3VE0B

Crystal structure of sudan ebolavirus glycoprotein (strain boniface) bound to 16f6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
DIVMTQSHKFMSTSVGDRVTITCKASQDVTTAVAWYQQKPGHSPKLLIYWASTRHTGVPDRFTGSGSGTAFTLTLNSVQAEDLALYYCQQHYSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Structural basis for differential neutralization of ebolaviruses.
pubmed doi rcsb
source organism Sudan ebolavirus
molecule tags Immune system/viral protein
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B01
3BUTA 4UOW1 5AD0B 5I18H 3NFPA 3MLYH 2B1HH 1UCBL 2DBJA 2RGSA 4BKLB 4GKNB 2VTFA 3OR6A 3L5IA 1NLDL 2HFGH 3L7FA 4K3HA 4LCCA 2EDJA 4L8BB 5DO2D 4J8RB 4O58L 4NSKB 2F58L 3O6MH 1BBJA 3BD5A 4NQDB 5T5NF 3JV4B 4E42B 2L7JA 1XAUA 3MA7B 4UT7L 1A3QA 3GSRB 5F7LB 3QDJE 3HMWH 2Z31A 4J12A 4X80L 3IKCA 3CDGA 1CL7L 2VITB 1MWAH 4RGMB 2XZAH 3WJJC 3QXDB 3CCHB 1NGYA 1PZUB 1MCHA 4XTRD 2ZCHL 3CSYB 2K3TA 5EO0B 3WXWH 2HVKB 3PL6D 5E8DH 3NN8B 5DA0B 1RPQA 2HYMA 3B6SA 3BMVA 5GJSL 2UWEE 1RVFL 4PJ7F 3GJFB 4I48B 3NCMA 4JN2B 4O2EA 3PQYE 2OP4L 2J6EH 1JF5A 5I1DA 2EYRA 1AO7B 2GSGA 1FE8L 2Q87A 4L4VB 2IWGA 4XGZA 1DL7H 5KSAC 1P6FA 2HLAB 5B3JF 1OAKL 5L88H 2NXZB 4G6FB 4TRPL 4W81A 1BIHA 3W11C 4WI7A 1FLTX 3CFBA 3PXHA 3JVGA 4PY7B 1M6OA 3DX7B 4IRSB 4MHHI 2GCYA 3MACL 3MRJA 5CP7B 1WITA 3I9GH 1FFPA 5HI5D 4KRNA 1JUFB 2PTTA 3DX6B 4PJGF 4C58B 3T1FB 2IG2L 1OAXL 4XAWH 1O5DT 3RVUD 4M61A 3WNPA 4J3SA 2HTKD 2IMMA 2AV1A 2Q20A 2FIKA 5EULV 1J8HB 5E08L 4MSWA 5C0CA 4LQFL 5FGCE 3BH8A 1AIFB 2ZJSH 4LCYB 2CRIA 4HWBH 1KN4H 3BMWA 3SO3C 5B8CB 1MY7A 4ORZC 2GUOB 1SJHB 1WISA 3I6GB 2W38A 4U1HB 4G43B 4HWUA 3RWDB 1RI8A 3FT2A 3KVQA 2YKLH 3N85H 5AZ2L 5E5MB 4KTYA 3KPSB 1LNUB 3FN0L 1PSKH 3QULB 4FXKA 4NC1E 1I8KB 4MA3B 3KPTA 5IFJB 2QQLL 3DMMC 3GSVB 2VQTA 4LSRH 4PJ5E 3T65A 4WI6A 2EH7H 2FWOA 4D0CB 1NDGB 1VCAA 4I0PA 1MJJA 5D7JA 4MJID 4OD1L 3QJFA 1WFOA 4HF5L 4U6TA 1LE9A 3QNYA 3S3JA 4UI2A 3BEVB 1BVKA 1XF3B 3VWJD 1I7UB 4WHCA 2VAAA 4XNQA 1M7IB 5T3XD 1Z0MA 1OL0A 4RSVA 3F8UB 3H42H 3VRIB 5BRZE 2DN7A 1XIWC 2VLME 5T1DH 5ICYB 1G7IB 3LDBC 4DAGL 2PO6D 3OAZK 4PJ8D 5E2TH 1OD9A 1UM5H 2CKBB 1I7ZA 1GGIL 4O02H 1FN4A 1Q0YH 1EZVX 2PXYD 5H94A 4JRXD 3V2AR 3P4MB 5ISZA 1I75A 1EFXD 2LAAA 5BS0D 5T1KB 4HC1A 4N5UA 4N9GB 4YFEA 5SV4A 5J6GB 3RWCA 3KR3L 5IVXB 2BXYA 1DUZB 2Z93A 1EK3A 5KVMC 3OKLA 4NKMB 5I1EH 1BQHB 4Y8DC 3T0ED 4NO0A 1Q72L 3L9RA 5FKPB 2HLFC 2VH5H 2EC9U 3EYOB 1RURL 4KI5E 4NN7B 3VD5A 4Y4FC 4HK3N 3BT2H 3L3HA 1MHPH 3I02A 4OFYA 1JNHA 3DO3A 1LP9F 1ZKAA 1WWBX 3PL6B 3OQ3B 3NCJL 2D4DA 4RFOL 5F93C 5I30H 2YXFA 5F7WC 1QZ1A 2WZPD 5JLZA 2BVUA 3HNSH 3ESVF 4I18B 3CPLA 4BSWB 5D72H 4KXZI 2VWEE 4LPCA 4PRNA 1HDMB 2CLRA 2FDBP 2VERN 1FL3A 1ZGLP 3DVIA 4KTEH 3K4ZA 3QZWG 4HUNB 4X7SL 3O11B 4PBXA 1MRFL 3S35X 3GSNA 2R1XB 1CG9A 1OLLA 3DXAD 5TH2B 5HVFB 5DQDH 4ONFL 2VLRA 5IB1B 4PB9H 2C26A 4RNRB 4HXBL 4CU8A 1BFVH 2X4QB 1TJGL 2P49B 3MRHA 1WTGT 3ZTJH 5GGRB 1UVQA 3IS0X 1FVEB 2R0WH 4TYUA 4GQ9H 4KROD 5IMMA 4Y4HC 1LMKA 2DL9A 3IDJA 3MZTA 4K71B 1P7HL 4Z8FL 3SDCC 5CILH 5AYQA 1CICC 1R3KA 4XNUL 5F6IC 4MLSA 1MFEH 2AJVH 5DDHB 1J86A 1RUKL 5DMKA 2Q3AA 3E3QE 2LE9A 3FT4A 3KYNA 4M1CC 4Z7QE 3FOMA 1TTGA 1DP0A 2R2BB 4RIRA 4QRRE 2E6JA 2J8UB 1D5BA 5C9KA 1J0JA 4JREC 1MJ8H 1U92B 4IDJH 3OJDA 3MNVA 4NC0B 3TBSB 4XPTL 4X6FB 1OP9A 4K8RH 3VFOB 2DRUA 2YMXL 4IOIA 3O6FC 4HV8A 4IDLA 3UJIH 4PS4H 2BNRA 2W60B 2DLHA 3WE6B 1JYVA 1NCUA 3KPLA 4PLJC 4M3JA 5F7DA 4P23C 4JN1H 3KLHC 1DBJL 3DOSA 5SWSD 5HPMB 2XA8L 4PY8I 3T77A 1YC8A 2AEWA 4MJIB 1KCVH 2DQGH 4MYWB 4IIQA 5IB3B 4UUJA 4LHJB 2EXWC 3DYOA 4JFED 3B83A 5BMFL 4MDJB 4NWTL 5MEPB 3OF6D 1R3JB 2BC4B 3ZTNL 3I50H 5IB2B 1HILB 2M2DA 5FV2A 3RWJB 4U49A 3IU3B 5IJKC 2APFA 5HJ3B 1C7SA 1DJSA 4GQPH 1OP5K 2GJ6D 3VXSA 1XMWA 4PGDA 2Q6WB 1IEBB 5I74B 2ITDA 5DD5H 4WI8A 1OT1A 4NNYA 2PXYB 2YC1A 1KTDB 1X5XA 1MAML 1KNOB 3TPUA 3UYRL 1EFXB 4UOW0 3S3SA 5BS0B 2VDLL 5TE7H 3TZVC 4JY6B 1B90A 2ICEA 5C0DB 4JGMA 1F42A 1INQB 1VFBB 2C7UB 1NGPL 2LV4A 2VL5B 3O8XD 1SMOA 1JGLL 4S1DD 1JRHL 3W0WA 5CZXD 2OTWB 4MNQE 1R3HB 3I3EA 5C09A 2APXA 3RJQB 4PJIB 1JWUA 1QPXA 2A83A 4UDUB 4KVNL 3T0EB 5DTFB 1ADQL 1BFSA 1I8LA 4EIZC 4JZNB 2Z9TA 4P2OB 3ARWA 3ZT7A 5DEFB 1FNFA 3MJ9H 2Q8AL 5L0QB 3EYVA 1EA9C 5JNYB 4X4XB 4OZFB 1K3IA 2VISB 3HNVL 2Y72A 5F9DC 4OUOA 5ESQB 4PTUA 3TCLB 1U8HB 3FQNA 4P46C 5IJVA 1FPTL 2YD4A 1VA9A 3PIQB 3RX7A 1GSMA 4UV7H 5D1XD 3BP4B 4YHZH 3O6LL 5F7FA 4NP4H 3C8HA 1CGXA 3QBTB 1ZLSH 5DRNA 2F5BL 1WCBA 1F4XL 2DYPA 3O3BA 5IQ7L 4RRPA 5L9DH 3DXAB 3RY6A 2CGRH 1QRNA 3GM8A 3U0PB 4MZ3A 2CLZB 4F7PA 3TYFB 2IH3B 3MOAL 3GK8L 2ZCLL 3DYMA 5EU7C 1QA9A 3UP1A 2PR4L 2DQHL 3DBXA 1A4KA 1O7VA 4ZUVA 5EZLB 1BGXH 1I1AA 1UM4H 2BVYA 3DVGA 2ADFH 4HJGB 2VYRE 1KIRA 1UJ3C 2F54A 4JY4A 5LBSL 1IAKA 3TA3B 4EZMA 2HFEA 1E28B 5SX5H 5TDPA 3SQBA 4U33A 4L9LC 4XI5D 3EYUL 3LKRA 1KULA 4KUCF 5C0BD 2X4OA 4Y1AA 2BJML 5FYJH 5IB4A 3TT1H 1BM3L 1MCRA 4MJ6B 4RAVB 5JPNA 1JGDB 3B9VA 1KPRB 2Y5EA 3C5ZC 4YHPA 3MA9H 3O3AB 2N7AA 4P9HC 4WCYH 2VDML 5CINH 4MXVE 5F88A 3C6SB 2YD3A 1IQWL 1DVFA 1QLRB 1WWAX 3JWOL 5GGVL 4CMHC 4YDVA 4AM0B 2VSDA 3WDHA 4F15C 1QHOA 2VDPH 3EDDA 1TZGH 5CKGA 3PWLB 4PJEE 5T3XL 3PWJA 1JJUA 2J5LC 5E8EB 1GC1L 1N59B 4FHBD 5AUMB 3WNOA 1IEHA 3QFJD 2OS7A 1C1EH 5SWSB 3WIHL 5FYLD 3IRPX 2JJVA 3QIWA 2HH0H 3LEXA 1JNNL 5TQ0H 1YEIH 2PF6A 5ID0B 2YBRB 3BPLC 4PJHE 4JFEB 1U42A 3VXTA 2FGWL 1TQBC 4M6ML 5K33A 5BO1H 1F8TH 1QD0A 3O41A 3LKNB 1ZVHA 3RWGA 5GHWL 4JHWH 5T1LD 1BJ8A 3MNWB 3RKDD 1NFIB 1LE5A 3IDNB 4X5XA 2ZUXA 2GY5A 1W0YT 2GJ6B 5HGAB 5T5NG 3U1SH 1M7DB 3P73B 4OCRH 1T0NA 3C60C 2WUBH 5CJ8A 3KXFD 3WXVL 5DMGC 2O5ZL 3MUGB 4GUPA 4OCYL 2GHWB 3CC5B 3QAZC 3MRMB 3I6KA 4CN1A 3O3DB 3ES6B 5DJ8B 2OXHA 3P3YA 3O8XB 1CWVA 1MI5E 3BJLA 3MJGX 1NCDH 2V5YA 3BP5A 5JW4N 1D9KC 4U3HA 1HCVA 2ARJA 1Q8MA 1XR8B 4J3TA 5JO5B 4NO5B 4OV5B 1JK8A 8FABA 4CDGC 1WZ1L 2Y06L 3IT8D 5J8OA 1DN0A 2NNAA 4I3RL 4XC3L 1HEZA 4A6YB 2W65B 3F7VB 4WTZG 4HIJA 1TTUA 3CLFL 4FQCL 2E9IA 3IXTB 4KDVA 3ZE0E 1S7SB 3BAEH 3PWPD 3CVHH 3QXAB 1EVTC 1E4XL 2YPKA 4NQDA 5MI0B 5KW9L 4W6YB 3WFDL 3U82B 4ZUSA 4HFUL 1YPZB 4H0GA 1QSZA 1CDYA 5EZJB 3B2UC 5I76B 5D1XB 1UA6H 2HVJB 3ARXA 3MV9A 1J1PH 3UPAA 1LP9E 2DICA 3D6GA 2R4SL 3M17B 4JFDD 3V6OA 4N8VG 4G9FA 5FEBA 3ZSTA 4R9HA 2NY4C 2LU4A 3ULUD 1P1ZB 5ESAA 3U7WH 3NN8A 1QKZL 4NJAL 2C1PA 3OJ2C 4ZFOA 4M43L 5MEND 3U2SB 1T0MA 3GJFA 3GSXB 1MCPH 4I48A 3U7YL 1A21A 5M95B 5LKNA 2WAHA 1AO7A 1E6JL 3G04B 3RJDA 3LVEA 4HXAL 1S7RB 5J12B 5HVGB 4MVBC 3OL2A 1ORSB 3OMZA 3G5XB 2B2XH 4JO4L 4LAJH 4ZDHA 5C86A 2CK0L 3R0NA 4X6CB 4D8PA 1F4WH 4JQVA 1F58L 4HUXB 4MHHG 2DMBA 2ZKHH 3DETD 1EO5A 4L8CA 3IDGA 1ZT1A 1S7XA 1GGYA 3QIUD 3RTQA 1QLFB 3GMNA 1VGKA 1A6VH 1K4CB 4HWEL 3T1FA 4FG6D 4CJ0A 1LO3H 3W2DH 2GK0B 1G9NC 1C5DB 1RZIB 4Y19B 3AROA 4PJXB 4HFWA 4XRCA 9CGTA 2IAMC 3KDMA 1MCIA 1U8LB 4QXTA 1OAZL 3QFJB 1AQDB 4LCWD 4JRYE 4KQ3H 5K9QI 4NQXA 3BDXA 1JHKH 5EN2A 1P4IL 1MCWW 1TTFA 4U1HA 5DMJB 3ZDXF 2QHLA 3TO4B 1FGNH 3BN3B 3RWDA 4JFPB 1JI2A 2A9MH 3LKQB 2AEQH 5E5MA 3T3PF 1G7HB 3CH8A 3KHOA 3MREB 5DD6A 3PABB 4LLDB 1LNUA 3TIEB 5MEQB 2X4NA 3RNKA 4ONHB 4B7LA 2JELH 2YD5A 5T1LB 1RUMH 2BOBA 3D3VE 3DRQB 4N90E 4NHCH 4IHOA 4MA3A 5IFJA 3LS4H 1FNAA 2DM4A 2YK1H 1K8DB 1HQRB 4NRZB 4OJFL 1VEMA 2XQBH 1BBDL 3ULVC 4ZPVB 1QHPA 3U6RB 3P4OA 4YDIH 1MEXL 4LSVL 3CXHJ 4UIKL 4AEHH 4GW1A 4A6YL 1TQCB 4NM4H 5J6HA 3BEVA 1JGUL 4WV1A 4CMMA 3VI3F 4ZFZA 3BKYL 5JXAL 1FV1A 4KMTH 4OZHE 5A2JH 5KSBA 3VRIA 2PTVA 5I9QB 1EMTL 1HYSD 2COQA 4DN3H 1FNLA 5IFAL 3D39A 4JO3L 4FFYL 4K7PX 2HT2C 1G7IA 5AYUH 4PLOB 1MAJA 4ZTPL 1IM9B 2N56A 2ITCB 2NZIA 4F37F 1RIUL 5HGDB 1YMMD 3SBWC 3P4MA 3QT2A 4HEPG 3ARDD 5T1KA 3HE7D 1X44A 2QBWA 4YC2B 4LCIL 5D7IB 3S37L 4WTWA 4Y4KD 1TFHA 3OKNB 5EO9A 1RUQL 2IALB 5HI3C 3VWKA 5J6GA 4XX1G 3BIAX 4L4TE 2NY7H 1YEFL 5EOQL 1JN6A 4L29A 4YWGH 3HR6A 3GM0A 3VD9A 1A9BB 1N7MH 1W0WB 2WLYA 3AS0A 4KHTH 2PNDA 3QEHB 5C6PB 5JMRA 2Z4QB 1ZEAL 4LLYA 5CWSB 1UJTA 2BRRH 3EYOA 3L3GA 4FTVA 2E9BA 1FORH 4KQ4L 3QDAA 5TQ2H 3V8OA 1ZE3C 1B0RA 2G5BA 1A1MA 4FFVC 4BK5A 5IKCB 5DJYB 4NM8H 4U6XA 4PRBA 3E6HA 5C2BL 5MENB 1I85A 5DO2C 3MLTA 4LSDA 5IV2A 1W72H 4GOSA 3BIBX 3L1OH 3NPSB 1ADQA 4PJCB 4L3EA 3MO1B 4CN6A 4Z77A 3SDDA 1E4JA 1DFBH 3S97C 1NQBA 4HS8L 1TVDA 1UYWH 1X4YA 5JPMA 4EXPX 4XTRC 2KUTA 4NN7C 5FM8A 2BNQB 2DJSA 2DKMA 2B4CC 4MD5A 1FVDA 1LGVA 3VFTB 1VKXB 2QJDA 1E0OB 4PLNC 5FYKH 1UENA 3Q5YA 4Z7NF 4P2QE 4Q9BA 2VC2H 5EU3A 3AFLA 1LEIA 1T89C 3WJLC 3KNBA 5EU4A 3KPOA 2YA1A 3IDIB 3NFSL 5DEZA 5L2KA 1LK3H 3IRZA 3I6LE 5D1ZD 4LCWB 1KGCD 3QEQA 5ICZB 1QO3B 1P4LB 1PBYA 2Q7YA 5DSCB 4NQEA 2VKWA 5DK3A 1I3RA 4QY8B 5SX4H 3UTPE 2YS4A 2OL3B 4DGVH 4ZD3H 4FQXB 4D9LH 1KTLA 1U92A 1FFNB 5HI5C 5C0CE 2NY0B 5A2LH 3NIFE 4NQSB 5HDQH 1AGFA 4GKSA 1JE6A 2VZ1A 4JKMA 3GHBH 1FL6B 3T2OA 4L3CB 2IADA 4GAJH 2CR3A 3WE6A 2EDQA 2D7OA 1RMFH 2ICWI 3NACH 4F58H 3QPXH 1A7OH 2XOTA 5HPMA 5F9JA 4LCUB 3O0RL 5BW7C 5JUEH 3QQ4A 5C8JB 4MCZB 1MREL 2BSRB 4QCIB 2JJTC 3UJJL 5CEZH 2UUDK 3MUY1 1X5HA 4LRIC 3IJYB 4K23H 4EN3C 3EFFA 1EV2E 3MLXH 1Q9LB 3MLSL 2LVEA 5MEPA 1ZK9A 2BC4A 1XT5A 3TP4A 5IB2A 4NZJA 1X7QA 3V7MA 2BY2A 1ZSDA 4C56B 2NX5A 5TPWL 3M1BA 3WIHA 1U95B 3L3IB 1NFKA 3S5LA 5EUOA 2FRGP 1CE6A 3BRFA 2Q6WA 3NMEA 1JNLL 4Z7WB 1C5BH 2AEPL 5C08A 3LPGA 4QRTB 1YMMB 5I1JH 3BSZH 3FONB 4U1IB 3NA9H 4GW5A 3HE7B 4YFLF 4RDQF 1U8NA 5HHVH 5ENWB 4JFZL 4PGBA 3W9DA 3SGJA 4XCFL 3T0DA 4Y4KB 2QQNL 4D9RE 1IAIM 1RJLB 3VWJC 2OTWA 1U2HA 4O51A 5CJOL 5DD3H 1NC4D 3DURA 2V7NA 4HIIB 5KJRL 2FR4A 5ISZE 3QNZB 1F4YL 1A9EA 4XP9H 3CFDB 4ZAKD 4D94A 4FXGA 4UDUA 3VRLF 5ILTH 1RJCA 1KN2L 5FV1L 5F7NC 2PO6C 5T5FL 2C3XA 4PJ8C 1GOGA 1QVOB 4F7EA 4P2OA 2PXYC 4H1LB 2FJFA 5DF0A 1T4KA 35C8L 4OFIA 5EORH 1Y6MR 1JWMA 2P8LA 3MBEC 2A6JB 1BWWA 4X4XA 4TVPL 4POYA 5I75C 4BQ6A 4FNLH 1QBLL 5GS0H 2VISA 4XVJL 4XPFH 2CLVB 1AGBA 1S7TB 4U7MA 1MQ8A 4XCCH 5DRXB 1UZ8A 4OKVB 4XAKE 3LEVH 4EBQH 4MB5A 4GW4A 4PD4J 3RPIA 3T0EC 4YDKH 3MJ8A 3BRDA 3EHBD 3UDWA 4OLZL 3RWHB 5JOFB 2J2ZA 2VSCA 3K8LA 5E95B 2I07A 1XF4B 2VO5A 3DX9A 2OL3L 3GUTB 3C09C 1E4KA 5CIPH 1QG3A 1UB6B 2VLRE 3AS2A 4UB0L 3TA3A 5CLTA 3UXFA 3PHOB 3TCXA 3A6CH 5GZND 4HDIA 4QEGA 5IFHH 3O2DH 5MERA 1FFQA 5D1ZB 2AJUL 3IAQA 4JO1L 3T2NL 1BJ1H 3I75A 4YEFA 5BVPH 1F4HA 2F53D 4GXVH 2I9LB 5EZIL 1T03H 3QI9D 3F7YA 1EX0A 4NO3A 3ESUF 3MRIB 5C9JB 4F9PA 4NRYB 4HWZA 4S1QL 2R0ZH 1VFAB 3RX8A 3N06B 3CK0H 4OQTH 3WJJA 4AM0A 4KROC 1NEZG 3X13A 1GYAA 4NDMA 1BFOB 3PWLA 5DLMH 4BQBA 5I1HH 5K9OB 1G6RA 1TIUA 2C1OB 1ZTXH 1FO0A 3ZDXE 4Y0GA 4E41A 1GIGH 4NFBA 4TPRL 1TENA 4Y5XB 1WEJH 4JGUA 1L6ZA 1SBSH 3EOYG 5J89A 4MAYD 2XPGB 5E8PA 2YD2A 4TNVF 3Q48A 4PGCA 5E2WL 3RWFA 4XBEH 3U46B 1UWXH 2BNRE 2YUZA 4WW2F 2OBGA 5TE6L 4DEPB 3ZTJG 1IKNA 4LVHC 4PRDB 4X83A 3WD5L 3DUUA 5KSAA 3IFPB 3TBTA 4J6RH 4I2XB 4FOMA 5E9DB 3QFDA 3TWCH 3P9LB 3MNWA 5B38A 3IDNA 3MBXL 4IMLA 3VXNB 4ZXBC 3UTSE 2FHBA 1S9WA 3OKDB 3P73A 4UIMA 3VI3E 2E6QA 1INEL 4YAQB 1S7UB 3F58H 2EDWA 4KRLB 4EQ3A 2F15A 2DM7A 3X3GL 1JBJA 3WFBL 3CC5A 1P84J 1YN7A 2X9XA 2VXSL 2VLKA 4F7TB 1E6OL 1U8JB 1N8ZB 1PJ9A 4N0UA 5SX4I 4A2LA 2EEBA 3QDGD 3ES6A 4BH8B 1NGZB 3VXSE 4GG6E 3PUCA 1MIEH 5KBNC 1QFUH 3MYJB 4Z7VB 4PJBA 4PLKD 3QHZH 1NC4B 5FOJA 1FNEA 3LQZA 1XR8A 1K4DB 4ZAKB 4MMZC 1YUHB 4KMQA 1SHMA 4NO5A 4OV5A 4PBWD 4ERSL 4J4PA 4K7FA 3BUYB 4JAMB 4DGYH 4WDIA 3RGHA 4H88H 5H37H 4H20H 5DHYA 1RZJC 2X4UB 4A6YA 4NKIL 4S1SL 3W0WE 5D93C 2W65A 2Y4SA 1XF5B 2R1YB 2R0KL 5E1HB 5EWIH 3J7HA 1RZ7L 4U1MB 2VUYA 4E5XA 4Z0XB 2IC2A 1MVUB 4ODVH 1C12B 1HHJB 1L0QA 2RFXA 4S1DC 4PRIA 2HWZH 2HKHH 3JV6A 5DGRA 5CZXC 1DQJA 2GITB 2HAZA 1CFSB 3SY0B 2AI0H 2R2HB 3MRGA 4M8QB 4I3SL 2D7MA 1BREA 1WFNA 4FQJL 4TUKL 2I9TB 3P11L 4R26H 5EZOL 1Z9MA 3U83A 1U6AL 4KTDL 2H32B 3O6KH 4JJ5B 4ZOBA 3B2VH 5ACZB 3C9NA 3NGBB 1KXQE 3EOTL 2FLBT 3LKSA 2CO7B 2DQIH 4JY5L 3TC9A 2CRMA 1EAPA 4LSSH 4LFHG 3D85A 3TYGL 5FUOL 4M6NH 4JO2L 1IGYB 4YHKH 2D03H 3GJFK 2X4SB 4Y2DD 1HH9A 2ZPKH 4ZQKB 4LSQL 3INUL 5MI0C 3R1GL 1JVKA 1QRNE 1YY8A 3QDJD 3UBXA 4TULL 3X3FH 5F1OB 4A2MA 2PN5A 1CLCA 3CMGA 5D1XC 4DTGL 4QRUA 4WEUD 5TE4H 3MRFB 5LJYH 3TT3L 4PUBH 5C0IB 2N7BA 2KBGA 1CGSH 3QI9B 4WGWB 4Z7NE 3BQUD 4M8VA 1KB9K 1F13A 4JFHD 2O5YH 5EDXA 4RGNE 1V7MH 1HINH 4F9LC 1K4CA 1OVZA 3PQYD 2Q7NA 2GK0A 3UZVB 3OXRA 4Y1AE 2A9NL 4HUVB 1CGTA 4M7JL 3LZFL 4M6OH 4Y4FA 1EZVY 1R24B 1OPGH 4XP4H 1DE4B 4UU9B 3VFGL 3HTLX 1YJDH 1DDHB 1MHHB 2QR0B 1S3KL 4XI5C 5J1AB 1Y0LB 4LHUA 1CCZA 2D2OA 4LARH 3DSFH 4G42B 1PZ5B 2MCPH 2X1WL 3LEYL 3S8WA 3ZKND 2ICWJ 4TNVK 5DD1L 3TO4A 2FEEL 5C0JB 3GRWL 2A74A 4OB5L 5DI8B 5EOCL 1D5XB 1NUDA 3QEUA 3SDAD 3DV4A 4U6HB 4XCNB 5SWQA 2X1XR 2VXQH 2X89A 4OZIF 3D0VB 3ROLA 3E8UL 4ZO6A 5ERWA 4XCEB 3S34H 3DROB 4ZSOB 3TBYB 3CFKB 1S9YB 3QCTH 3O2WH 1IC7H 3EOBA 1DQDL 4GBXB 1HQRA 2VXUL 3TFKD 3CFCL 3V0AC 2EYTA 3U6RA 3IU4L 3BKML 4NUJB 3MFFA 3QDGB 3A6BL 2P45B 1H15A 1OAYH 4M4RA 1ZA6A 1YQVH 4NOFA 1I1YB 2RCSH 5GQBA 1SY6L 2BVQB 1HKLH 1OARL 3FFDB 1OOAA 4Q9RL 4XVUD 3RKDC 5ITBH 4N0YH 5EUOF 4HZAA 2X9YA 1UH3A 1V7NL 4PJ5D 4F7MB 1JGEA 1F90H 3L3DA 3Q5OA 5AG8A 2RBLA 3TNNB 1IM9A 4BQ8A 4XT1C 1ACZA 2ITCA 3RX5A 5CUSH 1SM3L 4GLRH 1G6VK 4K7PL 5HGDA 3FB6A 1NCCH 2UYLB 3BPNC 4ELKA 5DVLA 4P49A 1I9RH 2ZNWA 3IFLH 3U7AA 5D7IA 3S4SA 1IL1A 4F57L 4GSDL 1HSAB 4HQQL 1RFDH 3IDXH 3VRLE 2JIXA 4JM2D 1AD9A 2H2PC 4R96B 5BRZD 2PTUA 4GMSL 4DZ8B 4Z76A 3SPVB 2P5WA 3UTZB 1XEDA 2P8MB 3HC3L 2YRLA 3IJHA 3UMTA 1SVCP 4NQDE 4UV4L 2BMKA 1NMCB 2H26B 5GZOD 3H7BA 4UINL 4QRSA 4WHTA 5FCUL 3MV9E 5E8NA 1UZ6E 4JG0L 5I71C 4Y2DB 2PYEB 4HGWB 2XRAH 1H8OA 1A8JH 2H2SD 3V6OE 4QT5B 4G9FE 4KJWD 2NW2B 1CK0L 4ORGB 1RZKC 3LKPB 2FO1A 4OCWH 3MMEA 4MA8H 3HG1A 3TZVA 3IDMB 3N9GL 5E2UH 3ARBA 2X40A 1NCAL 4LP5A 5E4EB 2BNQA 1UKTA 2DF3A 2F5AL 3BQUB 4OI7A 3F6IA 4KRMB 3NH7L 4OGZA 1AO7E 3ULUC 1YEGL 4G5ZH 5HGHA 4KJYA 4KZEL 1CFVL 3L3OA 3FO0H 3PQYB 4HCRH 1KLUB 4FFWC 4QXUL 2ZUVA 1K2DA 1BZ7B 1NPUA 4Z9KB 4U1NB 5GS2H 1NKRA 2E7BA 1N26A 1N5YL 1AGCB 3UJTL 4AEEA 3HUJA 3MRLA 1BZ9A 3IDYB 3T0XA 4LU5H 5FKAB 1RUAL 2NY5C 3ROOB 5FA4B 5ICZA 1QO3A 1NMAL 5DHVB 5I2IB 2O61B 1S7WA 2VXVH 5EB9A 4WTXA 4DKFL 4QY8A 4WEBL 4ZPTB 3BWAA 4LF3A 5TGBB 3IFNL 4P46A 1LEKA 2OL3A 1S7VA 4HT1L 4M3KB 3W9EA 4FQXA 3BHBA 4X8JB 3VRJB 3QIUC 1ZHLA 1RIVH 4H5SB 2BHUA 3K46A 2OQJA 3SDAB 4WO4D 5FO7B 3TN0D 1KBGL 4M7KH 1U8QB 3CFEB 4FG6C 2IBZX 4YHML 5CP3H 1EEYA 4TVSa 4XVSL 4L3CA 3KYKH 4H0HB 2RHEA 4U6VL 5D9SB 5EIIA 5EIVA 1DQTA 2EH8L 1AY1L 2PYFB 5K59F 5FGCB 1BOYA 5F9OH 1CBVL 2XXCB 5F72S 1VGEH 4QHNA 3MRCA 5GGTH 3CUPB 5DZOA 4JR9L 3N1GC 4QRRD 5ADPL 5C8JA 1Z9OA 4GRLA 1HXMB 4QCIA 3QXWA 1B9ZA 2UUDH 5DFVC 1Q9LA 1SYSA 2R0LL 5E7BA 1QQDB 1RJYA 3MROB 3C2SA 4Q6IB 1LEGB 1CFNB 1FSKB 3DGCR 2WBJB 4C56A 5DJZA 5IW1B 1B0WA 3ELAT 1U95A 2EIZB 3K0WA 1EEZB 4PJ5B 3C5ZA 3FOLA 5FHAH 4JZJC 4N0RA 4XNZC 3F65A 3K2UH 3QDMB 5HDOA 3GBMH 3AS1A 1A6WL 1CXFA 2FX7L 5KSBE 1CGWA 4C59B 1IAIH 3TESA 2OZ4A 5ENWA 4K3JL 5D8JH 3F12A 4BUGA 4LL9A 3HB3D 3BKCH 3D39E 5HY9B 4JM2B 3N1QC 4PJ9C 5GSVB 4X4MA 5BRZB 4PJBF 5F9AC 4D2NA 1HHIA 4FQHA 3LS5H 4Y88A 1WBXB 3HZYA 5ALCL 2FATH 4POUB 5JIIA 5FO9B 1UWGL 4B50A 1IC4L 5GRZA 4RZCA 4G8EB 3ARDC 5IVXE 5EFIA 1EHAA 1YQ2A 3HE7C 3HR5A 3QB7C 4MDIA 5CZKA 2FYYB 4Y4KC 5DJCA 2MOVA 4MNHA 3VG9C 2OTPA 3DHJA 4OLUL 4AYFA 4MNQD 1S7TA 4FTVE 4M5YL 1FFRA 3CGTA 1MOEA 3D9AL 5KOMC 3SE9H 5CEXA 1KB5L 4CAGA 2X4PB 4KJPD 3MQIA 3PP4H 2ZOLA 3S88L 4HH9A 4AENB 5I8KL 4Y16A 5HYQA 4J3OC 1NDMA 4XH2A 5M7QA 1RU9H 3HMXL 4HHAA 4LSPL 1U8PB 3V5KA 1NC2D 1RD6A 4U6YB 1QPPA 1NAMH 5HYIA 1CD0A 1YEJH 2AXJA 2OMNA 2X2YA 4O58H 4L3EE 3RUGA 4P9HH 4GLRI 3VFUB 1IM3B 2F58H 3U48A 2G5RA 2ICES 3ZDZE 5IUSA 4UT7H 4CDHA 3HPJB 2ZG2A 3CMOH 4DVRL 1DCLA 1WC7B 1Z5LA 4X80H 1M4KA 1CVSC 1F6AA 4CU6A 32C2B 2EKJA 3HZKA 3P4NB 1NL0L 1OB1A 4RCAA 2Z92B 3GI9L 1OSPL 4XPGL 2ZCHH 15C8H 2N1KA 3I84A 3GEWB 2A73A 4HBCL 2NLJA 1I4FA 1TCRB 3EYFB 4H26B 2XWJA 3OKOA 4J1UB 2FB4H 4FQLH 3RVVD 3BP7A 4P5TB 4YNYB 5C9JA 5M94B 3TN0B 1VFAA 2VR9A 2H8PB 3HZMB 3QEQE 4OFDA 3BRGC 5I1LA 4EUPA 4PR5B 3PDOB 3ZE1F 4QOKD 1E4WH 4K9EL 2NYYD 3OR7A 4ZNEA 1AXSB 2C1OA 3FO1A 4ZO7A 1A6ZA 4MQXD 4XNMB 3WDJA 2P4AB 1HI6B 4OM0L 3MCLH 1A2YA 2EECA 5I66A 3MACH 3Q6GL 2CMRH 5L6YL 4QRRB 3P4LA 2EDTA 3ETBF 1IT9L 3L3JB 3U46A 1OSZB 2VKXA 1OAXH 4YHOH 5C0GA 1I9JH 4XPHH 3JSSA 5F1NA 2CRZA 4PRDA 2GTZA 1NGQH 2Q86B 4JCLA 4ZOEA 1IKFH 5CD5D 2ZUYA 3K4DA 5E08H 3GJEA 5LCVL 1F97A 4I2XA 4LQFH 1NFDA 4O00A 2VE6A 5E9DA 1JV5B 1YZZA 1GCFA 4OUUB 3ZKMD 3VFWB 3AAZB 2VXTH 5EU5B 1DEEB 2YRZA 3X12A 4RFEA 4Q6YA 5T3XE 3VE0A 2AV7B 4Y5XC 3VH8B 1KCSL 2VOTA 3GRWA 1R5WA 4LK4A 3WFEL 1HSBA 5TJWK 2HJLA 4Y8AA 4OZGF 1LO0H 1U58B 1NCBL 2BNUA 1N8ZA 3PNWB 4L4JA 4CNIA 2IAMA 3RA7L 3HAEA 1NGZA 5EUOE 3FN0H 4HK0B 5C08E 4L8DB 5FECB 3WN5B 1TNMA 4F80A 4EI5B 3GHEL 5KSUA 1K4DA 2GY7B 4KAQL 1B2WL 4NGHH 3BO8A 2NXYD 4MZ2A 4OD1H 1G7PB 5J0BA 1ONQA 4MX7B 1L6XA 4HPOH 4G9DA 1G0XA 4LVNC 2EZ0D 3VXQB 4LPVA 5FUCE 2R1YA 2PW1A 4PV8A 3AMKA 5CBAB 4PJIE 4JFXA 5DUMH 4DQOH 1SY6A 1MI5D 1HHJA 3OGOE 1P9MC 4UT9L 5DK0A 5GS3A 4MNQB 3KPRA 4NPYA 3QP3A 4KKAD 1T21A 3EJYD 4H8WL 3FRUB 2MHAA 1JF1A 4HUUA 2Q76B 5GS1B 1GGIH 4IRJC 1ZLWK 1FZMB 1F6LL 4K3EH 5B21A 1Q9WA 2AGJL 3MYZA 4JJ5A 4X98A 2OI9C 4WI2A 5LAXA 1MFAL 2YSSB 1NC2B 3L5WB 4I77H 1ETZB 3KPNB 1YNLL 3T2PA 1ORQA 4OGYH 5FFLA 3J8F7 1XCQA 2NY6D 2FL5B 3BVNA 2E9WA 2VDKH 3QWOB 5KSVA 1J87A 2R2EB 1JZ3A 1HXYA 4P4KB 4TN9A 1HHKB 2E7LA 2H6PA 3SBWA 1RURH 1KJ2B 1TDQA 3IFOA 4LEXH 1CDBA 3QXUA 4PJ7B 2CSPA 4RISL 4QGTA 4BK4A 3EHBC 3NCJH 1W0VA 4RFOH 1P7KB 2OX5A 1BF2A 1LDPL 5F1IB 5F8RC 1MNUL 3OXSB 2R69L 3V4PL 4WUKH 5J1SC 4X7SH 4RWYL 2XYCA 4P5MB 3NZ8B 3VXRA 1MRFH 4QOKB 4N0FB 4P59L 4U0QB 1FGVH 2R1WB 4GMTL 1R24A 1ZXQA 3CU1A 2XWTA 4ONFH 3UYOD 4DOHE 5CZVL 2YUXA 5DYOA 5J1AA 4LSUL 5DWUL 2C3VB 4PJGB 1C16A 4HXBH 3U9PL 1EJ6A 4EXKA 4U31A 3ULVH 4HX1A 3RBGA 1TJGH 3GMLB 4GKZB 4KDTC 2FH8A 4UZGA 1A6TA 1SMAA 1CFBA 1CLYH 2W59A 3WIFA 3G6JF 3F7RA 3X11B 5I1GH 5DI8A 1L7TH 5D1QD 5T3ZL 2IH1B 1PAMA 4Z8FH 4E41E 5HPOA 3BH9A 4XNUH 4TTGA 5IP4A 3LPWA 1U0QA 4LNRB 4YXLH 1AE6L 1CU4L 3HE6D 5KS9F 1AGEB 4XCEA 2DBLH 3B9EA 1CL7I 3TBYA 1S9YA 1NH6A 3WMSA 4JRYD 43CAA 4GBXA 3GSOA 5FB8A 3AS3A 3BXNA 1Q9OB 3IAPA 3R06A 5BJTB 1UKQA 4OD3L 3LN5B 3NAAL 4MAYC 2W1NA 1YDPA 2R9HD 2NY2D 4KKCC 4EEEA 1IGFL 4OFPA 2H9GA 3R8QA 4N0CD 2PUQT 2VZUA 1I1YA 1XFPA 2E7HA 5HGBB 3EYSL 3GI8L 3D3VD 4N90D 3UC0L 1B88A 1YNKH 2RAMA 3JTTA 2QSVA 5GISL 3VGGA 2E9JA 2WV3A 3WEXA 1Y18A 2NXYB 4Y5VB 2J7LA 2Y1VA 2QSQA 3WUWG 1P2CB 1R5IB 4PV9B 3TNNA 5DJXA 2CKBH 2HKFL 3B9DA 3G9AB 4ONGL 3U9UA 2XNAB 4J3WA 4K8RC 1FBIL 3QQNA 4PJBE 1MQKL 4NWTH 1XGTB 3DUSB 3PGDA 3QNXB 5CMAA 5BZWA 1B4RA 5A1AA 1ZT4B 3SJVA 1HIML 3R0MA 2MQCA 2P7TB 3UTZA 4ODUB 3U79A 4YGVB 4YHYC 3UTQB 1KIPB 3GIVB 1R3LB 2Z35B 2AAVA 4XNXH 1MHCA 3MNZB 2Y7QA 1MAMH 3RZCD 3UYRH 4LRIA 4EN3A 3IETA 4FXLA 3RAJL 4PRIE 2B4CH 2H26A 1D5MB 1NGPH 1YPZE 1Q0XH 1AHWB 3V7AE 1K5NB 1TPXB 1PKOA 1JRHH 2I60L 5C0FA 1ZGLB 3WSQL 2BVOB 2G60L 3EUUA 5HVHB 4K94L 5DMIH 4L4TD 3RKPA 1JFQL 3MPCA 3F5WB 4WJ5A 4ORGA 5CSGA 5F3BB 4ZUUB 2QSCL 3HRZB 3LKPA 2FZ3B 1LP9B 3EAKA 4XBGB 5FYJU 4ZFFB 3VMPA 2Q8BH 3OJVC 4RQQA 4NYLA 3FB8B 5AEAA 2Q8AH 3JWDL 5H37G 3W39A 2A38A 3UYPA 3L95B 3FTGB 4DKEH 1QSFA 4ELMA 4OD2A 3P30H 2ZSVA 5JR1L 3RUGF 5F97E 5DRZB 1NMCC 5LQBL 2Z31D 1RK0B 1DBBL 1BEYH 5HD8C 3T4AA 2ARWA 1FPTH 2V5MA 1CR9H 2EDEA 3MGTB 4L5FL 1KLUA 1KB5A 4JKPL 3O6LH 5CSZA 3MXVH 3K74B 4PJ8A 4M6AA 3T4YB 4JHAH 2YRPA 2F5BH 4FQ1L 1A1NA 3HMXA 1H5BA 1MJUL 5HHXL 1G7LA 3MBEA 3ROOA 1LO5B 1F3JA 1FZKA 5DQ9B 2FHCA 3KYMA 2GTWB 3MOAH 5ANMA 4ETQB 3MZGB 4OT1L 2PR4H 3QH3A 3QCVL 5TGBA 4Y19E 4AL8L 1IGTA 1KG0B 3QUZC 3V4VL 3VXOB 4H5SA 2C3HA 3VFPB 4X8XA 2QADC 1NMBL 4K3DL 4KUCD 1RZ8A 3C5SB 1X5IA 4I9WE 3HE6B 2AKRB 3EYUH 1EEUA 1VENA 4QHMA 5FXCH 5D9SA 4J3XA 2EDKA 1WIUA 2IBBA 4P9ML 3I6LD 1T20A 2BJMH 1QLEL 3ISWA 4JDVB 4JRYB 1JTPA 3QZWA 5FHBH 1V3LA 4TSAL 1VFMA 1NBZA 2M26A 1OF2B 3UTPD 3LRSA 1GHFH 2WMPA 4M62H 4LDLB 5B39B 4PG2C 2W0PA 2A1WH 2EDHA 2NY2B 3JWOH 4JCMA 5GGVH 1G0YR 2YN5A 4KY1H 3PV6B 3V0WH 5C0CD 1S8DA 1G7JA 3H0TA 4LPWA 5ETUB 4HIEB 4JFYB 5T3XH 1QQDA 3SDAC 2ZOKA 3E1F1 1LEGA 5JW5B 1GC1H 1XH3A 1RULH 3MLZH 1PKQB 3QIBB 2WBJA 3GSQB 4YBLB 4DKAA 3D3VB 3ALWA 5F71A 1M71B 3RGVC 1GPOH 3QUYC 4MA1B 1EJOL 1VFOA 3S96B 4RMWA 4R90H 1KIQA 1X5FA 3WL9B 3GKWL 2WW8A 2CDGB 4OTXL 3QDMA 3TFKC 1BQLH 3NCBB 4OLXL 3UZEA 5D5MF 1WBZB 3DVFA 4R0LB 4YDJA 3TV3L 4KV5E 4LLUA 1E27B 4Y89A 4WY7H 5GHWH 5GSVA 5JHLL 4KGLA 2NW3B 4LGRB 4DFIA 4I0PD 3VFVB 4Q6IC 2BSTB 3PHQA 4IM8A 5D7JD 5H35A 1EO8L 3FQTA 4R97C 1S5IL 4WU5B 4LRNL 4XVUC 1WFUA 5D7IE 5JQ6L 3IB4A 5EA0L 4G6JL 1T83C 3EO1B 4DN4H 1PGRB 2W9EL 3D18A 4OI8A 5HHPB 5HHQB 2NY3D 2P5WE 2DLEA 4D9RD 2DJUA 1MCQA 1MHEB 4OZFH 2FYYA 4JB9L 4OF5A 4OBRA 4Q2ZB 4ZXBA 1D3CA 3DUHA 1EUUA 4JM2C 4NN5B 5DJAA 4XPBL 5ISZD 1A5FL 1CFTA 4U0RB 1FH5L 3ULVF 4U1LA 3SKMA 1R0AL 3OR6B 4I3RH 4APQC 4XC3H 2EXYD 3L7FB 3JV0A 3PGCA 4LCCB 4AENA 2DAVA 3CLFH 1BBJB 4FQCH 2GAZB 4U3CA 1YEHH 5BV7L 4U6YA 4H25A 4PJCE 2A77L 2Z31B 1E4XH 3IKCB 3CDGB 3VFRA 5HI4C 4NO0D 1NGYB 5DS8A 5DT1L 1PEZA 1I7RA 4NRXB 4XC1L 1OM3L 1T2JA 5FOBB 4KJWC 4WFEE 4OFYD 4TVPE 1JZ4A 2BNQE 4XAKD 1N6QL 3S36X 3B6SB 3ZKXC 1ERNA 4LIQH 43C9A 1T2XA 4ODHL 4WENB 4KI5C 3O4LA 4O2EB 4NJAH 5I1DB 1FG2B 2EYRB 4YXKL 3WLBB 2GSGB 5IBUG 4G6ML 5JW4Q 4QRPA 1ZLUK 3U7YH 3HUJE 4XGZB 3Q3GA 1ZLVK 1E6JH 4QHLA 4HXAH 5C0RL 2VWEC 1JRHI 5HHNA 1VADA 2VLRD 3BYYA 3X17A 3CFBB 4B7IA 5I18L 2ESVA 3MLYL 4JO4H 4PR5A 3V5DB 1CN4A 2W0LA 1OTTD 1MCJA 1M6OB 2GCYB 3MRJB 3SOBH 3SDXA 1FFPB 3HI6L 2G75A 4YGAB 2LTQB 1HI6A 3BDBA 2L7UA 3CZFA 3QEGL 1I9EA 5J06A 2O5XH 3GO1L 4XP6L 3ZDYF 2AV1B 1FHGA 2FIKB 3QHTC 1MWAL 4HWEH 2XZAL 4QLRA 4MSWB 5C0CB 1FC1A 3LHPL 4NCC1 4NWUL 3BH8B 5IBTL 3TN0C 2EDYA 4WO4C 3B9AA 3VG0H 3VDBA 2FJGA 2HRPH 2KQMA 4MCYA 4YH6A 1OAZH 3U4BH 4ZOAA 2JJWA 3FZUD 1R6VA 1LVEA 4JM4H 5HYJB 3VFWA 4KI1A 3FT2B 1P7QB 5GGSY 1P4IH 1DEEA 1IRAY 1CDJA 1RZJH 4HD9A 3E3QC 2J6EL 3RVWC 1HYRC 1LHZA 4C56E 2BNRD 3NCYS 1MAKA 3PNWA 3IYLW 4F3FA 1WIPA 4FXKB 5L88L 1JYWA 4LVOB 5GGUA 1J10A 3T65B 2FWOB 4I0PB 1MJJB 2NQCA 5D7JB 5J11B 1QBBA 1YMME 3QJFB 4GAYA 1WWWX 1LE9B 3QNYB 4LLWA 3I9GL 3VGBA 2UZXB 1BBDH 1UXWA 1NBYA 1IEAA 3GIZH 4XNQB 2VAAB 5C3TA 1FAIL 4XAWL 3P0VH 3BPCA 4LSVH 4X4ME 1JGUH 3TBWB 3BKYH 2NY3B 2WK2A 5DJ2A 4G80A 5JXAH 2WLZA 3OAYH 3MGOB 3VXSD 4L8SB 2ZJSL 1I7ZB 4JFOA 5IEKA 3RFZC 1FN4B 5IFAH 1HK6A 4OLEA 5H94B 4RAHA 4JO3H 4FFYH 3F7PC 5F96L 5ISZB 3WN5C 5C0AA 4M4PA 3HNTL 4NNPH 3OHXA 4LGPB 5D2NC 4F33B 4RX4A 3ME0A 3MJ6A 4ZO8A 3EKCA 3RWCB 1GRWA 3W0WD 4LCIH 1YYMH 1PSKL 3KYOA 3C6LC 4ISVA 5C09D 1RUQH 4N9OB 5FYKU 2Y23A 2Z93B 3DI3B 3OKLB 3I85A 2D9CA 4OFVA 4X6DA 4LSRL 1KYOJ 2EH7L 3H3BC 4X7TA 5L8LB 4QTHA 3L9RB 1XR9A 3QWOA 3CX5J 3MODH 3L3HB 4P4KA 5FDYA 1FYTB 3G6AA 1JNHB 3H6JA 1L0YA 2EC9T 1Q94A 1ZEAH 1XGQA 4WGVB 3K1DA 4KJPC 3RUGE 4KQ4H 2B1AL 3PDDA 1U8IA 3PWUA 5I8CB 1KCUL 3CPLB 2P24A 3P77A 1U93A 4PRNB 4ELMF 2CLRB 1WICA 3RIAF 1FL3B 1CE1L 4RGOH 2EDXA 1N0LA 4E9LA 3OAUL 5E2TL 4WTZA 1UM5L 3GSNB 4CVWA 4O02L 1CG9B 1Q0YL 1QRND 3EDEA 3W81A 1X4XA 2CH8A 5KZCD 3MRHB 2GQHA 5IGXL 1NUGA 1VSCA 4Y7MA 1J5OH 1FNSH 5D7LA 5IMMB 1I1AD 5FYLH 3IDJB 3EIFA 4ODTL 5LGJA 4N8VA 1R3KB 2F54D 5I1EL 2E7CA 3RVVC 5DR5L 2UZIH 4ZNEE 4RGND 4EOWH 1BOGA 1H3WM 1EVUA 2VH5L 1E4XI 5DMKB 4Y1AD 3BESR 1MUJA 3FT4B 3KYNB 3NFSH 3FOMB 4LNRA 4QF1A 4UBDD 4JFDA 4ENED 1J0YA 4PRAB 4RIRB 1ZHNA 1AGEA 4KH2A 3V52H 1D5BB 1X5KA 2R56H 2FX8L 3HNSL 1KC5L 1CXEA 5FM5O 3OJDB 2EDOA 2EDNA 3MNVB 1DVFD 5HYSG 1K9TA 1M1SA 5F21B 1MCBA 1KPVA 1S7QB 1EDQA 3SKJL 4HV8B 2BNRB 4I2XE 3TNMA 1NFDE 5E9DE 3NCCB 3KPLB 1DBMH 3Q6FA 1MVFA 5F7DB 4NQUA 1OAQL 1NGXA 5DQDL 3V6ZB 3U36A 3ZYIA 1B6UA 3ARPA 3SGKC 3DX8A 4PB9L 3T77B 5HGBA 3QIWD 4IIQB 1T3FA 4OCMC 1DZBA 4XWOD 4UUJB 5C70A 3KJ6L 3ZKMC 2R0WL 5C0ND 4GQ9L 1J12A 4OF7A 4HC1L 4UNUA 5JXEA 1MREH 5KANI 5L7XH 5CILL 1EIBA 2FIRT 3MLSH 2D7TL 2AJVL 2ZCKH 2BSSA 2XZQH 3VXSB 4PGDB 4HUWA 5SWZA 2ITDB 5TPWH 2CD0A 4NNYB 1SQ2N 2YC1B 5GRWA 3TPUB 5FGBC 2DJ4A 4ODUA 2NY1D 4YGVA 1H3TA 2AEPH 4J2XA 3OB0K 4D0DA 3GIVA 1TVHA 2YWYA 2NXYC 3W0WB 2X09A 3N0PB 4JFZH 2YN3A 5C09B 2QQNH 3ULUH 1AHWA 1T22B 2IBZY 4QXGH 1HKFA 5DJ0B 3MJ7A 1ZGLA 4JN1L 4U1GC 5CJOH 4I5BA 5EH1A 5KJRH 4YQXL 2DQGL 3BZ4A 4JZJA 3VXUA 2F19H 1KN2H 1A64A 4KKAC 3EJYC 2FZ3A 5T5FH 3EYVB 4HZLA 5IESH 4ZFFA 1NAKH 2ZNXA 2NY5H 1A6UL 1K6QL 4XCYA 2D3VA 3I50L 7FABL 1BD2A 4PTUB 4NQDD 3FQNB 2WWKT 3L6FA 1JTTA 4PJ9A 4XVJH 5DRZA 3QO0A 5IROC 2C9AA 2BVTA 2JB6B 2HTLD 3MV9D 1CLZL 1OGAB 5C0EA 3SCMC 1QSEA 4GRWF 2DYPB 3O3BB 5DD5L 2NY6C 4U05A 3GMQA 4G9FD 3BZFA 1QRNB 3BN9C 3KJ4C 1PFCA 4HKZB 3VFNA 3TH3T 4C4KT 1PQZA 3V8CA 2ADJA 4L9DA 4F7PB 2M8XA 5KZCB 1PG7X 3O3UN 1QFWL 1T7ZA 3MXWH 4LNVA 5GS0C 3DBXB 1LO5A 4ZUVB 1J7VR 1I1AB 2GTWA 3GSUA 4YHLH 3DVGB 1MRCH 1AO7D 1KIRB 2F54B 1DQMH 4JY4B 1IAKB 3VXRE 5KVDH 2HFEB 5TDPB 3EYQD 1YEEH 4RGNB 2HT3D 5D70H 3VFPA 3WFCL 3LQAL 3LKRB 4G6FD 4UB0H 4UQ2A 5LGKA 3RRQA 2X4OB 4L1HA 4Y1AB 2VQ1A 3MJ9L 3MV8A 5H2BA 3WNLA 5IB4B 1EUTA 5D96B 3TJEH 3O4OB 1ITBB 4NIKB 1WK0A 5CJXC 2AJUH 1DLHA 5JPNB 1UWEH 4I1NB 4YHPB 3VFMA 1Z0NA 4MNGB 3SDXF 1I3UA 3RTQD 5EZIH 2XY1A 1CYGA 3KGRA 1CI5A 4WWKA 1YY9D 4YDVB 5INDA 4ZS6D 3OG6B 4FZ8H 4UV7L 3PWJB 4NP4L 4PGJA 1BVZA 1RZGB 4BSVA 4ZSOE 2DL2A 2BDNL 4UAOC 3QUKB 4HIEA 2CGRL 1OAUH 1X5LA 5D1QC 4NKDB 4HEME 2M1KA 5TF1L 3O2VL 3QIWB 1PKQA 3QIBA 3GSQA 1FAKT 3LEXB 4HJ0D 1VEOA 4CRPA 4TTDD 3IXAB 4U1SB 5I6XB 3BW9A 1UM4L 2KZWA 5F6HI 1MWAA 2DQUH 5C3LD 2ADFL 3O41B 5TE6H 4ODWA 3RWGB 1ROWA 4XWGH 1MLCA 3AVEA 2D0FA 2V5TA 5IVZA 3PE9A 1LE5B 2DKUA 2R9HC 1OHQA 1KTRL 1SJEB 1UKSA 3Q5TA 3RVXC 5GSRA 3O45A 2YA2A 5IWLC 1T0NB 4N0CC 5FYJL 3WO4B 5AAWA 1D5ZA 3TT1L 3MBXH 3VFVA 1Z3GH 4KHXH 3CDFA 5FGRA 3KS0H 4X6CF 5CHNA 4GUPB 3MA9L 2NY1B 4WU7A 1INEH 3B8SA 2J6EA 3I6KB 4Z5RA 1SBBA 3CX2A 3GMRA 3WKNA 3BX7C 3X3GH 4R4FH 1PG7W 4LEOA 3ZL4H 1JPST 1E6OH 3TEUA 3BP5B 4H1LH 3O3EA 3QQ3A 1G7MA 5A40E 2ARJB 1A7NL 4R0LC 2DD8L 5EUKA 4XMPL 3D39D 2JCCF 3NA4A 1MHEA 1JK8B 8FABB 4PJXF 5A2KH 1ND0A 3IAGC 4JHBA 5CJQL 4Q2ZA 4WI3A 1OTSC 1DN0B 2NNAB 1HEZB 2HH0L 1FJ1B 4OGXL 1YEIL 1DLFL 4HIJB 5I73B 5DQJA 2QHRH 5T1KD 5J57B 2Y9RT 4PFEA 2ZZUT 4NKIH 4S1SH 4NCC2 4WHYH 3RZCC 2AK4A 3REWA 2YPKB 5BO1L 2R0KH 1F8TL 2PYEE 3OJMB 2GAZA 1RZ7H 4NBZB 4ZUSB 4JHWL 2ZUWA 3FB5A 4HWBA 4HKJA 4P4RB 1CT8A 3MV9B 4X6DF 3DRTA 4YDLB 4Q74A 3U1SL 5DMYA 4OCRL 2XFXA 2A6DA 4ZG1A 2WUBL 4UT6H 4E0RA 4U7KA 2XTJC 1ZAGA 2V7HA 1H3XA 4I3SH 4G9FB 4FTVD 4NRXA 3NTCL 3PGFH 4FQJH 5FOBA 4KKBC 4H0IA 4TUKH 3M8OL 1NCWL 3NIDF 3P11H 2ERJB 5ESAB 5EZOH 2ZWLT 1U6AH 4HLJA 1N5AB 4KTDH 4MD0A 4U0RC 2C1PB 2R23A 4ZFOB 3H3KA 1BQHG 4JFHE 5MP6L 3EOTH 1T0MB 4LBEA 3S36L 3TIDA 1U41A 2A0LD 3A67H 5ALBL 3G9VA 3ARGC 1FG2A 5ADOL 3WLBA 4IJ3B 4L3ED 3TYGH 5J9PA 4JO2H 3UTTA 4IS6A 3RL1A 3WNKA 3SDDD 3QYCA 3H8NA 3R1GH 4ZDHB 3MR9B 4TULH 4IRJA 1JZ6A 4D8PB 5CLWA 2CR6A 4X7CC 5ANME 3V5DA 3Q1SL 4IMKC 4NKOA 5IHBA 2W92A 4L8CB 3IDGB 1ZT1B 4X7DC 1S7XB 3QG7H 3RTQB 3RWIB 1KEMH 3GMNB 1VGKB 2K1MA 2GEEA 2B0SL 3DGGA 4KZDH 3NPZB 5EO1A 1KELH 2HFFA 1UA6L 4RMSA 1J1PL 4GAGH 4HFWB 4R6UA 4XRCB 3KDMB 5C07A 1QBAA 4QXTB 1IGCL 1HN1A 5DJ6A 5GIRA 5L2KD 1JWSA 2OM5A 5KTEL 2A9NH 4PP1C 2MMXA 4RAUB 4J3UA 3QEQD 4NQXB 4ALAH 5EN2B 3QHFL 1TNNA 3CZJA 2JLLA 2WIIA 1G9MC 3T0WA 1U91A 1S3KH 3JVGC 5HYJA 3ULUF 1SEQH 4WW2B 1P7QA 5IK3A 1L7IL 3LEYH 3VGEA 2LTQC 5DD1H 5DD6B 2ATPA 2X4NB 3RNKB 2X4RA 2CUIA 5EOCH 4N1HB 2BOBB 2B2XL 4IHOB 1JYNA 1Y6NR 4FMFA 1BF8A 1YJDC 1F4WL 4RMQA 4OF6A 3QDME 4KFZC 3WKMH 3P4OB 1T80A 1W72B 3JBG7 4DVBA 1NEZA 1Z9LA 4S2SA 2VXUH 3G5YA 4GW1B 5J6HB 4FZEL 1WUNT 1UQSB 3CFCH 4GS7B 4WV1B 4YE4L 4CMMB 4ZFZB 2DLIA 5DGQA 3TM6A 1UXSA 3W2DL 1FV1B 5K9JL 5KSBB 1KTKE 3A6BH 1Y6KR 3TBWA 5I8EA 3H9SA 3F62A 5B4MD 1JZ7A 3D39B 1KJVB 4HUMB 4NNXB 3MGOA 3OZ9H 4KQ3L 4L8SA 1OARH 2R29L 4LVOC 5C08D 3HI5L 4LLAA 3S37X 3EO0A 2QQKH 2VUOA 5C7XH 2IPKA 3QPQD 2GFBB 4GG8A 5EPMA 1V7NH 4NQCA 1CD9B 1QBMH 1FGNL 1NUFA 4URTB 2B5IC 4F33A 3DJ9A 4ZUTA 4K7PH 3VWKB 5EO9B 3TVMC 3MUHL 1T04B 5TDOA 1U3HA 1WF5A 3EDFA 3HA0A 1X6NA 2H32H 4ZFOL 2JELL 4RMUA 1JN6B 4L29B 1EHNA 3C08L 2VDQH 3RZWA 1TZHA 1CLOH 1IAMA 4IBLT 3LS4L 2YK1L 4W6XB 2ZUQB 2SEBA 4LLYB 1B0GB 2XQBL 3L3GB 4FTVB 4PJFA 5DVKA 1T1ZA 3T8XA 3CIQA 3HC3H 4P2OD 4EI6A 1FYTA 1B0RB 2G5BB 1A1MB 4TSBH 2AJSL 1EEQA 4U6XB 4PRBB 1SEBA 3SGEH 3E6HB 2DDQL 3ZHDA 2FBJL 2EXYC 4UV4H 4AMKH 4JFFA 5IB5A 5I8CA 3MLTB 3P2TA 5DZNA 5IV2B 4M93B 1NLBL 4YIQA 1YYLH 4GRWE 3U0TB 3AB0C 4UINH 5D6DA 1H0DA 4L3EB 4JG0H 4PB0L 4Z77B 3SDDB 4AQ1B 5AYUL 4OM1L 2AP2A 3KPPA 1AQKH 4OZFG 4NCDA 5HYFA 1CK0H 3D2UA 4TQEL 2BSED 2WUCH 5JPMB 1U8OA 2V2XA 5JORA 5E56A 5CJBA 4X6EA 4Z7WF 5C92A 5E0QA 2DIJA 4MD5B 5DVNA 1FVDB 1MFCL 5JW4R 2GKIA 1NCAH 3HI1A 4QRPE 1N64H 2F5AH 2NY7L 4P57B 2FO4A 1YEGH 3VMNA 5ITFB 4G8FA 2EE9A 5EU3B 1LEIB 3WS6A 1N7ML 5E6IC 3KNBB 5EU4B 4KZEH 3KPOB 2ESVE 3TA3D 1CFVH 1ODAA 3LD8B 3R8BB 4KHTL 3RI5F 2H3NA 4QXUH 5F7UA 5L2KB 1OP3H 3FB7A 2BRRL 3I3BA 3QEQB 1DBAH 1FORL 5TQ2L 3UJTH 4QYOA 2OJZL 1R3IL 2Q7YB 4NQEB 1I3RB 3BDYL 5BQ7A 3OKKA 4PRAA 1QNZL 4S0TD 4HPYH 1NMAH 2VN4A 5DEGA 1KTLB 2BHZA 4DKFH 3STZB 12E8L 4WEBH 1W72L 5F7EL 5J13C 1FCCA 3RWEA 3S98A 2XN9A 3IFNH 4TOYL 1AGFB 4GKSB 4HT1H 1DUYA 1S7QA 3FN9A 2X6MA 2IADB 3ZZ1A 1DFBL 1OW0C 3MJ9A 3ZKQD 5DD0H 3QDJA 4UTAH 5E7FA 4E41D 1RV6X 1A14L 3V6ZA 4U6VH 3VI4E 1WCQA 3L5XL 2EH8H 5F9JB 1AY1H 4F8QA 1NCTA 1CBVH 3QQ4B 4RBPK 1QR1B 5HTSA 5T3ZE 4KJQC 1GGBL 3FZUC 4JR9H 5F70A 5KANG 3EFFB 5FYKL 2APTA 5ADPH 5E2VH 3QUZA 2UWEA 2FCBA 2VC2L 5KSAD 1X7QB 1UFUA 5E5RB 5EBWB 2AERT 2X41A 1T5XA 1ZSDB 2BP3A 5DVOA 4YBHA 3W11D 2NX5B 2VLJA 3M1BB 3SQOH 4W70A 2EDRA 3K80A 4EDWH 1LK3L 3VA2C 3S5LB 5EUOB 3KLDA 3SHSA 1CE6B 2W0KA 1LILA 1CD1A 1INDL 4N68A 5C08B 1ACYH 1YA5A 4NFCA 1D5IL 1Q38A 3PWNB 1JTOA 4JRWA 4GW5B 5E24E 5IBLD 4P0DA 1U8NB 1FVCA 4DGVL 4EJ1C 2VLKD 4PGBB 3JZ7A 5CIPB 3V0VA 3W9DB 2XIDA 4PG2A 4R7NB 2FX7H 2D31A 2KQNA 3ILQD 3FQRA 4P3DB 5HDQL 4FP8L 4XBPB 4O51B 3DURB 2V7NB 2W9DH 2FR4B 1T22A 1A9EB 1OQXA 2FEEI 5C0AE 5DJ0A 4FXGB 5E03A 3VJ6A 3EFDL 4F58L 1BHGA 4J4PD 1IBGL 3RGVA 5E00A 3QUYA 4M7ZC 1MFDH 1U8MB 4XMKL 5JUEL 4F7EB 2GYSA 1AFVL 2P1YA 2FJFB 1T4KB 3M45A 2ZG3A 4FQQA 5CEZL 1JWMB 2P8LB 4DW2L 3MLXL 1UWGH 4XPAH 4X6DE 2MSPA 4OI9A 1KJ3H 4Z7UF 3BOVA 1AGBB 3MRQA 4MA7L 4PRID 1A6AA 2AXHA 5E6YA 4YBQD 2C5DC 1UZ8B 2LU3A 2JB6A 2H45A 3PP3K 4OLUH 1RHHA 1OGAA 4GW4B 3RPIB 3D9AH 3MJ8B 1X4ZA 1I8LC 5JIPA 4PJ7E 1AXIB 4HKZA 3KYAA 3S88H 4AT6A 1T83A 3V7AG 5I8KH 3G5ZA 3IGAA 2MCG1 3ARFA 4CBPA 3DO7A 1OLZA 1IMHC 4LSPH 3D85D 2Z8VC 2I07B 4O2CB 2A6IA 3RL2B 3WIIL 3DX9B 5B3JE 5DHVH 2ORBH 1UB5A 1W8OA 3D48R 1PG7L 2YR3A 4KGJA 4XP9L 4XZUB 3N1FC 4QOKE 4Z7VF 5ILTL 2FHFA 5A16A 4HDIB 5MERB 4LMQE 1Q1JH 3I75B 4DFHA 4APQA 1I1FA 5D7LE 2Y36H 3GI9H 1OSPH 2X70A 4G7VH 4PJGE 4X99A 1GZQA 2P43B 3VD3A 5EORL 1AP2A 1F3DH 3THMH 2HJFA 3F7YB 4NO3B 4HBCH 4U7SA 4DOHB 4MNGA 4UDTA 2V17L 4XPFL 1I1RA 3ZYJA 4LASH 1N4XL 4HWZB 4M03A 5J3HD 3SGEI 5A2FA 5INCA 3X13B 3RDTA 1IGJB 3DVNA 4NDMB 4Y19D 2HLFD 4Y4FD 1CXHA 1YECL 2DQEL 1G6RB 1RZGA 3LN4B 1FO0B 4JPIA 4YDKL 4E41B 2IGFL 4RGNC 4U4BA 2AXGA 3QUKA 4LHUD 3AREC 4NKDA 4K9EH 4I9WD 1VFUA 3CVHA 3T3MF 1I1CA 5E8PB 3IXAA 5D96C 3O4OC 3GZKA 4PGCB 4P5KA 4U1SA 3RWFB 4OM0H 3TO4D 4YZFF 1ZS8A 3STLA 1MCOH 4JKWA 1IT9H 4ODXA 3DUUB 1DVFC 2GJZB 2QKIB 2J12B 5KSAB 1U36A 3TBTB 5I15L 2X89D 2Y07L 4WNQA 2P44B 3C8DA 4LP4A 3QFDB 1UACL 4OQ1A 5B38B 4D3CH 3A6CL 4IMLB 5IFHL 3O2DL 1SJEA 2CUHA 5BVPL 3I2CH 5LCVH 3U4AA 1S9WB 1JHTA 4GXVL 5L2JA 5IW6B 4UIMB 1RUPL 1T03L 1AXTL 5IR1A 2WM0A 5HGGS 3ARVA 1YN7B 3TH2T 2VLKB 5FF6A 4N0UB 3D25A 2ICWA 3CXDL 3C8KA 1KCSH 1FIGH 1JGVH 3WHXA 1WT5A 3WFEH 5GGSA 3G08A 4PP2A 5C0NC 2AQ2A 5KG9A 5SWZE 2MFNA 5DLML 4PJBB 2AXFA 2MKWA 3OPZH 5I1HL 5KVFH 1FNEB 4FABH 5AG9A 3LQZB 4M1CD 4Z95L 3MRKA 1GIGL 4K7FB 2VIRA 3O9WA 4S10A 1IM9D 1SBSL 1N2RA 3GHEH 4WDIB 5DHYB 4OV6F 3V5HA 1FJ1A 4CW1A 4HGMA 1BZQK 1DN2A 3B9KA 3HC4L 1S9VA 2DQDH 2VLLA 4X7EC 4E5XB 4MB3A 3CXHK 4ZO9A 1BX2A 4PRHA 3VCLB 2JIXD 2RFXB 4PRIB 3KLHD 3JV6B 3DTXA 1DQJB 3TWCL 1G1YA 4ODBD 3MRGB 3KS0J 3VXUE 4EKXA 3RNQA 2P5WD 4P4RA 3SE4C 8CGTA 1BWMA 1C08B 4V2CB 1JYXA 2XXMB 2Q1EA 5JTWA 2OR8A 4H8WH 4PJFF 3DIFB 2EXWD 5MHSE 3FCTB 4NT6B 2XZZA 1BD2E 2AJZB 1LK2A 3C9NB 4RA3A 5ABDE 5LGHH 3LKSB 2DLFL 1D7FA 2FEDC 3H3PL 4HAFA 1N5AA 5JDSB 1EAPB 3UROR 2AGJH 3D85B 1MFAH 1MIEL 1FNHA 4JPWH 1QSEE 1YNLH 1QFUL 1HH9B 3LDBB 2IPTL 1YY8B 2J8OA 3UBXB 6CGTA 2XZCH 4BFIB 1JHLL 2Z8SA 4R2GD 3WDIA 2VAJA 4X5WA 2EE6A 1XGPA 1QUNA 4QRUB 4RGMC 3HG1D 4MQSB 3TZVD 3U0WH 5D2NA 3MR9A 3ARBD 3V6OC 2NTFA 1G6RL 3SKUD 1FO0L 5BVJA 4HWNA 2RQ8A 3JTSA 4WFED 4TVPD 2BNQD 5LXGL 4MJ4A 2DLGA 1H8SA 3C6LA 4YHNA 3AXLA 3RWIA 4LAQH 5GJTH 4QHUB 4ODVL 4KC3B 3ECBB 2HKHL 1LDPH 3OXRB 1XF2A 4QNPF 1MNUH 3MV8E 2EYSB 1G0DA 4JPKL 4Y4FB 4HIXH 1FYHB 1IGMH 5A2IH 4RWYH 2DB8A 3UCRA 2HT3C 4RAUA 5ICXB 2I25N 2GK2A 4LHUB 2NXZC 2YZ8A 1A3RL 3B2VL 5E8OB 4GMTH 5F7HA 3BZDA 4JQVC 4UNTA 4CJ1A 4M7LT 4M5ZH 5CZVH 2DQIL 2DTML 3QCUL 3TO2A 4C54A 4LSSL 4P46D 4IRSC 2YD1A 1FL5A 4FQXD 2A74B 4WW2A 2D03L 1LQSR 1S78C 4ZMAT 3QEUB 4PY8J 4DCQA 2DQJL 3DV4B 2ZG1A 5F1SA 2NY0D 5SWQB 1YY9C 2IPUG 3MRNA 4NHUA 3MV7A 1ES0B 3X3FL 1QFOA 3ROLB 1PKQE 1AI1L 4OCNC 5HHOA 1RZFH 5ERWB 4J7RA 3EOBB 4PUBL 4WWID 5IBUB 2AEIT 3CH1A 4K2UH 1CGSL 5FCSH 4X0KA 2EYTB 1EGJH 5B8CC 1W72A 4GRLD 1KXVC 2OSLB 4HJ0C 2O5YL 1WBYB 3SDCB 1UQSA 3MFFB 1PX3A 5F6IB 1H15B 4G3YH 1ZA6B 2UWEF 1WZMA 1I8MA 3HZVA 4JQXC 4DUWA 5I1CH 1IGFH 4M6OL 4ONOA 3BYTA 4C56D 1OPGL 1A3LH 4LKXB 2X05A 4CADA 5EOTA 1KJVA 4NNXA 3BKJL 3GSWB 4TUJA 1F02I 1JGEB 1JPFA 3L3DB 3OAZH 3GI8H 4LARL 4JREB 3DHMA 3UC0H 2MCPL 3FB6B 3QUXA 4Q0XH 4ELKB 2GFBA 1TZIA 3ARSA 5EOCJ 3ALPA 3IJSA 4Y5YA 2HKFH 3S4SB 1IL1B 5C71A 4PIRF 4PRPA 3QRGL 1FBIH 1T04A 5D4QA 2Z91A 2JIXB 1MQKH 3CJJA 3SDYH 1AD9B 1DQLL 4LKCA 2CDEB 1NBVL 4XMLL 2P5EA 1VPOL 5EBMA 2MWCA 4D0BA 4Z76B 2IQ9H 3SGKA 2P5WB 4MWFA 3CLEL 3BEWB 3ET9F 3O2WL 3QCTL 2R8SL 1OTUD 1IC7L 4PJEA 2UY6A 4GRMA 2UVEA 5D2LA 4M48L 1HIMH 2BVEA 3CVIH 4NZUL 1B0GA 3IJHB 1NGWB 1G7QA 2DIBA 2AK4E 4WEMB 4JDTL 2BMKB 2X42A 2J4WL 4Q58C 1U2CA 3H7BB 4N8CH 4QRSB 5IMOB 4WHTB 1EXUA 3S9DB 1OAYL 4YPGA 1KJ2H 1IGIH 5E8NB 3FT3B 1YEKH 2CIKB 1JZ5A 2KZ1B 4PJHA 2P8PB 2Y6SD 1V5JA 3U0TA 3TLRA 1MCSA 4H1LG 2I5YL 3LIZH 1ITCA 2G60H 4K94H 5IF0A 4G7YH 5ITBL 4N0YL 1JFQH 5DMGD 1H3UA 2DI9A 5J7CC 3PG2A 4R2GB 3MMEB 1F90L 1MFBH 1A4JA 3HG1B 2R2CA 3TZVB 4Y16D 3ARBB 1HQ4A 4WFFE 4B53A 4PGEA 1JZ2A 1ED3A 3ARRA 1I9RL 2EO9A 1IAOB 3JWDH 4YR6B 3PL6C 3UTTE 1RFDL 4JLRB 1XZ0A 1WAAA 5HGHB 3IDXL 4O2FA 1P6AB 4KJYB 1I8IA 1T1YA 4BA8A 3L3OB 4P57A 4WHYG 5DJDA 4I18C 4CVUA 1K2DB 5ITFA 2A0LC 1IQDA 1DBBH 1QSVA 3C2AH 4JM2F 4PJDA 4Q7DA 1BLNA 2DWEB 3HUJB 4FQ2H 4L5FH 3MRLB 1BZ9B 4K3GA 2BFVH 4X9IA 1XGRA 2MPAL 3VGFA 1ZVSA 3VFSA 4PD4K 1S7WB 3MRDA 4JPVH 5HHXH 3BWAB 4LF3B 1JPTH 1LEKB 4P46B 4NUGL 1S7VB 2D9QB 3W9EB 3BHBB 3B2UD 1ZHLB 5KAQF 3STZA 4OT1H 2OQJB 1RIHH 5FIEA 4AL8H 3SCMA 4P2RB 1G84A 1MCDA 3V4VH 4K71C 3RVUC 1EEYB 2HTKC 4OZIA 1NMBH 2B39A 5EIIB 2NY4D 5ID1B 3LD8C 2FSEA 2LQRA 5HYJE 3SKNA 3V4UL 4QHNB 3MRCB 2G2RA 5GGRY 4GAFB 1GH7A 4KI5F 2B20A 2IANA 1QLEH 3ILPA 4GRLB 4G5ZL 2XQYG 4TSAH 1QR1A 1D6EB 1DR9A 4PPTA 3FO0L 1SYSB 3T0AA 3H7LA 4MVBD 2X7LB 5CEYA 1RJYB 4L9LB 1FFOB 3NZHH 5EBWA 3TBVA 4F2MA 5DJZB 5E9DD 1OP5H 1C5CL 4YHIA 5I8OL 1OQOA 5HDLA 4OF0A 2YPLA 2A6KA 5CJXA 1NAMB 3C5ZB 3FOLB 3QA3A 4LHQB 1QP1A 1FZOB 3SKOA 4F37K 1EJOH 2ATKA 4X6BA 3PWNA 3EGSA 1GGCL 3F12B 1T1XB 3H9SE 3JWOC 4OTXH 5CIPA 3RU8L 4R7NA 4OLXH 1IJ9A 3LKOA 2J5LB 5I0ZA 2IAMD 5LWYL 1N3NA 5SX5K 4P3DA 2X4TA 4LOUD 3TV3H 2OK0H 3O2DA 2ADGA 3QO1B 1EO7A 4XBPA 2BCKB 1GC1C 3KYKL 1HHIB 1GVIA 4FQHB 3NCFB 4NQCE 5F9OL 1HHHB 5GGVY 3FQWA 3EW3B 4EQ2A 4Z78B 3HZYB 5H8DA 5GGTL 3BPLB 6FABL 1DANT 3VXMB 5I74C 1NKOA 1U8MA 3ULSA 1D6VH 4NO2A 1TQBB 2K7PA 2DMKA 4OQTA 4RZCB 1HCFX 4ZUWA 5EFIB 4G6JH 3HR5B 2DOCA 1DQQB 3BP6A 4MDIB 1P84K 4BUHA 1MPAL 1FLRL 5DJCB 1FDLH 2W9EH 4MNHB 3KPRD 3UAJD 4PJFE 1KLFA 4POZD 3WUWA 5IWLA 5ESVA 3C60B 4JB9H 4R7DA 5FUCC 1FYTE 5CEXB 4BJLA 4KKLD 2ZOLB 2IQAA 4HH9B 1MCKA 2NTSP 1KCRH 4Y16B 3QAZB 3K2UL 5J4MA 2AQ3A 1A5FH 5HYQB 1NDMB 4XH2B 1CTOA 4HHAB 1R0AH 4YK4B 1IAIL 4I3GA 4LLMB 3V5KB 1A7RH 2DQTH 4P2OC 1OCWH 3BE1L 4JEGB 5FO8A 3RUGB 5L0QC 5JW4M 1D9KB 4KVCL 2WANA 2E7MA 4LPXA 3WBDA 3GB7A 4P3CL 1XCTA 4O2CA 1KCLA 3RL2A 1UCTA 1Z5LB 2HT2D 2OCFD 1F6AB 3LS5L 2AJ3A 3HZKB 2J1KA 4KK6D 4XZUA 2PW2B 2J88H 1OB1B 1QRKA 5I19L 4XC1H 5IMKA 1OM3H 2FATL 2A73B 4OGAD 4U1KA 2NLJB 2V2TA 1I4FB 5HI3D 3UDWC 4Q9QL 4OLVL 3L7EB 2XWJB 3OKOB 4ODHH 1JF6A 1ZA3A 3BP7B 3K2MC 1T66D 3FQXB 3MGAA 4YXKH 3KPQA 3RVTD 1IGJA 5I1LB 1E4KC 4EUPB 3VXRD 3QUMH 1J05A 3DLQR 3PP4L 3QR2A 3OR7B 3TA3C 2NY4B 5C0RH 3LN4A 3FO1B 3UO1L 4FFVD 1A6ZB 5I0DA 4XNYL 1RU9L 1A2YB 3QWRA 2JJSC 3MSPA 3FO9B 5I66B 1ZT7A 2XN9E 3T3PE 1NAML 1YEJL 4WUUB 1B4JH 3HI6H 4P9HL 2F8VA 3WNMA 1CFQB 2IMNA 3ARGA 3BIKB 5TFSL 5BXFA 2CJUH 3QEGH 3ZKSD 2WINA 1CIUA 5C0GB 3GO1H 5F1NB 4XP6H 3CMOL 4F9PC 2OZ4L 2GTZB 2YPVH 2GJZA 2QKIA 2YXMA 4LMQI 3NFNA 3MLUL 3GJEB 3K8KA 1NFDB 3LHPH 2VE6B 4G6AD 4NWUH 1CGYA 4J23A 5IBTH 15C8L 1F3DJ 4IMKA 3MOBH 4WHDA 1X9QA 4GBXD 4W4NA 5IW6A 2DWDA 3X12B 4RFEB 3VE0B 5GRUH 4S1RH 4ZTOH 3NABH 5D5MB 1R5WB 2FB4L 2HA1A 4FQLL 1HSBB 4BZ2H 2HJLB 4FQIH 1HNFA 4JGJA 1QYGL 4G6KH 3K3QA 2BNUB 2VLJE 1F5WA 2IFFL 4OIIL 4HMEA 4CNIB 2IAMB 3HAEB 4HIHA 1IKNC 5JOEA 1BFTA 5JDJA 5E99H 1E4WL 4P2QA 4YFDB 5KSUB 3MRRA 2R4RH 4AEFA 1X5JA 3BO8B 3BI9X 4OSUL 5FM4A 3MCLL 1JPGB 1ONQB 4HKXB 2CMRL 4G9DB 2ENSA 4OIAA 5DK2A 2ADIA 5C09E 2PW1B 4PV8B 1BAFH 1FAIH 4YHOL 5IBLC 5I17A 2HG5A 1TJHL 25C8L 4CUCA 1I9JL 4XPHL 5FYJE 4JFXB 1NGQL 2QLVB 5CD3B 3VCLA 4MXVF 1IKFL 3ILQC 2R15A 3O8XC 5DK0B 3DMMA 3KPRB 4NPYB 5FGSA 3SJVD 1T21B 2MHAB 1T5WA 4R8WH 5CKAA 1JF1B 4HUUB 4PJEF 3WYRA 1C08A 4HG4J 4N1EA 2VXTL 3HLAB 4BH7A 5DUPL 1IC5H 4FFZL 5D2LF 2ZSWB 1ZANH 5F96H 4J4PC 3DIFA 1EHLL 1SYVA 4EN3D 3FCTA 3HNTH 3KLSA 4NT6A 1Q9WB 4C83A 5DA4A 4X98B 1MRDL 2AJZA 3HS0B 5LAXB 5T1MA 3BFOA 4N5ED 1LO0L 1CQYA 1ORQB 3FMGL 5JDSA 1QR4A 1U3YA 1MFNA 1XCQB 1XIWA 1OGAE 3BVNB 4PJHF 2PYED 3EBAA 5KSVB 4BQ9A 4KK8D 1HXYB 5I16A 2H1PH 3GNML 4BFIA 4YBQC 1AD0A 2H6PB 4NGHL 5K9KA 5L8JB 3IFOB 4HPOL 1H3PL 3TVMA 1W0VB 5IM7A 4PREB 4W4OC 1QSFD 1G9MH 2B1AH 3OWEA 4UMGA 1T6WA 1ZHBA 3EO9L 5IHLB 1KCUH 2F54E 4OZ4A 1WAAF 5DUML 4DQOL 4BZYA 4QHUA 3T0VA 3AY4C 5HSFA 1CE1H 3ECBA 5AZEL 5JW3H 4PJDF 3OAUH 3VXRB 2EYSA 1J8KA 1RQ5A 1OT2A 2EEAA 5K9QG 4DKDC 5J12C 2XWTB 4UILH 3SN6N 5FK9A 4Z0BL 4MNGE 1UC6A 4K3EL 4XVTH 4XHJD 3MBED 3FO2A 5DYOB 5ICXA 4DGIH 5E8OA 1C16B 2W9LA 3LH2H 1PVHA 1JPSL 4I77L 4QRQA 3OKMA 4HX1B 5JHDA 3P0GB 4OGYL 5IGXH 1A6TB 5E1AA 1J1OH 3LCYA 3WIFB 1YN6B 4HLZH 4AEIH 4MQ7A 2EIBA 2VABA 1QEWA 3ZE0F 5IEHA 4ODTH 2VDKL 1QOKA 3BH9B 1G9NL 1NJ9A 2XWBA 5J3HC 3WCYA 5DR5H 1ES0A 3VW3L 4NQVA 4XP5H 1GAFH 1ZV5A 3LV3A 4LEXL 2XACC 1J88A 2RIKA 3MRBA 43CAB 4NZTH 5AWNH 3GSOB 4NQTA 5FB8B 1QTYT 2VDOL 3BXNB 3R06B 2FX8H 4RA0C 1KC5H 4Y4HA 4BZ1L 2OSLA 1CS6A 1YDPB 2O93L 4OZGA 3T0BA 1WBYA 3SDCA 5E6IA 3TO4C 4BFGA 1CICA 2H9GB 4WUKL 3SKJH 1UH2A 1T7WA 1WFTA 2YD7A 4JFQA 1O0VA 1R5VA 3WFHA 4ZYKB 2WBJD 1FGVL 3FL7A 3ALXA 1OAQH 3L5HA 4LKXA 3KLAB 3JTTB 3T04D 3WEXB 2GSIA 3GSWA 1KCKA 1Y18B 5DJXB 3CFJB 4DZBB 3QDMD 1II4E 3ULVL 1I9IL 1NSNH 3U9UB 1JL8A 3KJ6H 1OGTA 3MLVL 5T33H 4HCRA 1CLYL 3E6FA 4JHZA 2R39A 3UX9B 3PGDB 4HC1H 4NN6B 4PTTA 5I1GL 3O6FA 1I7TA 1KUMA 1L7TL 4NZDA 5CMAB 1TQCC 3WO3B 4L1DA 1OW0A 5BZWB 3IDUA 2D7TH 4LLVA 4P23A 4JG1L 2CDEA 4YXLL 4ZFGH 3HCVA 3SJVB 1P4BH 2DBLL 5I9QC 1A0QL 1PY4A 3BEWA 1WZKA 1V3MA 2OYPA 3SE8H 1MHCB 2Y7QB 4EDXA 5JZ7D 4EN3B 3IETB 4PRHE 1NGWA 1PLGH 5F7MC 5CCKL 1FRGH 1B3JA 4FRWA 4KPHL 3B43A 5CP3A 5IMOA 1UM6H 2XI9A 4MAUL 5C0FB 5IJKA 4PJAA 4YC2C 3FT3A 2CIKA 1J1XH 1DBKH 2YEZB 1KIUA 4PBVC 2P8PA 3GMOA 4ZXBD 3MUJA 4WJ5B 2JB5L 2VN7A 2XKNA 1YNKL 5GGTA 1MH5B 1S5HA 3IKKA 5KAQG 4YQXH 5C1MB 1A02N 4RQQB 2VZTA 3RBSA 4ZNCD 4NYLB 2CKBL 3GSNH 3UTSA 4G8GA 4XB8A 3W39B 3B5TA 3VWJB 1QSFB 1LD9A 3MUZ1 4KMLB 4ELMB 2BOCA 4OD2B 1MIML 1RK1A 1A6UH 2ZSVB 1OD7A 1K6QH 1IAOA 5EIQA 7FABH 4YR6A 1I3GH 2ICCA 4JLRA 1XGUA 3GMPA 4X4ZA 3T4AB 3FAWA 3KWWB 1KB5B 5D2NE 5D6CA 3QISA 5CSZB 1CLZH 4GG6A 2PO6B 4PJ8B 4OZHF 3NPSC 2E27L 1T1WA 1YNTA 3F6LA 3LMJH 2DWEA 4XNXL 1A1NB 1H5BB 4JRXB 3CFIC 1G7LB 4R2GC 3MBEB 1F3JB 1FZKB 3MLRL 3G5VA 3H9ZA 3KYMB 2P47B 5I75B 3ARBC 2AJYH 3O4LD 5F89A 3HPLA 5ANMB 2B4CL 3BJ91 3D0LA 4KK5D 1QFWH 1Q0XL 3QH3B 1EAJA 3IVKA 2ED7A 1IGTB 4CN4A 3DETC 2DM2A 4QRPD 4P5TD 1S9XA 3G6JA 4V1DA 5DMIL 2W0FA 3QJHA 2FD6L 1RZ8B 4P2RA 1A7QL 1KFAL 4ZS7H 2ESVD 4QHMB 3WFCH 4ESKA 5KS9A 3LQAH 5ID1A 3EJZD 2Q8BL 2BY3A 3VU2A 3QSKB 1T20B 4MB4A 2PCPA 1ZHKB 3QZWB 3FN3A 3BZEA 1NBZB 3HFMH 4DKEL 2MNUA 4QGYA 1A22B 3LRSB 3P30L 1LO2H 5I1IH 3MV7E 3C09B 1BEYL 2C3WA 4AIXA 5HHOE 1D6EA 4XP1H 1UJ3A 5BOZG 1CR9L 5A43C 1S8DB 1G7JB 3H0TB 4FQXC 4UQ3A 2X7LA 5C6TL 3VXPB 2ZOKB 4L9LA 1FFOA 3MXVL 2NY0C 2KKQA 1XH3B 4JHAL 4IOSD 4CVXA 1BQSA 5F9WB 2BDNH 1F2QA 2F74A 1FNGA 5ELIA 1ZWIA 3BWUC 1KJMA 2VNCA 1CF8L 1KT2A 5TF1H 1NAMA 1KIQB 3O2VH 2D0GA 1BIIA 1FZOA 4EVNA 3IF1A 4YDJB 4KROB 5T3ZD 4GRLC 1T1XA 4LLUB 1YC7A <