3VE0B

Crystal structure of sudan ebolavirus glycoprotein (strain boniface) bound to 16f6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
DIVMTQSHKFMSTSVGDRVTITCKASQDVTTAVAWYQQKPGHSPKLLIYWASTRHTGVPDRFTGSGSGTAFTLTLNSVQAEDLALYYCQQHYSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords Envelope glycoprotein
publication title Structural basis for differential neutralization of ebolaviruses.
pubmed doi rcsb
source organism Sudan ebolavirus
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B01
3UCRA 3REWA 4L8CA 4B0MM 3VW3L 1WIUA 5D7JC 5ESQB 3MNVB 3LRGA 5DK0A 1KXQE 3RL2B 2NY4C 5FDYA 2AJYL 1BD2B 1MCKA 1VGKB 4Z7QF 3BWUC 4PGCA 5J6GB 4HKZA 2CGRH 3VCLA 1JN6B 4GH7B 4U49A 3JVGA 2GJ6D 1VPOH 2BVUA 4C55A 5FM8A 1T66C 3KLAA 3ZYJA 1GGYA 2MKWA 3T2OA 3IDJA 1MQKL 3WS6C 3C6LB 2OSLA 3DI3B 1H9VA 1I1YA 4O2EA 4U1LA 3REVA 1ZLVK 1FN4A 2X4TA 1OCWH 1H0DA 4LVOC 4GXUN 4TUKH 1W72B 4RAUB 3FFDA 3ZE2F 5K9JH 4K94L 2YHGA 3ABZA 1H15B 4JO3H 5DO2D 1TZHA 4JPWL 3UTTD 3SE8H 1RK1A 2FWOB 4RDQF 1EIBA 1A7BA 3KPQB 1CGWA 4BELD 2YMXH 4HWBL 5F7NC 2AK1H 4M7LT 5FHBL 3SKNA 3BH9B 5EG6C 5LGKA 1U8HB 5DRWA 1GC1L 4PYGA 1ZANH 4IM8A 4QXWA 2F58L 3GGWB 5HYJE 3OKOB 3VXRE 4ESKA 4MS8C 2RGSA 4YR6A 4EOWH 3C5SA 5F70A 1T83C 4DEPB 4IRZL 1JBJA 4M1CD 5DYOA 4F7PA 4ZFZA 5CBAB 1TCRA 1BGXH 4XP1L 1SEBA 4OZHA 1NGQL 5HI4C 1ZA3B 3KYKH 1A7PL 5HPMA 2FDBP 4WO4B 5I16A 3HRZA 1T20A 2PTTA 5IBLC 3PDOB 2MNUA 1AXIB 1T04B 2A73A 1T2XA 1NJ9B 4JQXC 3SDXA 2NPLX 4K3JL 4QRRA 4YHYB 3E8UL 5CMAA 2DM3A 3UTSA 5JXED 1S7QA 4FQCH 5HI3C 3LV3A 3SO5A 2AP2A 2WAHA 2WMPA 3VFSA 4X7SH 1V3MA 2IBBA 5GS1B 3M07A 4NRYB 5DFVC 5EBWA 3CX5J 3RGVA 5KVEL 3KNBB 4DN3H 3QDJA 4YPGA 2Z4QA 2Z8VC 4Y4FC 2EE2A 3I6GA 3HZVA 4DAGH 4P2OB 3S37H 1RUKL 5JW4M 3HNSL 3OXSB 5ALBH 5IROC 2AK4D 4XNUH 3QDMA 3T2NL 3RTQA 3HZKB 1L0YA 2KDGA 5B8CC 4NHUA 4JPKH 1WZMA 2OJZL 4Y2DD 2HJKA 2O5XL 4Q9BA 4CU8A 1YEDA 3SKOB 2XQYG 3HPJA 4PJCF 3PNWB 2YKLH 4RRPA 3W39B 1HXMB 4D94A 2VUYA 1M71A 2R2BB 5KJRL 4JY4B 5L9DL 1S9YA 4G7VH 4PY8I 3AB0B 2Q6WA 3NIDF 3S3JA 3KXFD 3QPXL 4YK4C 1ZLWH 1JRHI 3WNKA 1EX0A 1NDMB 1EMTL 3QNXA 3X11B 1AQDB 5IROA 1IKFL 1YNKL 2B2XH 4PBVC 5C6TL 2W9EL 3LIZH 5CBEB 3GBNL 1ZKAA 1BFTA 3GHEL 2OLDA 2V5YA 3G5VA 1FAKT 5DMGD 3HAEG 1X6LA 1P4BL 4PLNC 1RZJH 3DI2B 4IDLA 4J3TA 3BSZH 3C60A 1OOAA 5EUOA 4KY1H 2CLZB 1KPUB 1RY7B 4DUXA 3I6LE 1QSFE 2IANA 3K7UA 4UINL 3ILPB 4OF0A 4FZEL 4P23A 4JZOA 3DPBA 1OGAE 1KEML 3S96A 2DL2A 4CADA 1T89A 2R56L 3SDYH 4YQXL 5JIKA 1E6OH 5M7QA 5CCKH 5I1AB 5TF1H 1FL3A 4L3ED 2IH3B 4DVRL 3BUYA 5IWLA 4WHYH 1IEHA 4JGMA 3GIZL 3S36L 3OKKA 5I8OL 3BP6B 4OKVB 4H0GA 4PJHE 3F58H 4OAWB 1C5DB 5CEXB 2C1OA 3MBEB 1MAMH 1WFNA 1U36A 1EDQA 1Z9MA 5CEZL 2UUDH 2OL3B 4Y16D 3U9PL 3J7HA 4J3WA 3MUJA 1QEWA 1AXSB 4GW1B 3M8OL 3P9MA 4G8EA 4I18B 1S7WA 2DIAA 4JR9H 4ZSOE 4NC0B 5C07A 1MCEA 2NY3D 3DVGA 2UY7A 4RMSA 2ZSVA 3TBVA 1W0WA 3ZKXC 5F1IA 1PKOA 3HI6L 5E8DL 3IDYB 3WYRA 5HYJD 1P84K 3DVNB 1A3RL 3DRQA 4XBGA 4NZTH 4HUUB 4PJ5B 3T2PA 1RZGB 2BSSA 5IMKB 1PG7X 4OCRL 1MNUH 4V1DA 3VXUA 3IF1A 4XPTH 1LGVA 1FO0L 5C1MB 2KH2B 5D1QB 4Y5XA 2OCFD 5L0QC 1U0QA 1JHLL 1ADQL 1JTPA 3EGSB 3MNWB 5FDWA 5D7IA 2X6MA 5F7FA 1GPOH 3GI8H 1WAAF 4ACPA 1F3JB 4HIXL 4BK5A 5ESAB 2D0FA 4PD4J 3MUGA 4HC1A 4P46D 3LY6A 5SWQB 2H32H 4RGND 5JQ6L 4G3YH 1H5BB 2NTFA 4G8GB 5F1NA 4CMHC 2NW2A 4F80A 5F7YC 1FFOA 2OX5A 1MRCH 5ID1B 1RVFL 3QXVA 3LN4B 1MHHB 4RIRB 5K33A 4ZNCD 2HLAA 5BVJB 2OMNA 3QNYA 1KB5H 3MLWH 4O5LH 1OP3H 1GXEA 3FRPG 2AEPH 5J1TC 3BZEB 1IGML 1AE6L 3MRPB 1X7QA 2ADIA 4LGSB 1QNZH 3JWOC 4OZIB 4MJIA 3ULSA 3RAJH 2EDLA 5LGHL 2I9TB 2D0HA 3WEXB 2J4WH 1J05A 3O8XC 1MRDH 5DD0H 3JTSA 5EBGA 4HF5H 3PHQB 3IFNH 2XWJA 3DMMA 4JFOA 3TF7C 1IGJB 4K8RL 2NCMA 3OAYH 3OBAA 5HHOA 3CCHA 1I8KB 3E3QE 1KTDB 1R3IH 1P7QA 3WXVL 4LHUG 1MHPH 2ADFL 2Y7QB 3H7BB 4GG6F 2VERN 4LSSL 1QVOB 5JUEL 4MSWA 3WIIH 1CXIA 1A22B 1EJOH 4HZLB 4BUGA 1D9KD 3TJHD 1EHLL 2AJZA 2MWCA 5FYJL 2W91A 4FQLL 2CIKA 2JCCA 5KVMC 4L29B 3GRWL 1EUTA 3SQOH 3THMH 4GKZB 1XH3B 4QRRD 5DR5L 2ARJA 5E08L 5DD3H 2XRAH 4UB0L 3U79A 4Y5VB 3MRNB 3NMEA 4LSVL 3V5KA 3WL9A 1KV3A 5HYSB 3P2TA 1N6VA 2HA1A 4JKLA 3I6LD 1IAKB 1QSFD 2WIMA 1KCRH 4ZOBA 3RGVD 1JF6A 4ZTOL 1V3JA 4EBQH 1DBAL 3SDAB 5C70A 3VFWA 1EEQA 1RQ5A 1BQHA 3MYJB 3HCVB 4Y4HB 1MRFH 2AJYH 2P8LA 3LKPA 4XNYL 3BKCL 5DJDB 4CMMA 3STZA 3QULB 4PJ7E 3AGVA 4OGXL 3BZ4A 4OLWH 2APBA 3GMQA 4K3EL 1SM3L 3MA7A 3V2AR 3NCJH 3ZE0E 2J5LB 2AXGA 5TE6H 5IM7A 3LHPH 4XNZB 1MFDL 2MCPH 4EUPH 5C7XH 1II4E 4KJPD 3V5DA 2Q76B 1I8IB 4LAQL 3W82A 1EO8L 5ENWA 1UZ6F 3JV4B 5CWSB 3TZVA 5D8JL 4Y89A 1YEHH 1BQLH 4QRTA 1B0GA 1QKZH 4HK0B 4L4VA 4D0DB 2RCSL 4P5TA 1SJVA 1N64H 1KN4H 1UENA 3V4VH 2BOCA 2YUWA 3K4DA 1ZHLA 3CH8A 1XGQB 3C5JA 5I1EH 3VRJA 4EN3B 2UYLA 3WUWA 4KKAC 4HLZG 5DUPL 1AP2B 1MCWM 4YNYB 2GJZB 3I3EA 3G6DL 4QYOB 4JREC 2FB4L 3QDGB 5HYEA 3T3ME 5E6IB 3U2SA 1BVZA 2FYYB 3KVQA 4ZYKA 2BXZA 2F5BL 4X7TA 3CVHL 4N1HB 1CT8B 2V2WA 3IYLW 4YWGH 4WFHE 4LGRB 4K7FB 4H0IA 1B2WH 4EQ2A 3CSYA 4RFEB 1R3HB 4ZXBA 1EERB 3E6HA 5HDLA 1AFVH 1OTSD 3HE7B 1TTFA 5DJAB 4XCFH 2HT3D 1LK2B 4CW1A 4OUUA 5A1AA 1BBDL 3GMMB 4HAFA 3RQ3A 3VFGL 5ADPL 3BGFB 3RPIA 5KVEH 4K7PX 4M93C 3EOAB 5F3HA 2MPAH 1CGVA 1RUKH 4F7EB 3GSVA 1S3KL 2EH8L 5FB8A 4XPGH 1XR8A 2OK0H 2HKHH 2WBJD 1R0AH 1A7QL 5C0IB 1TMCB 3MRDB 2JJTA 3FB7A 4PJGE 4QLRA 5CJOL 3UP1A 1A9BA 2YK1H 5EBMA 4YHLL 4V1DD 3DUSB 3NH7L 1NGWA 1ZSDA 3EFFA 3W11C 1FZOB 2IADB 5KJRH 2YD4A 5L9DH 3V7AG 2HKFH 3KPNA 5FO7B 1CFSB 4G7YL 5E6ZA 1QBAA 3CGTA 3X14A 5C9JA 3EYFB 3N1GC 4N9GA 1DSFH 3QQ4B 1ZT7B 3MUHL 5ESVB 2VDNL 5C6TH 3RWHA 4GS7B 1S5HB 4HUKB 2V9RA 1N59B 3EHBC 4I0PC 3BO8B 4ZOCA 5I8KH 1UXSA 4Y2OA 1WWCA 2A9NH 3NTCL 1ZEAH 1UWXK 4D0CA 4EI5B 4WI5A 4UOJA 4JKPL 1AGFB 1A3LL 3T0WA 3G08A 1I7UA 1L7TH 2GFBA 2GY7B 2QHRH 4YX2L 3VGGA 3TA3C 3B9KC 1KBGL 2DM4A 3CC5A 4HJ0D 2OQJA 4LBEB 4B50A 3QHTC 1A7NH 5TQ0L 1HCVA 4NWTH 1KEMH 3MOBL 4ZNEE 4IHOA 1R6VA 1HILB 1U8NB 1J0JA 3TNMA 5KG9A 3A6BL 1NC4A 1EHNA 3PGCB 4U1SB 2AAVA 3PHSA 3WE6B 3P4OB 2Z8SA 4HGWB 3Q48A 4LP4A 4NYLB 3TBSA 1EEZA 3NCMA 1SEQL 4MNQA 4OD2B 2EO1A 1DUYA 4AT6A 5HHOD 3TFKC 3MV8A 1GAFH 4PR5A 1BVLA 2ZUSA 3TA3A 2YPKA 2HT4C 1GGUA 5I8OH 3B43A 3GBML 5TH2B 4APQA 5BRZA 2JKXA 5GJTH 4FABH 4NCC2 2OR9L 3C9NB 3QWOB 5E2UL 1MIEL 5HDOA 1AHWA 4PGBB 4J3VA 4KKLC 1EFXB 4XB7A 3O6ML 3IAQA 1HXYA 2KUTA 4DGIH 1R3LB 1PSKL 4LFHG 4NQCA 4G6FD 1UXWB 1EH9A 1U6AL 5E8NB 5EZIL 3ECBA 4OLYL 4MQXC 3FO9A 5CFHA 3FTGB 4YHKH 2NYYC 3RWIB 2ZPKL 2EIDA 3LN5A 3V52L 3VMOA 2VQ1B 4KROB 4D3CH 4LMQI 3GSNB 5F9DC 2FO4B 1OARL 4OF6A 4IS6A 3ARDC 4NKMB 2UZXB 1CFNB 1G9NC 5IJKA 1JCKA 5GS0D 1I9IL 1D5XB 5DURD 4DW2H 1VKXB 1BWMA 1FO0B 3MLXH 3C09B 4N0YL 2A6DB 1HDMA 3W5MA 4Y0GA 5EU5A 4WW1B 3BN9C 5CINL 4I2XE 4Y1AB 1OTUD 5KVGL 2ZOKA 4UV7L 4HUVB 3O45A 4WFHD 1JWSB 2DQHL 4LAJH 3MJ6A 4U6HA 5D2NC 2QV2A 4OM0L 1RURH 4LCCC 1QPXA 4J3OC 3M17A 1ZHKA 4PJAB 4OQ1A 1P7KA 4DGVL 5C0EA 43CAB 2HMIC 4KDWA 4UV4H 1U92B 2IWGA 3HAEH 1BZ9A 2YN3A 2UWEE 1BIIA 4BA8A 1K6QL 4ELKB 4ONHA 4OM1H 4RA3A 2EH7L 3TZVD 3H9YA 2DRUA 5EBLB 5BVPH 5DMIH 4G9FA 4L4VD 1X4XA 4NJ9H 4JFEA 1F4XH 3HLAB 1CF8L 2W65B 4QXUH 4PP2B 3TV3H 2FSEA 3W2DH 2FHBA 3WFHA 4K3DL 4R4BA 4YHOL 4WV1B 3S3SA 3GIVA 5D6CA 5F9JA 1JZ5A 5D96C 4PRIB 2H2PD 2ADJA 4XHJD 5BZWB 4PJFB 4Q6IB 1NCAH 2YPVL 5I1KL 3CFEA 1ZA6B 4JANA 5DMJB 1WQVT 3BQUA 2Z31B 5GGRA 4K8RH 4PLJD 1I3RB 4R6UA 5DTFA 3ARFC 3IXTA 1PLGH 2VZTA 1FFPA 3JWNC 1KPRA 3G6AB 3G5YB 2P5WA 1XIWC 1KIPA 3P77B 1UZ8B 4V2CB 5TFSH 1T0PB 2ORBL 1MUJB 4NCC1 4ZXBD 3QO0B 5I1IL 5E95B 2E7BA 2H6PA 4DN4L 4RGOL 2VABB 4OLXL 2X2YA 2UZIL 3RIFK 1HHIB 2NY6D 1ORSA 5EOQH 3MV7E 5DWUL 1IC4L 2R9HC 2VZ3A 4P4KB 1MCSA 2VLJE 5DQDH 1NEZA 3N85L 4JFFB 2X9YA 5K59F 1T5WB 4ELMF 5KSBB 1OGTB 3DTXA 3QFJB 4CVZA 3L5HA 1AD9B 4G9FE 4XPHL 1OW0A 1Q8MA 4JFEE 5JIHA 1INQB 4WY7H 3ZMRA 4P5MA 2V2XA 3FN0H 3RHWK 1R3JA 2HJLB 3ZYIA 4OGXH 1MFEH 2XA8L 4AY0A 4YO0A 4HEPG 2C1PA 3MMEB 3VWKB 1RJCA 3FQTB 1SM3H 3WO3B 1MJUH 2H3NA 2AV1A 2VXVL 1T7VA 3NZHL 4JAMA 5F8RC 2E27H 2V6HA 4R0LC 4ZUSB 3O41B 3LKSB 4XMLH 5FA3A 2GUOB 3R1GH 2K9UA 1IFHL 4GT7A 3ARWA 3ULUE 5ICYB 2A1WL 1KIUA 4C57C 4X6BA 4OZGE 3BVNA 5DRNB 1J5OH 4WVRA 5DMKA 1RJYB 4HUMB 3QI9B 2QQNL 3U4BL 4LAQH 5DO2C 3VH8B 1JZ3A 4XPAL 3CJJA 2X4NA 3MLUL 3FQRB 2DYPD 4KU1A 5FKAB 4F57H 4GRLD 1IQWL 3RVWD 1CBVL 1FNLA 2OMBA 1EAPB 4NFBA 1MREL 3FO0H 4JM2D 4TPRH 5J7CC 2JF1A 1RUMH 4LU5H 3O6FD 1IGFL 4OF5A 1T5XB 3EYOB 5C2BH 4HXAL 2CMRH 5LJYH 3CXHK 1RHHA 2PTUA 4UIMB 4FXKA 2V17H 4U1HA 3UO1L 4HMDA 4J3SA 2PYEB 5KSAD 1I7ZA 4YBLB 5J11B 2NY2B 3VXTA 2DTML 3GMRB 1H3WM 1LO2L 5F21B 3O2DL 3UC0L 2YBRA 3G6DH 3V0AC 1DANT 5D70L 3RX7A 1UH2A 4U3HA 4OIIL 4K71C 3CVHB 3O9WA 5F1KC 4I13B 5ESQA 3MNVA 4JRYB 3DIFB 4KVCL 3HZMB 3BI9X 3RL2A 3QIBB 1RI8A 3M1BB 4S1SL 1BD2A 1CS6A 4B7IA 3HG1B 1VGKA 3FQWA 4G80B 5C0FB 5J6GA 1CR9H 3RDTB 1KLUA 1IAOB 3WO4C 1JN6A 3P30H 3V6FB 1EK3A 1C08B 3TH4T 5JXEC 1Q0YL 2DWEB 3TT3L 3D2UB 1PX4A 3HUJE 3V6ZB 1SBSL 1X5IA 1EEYB 4XPBH 3SGEH 1C5BL 3C6LA 5ADPH 2E7LC 1KJMB 5GGSB 4BZYA 5FM4A 4GMTH 4HGKC 3HI5L 3T0EB 4P49A 4JG0L 4I3GA 4OB5H 1K4DA 3NGBC 1F6LL 1LO0L 1W72A 3I2CH 4RAUA 4HWNA 1LE5B 3NACL 4S1RH 5DC0A 3CLFL 3UJIL 4LARH 3B8YA 4Z6AT 1H15A 4AL8L 2JB6B 1INEL 2VLME 4KI5F 4UILH 4KK6D 2FWOA 3KPQA 2A77L 2VR5A 4LHJB 3EDFA 3SKJL 5T1DH 3BH9A 5JIIA 3NH7H 2ZG2A 2FR4B 1U8HA 2VC2L 3Q1SL 4ZG1A 4J8RB 4EQ3A 2DQIL 1RPQA 2W0KA 1IGTB 5F96H 3WFCH 4ZAKC 5FYKL 3EUUA 3GGWA 4C56B 3OKOA 3GKZA 3MODL 1ACZA 2VDNH 2AI0L 3V9FA 4LPCA 5C0JB 5E2JA 5E99L 5CBAA 2FJGB 1WLHA 1FQ9C 3D6GA 4PLKD 3SDCD 4TVPH 5DMGC 3EZ8A 2WUCL 4P9MH 1ZA3A 3PGFL 4K2UL 2VLJD 4JHWH 4WO4A 3SBWA 3PDOA 2W38A 1X5JA 1T04A 4YDKH 1IAIL 5IF0B 4DVBB 4G9FD 4JKPH 1NJ9A 5DRZB 4UQ2B 4F9PC 1A3LH 3S6CA 1RU9H 1LP9B 4HLZH 2CIIB 4JFED 4NBZB 5IEHB 3K1DA 4GAGL 1CIUA 5TQ0H 3TJEL 4IJ3B 2ESVB 4M02A 1QYGL 1URLA 4WHCA 5FCUH 4J4PD 5GS1A 5AYQA 5HHMB 4NRYA 5C08E 3KNBA 2KZWA 1U9KA 1ZHBB 5D93C 3BQUD 3NIFF 5JXAL 4P2OA 3QUZC 1T1XB 3WN5C 2R8SL 2HFFB 3ZE1F 3OXSA 1ZK9A 2EDBA 2EIBA 4TSBH 3FT2B 4R8WL 5GQBA 2EDDA 1IL1B 2UY6A 3HZKA 4KTDL 4UDUB 2P5WD 1PDKA 3QISA 4P3CH 5CJ8A 5MI0B 1YMMB 3QG6B 3CLEH 3SKOA 5I19H 1FFQA 3K46A 1L7IL 3PNWA 5DDHB 1A6ZB 3RJQB 3SPVB 2X9XA 2HLFD 5KOVC 4Y8DC 4KKCD 3W39A 5IIEB 4PRNA 1PSKH 4Y16C 2R2BA 4N1CA 2VLRB 3UTZB 3BIKB 3QPQC 5KVDH 2NY0C 3O3UN 3UZEA 2IAMB 2NY3C 1NDMA 3EYQD 5JW4R 3X11A 1AQDA 2IG2H 3MZTA 3ZSTA 4MQTB 5F93C 2VDKH 4X6CE 3WFDL 1ED3B 5E8PB 1RJZA 5CBEA 3NN8B 1RHFA 2B39A 2QQLH 1KFAL 1DL7L 1DN0B 1PG7W 2FX7H 2N56A 2Y72A 5C8JB 4LL9A 2C4FT 1RZKC 1QFUL 2CRMA 2E7CA 2CLZA 1KPUA 3MRKB 1FLTX 2QADD 1GJIA 1UT9A 4Z7WE 4N8VB 3LQZB 3ILPA 2I5YL 4GXVL 4FQ2H 1F6AB 2H1PH 3ARGB 5HDBE 3ZHKA 1QBBA 3QYCA 5IHUL 3WIHA 1CDHA 3AS1A 3PUCA 1OQXA 4H1LG 4P46C 5I1AA 3AVEA 4JGJA 1TJIL 1J1XL 2Z8RA 1XGUB 2IH3A 3CFJB 3W0WE 5CJQL 4Y5YC 3HRPA 2WNGA 3VGEA 3Q5TA 4NFCA 4QWWD 3K1KC 5H35B 1YUHB 1DBJL 1IM3B 3BP6A 4MYWB 2X05A 1NMAH 4NZUH 1FAIH 3T4AB 3C87A 4OAWA 1C5DA 1T03L 1X5YA 3M45A 3MBEA 1NMCC 5F71A 4XC3L 4MGXA 1E6JH 2KZ1B 2AV7B 2OL3A 4MNGB 5I75C 4PRAB 1M7IB 4CRPA 1OAXL 2FJHB 1AXSA 1A14H 1E4KC 1JMXA 4GW1A 4I18A 4EDXB 1YY9C 1A5FH 4JVPA 2OR7A 4EVNB 1UM5L 3QIWB 3SCMB 2OM5A 4H0HB 4MJ6B 1CD1A 3IS0X 5EU4B 4HUUA 4PJ5A 1RZGA 5IMKA 3CK0L 3KPPB 1D9KC 4L9LB 3TJHC 1C5CL 1Z0NA 4XP9L 5GRJL 1DUZB 1FYHB 3S3PA 1JZ8A 4ZPTB 3JWOH 1JYNA 2XWBB 4YE4H 2V2TB 3K3QA 4HWEL 4OLXH 5D1QA 2UZIH 4Q58C 2EXWD 1M1SA 3EGSA 2YUXA 3VD4A 3EYSH 3MNWA 2VXSL 3FB8B 2VDQL 3Q6GH 2NTSP 1F3JA 2DWDB 5ESAA 4XMKH 1NANH 3QEGH 4KTEL 4KK5D 1NFDE 5SWQA 3LKOB 1DFBH 1V8HA 1H5BA 4G8GA 4KTYA 2IFFH 5T3ZL 5C08D 5TE7L 4PJ8B 2XA8H 3RUGE 2X1PA 2IQ9L 3IDXH 4PGJA 5ID1A 2DM2A 3LN4A 4NN6C 5KVFL 3DXAE 4O58L 2VO5A 4KXZH 1U58B 4RIRA 1Q94B 3CDCA 3P40A 4AEHL 2VXVH 3BWAB 3KHQA 1CXKA 3NZHH 5BVJA 3IVKB 4B5EA 5BV7C 3WD5H 3BZEA 2WANA 3MRPA 4XP6L 5F9OH 2AJUL 4OZIA 2JLLA 1Z5LB 4QHKJ 4MX7B 3P0VH 3BP7B 4NDMB 1ZLUK 2I9TA 3WEXA 4LLUB 4RAVB 4U05A 4NN7B 1DBKH 2QQNH 3U4BH 3EOTH 1IGJA 1RIUH 1SHMA 5SV4A 1I8KA 1KTDA 3JXAA 4HCRA 1YMHB 1N0XH 3NZ8A 1TTUA 1MREH 2Y7QA 1D7FA 5E8EB 3RBSA 4NQEB 3H7BA 1FVEB 1QVOA 2FECI 4HZLA 1TQCB 1XEDA 4KK8C 3G6JE 3WNPA 4L29A 4GKZA 1XH3A 3SOBL 2ERJB 5D7SH 5SWZB 1FDLH 1PY9A 1AO7B 2DQEH 1C1EH 2Y36H 5T1MB 3VI4F 2G60L 5EZOL 1J12A 4Y5VA 3MRNA 5HYSA 4Q2ZB 3EJYD 2DI9A 4GMSL 1IAKA 4BQCA 1M7DB 4OIIH 4M5ZH 1ACYL 3R06B 5CEYB 1JIBA 2PF6A 3HN3A 2B8OT 2XTJB 3CPLB 3SDAA 4IOSD 1MLCB 3MYJA 4Y4HA 3HCVA 4P2OD 5IESH 2D9QB 5DJDA 2VDML 3QULA 1CICB 5D5ME 2MQ0A 3KPMA 1NBVL 2ZCKH 5IB4B 1UA6L 5F9WB 2KQNA 5AZ2L 2FO1A 3OAUL 3NPSC 3KPSB 3V6BR 1GZPB 3HS0B 3F7RA 3MLZH 5JNYB 3MA9L 1YPZE 1C5BH 4GBXC 5J12B 4XVJH 3QJFB 4JHAL 5D72H 1F4HA 3HI5H 5FUZL 3VRLF 4JG0H 2XACC 1OHQA 3BKYH 3D69B 5DHVB 1ZLSH 1G0YR 1RUPH 3WFZA 4CBPA 4H8WC 2QSVA 2B1HL 2F19L 2Q76A 1I8IA 1EZVY 1INEH 3NABH 3MRCB 3JV4A 2WBJC 5CWSA 4KUZL 4AQOA 4HWBA 1PD6A 4DKEH 4KVNL 1T1YB 4HK0A 4D0DA 4BFEA 4GLRI 3E3QC 1CE6A 5D4QA 3BZDA 3V6OA 3LEXB 2O5ZH 4LSUL 3KPRE 3KPLB 1EGJL 1NCBH 4YDLB 3O0RL 1B88A 4HHAB 2MJWA 1XGQA 4KMTH 3MCG1 4EN3A 4D8PB 3MLPA 1FCCA 3MLYL 1AP2A 4PJCB 2GJZA 4YNYA 2WQ8A 5IMOB 4QYOA 2BY0A 3OJVC 3BT2L 3BH8B 3QDGA 1WCBB 1IM9B 5E6IA 3T0DA 1ODAA 2FYYA 2B4CL 5D7LB 1MCWW 5D2LF 1XGYL 2BY3A 2LAGB 1INDL 1CT8A 2RJMA 1LK3H 4K7FA 8CGTA 4XC1H 5IR1B 3BE1L 2P46B 4RFEA 1R3HA 2VYRE 1KN2H 1XT5A 1GOFA 3U4AA 2H2SD 3HE7A 1S7RB 4YXKL 5C09E 5DJAA 4OZFG 1VEOA 4QTIL 1DQQB 1LK2A 3MBED 4NOFA 5C0CB 1QYGH 3KR3H 1IGCH 5C0BE 3GMMA 4Z18A 2A6JB 3O4LB 1TVHB 2DBLL 3K0WA 3FMGL 3B2VH 3U0TB 3MJ9H 3SE4C 3EOAA 2CD0A 5IFAH 1KACB 1K2DB 2E9WA 3IJSB 2MQCA 1EJ6A 4HUNB 1OAUH 4F7EA 1BJ8A 2OR8A 1KB5B 1Q1JL 4OFDA 5GGVL 4OFVA 1N26A 4CN4A 5C0IA 3R8QA 3MRDA 4XCCL 2BVEA 4PJ5D 2B0SH 3O6KL 3S7GA 3DUSA 3LD8C 1QRKA 4PRDB 5AD0B 1FZOA 5H37G 2IADA 2HFEB 4LQFH 5D1QD 5IBUB 4LOUD 2YD1A 5FO7A 1CFSA 1DN2A 3EYFA 3QWRA 3IDNB 1WFTA 2XZCH 5HHQB 3GNML 1L4IA 3QQ4A 1ZT7A 5ESVA 5FF6B 1KB9J 1S5HA 1UKSA 1N59A 3BO8A 2R1WB 1JPSH 2GTWB 3N1FC 5I1HL 4X9HA 5EOCH 1JZ2A 4XVSL 1UB5B 2G5BB 1VEPA 1CIDA 3MLVH 1OTUC 5T3XL 1AGFA 2PNDA 1VFBB 4WEBH 1UM6L 2RHEA 5CZVH 4Q9RL 4O4YH 4LBEA 1RUAL 4LVNB 1MF2H 4ONFL 3RY5A 4MZ3A 4WW2B 1HILA 4LPVA 4X6DF 1U8NA 5E4IA 4M8QB 1FLRH 3RZCD 1R3KB 4U1SA 3PGCA 4KRMB 5CD5D 5C0AE 3WE6A 1DVFB 3P4OA 4HGWA 4QOKB 2DQDL 3WJLA 4R2GD 4LDEB 4NYLA 3HTLX 3G5ZB 4OD2A 1UCBL 1PFCA 4N8CL 2QSQA 1Y0LB 3EKCA 1OSPL 2A2QT 2OXHA 2VDLH 1H3TA 2VISB 3VDBA 5CAYB 5HHVL 3UBXB 1ZXQA 5TH2A 4MJ2A 3QWOA 3C9NA 5F88B 4H5SB 4R7NB 3WHE0 4A6YL 4WFEE 1EFXA 1NMBL 2HAZA 1G9MH 3EO0B 3VGHA 5F9AC 5TQ2H 5IMMA 2VLKE 1YDPB 2H2PC 1R3LA 3BKML 4L8SB 4BFGA 4Y4KC 4PP1D 1UXWA 5E8NA 5JOFB 1S7TB 1QFWM 3QXAB 4NWUL 1NPUA 3KHOA 4JJ5B 3D3VE 3VFMB 5CGTA 3SJVE 3FKUS 2ENSA 2DQUL 3QH3B 4HDIB 1UACH 3FTGA 3T1WA 3QUXB 3RWIA 4PLJC 2F54B 4GO6B 1ERNA 3GSNA 5I9QC 2FO4A 4NKMA 4Y4HD 1CFNA 3CZJA 2IBZY 3FHAA 3CK0H 1D5XA 4U0RB 4ZO9A 3BYYA 2ZZUT 3DSFL 1V7MH 1VKXA 1FO0A 2A6DA 4M7LL 4CUCA 4WW1A 1CFQB 2LABA 3D48R 4Y1AA 4HUVA 4GG6B 1ADQA 1JWSA 5DK2B 1UJ3B 3DLQR 2DOCA 3QZWG 1B4JL 3KYMB 2C5DC 2F8OA 1OLLA 4PJAA 3HNTH 1E28B 3ULVL 1OWWA 43CAA 2FEDC 5C09D 5A40E 1CDYA 5KN5B 1U92A 1KTLB 2APWA 1RZIB 4UNVA 4ZTPH 3PGDB 3WDIA 1QPPA 4HFWB 4WWKB 4ELKA 3FFCE 3MV9B 5CEZE 1HIMH 5EBLA 4BH7B 5ISZB 2CUHA 3S4SG 4UMGA 1CWVA 1I75A 1FORL 1V5JA 1CLYH 2FGWL 2ICWJ 4LVHB 3BDYL 3HLAA 2W65A 1BZ7B 3RWDB 3I3BA 2WWKT 1FIEA 4PP2A 3E2HC 3IB4A 4H1LH 3K74B 3P4NB 4WV1A 3ZDXE 4Y19B 4L4TE 5I74B 1RULH 4R97B 5DUBB 4PRIA 3ZTNL 4EN3D 5T33H 5BZWA 4PJFA 2JJSC 4Q6IA 2XZQL 3FB6B 4R26L 2CJUL 1ZA6A 2WLZA 4UAOB 1WWAX 4NZRH 2Z31A 3DETD 2PR4L 1I3RA 1J1PH 3HNVL 4JZJB 3ZYOA 1JGLH 4JM2C 1NFIB 4FTVE 3TT1L 1A1OB 3O6FC 2ICEB 3G5YA 3G6AA 5IKCB 3P77A 12E8H 4Z8FL 1UZ8A 5FUOH 1F4WH 1KJ3L 1A6VH 1FNSL 1MUJA 2Y06H 1XF4B 4QF1B 3QO0A 2NXZB 4Q0XL 2EZ0C 1S7XA 2WBKA 4AIOA 2FATL 3HE7D 3V4UL 2PXYB 1OP5K 5KSAC 2VABA 1EPFA 5EZOH 3H9ZA 1A7RL 4LASH 4N1EA 2EKJA 1HHIA 1CVSC 3EDJA 3VGDA 2BP3A 5MEPA 4GMSH 4P4KA 2FRGP 2ATPB 4XPFL 4YHMH 1QFPA 4JFFA 4ODHL 1T5WA 5AUMB 5KTEL 4JQVC 5KSBA 1OGTA 3QFJA 5IVXF 1AD9A 1F58H 2A83B 1JPTH 4AENB 4F33B 1INQA 5D1XD 1YEKL 4N8PA 4I1NB 2R2HB 2VTFA 4HQQL 5BW7C 1FH5H 2HJLA 4OGZA 3KLHC 3D85B 2EYRB 5DLML 3MMEA 2WM0A 5AZ2H 3VWKA 2G5RA 2ZOLB 3FQTA 3OAUH 4TSCL 5ACLA 3LPFA 1ZVSB 5JA8B 4ZUSA 4Y7MA 3O41A 3LKSA 4YXLL 3MUY1 4W81A 4Z7VE 2GUOA 2KL6A 4ZQKB 2R0ZL 2OJEB 3MRHB 5ETUB 4HPYL 3UTPE 4NM4L 2BVTA 2D7TH 4FXGB 4N5ED 5ICYA 4WFED 5ADOL 4L8BB 1EVTC 1VSCA 3QWRD 2JB5H 4PJEB 3GEWB 4OBRA 1A1NB 5DRNA 3ALXA 3LZFH 2B1HH 1RJYA 3QI9A 2VLKD 3VH8A 2M26A 3FQRA 4KK6C 5E03A 5FKAA 2JK5B 1KC5L 5KOMC 3D3VD 3SJVD 4WI2A 1EAPA 2Y5TB 3QT2A 3QHFH 4X5LA 1VDGA 1T5XA 5CZXD 1NAKL 3EYOA 4XP5H 1KELH 4HMEA 2XA3A 4EI5D 2PO6D 1OAZH 3PP4L 4MAYB 2QR0B 4LSUH 1YQVH 2DICA 5HVHB 5I18L 4DQOH 3PL6D 4UIMA 3ARZA 3LVEA 2X4SB 2PYEA 2OP4H 1I3VA 3GMRA 4U6XB 3QCVL 2AXFB 1GGBL 1YNLL 3C8DA 5M94B 4TULL 1P9MA 5FGBC 3CVHA 4G6AD 5L8LB 1ZS8B 2D7QA 3SDCC 4I77L 2QTEA 1IVLA 3NFSH 4JRYA 1H3XA 3DIFA 2JIXD 3HZMA 4CVXA 3QAZC 3QIBA 2BNRE 3M1BA 1DQMH 1HYRC 3HG1A 1K85A 3SE3C 1HINL 1J8HB 3CFCH 2QSCL 4JLRB 5C0FA 2DQJL 1R5IB 3OWEA 1AXTH 4HAGA 3RDTA 1IAOA 3O2VL 1F00I 3V6FA 5IV2B 4QTIH 1C08A 3LH2H 5AAWA 2DWEA 4J3UA 5CEZD 3D2UA 3V6ZA 4JO2L 2IBZX 1EEYA 3RWCB 3FO2B 4J4PC 4S1QH 1KJMA 4MLIA 5GGSA 3FONB 3GJEB 4QXTB 4KRLB 1S7VB 1UM4L 3T0EA 4I5BB 4LSPL 5DD1H 4HIEB 4R3SB 4HC1L 1LE5A 3B5GA 3BPLC 2Y1VA 3L7FB 4L4TD 4MHHG 3ULUC 4JRWA 2NR6D 2JB6A 4MWFB 1GH7A 5IT2L 1QO3A 2J88L 4DFIA 1MCJA 4ISVB 1XF2B 4E0RB 5SWSB 1HSBB 2PYEE 3AMLA 3CAFA 5I73C 1TITA 3PE9A 1KUMA 5T1KD 5D1ZB 2FR4A 4WCYL 4J8RA 4KKCC 3VXQB 5EU6B 3RVUD 3MJ8B 5INCB 1MFBH 1IGTA 2ZJSL 4FP8L 1DQDL 5EPMB 4XVUC 5EWIL 4UTAH 5JMOC 4C56A 1FV1B 3EYQC 1Y6NR 3GNMH 1MJ8L 3L3DB 4K7PH 2GK2A 4P9HC 3RNQB 2ENYA 2EC9T 4NQXB 1LMKA 5C0JA 2FJGA 2YD8A 1SYVB 1DQLH 1WT5C 1MH5B 5K59E 4XVSH 2X9WA 3ME0A 3AREC 3ET9F 4NQSB 2FX8H 3BHBB 3OKMB 4X9GA 4DVBA 5IF0A 5DRZA 2QADC 4PRBB 4UQ2A 3GUTA 5DC4B 1LP9A 2CIIA 3C2AH 5IEHA 4X80L 1JRHL 4P59L 5DUML 1BFSA 3NAAH 5GXBB 1GSMA 1HWHB 2CR6A 2NY1B 1Z3GL 2ESVA 3MTRA 4YAQB 3O11B 4PRID 3OJDB 4NT6B 1JHKL 4K8RD 1ZHBA 4F15C 5J4MA 5FA4A 3U82B 3RA7L 1T1XA 3HC4L 3UTPD 1W8OA 4ODVL 3FT2A 3VCLB 4M6NH 4OZFH 4D9LL 1IL1A 1OSPH 2CRIA 3RVTD 3MV11 4IOFC 4UDUA 4A6YB 4HK3N 4KK9D 5FYJD 4X9FA 3GMNB 1YMMA 3QG6A 5IEKB 3ZT5A 4WDIB 4NBYB 3CSGA 1A6ZA 5DDHA 3SPVA 5D7JB 4Y88A 4U6VL 1JK8B 2XOTA 3WBDA 2V9QA 2NY4B 4OI9A 5ACZB 1CD8A 3SGJC 2VLRA 3UTZA 4XNQB 3BIKA 5ID0B 1J0YA 4BSVB 5I1DB 2IAMA 4WI4A 1KCUH 4PJHF 3VJ6B 2YZ8A 4PBXA 1YN6A 4QRPB 1ED3A 5E8PA 3HHRB 4ONOA 1UEYA 1FCGA 2P44B 1QFWI 2VR9A 3NN8A 4LCWE 1V05A 4JZNB 4QT5B 3U6RB 5H37H 4QO1A 4BZ2H 1DN0A 4YEFA 4JQIH 4M7LH 1TETL 5C8JA 3BRDA 2FD6H 3EO9H 5TE4L 4LVOB 3MRKA 4DCQB 2XNAB 4N8VA 5HHME 3LQZA 2BNRD 1JZ7A 3L3OB 2EXWC 1P4IH 5CUSL 3BXNB 3S34L 4LLDB 1F6AA 1CTOA 3J8F7 4JRXE 3ARGA 3SE9H 3ULVH 2I07B 1X5HA 2ARJQ 5LKNA 1AQKL 4LSTL 4KK5C 2EDQA 3BFOA 3CFJA 4KKNA 4AH2B 2FH6A 1WF5A 1MWAH 1OD9A 1YQ2A 4HS8L 4ELMB 3BGAA 5H35A 2RBLA 1YUHA 2AEQL 3QEQE 1HEZB 3C5ZC 5K9QG 1FJ1B 1T6WA 1F3DH 1IM3A 4AEIH 5EZJB 3UTSB 2VLRE 4PJBE 3RNKA 3OV6A 1KCVL 1EV2E 2H8PB 3T4AA 2VN7A 4NO5B 4UZGA 2B5IC 5SV3A 4H88H 1TQBC 4DGYL 2AV7A 2PYED 4MNGA 4MZ2A 4MMZC 4PRAA 1M7IA 2FJHA 1IAMA 1JNJA 2DN7A 4EDXA 2XI9A 4PLOB 3VXSB 2NY7H 2DJUA 1IGYB 5E2VH 3QRGL 1QBML 1FIGL 4EVNA 4HIJA 2QKIB 3QIWA 3SCMA 3W5NA 4JRYD 5EU4A 4JGUA 4Z8FH 4K55A 3KPPA 1S78C 2YR3A 2OZ4L 4L9LA 1RIHL 4FS0A 2FHFA 1LDPH 1DUZA 4M43L 4Q0XH 3ARPA 4Y4FB 3PXJA 5BV7H 5DT1L 1S9KC 4ZPTA 3C08H 2XWBA 3FQUB 2V2TA 1FE8L 1OQOA 3GMPB 4U31A 4E41E 4TNWF 3D2UD 5F6IC 1NFKA 2R69L 4NM8L 4NKQB 3RL1B 4XPFH 2ZCHH 4WFGE 3FB8A 2Q86B 2DWDA 3S36X 2W1NA 3WKML 2E8ZA 3LKOA 5HJ3B 4GJTB 2XZZA 4OLEA 3PWPB 4LIQL 4PJ8A 4NO0B 3STBA 4YK4B 3SGKC 5I1LB 4QHLB 1U58A 4XTRC 1Q94A 1OSZB 3BWAA 2P45B 4WGWB 4AEFA 1HZHH 1YEGL 3DECA 4FQXC 3DRTB 3QR2A 3RHWF 4QHNB 4MB4A 4OCYL 3LDBC 3VFTA 2V7NB 4MX7A 4L4JA 4PJ7F 3BP7A 2E6PA 4NDMA 3MRQB 4C56D 4LLUA 3IDMB 4OD3H 1DBBL 4PB0L 2Q7YB 4Z0XB 1NCCL 1N2RB 2P5EB 4YGAB 1LO5B 3ZE0F 2VKXA 1E4WH 3RU8H 1JPGB 3WJJA 1RZJC 1RK0B 1YMHA 2NZ9D 4MA8H 1K4CB 4OJFL 1PW3A 5E8EA 3WLBB 5ANME 4NQEA 3UX9B 2QBWA 4JFZL 5L2JB 1FVEA 4IRSD 3Q2CA 4JDTL 2X89D 2OI9C 2DI8A 3PP4H 1IKNC 2Z35B 3BP5B 1MI5B 4WUUB 2R0LH 4LCWD 2CH8A 2D7OA 5SWZA 2XKNB 3O2DA 1AO7A 1FL6B 2JCCF 5T1MA 4DK3A 1AC6A 1PVHA 2R2EB 3DO7B 1UG9A 2ESVD 3WUZA 4Q2ZA 4PV8B 5DF0A 1CU4L 1JE6A 1M7DA 5HHMD 1N5YL 3R06A 3P73B 5CEYA 5EA0L 2NXYC 1A64A 5IOPB 3GZKA 4XAWL 3CPLA 1HK6A 2DKMA 1MLCA 3JV5A 4JRXD 1IKNA 3HC3L 4OV5B 4UNTA 3MPCA 3X3FL 2GAZB 3FAXA 1SVCP 3A67H 2GK0B 1GGCL 5KANG 2H2SC 4ZUTB 3U1SL 4CVUA 3O2VH 3LB6C 5IB4A 5DJZB 3T3MF 1QTYT 2HH0L 4HSQA 4KPHH 3KPSA 3ZKXB 1GZPA 3HS0A 5T5NG 4Q74A 3UBXI 2F5AL 1P5VA 4O9HH 5JNYA 4PRHB 2BRRH 1TDQA 4HT1L 3VFNB 3QEQD 3QJFA 4OCSH 3QCUL 2VLRD 4MD4B 1CK0H 1G9NL 4LSPH 4EEEA 3D69A 1IC1A 1ULVA 4U4BA 2PUQT 1N7ML 1W0YT 3LSOB 2IMNA 5IMLB 4RISH 1U93B 4HBQA 4L3CB 1C12B 5SX4H 5BO1L 3MRCA 5IT2H 1QSZA 2EEAA 3K2MC 5L0QB 4P99A 3TVMC 4JFXB 3FB5B 1T1YA 4R4FL 3QSKB 4WHDA 1G0DA 1EBAA 4UT9H 4OFKA 3LEXA 3LCYA 4R9HA 4OSUL 1HH6B 3KPLA 4MA7H 2VQUA 4LOUC 4HHAA 4CMHB 4RFOL 1KXVC 1MCPH 4NC2B 2J8OA 4D8PA 4PJ9C 5TPWH 1CZ8L 4FHBD 4PJGF 1MJ8H 1NL0H 4PJCA 4AMKH 3CCHB 5IMOA 3BH8A 3DVFA 3TVMA 1P7QB 1H3VA 4OT1H 4UT6L 4WEMB 2KKQA 1WCBA 4WEUD 1IM9A 4C83B 1MPAH 4E41D 3E0GA 1JGUL 1JYXA 3DUUA 5D7LA 5EB9A 4CKVX 4QEGA 4WFGD 4CAGA 1BJ1J 1AI1H 1JWMB 5GGQL 1U2CA 3QUML 3KWWB 5IR1A 5TDPB 3RRQA 1I7TB 3O8XB 2R29L 1O5DT 1DLHB 4ERSL 2RQ8A 1NLDL 1DQQA 1GIGL 3ZL4L 4RQQB 1P84J 5C0CA 2WZPD 1PKQB 1X5FA 3MZGB 4KHTH 4MXQD 3RZCC 4MAUH 2A6JA 1C7SA 2MOVA 3O4LA 4YUEL 5CD5C 4B53A 1TVHA 4OCXL 2NW3B 1ND0B 4R2GC 4M1GH 1K2DA 3IJSA 1TIUA 3TNNB 3RA7H 5GS0H 1G6RB 1GGTA 1KB5A 4YFEA 3SCMD 5J3HC 5FYKE 5LXGH 2HRPH 2F53A 3D9AL 4NNPH 5I6XC 3VXMB 4BQ9A 3FCTB 2YA2A 2EE6A 2J2ZA 4PRDA 5AD0A 3I50L 4YBQC 2HFEA 4IMKC 2O26U 5DSCB 3WNOA 4PP1C 4P2QE 4O00A 4TTDD 1TPXC 2VQTA 4RMRA 2VXQL 3V4PH 1RMFH 1D6VH 3IDNA 2EEDA 5HHQA 5FHAL 3KLDA 3TBYB 5GPRA 35C8H 1JWUB 5FF6A 4XXCC 3F5WB 4LLYB 3BRFA 1KSRA 2BRQA 2M8XA 2R1WA 4K23L 2GTWA 4W4NA 3GK8H 3U0WL 4FFWD 4P2CG 2GCYB 2DI7A 4OLZL 1I3GL 4PJ8D 5J1SC 3WXWL 1UB5A 4JM2F 1WC7B 2G5BA 1A6TB 2AQ2A 5BS0B 3KYAA 5JW4Q 1VFBA 5IB1B 1TNMA 4OZ4B 1Z6JT 5DEFB 4KRPD 4KHXH 4XBEH 1CDBA 3S34H 1WGOA 3UDWA 2YWYA 3Q3GB 2DQGL 4HPOL 4WW2A 4R96B 1T7WA 4JY5L 1YEFL 3GJFB 4K94C 4M8QA 1R3KA 3RP1A 5KS9B 1A1MB 4X7TB 1QSEE 2X09A 5LGJB 2C3XA 1DVFA 4M62L 4ZO7A 2V2WB 4QOKA 1I1AC 4RZCB 3V0WH 3VGBA 5HD8D 4U3XA 1F4YH 3RI5F 3A6OA 3LS5H 3G5ZA 4Z7UE 2G2RB 3QO1B 3QXDB 4N0UB 4TRPH 4YHZH 4ZPVB 1WAAA 1DANU 1ORQB 1R5WB 1Y0LA 4LSRL 3RKPA 1NCDH 4NQED 2QHLA 2VISA 4L1HA 4X7CC 3UBXA 4OGYL 2GY5A 3LS4L 4G9DB 4JREB 2UWEF 5F88A 1IBGH 4H5SA 1GC1C 4R7NA 3V8OA 3MLSL 5H94B 5B22A 2IC2A 3EO0A 3DYOA 1OPGH 4JM4H 1YDPA 5HDQL 4L8SA 2BNQE 4X5WB 3WFBL 2DDQL 4GFTB 5JOFA 1S7TA 3QXAA 4JJ5A 1OD7A 2Q3AA 5JOPE 3QH3A 4HDIA 4HJJL 3K8LA 2I26N 2X1XR 3QUXA 1HNGA 2F54A 1RFDL 4MXWL 4HXBH 4R90L 2DKUA 1DDHB 2QSTA 3IDUA 3MR9B 4WNQB 3EFFB 3KAAA 3C8HA 4MMXC 4S2SB 1BEYL 1I8LC 1A9EB 4M93B 1KIRB 1CICD 2B7DT 1CFQA 3VG0L 3ZKMD 5FAAA 3CVIH 3U7AA 4GG6A 2YD6A 3KPSD 2J6EH 5DK2A 5C9JB 1T4KB 5J89A 1UJ3A 4O51B 4ODSH 1UWGH 2R69H 3KYMA 5A2JH 4FOMA 1E28A 5HHNB 4HS6B 5KN5A 1KTLA 5DGQA 1RZIA 2AEWA 1GOGA 5F97E 5D1XC 3PGDA 4EDWL 2GSIB 4HFWA 4WWKA 4PTUB 4RFNC 3G04B 3MV9A 5HGBB 2AGJL 3UPCA 4BH7A 5ISZA 5C0NC 4JB9H 4WHYG 4YXHL 3U7WL 5L2KE 1JNHB 2QLVB 1MHEB 1CXEA 1QR4A 5JOEA 4GRWE 5MHSE 1T1ZB 4FRWA 1F90L 1BZ7A 3RWDA 2VDRH 5EO1B 4UBDC 1IARB 3PQYB 4I0PB 4HBCL 3LRHA 5FYKD 4KAQL 4OCYH 3P4NA 4Y19A 3F65A 1JV5B 4H26B 5DUBA 4NUJB 1E4XH 1WZ1L 3L3IB 3GMLB 3VFOB 5I15L 3H3PH 3FB6A 1ONQB 1YYML 1DBBH 4NQDB 3RIAF 4D2NA 2V5SA 4ZO6A 2YPLE 4F8QA 1KJ2L 3TA3B 2YXFA 1YEIH 3B9KB 4KJQC 4JZJA 1FL5B 5JHDA 1NFIA 5D7LD 1DE4B 1A1OA 2ICEA 3ULUF 5IKCA 3T08A 4EI5C 2BHYA 2PO6C 1TENA 1AGBB 1XF4A 3PL6C 4QF1A 2R4RH 5JHLL 5FCSH 1BAFH 1IZJA 2LTQC 4PJXE 1MJJB 4DZBB 2BFVH 4KFZC 4TOYL 5ICZA 5C0CD 5T3ZE 4LPYA 1L9NA 3MGOB 2ATPA 1MCIA 3O4LD 1RIVL 3O3AB 3U7YL 5AUMA 3SO3B 2R0KH 4LLQB 5SX5H 2EKSB 3QDAA 4U1GC 1U3ZA 1JVKA 3CUPB 2A83A 4WJ5B 4ZFGL 4AENA 5FO9B 5KW9L 3LKNB 3O2WH 4F33A 1GCFA 1OP9A 2FBJL 1HDMB 2R2HA 3LMJH 1D5IL 1QSED 4OF8A 2ICCA 4ZODA 2O93L 3D85A 2EE9A 2EYRA 4U7SA 5E2WH 3NIGE 3PDGA 2FX9L 4GUPB 2YRLA 5F7WC 4ZOAA 4ZO8A 1BFOB 2ZOLA 3MROB 5D2LB 1AIFA 3D25B 3DJ9A 1D6EB 4WIQA 5T5NF 3ARDB 1OAQH 4ZDHA 4ZQKA 2OJEA 3MRHA 4ONGH 1BZ9B 3QCUH 4PIRF 5ETUA 4OTXL 1F3DJ 2NY5L 3WIHL 2C4FU 2ZUQC 4FXGA 4LK4A 1TLKA 3UZVB 3WMSA 4QNPE 4L8BA 1NGXB 1NGPH 1FRGH 2GJ6E 4PJEA 5BZDB 1A1NA 1RZ7H 2NR6C 4HFUL 3N9GH 1R24B 2BNQD 1BHGA 1RZKL 2JK5A 2VDPL 4OCNC 5D2NB 3RPKA 4LCCB 1ZLWK 3PP3H 5LAXB 2SEBB 4G8FB 3WV0A 2Y5TA 2YOCA 2FLRT 2C3VB 1TZGL 3L5XL 2AW2A 1T0NB 1ZWIB 3DX7B 4MAYA 1WCQA 1F8TL 2QR0A 5D6CB 5FGCB 3X3GH 1BLNB 1GL4B 1IGIL 2J7LA 3UTTE 2DJ4A 2R4SH 3P11L 4NKIH 4KGJA 4POYA 4RFOH 2X4SA 2IPTH 2OL3L 3H42L 1P2CB 5DC9B 3VD9A 4PJDB 4U6XA 1CZ8H 3OX8B 2AXFA 5HGDB 1LO4H 5B21A 5CJXA 1DQJB 4TVSa 4UT6H 3WLWC 1FNFA 1ZS8A 5HYSG 3CNKA 3HZYB 1VFUA 4LDOB 4F7CB 4OGAD 4QOKD 3T2QA 1PZ5B 3QUMB 1TVDA 5ERWB 3OXRB 3FT3B 5FYLL 2PW2B 4QXGL 3HE6D 5D96B 1WTLA 5I71C 3QA3B 1J8HA 3QIUD 4JLRA 5IJVB 1R5IA 5DK3A 5GRUL 4HEME 3FT4B 2AJXL 8FABB 3SGEI 5IV2A 4YDIL 2A6KB 2P1YA 1H8OA 3ARFB 3RKDC 3A6CH 5MENB 5L2KD 1G1CA 3RWCA 2FLBT 3FO2A 3H9SB 5MP6H 2PTVA 5FFLA 1D5ZB 5MHSD 1XIWB 3FONA 2NX5B 1I85C 3GJEA 4QXTA 3VWJC 1S7VA 4XBPB 4K8RC 4I5BA 5CIPB 2QEJA 4OCWL 4HIEA 4R3SA 3X17A 4J12A 2C26A 3K2UH 4EUPG 3L7FA 4RNRB 2F54D 3WIFB 5I1CL 4PB9H 4X6DB 2UUDK 2Y6SC 2ZCLL 4MWFA 4ENED 4I9WE 5C0RH 4R7DB 1WIPA 3RVTC 1X6NA 1YY8B 4ISVA 4XNXH 1H3GA 4H1LB 4JO1L 1XF2A 2W07A 2XG5A 2AABL 3QNZB 5SWSA 1XF5B 4E0RA 3SDDA 1FBIL 1HSBA 2YPLD 1X5AA 1XGPB 4XCEB 5AZEH 4KDTA 1JHTB 4AIZA 4G6JH 5D1ZA 5EZLB 3QJHB 5JLZB 3VXQA 4CNIB 4MD0B 2CK0H 3MRLB 3MJ8A 5EU6A 5INCA 1JZ4A 4U7KA 3OPZL 2AK4E 3BPCB 3IFLH 5EPMA 1U8QB 4FG6D 4NN5C 1DP0A 4J6RH 1FV1A 5FHAH 3RNQA 3L3DA 2AJSH 4NQXA 2PN5A 2BJML 4FQIL 1OM3L 2ID5A 2KPNA 4HCRL 1Q0XL 4R0LB 5IW1B 5T3ZD 5DJ6B 4F7TB 4F58H 4OLZH 1MH5A 5BJTA 3KXFE 1YEEL 3MV9D 4LPUA 4I8DA 5A2IH 4W6XB 4X4ME 3UJJH 4NQSA 3BHBA 3OKMA 2FEEI 4XGZB 5JZ7D 1F11B 4PRBA 2BMKB 2IPKB 4X6CF 2BVYA 1YJDH 3TN0C 1RUQL 4YC2C 1UADC 4HPOH 2W92A 4YAQA 4Y19D 2M2DA 3O11A 1MJ7L 3OJDA 3PWJB 4NT6A 2VMFA 4I0KA 1OP3K 4URTB 1T1WB 4Z7WF 1Q9LB 1LO3L 4PY7B 3FQWB 2D31B 3IDIB 1PY4A 1CGYA 1KLUB 1H3PL 5HDBF 5LCVH 4XP4H 2IPUK 3I02B 4WTWA 4NJAL 4A6YA 4I3SL 4TQEH 3GMNA 5IEKA 1YEJL 3ILQD 4L3EE 4K71B 2LU7A 3OAYK 4WDIA 2XICA 2DJSA 5D7JA 3BD3A 5IQ9B 1JK8A 3SQBA 1HHKB 2PXYD 3TWCH 3QG7L 1K4DB 5ACZA 1SY6L 1WWBX 5C2UB 3QXTA 4XNQA 3VI3E 2XKUA 5ID0A 4GQ9L 3FRPA 4M3JA 4HJJH 1W72H 4BSVA 5I1DA 4WUKH 3WO4B 3VJ6A 4MXWH 4CDGC 5T3XE 4QRPA 1KCSL 3L95B 5EORH 3JSSA 2BK8A 4IEFB 1UYWL 1A6AB 4JZNA 4QT5A 3U6RA 3WS6A 4F2MB 4LP5A 3MACL 1WEJH 3W9DB 4D0BB 3IJYB 5IGXL 4UUJB 3D85D 4G8IB 5FO8B 5ITBH 2E6JA 4L5FL 3NGBB 5L88H 4K9EL 4DCQA 3V95A 4J3XA 2XNAA 4QGYA 3F7YB 3TIEB 3PJSB 1MSPA 3L3OA 2X1QA 4M7ZC 1FG2B 3TBTB 4FFYH 3VFVB 1T7ZA 3WDJA 4H8WL 7FABH 3BXNA 2BDNH 3QEHB 4LLDA 1KLGB 1NDGB 1I3UA 3F62A 2R0WH 3IT8D 2I07A 4PY8J 3MRRB 3L6FB 4X98B 3CXHJ 4ORGB 2ATKB 4NUGL 3BPNC 5E5RB 1AR2A 4AH2A 1NSNL 5I1GL 1MCCA 1ITCA 4YHPB 4ZAKB 1UKQA 1NCTA 4ELMA 3OZ9H 4GW4B 4BYHA 5IVXB 1HEZA 2WIIB 5IFHH 1FJ1A 2MHAB 4RMWA 4L8DB 2CDEB 1HYSC 5EZJA 2BVQB 5DJXB 3S98A 15C8H 3I84A 3OKYA 1T83A 3MBXH 2H8PA 4RGNE 4I9WD 4I3RL 1NFDF 3BDBA 4N90E 4NO5A 4HBCH 3GI9L 4XWGL 25C8H 1KEGH 1WZ1H 4LCIH 4H20L 3RUGF 4V2BA 6FABH 1CGSL 1DBML 1KJ2B 5AWNH 4JN1H 4JQXA 3VXSA 1I4FB 1CDGA 5B38B 1IGYA 3ARBC 4TUOB 5BMFH 1PZUB 3OHXB 3GSQB 1BWWA 3MRBB 5I8CB 1L6XA 4DKFL 2E3VA 2MQ3A 1AJ7L 2OTPA 3LQAH 2QKIA 2B1AH 1C7TA 1K3ZA 4IRSC 2L4OA 1FGVH 4BZ1L 4DWHA 5AYUL 2XZAL 1OY3B 3QHZL 3ULVE 4N0CD 4LEXH 2K7QA 4PRNB 5DD5H 2DKSA 1Y6KR 3MXWH 4Y4FA 5IUSA 1XAUA 3BMVA 5D93B 1RZFH 3DV4B 2VXTL 2GSGB 2VSCA 4KQ3H 3FQUA 4OZHE 4DZ8B 3QUZB 3RJDA 3WN5B 3GMPA 3OGCB 4LCYB 4XCNB 3P4MB 4ZMAT 3RL1A 1NANI 4GSDH 1OAYL 1RJZB 1MFAH 4WTXA 5B8CA 5D6DC 4HWUA 2DQCL 4F7MB 2Q86A 4JPVH 2DMBA 3SDXE 1LE9B 3G6JF 4NHCH 4QRRE 5MEOB 2VSDA 2OTWB 4KC3B 1F2XK 4Z77B 4O02L 3TO4C 1MCOL 3LKQB 3UTSE 1HKLL 4Y16B 5HJ3A 1WZLA 4KXZI 1D5IH 3PWPA 4KQ4L 4X9BA 4NO0A 5JW3H 2NY0B 4HUXB 5I1LA 4QHLA 5JR1L 4RBPK 2NY3B 2UV3A 3QDJE 4F37F 5F8QC 3NA9H 3CD4A 4UT7L 1OSZA 5DJYB 1F5WA 3DRTA 3KJ4C 5HYJB 1G0XA 4QHNA 3EFDH 4F9LC 3F7VB 3VXRB 1JFQL 1FGNL 2EO9A 5F7UA 1S5IL 1FYTB 3INUH 3QDME 2V7NA 2NY5H 4KI5C 4KV5E 1QLRB 3L5IA 2WINB 2EDHA 5D5MF 4OZFB 5EOTB 3L1OH 2VOTA 3MRQA 4S0TD 3IDMA 4X9IA 3T09A 2EC8A 2Q7YA 4Z0XA 3FZUC 1N2RA 2P5EA 1JGDB 1LO5A 1JPGA 4JG1H 1YPZF 1TJGL 1RK0A 1GHFL 5GISL 1K4CA 3WLBA 1BIHA 5B4MC 5DD6B 3P0YH 5L2JA 3CMOH 4S1DC 4KKBD 4PGEB 3EJJX 5T3XD 1H8NA 2W9DL 4KZEL 2YUVA 5C6WH 2CDGB 2Z35A 1MI5A 3BP5A 4P46B 3T1FB 2XXCB 4WUUA 1PX3A 2GIYA 1G9EA 2PW1B 2XKNA 4Y5YB 1TXKA 2OL3H 3AM8C 1FL6A 4BFBD 2ZUTA 4U33A 5GGTL 2NY1D 1IILE 2R2EA 3DO7A 3L3HB 4PV8A 5EUOE 3TIDB 3P73A 2DLHA 1CE1H 3QEUB 1CD1B 1AY1H 5IOPA 3GSNL 2IANE 1OAKL 1NMCB 5JDSB 2OXGA 3RY4A 3BKJH 3IRPX 5HY9B 5FYLH 4K7PY 4OV5A 1S8DB 1FNEB 4OF3A 2GAZA 5I75B 2GK0A 4FQ1L 3MOAL 1Q72H 4J1UB 4ZUTA 3BYTA 3MCLH 2VH5L 4HGMA 5DJZA 1NLBH 1XGRB 3OAZH 1YYLL 4QHMB 5C0GB 2WUBH 4PRHA 5D7JD 4RWYL 4MXQC 1QLEH 3VFNA 3E6FB 4LCUB 3AS3A 4S11A 1I9RH 5D9SB 2X1OA 1MWAB 2IQAB 4FQJL 1IC5L 7CGTA 4AZ8A 4MD4A 1NAMH 1D9KB 3IU4H 1I9JL 2XQBL 4G6KH 5CHNB 4N90D 5L7XH 4YZFE 3WSQH 1HN1A 3LSOA 5IMLA 4MQSB 1U93A 1N6QL 4L3CA 1C12A 4LSQH 2DL9A 3CXDL 4X7FC 1T66D 5DJCB 4PG2C 4JFXA 4DUVA 3FB5A 1FPTL 2BY2A 4XNMA 2GITB 1U8PB 1QSFB 3WHE1 4YGVA 1NEUA 2CLRA 4ZS7H 2IBGA 5C07E 4OD1L 1VGEH 2X4UB 1OGAB 4OLVL 4PUBH 5ELIA 1HH6A 5LWYH 1U8OB 43C9B 4TTDC 1E0OB 5EUKB 1A6WH 4NKOB 1J1OH 4XAKE 3ULVD 3ARYA 5AEAA 2DLIA 3DHJA 4NN6B 4V1DE 3VXUE 2YD2A 4IDJH 1BFVH 3NZ8B 4FQIH 4NQVB 2Y23A 4C83A 2I24N 5ILTL 1CVRA 2ZUYA 5J6HB 3VXOB 2HT2D 4W6WB 2J8UB 4PJHB 1JWMA 2YC1B 5D7IE 3KWWA 5TDPA 1I7TA 2P8PB 3O8XA 3MGTB 1U3JA 5IK3B 4MS8D 4KUCD 5EU3B 1AD0B 3ZDZE 1Y18B 1DLHA 1U3HC 4KRPC 3UTSD 5GHWL 5HVFB 4Z95L 5FYJU 2X41A 4HIIB 1Z9OA 4RQQA 3JWDH 1PKQA 3B2UC 5HI4D 1SJXA 3QDJD 3VW3H 2DIJA 2NW3A 3B4NA 2VIRB 3QUKB 1ND0A 1YZZA 5E4EC 2BSED 5HD8C 3QZWB 4LLVB 3TNNA 5ALCL 1G6RA 1S7SB 1N8ZB 3QDMD 1G7PB 4IIQC 3RTQD 3KPMB 3PWUB 4MJIE 4P3DB 3LRSB 5HI3D 5A43C 1T2QL 3RVXD 3O6LL 1JL8A 4DTGL 2VZUA 1S9VB 3VXMA 1MQKH 4XVTL 3FCTA 5KAQG 4Y4FD 4KZDL 1AR1D 5HHOE 2HFGL 3FQNB 3T0BA 5DSCA 3OQ3B 5HHPB 3JUZA 1VFMA 4JHZA 4C4KO 2VJXA 3G5XB 4RSVA 1BMGA 4K94H 1A4JB 1BM3L 5I1JL 1U95B 4QRSB 2BHZA 3TBYA 4JPWH 1JWUA 4W4OC 2JCCE 1TJHL 3F5WA 4LLYA 5DHYB 3NPSB 4UTBL 4CU6A 1FC1A 4HWBH 4R4ND 5BXFB 5FM5M 5FHBH 3LPWA 4X83A 1W8NA 4GBXB 4PPTA 2R23B 1CE6B 2GCYA 3C60D 4DOHE 3MO1B 3PWPD 1CICC 1WC7A 4M61B 2HTLC 4FN0A 1A6TA 5BS0A 2IAND 1GC1H 3ZKMC 5EDXA 2DD8L 1ZT4A 4K9EH 3JTTB 1D3CA 5HYFA 5IB1A 4OZ4A 4I0CC 5DEFA 2F58H 4P23D 2OBGA 3EDEA 1JNNL 2WBJB 3EYVB 1F3RB 3HA0A 2E9JA 3Q3GA 4BFIB 4IRZH 4R96A 4XP1H 4B7LA 4GG8B 3GJFA 2X4QB 3BEVB 2NNAB 1NGQH 5KS9A 4MA1C 1A1MA 2ED9A 5LGJA 1A7PH 5IBTL 5A2KH 4RZCA 1NCWL 5AG8A 3H7LA 1MY7A 4M5YL 2P5ED 1NSNH 4G5ZL 5IG7B 3DWTA 2G2RA 1UVQB 3QO1A 3TM6A 3QXDA 4N0UA 4ZPVA 4ZUVB 5CJBA 2ARWA 1ORQA 4K3JH 1R5WA 3E8UH 3U36B 4G9DA 4A2LA 4FNLL 1CLZL 1A2YB 5H94A 4WI8A 1JPFB 1MI5D 3IDGB 5JORB 1KLFA 4M7JL 4X5WA 2VNCA 4J7RA 2I60L 5C07D 1CGSH 4L4VE 3HMXA 3HNSH 2VL4A 4X4XB 1SJEB 2H41A 1WBYB 4FFZL 3GM0A 1E4JA 3T2NH 4HG4K 2ZNXA 1AJ7H 3EW3B 2A38A 4XAKD 2OJZH 2O5XH 3ZDXF 1DDHA 1LILA 4KMQA 1DQTA 2OZ4A 4BZ1H 3VXUD 4FMKA 1NBYB 3MR9A 4WNQA 4DFHA 2EDJA 4M48L 4S2SA 4WTZG 1A9EA 1KIRA 3JV0A 3TYGL 3U30C 4ZD3L 4NQTA 3QPXH 1EMTH 1T4KA 3KG5A 1IKFH 1YNKH 3MNZB 4O51A 3I75B 2QJDA 3O81A 3ULUL 4N8VG 1OAYH 3MFFB 2W9EH 3HI1B 3GBNH 2VDOL 3GHEH 2DQCH 5HHNA 4HS6A 4JY6B 3KPOB 4ETYA 1P4BH 3LD8B 4JFDB 3X12B 1MCOH 1WBXB 2DQTL 2GSIA 4PTUA 5EFIB 1RZ8B 1NBQA 3G04A 3SKUD 4KQ4H 1FFNB 5HGBA 1B6UA 1ETZA 3S35L 4UINH 1JNHA 1K8IA 2EC9U 1MHEA 3PDDA 1T1ZA 1ZOXA 2WLYA 4FZEH 1BQUA 1LWRA 1J18A 1K8DB 3WNLA 5EO1A 2AJVL 4P9HL 5A3ID 4MJID 1U41A 2Y25A 3PQYA 4I0PA 2R56H 4YQXH 1S5IH 5DURB 2L7JA 1JV5A 4H26A 4NUJA 3L3IA 1J10A 3GMLA 1SQ2N 3EYUL 4WRLA 3MJGX 5DI8B 3VFOA 4DVRH 1ONQA 2BX5A 3DMMD 3NCCB 4NQDA 3X13B 5HHXL 1P7QD 3GIZH 3S36H 2FBOJ 3B9KA 4Z7VF 2P7TB 5GISH 4E42B 4YEEA 1FL5A 3B9VA 1DE4A 4M1DL 5F3BB 3BD4A 2E7HA 1I1FB 3HMWL 3S9DB 5KSUB 3QDHA 5IMMB 5CEZH 4XMPL 5INDB 1AGBA 3O8XD 1IT9L 4MQ7B 3U9PH 5M95B 3B83A 4TTGA 3M8OH 2O61B 1W2KT 1MJJA 4DZBA 3OB8A 2EICA 3IS1X 3AFLA 3MGOA 1S9WB 3ZT6A 1XGTA 3HI6H 5CILL 5E8DH 3O3AA 3CFIC 1A3RH 4LLQA 5I30L 4KJWD 2EKSA 1OAKH 4GLRH 3CUPA 4D9RE 4WJ5A 2CO7B 5FO9A 4OCRH 3LKNA 2A9ML 2APXA 5KSBF 4PJGB 4IRJC 3HE6C 4Y4KB 5E00B 1FO0H 3GHBL 3QIUC 5L6YL 4M6OL 3CFDB 5E24E 1CFVL 5JO5B 2Y9RT 1IEBB 2W0PA 3D87B 3FQXB 1QBLL 2AKRB 3DX8B 4GUPA 4UIKL 1G9MC 1BFOA 3MROA 3O3BB 2IJ0C 1JHLH 5D2LA 3D25A 1ADQH 1D6EA 1MCHA 1NH6A 4LRIC 2YEZB 5I9QB 3T0VA 4MNQE 3ARDA 1M6OA 3MV8E 5F7KC 4HIXH 5E2TL 4QY8B 3C8KB 3TGXA 5I2IB 1IC5H 3MREB 5A2LH 1ZGLB 1OB1B 1YC7A 2XQBH 5JQ6H 5BRZE 5HSFA 3QUYC 1NGXA 3DX9B 4LDLB 2VZSA 2CGRL 5BZDA 1NGYB 1BJMA 1R24A 1Z2KA 4ENEC 1RVFH 1VPOL 3AY4C 3EDDA 2ED7A 5D2NA 4NO2B 4Z76B 4NQCE 4QHUB 5E1AB 5HYQB 4LCCA 4P5TD 5LAXA 2SEBA 5DQJB 4G8FA 5CJ5A 1IGMH 5J13C 1AE6H 2C3VA 3IFOB 4C54A 2UZYB 1Q38A 1T0NA 1ZWIA 3DX7A 1OCWL 1CFTB 4OLVH 4TUKL 5LGHH 4PJIB 5K9JL 2IMMA 1BLNA 4YHNB 4P3WA 5J1AB 3ARTA 4JO3L 5D7KE 4PV9B 1P2CA 1G7IB 3RX5A 3SE8L 4PJDA 3MYZA 3OX8A 5HGDA 3CIQA 3TEUA 3S88L 2YMXL 2AK1L 2HG5B 1DQJA 3WXVH 1F42A 2ADFH 5GGUB 4X8JB 5ILTH 4LSSH 3HZYA 5JUEH 1BQSA 4F7CA 3BISA 1PZ5A 3E2HB 3QUMA 5ERWA 4BSWB 3OXRA 1EHLH 3FT3A 4YIQB 5FYJH 1P5UA 2PW2A 4FQLH 4POZC 4HH9B 3GRWH 3QA3A 1S7XB 3DOSA 2Z92B 4U1KB 3PWNB 5IJVA 5DR5H 1U8IB 4U6TA 5E08H 1EA9C 4HMCA 4UB0H 5F7EL 3FT4A 1WBZB 8FABA 4EOWL 4LSVH 2GEEA 2DYPB 2A6KA 5MEPB 1BGXL 3ARFA 1BOGB 2GT9B 1F2QA 5MENA 3VDCA 4JM2B 4ZTOH 3H9SA 3O6FB 3KYKL 4JFPB 1DBAH 1D5ZA 1XIWA 2NX5A 2D9CA 1EHXA 4XBPA 5CIPA 4XNYH 3BKCH 3DNKA 4Z7OE 4RNRA 3WIFA 3CFKB 4X6DA 5KSAB 1QR1B 4R7DA 1YY8A 3OTTA 4FQCL 4H1LA 4K3EH 2DMKA 3QNZA 1XF5A 4X7SL 5DA0B 1XGPA 4XCEA 5KAQF 4MLSA 4DN3L 1JHTA 3OR7B 5EZLA 1JI2A 1U8LB 4H25B 3QJHA 5JLZA 4KZDH 4G42B 4CNIA 4MD0A 3MRLA 1VFOA 4DAGL 1MFDH 3S37L 3BPCA 1U8QA 3R0MA 2YS4A 3BW9B 2ZSWB 3V79C 1BM3H 5ALBL 2P5WE 5C71A 2UWEB 1EO8H 4JPKL 5D8JH 1OTTD 1PEZA 5CGMA 1ZVYA 4RA0C 3PV6B 5J0BA 5B3JE 3SN6N 2RCSH 4R0LA 5IW1A 2YKLL 3FAWA 5DJ6A 4IMLB 4F7TA 5DJ8B 2EYTB 2YRZA 3VDAA 2CK2A 4XB8A 2CKBB 4G7VL 1BF8A 5MENE 1CYGA 3JV6B 4XGZA 1F11A 4P57B 4D9RD 2BMKA 2IPKA 3HPLB 3PWVA 5I76B 5TDNB 2B2XL 3HC0B 5DUPH 2EE3A 3LIZL 1JNNH 2FB4H 3PQYD 1NC4D 4I0PD 4M1CC 2XYCA 3CDYA 1XR9B 1Z9LA 4OQTA 4AM0B 2WSKA 1RZJL 1QFWL 2F5BH 3PWJA 3CVHH 3CX2A 3BSZL 5IBTH 4CVXB 4KY1L 1T1WA 4MNQD 2AJ3A 5HTSA 5EIIA 1Q9LA 3MV8D 5I66B 3RWEB 4PY7A 2D31A 3IDIA 3TA3D 3B9KD 1UQSB 2R2CA 4APQD 5BRZD 2XFXA 3GDBA 3B5TA 3I02A 1CLCA 5IVNA 5K9KB 1MVUB 1BBDH 1E6OL 1IMHC 5CCKL 3SDCB 5TF1L 3VFGH 4X5XB 4NQCD 2HN7B 3MV7B 5IQ9A 3NCBB 2VLJB 1HHKA 3QAZB 5DVLA 2IPUG 2F9BT 3TFKD 2EEBA 1SMAA 5CD3B 1S3KH 2EH8H 4PJBF 3RY6C 4FFZH 1QO3B 2X44D 2OYPA 1A7QH 5DVNA 1C16B 3L95A 5D7KD 2ITDB 5E6YA 3F58L 4Y2DC 1SYSB 5JXEA 4KKLD 5CJOH 2BNUB 1A6AA 2GYSA 1MAML 4YHLH 3OKLB 4FZ8L 4F2MA 1VHPA 5DJ0B 2E7LA 3W9DA 4D0BA 3IJYA 2GJJA 4JE4B 4N0CC 4UUJA 3TYGH 4G8IA 4JR9L 3ZDYE 5FO8A 2ZUUA 5FKPB 4G7YH 2GTZB 3BPLB 3TIEA 3F7YA 3PJSA 2CQVA 1FG2A 3GJFK 3TBTA 3VFVA 1ZGLM 3F8UB 1KG0B 4OZGB 1BD2E 3ARDD 1KLGA 3QEHA 1NDGA 4M00A 4CVWA 1WK0A 5FYKU 5I73B 3MRRA 1MNUL 5CSBA 3L6FA 4JVWA 4X98A 1IRAY 4ORGA 2ATKA 4XPTL 4AYFA 1HNFA 4NKDB 1CLOL 1XZ0B 3NTCH 4XI5D 5E8OB 2YWZA 1P7HL 1A0QL 2O5YL 4M6AA 4NQUA 5I17B 4YHPA 4ZAKA 3GUTB 3S35H 4YX2H 2JTDA 4GW4A 1KBGH 4WHTB 5IVXA 2WIIA 2MHAA 3KS0H 4L8DA 2CDEA 1GPOL 2BVQA 3GI8L 3MOBH 5DJXA 2HMID 5B39G 2EIEA 5C6PB 3A6BH 1D5MB 2WWMD 1KJVB 4WU7B 1YNTB 4G3YL 2JJWA 5FA4B 3AREB 1MRCL 1KJ2A 1SEQH 3CH1B 2QADB 4F9PA 1I4FA 4ZOEA 5B38A 1TTGA 4TUOA 4M9OA 2LU3A 3OHXA 3GSQA 1KB5L 3MRBA 3B9DA 3MLWL 4LSDA 4O5LL 5I8CA 1XF1A 2AEPL 2CUMA 3GBMH 1X5ZA 4NNYB 4BSJA 1QNZL 2OR9H 4GKOA 4MA3B 5E2UH 1MIEH 1VADA 3MQIA 4KKBC 3S97C 2GW5A 3RAJL 3O6MH 3TCXA 2J4WL 4NO3B 3HUJB 5DD0L 4HF5L 1U6AH 4F15B 3IFNL 5EZIH 3DV4A 4OLYH 2GSGA 4LPTA 5TGBB 4DZ8A 1G7QB 3QUZA 3WN5A 3OGCA 4LCYA 4XCNA 3F6LA 1PEWA 3P4MA 1R3IL 4XH2B 4DKDC 5MEND 1MHPL 2ZPKH 3V52H 1YN6B 3H9SD 5KSVB 3KGRA 1OARH 3WIIL 2NX5D 4F7MA 5IHLB 1LE9A 2ILLA 2N4IA 1I9IH 4HZAA 2F15A 4RMTA 4PG9B 5MEOA 2OTWA 1I7RB 4Z77A 3SQOL 4N0YH 3LKQA 2Z8WC 1F02I 4Y16A 5GGRY 3QCTL 5DD3L 5CINH 2XRAL 2MFNA 3I6KB 4M6OH 5KVGH 3JVGC 4UV7H 3IFPB 3CU7A 4HUXA 2DQHH 3ETBF 4OM0H 1KCRL 5DJYA 5HI5D 4EBQL 3UJTL 4DGVH 5HYJA 2BSRB 3F7VA 3VXRA 5E2TH 1MRFL 5EH1A 1FYTA 3RBGA 3L7EB 1QLRA 4RGNC 2WINA 4CJ1A 4OZFA 5EOTA 1K6QH 1QFHA 5L8JB 2V7HA 4OLWL 2EH7H 4GW5B 4KMLB 1AC0A 3BPOC 3DGGB 1JGDA 3FOLA 3GB7B 3NCJL 2NZIA 1T7YA 1CQKA 3F12B 2BY1A 3RNKB 1CF8H 4POUB 5DD6A 4YFLF 4PGEA 5TE6L 3LHPL 4K3DH 3GSWB 4YHOH 1M05A 2MCPL 2YD9A 2CDGA 4P46A 4ZS6D 3T1FA 5C7XL 2LU4A 5F7DB 3HR5B 2X4RB 2DB8A 2PW1A 2YPVH 4Y5YA 4MJ5B 5I1KH 5C08B 3DYPA 5IB5B 4JDZB 3ULVC 1YEHL 1BQLL 4QCIB 3S88H 3L3HA 4DKAA 3O9WD 1QKZL 3IGAB 3C5ZB 4W70A 4HIJB 1VB9A 4RMQA 3TIDA 3QEUA 1DZBA 1N64L 5GZND 1KN4L 2P43B 1BD2D 3NBNA 2B5IB 3EDKA 3V4VL 5JDSA 2HT2C 2ORBH 5HY9A 1TQBB 1ZMYA 1S8DA 1V7NL 4UI2A 1FNEA 5I1EL 5I1IH 4NRZB 1WWWX 3OJ2C 5H2BB 4DN4H 4RGOH 1E4KA 1T22B 4J1UA 2L7UA 1FYTE 5F7EH 1WZKA 1XGRA 2YRPA 1FZKA 1FFRA 5DWUH 4QHMA 1IC4H 5C0GA 3C6LD 1ZT1B 4O2CB 3N85H 4FQHB 3RGVC 1EEUA 1OT2A 3E6FA 4LCUA 3TBWB 4YWGL 3TPUB 4U3CA 5D9SA 1MWAA 2IQAA 4XPHH 4X6CB 1B2WL 1D9KA 3RWJB 5SX4I 5IW3A 5CHNA 2CKNA 1AFVL 1J8KA 3RTQC 4XCFL 5DJCA 4OV6F 5F6IB 5BOZG 1MCBA 3PHOB 5F1OB 1T2JA 3RVXC 1OLZA 2GITA 1U8PA 3WDHA 1QSFA 4Z7WB 1HSAB 2H26A 3GSUB 3VGAC 1UFUA 4DK6A 1IFHH 6CGTA 1AR1C 3VFTB 2X4UA 1G7HB 1OGAA 2MPAL 1U8OA 2A1WH 1BF2A 1KIQB 4HIHB 4XPGL 43C9A 5EUKA 3QB7C 2OK0L 2CRZA 4NKOA 2HKHL 1FSKC 4KJPC 4PJ5E 1R0AL 5FYLE 1RAMA 5GS2D 4XPAH 3MLUH 1XCTB 4GKSB 3W0WB 1IQWH 2YK1L 3BUTA 1CBVH 3DARA 4NQVA 3PF2A 4R4NC 4FQXB 5J6HA 4I4WB 5CP7B 1IGFH 4WO4D 3U48A 3VXOA 3IKCB 4HXAH 3C60C 2D2OA 1T0MB 1CDCA 3LDBB 4XT1C 2HKFL 2J8UA 4ZAKD 4PJHA 2YC1A 1PYWB 2Z93B 3AS2A 3UO1H 2P8PA 3MGTA 1DSFL 5IK3A 2X10A 5EU3A 4P23C 1AD0A 5DXWA 2DTMH 1LO2H 1Y18A 1U3YA 4BM7A 3O2DH 3UC0H 4YHIB 1UCTA 1T89C 5D70H 4HIIA 4G8GE 4ZSOA 1X44A 5I8KL 4NFDA 1UWEL 5E1HB 4P48A 5DGRA 2BVPB 1QFWH 2A9NL 4JKWA 1ZEAL 3ZHLA 1P69B 4KVCH 2OI9B 2VIRA 3QUKA 3TCLB 4S1SH 5IWLC 3QZWA 4LLVA 5C3LD 1L7TL 3TESA 2QHRL 1KF9B 1S7SA 1N8ZA 3MC0A 1G7PA 4TNVF 1OTSC 4OZIE 1A7NL 3PWUA 4P3DA 4NWTL 3LRSA 2HT3C 1Q0YH 3TT3H 1SBSH 1S9VA 3IAGC 3FOMB 2NXYB 2YA0A 1SY6A 4MHHI 3FQNA 4Z7UF 2FH8A 3S4SA 5HHPA 3QUZD 1LO0H 3G5XA 1GAFL 3NACH 1A4JA 3CLFH 1A4KB 1OWRM 3UJIH 3N1PC 5DHVH 4AL8H 1U95A 2RB8A 1NCNA 4QRSA 1NFDB 5GJTL 4FABL 2J8UE 4A2MA 5DHYA 2A77H 1LEKB 3RUGB 3SKJH 3BZFB 4RMVA 2CUIA 5BXFA 4PREB 3DXAB 4FZ8H 4MXVE 4GBXA 4WGVB 4DGIL 2R23A 2VC2H 2EDXA 3Q1SH 5IP4A 3MO1A 2DQIH 3QPQD 4M61A 2NY0D 4Y5XC 3OMZA 3RZWA 3EO1B 3JTTA 4JCLA 4YHKL 5JW4N 5FYKH 3MODH 2OTUB 1MY5A 5J8OA 4D3CL 1S7UB 2X70A 2XV6B 2WBJA 3EYVA 5A2FA 2VWEE 2AI0H 3VXRD 3S5LB 3TVMB 4BFIA 1U8MB 5E99H 4ZUWB 5HXMA 1FYTD 4GG8A 4DW2L 3W9EB 2X4QA 3BEVA 2NNAA 2YD3A 3MLXL 2WUCH 3T8XB 4RGMC 3DUUB 4WW2F 3PGFH 4K2UH 3FN3A 1CLOH 2AQ1A 5EIVA 4HWZB 1CTNA 3MRJB 4X99B 1IAIH 1A0QH 5IG7A 2O5YH 1UVQA 3VFPB 1LD9B 2MMXA 4U7MA 4U1NB 4ZUVA 4L9DA 1RURL 5CP3A 4PJ9B 4HJ0C 3G6JB 3U36A 4ODUA 4GAGH 1QOKA 1L6ZA 3TJEH 1NAMB 4S0SD 5A3IC 2H32B 4UV4L 3IETB 2E9BA 5FOJA 2DM7A 1A2YA 1JPFA 3IDGA 4WI9A 5JORA 1UGNA 3I9GL 5I0ZA 4OM1L 2D7MA 4N5UA 3DMMC 5JXAH 5BVPL 5DMIL 1CL7L 4GRWF 2R8SH 4DUWA 4X4XA 4LNVA 1SJEA 4R8WH 4NJ9L 4J2XA 3V6OE 1WBYA 3QQ9D 4N0FB 1F4XL 4P5KB 2BOBB 2ZNWA 4KTDH 4QXUL 4PJ7A 3BESR 3JUYA 1CD0A 5FYLD 3TV3L 3W2DL 2F53B 5D5MB 4X4YB 1A6PA 2P24B 5DFWH 4LRNL 3MRIB 4CJ0A 1L7IH 1NBYA 3RZCB 3VFRB 2H9GB 3MOQA 1GZQB 5F6HJ 1NCAL 3QDGE 3SE4A 4R2GB 5J06A 1YPZB 1WITA 1YY9D 3NFNB 3ARUA 1CGXA 1PLGL 1T80A 3MNZA 5IHZB 3I75A 2IEPA 5B3NA 5FGRA 1ZLVH 3WFDH 3MFFA 1EO7A 3HI1A 4Q6YA 4WI6A 3O3EB 4KJWC 4JY6A 5TFSL 5I6XB 5GS0C 4EXPX 3KPOA 1KFAH 1DL7H 4G8GD 4JFDA 3X12A 4PJXF 1WBXA 5EFIA 1RZ8A 3QCTH 3QBTB 5EO0B 1QFUH 1FFNA 1TPXB 2V5MA 1X4YA 1KCLA 5EOQL 3KPRB 5BOPA 5DQDL 1SVZA 2I5YH 4GXVH 1K8DA 3ORJA 3UJTH 4DJMA 1FNHA 4CN1A 4QGTA 1E4XI 5IHUH 1OGAD 2MSPA 4WY7L 4XRCB 1TJIH 3FN0L 4Z7NE 1J1XH 3NIGF 4UOW1 5DI8A 1MFEL 4HW6A 5CJQH 5K9QI 3TZVC 1OT1A 3X13A 1MJUL 1I8MB 1DBJH 2E27L 2P7TA 1ITBB 4P5TC 1XCQB 4E42A 4XMLL 3R1GL 5F3BA 4B41A 1I1FA 1T03H 5C09B 4EUPB 4G6ML 4QNPF 4XC3H 5KSUA 5DS8B 5INDA 1AGEB 4MQ7A 1I1AB 4XHJC 5C0BB 1J5OL 1OAXH 5J9PB 4BQBA 4RRPG 5GGTA 5H8DA 2J1KA 2O61A 4GRWH