3VE0B

Crystal structure of sudan ebolavirus glycoprotein (strain boniface) bound to 16f6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
DIVMTQSHKFMSTSVGDRVTITCKASQDVTTAVAWYQQKPGHSPKLLIYWASTRHTGVPDRFTGSGSGTAFTLTLNSVQAEDLALYYCQQHYSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for differential neutralization of ebolaviruses.
pubmed doi rcsb
source organism Sudan ebolavirus
molecule tags Immune system/viral protein
molecule keywords Envelope glycoprotein
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ve0B01
5T1KA 1CFNB 4YXKL 1S9WB 5DZOA 3WUWA 1GSMA 2Q7YA 3Q2CA 3WFBL 3GRWL 2LVCA 4PJAB 2IQAA 5I1HL 3MLSH 1D5MB 4L1DA 1LDPH 1EVTC 1TZGH 3LV3A 1WBZA 5JPNA 5HJ3B 2NZ9D 1U8MB 3HNSL 4PRAB 4UAOB 3DUSA 4J4PC 4K7PL 5FCUL 3ZKND 5D5MF 2XXMB 5C09A 1J12A 5BV7L 5F8QC 5IROC 3HRPA 1AC6A 4OCYL 4AT6B 1KB9K 3ZDZE 4MWFB 3QJHA 1IAOB 4Y4KB 4H88L 5EOQH 1LO5B 5DEFB 4UIMA 3S5LG 4NC1C 5IFJA 3MRQA 5K9KA 2PCPA 2IFGA 1MNUH 3MV8A 3RWDB 3Q6FA 3WNMA 5JIHA 2AI0L 2R9HC 5JW5A 2L7JA 2IBZY 3NH7H 4NQVB 4LPVA 4G7VH 2OP4L 5JXEA 3PDOB 2AJUH 2APVA 2R0LH 2MKLC 4TVPD 2ZKHL 2YA0A 3TBVB 5FKAA 4OF5A 3H3KA 1JGVH 4PGBB 3LKSB 4WI9A 5CP7B 1IEAB 1ITBB 2GJ6D 1JRHL 2R2BA 1BM3H 3DJ9A 5IQ9A 3IDXL 1T6WA 1PSKL 3TT1L 1T3FA 3CSPA 4JY4B 3SN6N 2BK8A 1MFNA 1HSAB 3VXSB 5DO2C 1K8DA 3S96A 5CWSB 1KIUA 2ZG3A 1H3XA 4NQEE 2DKUA 2EXWD 1SYVA 3WJJC 4WWKA 5IMOA 2A9MH 4GQ9H 2QR0A 4MA8H 2AKRA 3SY0B 2J2ZA 1RD6A 1RUQL 4X9FA 1RUKH 1MCRA 2MSPA 2GIYA 5CSGA 3SOBH 5HYJD 4JPVH 3F7VB 5ICXA 1GGYA 2XKNB 4QRSB 3ZL4L 3MLZH 4QOKE 5EU4A 4HJJH 3BZEA 2FD6H 5JOFB 1OSZA 1PYWA 2OTWB 5K9QG 4PRHB 5ISZB 3FFCD 4YBLC 1WEJH 5IFHL 4Y19D 4NRZA 5E8DL 1YYLL 1C08A 4FFWC 1VACB 4LOUD 1UA6H 1MJJB 5GGQH 3E6FB 3VA2C 2VMFA 5HVFB 3EHBD 4YHKL 4X5WB 1IAOA 4P5MA 3TBYA 5C92A 4UOW0 1EEZA 1P1ZA 2Z91B 2A83B 5BZWA 3I2CL 1IGMH 5HI5C 3KYOB 5DZNA 3S88H 4K23L 5EU5A 2OMBA 4OZFH 1JMXA 3LSOA 4TSCH 5D2LE 5GRJH 3WFDH 5IESH 2IC2A 2HP4A 2CPCA 4ZTPL 1WBZB 4YHNA 3T09A 2C3XA 5GGRA 2PXYD 4JKMA 1W8OA 5ALCL 1ZSDB 3ARGD 3GGWB 1EH9A 2CQVA 2FEEL 3C08L 3LIZL 5FUOH 2ENSA 3LMJL 3RGVB 4MA7H 1JE6A 3RAJH 4IRJB 4LEXL 5LJYH 2H3NB 4M03A 3OX8A 4KHXH 3AXLB 1IGCH 4L8BB 5CJBA 2D9QB 5D7LD 4XPBH 2ZG2A 3U0TB 1RZFH 2J8UA 3SGJA 1LO2L 5JW4Q 4D0CA 3QXWA 2F58H 3V6OC 4EI6B 1IM9B 3W0WB 5I1LB 4PRPB 4BM7A 5DJDA 4TUKL 4NNYB 5BMFH 4LPUA 4W4NA 2LU7A 3D5OF 1J10A 1GZQA 2JJSC 8FABB 5IVXE 4Z5RA 5H8DA 3SBWA 3TNMA 4PJXA 2YOCA 1X6NA 3ARTA 4X80H 3U4BH 2GEEA 4BJLA 3TM6A 3QDJB 2P8MA 4OFDA 3DXAB 3H3PH 4I48B 1D3CA 1BD2D 5GJTL 4L8CB 3G5VA 5IUSA 4UNUA 3SDDC 3O6ML 1LDSA 4FXKB 5JW3H 3RUGF 2YK1H 5FO7B 4O00A 2F54E 1A14L 1DQMH 3GMPB 4KKNA 5HHOB 5CWSA 2D7MA 4Q9QL 3WHE1 4URTB 1Z6JT 1ADQH 5CBEB 1INQA 8CGTA 1MJ7L 5IFAL 3GSXA 1AXSA 3GM0A 1A9EB 3F58H 1JGDA 1T20B 3ARFC 3HB3C 5BXFB 2XZCH 2PXYB 3M8OH 3EO9L 5IT2H 1MHEA 4JKWA 4JN1H 5DJAA 4U1JB 1OLLA 1FYTD 2WZPD 5KAQG 2X89A 1C8PA 3T65A 1V7MH 3OQ3B 4KMTL 3RX7A 4EZMA 4XZUA 2B4CH 2X4QA 1TJHH 1P9MA 4RISL 4X6DA 1EK3A 3OKOB 5GSVB 4CNIB 4G9DB 1CD9B 5GSRB 1FNSL 3QPQC 5J1AB 3GI9H 1E4XL 3TFKD 5JHDA 3QHZL 3VXRD 1HNGA 1OL0A 1J9CT 3MXWH 3J7HA 3V5HB 2ICWJ 5FYJE 4PJHF 3IS0X 4Y8AA 5FEBA 4PJDF 2FBOJ 3DRQB 4Y4KA 4GSDH 4GLRH 1FYTE 1A02N 1UADC 2QL1A 5ICYB 2VAAA 4F7PA 2NY4B 3T0EE 1OGTB 1QRND 1XIWA 3SDYH 5E7BA 2DLEA 4KH2A 2AJYH 3FKUS 4XI5C 1ZHKA 1BFVL 5C09B 4RX4A 4W4OC 5F7MC 1T20A 1SMAA 4PYHA 1J0JA 2EDDA 4A6YL 2B20A 3KLAA 1IAIL 5DTFA 5FECB 3BW9A 3HG1E 4QRUA 1INQB 4KTDH 1BBDH 1KLGB 4Z7VA 3U0WL 3U7WH 3VXRE 4LMQE 3MRPB 1CI5A 1X5YA 1C5DA 2FECL 3GJEB 4JY5L 4FA8A 4PJGF 4Y0GA 4W6YB 3VFGL 1EIBA 4Y4HB 3TV3H 1CGTA 4P2CG 4Q6YA 1JP5A 1IC5L 5JZ7C 1FFOB 5E9DD 5T3XH 3RGHA 3DXAA 3MBXH 1CGUA 2VC2L 3CDGB 4OQTA 2F74B 5TPWL 4KKCC 1CF8H 3JV4B 4G6KL 4OZHB 2G5RA 5EZJA 3NA9L 5EOCL 3QJFB 4JGMA 1AQDA 1CN4A 3EO1B 2CLRA 3IAGC 3HAEB 3C8HA 4WCYH 1KCLA 1UVQB 5E99L 4S1DC 5TDOB 3RQ3A 5JTWA 1G0YR 4ZQKA 5IHZB 3VXSE 5C08B 2HFFA 1WZKA 2E6QA 4ACPA 1NBVH 4U6HB 1I7RA 1MFAL 2ZUUA 1G7QB 4L3CA 1S3KH 3L1OL 2A0LC 32C2B 4IRJD 4J1UB 1MY7A 4DVRH 5IEHA 4ODTL 5BZDA 3BPOC 4GKOA 5FUZL 2HTLD 1UKQA 4ZUWB 5GGSB 2CRIA 4F33B 5DD5L 1HHHB 2FJHB 2BSSB 2VQ1A 4RIRB 2M1KA 2R0WL 4IMLB 4HFUH 4PB0H 2BNRE 1KJ2A 1YY8B 1SJHA 1BQLH 4NKIL 3GJFK 3HR5A 1G1CA 3P11L 1F4WH 3L3KA 3HZKA 3VXUE 4JO3H 1KPRB 5GGVY 3KWWA 5K93A 4UILH 3WKMH 2KUTA 3ZTNH 4KPHH 1H3TA 2Z91A 2MQ3A 1P7HL 2CDFA 3DWTA 4K8RC 2H9GB 5I1GL 4X5WA 2E9BA 4HDIA 3ARFB 3E6FA 4HIXH 3QAZC 5HYJB 4Y19E 1DUZA 5JNYA 3RPIB 5EU3A 1TQCB 3UC0H 4WWKD 3TCXA 5CEZL 4ZFZB 3L5HA 1OWWA 1QSEA 3FB8A 3MJ9H 3Q0HA 3O2WH 4KVCL 3SO3B 5IM7B 5GJSH 3FRPG 5E6YA 5DQJB 4GG6E 2X9WA 2C4FU 4Y2DA 1LE9A 4OUOA 3O6FD 2OTWA 5FM8A 2R56L 3MCKA 1U95A 3EOYG 4RCAA 4J6RL 2DQHH 4QF1B 5CEXA 4H1LB 4MLSA 3FCTB 5D2LA 5HHOE 4WW2B 1JWUB 5ICXB 3GSNB 1ORQA 2RQ8A 3T2PA 3V4PH 1NL0H 3LB6D 3BP6B 3PF2A 3TN0C 1QZ1A 1GGTA 5D96C 4HIHA 3T3MF 2ERJC 1MF2L 4LPCA 4PV8A 2YPVH 3AY4C 4YHLH 5TE4L 4G8IB 3RWEA 4LCCB 3GKWL 1HQRA 2R2EA 4LSVL 3CC5A 3QUZD 3SDXE 5ACZA 2DJUA 1XGUB 1OAQL 5E8NA 1FNAA 3TJHC 3WJLC 3PWNB 1CICD 2DBLH 4H26A 5D6DA 1JPST 4ZUVA 4I0PB 5GISL 4JFXB 1P7KA 4LAQH 1XZ0A 4LP5A 4MZ3A 2V2TB 3T04D 5SV3A 4M3JA 5J9PB 5INCB 2VH5L 3QXAB 3FO2A 2FHCA 2P47B 1MEXH 3JV0A 3JWDH 3MLWL 1L0QA 5IMMA 4Y4HC 1NBZB 4XPTL 5E2VL 4YHOH 1AGFB 3B9KB 4P5TC 4TSAH 2OZ4A 4A6YB 4CVZB 4OCSH 2AEPH 1FDLH 5D1ZD 1EERB 5HBBA 3D39E 3ZLQC 3RWDA 1JVKA 4R2GC 3MLSL 3C09B 2OZ4L 1LDPL 2YUXA 1DBKH 1MFEL 3VWKB 5K9KB 1TITA 1KB5L 4UDTB 5E2WH 3OKYA 2Q20A 5EUOB 4JFEE 1CICA 1ED3A 4D8PB 5JQ6L 3A6CL 3REVA 5IR1A 3V79C 2CIKB 3CFBB 1ZLSH 2VABA 3DMMC 5D7SL 4OLVH 4APQC 5L2KB 1NCNA 4P48A 5JUEL 2CXGA 3WS6A 3K8MA 1KEML 2VLJA 4C83A 4FRWA 4G6AD 5LWYL 1U8MA 5DQ9B 5JIIA 2VDMH 1U42A 3LV3B 3BZ4B 3MV7E 2J4WL 4H0GA 4WFGE 4AIXA 3SQBA 3HI5L 4I3RH 3I3DA 3CX5J 5DEZA 3AS0A 4ISVA 5E9DA 2ADFH 4KHTH 1S9WA 1S7VB 1S7XA 4QXTA 5D1QB 4WV1C 3E3QE 5MEOB 2B2XH 2VDQL 1KTRL 1JZ5A 2G9HA 4KV5F 5EORL 4XXDA 1ZS8A 3O3UN 4M7JH 3RY4A 5I8CA 1YECL 4OLXH 4KXZI 5TJWK 3HPLB 3BEVA 2CLVB 4DGVH 5KVFL 2BRQA 5LGHL 1FYHB 4X99A 4YFLF 1XIWC 5GRYA 1N0XL 2NY0D 2XNAA 3L6FA 5CEYA 1FRGL 2YD9A 4OFPA 5GGTA 4AK1A 5D72H 3HRZA 2IPUG 1UH3A 1LE5A 1WBXA 2MHAB 4I2XB 4HKZB 4PJDA 4QNPE 4X4MA 3KG5A 1PLGL 4L3EE 3SKMA 3GDBA 2P8LB 4CAGA 5T1MB 3TVMB 4K8RH 3SO3C 1HINH 3BKYL 3VD4A 3BRGC 4CRPA 3QIBB 3ZL4H 5EN2A 3CFKA 2AJVL 3U0PB 3BDYH 2Z8VC 1WCBA 1ZLUH 5I8EA 5KSAC 2CRYA 1B4JH 4EI5D 1R3JB 2QV2A 4NUJB 4JO1L 4PB9L 5GGTL 1A6AA 1FYTA 4LLDA 1F11A 1BLNB 1A0QL 3Q1SL 4KQ3L 3KPTA 1S5IL 4WO4A 4P46B 3UDWA 1NSNH 3O3AA 3UYRH 3BDXA 2JCCE 3EW3B 3CNKA 3VXUD 4HSQA 3DO7A 1MCJA 1EEUA 3H0TB 1UA6L 4GS7B 4HC1L 5CJXA 5HYJE 5K59E 1PDKA 3AM8A 4OFYA 2G75A 5L2JB 2OL3B 1T21B 3QIUD 5KW9H 5H37H 4UU9A 3W39B 2PNDA 1MJ8H 3PDGA 4XCNB 1GPOH 3LN5B 2BERA 3SGKA 3MV8E 3CFIC 4JHWL 3LQAL 1YEJH 3O45B 3TVMD 1A4KA 3BKJH 4G8FB 5TE7H 4S0SD 3RIAK 3BZDA 2YZ1A 2QQNH 2IMMA 4TUJB 3NZ8B 3PGFL 4PP2B 4Y4FA 4OKVB 3VXNB 3HCVB 4YZFF 1QACA 4WY7L 3KS0H 3VW3L 4M5YL 1AGBA 3OKMB 5IB2B 1PKQB 2EKSB 1CDYA 3HE7C 4X4ZA 4UIKH 4OQTL 4YWGL 5HYEA 2OR9L 1W72H 2VLJE 3QDGB 2XICA 1Z0MA 1ZA3B 4D3CL 3ROLB 4NQDE 3P30L 1LP9F 5I73B 4HF5H 3FOLB 5GGVL 1LEIA 3P9LB 1XGQB 3U48A 5DRWA 4YHYB 3T3PE 4OLYH 5F3HA 1NEZG 3AVEA 4UT7L 2BSTB 3KLDA 3MR9A 2B0SH 4JFOB 1BQSA 4XBGB 3FQWA 4L4VE 2BNQB 1MI5A 1MSPA 5EWIH 5D6CB 3CIQA 3BE1L 4E41B 1ZLVK 4HIJA 2MQ0A 4B0MM 3FQRA 5JOEA 3BGMA 2GHWB 4JZNB 5MEND 2AQ1A 4M6OH 3VFVA 3OF6D 4KK9C 2VXVH 4DGYL 1EV2E 3D3VA 5EUKA 5DT1H 3WHXA 4PRID 4CU7A 4GXUN 4RSVA 4ZYKB 4GG6A 1NGXA 1Z3GH 3DVGB 4QRQB 3RZWA 2O5XH 4JANB 3QUMA 1E0OB 3JTTA 1QFPA 1KPVB 4OV6F 5IV2B 4Y5YA 4NGHL 4ONFH 4OM0L 4RWYL 4Y16B 2HVJB 4UQ2A 1Q94A 4GOSA 4JFEB 2ZUVA 5DJXA 3IDJB 5GS1A 1F4YH 1T66C 2EXYD 4XP6H 3DMMA 4MQ7B 1IRAY 1RJYA 1T0NA 4EDXA 2VLJD 2IGFH 5EUKB 4FOMA 1A2YB 3QI9A 1TTUA 4YDIL 1K85A 2VXUL 4MA3B 4O58H 1QEWA 2P8PA 3NBNA 2VB5A 4MD0B 4R4BB 3RWFA 1QTYT 4QYOA 1AHWA 1GRWA 5F7KC 4FG6C 4YX2L 4OZIA 4PV9A 2J6EA 1AR2A 5SWQA 1YA5A 3QNZA 1CT8A 2P1YA 3TVMC 4FZ8L 4LF3A 4PTTB 4BZ2L 1YPZB 3GMLB 5F3HB 1HHJB 1K6QL 4LASH 2Q6WB 1TETH 4PJIF 3SJVB 4JVWA 4N8VG 2WP3O 1X4YA 1Q9WA 2DJSA 3D39D 5JXEC 1XF3A 4GAGL 2IWGA 1OARH 3QHZH 1PG7L 3JUZA 1FVDB 4PGEA 2K7PA 5C9JA 5BVPH 4TTGA 1G9MH 2EKSA 3WMSA 2NW2A 2NY3C 1T03L 3QEUB 1WITA 4HKJA 5F96H 1KIQA 4N9GA 1GAFL 1MCCA 3WFEL 4I0PD 1P5UA 1D5ZA 4J8RA 3CFCH 2DDQH 2NY1C 4ZOBA 5C0FB 1BD2E 3TO4C 4XNZB 2PR4H 3QQ9D 4L8SB 2Y7QA 1NGZB 3T0BA 1OB1A 4HS6A 3MNVA 3UJJL 1FO0H 2VLKD 3GB7B 2ZOKB 5GGQL 4OCXL 4CKVX 5I1AB 3P0YH 1R3LA 4NIKB 5IKCA 3C5JB 2P5EB 4PJ7B 4D0BA 3PP3H 2X7LB 4G9FE 4WU5A 1IGML 3DUUB 2F8OA 3F12A 5GS3A 3U2SA 5ESAA 2ZPKL 3PQYA 4JR9H 4FXGB 4N0FB 4UI2A 1EHLL 3QH3A 3H9YA 1BJMA 4PJFF 3WFDL 3EOAA 4Z7NE 1N4XL 4XC3H 1VGKA 4NFCA 4ZTPH 3O6FC 4JRXB 5IVNA 1A3LH 2IPTL 4FFWD 1M4KA 3QEGH 4JM4L 4QOKA 4XNQB 1QYGL 3C6SB 3FJTA 1A6TA 4UDUA 3S97C 2FZ3A 3GBML 2QKIB 1JI1A 1NCBL 5FOJA 3RIAF 5KG9B 2YSSA 2E27L 4G7YL 5SWSE 5I1IL 1UWGH 3MRKA 3SE3C 3KYMB 3HR6A 1B0RB 5DGRA 1UZ6E 4PG9A 3QXUA 3LZFH 5FO8B 1ZEAH 1I1FA 2G5BB 4ONHB 5I19L 1ORSB 1H3UA 3W11C 2EZ0D 5HDLA 3B6SB 2FEDC 5C0FA 3C87A 4TOYL 2DYPB 4DW2H 5CZKA 1YN7A 3DVNB 3HE6D 3G5ZB 4Y16C 1FL6B 4PJEF 4BZ1H 2I9LB 4S2SA 1Z5LA 4GH7B 2FJGB 3V2AR 4OD3L 3ZYZA 1UWEH 2VO5A 5D7IB 5GXBB 2VQUA 4RDQF 3MFGB 5IQ7H 4P2OB 1AD9B 1NBQA 4RGMB 3WIFB 2EC8A 2UVFA 1T0PB 5F7HA 5B21A 2W38A 3SE4C 4DCQA 4MXVF 3HMXA 3KLHD 3EZ8A 3SGJC 1XR9A 1QFOA 1T2QL 4IOFC 3PP4L 3O6LL 3TNNA 4M48L 1BZQK 2AXFB 1M6OB 4LDLB 4OLUL 4KVCH 3QPXL 4CU6A 1BEYH 2XZCL 4Z76A 3KDMA 3AAZA 1QR1A 1T0MB 1VFAB 4KDTA 1AHWB 2XTJB 3QHFL 4XTRD 5FA3A 1XF4A 5FOBA 1VDGA 1UB6B 2NXYD 3SBWC 2GSGA 1P2CB 2DYPA 2WK2A 3T77B 5HTSA 2DYPD 5ANMB 1AKJA 4M7KH 2ZCHL 3NVQA 1KT2A 1BOGB 3HC0A 4WUUB 3MLTB 5ALBL 2V5YA 1OP9A 4MMXC 5CSBA 3NAAH 3UBXI 3CXHJ 4ZFOA 2PXYC 1UZ8A 1EDQA 5TE4H 3QUMB 4PJAF 3BN9C 4OB5H 5E1AB 5IB5B 3L3IA 1ZT7B 3G5XA 1EXUA 5D71L 4NQCD 5ECJE 4AJ0A 3LEVL 1U8JB 2H32B 4WRLA 4Y4FD 2YSSB 5BW7C 5KG9A 4QRRB 4LAQL 4WU7B 5HYQA 3QXDA 4P2RD 1P7KB 4JFXA 1BFVH 1FFNB 4J23A 4F80A 3UJTH 3WIIL 2PO6A 3VFRB 1XGUA 1E28A 1HHKB 5B39A 1MI5B 2DQEH 2EIEA 4WFED 3PNWB 3O4LB 3VA6A 3KYKL 4OUUA 4P3CL 3VDAA 5D7IE 2OI9C 3QUKB 5HHME 4LSPH 2UYLB 1OGAA 4NUGH 4HEPG 3ORJA 4LRIC 4LFHG 3QH3B 4WJ5A 2DQIH 1CE6A 2FIRT 3CH1B 3EFDL 4PJCF 5EFIA 3QDJE 2MPAL 3GJFA 3PHSA 5FA4B 1P4IL 5D2LB 3N1MC 3TA3C 3OAZK 2EE6A 3DUUA 1T7VA 4QF1A 4CVWA 3H9HB 3VXOB 2ZCKH 4N5EC 2YUZA 4D0DB 1U58B 4POZD 4M7LT 3DX9B 3QZWG 5EO0B 1S7RA 3C5JA 4DK3A 4O2CA 1ADQA 3A67L 3EDFA 4XC1H 5J11C 1IM9D 3C8DA 1BQUA 3GB7A 4OKDA 4P4KD 1Y0LA 4GRMB 4R26L 4RGNE 4HLZG 3O41A 2WNGA 2EIZB 3HTLX 4QKXB 4XBPB 4PGJA 3Q5YA 2NR6D 4KKBD 1J1PL 4L8SA 1IGYB 3KPRA 1ONQB 3BKMH 3QCTL 2H6PB 4ZUTB 4HXBL 1KEMH 3VFTA 2PETA 1CFTB 3UMTA 5HI3D 4FNLL 3LS5H 4R7DA 3W0WE 2I07A 1MRFH 1GGBH 5IMLB 1HHGA 1BIHA 1IE5A 3D25B 4XPGH 4UU9B 3GNMH 3O9WD 3OJDA 4IMKA 4OZ4A 4EDWL 4O2CB 1JZ8A 3O6FA 2X1PA 5CMAA 4AIZA 5IVZA 1TDQA 2EYSA 4JQXC 1R3HA 3D3VD 1E4WH 3PQYD 1R24A 2WLZA 4XPFH 1FL5A 2PYFA 2AABH 1U3ZA 4O4YL 3SJVA 1L6XA 1G0XA 5IVXB 1YPZA 3GMLA 3QG7L 2D7TL 3QISA 3TIDB 3T0EB 4PRDA 2BNUB 4IS6A 5I8EB 5JXED 4YH6A 4HT1H 4M6NL 4Y19B 4C4KO 1CR9H 3V6FB 1E28B 1UKTA 1NUGA 3HNSH 1GGUA 3P4OB 1CK0L 5DZLA 2UUDH 3QA3B 3CFKB 4LLYB 2P8PB 3LRSA 3UTQB 1FH5H 5IEHB 4MJ5B 3L3OA 3QZWB 5DR5L 4WU7A 4QRRA 1KIRB 3X12A 1OAXL 2X70B 32C2A 4XBEL 1P84J 5C2BL 5J4MA 5EOCJ 1VEOA 2C3VB 3VXRB 1G7QA 3ZKSD 1HINL 1RPQA 1UXSB 2EE3A 1L7IL 4G8GE 2HFFB 2ORBH 4Y16A 3O4OC 1CLYL 4Y5YB 3U30C 3WD5H 5TDOA 1L7TL 3IFOB 1NEZA 5IHUH 2NMSA 1GOHA 1NAMH 2IAMA 4CN6A 5B3JE 1B4JL 3L3DA 1H8SA 2Z35B 3QEQE 5CFHA 4I18A 3RVXD 3QJFA 2R9HD 4N8PA 3MOQA 3WHXB 2V9TA 1EHNA 3B2UC 5CBAA 5FYKD 4PJXF 2OP4H 3JV4A 4OZHA 3BPLB 4LLMB 5GS0H 3TCLB 4RGND 5GQBA 1JGVL 5TE6L 3AROA 4NHCL 2O5ZH 3QO1A 5HHVH 2VWEE 5BRZD 1NL0L 3B8SA 4Y4HA 4Z76B 5E8EA 3KJ4C 3CSYA 1BAFH 4UV4L 4Z7NF 3GJEA 1EHXA 3MR9B 1YEIL 2BSTA 3E8UH 5IOPB 2GYSA 5ADPH 5MERB 3HC3L 3WNOA 3D85D 1RIVL 2J7LA 3QBTB 4JRYD 4ZPVA 1ZGLB 2BX5A 3QQ9C 1DBML 1UFUA 4BH8B 3N85L 1YYMH 4RA0C 1X5HA 1ZHKB 4ODVL 1K5NA 5ACMA 1AD9A 1XIWB 1DN0A 1SVZA 3LVEA 1T2XA 5L2KA 1MRDL 1DZBA 3RGVD 3IGAA 3WFCL 4Q9BA 4JPVL 2W92A 3OHXB 3GM8A 2I9LA 5E2VH 3MV7D 1CVRA 1N8ZA 3DVNA 4TSAL 4U1IB 2YWZA 4WGWB 3EDKA 1I7ZB 1V8HA 5F7YC 5TFSL 5D7LB 3B6SA 3WEXA 2J6EL 4EQ3A 2VITA 3LHPH 5GSVA 1NCAH 5GGVH 4HGMA 4XNMA 4OFVA 3FB5A 4HUWA 5TF1L 1DL7H 1UB5A 1FVEB 1IEHA 1QSFD 3D2UA 4A6YA 4JFZL 5A2FA 4EI5B 1FG9C 1DBJL 2W0LA 3QIUB 1EAPB 3FHQA 4ZTOH 4CVXA 3KPNB 2OL3A 1HHIB 3MV9E 4MAYD 2QLVB 4WDIA 2EDBA 1WFUA 2EIDA 4P9HH 1RZGB 5DJAB 4MJIE 3PIQA 4B53A 5D7JA 4W70A 4MD4B 5HI3C 15C8H 1OCWH 1W0YT 4IDJH 3CVHH 1MIEH 3X13B 4GW5A 2J5LC 3GSXB 1H15A 1M7DB 1DLFH 3HMXL 4TQEH 1RV6X 1BLNA 2E6JA 5B22A 1CCZA 3C09C 3V9FA 5DT1L 3VWKC 1RZKL 4S1DD 1Z3GL 1QD0A 3LH2H 2V5MA 5EPMA 3V52H 1F6AA 2BNRB 3ZE1F 1EA9C 1WCQA 4WHYH 1TVBB 2ESVD 2X4PB 4FXKA 3IU3B 3U9PL 3S3PA 1X6LA 3D85B 3BP6A 3DYPA 1DQTA 4QLRA 3E2HC 3GSNA 1I9JL 4V1DB 5T1MA 5EORH 1EBAA 2VUYA 2ED7A 4PLKC 3H9SE 1DANT 4QRRE 3ZKXB 3HAEH 4LHJB 4MA7L 4JJ5B 1BFOA 2I60L 3BOVA 2BOBA 5GHWL 4APQA 5CD3A 5F9JB 3W0WA 2A6KB 4P3DA 1ZK9A 2EDKA 2XNAB 4PRHE 4IMKC 3TF7C 2AV1B 5L6YH 3KYNB 5D70H 3JSSA 4AG4L 4I3SL 4L8DA 4GXVH 4LQFH 3QRGL 5FV2A 1LP9A 2EC9U 1I9IL 3AXLA 3B43A 5F97E 3LPFA 1QRKA 3JWDC 1PLGH 5D7LE 3WKNA 2W0PA 3GBNL 2FECI 5HHXH 4TUKH 4JLRA 2VYRE 1FGVL 3GGWA 4H0IA 1S7XB 4HKBB 2RBLA 4MS8C 3ILPB 4BFIB 4F9PC 1NMAL 1IGTA 3U4BL 4X4XB 3ZHKA 4W68A 4JFQB 4UB0H 4EBQH 3BZ4A 3V0WL 1CE1H 2H1PL 5IWLC 2JIXB 3B3IB 2CMRH 4LCYB 3MX0A 4KUCF 4HCRA 2BY3A 1HHJA 4IMLA 5A40E 1OLZA 3LEYL 4N1EA 1CT8B 4FQHA 3TZVD 5IFAH 1KYOJ 2C9AA 5MP6H 4TRPH 4ZUSB 3MODL 3JBG7 1E4XI 43C9A 3MMEB 3SE9L 1JFQH 1KN2H 3BZFB 4QT5A 5KW9L 1A3RH 4NQSB 2VRAA 1DSFL 5MENA 2P4AB 4HFWB 2ADGB 1NC2D 2X4TA 1CFVL 2FX8L 3RL1B 3VWKD 2BCKA 4JHWH 3RGVC 3EO0B 3THMH 4P46C 3GFUA 1MJUL 5I15L 1TJIH 2H8PB 3BH9B 5C08D 2YD3A 4ZQKB 3STBA 1XH3A 3CPLB 4WY7H 5HI4C 2W9DL 1GC1C 5DJ6B 4ZFGL 3KGRA 5KSBF 1DLHA 3QYCA 5CJXC 3O3DB 4ZS6C 2QBWA 1XGPB 5KAQF 1QP1A 5JDSA 2VXTH 1NCDH 1TJGL 3JV5A 3RVWC 1KSRA 2B1AL 3QIUC 5KSVA 1RZ7H 2QR0B 4JG1H 1FZMA 1KXTB 1V3LA 2P24B 1NGQL 5C2UB 1OD9A 5I30L 4NN6C 3RU8L 3TWCH 1JWMB 1JPFA 4I3GA 3RTQD 3IDNB 4U0QB 1H5BA 4L3EB 4R96A 1HSAA 3ARYA 1UACL 1MCPH 1U8PB 3P9LA 4JY4A 3LPGA 4KUZH 5DUML 1T3FB 1Y18B 2Q87A 4LCWB 1I1AA 5K9JL 2D31A 5FFLA 1E6JH 3G04B 4U1LA 5CD5C 5EOTB 1OSPL 1W2KT 1IEAA 4WUKL 3PWUB 1FNHA 4B41A 2VC2H 3T2OA 3C6LD 1BVKB 3C5ZC 3ARBD 1UM4L 4NC1E 4X9BA 4K7PX 5DRNA 4M4PA 4MJ2A 5E70A 2A73A 4MAUL 4K9EL 4XPAH 2HG5A 3VU2A 5EU3B 5DEGA 4XP6L 1YQVH 1JGLL 3EJYD 1MLBA 1RJLB 2R29L 3I50H 3GMOA 3RY6C 5HDQL 3I84A 3MOBL 5SWSA 5ALCH 3PG2A 1F3DH 1LP9E 3QJHB 4Z77A 3BAEH 3EHBC 4MNQB 4F9LC 1CU4L 4LCIL 3ZHDA 1NC4A 5ADOL 4D94A 3IFPA 1QFWM 3MRDA 5L8KB 4U1KB 1SVCP 4ODTH 4EUPG 1A7RL 3OR7A 2XZAL 3HFML 5DO2D 3PP3K 3QUYD 3IF1B 1PD6A 1JNLL 4ALAL 5JPNB 1GYAA 4LASL 3BMVA 1YEEH 3OAYH 4JFPB 4YIQA 4L5FL 4KJQD 3VG9B 4MQXD 2OSLA 1T4KB 7CGTA 1U93B 3OKLB 2EDOA 1ITCA 5DD3H 3LD8C 3G6JA 3T1FA 4XAKE 1SM3H 1SJXA 3C6LB 3S34L 1CFNA 4RFEB 3RI5F 5F7WC 4Q74A 2WBKA 2E6PA 4I48A 3FT4A 4TPRL 5DMGC 2EH7H 4HPYH 5FHAH 2ICWA 4NPYB 1RHFA 3K0WA 3ME0A 2EE2A 1KELH 3MLVL 5JA8B 5F7EL 4Z7VE 3UPRB 1QFWL 4Z5RB 8FABA 4GUPA 1MRCH 4R3SB 4XX1G 3TT3L 3Q3GA 3B5HA 2DDQL 2YK1L 1SQ2N 1MPAH 2B7DT 5DD0H 3RNKB 4Q9RL 1U3JA 25C8H 5IHZA 4WHTB 2WIIA 4FFVC 4L29B 2DQEL 1UVQA 4CMMA 4P59L 5MI0C 1VKXA 4ELME 1KJMA 1MREL 3KYKH 2J8UB 3U0TA 2B4CC 3Q3GB 4E41D 3TPKA 1KIPA 5B38A 4L8BA 1CD8A 4BQ9A 3BHBA 3WLBA 1MCWM 3WFBH 5TGBB 2RCSL 4XP1L 4K55A 4NPYA 1BGXH 4K3EL 4WWID 3SDAC 3DBXA 1TLKA 5CAYB 4P4KA 3F8UB 1TJHL 4OI9A 4Y4HD 4X7DC 3IFNL 3MLUH 2BNRD 2JB6B 1J8HA 4L4TB 3X3GH 2IG2L 2E3VA 3PHQB 2E8ZA 1CD1A 3O3BA 2DM2A 2DM7A 3F5WA 3GI9L 2Q76B 5JDJA 1KLGA 4NQCB 3SEPA 3MXWL 5GGUB 4ZXBB 3UZVB 1WSST 3IF1A 3FTGA 1FC2D 1QYGH 3BKML 2VLJB 3QDGE 4MXQD 3H7BA 5C0EA 2Y72A 1H3WM 4RMQA 4PRIB 4ZNEE 3MRDB 3BPCB 2ADJB 5CLTA 3QDMD 4XHQA 1OGTA 5DVMA 3KYOA 3VMNA 2CDEA 3ECBA 3SDYL 3ZKNC 4X4YA 2D4DA 1BF8A 3EOTH 5GZNC 1N0LA 3NFSL 4MDJB 2BY0A 3BI9X 5C0GB 3FN3A 1RZ8A 1HE7A 3RWCA 3KS0J 4F2MB 5I16B 2BNQE 5EC2A 4WHDA 3SE4A 4FMFA 2DJ4A 3GIZL 5I2IB 1QLFB 3QUYA 4FTVD 4J3TA 1HZHL 2IF7A 2BVEA 3EJYC 1AFVH 4ODWA 3GRWA 3VFGH 3GO1H 1IKNC 1G9NL 4XP9L 3MGTA 1PQZB 1YN6A 1QBAA 1A1NB 2Y6SC 1OSZB 5IWLA 1C5BL 1KB5A 1CR9L 1WLHA 5E2WL 4ZXBD 3EGSA 2D3VA 4NJAL 6FABH 3MUGB 2D31B 3TH2T 5JQ6H 1F4HA 4PJHE 2IALB 3WV0A 4GQ9L 1K3IA 1XZ0B 3VFUA 2HVKA 1F58H 1RUQH 2AK4A 4WCYL 4KI5D 4EI5C 4U1NB 5T3XD 2IBGA 1H5BB 5D1XA 4WI3A 1HQRB 1T2QH 3MRMA 4FQXB 4UQ3B 4PLJC 5LWYH 1Q72L 1HXMA 2A6DB 1EFXB 2FWOA 4QXGL 4G6JL 1RURH 1XT5A 2LFGA 1U3HD 1JBJA 5C0JA 3K7UA 3DHMA 2F53B 5I66A 2EDLA 2VAJA 4D9LL 3AFLA 5F44A 4PREA 5C0BE 2AERT 4ZSOA 4NQCE 4WW2A 3PABA 4PTUA 1QSVA 5IQ9B 5T5NG 4U6VH 3WSQH 5E8DH 4YHPB 1MFBL 4Z0BH 5D7KE 1CDJA 4M7JL 3OJ2C 4R0LA 1H3VA 4G6ML 2R0WH 3FN9A 1G7IB 4ODWB 3X3FH 3WNKA 5MHSE 2H8PA 5TDPB 2FATH 2NY6B 4ZFZA 1D5BA 2WAHA 2DQUH 3VJ6B 1F4WL 3PV6A 1IGIH 2VZ1A 3DV6B 3SCMA 4QT5B 4MDJA 4KDTC 5AEAA 4OBRA 2MCPL 4H1LG 3KPRE 5DUPH 1JHTA 4A2MA 3LKOB 1FP5A 3U9UB 4OCLC 4QCIB 5DMKB 1WWAX 3IDYC 3E6HB 4QHKI 1JZ6A 1A7NL 1S7TA 4U1SA 1UEYA 2D0HA 2CO7B 3DUSB 3I9GL 3MLPA 1EEQA 1FVCA 2P5EE 4R97C 2FJFA 2Z31D 3MFFB 3LMJH 1T5WB 4QTIH 5I1EH 5DUBB 1VEMA 4NUGL 4K3JL 1DVFC 3BO8B 4UT9L 3F5WB 4DUVA 1CICC 2HJFB 2AJSH 3GK8L 1G9NC 2BSSA 1SEBA 1NPUA 1OVZA 2VQ1B 4LRNH 1E4KC 3BWUC 3IAQA 4EQ2A 2R56H 5KJRL 3GSWB 3MRGA 2EIBA 4RAUA 1P1ZB 3UYRL 2YPKA 1R3KB 3BQUA 2BJML 1I1YB 1TVHA 4ZDHB 4P9HL 5FB8A 1HEZB 1FAIL 3GHBH 4OGYH 1LO4L 1M71B 2QHRL 1T66D 3PV6B 1WT5C 3VJ6A 5D1ZC 1JHKH 4DN3L 4IHOA 3R4DA 1SJVA 2NZIA 3OXSA 4K94H 4MSWB 4HXBH 2QQKH 3MRCA 1VKXB 1DDHA 2AJ3B 3WJJA 1QBML 3HUJB 4WV1A 3B2VH 1BZ7A 4PJGB 5FGCE 4X80L 2EEDA 2CLRB 1TTFA 1T89A 4FABL 1J0IA 5I6XB 1AQDB 3PGFH 4PJEA 1MCHA 5F21B 1H0DB 2WQ8A 3O6KH 4YGVA 3PABB 2NX5E 1RZIA 4OZHF 4AM0A 2ARJA 5CIPB 4FG6D 1G7MA 1NEUA 2AAVA 3QIWA 3IJYA 3QQ4B 1EFXA 5FGRA 5FO9B 2VLME 3ARBA 5D1QD 1FDLL 1WAAF 2NY4C 4F7MA 2PW2B 4AH2B 1T7XA 4C58B 4KI1A 2FX9L 5IBUG 4U1NA 3JTSA 2AK4B 3W11D 1DBKL 2HA1A 3NABL 2EZ0C 1JGEA 3A6BH 4NFBA 3BN3B 4OT1L 3DETC 3QRGH 4YAQB 1FH5L 3ULVC 1I9IH 2RB8A 1SBBA 3FO0H 12E8H 3TBTB 3RDTA 3QEQB 2VZOA 1MCQA 2HKFL 2WUBL 5CUSL 1RJZA 3X17A 2VAAB 4F7PB 1I3GH 3D2UB 3P9MB 4PJ7F 2V9RA 4HUWB 1J1OL 2M26A 4XNMB 3ZYIA 3C9NA 3GMRA 4HQQL 4GSDL 1IL1B 3HZVA 3GMOB 2BRRH 1L7TH 2HAZA 5F9AC 5KZCD 4N8CL 2PCPB 4Z0XB 4NYLA 2QSCL 4CW1B 4KWUA 4U1IA 1IL1A 3AM8C 5C0GA 3WNNA 1FIGL 1F4XL 1H3GA 1WZMA 1LO5A 1KYOK 1CXKA 5FUCC 3HZYB 3U4EB 3SGDI 5HSFA 4OLZL 4MJIA 1P5VA 3U0WH 3N50A 3QNXA 4NO0B 1CTNA 2JCCA 3HC4H 1K5NB 3FHAA 4U1LB 4G43A 4JKKA 4WTZA 3WO4C 1KLUA 3ULUL 2AEIT 4PS4L 4LPYA 5E2JA 1GVIA 4CU8A 4NBXB 3HE7B 2X5PA 4HMCA 4X98A 4GRWB 1M05B 1JZ7A 3D3VE 4PJ9D 4XNYH 1CD1B 4LVNB 1CFQB 5D72L 5BV7B 4N9OB 4XVSL 5FYKU 1TJIL 2O5YL 5K33A 1WBYB 1NCCL 2IAMC 3O9WC 2DRUA 1FZMB 2JJSA 1J88A 1HDMB 4G80B 4X9HA 5KSVB 4P4KB 2RFXB 3UTTD 3QUYC 4XCYB 3WFCH 1FV1B 3RRQA 5F89B 4PJCA 1YEFL 3BHBB 3WLBB 1EFQA 3BXNA 3P2TA 2AJVH 4HIIA 4JFFB 1I85C 2V6HA 3T0DA 1KIPB 4MHHI 5TDNB 1QRNE 3L1OH 5I1LA 4MHHG 5HHPA 4JG1L 5DK0B 1ZHNA 3LKQB 4PJ8A 3RU8H 3BH9A 2BHZA 1NCAL 1A21A 4MSWA 3UJIL 4IHOB 1JNNH 5DSCB 1UXSA 5JW4R 1R5IB 2MFNA 1FLRH 2GSIA 2VLMD 2VR4A 2JKXA 3X12B 3QO0A 4HC1H 5I9QC 1S9XB 3NIDF 2I5YL 2FB4H 1FNGB 2ZUXA 5DMJB 1RVFH 4KRNA 4JCMA 4IRJA 4P5KB 5C0BB 4NN7B 4P23B 1BQLL 3D0VA 1D5XA 1S8DA 3L3GA 1WFNA 2NX5D 1R0AH 4I77L 4RFEA 5HHMD 4OBSA 5DF0A 4TQEL 4JFHE 5I17B 2OJZL 2YA2A 5DC0A 4GBXD 4JO3L 4HC1A 1U93A 1RK0B 2P5ED 2F54A 5F9WC 4LCYA 3BH8A 3ZTNL 3HNTL 2CGRH 2H32H 4YEEA 1DE4A 5DHVA 5ICZB 1BZ9B 4JFQA 1Q9KA 2A2QT 2W60A 3MA9L 5EUOF 3VRIA 3KXFB 5IVZB 1CFSB 5JZ7D 3LKOA 4OLEA 5BZWB 1A6VL 3ESUF 2ZCLH 3TBYB 4OCRL 4NSKA 3K4DA 4D3CH 4P9ML 4Q58C 2PW1B 3QCUL 1FZOB 3IU4L 3M17A 2VDOH 5ILTL 5DEGB 1T22B 3DX8A 2HG5B 4LIQE 1F90H 5D2NE 3E2HB 3LZFL 1DVFD 3O41B 4GXVL 1MCBA 1WIUA 2NX5B 1X7QB 5KTEH 4HJ0D 4R0LB 3FQUA 3GBNH 4PRHA 4JDVB 4JQVC 2ZG1A 3PWUA 2L0DA 4TOYH 2DD8H 4KVNH 4LGRB 1DVFA 4JDTL 2ARWA 4JO2L 2GAZA 2VXVL 3VRJB 4DGYH 3D18A 4QRSA 4CN1A 1JYNA 1QG3A 4P3WA 5E56A 5HGAA 5CHNA 4MXWH 1CLOL 5A16B 1LO3L 5C7XH 2KQNA 5FDWB 1IM3B 1HH6B 4X6DE 2PF6A 1E27A 4LSRH 5IQ7L 3KXFD 1BX2B 1MI5D 5GISH 1DCLA 3TT3H 1YEKH 3TH4T 4OM0H 4RWYH 1S7WA 4GRLD 2CMRL 1SJEB 2WBJA 1V3MA 4OV5B 1JWMA 2QHLA 5ABDE 1I8KA 4Q97A 3JWDL 1L6ZA 5B39B 1BJ1J 3VXSA 4JO4L 2E7CA 4PG2C 2JB5H 4PJGE 1ES0B 3D69A 2ITCB 4OZIE 1RIUL 1H15B 1M7DA 2HTKD 3V4UH 4O58L 2NXZC 4RZCB 3GKZA 3N9GL 2B1HH 3SKJH 5J0BA 1DLHB 5E5UB 1ZT7A 1HHIA 3D1MC 3ULUC 1YN6B 3UO1L 4WUUD 3QIUA 3RI5K 5HGDA 1UZ8B 5T33L 4PRNB 3REWA 5J3HD 4TTDD 2YMXH 4ZFOL 1FLTX 2JE8A 3QEHA 2BNQD 3ZYOA 5IW3A 1YJDC 2Q3ZA 3K1DA 2GK2A 1SBSL 1HI6B 3VWJD 5ALBH 1TZHA 2D03L 4YE4L 1I9EA 3VWJA 1YEHH 3FONA 5MENB 2OR7A 1VENA 3VMPA 5DEFA 5IVXF 1N5YH 5SWZD 5B3NA 4F7EA 3UTSA 4U6YA 5FK9B 1TJGH 1RZKC 4E0RB 3HG1B 4RMUA 3PV7A 4YDVA 5F96L 5F1IB 4AT6A 3KJ6L 1SHMA 4LSUL 3WFEH 5FIEA 2J4WH 1KACB 1KENH 5HYSG 2XFXA 2AJXH 1HCFX 2OXHA 2ADFL 2FBJL 1Z9SA 1U2CA 2GK0A 4IIQA 4KHTL 2NY5C 3DYMA 3IJHB 1OD7A 4PRAA 4NN7C 1HSBB 2HWZH 1T1XB 1IMHC 1HYRC 1UQSA 4IOIA 4Q9CA 1G7HA 5E00B 1BVLB 4NQED 3O2VH 3SGEH 3S6CA 3C8KB 2Q7YB 3ARDD 4PRHD 1FO0B 4NKOA 1KCUL 4YHIA 1A7OL 5KVFH 4YFLI 2UWEB 1A6PA 5CZXD 2DMCA 1CL7H 3TA3D 1Q1JL 4NKMA 2ZPKH 4GKZA 4KJYB 1C5BH 3TCLA 3BFOA 5KS9A 3WIHH 3CFJA 1LP9B 1RI8A 3MUJA 1UM4H 2XZZA 2HRPL 5BS0E 3B8YA 1U8KA 4MGXA 1PZ5B 2LAGB 4PUBL 4I18B 4UBDD 3KPQB 2Z8SA 4Q7DA 2H26B 1N6VA 3TBSB 1ND0B 2FEDD 1JPGB 1PBYA 2ZSVA 5HDQH 1K4CB 1CXLA 1Q0YH 3MQIA 4WFFE 2AV7A 4JM2F 2DQJL 5JORB 3ARFD 1I7TA 2ZUQB 3CVIL 3CXDH 2NY2C 1JUFB 3I6GA 3T1WA 1B90A 2MNUA 1FN4A 4XHJC 3M1BB 5CJQL 4YPJA 4JZOA 1RUAH 4F58L 3BISA 3HFMH 1GZPB 3QA3A 4X7SH 1UWXH 2B39A 3P4OA 4GAJL 4QHLA 2O93L 3V6FA 1MFBH 3PGDB 5DJCB 4Y19A 1TVBA 2XN9E 5MHSD 3ARZA 2Q86B 2BDNL 4PRDB 4E41E 5I6XC 1ZANL 4ELMA 4RNRB 1RY7B 2FSEA 1TENA 1G6RL 1C1EL 3V5DB 3O4LE 3X3FL 2ZNWA 3EOAB 4PR5A 4YIQB 4XH2B 1YMMA 3TT1H 1FL5B 2PYFB 4OIBA 2DQUL 3PQYB 1H3PH 2QQQA 5FHAL 1U6AL 4OZGA 3IYLW 4HIEA 4OD3H 1YEJL 1RZGA 5LAXA 3MLVH 4LHUB 4OD1L 3WUZA 1EGJL 2CDGA 1XCTA 2EH8L 2OS7A 4MAYB 4WW1B 3SDAA 5DRXA 3WE6A 3T0ED 2MCPH 3LEXA 5BRZA 5DQDL 4PD4J 3TA3B 5C2BH 1TMCB 1NGZA 4Q9RH 5D1XD 5HPMB 3OGCA 5T1DH 2EDRA 4LNVA 1NFDB 3VFTB 3PP4H 1OP5H 5F1NA 1ONQA 1M7XA 4XVJH 4X6CE 1S9VB 3R1GH 4HHAA 3TH3T 2APBA 5DJZB 5IHUL 2ATKB 3NIFE 3B9DA 4HW6A 4NDMA 5C07A 1BVKA 1C16A 3BKCL 2PYEA 3MYJB 4EUPB 3ULVD 1BGXL 3OB8A 4K3EH 4YC2C 3QUXB 4HEME 1WEJL 4H0HB 5IFHH 5EOTA 4XXCA 5FYLL 4DQOH 3MYZA 4M43H 4NCC2 4YXHH 5FA4A 1F00I 4BH8A 4O9HL 1CE6B 3CH1A 4DKFL 1ZWIB 5EU6D 4S1RH 5AG9A 4UV4H 2Y06L 1U8PA 4LHUD 2BOCB 1YC8A 2HT2D 2A1WH 4KK8D 3TYGL 4PTTA 2VSCA 1S7UB 4M6OL 3IKCA 2DWEB 3CSYB 5E8EB 3SO5A 4BSJA 4NWUH 4HS8H 1HHKA 4DN4L 5H35A 3QO1B 1LD9B 1DFBL 1LK2B 4N5ED 2PO6B 1QO3A 2VE6B 1OAUL 3R06B 4LLUB 4LCWE 3SJVD 3MSPA 4LIQL 4TUOB 3V0VB 5IJVA 2C5DC 1F6FB 4ONFL 2W9EH 4AMKL 1SMOA 2HN7B 1BPVA 2A9NL 4N0YL 1MRDH 4OJFH 3WIIH 4DOHE 2XI9A 4FQIL 4EDXB 2Y36L 3RWHA 3GSRA 3S36L 4YR6B 2E9WA 2Q1EA 1EXUB 3RUGE 4D9QD 2IAMB 1IC7H 4P3CH 5KOMC 3BUTA 1NEZB 3IFOA 4QTHA 3FFDA 3BT2H 1NUFA 3G6JF 4POUB 1MVFA 3EIFA 4JANA 1D6EB 4LLAA 1YEGL 3GSUB 3GO1L 4KDVA 4QRQA 4ZO9A 3SDCD 1J05A 1BOGA 2DQIL 4OGZA 3QXTA 3MGAA 1EEYB 3QQ3A 4FQQA 1UM6L 3MRIB 1TZGL 3UTSE 3MV7A 4XCCL 4MVBC 4Z7WF 1AGEA 3ULVE 3NMEA 4RGOL 4UINL 2VE6A 2E7LC 1CLZH 3VFNB 4E41A 3VFWB 2FGZA 1UCBL 4ZO7A 3UBXA 5JW4M 2AVGA 4LPTA 5ID0B 2DLGA 3FQXA 4JFOA 1MIEL 5J06A 1PAMA 1LWRA 3P40A 5F6IB 1YY9C 3CDFA 1CDHA 4X5XB 2BHYA 1UJ3B 3B3IA 2F8VA 1OTTC 3FOMB 3U36B 4X7TA 3P73A 5FHBH 3OTTA 1H8NA 3FT3A 4Y1AB 5EU6E 2FCBA 4Y5XC 1I3RB 1QQDA 3SCMC 5EU7E 3NH7L 3O6FB 1EZVX 1ZXQA 5K59F 2CKBH 2PR4L 5EA0L 3MGOB 3SKOA 2MQCA 5IMKA 1GIGH 4Z0BL 1BQHB 1A1MA 2X4OB 4XAKD 5ISZD 3QIWD 1JMZA 2MKWA 5KSBB 1ZHBA 3MO1A 4UBDC 5CCKL 3NZ8A 1NFIA 2DLFL 4F3FA 4I2XE 3KPRB 4FMKA 4GW1B 5J12C 4MNHA 4XBPA 5SX5H 4ZMAT 1W0VA 4LCCC 4WTXA 5IB1B 4P3DB 5LCVH 3O8XA 1IGIL 2B4CL 3RUGB 4YHZL 4JFDA 1CK0H 1II4E 2VIRA 2XWBA 2C1OA 4PY8J 2ICEA 5L2JA 2HLFC 3MJ8A 4JY6A 4PJBA 1WTGT 3OG6B 1CYGA 4AENA 5EO9B 1N64L 1OAXH 1VFMA 3HNVL 5DLMH 2YN3A 5EFIB 4JM4H 3WBDA 1YMMB 3OPZH 3MLZL 1F11B 5H2BA 2ITDA 4L4TE 4R0LC 4NJ9H 3QUKA 2FSEB 4IOSD 4HAGA 4HWBH 1OM3L 2E27H 3D9AL 5EPMB 3V0WH 2ID5A 3WIHA 1HOCA 5D7JC 2IMNA 4PY8I 4R2GB 2OJEB 5CSZB 1ZLUK 5BS0A 4GRLC 1Q9OA 3CCHB 1CGVA 4L9DA 5I1KL 2XQBL 1OY3B 5HDBF 1E4JA 3JV6A 5DJYB 5IP4A 1GGCL 4KK5C 4Y4KC 3P4NB 3SKMB 1MELA 1RQ5A 4BFGA 4YFEA 2I5YH 4PJDB 5DWUH 4BK5A 4PRBA 4Y5YC 3U30B 5F3BB 1NCTA 1MLCB 2J12B 1CWVA 5IKCB 5IEKB 1FBIL 2HFGL 4AEHH 4H5SA 4ZFOB 4WI2A 5IB1A 4MJ6A 4HKXA 5IJKC 1X44A 3HZMB 5HGGS 3KPRD 1U3HB 5HYSB 4F3FB 3GSOB 1NMBH 3T77A 3CFJB 3HNTH 5D2LF 1A6UL 1MIML 3OXRA 1AHWC 3RKDD 4L3AA 1ZHBB 3MO1B 4BSVB 3TLRA 5BS0D 5E99H 4K9EC 1WAAA 1VFUA 2V2XB 5B3JF 3IKKA 2WUCL 3O6LH 3C8KA 4BQ6A 1NBYB 3TN0D 3NPZB 1RZ7L 2BVTA 4RA3A 3IDIA 4DZBB 5M95B 1S5HB 5DQ9A 4POYA 3I6LD 2IH1B 3VGGA 4OFIA 1BP3B 4X5XA 2O61A 1DQLH 3QI9C 2DF3A 4KGJA 1X5FA 1UACH 3A6BL 4MQSB 5F1IA 5DUMH 3V5KB 3WNLA 3HG1A 3RVUC 3V6OE 4QYOB 4S2SB 3L5JA 3S35L 2WWKO 3HN3A 4LSDA 3VDBA 1B2WL 1U8LA 3KPLA 4WEBL 5D5ME 5SWSD 3MRIA 5T3XE 2ZP0T 2XTLA 4QHKJ 4U7SA 2BMKB 1A4JB 3ZT5A 2BVOA 5HHQA 4ZAKB 4MQ7A 2N7BA 2A77H 3LH2L 1MQ8A 5ESVA 1N6QH 3ARBC 4UQ2B 4TN9A 5FO8A 1EAJA 4QTHB 2NY7L 4WNQA 5HGDB 1MFDL 1UKSA 4RFOH 4KKLC 3KYMA 3NOIA 1JGLH 1N5AA 5E5MB 2R29H 2V5SA 3I50L 4Y7MA 1L9NA 3MC0A 1B4RA 5L88H 4GKSB 1MFCH 3UTSD 3D3VB 3MV8D 5JPMA 5INCA 3JV6B 5DJYA 5C0AD 4G9FA 4MD5A 4JGUA 2FIKA 4I0PA 1PG7W 2CJUL 5F7NC 3ULUH 4JZNA 1X4XA 5AWNH 2I60H 3BGMB 5GJSL 1DBBH 4MNGA 2P5WE 4DOHB 1LD9A 3EFFA 3HS0B 3ULUF 1ROWA 2R2EB 3FQWB 2AJZB 2JTDA 4YDJB 1I7UB 2YPLB 3ARPA 1KG0A 1X5ZA 1U91A 4X7CC 4EOWL 4H8WC 2ZUQC 4IRSC 2O5YH 1Z9LA 4ZUUB 1J87A 3DGCR 2AP2A 1ZWIA 1P84K 4XT1C 5J13B 2OYPA 3TN0A 1QLRA 3QPQD 3NPSC 3C60A 3F65A 1YEHL 4WU5B 3K2MC 3O11A 1IGFH 2GT9A 5AUMB 3FQUB 4JFDB 4LSVH 3ZKXC 3N06B 4OM1H 3VXSD 3MBED 5IB2A 3GIVA 3U7YH 1HHGB 5C07B 1A7PL 3ARRA 3LOWA 3ARUA 1OB1B 2DQDH 4YUEH 1CE1L 5FKPA 4HHAB 1S9VA 3T0EC 3SGDH 1AXIB 4NKDA 3ROOA 1T1WA 1T22A 2VH5H 3DX8B 2OX5A 5F88A 1MEXL 25C8L 2ADIA 1INEL 5D5MB 3SDCC 3IT8D 4KTDL 4HDIB 4P5TA 4MJ4A 4S11A 4HWZB 4F15B 5E9DE 4R4FL 5IMKB 5BRZB 5CEZD 5D6DC 5BO1L 4MAYA 4WW1A 3TJHD 1RIHL 4CL7A 4OCMC 3PGCA 5D9SB 3QG7H 4Y2DC 1BREA 1FGNL 4MDIA 5DRZB 4ORGA 2HJKB 1OP3K 3MCLH 5KSBE 3VXME 2HMID 4P46D 1DQJB 1I9RL 4KTEL 4NN5C 3GSNH 3QUML 1SJHB 3MLUL 3ABZA 3CAFA 4PR5B 5M7QA 4E5XB 1FYTB 2RR3A 1M7IB 2F54B 2CGRL 2GITA 2RJMA 4FP8H 3FQNA 1G6RA 3H42L 5IF0B 4YDJA 5I17A 2ZJSL 2Q86A 4XP4H 1MCWW 3AS3A 3ZE2F 2HT2C 4QHLB 3S37H 3VFWA 1Q0YL 5F7FA 4B7LA 5DD6A 1MFAH 2OK0L 2NXYB 4G9FB 3VD9A 2YS4A 1MCKA 3T0AA 1NAML 5L9DH 2HT4D 4OF3A 2DM4A 1FFRA 4MB4A 4DAGH 5IBTH 3ZE0F 3ZTJH 4NNXB 3WNPA 1D6EA 4U2ZA 1JZ3A 3AS1A 3TBSA 4NWTL 1S7QB 4X5LA 4JFDE 1ZANH 5DMYA 2XTJD 3LPWA 3HLAA 4NHCH 3RKPA 4EN3C 3GSRB 4ESKA 1F5WA 1A4JA 4F57L 5I76A 1K3ZA 5KVMC 4WFFD 4XP5H 5KS9B 4NKIH 4MA1C 1VCAA 5FYKE 3JUYA 3VRLF 2IPKB 3DX7B 1XF4B 1ZS8B 3HC3H 2X1WL 1K8IB 1UH4A 4YHIB 4QXWA 4V2BA 2NNAB 3BPNB 4UILL 3WXWH 2XZQH 2F19H 5E9DB 1KTLA 1LMKA 1BVLA 1S7UA 5TH2A 5ANME 1A6ZB 1FPTH 1OT1A 1Q0XL 1XGQA 1JPSL 3NFPA 5F7DA 5HD8C 4QRUB 3HPJB 3BKYH 4N90D 3WS6C 3MOBH 4PYGA 4MCYA 3ES6A 3ROLA 2OM5A 2NYYC 5CS7A 1CBVH 4NO0A 1ZT1A 5GS2D 1AJ7H 5HGBB 4A2LA 1RURL 2B5IB 4S10A 4AEFA 2EDYA 3ZDYF 5AZ2L 3T2QA 4I9WE 3H3BC 4NHUB 5FK9A 4Z78B 1ED3B 5J13C 1HQ4A 3NIGE 4F7EB 3RTQB 3G5ZA 4FQ2H 4YPGA 1T2JA 4JFZH 4J6RH 1ZOXA 1JNLH 4PJ9A 3IS1X 3H6JA 1S9KC 1YEEL 5F1NB 1OTUC 4I1NB 1U3HA 3IB4A 1DQDH 4PBXA 4Q0XH 3ZDZF 4HAFA 1MHPL 5J8OA 1N7ML 5C70A 5KSAA 4UZGA 4YE4H 4XX1E 3WXVH 1I1FB 3CVHL 1BFSA 2FATL 2QTEA 3UZEA 3LEXB 1MF2H 1ZT4A 4ODBD 5FCSH 4HZAA 4KJWD 3SHSA 3LY6A 3TBTA 3PWPD 5T1LB 4N0UA 3VH8A 3QUZC 3BUYA 4OZGB 3P3YA 5CJOL 3O3AB 3EZJB 2FZ3B 1FSKC 3TEUA 1FHGA 2HJLA 3C6SA 5CBEA 4LLDB 2OJEA 2GTWB 1I8IB 1KNOB 5A2KH 1A7NH 5A43C 4G8EA 3RWEB 3ARXA 2HKHL 3CD4A 1GXEA 1I8MB 2I25N 5FO9A 4ZOCA 5I1CL 4KZEH 1OTTD 2N1KA 3L5IA 5JXAL 1E27B 4ZO6A 1KBGH 5GHWH 3LQMA 1FN4B 3P30H 4Y4FC 2AJSL 2X44D 1BOYA 4JQXA 5HDOA 2EDWA 1JUFA 5ESAB 1UM6H 4NT6B 5EO9A 2X7LA 3CGTA 3MJ8B 4M9PA 2BSRA 3PWLB 3IFNH 2P5EA 3OKNA 2C1OB 1DBAH 2DQGL 5EDXA 1FFPB 2Z92A 4JGJA 5I1AA 1CIUA 5EWIL 1ZLSL 4GRLB 5TQ2L 5LG1A 3T4AA 2YUVA 1MI5E 2C7UA 4WFEE 2NX5A 3MRRB 4XCFH 1VA9A 4LMQI 4BFEA 2Y25A 2NCMA 3KNBA 3VDCA 4MXQC 4J3OC 4K94L 3SGKC 1G7LA 3U1SH 5IBLD 1DUZB 3BEVB 1AGCB 1IQDB 5DHYA 2PTVA 3X11A 2LTQC 4BYHA 2L4OA 2H3NA 2QSVA 5KSBA 5C6PB 1S7SA 4JVPA 2YPKB 3STZA 3MROA 3GHEH 4EN3D 3ULUD 2DIJA 2Z4QA 1RUAL 4ODUB 4F58H 2BY1A 2YPLD 3NFSH 3KWWB 1I3RA 1QQDB 1TNMA 5AZEL 5I1JL 5CINL 2WWMD 2W60B 2YKLH 4G5ZH 4K3DL 4PBVC 3RVTC 2BDNH 2IANA 3L3KB 4NZTH 3OR6B 5DUBA 2OL3H 3HR5B 1C1EH 3OKEB 1HZHH 4AEIL 4IIQB 2FEEI 1G9EA 5KSUA 5E2TL 4LF3B 5DMKA 3AGVA 3SDXB 2PYEE 5EU5B 1LK3H 5MEQA 3KYAA 3DYOA 3FQXB 1U8IA 3HI1B 1QA9B 4OZIB 2NY3B 3NABH 1NFDE 3HG1D 4FZ8H 4BZ2H 1AD0A 1CICB 3KPMA 4MD0A 4Z7QF 3WLWD 2EO9A 4E42A 3DV6A 1NAKL 3WDHA 4P2RB 3MV7B 3FONB 2FO4A 3FO0L 1A2YA 3QI9B 1IBGH 1F58L 2WUBH 3MV9A 4K8RL 1PG7H 4Z7OE 4JQIH 3ALXA 4BQ8A 2Y4SA 2D4FA 3QWOA 4IJ3B 4N8VB 5C08A 4HZLB 2VXTL 3I3BA 3RX5A 1WWWX 2OCFD 2XA8H 3UTZB 4L9LA 4HWBL 4MJID 3BQUC 3K8LA 4N0UE 4U2YA 2R69H 2B1AH 3N1QC 3P0VL 5KSAD 1YPZF 3DVGA 1CVSC 5F9DC 4JFYA 2AEWA 4O02H 1JN6B 4FFZL 5D7KD 4KQ3H 4PREB 2HN7A 3F7VA 3AMKA 5I66B 1BECA 1KXVC 4DUWA 4LLUA 2VLRD 4H26B 4HIJB 1HWGB 1CXFA 2FWOB 5L2KE 5H35B 1CD0A 1I8KB 3DXAE 4UV7H 3RX8A 3WN5B 1IVLA 5EBWB 3UXFA 4K3GA 1AR1D 5ERWB 1W72A 4G8GB 5C8JA 4AEHL 1IFHL 4HUVA 5E24E 1GPOL 4ETQB 5DK2B 4Z7VB 4UNTA 5FECA 4DN4H 2IALA 3CLEH 4JRYA 3UTTB 3VXMD 2GAZB 3EGSB 3ARGC 4MAUH 2W9EL 1U95B 1KB5B 4MA8L 4N0YH 2UWEE 4DKEL 1EO8H 4PGBA 4QHNB 1A3LL 2Q8BL 4M5YH 1HNFA 4MJIB 4C59B 2BHUA 2XWTB 4H20L 2IEPA 2PYEB 3EOBA 3MGTB 3MYJA 3SOBL 5I0DA 4KU1A 3PDOA 1MUJA 4M7ZC 4HD9A 1NCUA 3VI4E 4MXVE 3DIFB 3GSVB 1BD2A 2OBGA 3BAEL 1W72L 1IEBA 4CW1A 4PP2A 2XG4A 1KFAL 1E6OL 1UT9A 4F8QA 3M17B 5C0AA 5I1IH 1NKOA 3FL7A 3OGCB 1URLA 4P2QE 3UTOA 4GAYA 5KJRH 4MWFA 4R7NB 2EDXA 2VDKL 4ERSH 1G0DA 1ZEAL 4F9PA 3KPSA 5FDYA 5C71A 4L5FH 1OAYH 4LOUC 3KXFA 3B9KD 4HG4K 3HZKB 3RVWD 4YHKH 2NY5L 3MJ9A 3O0RH 3EYFB 3H9SB 1B6DA 1A9EA 4DW2L 4P46A 3NACH 4FFYL 3SDDD 5GGUA 5EIVA 3FQTB 4CMHC 1WZLA 2XN9B 2NY1B 2Q76A 5BCAA 1IC4L 4YNYA 3JTSB 3JVGC 3RZCC 3TESA 3V5DA 4RIRA 2VR5A 3BQUD 3UX9B 2VTFA 4NUJA 2R8SL 1CGXA 5GIRA 2IADA 5LBSL 3PGDA 4GMSH 2CXKA 3JWOL 2QADD 35C8L 1QSED 4P23A 4RFOL 3U0PA 1GC1H 5LXGL 1F4YL 3FRUA 4P2QD 1LQSR 5L88L 1LVEA 2P49B 3L7EA 1IARB 4LHUG 3NN8A 2W59A 4YGVB 1MREH 3IETA 1PG7X 4M48H 4YDIH 5HGHA 4HK3J 3PXJA 4O2FA 4N0RA 4PJEB 3GJFH 4I2XA 5DSCA 3RAJL 4X0KA 2CJUH 1WBXB 2MHAA 4P9MH 3O9WA 4XVUC 1JPGA 4XP1H 4HWEL 1ACYH 1X4ZA 2DL2A 3QSKB 4BFBD 3I85A 1VB9A 2WSKA 3AREB 1MCEA 1F90L 4TULH 1KTKE 3Q48A 4O2FB 4PJCE 3UYPA 3T08A 1LO2H 4QHMB 2YC1B 3FT2B 3HE6B 3FFCE 2ZCHH 1JWSB 5FB8B 5I8CB 4XCYA 12E8L 4GAGH 2VL5A 2Y5TA 3M07A 3BQUB 1QOKA 5CUSH 5BMFL 4ODSH 3RGVA 2P7TA 4KVNL 2EE9A 4TSBL 3MRGB 4I5BA 4NKOB 1DJSA 4JDTH 5GIRB 3RDTD 1ZSDA 3T1FB 5A2JH 1C5DB 3PWPB 1A7BA 1RUML 4UT6H 3CFDA 1EFXD 4OAWB 5BW7A 2X41A 4N8CH 3MPCA 4NO2A 3FQTA 1T04B 3V4VL 5BVJA 2EYTA 5ITBH 1Q9LA 2WIMA 4NCC1 4DWHA 4ZAKC 1S9YA 3BIKA 5ESQB 4L4VB 5CGTA 2DQFA 1WAAE 5GRXG 4Y16D 1ZHLB 2VABB 4AEEA 2XYCA 4MNQA 1J8KA 2DN7A 5J56B 2Z0BA 4J3SA 3P0YL 3HZYA 5DDHA 3OAUH 2OTUB 4RRPG 4GAYB 3DX6B 3N9GH 1U8HB 5E8OA 2HT4C 1YDPA 1YNKL 3M8OL 4ODHL 4UDTA 1FBIH 1H5BC 4PJFE 2E8YA 4I4WB 1G1YA 4FQJH 1JPTL 4KMTH 1ZVSB 2W0FB 5GSRA 1PX3A 3JXAA 1EHLH 5DRNB 4CNIA 6FABL 3DIFA 5TDPA 4PJBF 2AGJH 1KC5L 1MUJB 1GJIA 4CVZA 3MUHL 1MIMH 4XZUB 2ZNXA 4WWKC 1XAUA 3T65B 2ZJSH 5I75B 2B8OT 2E9IA 2H2SC 1HH9A 5CGYC 2PYED 5BQ7B 1J1PH 2XRAL 3G04A 5EU4B 2KDGA 5EULV 1AO7A 1I1AB 4JAMB 1T1ZA 3UTTA 4JRYB 5KBNC 3N1FC 4U3CA 3RJQB 4LSUH 1FNLA 2ITCA 1RFDL 1KJVB 3PWJA 3VI3E 4D9LH 3RY6A 5C8JB 2ICES 2AJXL 1KTDA 3GMPA 5IJKA 4WI5A 3CK0L 4DGIL 4FQXA 4UQ3A 5EBWA 5EIIA 4MZ2A 4ONGL 3HMWH 5D1XB 2HRLA 2CIIB 3RJDA 2YXMA 3WO3B 3PWJB 4L8CA 4NWTH 2HH0H 5E2UL 3QDJA 3LS4H 1IM3A 3NTCL 3BP5A 4M61A 4XPFL 2QQLL 1KCVH 3SCMD 5CHNB 1EJ6A 2R2HA 1JWUA 1T1ZB 2P44B 4P4KC 3FCTA 4Z7UF 1DVFB 2R2BB 4BELD 1B2WH 4LSTL 3QUXD 2FLBT 5I71B 1Q1JH 3DMMD 3H8NA 3NCJH 3I02B 2V7HB 4LFHD 3VD7A 3TIEB 1OP5K 4Y88A 1JF6A 3QQNA 5B39G 2YBRA 1EMTH 4U1GB 1RMFL 1PFCA 4LGPB 1QLFA 2VXQL 3BD4A 3RFZC 1AGDA 4KDWA 2ZOLA 4IRSA 5B8CC 5DURB 4C56D 4NN5B 3OX8B 5C9KA 5J6GB 3PXHA 1OAKH 4PIRF 3FFCA 3TYFA 4OZHE 3I9GH 2OTUA 5ID1A 3LQAC 4OLUH 1N6UA 2CDEB 3ECBB 3JVGA 2BVQA 1K4DA 2DLIA 3QCVH 1TQBC 3OB0H 4DVRL 3RL2A 1Q9KB 2X6MA 2AK4D 3KPPB 3V7MA 4G9FD 5ICZA 1D9KB 2NQCA 1IGJA 3LKRB 3S98A 2FJFB 1T04A 3C2AH 4NQCA 1PGRB 3FRPA 2IAMD 2BJMH 1NC2A 3KPPA 5DD5H 3RL2B 2X4NA 2GJ6A 3E6HA 1RK0A 3LSOB 4PJAA 2NW3A 4QCIA 1CLCA 1GHFH 1HHHA 4R6UA 2LU4A 5EIQA 2QHRH 4R90L 4ZUWA 43CAB 4I5BB 5T1KB 3SPVB 1YEIH 3E8UL 4G3YH 2VDLL 1S8DB 4P5MB 2V7NA 2HLAA 1A5FL 1NGYB 1Q38A 1ZKAA 3N1PC 2F15A 3U7YL 1DBMH 5DURD 4C56B 4ZFFB 4IRSB 3DVFA 3N85H 4NZUH 2DQCL 3L7FB 1I7RB 2JIXD 2EDNA 5H94A 1KJMB 3TIEA 2V7HA 4WHTA 2Z92B 1MHHB 1OOAA 4Y2OA 5JOFA 4Z95H 4YDLB 4HH8A 4YHPA 1F45A 3O2WL 1RIHH 2DAVA 2E7MA 2XKNA 5HYIA 4XNUL 1FGNH 4RGMC 3MNWB 1QFUL 2ICWB 1FAKT 4LBEA 3UO1H 3GZKA 1DL7L 3TBWB 4WENB 2Z93A 5CLWA 4HX1A 4PGCB 3C6LA 2ZWLT 2WWMC 2G2RB 2V9QA 1KTDB 3W5NA 3A67H 4TVPE 1N3NA 3W0WD 4F15C 2F9BT 1NLDH 4HUUA 1OCWL 2HT3D 3QFDB 1AIFB 2Y06H 4IDJL 3VFUB 5GZOD 3HAEG 3ILQC 3PDDA 1PX4A 4IRZL 1GOGA 1EUTA 2HFEB 4IBLT 3B2UD 3IXAB 4U1KA 4HS8L 1B9ZA 5D1QC 2OK0H 2JCCB 2DLTA 1LO0L 1WFOA 2XTJE 1MNUL 1GGBL 2HTLC 4LIQH 4EI5A 4WHCA 4DAGL 1FVEA 3ELAT 3TGXA 1UGNA 4G7VL 4OZFB 1X5AA 5KS9E 4LVNC 1AO7E 3VFMB 3QUYB 5HYFA 4NYLB 4P9HC 1TZIA 3MV8B 3L9RA 5L0QB 2DLHA 1IC7L 3L5XH 1O7VA 3RWCB 4F2MA 4YPGB 5I16A 2NY0B 5K9QI 4JM2A 1YDPB 2FH6A 4OCSL 5C0BD 2DWDA 4M5ZH 5BOPA 2G60H 4NHUA 1PSKH 4HJGA 5D93B 1NAMB 3RDTB 4I0CC 4O5LL 1MFEH 4HT1L 4M6NH 1KB9J 1AQKL 4L4VA 4M8VA 2JJVA 4NO3A 4PRIA 1OW0C 4I3SH 4NRYB 4PJFA 1NCWH 1S9YB 2XZQL 3LRHA 3QIBC 4RWHA 1JGEB 5EU6A 4XAWL 3J8F7 4KI5E 2EYTB 2NTFA 2VDPL 1FPTL 1QR4A 1NGWA 4F7CB 4XBEH 4XWGL 1MQKH 5IGXH 5CJ5A 4P23D 1A6ZA 1BFTA 3O3BB 1KULA 3BWAA 4U6XA 4OAWA 4HUVB 3GI8H 1N3NB 1JIBA 3IDNA 2ZUYA 2CRZA 2PW2A 3LN9A 4ORZC 5IHBA 5FO7A 1CBVL 1CG9B 4X8JA 2P7TB 1RU9H 3ARDC 3ESVF 3IVKB 1DR9A 2NY2D 5LQBH 4V1DD 4HUNB 3MREB 3HI5H 1JWSA 4GS7C 3IDUA 3TNMB 3UROR 1ULVA 1JN6A 5I76B 4QHUA 3ULUE 1MVUA 2FGWH 3KR3H 4FQLL 4M6ML 4NNYA 4UTBL 4JCLA 3ZSSA 2EC9T 3STLA 4OLXL 4OZGE 5CCKH 2WIIB 1K2DA 1DDHB 2AJ3A 3MJ7A 1F02I 1R0AL 3FB6A 1DSFH 3I2CH 3KPOA 5KVGH 5T5FH 3QDME 1M71A 2VN4A 1U6AH 4JZJA 1QVOA 4E42B 4PBWD 2V2WB 3DO3A 2X4SA 3LRSB 2VDNL 5C0IB 3UTQA 1TVHB 5I15H 3FT4B 4K2UH 4ODVH 4I8DA 1U8NA 2NY3D 1ZV5A 3NCMA 3UEZA 3RVUD 3G5YA 4HULB 1KEGH 5D8JL 2GCYA 4PJ9C 4FQHB 1V05A 2ATPA 3FQNB 5KVDH 5J3HC 3DI2B 2HJFA 1T4KA 4ZO8A 4CN4A 2ESVB 3BO8A 5ACLA 2D0FA 1T89C 4P0DA 5HY9A 4XVJL 1JHLL 1T5WA 3QI9D 2VUOA 1NCDL 4M62H 2ED8A 3OB0K 3LKRA 4NJ9L 3NCEB 4WO4D 1F2XK 2V17L 1R24B 4CDGC 2E7LA 1N26A 3A0OA 3CSBA 4PB9H 1NC4B 4HWNA 4JREC 4NO5A 5CMAB 4AIZB 1FG2B 2HTKC 5D7IF 4N1CA 3OKKA 1K4DB 2A6IB 4ODUA 1P4BH 4TNWK 5HI4D 2A83A 1T7YA 2XQBH 3DVIA 3STZB 4Y2DD 4FQCH 2I07B 5CP3A 4JPKH 4HCRH 2BXZA 3JZ7A 3SCMB 3X11B 3L5WB 1FZKB 4S1RL 2J88H 3RA7H 4ZPTB 4ZAKD 1ERNA 3VFSB 1KJ2L 1T1WB 5J57B 1F8TL 2DD8L 3NACL 2XIDA 4R9HA 4HV8A 4GMTL 1GH7A 1BD2B 4Z6AT 1PJ9A 4FQXD 3AY4A 3L3HB 3F6IA 1NJ9A 4MXWL 1N2RB 5F9JA 3BSZL 1P6FA 2XPGB 3V52L 1OAUH 3F62A 4QHNA 1KJ3H 3TZVC 1REIA 1YEKL 2EEAA 2W1NA 3QG6A 4GMSL 4NQEA 3H9HA 3MRBB 1PZUB 3MRNB 4RMVA 2JJUA 2APXA 4RRPA 2VLLA 2IANE 5EZLA 1I9JH 4ODXB 3BP5B 2JJTC 2GW5A 2WUCH 5DK2A 1IAII 4C56E 1UXWA 3HE7D 4OQTH 4DTGL 2P45B 4ETQA 2CIIA 4WWKB 4L3EA 3BT2L 5IMOB 1L0YA 4JKPL 5FYKL 3ZZ1A 1I7UA 2YPLA 2ZUTA 2NY6C 3GMNA 4LCIH 4G8EB 2H2PD 3BJLA 1K8DB 5JQHC 1I8IA 1TPXC 4P49A 3LAFA 1WIOA 1ZA6B 2APTA 4AL8H 4OLYL 1D9KD 5JR1H 1YJDL 2H2SD 3IXTB 1KN4L 4IRJC 4RISH 4LQFL 2X9XA 2A38A 2IPUK 3TC9A 3BIAX 1VEPA 1NC4D 1T83C 3CFEA 3PJSA 3O3DA 5D7JB 5GRWA 4N0UB 1N5AB 5E5MA 1HH9B 5DJ6A 1A1NA 4JB9H 1SM3L 4CVXB 3OG4B 1ACZA 2VZ3A 1ZT4B 4ODSL 2NY4D 4JQIL 5GGRY 2GUOA 3T8XB 2EDFA 4N8VA 2X05A 3FB5B 3EDJA 4NN6B 3MLTA 5JW5B 4CJ1A 1B3JA 4QY8A 1NLBH 4GRWE 1G9MC 5FHBL 5EC2B 4P2RA 2A74A 3QDHA 4HLZH 4X6BB 1CQYA 4UMGA 1AXTH 1QLEH 3DTXA 2DTSA 43C9B 2CKBL 4MMZC 4OI8A 3EJZC 4OF6A 1SYSB 2HWZL 4LLQA 3IGAB 1F97A 1LGVA 1CGWA 3KHQA 1AI1L 4XHJD 3U7WL 1M6OA 4KMQA 1YQ2A 3SDXA 5DC9B 5HHOD 3BP7B 2DLFH 4JFFE 1G7PA 2O61B 2OLDA 4MCYB 2IH1A 2F53D 2J8OA 2JIXA 1KCSL 3NCYP 5IBLC 2XWJA 1WK0A 3NFPB 5F7DB 1CL7L 2IANB 1MAML 5TH2B 4LP4A 4HK0A 4KKCD 3ILPA 1UH2A 4BFIA 4H25A 3PWPA 1TETL 2HRPH 2VKWA 4ZODA 4L9LC 4QXUL 2VSDA 5DK3A 2V2XA 3MROB 4HUMB 3T0WA 1XEDA 2A0LD 2R0ZL 4K71C 1YN7B 3OXRB 2WBWB 1AGCA 5DHYB 4UOW1 2DKSA 4QHMA 5FM4A 1JI2A 4TYUA 4YFDB 4UUJB 3HZMA 3F7PC 4KFZC 1T03H 3MLXH 1R3IL 2WBJC 2DQJH 2GI7A 4HKXB 2QSTA 4ONHA 1YMHA 3ZE1E 1OWRM 2DQDL 4LNRB 4X6CF 2A6KA 1MCOH 1LEKA 3FAWA 4WUUE 3VG9C 5CILH 4TNVF 5CJQH 5CD3B 1YNTB 4B7IA 2Q8AH 1OF2B 4X0KB 3LD8B 1QSZA 4TVSa 1HIMH 1INEH 3P4NA 1DANU 1C12A 2EDTA 3VXUB 3O3EA 4HWUA 3L7EB 2DQTH 1KCVL 4M6AA 3T4YA 2VZUA 4MJ5A 1A6TB 3VGFA 3LN4A 3O0RL 4LEOA 1MCSA 1CGYA 4Q2ZB 3VXQB 3MXVL 3VFOA 4YHML 4KI5F 3VE0A 3ZSTA 4X6DF 3B9EA 1UM5L 3CDCA 3DHJA 2X2YA 3G6JB 1QSFB 3OKLA 3KXFE 3UPCA 1FL3B 1J8HE 4YNYB 1ZGLM 2OSLB 1VADB 2XN9A 5A3ID 4J4PD 3NZHL 4RFNB 1N4XH 4XC3L 5CP3H 2IQ9H 3H9SA 3EYFA 3H42H 1BQHG 3F12B 3U2SB 2CO6B 1VFOA 2IPTH 1R3HB 1SY6L 3QDMB 1INDH 5GRZA 4X7FC 3P0GB 3QEGL 4JHAL 3ILQD 3PGCB 1QPXA 3WLWC 5IW6A 1H9VA 3KPNA 3V95A 3D6GA 5DJ0A 3GBMH 4R7NA 1HXYB 3NPSB 3OZ9H 4I9WD 4EVNB 3SE8H 3MJ9L 5C0AE 3GMQB 1CU4H 2KL6A 3FO1B 3U79A 4ENEC 3NIDE 2VITB 3EUUA 3VG0H 2Y7QB 5D5MA 4KZDL 2R23B 3W9EB 1A7RH 5D7LA 1U41A 4XMLL 4BQBA 4ZXBC 3MRHA 4XWOD 3C2AL 2LAAA 1FJ1A 3GSVA 3G9AB 4OGAD 3UDWC 1A1MB 2X4OA 4NC2B 4P4RA 2XWTA 3ULVF 2R1YB 2VR9A 2KQMA 5EZIH 1WTLA 3BMWA 1S7RB 4M1CD 4Q6IC 4WFHD 1W0WB 4D0DA 4UOJA 3TYGH 1NDMB 2V5TA 4M1DH 1XF3B 3ES6B 4NWUL 4X7TB 2DB8A 3RHWF 2YA1A 4ZOEA 2A77L 1DFBH 1QFWH 3CX2A 1QHOA 4MB3A 3VXMB 1OGAB 3RPKA 1U91B 5D2NB 1HKLH 3QNZB 4N5UA 1KPUB 5GS1C 3S36H 2P24A 5D1ZB 1QNZH 3B83A 2X4RA 4Y4KD 3RWFB 2NPLX 5MENE 1LILA 1MWAB 2A6JB 4LLMA 3FZUD 2VZVA 4U49A 1JF1B 4FQQB 5JPMB 1YEGH 5L7XL 1O7SA 4GKSA 4WIQA 5DFWH 2CKNA 4JFYB 2NLJA 2Z35A 4FQJL 4ONOA 3TZVA 2NY1D 3CPLA 2HVJA 5JIPA 3TJEH 1TCRA 1IKFL 1EO7A 2R4RH 4N1HB 3EKCA 1RK1A 4IDLA 1CLZL 4FQXC 1J5OL 1DQDL 2NLJB 4ZAKA 3EO0A 1FAIH 2C3VA 3VXRA 2X70A 3WXVL 1KIRA 1U8LB 3KPLB 4UTAH 4GLRI 4KKAC 3VFVB 1T1YA 1P2CA 5IJVB 4F7TA 2F54D 3BZFA 5DD6B 3L95A 3MV01 3KPMB 4ZS7L 4OB5L 4EN3B 2R1XB 1T0MA 5EBLB 4WHYG 4X6EB 4POZC 4FABH 2YD7A 4KJQC 2AXFA 4I3RL 3EYQD 3EOTL 1M7IA 1NANH 3TNNB 4PJ5A 4M00A 1IQWH 2GY7B 2WMPA 1DEDA 5C1MB 4X83A 3ULVL 1LNUA 3FO9B 1WFTA 3OR6A 1ZA3A 1WC7A 4DKAA 4ELKA 2GFBA 5ETUA 1A9BB 4KZEL 3S35X 3WIFA 4KJPC 4ZD3L 1QSEE 1TXKA 4NOFA 3PWVA 3OJDB 4OZ4B 5ENWA 1JL8A 5K9OA 4HWZA 3V6ZA 1Z5LB 2MPAH 3GUTB 4P5TB 2CLZA 4RMRA 2ATKA 3HCVA 5C0CE 4OKVA 3NFNA 2K1MA 1NFKA 5HVGB 4O51A 1H8OA 4R8WH 2H6PA 4ZUTA 3RP1A 1U2HA 4W81A 1VHPA 3QULA 2CRMA 3D0LA 1JV5B 2ENYA 5TQ2H 1HK6A 3WO4B 4I13B 4XP4L 4XCFL 5I74B 3T4AB 3NCFB 4H5SB 3GIVB 1IC1A 2J8UE 4EVNA 5IW1A 2WANA 4YLQT 5IEKA 3OKNB 5EOQL 3SDAB 4NNPH 5F3BA 1Q72H 3ULSB 4FNLH 4NT6A 3HI6L 3MZTA 4Z7WA 1OM3H 3C60B 1U3HC 2CH8A 2WW8A 1UWXK 5ITFB 4OIAA 4RGNB 2QSCH 2Z31A 3LDBC 5GGTH 1CDBA 4PJXE 4LPXA 1KCRH 4KRMB 5BS0B 1IAMA 2P46B 4OIIH 5B8CB 1XGRB 2R0LL 3PQYE 5I1KH 1QSFA 2ZKHH 3TO4A 4OLZH 4OUUB 1GGCH 1F6AB 1NMCC 1J8HD 5F70A 3HC4L 3EFFB 3HS0A 3K4ZA 5B8CA 3CUPB 5H2BB 4O4YH 1GZPA 4R90H 1J0ZA 3SQOL 3T0VA 3T4YB 4MD5B 4M7LL 4RMWA 3X13A 3C5SB 3D39A 2CUIA 3BVNB 4CBPA 3VXUA 3S8WA 5C0ND 5JORA 4JN2A 1PKQE 3PIQB 1EBPA 4AENB 2NXYC 5T1LA 5IB5A 1JTPA 1FNEA 4KQ4H 4K2UL 3RUGA 2A9ML 3RDTC 4AQOA 3CX5K 2F53E 2VERN 2ED9A 4QRPE 2YD6A 3BGAA 4MNHB 4AZ8A 4DKDC 1JV5A 2UY7A 5KN5B 2MJWA 1YEFH 1HYSD 3Q6GL 4N0CC 1CZ8L 2CLVA 4YWGH 3NFNB 2P5WB 2XA8L 3B5GA 4QTIL 2DTML 1IILE 5E8PA 5FOBB 2M8XA 1ZVYA 3QDJD 4UT9H 5F9WB 4XXDB 3RIFK 3V6ZB 5A2IH 4HGKC 3GK8H 3V5KA 3AAZB 1AP2A 2AW2A 1QR1B 3G08A 5D1QA 2RGSA 2YRPA 1X5JA 4O02L 1FVDA 1P4BL 4X6FA 3TPUB 5GS0L 3BPNC 1CDGA 1ZLWH 2GFBB 3OJVC 5ETUB 5F1OB 2IFFL 1I85A 4XB7A 2O26U 1XR9B 1I3UA 3FOMA 4ZPVB 1Q9WB 1LO4H 1NLDL 5MERA 5GZOC 4DCQB 2ZUWA 4NQTA 2VDRL 1NBYA 3S35H 5T3ZE 1CXEA 2W07A 5GPRA 4IRZH 3E1F1 4LLVA 2QADB 3G08B 3TO2B 5D7IA 3KPSD 1K8IA 1FZJB 1BF2A 2JK5B 3BSZH 4GRWH 2O5XL 4R4BA 1QUNA 1FL6A 1YUHA 4WVRA 3DTXB 4FTVA 2A74B 5GZND 5IK3A 5SV4A 3R8QA 5L8LB 4OD2A 1O5DT