3VE0B

Crystal structure of sudan ebolavirus glycoprotein (strain boniface) bound to 16f6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
DIVMTQSHKFMSTSVGDRVTITCKASQDVTTAVAWYQQKPGHSPKLLIYWASTRHTGVPDRFTGSGSGTAFTLTLNSVQAEDLALYYCQQHYSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Structural basis for differential neutralization of ebolaviruses.
pubmed doi rcsb
source organism Sudan ebolavirus
molecule tags Immune system/viral protein
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B01
4P2QD 1EAPA 1MI5E 1PGRB 4PJHE 3UJTL 7FABL 3FTGA 1B90A 2F53A 3HI6L 1OCWH 4OZGF 4PTTB 3TN0C 2FECI 1XF4B 4HGWA 4HJGA 4MNHA 4PV8A 3FN3A 1U58A 4JANA 2H2PD 4NQEE 2I9TA 2R0ZL 1TETH 2R1XA 4ZODA 3TBYB 2VZOA 4PJ8A 5ECJE 5CWSA 2HFGH 1WT5C 5KVEH 1AHWB 3S3SA 2UWEB 5K33A 2R8SH 2C1PB 1AJ7H 4P3DB 4D0BB 5ICXB 1G7HB 5TE6H 4MA1C 1XEDA 2FCBA 1DE4B 3U2SB 4K07A 4QRTB 1N7ML 1N3NA 4OKVB 3LKSB 4IDLA 4FG6D 4U6YA 4JFZL 2XNAA 5GZND 3V5KA 3BYYA 3L3JB 5KVGL 1JUFA 4OCSL 4BZ1H 1I8IA 5EN2A 3WN5A 1OAXH 1VHPA 4D9QE 5JIPA 4XMPL 1ZWIB 1DVFD 4S1SH 4LMQE 5IK3A 5JMRA 5BS0E 2PETA 3CXHK 1ZSDA 1T66D 4AM0A 4PG9A 1BP3B 5D6CB 4UT9H 4OD2B 1FRGH 5BCAA 3RDTD 2H2PC 1KT2B 3TYGL 3K4DA 3CDCA 5HGBB 4OBRA 5DK2A 1U8PB 1YZZA 1H3UA 2E5EA 1G0YR 3BHBB 2HVKA 3MV9E 3B2UD 3G6JA 1I9RL 2FBJL 3KYMB 3CU7A 1NGYA 2KL6A 3W2DL 5A40E 1HHIB 2G75B 4NKOB 5HHPB 2YKLH 1I8LA 1G6RL 4FG6C 1TZIB 5IWLC 5KN5A 5BRZB 5A16B 3A6BH 1CU4L 4AK1A 3GBMH 4Z76A 5GZNC 3ET9F 3SJVB 4NQVB 1VESA 5FKAA 2OR8A 3CFJA 2B0SL 3O6FA 3O6LL 2DBJA 4X0KB 1DVFC 5L0QC 5A43C 5HPOA 3NZ8A 1IZJA 2Z0BA 3MV7B 1T66C 4P46A 5D4QA 3QB7C 4PG2C 4MXVE 5C0RH 2CDFB 4J4PD 3RDTC 3RA7H 2J8UA 3BP4B 4NZRH 1F4YL 3QI9D 5J6HA 2YEZB 3LKQA 1QVOB 2FL5A 1NC4A 3QEQB 1C5CH 2BC4A 3OJ2C 3B2UC 4ZAKB 4ODXA 4LFHD 4QRQA 3SHSA 5GGSY 3BI9X 4CUCA 3R8BB 2V2TA 2YUWA 1KB5B 4AMKL 4Q0XH 4NT6B 2B2XL 2UY6A 2X4QA 3AMKA 4CNIB 4ZS6D 4O2EA 5INDB 3WKML 2IBZY 4FTVB 4Z7VA 5E7FA 2ARJB 2D03H 5DJ8A 1B0RB 1BF2A 4PJGE 1YJDH 3MUJA 1L7TH 4Q9QH 4HC1H 3C09B 1JZ7A 2QSQA 5KG9A 4J4PC 5DHYB 5J89A 2ZJSH 4PB9L 3QI9C 2X4NA 5DVLA 5IGXL 4KDTA 2O5YH 1NAKL 5HVWA 5E2WL 2Z8SA 5DJZB 2Y5TA 4LGPB 4NUGL 4L8SA 3LZFL 1IGCH 3HMWH 4PRAA 3RWJA 3MNZB 1Q38A 5I71B 1I7RB 4DOHB 4OZFH 3I2CH 1VDGA 5IVZA 4IIQB 4YLQT 1AE6H 3T2QA 3X3GH 1IC1A 4FHBD 5C09D 1TIUA 1T20A 4YDVB 4YXHL 4ZS6C 4NC2B 5KTEH 2HJKA 2F54D 1JHLL 4PRNB 1AGFA 4LP4A 3MRNA 1KJVA 4M8QA 1D5IH 1ZTXL 3GSRA 1NCDL 4Q6YA 4TTDD 1VFAB 3JWOC 4FQQB 2D0GA 4DCQB 3PWNB 3CCHA 1FVDB 3LQAC 3IGAB 4BZ2L 5ETUA 4TNVF 4XNMA 4K3JL 3VDBA 1WBYB 3E6HA 3KPMA 3ARSA 4ZNCD 3M45A 4EDWL 1DUYA 2RCSH 4WHDA 3TWCL 3I50L 4HKBA 1KGCE 5DZNA 1X4XA 3IF1A 4OFVA 5FF6A 1WBZA 3PXHA 1MCPL 5EORL 3N1FC 2FX9H 2MWCA 1A7OL 3RWCB 2CPCA 5I1HL 4HUUB 1LNUB 3GSNB 4OCNC 1LEKA 4PRBB 1YMMA 4MA7H 1SY6L 4QTIL 2XY2A 1EEUA 4PJXB 3Q5YA 3KPSE 2VL4A 3DRQA 3IDXL 3GMMA 3L3KA 4MSWB 5I17A 2R1YA 4TTDC 3QUXB 3ARXA 4OLEA 1ZANH 3T0DA 3K4ZA 5E99L 4L8CA 3LD8B 3QXDB 5IW1A 3O4OB 5T1DL 1WUNT 2NTFA 4R0LC 1UKTA 5FM8A 3WLBA 3O3BA 2PN5A 1MWAL 1IEBB 4PRIE 3DX6B 4POYA 3STZB 3LH2H 5AZ2L 2I27N 1TTFA 4XC3L 4XBPA 4HXBH 3MRDB 1A3RH 3O6KH 4OFYD 1L7IH 3BDYL 3HR5A 3QPXH 4P9MH 4PBWD 5ANME 1YPZB 5MENE 3P0YH 3UEZA 5CJOL 3FQXA 1OAQL 2CGRH 3SDCB 5I15H 2JELH 5MP6L 3GI8L 4NQXB 2DQDL 4CKVX 1UB5B 3NGBB 3U9PL 1AHWC 3PP3K 3TIEA 4LLQB 2VAAB 2XKNA 3VFVA 4XTRD 1YUHA 2JK5B 1YA5A 2V2XB 3PIQA 5CJQL 4G6KL 1INQB 3WE6B 5H8DA 3WUWA 1BVLB 1G7MA 5CIPA 5BJTA 2DTSA 2G5RA 1MHEB 2X4PA 4NM4H 1W8OA 4OM0H 2WUBL 1AIFB 1S8DB 2F74A 3QEGH 3SJVD 3FHAA 5T3ZD 3QBTB 4PV9B 4HJJL 1OGTB 1D5BA 2DDQL 2OP4L 1B0WA 3VXOB 4H1LB 1JRHL 2VLMD 3P2TA 4MJ5B 4ZTPH 3Q1SH 3ZYOA 43C9B 1J9CT 3DV6B 3DI2B 1QFOA 3S36H 2A1WL 4QRRA 5I9QC 2R2BB 3QEQD 1Z3GL 4XTRC 1BD2D 1U3ZA 4JPVH 1G84A 3PQYA 1RZJC 4WHCA 3V4VH 2FR4B 5EUOB 2P44B 1RV6X 3OR7B 3NIFE 3D2UD 4Y16B 3TPKA 4ZD3H 4Z7UB 3WXWH 3MRHB 4R3SA 4H88H 2W91A 4WW2A 2IGFH 3G5ZA 3D0VB 4WHYG 4Y4KB 4PJ5A 4QHNA 5J06A 1A1MB 5E8PB 4NHCH 1MAKA 4HX1A 2AJSL 4YHPA 5D6DA 4FTVD 2RFXB 1G1YA 4RGND 4U6VL 1EGJA 5TQ2L 5F8QC 3VGDA 3NPSB 1PBYA 4LPWA 4ZSOA 1NAMB 1KJ2L 1OY3B 3U46B 4R7DA 3LKRB 4BSVB 1JCKA 4AEEA 2FGWH 2XN9B 4O00A 4Q6IA 3LN9A 5HHME 2R4SL 3DBXA 4HKXB 3CGTA 4ERSH 3MRQB 5DD3L 5ICZA 1A22B 3VW3H 4QHMA 5I18H 2O5XH 1OGAE 3C6SB 2B4CL 1D6EA 4N0CD 2X4RA 2DQHL 2LV4A 1FNGA 4P4KB 2VDNL 1KLUB 1FNHA 1WK0A 5H2BA 1I7TB 5C0IB 3FRUB 3IDYB 2AJZB 3QFDA 4UMGA 2A6IB 1CWVA 3F5WB 3PP3H 4WWKA 1HYSD 4OGXL 3IKCB 4LVEA 1CLZH 1S7XB 5GGTA 4RGNC 3QG7L 2WZPD 5C6TL 5FO9A 5DD5L 3C09C 2GITA 3PXJA 2AJ3B 4G6AD 1RK1B 1L9MA 2FHBA 2FD6H 5HYSB 4Q9RL 1CGUA 1MFAH 4F3FA 4JKKA 1S3KH 5E8OB 4U7MA 4TNVK 1VPOH 2JCCB 2YUVA 5C8JB 4ZPTA 1KF9B 3KPQA 4Y88A 1FFOA 1OP9A 3VDAA 1QQDB 5EO0A 2EO1A 4YHIA 4N8VA 4QHUA 4HGKC 1MI5A 4N0CC 4PJHA 4P9HL 1WZ1L 1NFDA 2MPAL 3C2AH 4U0QB 3UTTA 5IESL 3BEWA 1MRFL 4IIQC 4M1CD 5EZIL 5F9JA 4KMLB 1U3HD 5FM4A 4NQEA 3ZMRA 1HOCB 4X5WA 4XVSH 4Z7QF 1HYSC 5FYJU 5LAXA 3O3UN 5KOVC 2HG5A 2BVUA 4OIIL 3BDXA 1B6DA 1J1PL 4PP1D 5HY9B 1JNHB 4G6AC 5DD1L 3QUXD 1T0MB 2OJEA 2VIRB 3EOBA 1YEGL 5E6ZA 1A9BB 4N8VG 2X4SB 4ODWB 2R4RH 4ZUVA 2VKWA 2BHYA 4OQTL 2FJFB 3NCMA 1YEDA 5D7LD 4B7IA 1U92A 3VXRE 5EBLA 5C1MB 5KW9L 1U3JA 4XC1L 5D2NC 1F6FB 4M1CC 5D8JH 1DQLH 5KAQG 1U3HC 2B1HL 3MRPB 1KTLB 4GG6E 1XT5A 4YEEA 3E8UL 5CMAA 5FUCC 3SDCD 2LTQC 2QJDA 4OLYH 1U8HB 3FONB 4H8WH 4JRXE 1D5XA 1JV5B 4K9EH 1DLFH 3BH8B 1MCWM 4PY8I 3BZEA 1WFNA 4L4VD 4CJ0A 3TBWA 4PP1C 5DMIH 3MV9A 5IB3B 3SKOB 3UPAA 4I2XA 2C4XA 5EOCJ 3ULUD 1ZHBB 1ZA3B 3IXTA 3FB6A 3QUXC 4FP8H 4KQ4L 1U8LA 4JPIA 5DR5L 5DQJA 5FB8B 2YBRA 5CUSH 4PB0H 1MHCA 1WBXA 2Y1VA 2NY6B 1T83C 2VE6A 4JZOA 1V3LA 3O4OC 4PS4L 3T4YB 3VH8A 4M61B 1IGTA 1SVZA 1MJJA 4OZIB 4OTXH 5I66A 4DTGL 4MWFA 1WWWX 4F33A 4Q2ZB 3O45B 1FCCA 5IQ7L 2Q3ZA 3WHE1 3B4NA 5J9PB 1TMCB 3WNMA 4NP4H 4X7TA 1J1XH 2HJLA 3ARFA 1NGZB 1V3MA 3LPGA 4QYOA 5GPRA 3M1BB 4PUBL 1HDMA 5T3XD 5HYFA 3SDCC 1KEGH 2ITDA 3QJHB 3IJSB 2P7TA 3S37H 2CDGB 4LVHB 5JR1L 1AXTH 4QXGL 35C8L 3HRZA 4JRYE 4LBEA 2CSPA 2HTKD 3DX8A 4LCYA 1LEIB 2V17H 2YD2A 4IHOA 1ORQA 5MEOB 3ULUC 4NFDA 3KS0H 3FB8A 4PBXA 1A4JB 4RAUB 4F9LA 4G5ZH 2DKMA 3L3DA 5B38G 4Y16D 1HCFX 4EUPG 3FQWB 3F7YA 3SBWA 3WJJC 2NYYD 1YEFL 4L9DA 4OT1L 1P7QB 5FO8A 4Y4KD 1DDHA 4K3DL 3ZYIA 1KN4L 1MF2H 1MQKH 1JK8A 3BAEL 5CBEB 1G0DA 1JPGB 3C5ZB 4PJGA 4UDUB 1C16B 1X5IA 3E6FA 4XNQA 3GMOA 1CFBA 4OJFH 2D31B 1GZPB 2R29L 4LHQB 4LEOB 3I6LD 5SWZD 2O5ZL 5HHNB 1UG9A 4JAMB 4G42A 2LFGA 2HTKC 2HYMA 4BSWA 4DGYH 3OKLA 5EPMB 3ZDZF 1GGYA 5ID1B 4TRPL 2Z31A 3U0PB 3SEPA 3PF2A 4GJTB 5K9OA 3FB7B 5FV2A 4Y16C 3GRWL 1MLBB 4P4KD 3IDUA 5JMOC 4PJEB 3BMVA 2YSSB 1AD0B 2FATL 3ZHKA 4Y4KC 2E7MA 1PZUB 3FTGB 1UWGL 1CD0A 2F53B 4ISVA 1DTUA 3QHFH 1XGRA 5BVPL 3FO9A 5E56A 3L5JA 4KVCH 1J0KA 3T2NH 4HGWB 4HJGB 4MNHB 4PV8B 4JANB 3NPSC 3BPNB 5AAWA 2I9TB 4PY8J 2R1XB 1U93A 3VD3A 1JPST 5CWSB 1CD1A 1INDH 1H8NA 3KR3L 5HYEA 2DQUL 3PGDA 1Q0YH 1T5WB 5GRZA 3HUJB 1KPVA 2ORBL 1KOAA 2LU7A 3ZHDA 3EYSH 2PYFB 1NCCH 1S7SA 2C3HA 2EDKA 4U6YB 5KS9F 3RI5F 4P4KC 2XNAB 3V5KB 1JUFB 1I8IB 5EN2B 4J1UA 3WN5B 1NUDA 3ARWA 4LRIA 4POZD 3W5NA 2CIKA 4QXUH 3L6FA 1OLLA 1OPGL 5E2UL 5IK3B 3SGKA 3KYNA 4HULB 5GGQL 3MUY1 1RJYA 4K23L 3O6MH 1HINL 5EU4A 2Z91B 3KPSA 1PY4A 3O4LA 4RGMB 5H94A 5IW3A 1VGEL 4XH2A 3UBXG 1Z9LA 3LV3A 1KFAH 4LGSB 2QSTA 1F8TH 3G6JB 3D85A 2ZG2A 2FDBP 2I60L 2Y6SD 3BSZL 1JHKH 2EIEA 4YR6A 3CFCH 4MAUL 4PRIA 5KN5B 1KULA 1XGPA 4Z76B 2IMNA 4Y7MA 1G7PA 4LHJB 2UZXB 5HGAA 5ANMA 5FKAB 1EUUA 1U8NB 3TT3L 3CFJB 4POZC 4NGHL 4HBCL 3O6FB 5MENA 4K55A 1P9MA 4KV5E 1ZLSH 2VDOH 1JRHI 4HAGA 5L7XL 1NCAL 3LCYA 5IFHH 1MAJA 1ZA6A 4P46B 3BDBA 3SDAD 4TOYH 1QD0A 1OD9A 4U1IB 4CVXA 5JW4Q 5ADOH 1RHFA 1S7RB 3L7EA 3QCVH 5J6HB 4IS6A 2FL5B 1NC4B 4LNVA 5C71A 1RZKC 2BC4B 2NY6D 2WINA 3O9WA 4I3SH 2YRLA 3QUYA 2BSSA 3INUL 1DBJL 4NOFA 4HWBH 2Y6SC 4A2LA 2H32H 1FIGH 4DN4L 4I9WD 1EXUA 4GO6B 1FVEB 2V2TB 5D2LF 4LSSH 1VENA 1M4KA 4LHUA 2G60L 3HNVH 2A0LD 3RPIB 3AREA 2GCYA 1YY9D 5JQ6H 4PTUA 3IAGC 1UCBL 4O2EB 3K8LA 5BO1H 3EW3B 4Z7VB 3MRGA 2ZSVA 5DJ8B 3QIBA 5JO5B 5JHDE 1FCGA 4WW1A 1CVSC 4JHAL 5KG9B 2ED8A 5IEKA 1CZ8L 2XZAL 3NIDE 4LCUB 1KCRH 2X4NB 3QEUA 4JVWA 2Y5TB 4NO0A 4L8SB 4XNUL 2NY6C 1J87A 1Q72L 4PRAB 3X12B 3RWJB 4R90L 1P7QD 1F3JA 2Z4QA 2G9HA 4XPHH 2FO1A 5IV2A 1AH1A 1MRDH 5IVZB 4FFYH 3Q0HA 4X4ZA 2A0LC 5EDXA 4Y5YC 2KQMA 3CMGA 1YY9C 3EDDA 3WD5L 1M7IA 1T20B 3CXHJ 1MCCA 3DTXA 4B50A 2HJKB 5KANI 2XWBA 1EEYA 1ES0A 4LVHC 1FNSL 1Z5LA 5FO7B 4C83B 3MRNB 1VCAA 3RBSA 1KJVB 4M8QB 3MODL 3LPWA 4FQJL 1JPTL 1RUMH 3GSRB 3W0WE 1RJLA 4BUGA 1NJ9B 1SMOA 3CCHB 4WFED 1OGAA 1CLYH 2HFTA 4L3EE 3WCYA 4XAWL 2JJVA 2YRPA 4XNMB 2XI9A 5EG6C 3E6HB 4WI6A 1FL5B 5A1AA 3HE7D 2ICES 3MLUH 4JB9L 3LS4H 1R3LB 4HKBB 2FBOJ 4H20L 3QO1B 2F53D 1K9TA 4KUZH 5FF6B 5DA4A 1WBZB 3BT2L 4KI5D 2VDLH 3CLFL 1C5BL 5IFAL 5SX4H 4BZYA 4PJ8D 5I1GH 4M5YL 3WFCH 4ZOCA 2OJZL 4JDTH 1FE8L 1LEKB 4OCWH 1YMMB 3NCBB 3GI9L 1G9NL 1GC1H 4YDJA 3DRQB 1FPTL 4IRZH 4JKLA 5EC2A 4K2UH 3UC0L 5F89B 3NACH 2FZ3A 4ZUTB 1P2CA 4L8CB 1CTNA 3VFTA 3MBXH 2WQRA 1TLKA 2VDRL 2EDOA 4XCYA 5IW1B 2IH3A 5J0BA 3HE7C 3O3BB 2Y07H 3CAFA 4QHKI 4OFDA 1H3GA 2FGZA 3N1MC 5L9DH 3HMXH 4F7EA 3GSVA 4NQDA 2IQAA 3HR5B 4KI5C 2YN5A 3BPNC 4I48A 3FQXB 3SOBL 1RUKH 1MHPH 4PJIE 4PJ8C 4Z6AT 4KHTH 4WI8A 1RK0A 4JO1H 2R56L 4LSUL 1Q9WA 1PKQB 3H42H 3TIEB 2BNUA 4EDXA 2NY5L 3BMWA 1KJ2A 2XKNB 5ISZB 3VFVB 4O02H 1YUHB 1X5FA 4PRHA 1OM3H 3PIQB 1J05A 1EAJA 5L88L 3L3GA 3WUWB 1G7MB 5CIPB 1RIUH 3WFDL 3OAUL 1WIOA 4AEIH 4L5FH 1I1CA 2X4PB 1FFPA 1KIUA 1OARH 2F74B 2J12B 3WN5C 1LO3H 2DLGA 4IEFB 1EZVX 3O6FD 3RUGF 4LVNB 1BBJA 5F7FA 2QTEA 1D5BB 2VXTH 1U8IA 3TVMA 5E9DA 4G6ML 1OAUL 5HTSA 4HMCA 1NDGB 2JJWA 4LLMA 4P46D 2F5AL 3V4UL 3VRIA 1IAIH 5JIKA 4PGCA 3BPLB 1UXSA 4RGMC 4QCIA 1OT2A 1P4IH 3QRGH 3MTRA 1VFUA 2WBJA 3QUML 1NC4D 1NLDL 3KWWA 1MFDH 4WEBL 1FAKT 1RULH 2XZZA 1IARB 3PQYB 1KCLA 2ZPKL 1CFNA 1LVEA 1UWXH 4ODVL 4NKDA 2CRYA 4LSVL 1I8LC 3BUYA 1TJGH 3VRLF 3HAEG 1KLFA 5LVEA 5F96L 3BO8A 1PJ9A 2ITCA 1UEYA 3G5ZB 2P8LA 4PJ5B 4QHNB 4YHLL 3LEYH 4FQ2H 3O6FC 3RY6A 3UO1H 4KHXH 4K3GA 3GBNL 4P46C 4GAFB 4YXLH 4Z5RB 2OTWA 4JRYA 3MXVL 4ZSOB 5D72H 5F6IB 3VFWA 3CK0L 2VQ1A 4R7DB 4UINH 4X5LA 5KJRH 3HG1E 1T89A 2CKBA 4XP9H 32C2B 3RHWF 4RDQG 2AW2A 1ADQH 3VGBA 4K7PX 3DBXB 2YS4A 5J4MA 1EO8L 4P2CG 5ICZB 3DO3A 3OAZK 1D6EB 2IC2A 3TH4T 4YZFF 5IB4A 4QHKJ 5DUPL 5IUSA 1ZT1A 1MHHA 4CMHB 2VQTA 1UM6H 1AQKH 1VA9A 5BOZG 2VWEE 3QFDB 4YHOL 2YA1A 1D5ZB 4FQ1L 3CX2A 3ZYZA 5DLML 1RZFH 3AC0A 4JLRA 5TH2A 3MRKA 5FO9B 3V52H 1UH2A 2GITB 1T3FA 4M8VA 3BKMH 4F3FB 2DQEL 4UTBL 3ROOB 1ZGLM 4KDTC 2W0KA 5F70A 4ZPTB 1E4XH 4JHBA 3KPQB 3VXMB 5FM5O 4L8SC 1FFOB 5CEYA 4DWHA 1DBML 4Y4FA 1F02I 4YHIB 4QHUB 1UACH 3ZL4H 1MI5B 4PJHB 4P59L 3ZHLA 4V1DE 1OLZA 3PGFL 1OOAA 1CIDA 3QCUL 5F9JB 3MFGB 2ZNXA 5F9WB 4EQ3A 4OM1H 3BKCL 4YDLB 1SJHB 4NQEB 2E7BA 4X5WB 3UJJH 2MKWA 3CNKA 3TBSA 1W72B 5LAXB 2HG5B 1YMMD 3TGXA 1TPXB 2H3NA 3DOSA 3HC4L 4KXZI 1EHLL 4XPAH 1EV2E 1MCRA 4K3EL 5IVXF 5HYQA 2ICWI 3KPNA 4BM7A 4BFGA 1UA6L 1FORL 2OJEB 2H8PA 1SM3L 2R0WL 3OKOA 4FMKA 4H25A 4AQOA 3NA4A 3S88L 4IRSA 4ZUVB 2E9WA 1X5GA 1YEDB 4OLXL 5IM7A 4OCRL 5CILH 4XHJD 5EBLB 4Y2DA 3MA7A 5BS0B 1XFPA 3VG0L 5BV7C 2P8MA 5KSBA 1CFQB 2BDNH 2NY0B 2APBA 4HUVB 3FL7A 4WFHE 4K94C 3E0GA 3VI4E 3TBWB 4PJFE 1BQHA 5CEZD 3MV9B 5GS0L 3P30L 4XPFH 5LGJA 1V7MH 2PO6A 5M95B 3IXTB 4PYHA 3FB6B 3OKDA 4DVRL 4JPIB 2DJSA 2YBRB 5IJKA 3U0WL 1MHCB 4GOSA 4KJPD 3KAAA 3ZDZE 5L8KB 3C87A 1S5IL 1WZKA 1O7VA 3RVWD 3VH8B 3NBNA 2W92A 3VFRB 2FX7H 1IGTB 3GRWA 1MJJB 3VFNA 5I66B 4EIZC 4XHJC 4TUJA 4MWFB 4F33B 1N8ZA 4X8XA 1BFOA 5BZWA 4KROB 1UADC 1CXLA 2UWEF 2HJLB 2ICCA 1UKSA 4QYOB 2GTZB 4Y5VA 2ITDB 2J8HA 2MOVA 1BQHG 2P7TB 4DQOH 4XP4H 1RUPL 2EEDA 4J3TA 5CD3A 4DKEL 4QRRD 4LBEB 4LIQL 4W81A 4JPWH 5AD0B 1NGQL 3EO9H 1E4WL 2VAJA 4WU5A 4EVNA 4XP5H 4HZAA 4IHOB 1ORQB 3LQZA 3FB8B 3IKKA 1S9XA 3L3DB 1KIPA 1UM5H 3CSGA 3TF7C 4P23A 1RJCA 4KJPC 1HH6B 2CJUH 1IBGH 1AY1L 4UOJA 5MEPA 5FKPA 5FO8B 1DDHB 3RVWC 5C0FA 1SYSA 4NC1E 3TYFA 4LVNC 2WIIA 2Y36L 3TT1L 1IGYA 2HFGL 4F7CA 4ZUUA 4PYGA 1AJ7L 2VDPL 4PJGB 1HH9A 3WNOA 3QAZB 2JKXA 5JHDA 3E6FB 4JKPL 4XNQB 5E2JA 3GMOB 3L3HA 3EIFA 1KSRA 2ICWJ 1ZEAH 1FLRL 2IF7A 3RHWK 3VFUA 1IGMH 2DMCA 4RQQA 1VFOA 4ELME 3OKLB 3QUZA 1TTUA 2Z31B 1OAXL 3HPLA 1ORSA 2WLYA 3V0AC 2EEBA 5K9OB 3MNVB 1CCZA 5D1ZA 4QRPA 1DBBL 5AWNH 1H8OA 5FUZH 2J2ZA 2I9LA 4WW2C 4FZ8L 5ALCH 5FOJA 3C5SA 4NUJB 4OF3A 4WWKD 4IJ3B 5D6DC 1HEZA 4UB0L 5BQ7A 1XGRB 1IM9A 3AB0B 3FO9B 4MD5A 1K4DA 3VE0A 3DWTA 1JGLL 5ICYB 5F6IC 1U93B 2DYPA 3O3AA 1UXWA 3EGSB 4AEFA 4JHWH 2C7UA 2H26A 5JOPE 2AQ3A 4AG4H 2YKLL 4F58H 2QQLL 3JWNC 3HCVA 1QSVA 4L3EA 4OF8A 1KPVB 4KMQA 5ID0B 2E7HA 2W0PA 1MI5D 5DEGB 1S7SB 4N0UE 2HLAA 3UTTD 4XXCA 1PQZA 4CMHC 5DI8A 3NZHH 2DWEA 1YQVH 3Q5OA 4KRMB 3M8OL 4NQED 2GAZB 5D2LE 2QQNH 4LCWB 3WNNA 4WWKC 5I1CL 1QSZA 2YPVH 4MDJA 2CKNA 4LP5A 2WK2A 1T2QL 3CFDA 5H94B 4FABL 1EBPA 4XH2B 3LV3B 1PYWA 1BEYH 4Q0XL 3D85B 4MYWB 3H7LA 4BQ8A 5JIHA 4CU8A 3EYFA 1YY8A 4D9QD 4PRIB 4WRLA 4XMKL 1M6OA 2AK1H 4J23A 2DLHA 3ARBA 5FA4B 1QFWH 4A6YA 1G7PB 5HGAB 1L7TL 5ANMB 4Q9QL 4WHYH 3VI3F 4JY5H 2AEPL 5MENB 5DJCA 5HGGS 4HBQA 4JFYA 4PJIA 3H9HA 1ZA6B 1H0DA 5E8EA 2V7NA 1AO7E 2P4AB 4DEPB 1DQMH 3MV9D 5F7EH 4CVXB 1P84J 3L7EB 4HLZG 1GJIA 1CL7H 1FZJA 4J6RL 1OWRM 5DUBB 3I2CL 2WINB 3O9WB 3QUYB 1JGEA 1G7JA 3OSKA 4HFUL 4EBQH 2W07A 4M62H 4YC2B 3VGAB 3ZKQD 1EXUB 4BH7A 5KTEL 1IEAA 5B39B 4LHUB 1FC1A 2IQ9L 4PJXF 1LD9A 3AREB 2GCYB 3ARFD 5EBWA 4PTUB 1D5IL 4DGVH 4JR9H 2ZSWA 3MRGB 2ZSVB 5JW5B 3VFGL 5GGVL 2XWJB 2J88L 3QIBB 2K7PA 4WW1B 2VN4A 4HJ0D 1D6VL 4FQLL 3CH1A 3EZJB 4NO0B 4F8QA 2RQ8A 5D7KE 2XTJE 5M7QA 1TITA 4M7LH 5DZOA 3R8QA 2Z4QB 2G9HB 2WBKA 1KN2H 2CR6A 4M6MH 5F1NB 2M1KA 5FXCH 1UZ8B 1XR8A 4RGOL 1MWAB 3DUSB 2C5DC 3O2DH 4YBQD 1BAFH 3ARFC 1TTGA 4WNQA 1M7IB 4PGZA 2OL3H 5JUEL 5GISL 3ULUF 1WAAE 4N8CH 2XWBB 5TF1H 1ES0B 3J7HA 2EH7L 1Z5LB 4BFIA 3ZTNH 1F90L 1ZLUK 5EO9A 3K0WA 3HG1A 1AD9A 1UVQA 3TBVA 2APTA 4MJ6A 3WDJA 4PR5A 3SY0A 1RJLB 1J1OL 2QQQA 1NMAH 5HHMB 2Z31D 1MCQA 4F9LC 2EDWA 5FHBL 1OGAB 2DM7A 1BM3L 3FN0L 1WFOA 4NN7B 1HILA 4PJAA 3SBWC 3QO0A 3DHJA 4P2QE 4ESKA 2A74B 2FX8H 2NY7L 5GRJL 4HK0B 1DEDA 5J7CC 2IWGA 5JNYB 1MCBA 4N9GB 4WI2A 1A7RH 2W9EL 4HKZB 1TJIL 2SEBB 4WJ5A 3RZCA 3B5HA 4IOIA 2WANA 4RFEA 1DFBH 4K8RH 4YBQC 5IQ9A 2DM3A 3OWEA 5GSRA 4MJIB 2A9NH 4MB3A 1K85A 1KELH 2OZ4A 5EUOF 4UBDD 3F7PC 2EYTA 2VXQL 3QQ3B 4Y5XB 4Z7UF 2Q8AH 4LSTH 3WSQH 4OLZL 3VXPA 5J12B 3MCKA 1CFSA 4YDJB 4NO3A 5EC1A 4FXKA 3DVGA 3MOQA 2Z31C 5EC2B 4EI5B 3QUMA 4EXPX 4MS8D 1CG9A 1P2CB 1BIIB 3VFTB 3WDHA 1KGCD 1RU9L 4X9FA 4V1DA 4XCYB 2IH3B 3P3YA 3I6GA 4ZTPL 1NMCB 1KEMH 1RVFL 3VD7A 4U1GB 3IFNH 4IJ3C 4YO0B 2GFBA 1YN7A 3AAZA 4F7EB 3GSVB 1WWAX 3JWOL 4KY1L 2IQAB 2V7HB 5I6XB 2ZCLL 5J11B 3MREB 3LQAL 3NN8A 4I48B 3V7AE 1MRCH 3GKWH 4JPVL 3KPSD 3O4LD 3CJJA 1RK0B 1Q9WB 4UBDC 4DN3H 1JWSB 1HHGA 2BNUB 3UZVB 2FLBT 4EDXB 5I30H 5FECB 1KJ2B 3D85D 1J86A 1DSFL 2ZUSA 5GJTL 1DL7H 5IBUB 4RFOH 3L3GB 4R6UA 5C6WH 4NHCL 4MS8C 5LQBH 4PRID 4P5MA 2IBGA 3OBAA 1ND0A 1RZJH 1FFPB 3VXRB 1FP5A 4HAFA 4EUPH 2BVQB 5GRYA 3SDDA 5ALBL 4C57C 3DX7A 4LRIC 4X7SH 5MEND 4N8PA 1BBJB 4GG6B 1IC7H 3ISWA 4ZDHA 1U8IB 3SGKC 5E4IA 4KK9D 3MLXH 4JRXB 4LLMB 3VJ6A 5DS8A 2JCCF 2FGWL 5A2FA 4X6DE 3VRIB 2YR3A 1L6XA 1QNZH 4X4MA 3GSXA 2IFFH 3F6LA 4PGCB 1MVFA 1UXSB 4PJFA 1YYLH 1DBKH 1ZS8A 5I18L 2WBJB 1G6VK 3KWWB 5T1LA 3HC0B 3O9WD 4U4BA 3QUYD 2D7TH 4CL7A 2ZOKB 1CFNB 3P0GB 4FNLL 1S7UA 3GBLA 4NKDB 3F58L 2P49B 4NRXA 3BN9D 3BUYB 1SEBB 4XXDA 3FFCE 2Q1EA 4LHUD 1GAFH 1U8JA 2VB5A 3B3IA 3BO8B 1F11A 3ARED 2P8LB 4KZDH 4XVTH 1NCNA 1P9MC 5HDBF 1MFAL 4U1KA 4G6FB 1WCBA 4KK9C 3RWGB 3QIBD 4JRYB 2GY7B 4YNYA 3GJFH 2FLRT 4DEPC 1A7PH 3HC3L 1Y6NR 1VACA 1UEMA 4MCZB 3EYUH 5GRUL 3IB4A 4EZMA 1X5AA 3M07A 2J5LB 3RNKA 2CKBB 1BJMA 3AUVA 4NO0D 5DSCA 2A77L 4DFIA 1IGFL 2VXVL 5AYQA 1LDSA 3O9WC 3QUYC 2VDQH 4UOW1 3SGDI 4NSKA 4XHQA 3RKPA 3CSBA 4YC2C 3VGAC 1A0QH 4WO4A 4M7ZB 1TXKA 3BN9C 4MHHI 4JDZA 3MLRH 1MHHB 4WFGE 2UUDK 1CQKA 1G9MC 3S5LA 3AREC 2W9LA 1ZT7A 4I0CC 3CDFA 1HSBA 3QCTL 3EOAA 5T5NF 1MCSA 4JLRB 2VH5H 4L3AA 1TZHA 5ENWA 2HVJA 5I8EB 3QIBC 2QL1A 2R4RL 4HPYL 1T3FB 4JG0L 4ELMA 1YEKL 3H9ZA 5D71L 3LIZH 5IVOA 5HHMD 2WNGA 2YWZA 1JI2A 1T1YB 2EH8L 1FZMA 4OZIF 5T3ZL 1OGAD 2V2WA 3UTZA 3UTPE 2C4FU 4LARL 5CEYB 1OL0A 1A7BA 1ZOXA 4Y4FB 4NNPL 3JTSA 3ULVH 5LBSL 1R24B 4G80B 1Y18A 2D4FA 4H8WL 1IC4L 4KTDL 5E5MA 4HKJB 5KOMC 2APVA 5F3BA 1AR2A 1FDLH 1QKZH 3LSOA 3THML 2AS5M 5DMIL 2X5PA 4TSAH 3TBSB 3GGWA 3WIFB 2DF3A 4KKLD 4X6EA 2LABA 5HDQH 5HYQB 4P3CH 3KPNB 3GSNH 4XNXL 3GSOA 4N0FB 1TDQA 3CMOH 3OKOB 2EDTA 4PY7B 3GFUA 4H25B 3VXNA 5L6YH 1N6VA 2DD8H 4N0UA 1V05A 3D39E 4PLJD 5CGTA 1N6UA 3MOBH 3UYOD 1QP1A 2KQNA 5IM7B 1GGTA 3QHZH 2AJVH 3ILPB 2XPGA 3TC9A 4Y2DB 5D2LA 5IHUL 1EERB 3MA7B 3F12B 1VEPA 4NQDD 3O81A 2Q8BL 2AXGA 3U4BL 4NBXB 3RIAF 1HN1A 3P4NA 4MXWL 4JFOA 3WS3A 4MNGE 3V0WL 1YYMH 4O2CA 6FABL 4G5ZL 4LPTA 4KKLC 1DQDH 3U83A 5J12C 5EUKA 4PRHD 3MRLB 5LGJB 2PO6B 3P11H 3Q6FB 3BRGC 2W60A 3OKDB 3I02B 1BREA 1B88A 4WI9A 1MF2L 2BSED 2UUDH 1IKFH 3IT8D 1TVHA 4LVOB 4ORZC 5HVHB 3O11A 4PLJC 4KI5F 3C08L 2BZDA 3D6GA 3MLZL 3BE1H 2JTDA 3VFNB 3TVMD 4JKMA 3MRRA 3QHTC 5E9DD 4U1GC 5IBTH 1FGVL 2WUCH 1N8ZB 1BFOB 5BZWB 2EC9U 2CMRH 5I6XC 4XVJL 5T1KD 1A5FL 5J11C 1YNTA 1AO7A 3EDEA 4TVSa 4H1LH 3ARZA 2Y7QA 4GAJH 3MBEA 4UIKL 5CD3B 2WBJD 4CADA 4RAVA 1A1OA 5F88A 1J12A 4X8JA 3KLSA 2MJWA 4EVNB 1TVBA 2VLLA 3K2UH 3LQZB 4HUKB 1CXHA 3OL2A 1KIPB 3V2AR 3CSPA 3OAYH 4P23B 4KZEH 4X83A 1NL0H 3PHQA 4RA0C 5FKPB 3T2NL 1K4CA 4PGEA 2B4CC 4Z8FL 5C0FB 4OGYL 3QDAA 3TYFB 5C0BE 3ARGA 3TVMC 4RGNE 2E9IA 1XF3B 3IRZA 4G6FD 4CDHA 1GIGL 3OXRB 4F7CB 4ZFGH 4H5SB 5DZLA 4JRYD 3G6JF 1HH9B 1A4KA 3HI1A 3VD5A 5JHDB 1AGCA 1I3VA 2ZG3A 4IRJA 3D5OF 2WBJC 3K8MA 1G1CA 3VFUB 4GKNA 3LEXA 4MX7A 2ZUQC 2ICWB 3QUZB 5CLTA 2BSRA 3W82A 1ORSB 4JCLA 4F57L 5EZJA 5C6PB 5TPWH 3LKOA 5D1ZB 3VFOB 3BRFA 1AI1H 4M43H 1OSPL 1RIVL 1SQ2N 1PLGH 3JWDC 2VERN 4JKWA 2EE3A 4JY6A 3MUGA 4P9HC 2X4OA 3REVA 1NCBH 4K3HA 3RY6C 3NFNA 2J8UF 3GMRA 3NIGF 5BQ7B 4GW4B 1F2QA 4X6FA 2X2YA 1WAAA 1IL1A 1IM9B 3BZFA 4KPHH 1V5JA 3GK8L 4HC1A 3O2VL 3ULUL 1K4DB 3VI3E 1T03H 3EZ8A 3VE0B 5CJXA 2Z35A 4L8DA 4QRUA 3MV11 2BSTB 2DYPB 1MFEH 3DV4B 3O3AB 3HNSH 5HHXH 1AQDA 1HHHA 2C7UB 2BRQA 3RZWA 4HF5H 3W0WB 3A67L 1B4JL 2H26B 4PD4J 1JMXA 5C0GA 4MQSB 2IBZX 4RRPA 2FYYA 4FMFA 2J5LC 3CH8A 1T89C 1Y6MR 4WY7L 3LS5H 4L3EB 2AJYH 3GIVA 4XNYH 4Y4FD 1J0HA 1J8HE 3C60A 4KAQH 4LU5L 2V5YA 4OZFA 2BOBA 5D2NE 2HLAB 1H15A 4M7ZC 4Z7VF 1JFQL 5T3XL 1PQZB 5JPMA 4HIJB 5CZXD 1U2HA 2DWEB 4OB5H 4P2YA 3ME0A 1QSFE 1CDCA 3S35L 5I76A 5IROA 4MDJB 1DUZA 2J1KA 4RRPG 3I3BA 4I3SL 3OF6A 2GW5A 3I9GH 1DR9A 4C55A 4OD1L 2E6JA 1DJSA 4HWBL 3SGJA 3JVGA 1JGUL 2IH1A 3LMJL 1PYWB 4WDIA 1AGEB 2JB6A 5AEAA 4MJ2A 5JXEA 4QWWD 3T04D 4IRSD 3QIWA 2WP3O 5JHLL 4GRWH 4ODTL 3EYFB 1LDPH 5ILTH 3WO4B 1CTOA 4Y4FC 1YY8B 4AEHL 1HKLL 3VFPA 5I8OL 3S96A 4Y2DD 1M6OB 3HAEH 3ARBB 1N5YL 2CLRB 4A6YB 5IR1A 3NTCL 3RIAK 5CZXC 4DFHA 1FQ9C 4KUCD 3U0TA 1OAYL 3N9GL 4XP1H 1U3YA 3TO2B 5DJCB 3MQIA 3BN3B 2R0KH 1EPFA 3H9HB 1LO2H 8FABA 1H0DB 5E8EB 3OR6A 2V7NB 3CZFA 4OF0A 1VGKA 4DK6A 2ADFL 3LEVL 1JGVH 2R69L 4Y4HB 3UPRA 1JZ5A 1J0ZA 2PO6D 2XRAL 4XGZA 2B1AH 4EOWH 1FZOA 1FZJB 3TESA 5LGHL 5C7XL 4M6NL 4XPTL 2Q3AA 1QEWA 4QWWC 1MVUB 4FFYL 4IRSC 4P99A 1U8KA 5DUML 1JGEB 1G7JB 4QY8B 1MNUL 3AY4A 2JJTA 2O61A 2GSGA 4NJAH 5I0DA 1MJ8L 1NEZA 2V9RA 3MCLL 4U49A 4BH7B 2D3VA 4Y2DC 5TE4H 4GMTH 1NANH 2X05A 3D9AL 1LD9B 2VLKE 5T3XE 4X6DA 1EVUA 2DQIL 3STBA 4NBZB 2ZSWB 1JNLH 4U3HA 5IJVA 2ERJB 2FNBA 1RUQL 2B5IB 3SQOL 5EWIH 4G7VH 1GOGA 1IAOA 1JNNH 4MB5A 3D87B 3IS1X 4OLUH 2PO6C 2AAVA 5I8KL 4MD0A 2PUQT 4S10A 4FQHA 3AU1A 1B6UA 5IJKC 4P23D 1A1NA 4JG1H 4LVOC 5HVHC 4FQXA 5EU3A 3FFCA 4P2RE 1FLTX 3QDGA 2DIJA 1KXVC 2CLVB 3SDYL 1EIBA 4HIIA 5I1GL 1JVKA 1NKRA 2PF6A 2Q76A 4JDTL 3CVHL 4PJDA 1C1EL 4JEGB 4OCWL 4Z7NF 5F7LB 1XR8B 5DFWH 4WNQB 5LWYL 2EEAA 1O5DT 1RZKL 5JHDD 3Q6GL 1KLGA 1N5AA 4Y5VC 4KTEH 4IRZL 3LKPB 1YC8A 2EIZA 3I6LE 4XPGL 4BFIB 4F15B 3DSFH 3MJGX 1RFDL 2AJXL 5EO9B 3MBXL 5I1JL 1JZ3A 3HG1B 3QYCA 3QUZD 5KANG 4ZYKB 3SY0B 1U42A 2DRUA 1FFQA 1N0LA 3BD3A 1I3GL 4YUEL 3IFPA 1IQWH 1CGVA 4P23C 4QRPD 5AYUH 1RZ8A 3U4EA 1HILB 1F4XL 3QO0B 1AFVH 4WENB 5K9QI 4PJ9A 1WWBX 3OXSA 3OZ9H 1P4BH 2ED7A 4KHTL 1IM9D 3RZCB 2AK4A 1A3LH 3TV3L 3FQTB 4IOIB 3QPQD 4RFEB 4C59B 2HKHH 3PHOA 4D9LH 5HHVH 1N64L 2PYEE 2YOCA 5GSRB 4PJ7F 2DYPD 4UV7L 1SEQH 3V8OA 4YFEA 5M94B 3I3DA 4KK6D 1XCTA 4S1RH 3MLWH 3MCKB 1CFSB 1NEUA 4NO3B 1KJ3L 5F7HA 2ZCHH 4P4RB 5EC1B 1QG3A 4WW2F 1MREL 3EOTL 3QUZC 4FXKB 3DVGB 1BPVA 3K1DA 3ZDYF 4X80L 2I07A 3QUMB 4ZTOL 2RAMA 1H3PH 2X41A 3O3DA 4BK5A 1JL8A 3KPPB 2QLVB 1CG9B 5D1ZC 4AY0A 4GKSA 1T21B 5JW3H 4V1DB 5DD0L 4TNWF 3AMLA 2FB4L 1X6LA 3GZKA 3I6GB 1KCSH 4U33A 1GHFH 5IOPA 4X4YB 2YA0A 3SE9L 1JP5A 1YN7B 3QH3B 1ZLWK 3AAZB 2EXWD 1KENH 4I3RL 2GY5A 3QPQC 1TZGL 2AP2A 3NN8B 1RZGB 3P73A 4BFBD 1U9KA 4P2OA 5L2KA 4MNQD 1HHGB 4KK6C 1C08A 4KQ3L 2LAGB 1FBIL 4NFCA 5K59F 3D39A 2R0LH 4I5BB 2DQCL 4X4XB 3NFPA 4HQQL 3LN5A 4U1SA 1CBVH 2YK1H 5ITFA 4FN0A 3CX5K 1ND0B 2P24A 4XXCC 4S1DD 3ARBD 1A9EA 1RZ7H 1KCVL 1N0XH 2F58L 5CGYD 1QBLL 5IMOA 3DX7B 4B41A 5IHZA 1XZ0B 3LAFA 2DMKA 2C1OA 4ZDHB 4NO2A 4KRLB 1MAMH 2ATPA 3KJ6H 2ADGB 3QEHA 4OGZA 2EXWC 4MNGA 3VJ6B 5E8NA 4XP9L 1EK3A 2DQGL 1YNLL 3GSXB 4J3WA 5FV1L 3D0LA 1KC5H 4KKAD 4PJFB 1FGNH 1SHMA 4LSDA 1REIA 4PJHF 3CXDL 4M03A 2R2HB 1NFDF 5MI0B 1X5HA 5A2KH 4TULH 4PJCA 4DZ8A 5KVFL 5TFSL 2HRPH 1LHZA 3WO4C 3F65A 4TQEH 1MCKA 1RI8A 2M2DA 4NRXB 1Q94A 4UNUA 3VXTA 4UUJB 3P4LA 3FFDA 4NKMB 4XXDB 1HIML 4S1DC 3ARBC 1U8JB 3G6AB 4U1MA 2E6PA 2CXKA 1F11B 5CGYC 1MCOH 2DQJL 2UYLB 2QHRH 1CLOH 5AUMB 3A0OA 3P4OA 4MD4B 1WCBB 2B7DT 1E4XL 3RWFA 5GJSL 3GHBL 4YNYB 1W0WA 3C8HA 4TVPH 1VACB 4KKAC 4CMMA 4UZGA 3IDGA 1MLCA 1UACL 4JRWA 3RNKB 1EFXA 3MYJA 2OMBA 5DSCB 4B7LA 5IT2L 3FB5B 4NO5B 1FL3A 5FFLA 1QBBA 2F5BH 2X6MA 4NSKB 3D69B 4BQBA 2G2RA 1LO0H 2J6EH 4M02A 4WO4B 3S4SG 3UJJL 4UILL 5C0BA 4JDZB 3S5LB 1ZT7B 5HGHA 3S36X 1NQBA 2CIIB 15C8H 5GGRB 5DRWA 2ERJC 1MFCH 3EOAB 3HS0A 2NY4D 1YN6B 2B5IC 4HGMA 5ENWB 2HVJB 3SO5A 3QJFA 3HG1D 5I1IH 1BX2A 5C07B 3EDKA 2YD5A 5I16B 1CDGA 5GIRA 4YXKL 1WTGT 1FZMB 4WFEE 3MXWH 2FHCA 1G9NC 1CE1H 4D3CL 4KK8D 4YWGL 2V2WB 1RIHL 3TJEH 3UTZB 4D2NA 4JO3L 3PWPA 5IMMA 5F9OH 4MXVF 3JTSB 4ZUWA 1CFVH 1RQ5A 1Y18B 4TSCL 2OTUA 4JN1H 4KI5E 1MCDA 5E5MB 3DGCR 4N0YH 3RZCD 5F3BB 3LSOB 4WV1A 4GUPA 1BOGB 4HD9A 1FH5L 3GGWB 1I9IL 2MQ3A 4F15C 5EOQL 1JN6B 2NY4C 4X6EB 1A6ZA 1T5XA 2DTMH 3GSOB 2F15A 4GAYA 5I1LA 4RWHA 4LASL 3B83A 1YECL 4OZ4B 1J8HA 1GRWA 3IDNB 5GGUA 3VXNB 1GGBL 3KLAA 3KYKL 4KK8C 4RISL 5DJYB 4YHZL 3QIUA 4N0UB 3UJIH 4UIMA 4V1DD 3B9EA 1ZT4A 5CHNB 4PJGF 1RZIA 2VWEC 1JGDA 1XGTA 3T0XA 2XPGB 2XQBL 1QSFA 5D2LB 1CR9L 2QEJA 1CK0H 3RAJL 5C86A 2AXGB 2BERA 3RZCC 1RMFH 3PV6A 3U7YL 2GT9A 2MQ0A 3P4NB 2C26A 4JFOB 4CRPA 1N4XH 3CUPA 3WS3B 3IDMA 3PDOA 4OI8A 1M05A 1A2YA 3BP7A 5DJXB 5EUKB 1E6OH 4V2CB 3UMTA 1WLHA 1U6AL 1UKQA 3U48A 1SJXA 4OZHE 3MNWA 3OJVC 1TVHB 3VMPA 2DQTL 3RIFF 3O11B 3A6CL 4ZXBA 1FZKA 3NH7H 3SDDD 5CIPH 5KSUA 3MLYH 4JFDE 5C0AE 1LK2A 3WIHL 1BOYA 1K5NA 3NA9H 1HSAB 2MTPA 3MRRB 4HWUA 4L29B 1ZEAL 3DJ9A 2DLEA 1IAKA 4RBPH 1IGML 1BFVH 4WFHD 1YNTB 1AO7B 1HXMA 2AEQL 3DECA 1AGDA 3IFOA 2J8UE 5FAAA 5IB5A 3HZVB 2Y7QB 3ZE2E 1I9JH 1PSKL 2UY7A 4CADB 1A1OB 3MZGB 5F88B 5T1LD 4X8JB 4HXAL 1EHNA 1LP9E 1X5ZA 3GHEL 4YGVA 5DHVA 2VLLB 3ZT5A 4HT1H 1G9EA 2RJMA 2VRAA 5BV7L 4UAOB 4JO2H 3ILQD 4UV4L 3GSWA 3PHQB 3SDDC 1K4CB 1P4LA 4PGEB 4FQCH 4Z18A 5IEHA 4K94L 3WBDA 3H9SE 4WI3A 5D7SH 4RMWA 4RMUA 2N7BA 2VLKA 4NDMB 5D7IE 1NPUA 3ARGB 1Q9OB 2GJ6E 2GK0A 1CF8H 4F58L 1XF2A 1XCQA 1D5MA 2I5YH 5DTFA 3EO1B 3CVIH 2Z93A 1A4KB 3HI1B 1P6AB 1AGCB 5JDSB 4HS3A 1PZ5A 2B20A 4IRJB 4U3CA 1YEJL 5DT1H 2EDBA 3PDGA 3LEXB 2HN7B 1HQ4A 3T77A 5MI0C 5FYJL 3DX9A 4MX7B 3OG6B 4HWBA 2PW1B 1WGOA 4OLVH 2BSRB 4Y89A 2XTJB 3CSYA 4P2RA 4CN4A 4BKLA 1YQVL 3WFZA 5EZJB 4BELD 5KSVB 1WC7A 4X98A 4WO4D 3LKOB 5F3HA 3ILQC 4WCYL 4AJ0A 4D9RE 4UT7H 2PTUA 4P3WA 5FUOH 4YGAB 3V6BR 1UH4A 3S37X 4JY6B 1S7WA 1V7NH 1KCUH 3REVB 3T1FA 3NFNB 3GMRB 2F19L 4X6FB 1L4IA 1IL1B 3BZFB 1A6AB 3HFML 1U2CA 1NLBL 1OQOA 4LAQL 4LCIL 3KLDA 2NW2B 3KHQA 1R3IL 1A47A 2Z35B 4L8DB 3RL2A 5DMGD 3BFOA 1M71A 1HHHB 1PFCA 3TPUA 1FO0L 1K2DB 5EFIA 3TO4A 3U9UA 4NZTH 5ESVA 1NGPL 3QWRA 5C0GB 3RRQA 1MCLA 1YEEH 3ZSSA 2A9MH 5DDHA 3GIVB 4IMKA 2CUIA 1F5WA 1NGXB 4P2QB 3C60B 4OZFB 4O4YL 1ZMYA 2BOBB 3ZZ1A 4WO4C 5TDOA 1H15B 4LRNL 3FHQA 1A7NH 5JPMB 2EDRA 1T6VN 3D25A 5MERA 1CDIA 2PYEA 4ALAH 3FZUC 3LB6D 2JLLA 1V3JA 5JOPD 4HUNB 3NIFF 4X7DC 1DUZB 3RY4A 5DMGC 1W72H 5JZ7D 4NRZA 4UDTB 4M62L 2IH1B 4WDIB 3ZO0A 3P0VL 2JB6B 2OK0L 3QIWB 5D93B 5F7WC 4YEFA 1E6JH 2E3VA 4YK4B 4WTZA 4DGVL 5FYJE 1DVFB 3VFPB 3S96B 2AI0L 3X3FH 3RNQA 5IR1B 2VDKL 5K9KA 2OMNA 3QZWA 1P7KA 3UX9B 2NX5E 3KPTA 4XP6H 3U82B 5L8JB 4MGXA 3LB6C 1BGXL 1GYAA 8FABB 2P5EA 3CZFB 1VGKB 2X1XR 2YC1A 4AT6B 1MPAH 1I3RA 1T1ZA 3BXNA 4XCCH 1L6ZA 1WFUA 1ONQA 1P6FA 5JZ7C 4XGZB 4Y1AE 1FHGA 4M7LL 3V6OE 3WNLA 1KXTB 3V4PH 3RIFK 1MY7A 2CO6B 4M9PA 4TPRH 1CLCA 1QEWB 5TQ0H 3J8F7 1U8KB 4GS7C 5GGTL 3O2DL 3H0TB 3MLTB 3X17A 2O61B 2GSGB 3FO0L 3K80A 3MLVH 1NEZB 5E1AB 5I1EH 5FYLH 3HMXA 1JTTA 2EDJA 2EDEA 5INCB 1DEEB 1E28A 2YD6A 1JPFA 3SKJH 5E5RB 3TNNA 4M48H 4X6DB 1AO7D 3S34H 4TSBL 4DAGL 2IADA 3GM0A 4P5TA 5IJVB 1NSNH 4QRRE 1CDJA 3MBED 3UJTH 7FABH 3T09A 1CFTA 3PWUA 3HI6H 4N0RA 4GSDL 4PJ7E 1WITA 3BP5A 1T0NA 4MD0B 3DRTA 2WAHA 4FQHB 4QOKE 4G8EB 1KYOK 1OWWA 4MDIA 1T4KB 3V8CA 3N0PB 1A1NB 1FYTA 4FQXB 5EU3B 3FFCB 3ZDYE 1DLHA 4CU6A 3FCTA 1YEHH 2R9HD 4HIIB 3ARGD 2A9NL 4QXTA 2Q76B 2P48B 3K46A 1N7MH 3UZQA 4JFZH 5GZOD 4AQ1B 4OCSH 3UCRA 2F8OA 1N5AB 4DZBA 2YD9A 4YH6A 4XMPH 4IRJD 3MBEC 1J5OL 3UTQB 4FZEL 1QPPA 2MNUA 3ARYA 3BEVA 1GZQA 5BZDA 5D7KD 2XTJD 5SV3A 2Z92A 5CGMA 1S9YB 2NZIA 4UAOC 3TYGH 1N59A 1LEGA 3PWLB 4APQA 4PJ9B 5J1AA 4CVZB 2HLFD 2R9HC 1I9RH 2V5TA 3ARGC 2FBJH 1B2WH 3W2DH 3RTQA 1S7VB 4DN3L 1IC5L 5BXFA 5EA0L 1EJ6A 1G6RH 3PHOB 5GZOC 1CU4H 4JHZA 3BIKB 5DQDL 5I1AA 2OX5A 4RFOL 3MA9H 1IKNA 2B0SH 4XX1G 4IRJC 12E8L 3O6LH 4RDQF 3ECBA 1HXYB 2IG2L 3MROA 1ADQA 1HWHB 3QR2A 5FIEA 1XCTB 4XPBL 4OQ1A 2E27L 2XTJC 2I07B 4GMSL 4BH8A 1AXSA 3C60D 3KG5A 3OJDA 1NFDE 1QLEL 3RWDA 3UTTE 3TCLA 5HHQA 2BRRL 1F4YH 4GKSB 3G5VA 1ZLVK 4M7KL 4YDKL 1F4WH 4XZUA 5BMFL 2IFFL 2DBLH 2HLFC 4JGJA 5HVFB 1FNAA 4ONGH 5CZKA 1GGCL 4UQ2A 5CEXB 4ODHH 5CJXC 4AMKH 1CXFA 5HPMA 3OF6D 3DO7A 3P73B 3FRPG 2B2XH 1Y0LB 5DFTA 4HIEA 3O2WL 1GSMA 5E8DH 4OLWL 3HZMA 5JXED 3WKMH 1C08B 3BW9A 3QIWD 2APXA 4GLRI 2YA2A 5JW4R 2ENSA 1KBGL 3SE3A 3D39B 2ED9A 4U1LA 5FK9A 4G43A 5D5MF 1FJ1A 1I1AD 2BFVL 4KZDL 4XVTL 3C60C 1HE7A 5ITFB 4UT6L 1DZBA 5SX5K 3MGTA 5IGXH 1ZXQA 5CJ8A 3TNMB 1NAKH 5E2WH 4BK4A 4NUGH 3V5HB 5IHZB 3E1F1 3LZFH 3BWAB 2C1OB 3MJ8A 4NO2B 3EYUL 5ITBL 2HKFL 5I9QB 5E8NB 3CLEL 2JE8A 5IROC 5J1TC 3D0LB 4I2XE 1ZK9A 1QYGL 4LSPH 3JV5A 4U0RC 5TDNA 1LE9A 3SGJC 2QHLA 1VB9A 1ZHNA 3JVGC 4NC0B 5F1SA 4OZHA 2AEWA 5JXEC 3MLRL 1B0GA 3QIWC 5D93C 4DZ8B 3GJEA 5LXGL 1UFUA 2C4FT 3B9KA 2BHZA 2A6DB 4KKCD 4KRPB 2DJUA 3BPCA 1NCWL 1ZTXH 4HWEL 4KGLA 4YK4C 4HIHB 5C0AA 4JFDA 1NCDH 1Q94B 4LPUA 3WJLA 2CRMA 4UTAL 1F45A 4XBEL 4KTYA 3T65A 3ZDXF 1JZ4A 4U1MB 2VH5L 4BZ2H 3AS1A 3TCXA 4K3JH 1NFIA 3RWHA 4C56E 5KVMC 3P4OB 5HI5D 4EDWH 3TWCH 3I50H 3RWFB 2GSIB 5HD8D 1BD2B 2AQ2A 1MCPH 1I1YA 1LP9A 1A6VL 1GVIA 3OHXB 4CMMB 1A7OH 3IDGB 1FN4A 1ZLVH 2YZ1A 4N5ED 2HA1A 1MLCB 4IDJL 3ULVL 2HWZL 3D2UB 3LRSB 4D8PA 1EFXB 3MYJB 4FQXD 3FFCD 3QDGD 1SY6H 1FL3B 1QKZL 4QTIH 4LKCA 5B8CA 1FNLA 3AY4C 4KUCF 2JJTC 2WP3T 2X9WA 1G7IA 4KKCC 3MR9B 2G2RB 3IDXH 5KSBF 3H9SA 5HHOE 3MO1A 5D7IA 5C0BB 1CICA 4RGNB 4ZFOA 1H3XA 2NPLX 3QDME 2GJ6A 5E99H 1PVHA 3I3EA 5HGHB 5IFJA 3FO2A 4P57B 5T1DH 1SMAA 5HI5C 4LNRB 3F6IA 2WV3A 1MWAH 4OUUA 5AZ2H 4ORGA 4XC3H 3I75A 1J88A 3QJFB 1BX2B 3BDYH 5HD8C 4YHML 1XF5A 5GIRB 5SX5H 5CJOH 3T2OA 4N5EC 2D0HA 1OAQH 2AJVL 5MP6H 3LDBC 3GI8H 4KV5F 1XGUA 2DQDH 4PJBE 3C8DA 3U9PH 5CZVL 4FQXC 2EXYD 4WFGD 4PJ9D 5IMMB 3CX5J 4ZUWB 4UI2A 3CFEA 4I13B 1RPQA 1WIPA 5CJQH 4G6KH 1CQYA 2OTUB 1BF8A 1LWRA 2AK4D 1IILE 4DOHE 1XIWA 3WIHA 4WV1B 2EC9T 2E6QA 1MFNA 4GUPB 2P5WE 4ONFL 1RD6A 2WUBH 4OD3H 3SCMA 2XQYK 5F7UA 5GS1A 3K8KA 1OTTD 2DICA 2DMBA 4MA3A 2OBGA 4HJJH 3L1OL 3HE6A 2OP4H 1INEL 4J12A 1T5XB 3FT3A 1JRHH 4OIAA 2HH0L 3UTPD 4GAYB 5I1LB 3BE1L 1G9ML 1S7QA 1EDQA 1J8HB 2ICEA 4NNYA 3KLAB 2WIMA 2WUCL 3QIUB 5D2NB 4UIMB 1LE5A 2A1WH 2CK0L 3G5YA 5EIVA 3ULVE 5JOEA 2EXYC 1U3HB 4PJ9C 1RZIB 4GAGL 1E27B 2QQKL 2LTQB 1JGDB 2W9DL 1QSFB 4C4KO 5DC4B 3PABA 4NBYB 3NIDF 3KHOA 3PV6B 3KJ4B 3VXUE 4X9BA 2GT9B 3TBTA 4L4TA 3O4LE 3VFMA 3D48R 1OTTC 1D7FA 4V2BA 4P2OD 3CZJA 3PDOB 4Q7DA 5L2KD 5H35A 4K7PL 1X5YA 5D70L 1BQLL 1CT8B 1M05B 2AJSH 1A2YB 3BP7B 4AL8L 4N90D 1I8MB 5DRZA 5TQ2H 3D39D 5D7LB 5EIQA 1KJ2H 2OR7A 3MNWB 2YPLE 2VLJD 2Y06L 3SE8H 2LVCA 4ZXBB 2AQ1A 1FZKB 2K9UA 4ZFGL 2X1OA 2GKIA 1CDUA 1FC2D 4C58B 5FDWA 1KPRB 2J4WL 2R4SH 4XB7A 2NX5A 1FNEA 5D1QA 1MJUH 5DD3H 1I8KB 4DKAA 4JM4H 1N6QL 1VADA 5FM5M 2DQHH 1IAKB 3DVFA 4L4VB 3NCFB 4HG4K 1NCTA 3IFOB 1HXMB 4HUXA 2VDNH 1AGDB 5IB5B 5E00B 5DYOB 1IAMA 2MMXA 3Q2CA 4P2OC 3DMMA 4Y1AA 1J7VR 3V6OA 1DCLA 5GS3A 5I1DA 2VXSH 4YGVB 5TE7L 1FO0A 5DHVB 5DD5H 4KRPD 3MV01 1E4JA 4GRMA 4I77L 4XBGA 4Q9RH 3GSWB 1MSPA 5CINL 3E3QE 3TJHD 2MSPA 3MLPA 5BOPA 3O0RH 3CDGB 3W81A 5IEHB 3RP1A 3R1GH 2C3XA 2VLKB 4F37F 4M3JA 1IMHC 1F58H 4DW2H 1B9ZA 3B9AA 3GMPA 4L8BA 1P69B 2R1WA 2GK0B 1VFMA 4HS6A 3ESVF 4QXWA 1QR1A 3GSUB 1XF2B 1D5MB 2MPAH 5DTFB 5IESH 1X4YA 2Z93B 1MRFH 2H9GA 5D9SA 5EZIH 3ROLA 4PJ7A 4HS3B 1WIUA 5C2UB 4I0PA 4XNYL 4JQVA 1Q0XL 4WTWA 5T33L 4NNXB 5EZOL 4DGIH 4QOKA 3LKNA 1EFXD 4LMQI 2KDGA 3T77B 3DX9B 4OIIH 1M7XA 2W0FB 5GRVL 3G5XA 4P2RB 1YNKH 4BKLB 4KRPC 4OB5L 2BVPA 4KMTL 1WC7B 4X98B 5DD1H 3CIQA 4PJIF 5C0BD 4JQIL 3QNZA 4NZDA 5E2VL 2NY2D 1YEGH 2ZUTA 4LLUA 1SBSL 1EEQA 2EYSA 3TJHC 1SVCP 3MJ9L 1JI1A 1S7WB 3T1FB 4OQTH 4H8WC 1KPUB 4WI7A 1IJ9A 4K9EC 5JXAL 2MQCA 5SWZB 4WVRA 5KW9H 3N85L 5DJAA 3S6CA 4JFHE 5B4MD 3RL2B 4IM8A 1M71B 4KVNL 3SKMA 1LDPL 3PJSB 3N1GC 2B1HH 5EFIB 3TO4B 5K93A 5ESVB 2BK8A 4HHAA 3E8UH 5KSAD 5JQHC 5DURD 4QRSA 4LFHG 4RAHA 1YMHB 5DDHB 4YDIL 1EMTH 3U79A 4CAGA 1FYHB 3PWPD 1TFHA 4ONHA 1KIQA 1C5DB 4O51A 5CCKL 2D7NA 5TDOB 5DR5H 4HZLA 1OAKL 3O2DA 4KQ4H 2QKIA 4K7FA 2NY2C 3UYRL 1DQQA 2OL3A 2NMSA 2Y4SA 3G08A 5MERB 1IT9L 2PYEB 4PS4H 2B1AL 3IETB 4OFIA 2ZUXA 1UWEL 4M1DL 4DTGH 5B21A 5F7YC 5IQ7H 5B4MC 3CPLB 2UVEA 2YRZA 1ERNA 4PUBH 5CSZB 3JWDL 3BX7C 4LQFL 1J8HD 5DJ2B 4YQXL 2VC2L 3QIUD 5JR1H 3OGOE 4QXGH 35C8H 5IF0B 4DVBB 4YX2L 3BUTA 4X6BA 3IYLW 1QSFD 2H1PH 4NQDE 3RNQB 1NFKA 1R0AL 3ZE0E 2YPKA 5K9KB 1F3DH 3QZWB 4S1QL 4WV1C 4A2MA 1P7KB 2CKBL 4OT1H 2BJML 3CVHB 4OLUL 4JGUA 1BJ1J 4K3DH 3TBYA 1KN4H 5E7BA 2YC1B 4PRHE 1I3RB 1T1ZB 3BXNB 4OSUL 4PJAF 1L0QA 1ONQB 3V7MA 3BAEH 2VMFA 1WEJH 2C1PA 3EYOB 1OW0A 4MQTB 4FQPA 4F8TA 4MXQD 4QTHA 3DURA 1T2JA 4GRWE 5ERWA 2R29H 2OM5A 3QIUC 4ZXBD 4XMLL 2AGJL 2Q86A 4QRTA 2O5ZH 4OKVA 1BWWA 3G6DL 5FYKH 3MPCA 1U8MB 2YN3A 4AIZA 2IJ0C 4NQUA 5E9DE 3GDBA 3BESR 4XWGL 4TRPH 2ZNWA 1MUJA 1E28B 2VZUA 2AJUL 3LRGA 3PWJA 1OAZL 4FFVD 3SDAB 4HK3J 3TNNB 3KJ4C 5IB2B 2IADB 3UBXI 1J0YA 4P5TB 2FATH 1A14L 1GPOL 5SWQA 2EECA 2PNDA 3OMZA 1UWGH 1CFTB 3PWUB 4ZO7A 2NZ9D 3QFJE 1ACYL 3BKJL 1PY9A 1TCRB 1KACB 1KIRA 5BVPH 5C2BL 1UB6B 2AV1A 3BP5B 1T0NB 5B38A 5DK3A 1C7TA 3U36B 4EUPA 3MLSL 4MXQC 3KYMA 1HHIA 1RHHB 3KR3H 4NKOA 4ZXBC 2DQUH 4Y5YB 5FCSH 4F37K 1Q1JL 5BRZA 2VLKD 2H45A 4C56A 1K8IA 1V3KA 1LMKA 4Q9BA 4X0KA 5JLZA 4WUUE 4FFVC 3WEXB 1CE6A 1I1RA 4JE4B 2VO5A 3MV7A 4R26L 4DZBB 2IBBA 5E2UH 1OPGH 5J56B 3BEVB 3BP4A 4LL9A 2NZ9C 1GZQB 4HS8L 5JW3L 2RR3A 5GGQH 5TGBA 2IALA 1SYVA 2D2OA 5BZDB 4E0RB 4K23H 4P2RD 2Z92B 3DXAE 5EU6E 4ZAKA 4KXZH 1HINH 1E4KA 5JPNA 1N59B 1LEGB 5HHOA 1VGEH 4H0GA 1FIEA 4ZFZA 5D5ME 4APQB 4XCNA 3VI4F 3QDMA 2R15A 4ODBD 4PJFF 5ELIA 2I60H 3KPRE 3NAAH 3VRJA 4OI9A 4WUKL 3BSZH 3WV0A 1QFUL 3RTQB 4HH9A 5BXFB 5K9QG 1CI5A 3GJFA 4MAUH 3TFKD 1P84K 2LU3A 4NWUL 5I1AB 3TT3H 1J11A 3TO4D 4NGHH 4HBCH 3QWRD 5DHYA 3MROB 4TUOB 1I7ZA 1NCAH 5L7XH 3EYQD 4PJBA 3VCLA 4KJQD 2NYYC 5HJ3B 4N1CA 3HE7B 4GRLA 1AXSB 1EAPB 2NW3A 4NIKB 3RWDB 5HHQB 3TCLB 1MFBH 3MNZA 4L9LA 3KJ6L 3HI5L 2J8OA 5JORA 1HQRA 4NZJA 2YUZA 2WWKO 3GEWB 4F80A 1U58B 4OV6F 4XZUB 1LK3L 2P5WA 4PJ8B 2PYED 1DBJH 1IGIL 5I8CA 3ZDXE 4DN4H 4UQ2B 3TFKC 3RVTD 5HPMB 1F6LL 5F7DA 3DO7B 2G60H 2HRPL 4YFLF 3UBXA 1F3RB 5F71A 4HIEB 3TO4C 2XZCH 1T7VA 1YEIL 1UCBH 3EDFA 1N3NB 4R8WL 1VFAA 3KPLA 4NN5C 1UM4L 3EYQC 3RFZC 3RU8L 4RMSA 1KYOJ 4KJQC 4IMKC 4U1LB 5I1KL 1BIHA 4ODSL 1NMBL 3IGAA 1WCQA 1FJ1B 4JHAH 1CLOL 4JQXA 2KPNA 1CZ8H 5IHLB 2XZAH 3V6FA 1ZSDB 4HCRH 3MGTB 4AM0B 4PG9B 5KSBE 2PTTA 3MACH 4ELMF 2VDML 3MJ8B 3VXUA 5JA8B 4R90H 4AIXA 3RWCA 4M1GL 5DK2B 4ZS7L 2NY1D 5EO1A 2P5ED 5F8RC 4HUUA 4GT7A 1LNUA 2HVKB 2X4TA 3GSNA 3RVTC 3DVIA 4PRBA 1ACZA 2YD7A 5DK0A 5DVNA 1LE9B 5K9JL 2D7PA 1NGYB 3WD5H 1ZHNB 2X4UA 3QISA 5KVDL 3S3JA 4OZHB 3OKEA 5T1MA 2YPLA 1B0GB 3DYOA 1FNSH 2ESVE 3GJEB 3ZLQC 3BPCB 4FQJH 1JPTH 2HJFA 5C0AB 5HVGB 5ACZA 4AIOA 2ATKA 3T65B 3WFBL 4TYUA 3NZ8B 3DX6A 3B2VL 4XAWH 3RWHB 1CGSL 4P5TD 4JB9H 2J8UB 1YPZA 2WQ8A 4HWNA 5E6YA 3LKQB 2NY1C 4H20H 4NQXA 4R97C 3BT2H 4J3UA 4ODXB 1I1YB 4QRQB 3CLFH 5IFAH 4ZOAA 1M7DA 1CXKA 5DO2D 2V2XA 3OKKA 4JM2F 2OJZH 1FYTD 1FE8H 3PHSA 3HTLX 3R4DA 4JO4H 5C3TA 4LLDA 4LKCB 3SPVA 3GI9H 2X4QB 1G9NH 4HPOH 4UU9A 43CAA 1AIFA 3H9SB 4FFZL 1S8DA 3O8XA 3MO1B 1FPTH 2R2EA 5D7IB 3UC0H 4PV9A 1UYWL 4D94A 1OGTA 4NKIL 4R4FL 1U8OA 4HDIA 2BY1A 2GJ6B 2R2CA 3SDAC 4XVUD 5IFJB 4U05A 2VDRH 3FO2B 4H1LA 1MIEL 4P5TC 3T8XA 1JNJA 2EDYA 1H3VA 3KYAA 4O5LL 4OUUB 5DVOA 1CDBA 4TVPE 1EO7A 3QDJE 4ORGB 3I75B 1F00I 2O93L 2R2BA 4A6YL 3BKYL 3S97C 4Z0BL 1FFRA 3SOBH 4QRPE 1T7WA 5DO2C 1A8JH 1XGUB 3QNXA 4GW1A 4RSVA 4LSUH 1LGVA 3FMGH 2NY5H 4APQD 3CFEB 4JFPA 3R06A 4P48A 2VSCA 5L88H 1N4XL 4H1LG 3TP4A 3RTQD 5E8PA 3WFDH 1XIWB 1AGFB 3HA0A 1X7QA 2NCMA 2K3TA 2MCPL 4XVUC 3SCMB 4Z7OE 5GS1B 2EKJA 1BWMA 2IANE 1GL4B 4MA3B 4MA8L 3H3PH 3HE6B 3KYOA 3DLQR 3I85A 5ETUB 3FT3B 4G6MH 3LVEA 5GHWL 1CGWA 1BLNA 3AGVA 3LKRA 3KPMB 2CO7B 2F5AH 3V4UH 1BFTA 2XN9A 3TM6A 1DUYB 4OCXH 3TZVA 2DS4A 3OPZH 3QXVA 4XB8A 2DLTA 4NNYB 5DWUL 2YD1A 3IF1B 5DC0A 3MUHL 2O26U 3C6SA 3QUMH 1NLDH 1K6QH 4MVBD 1GGIL 4FXLA 4APQC 5BV7B 2YHGA 3CC5A 3IJHA 4WEBH 1QSED 1OP5K 2ZPKH 5C0IA 3FRUA 3OG4B 2VKXA 4ODVH 3RTQC 4LSVH 1WQVT 3ZKSD 5EIIA 3IKCA 3TBTB 3VFMB 3GMMB 3L3KB 5F96H 2HP4A 5I17B 2R1YB 4MNQE 2D7QA 4YHLH 1C7SA 2YXMA 5FOBA 1IKNC 2AJ3A 3RI5K 1URLA 3L3IA 5H37H 3ZE1E 1UZ6E 1GOFA 4Z7WE 3T1WA 5DRZB 5SV4A 4R9HA 4TUKL 3GBNH 3LHPH 2NTFB 1QBML 3WLBB 3MXVH 2Y5EA 3U1SL 4NHUA 1RUAH 3CK0H 2KKQA 1OTSD 4XBPB 1WAAF 3GIZL 4LSQL 1RURL 3B8SA 4RMVA 4MVBC 5FDWB 2GHWB 2ZCKH 4NJ9L 4DKFL 1VKXA 2NX5B 1FNEB 3EFFA 5D1QB 1EO8H 3F7VA 4U2YA 3OTTA 1BJ8A 2DI7A 3VG9C 5IW6A 4LPVA 2FO4A 3MJ9A 2AXHA 1MEXL 4GXUN 2D0FA 5HYSG 3IFLH 4X5XA 5DGQA 4OLVL 5FHAL 3BP6A 1CYGA 4G9FE 5HY9A 3DMMB 5BJTB 4Y1AB 3V6ZA 2PR4H 4EIGB 4FQ1H 1JE6A 2DLFL 5DLMH 2VIRA 4HIXL 2XA3A 4NCC2 3U7WL 1FO0B 5B22A 3WS6A 3SE3C 3B9KD 4GRMB 5C0AD 4JFDD 1QO3A 4XBGB 5GRXG 1F42A 3HAEA 2FJFA 2GI7A 1OTSC 2DQEH 4UTBH 2ZOLA 2OZ4L 5T1KA 5DXWA 4GXVL 3NCJH 4ZOEA 1DBMH 5A3ID 4XAKE 1KTLA 1ED3A 3GMPB 4L8BB 5I74B 2R1WB 4HS6B 4QRRB 1QR1B 4P59H 1YEEL 2Q7NA 3HNTL 3GM8A 1JV5A 1F2XK 3QFJA 2H9GB 3PGFH 4JPKL 5E08H 3QCUH 3ROLB 3BH8A 4PJ7B 3FT4A 5E1HB 4WI5A 3BKCH 1GXEA 5IB3A 2QSCL 3SKOA 4QOKB 3LKNB 1A7QL 2XY1A 5FB8A 1GGUA 4R3SB 3GB7A 4LLVA 3HC4H 4WW2B 4QHLA 5B3JE 1WJ3A 3G5XB 1EHLH 3B9KC 4OCYH 4K3EH 3H9SD 4ALAL 3T4YA 2CQVA 4HX1B 1UA6H 4YHPB 1FORH 3K1KC 4OI7A 3WJLC 3QNZB 1CICD 3L7FA 2VXUL 4M61A 4LLUB 2EYSB 1EFQA 2GJ6D 4PLOB 1MJ7L 4WUUA 2GIYA 3FQNA 3S88H 3V0VA 4ZO9A 5I2IA 3AS3A 5A3IC 1NGZA 4OCRH 4GXUM 4EN3A 5DJAB 3PL6A 4Q6IB 1D3CA 2ARWA 1EEZA 3VG0H 1FL6A 4QHMB 1LEIA 2X4RB 3DXAA 5EU6A 1NBVL 4DUXA 1X9QA 3X3FL 4QRSB 1FNGB 4PJAE 2DKSA 1I75A 1PDKA 4D9RD 5B8CC 5H2BB 4ACPA 1RJZA 1KJMA 1X3DA 5D5MA 4X6DF 4ONHB 2Q20A 3FQWA 5GS0H 3P30H 5I73B 4WWKB 3KPRA 4DVRH 1CICC 4K7FB 1A6WL 4M6OL 1XIWD 1DQQB 4ZO8A 4YPGA 5ADPL 3R0NA 3G08B 3SCMD 1CGYA 1S5IH 3K2MC 4NZUL 5CBAA 1JPGA 1MCIA 3C5ZA 4HG4J 4UDUA 1C16A 3V4PL 1EO5A 3HE6D 4TPRL 1EH9A 3EDJA 2V9TA 3NOIA 3B6SA 4CU7A 4F9PA 5EO0B 4MQXD 2PW2A 4N8VB 5FYLL 4LK4A 1NFDB 3UTTB 4PJDF 3BEWB 1RUPH 3EFDL 4HEPG 4DKEH 4LPYA 5DMYA 4LIQH 1NGQH 3TIDA 4X6BB 3VGFA 1AD0A 4H0HB 3P9WB 3ZYJA 3TA3A 3DGGA 1BBDL 1S9VA 5C0JA 1XIWC 4MCYA 4M7JL 2YPKB 4L4TD 1AY1H 3SCMC 5GS1C 1Z2KA 1LILA 3FKUS 5CKGA 3EOBB 2E7LA 2YZ8A 2OR9H 2DI8A 3NCYP 2FH8A 2Y36H 3HE6C 3TT1H 4KU1A 4S0TD 2VDPH 1T5WA 1YEHL 4XNZC 4MQXC 3HUJA 5A2LH 1U92B 4JKPH 4QTHB 5FYJD 3DURB 4FQIL 1BZ7A 5ERWB 4Z0XA 3SGEI 1FLRH 2PYFA 2Q86B 2FJHA 4M6AA 3RWEA 4AIZB 3G9VA 4CVUA 4NM8H 5CMAB 3EYVA 2NX5D 4LSRL 5D1QD 1TQBB 1D5XB 1MUJB 3PWJB 3FQRA 3SGDH 4X4ME 4I4WA 3BZEB 5A2JH 2EIBA 4PD4K 1CD8A 1DBBH 4RZCA 2VZSA 2X7LA 3OAZH 3S8WA 1T7ZA 3MRBA 4I2XB 4FZ8H 4YE4L 4J7RA 1U8LB 3DMMD 3FOMA 4Y1AD 4JFFE 5DQJB 5SWQB 2DM2A 2Z91A 1WBXB 4UB0H 2VE6B 1KIRB 4JZOB 4QNPF 2AV1B 5GS2D 2ESVA 5B38B 2KUTA 1JGLH 4C54A 4YHKL 4EUPB 1I1FA 5BW7A 4NFBA 3PP4L 1B2WL 4JVPA 1IM3A 3C8KA 4X7TB 5FYLE 2QQLH 3ARFB 1T2XA 4X7EC 2XZQL 2RHEA 2P43B 1HDMB 4C56B 1H3WM 2QSVA 1K8IB 5D1QC 1U8NA 3MA9L 5JLZB 3HRZB 4O58H 4C4KT 3FO1A 4NN6B 1CE6B 3DX8B 4M5ZL 4LCYB 5DQ9A 1TNMA 2AABL 1NC2A 4I0PD 3SN6N 4U1IA 4Z78A 3M8OH 3DMMC 3V6OC 4QOKD 3QQ4A 3BWUC 5BVJA 1S7RA 3QA3A 5IMKA 1OCWL 5I1CH 3F7YB 2ZWLT 2IALB 5TGBB 1SYVB 2Q7YA 3JXAA 1XGYH 2EKSA 1A6TA 1F4WL 3SO3B 2DBLL 1TETL 1T2QH 2EZ0D 3H6JA 3EHBD 3IXAA 5JPNB 5GGRY 1Q9KA 4FABH 5HHOB 2LE9A 5JW4N 5KVEL 5ESAA 2VOTA 4ONGL 4ZFZB 1JK8B 1FVEA 4ODHL 4XCNB 2R8SL 3VXQA 4PGJA 3TLRA 3QDMB 2XICA 5TE6L 2IPTH 3RPIA 3VRJB 3NVQA 5I74C 4HH9B 5CP7A 3VDCA 5E8DL 3GJFB 3V95A 4XMKH 4G42B 4PJCF 3QDJA 4PPTA 4BSWB 2EE6A 4BZ1L 1Q8MA 1PD6A 2E9JA 4I0PC 5JO5A 4JQVC 4GBXA 4UNTA 2AEPH 3RGVA 4S1SL 1K3ZA 4X99A 2YD4A 1I7ZB 4LCUA 4X9GA 3T0WA 1WISA 4G8IA 4PJBB 3VCLB 1ZVHA 4GRLB 4UT9L 1FRGL 4M9OA 1MY5A 2J6EA 2NW3B 1S7TA 4QEGA 2EZ0C 3X12A 3EHBC 4L9LB 3BISA 4ISVB 3B5TA 3G9AB 4JREC 5JORB 1HQRB 4J6RH 1X6NA 2EC8A 4P5KA 1QA9A 2P5WB 4HFUH 2A83A 4LSPL 5J1SC 5I8CB 3AM8A 3K7UA 1CD1B 3I6KA 2IANA 1X44A 3PGDB 3VD9A 4Q6IC 3OB8A 3A6BL 5F7DB 1KUMA 3GBML 5FO7A 2IQ9H 3UP1A 4C83A 3UBXB 1TJHH 1AGBA 4NKQB 3HKFA 3T08A 3KPLB 1NJ9A 2GQHA 5TJWK 3VFGH 5GGVH 5C0CE 2J88H 4J1UB 5C0RL 2CIKB 3L6FB 5JW4M 1FL5A 5I73C 3RA7L 3BD5A 3V6FB 4NZRL 3KYNB 1D6VH 1R3LA 2LQRA 4K8RD 4FQLH 3QO1A 1C5CL 1RJYB 2PTTB 1A64A 5F7KC 2ILLA 3X11A 3VXUB 5EU4B 3KPSB 1EUTA 3O4LB 4LCWE 1F13A 4MNQA 5EO1B 4ENED 8CGTA 2X4TB 1T80A 4RGOH 4Z7WA 5DK0B 3QXUA 1G0XA 2CK2A 3ZTJH 2X4UB 1UT9A 5JUEH 4YR6B 5GISH 2W65A 3OKEB 5T1MB 1XGPB 2YPLB 5F89A 4MLSA 2EH7H 2D03L 3JV6A 4ZUTA 4NQTA 4JZNA 1F90H 1YJDL 4HC1L 1ETZA 3KPOA 2HJFB 1JYWA 5LG1A 5ACZB 1Q9LA 1J1OH 2ZJSL 2ATKB 4K8RC 2O5YL 5FHBH 1BM3H 3OJMB 3FN0H 2ID5A 1IGCL 3ARDA 1JYXA 3HMWL 3PGCA 2NY7H 5GRJH 3W5MA 2D7MA 2HT3D 3FAWA 4IS6B 4W70A 4G9FA 2FIKA 2JJUA 4ENEC 2OLDA 4IOFD 2DB8A 1F4AA 5DEFA 5A2IH 2W9EH 1TJIH 1PKQA 2BSSB 2GUOA 3L3OA 2GK2A 1AE6L 3PWVA 2C9AA 3X3GL 5ISZA 1M7DB 3DSNA 1OW0C 3OKKB 2AEIT 3QWOA 2K7QA 1I4FA 3PG2A 4OV5A 4LLDB 2VXQH 3SPVB 1TENA 4OLZH 4UU9B 5BRZD 1HHJA 4GQPH 4OD3L 43CAB 3O8XB 4C56D 2R2EB 1KTRL 1TQBC 2XFXA 1JPSH 1U8OB 4HDIB 5JIIA 3P77A 5HYJE 1BVKA 1RU9H 3MV7D 3A6OA 1NDGA 1S9KC 5IEKB 3T8XB 2RCSL 5AZEH 1RVFH 3DUUA 2HT3C 3MMEA 3QEUB 4I0KA 4IOFC 3JWOH 4KY1H 4KDVA 3WUWG 1W2KT 2FX9L 1F3JB 2ZCLH 3LQAH 2Y72A 4ZAKD 1GOHA 5IV2B 3RKDD 5E2TH 5MHSE 1WV7T 2V5MA 1RAMA 5HHOD 3C9NA 3QNXB 4GW1B 4MA7L 5HI4D 1O0VA 2XA8H 3QDMD 3DTXB 4JFPB 1DSFH 4LOUD 3R06B 1VFBA 5GJTH 4OKDA 5I19H 1EEYB 1ZANL 1X7QB 1BMGA 4NN6C 1FFNA 4U1NA 3JSSA 5ALBH 4Z5RA 2E9BA 3HRPA 4HJ0C 2CR3A 2XT1B 3CFIC 3LH2L 3KYOB 3MX0A 4F7TA 4H0IA 3SE8L 4HXBL 3O6KL 1A3RL 1BLNB 1QRKA 1L7IL 3QPXL 4P9ML 4GRLD 1KCKA 1OF2A 3P0YL 32C2A 3TZVB 4ZAKC 3SO3C 2CGRL 3ARRA 3RKDC 2RBLA 1E4KC 2JELL 5I15L 1MJUL 5C0ND 1EHXA 4JM4L 5JDJA 4QGYA 2YD3A 5HI4C 2CDEA 3CC5B 3IJHB 2P5WD 4LOUC 5CJBA 5GGVY 4FNLH 3VWKA 4BJLA 2A73A 3F58H 5ACLA 1D5ZA 5EIIB 2XWTA 4NM4L 3F8UB 4OM0L 2VXSL 3VWJA 2CD0A 4YFLI 3QEGL 4PGDA 4MJIE 5FOBB 2FZ3B 3L3IB 2EDHA 3N1PC 4DJMA 2OXGA 4U6TA 1RSFA 3ROOA 3O0RL 2UZYB 3WKNA 3X13A 1QLFA 4GRLC 3ULVD 3Q1SL 3VXMA 3R1GL 4NHUB 4X6CE 5C0EA 3HC3H 3L9RA 5GRUH 3ESUF 1F58L 4L9LC 4DW2L 5C0NC 4NQDB 3S36L 5I71C 1NBQA 4FS0A 2A77H 4PGBA 1IGFH 2VXVH 3VXUD 1VKXB 2VJXA 5J13B 3EFFB 4GG8A 2NY3B 3F7VB 3BVNA 3V4VL 3H9YA 4JFQA 1SJHA 1OVZA 4DGIL 5IW6B 2FO4B 2ZKHH 4ZD3L 4B53A 4EXKA 4U1JA 1W72A 3WXWL 4PRHB 4W6YB 4X5XB 4H88L 3RQ3A 2IGFL 1J05B 3BQUA 1YNKL 3BP6B 5CS7A 3UTSE 3FAXA 3V6ZB 4U6XA 3OV6A 2DL9A 3QCTH 2YPLD 4GRWB 3WHE0 2Z8RA 3O3EA 3ULVC 1ZV5A 1A21A 4HPYH 1QO3B 4JG0H 3HAEB 1YEKH 5D71H 3TVMB 1VERA 4JQXC 5CP3A 5E9DB 1ZLUH 2EH8H <