHOA 3H9SA 2GJZA 2AEIT 5HDQH 4HCRA 5I1JH 1W72A 3CDYA 5IBUG 4P5MA 3RIAK 1KTDA 3ZKND 1WZLA 5FYJH 2AGJL 4FZEL 5DMIH 4KFZC 5A2JH 4QRPA 3SDDC 3BRGC 1CR9H 4JFEA 2E7HA 5K59E 3DUUA 1BHGA 5D93B 5EFIA 4XVSL 5I71C 3EOYG 3X3GL 3BQUC 1A9EB 3RDTD 2YUVA 3HE7A 5FYKU 4HKZB 1BVZA 1CN4A 5EZOL 1U8HA 3D0VA 3VJ6A 3PIQB 4HBCH 1X5GA 3SCMB 3PABA 4GRMB 2X09A 4JVWA 4YFEA 1G9ML 3OAZH 1N0LA 5GISL 3DRTA 1PKQB 3QNXA 5HI4D 3WNLA 1JGLL 1U92B 2BNQA 3AS1A 1IEAB 4ZO9A 4OI7A 2AV1B 2UWEA 2DQUL 1G0XA 1PZ5B 2EDYA 1YNKL 4IJ3C 4NNPL 5AG8A 3MJ9H 1HSBB 3QUYB 3K7UA 1CWVA 4HEME 3DMMC 3LQMA 3ROLA 5HYFA 1KC5L 3BHBB 4ZYKA 1MOEA 5EH1A 2FJHB 4I0PB 4C4KT 3VG0H 3STLB 3EYSL 3MNVA 1FL5A 3RWFB 1W0VA 2X7LA 5HYQB 4EUPH 2PO6A 4MAYD 4ZSOB 5DMKA 1G7IB 2HFTA 3O41A 1I1FA 1F90L 1CGUA 1JMXA 4AIZB 3CSYB 1DQLH 2R29H 2Z0BA 3DBXA 3U4BH 4QOKA 2M2DA 5CGYD 4UUJA 3QDGA 5CGYC 1Q94B 1HKLL 4L4VA 4NNXA 4HDIB 5GGSA 4XT1C 5IT2L 2GY5A 5B22A 5T1KD 1MLBA 2C3VA 1PVHA 5T5NF 2X4NA 4HWZB 3JWDH 3O2WL 4ELMA 3BD3A 3TJEH 5HHQB 4ZQKA 5A43C 3TP4A 4DQOL 1DBJH 2CR3A 2JJUA 4CVZB 4P9HH 5F97E 5K9QG 3EDEA 1D7FA 3BIBX 1V3MA 3BZFA 3KLAA 2ZWLT 5GGRA 1JN6B 1HHKB 1MUJA 4ZO6A 4TUOA 3S3JA 3C2AL 4IDLA 1F4AA 2OM5A 1M1SA 5B4MD 2IPKA 5EIIA 1KN2L 3GJFA 1KELH 3DV6A 3E0GA 2OS7A 1ZEAL 2XNAA 1PLGH 2ADJB 3WFDH 3EYVB 3LIZL 3MGTA 4XCFL 4WFHD 1XR9A 2NY0D 1S7RB 1SMOA 1ETZA 4KH2A 3T3MF 1CXKA 1UQSA 3GSNH 4QHKJ 5DK2A 1CFSA 4PP1C 1FVDB 3HZVA 3HUJF 4PJFB 3FONB 5HVHB 3ARXA 1MJ8H 1XMWA 3MV9E 1CFNA 3EFDL 2Y5EA 4L3CA 5IB5A 1UZ8A 3BQUD 4ORGA 4PJXA 4JO4H 3GHBH 2YMXH 4K94L 5EA0L 2GSGA 1A7PL 1C08B 2HTKD 2SEBB 4P0DA 4EXKA 1C5BH 3T08A 1ZHKB 5B8CA 1Y18A 1GVIA 3LD8C 3C5ZA 3UO1L 1NCNA 1LE5B 2VE6A 4OLEA 4F7TB 3B2UD 4R97B 2NMSA 3ALPA 1P7QD 3BEWA 5IMMA 4QRPE 3LRGA 3VGAB 4G8GB 3QFJB 3KAAA 4UAOC 4D0CA 5HGHB 2D31A 5IFHH 1KJ3H 2H32B 3INUL 3MLUH 5FYJU 4YNYA 5E7FA 3MREA 4ZODA 2H45A 3OKOB 3SO3C 2NCMA 1WIPA 1ADQH 1OHQA 1YN7B 2NYYC 1JGUL 3EHBD 2DWEA 4UV4H 1MAJA 5JPMA 4Z7VF 4RGOL 4U1SA 1A4JA 1NAMH 3HI1A 4IDJH 1K2DA 3OZ9L 5GGTA 3VFVB 3WD5H 5DJAA 3RY5A 1QBML 5DUPH 5E6IA 5DA0B 1QSFE 1FZKA 5L8KB 2AQ2A 2LTQB 5MEND 2R56H 2YEZA 5MEPB 2X9WA 2WBKA 1KSRA 4HIEB 4PP2B 1R5IA 3PWVB 2QHRH 3WS6A 2XOTA 5EZIH 1G9NL 2Z35A 4RDQF 3KPLA 5DRNB 3OXRB 1HILB 4UILH 3GBNH 5BJTA 3WCYA 2BSRA 1GYAA 4OFPA 1QA9B 1UJTA 2ZP0T 4NBXB 1MIEH 3P4NB 4HGWB 4M43H 1SJHA 3QAZC 1OAYH 3V5DA 3MO1B 1JZ7A 3KJ4C 3GIVB 4S2SA 1NBYB 5HDQL 3D9AL 4I4WB 2NX5B 1RUAH 1XF2A 3NAAH 3DWTA 2VABA 4N8VB 4O2CB 2NTFA 4O9HL 2IH3A 3O6KL 3SO3B 1CFQB 4ZD3L 4E5XA 4MA1B 2YSSB 1OSZB 3C60D 5IMLB 1BFSA 4G6FB 5EU6D 1F4XH 4N8VG 2YZ1A 1K8IB 1OP3K 2ZKHL 1LILA 1LO0L 3FO0L 4PG2A 5D7JC 2C3WA 4LMQE 4K7FA 3GKWH 4H25A 4FZ8L 4P3CL 4GRWE 1I3GH 1JK8A 5IB2B 3DGCR 3QNZA 3OAYH 3MV8D 5C1MB 5CAYB 2W65B 1W0WA 3ARSA 5C8JB 2WW8A 3KS0H 4OJFL 5D7SL 4OKDA 1KEML 1NCWL 4D3CH 4EIGB 2Z31D 1MWAB 3SJVD 1IAIH 4ZPVB 3DSNA 3U0TB 5DQDH 1DLFH 4B53A 1FFOA 1PG7H 1P4IL 2VLLA 5FO9A 4FG6D 2RB8A 5F7EH 3KJ4B 3EO0B 1U36A 1FGVL 3RL2A 3SN6N 1PJ9A 4K8RL 4JDVA 4LPVA 3MV9B 4KI5E 4R8WH 2I9TA 4CL7A 5FKAA 4FQJL 4TRPL 4AEHL 4LP5A 1YDPB 3CC5A 4QNPE 4HJGA 3WNMA 2V5SA 2HFGL 1LK2A 1U93B 1VESA 3I85A 3JV4A 3SE9L 2HKHL 4HV8B 3KR3H 4L5FL 3BP5B 3CPLB 2RBLA 1D6EA 3CH8A 3KPTA 4JHWH 4I18C 4KV5E 4I1NB 4K7PY 3M17A 3IVKB 1XGUA 3I6LE 4PS4L 2G5RA 4TVPD 4X99B 1IE5A 4OSUL 2CD0A 3GEWB 5BVJA 3WLWD 4ALAH 1S78D 1A6AB 3GSOA 4FFVD 1IM3A 1JF5A 2GTWA 4WHTA 5DO2C 3SHSA 4ZFGL 5ICYA 1A3LH 3QQ3A 4OUUA 5KS9E 5EOTB 3VWJB 3WMSA 3K80A 1C16A 3BWUC 4JY6A 3OJVC 2E7MA 1Q9LA 4MJ6A 3I6GA 5CBAA 2EDDA 2ZSVA 1HHJB 1R3IL 1R3HA 4GW1A 3BW9B 1FQ9C 5FF6A 4OQTA 5D2LE 2BNQE 1EMTL 1BD2E 4B50A 2I27N 1JGEA 5F1SA 4LHUG 1MJ7H 3IF1B 1M71A 3MA7A 4HK0A 1T83A 4PJ7E 2IAND 4HS3B 4M4PA 5MEOB 4JDTL 3RGVD 3OL2A 2HVJA 3BH9B 4FQXC 4O51A 3LV3B 2ADFH 4XBPA 2GCYB 1FE8L 1FRGL 2O61B 3VFSB 4O02H 1FJ1A 3SDCB 1PBYA 3SGEI 2P7TA 4IRJD 1MHPH 5DMYA 3LHPL 3QEQA 2EZ0D 1JF6A 4XCEA 5L2KA 3GI8H 4X4XB 3WUWA 5CIPA 4PRDA 4KZEL 1YZZA 1Z9SA 2D03L 3FFCD 4ZNEE 5JZ7C 3QCVL 4JPKH 3SDXB 4KQ4L 4RX4A 4YZFF 1QBLH 1GGBL 3MRKB 2J4WL 1V7NL 2B7DT 1DLHA 1YC8A 4WW2A 3VXUA 3OHXA 4NJAL 5HGAA 1Q9WA 2P24B 3MRBA 5HY9A 2CIIB 1KJ3L 2ARJA 3ULUC 1WFTA 43CAA 1LE9B 1JHTA 1ZA3B 4J3TA 1P2CB 1JHLL 4P46D 1ZKAA 2AK4B 4WWKA 5EO1B 3BPNC 1NUDA 2B1HH 2IF7A 1QPPA 4UV4L 1IGYA 4R26H 3O3EB 4QOKB 4LSTH 4CN6A 5I1CL 35C8H 5JA9A 4KKAC 4F7MA 1KLFA 2J5LC 2PTUA 1ZLVH 1VDGA 1JUFB 4ZFZA 4QTHB 4E41B 4K7PX 2FATL 4WFHE 4XI5C 2R0KH 1ZTXH 2B4CC 5CEYA 1QLEL 1WISA 1A22B 1D5ZB 5J9PB 5JOFB 4FRWA 2YXMA 3E6HB 1KGCD 3ZKNC 1QFUL 3V4UL 4J3VA 4N0UA 4MAYB 1NMCC 1A0QH 3PDOB 3EYVA 3TPKA 1P4LB 1I8KB 4J6RH 3UROR 1GOGA 3QG7H 1D5XA 1RUKH 4M1CC 3QUYC 4P48A 3AFLA 4PJIB 1RZKL 1IGJB 5F7NC 3QZWG 4S1DC 4RAVA 4OGYL 1F58H 4GW5B 1RZJC 1VKXA 2X9YA 3V2AR 3VFMA 3IJSA 4L8DA 1IAOB 3NPSB 4GG6A 2AJYH 5C6TL 1CG9B 4K3DL 4HX1B 1S7QA 4OM0L 4MYWB 4ENEC 5TPWL 4LNVA 1KXTB 3ULUF 2FZ3A 3IGAA 3O0RH 4JN1H 4U6VL 4V1DA 3VD7A 4EN3D 4MNQE 2AXFB 1T1YB 4PGJA 4DGIH 4TSCH 3QIWC 3PNWA 3B5HA 4XTRC 4YDKL 1KEMH 1MJUH 2I5YL 1INQA 2VH5H 3IDIB 5I74B 5JXED 4Q74A 4KKAD 3FRPA 4G9FB 3X14B 1YEKH 1PG7L 1UACH 1AGCB 1GIGL 3VXOA 1N26A 2DWDA 3MBEC 4KY1H 3T2PA 2PXYB 2EXWD 5TDNA 3SKNA 4IRSB 3MA9L 3QFJD 4ZUWA 3SKJH 5EOQH 3HB3D 2R4SL 2PF6A 2P48B 2ESVD 3T2NH 3HS0A 3K3QA 3FOLB 2BNUA 3H9SB 4QRTB 1AC0A 1FDLL 1E4XH 3P0YL 1B4JH 2BVOA 1RULH 4NO3A 5E8EB 3K46A 1HIMH 3MYZA 4MVBC 2HKHH 5IG7A 3SPVB 3TYFA 4L5FH 2XI9A 3BPCA 2YN5A 2VC2H 1E6JL 3B83A 3HC4L 1IARB 1M6OB 1EAJA 1WWCA 4ODSL 1HWHB 3PHQA 2CUMA 4JFZH 4D0DA 4XPFL 3MLSH 3GI9L 4WV1B 3D0VB 1NC2D 3P4LA 4NZUH 1LD9B 3U7WH 3EYOA 5ILTL 3VFNB 5I6XB 3LH2L 2XZQL 3IU3B 4NOBA 4CDHA 4QHNA 4NKMA 3CVIH 1UCTA 1ZSDB 3EDKA 5T5FL 3V95A 5DVLA 4PRHD 2VXQL 4N68A 5I19H 1EBPA 3MRHB 3MBEB 4U1NA 4LOUD 2A6KB 4EOWL 2BJML 1F6FB 1R3IH 1JIBA 2AEQH 1S7SA 3SKMA 4UOW0 3H9HA 2Q7NA 2V5MA 1QEWA 3ZE0F 4UI2A 2EDWA 3DI2B 3PP3K 5SX4H 3TBSB 1EGJL 2C3GA 2XYCA 1S3KL 3VGAC 3VG9B 4S1QH 4M62H 1MCNA 1XT5A 5HYEA 4CMMB 2EDNA 3WSQL 3IAGC 1R0AL 4GRWH 1MVUA 3MGAA 5DA4A 4JDTH 2WQ8A 3PP4H 1O7VA 4AIZA 3HZYA 2RJMA 3CFKB 3RVXD 1FRGH 1MFAH 3RWEB 5FCSH 4WUUE 3GMRB 4ZAKC 4UNUA 1D5IL 1MHPL 1F02I 1WIUA 3FB7A 1ZK9A 4XMPL 1T20A 5LQBL 5DD6A 4R0LB 2QSCH 1D5MB 4U6XB 1LNUB 4PGCA 1IC7H 2ZUSA 1WWAX 1CS6A 4QHMB 3MACH 3IFPB 3ULSA 5CCKH 3M07A 2DL9A 3DYOA 4KQ4H 4PR5A 4XPTH 3NCMA 3E3QC 5BQ7B 1BVLB 2E3VA 2IADB 4LEXL 4DN4H 4JKMA 2CUHA 4TULH 5GGRB 4JRYE 1YJDH 1KCSH 4GBXA 4OFIA 1XF3B 4P2RA 3OSKA 3VA2C 1JPFB 3FB8B 1J05B 3U9PH 3H3KA 1GGIH 1CL7I 4P46B 3LS4H 5KVFH 3MCKA 5DJ0B 5E5MB 1DTUA 3FOMA 2F19H 4U6HB 3V4VL 4OCYH 2YRPA 5GZOD 5JNYA 2XKNB 1GRWA 3MRPB 3B9KA 5SWZA 1RIUH 4KKCC 4NUGH 2OSLA 3I2CL 5L2JB 4X6DF 1D9KA 4WEBH 5CJBA 4DKFL 4JM2F 1TJHH 3F7QA 3P73B 5FGRA 4YLQT 1AC6A 3CFDA 4J8RA 2FLRT 4NRZB 2OR7A 2NY3D 5IQ9B 3BAEL 4XC3H 3FO2A 4K7PL 5AZEL 1XCQB 4HUNB 4O2EB 5ICYB 1CE6A 1FLRH 2J6EA 5F1OB 2W9EL 3PG2A 1BJ1H 3UYOD 3BUYB 4PTUB 3PWJB 2HT3C 5C3LD 3QUML 4PJIE 5TE4H 3CFJA 1A3QA 3FT3B 4JPWL 4UINL 1SQ2N 2ITDA 5I30H 4F9LA 4G8FB 1VPOL 4OLZH 2QBWA 3QIBA 4G6ML 4HT1L 1MRCH 3UDWC 1MFEH 3BT2H 2QQQA 5HYJE 2ZZUT 5ENWA 4KKNA 2B39A 1LEIB 4NQCE 1MSPA 3UBXB 1OARH 1N8ZA 3L9RA 4KTEL 5EPMB 4B0MM 4IIQA 3H6JA 3P77A 3C8HA 5IB1B 5T5NG 1I8MA 3HE6A 4HIHA 1K8DB 3ZL4L 5KVEH 1ZAGA 2MCPL 3EYQD 1KCVH 2KL6A 1XGRA 5JPMB 4P4KC 1TETH 3FMGH 1K2DB 2FO4A 1I3VA 4Z78B 1LP9A 2CRMA 3LCYA 3DSFH 2J8HA 5JHDB 3GHEL 5EBLB 1U6AH 4PY8J 1VGKB 5L2KB 4P5KA 4A2MA 1EXUB 3S9DB 1XGTB 3QB7C 2R2HB 4V1DD 4KZDH 4OV5A 1NL0L 3R8BB 1TJGL 3T2OA 2P47B 4FTVB 1GIGH 2GJ6A 4UT9L 4JDZA 4YEEA 1NAMA 1FIGL 4Q9QH 4G42A 4NM4L 4NIKB 4Y4HC 4Y7MA 2ZG2A 5CEXB 4N0FA 3BKJL 2N7BA 4F9PC 1G9EA 1AKJD 3QZWB 3FJTA 4C58B 1NBYA 4QLRA 3P0YH 1I7UA 2UZIH 1OAQH 4JQXA 4PJ8C 1BPVA 1OWWA 3KPNB 5C92A 5CHNB 1PYWA 2ERJC 1FYTB 1SM3L 2ZCHH 2FGWH 2HN7A 4L8SC 4M93B 5GGVL 3VMNA 4JN2A 4EUPB 4WUKL 1GGCL 4JZOB 1ZANL 3EOAB 5C0NC 1NMAL 4P4RB 3LSOB 1I7RB 3K2MC 1NSNH 5HBBA 3LMJL 5F7MC 2W9DL 5T3ZE 3VXRB 2ARWA 2VAJA 5DEZA 1HZHH 3CAFA 1ZHLB 4QXUH 4XPHL 1KTLA 3ZYOA 1V3LA 1QOKA 5IFAL 1Q1JL 1MCCA 2CLZA 1I85C 1SJEB 1L0YA 5C7XL 2E9JA 4F80A 4WGVB 4AL8H 2WWMC 4XVJL 5GRWA 5EBWB 4ZAKD 4YAQA 3QWOA 3PGFL 1HQ4B 2FJFA 4WO4A 1N5YL 4LSPH 3HMXH 2AEQL 1DDHA 4RBPK 3QQ4A 3QXTA 3L5WA 3HAEG 5F8QC 5GS0H 5C07E 3V0VB 4ZPVA 4CBPA 1SYVB 3NA9L 1PX3A 4NGHH 3KPSB 4NDMB 3ARFD 3OAUL 3PIQA 1EGJH 1I8IA 5D70H 4G9DA 4PJDE 3NACH 1KLUA 4UDTB 3PQYA 2ID5A 5D1XA 3D0LB 1XF4B 1J87A 4HFUH 2C1PA 1QHPA 3CUPA 1DZBA 1RZ7H 4OF6A 1BGXH 3T4YA 3I3BA 2IFFH 1UGNA 1ZWIB 1YNTB 3O9WB 3MUGA 5DJDB 3UBXI 3E3QE 4TYUA 4TTDD 2RFXB 2D2OA 1MFAL 5DZNA 4N0CC 4WI8A 1CICD 4LLQB 4RIRA 5DK0A 2VIRA 1A6PA 1KPUA 5C0BD 2CLRA 5F7YC 2CDFA 2RHEA 5ESQB 4X99A 2D9QB 5HSFA 4YHLH 1AGCA 3VXOB 4H0IA 1T1WB 2J8UF 2YKLL 4EVNB 3MRIA 3AREC 2DQHL 3QEUA 1HHHB 2V6HA 4Z8FL 2F53E 4DK3A 3CSYA 4B41A 1YJDL 1QNZL 5DVOA 5T3XE 4EI5B 3TT1L 4KGJA 3ZE2F 4PB9H 1QFWI 4MA3B 3ZSSA 3X17A 1R3JA 3NFNB 5T1DL 4DFIA 4X80H 3S98A 1Y6MR 3CVHL 3EAKA 4YK4B 2LABA 4A2LA 4JFED 1NBZA 3WIIL 4HLZG 1S7VB 1A6ZA 3MODH 5E2VH 2DRUA 5DD0L 4OGXH 4PYHA 2JTDA 1Y0LA 2EYRA 4NUGL 2C4FT 4WEBL 2DBLH 3L3KB 4HIJA 3DUSA 4JJ5B 2Z31B 3SJVB 2ZPKL 3BH9A 3QI9D 5FDWB 5T1LB 1T7VA 3IXAB 3MLTB 4FNLH 1N2RB 4LSVL 4P3WA 4F7PB 1MI5B 5CD3A 2XTJC 1U8LA 4RQQA 2FX9H 1XGQB 5L8JB 1CD1A 1MFCL 3E2HC 3MLWL 4UBDD 2OR8A 2DIAA 2XN9E 3DXAB 3WUWB 3RWDB 1YNLH 5I30L 5H94A 4PYGA 4HPYL 4JQIL 4JFQB 3P4MB 4LASH 5DFWH 5F1NA 4HD9A 2DS4A 3L6FB 4WTXA 1ODAA 5D96B 4GKNA 1KTDB 1MRCL 4HT1H 4WW2B 1RZJH 4HZAA 3F5WB 2VUYA 4GQ9L 5MI0C 2VXTL 1HCVA 1TVBA 4JFYA 5AYUH 1JNLL 3ZHLA 2ED8A 2ENSA 5ID1A 3QJFB 3ZYIA 3GMLA 5E56A 5DJXB 4ODBD 1P4BL 1SMAA 4OUOA 5GS0C 4GOSA 1E27A 1JPSH 3QQ9C 1U91A 2DIJA 4Y5VC 4PLJD 3N06B 3Q6GL 2GSIB 2UUDH 4OF5A 5I8CA 5C0GB 4BELD 3BDXA 3Q5TA 4QHUB 2NW3B 5LCVL 4L4VD 3SCMA 3V9FA 2V7HA 1SHMA 1HYSC 5TF0A 5C70A 2ICEA 4CVWA 2VZTA 1EEQA 1BZ7A 1M7IA 3GSXA 1G7PA 1PDKA 4I9WE 1B0RA 5F9JA 4L3EB 4OM1H 4YBQC 2AV1A 1DANT 2UWEB 1G7HB 3LKOA 1FC2D 4APQA 1T6WA 5DUBB 2Z93A 1IEHA 3ZE1F 3UYRH 3RU8L 1J10A 3MLVL 5D1ZD 4MSWB 2R1YB 4NM4H 1ND0B 1YYML 4PBVC 4N1EA 4I0PA 3EGSB 5D96C 1FL6A 4N0UB 3TZVD 2P45B 3L3OA 2ZSWB 1LK3H 5MI0B 4BSVA 4HFWB 3EYSH 1Q0XL 4NQCA 4WFEE 2PO6B 1BM3L 2WIIB 1DJSA 3O41B 1IC4H 3FOMB 1I85A 4FQCL 2ZCHL 4JG0H 3OKDA 4PJ8B 2BRRL 5GSVB 3VRJA 4Y5XA 2ED7A 3SGEH 2R4RL 3DJ9A 5JW5B 2R1WA 4ONHB 4EBQH 2QQKL 2R2BB 1I1RA 3L7FA 2HH0L 2BP3A 2XY1A 4Z5RB 1QA9A 1PD6A 3VG9C 4X5WA 1J8KA 3WFBL 4IM8A 1S7QB 4JZNA 4D9LL 2A6DB 1MEXL 1IGCL 4F7CB 12E8H 5IFAH 3VXMB 1Y6KR 4ZUUB 3WO4B 2MKLC 5D7LE 5DTFA 1I9JH 4J3XA 4RMRA 4AEFA 4AL8L 1B0GB 1KPVB 3BUYA 4G3YH 4PTUA 1DFBL 3KWWA 4LNRB 5EZOH 4DQOH 1MLCB 2X89D 2OP4H 1GGYA 2HP4A 4M6OH 1YEIL 4F3FA 3QHFL 4JFFA 5I73C 5C0CB 1WBXB 1G1YA 1SY6H 5DC9B 3K8MA 5IBTH 5DMKB 1CBVL 4KROC 1QFPA 2KKQA 4GMTL 4GBXC 4QF1A 4OV6F 3A6CH 1JTTA 3DLQR 1AFVH 4NKDB 5IB1A 2OZ4A 1W0WB 1MQKH 1S7WB 2APWA 5C8JA 5JO5A 2HMID 1K3ZA 3NCYS 4EEEA 1PW3A 2XN9B 1NJ9A 3DXAE 4Z18A 3QUXA 3ARBB 3MX0A 4M8QB 3IJHB 2QSTA 4UOW1 3WN5A 4U2ZA 5FKPB 5ABDE 1Y18B 2XG4A 5EA0H 3LOWA 3EFFA 1XR8B 3I75B 1AY1H 3TO4A 3LDBB 4K9EC 4QHNB 3HAEA 2N56A 1NDGA 4JDZB 4Y2DA 1ZGLP 3UO1H 1CU4H 3ARGC 2EIDA 4Z8FH 4IBLT 4K23H 5E08H 1BEYL 4X9BA 1ULVA 1RHHA 4LHUB 5J12B 2D7QA 5DK2B 4CVXA 5HHNA 3QISA 1CZ8H 4LKXB 2ZNXA 3I9GH 4X80L 1N7ML 1UENA 3PXHA 4LPWA 4UNVA 4YQXL 5C0FA 2BOBA 5MP6H 2HRPL 4LCYA 1KLGA 4K9EL 1E4XI 1KN2H 1DQMH 3OWEA 3D5OF 4OGXL 1NPUA 1WUNT 5C3TA 1S9XB 3O3DA 3HRPA 1PGRB 4CMMA 1MPAH 3OZ9H 1C08A 1Z5LA 3VXTA 3KJ6H 1FZKB 4OZHA 2VDLH 3MRFA 2MFNA 1LO4L 4I3RH 5JIIA 3ES6B 3VFWB 3O8XC 4MNGA 4XCNB 2FBJL 4HUUB 4U7SA 3RZCD 1OT1A 4CW1B 2OJEA 1RSFA 1N5AB 4X7CC 1BVKB 1BD2A 4PUBH 2QEJA 3V52L 5F7UA