1YLBB

Nmr solution structure of the reduced spinach plastocyanin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Intermolecular Complex between Plastocyanin and Cytochrome f from Spinach.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin, chloroplast
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ylbB00
1KBVA 5LDUA 3IN2A 4WKXA 2BP8A 3GXUB 2N0MA 2J57A 1SFDA 3KW7A 4YSPA 1NTDA 4AI7A 3IE9A 5I5MA 2FNWA 2DYRB 3EHBB 4YSTA 1E67A 1ZIAA 3DKHA 6PAZA 3S8FB 4DP4X 4BDVA 3OMIB 4BWUA 2AZAA 1CYWA 2HZHA 3SBRA 3FSVA 4CSZA 1NDTA 5F7BA 4A2HA 3OQRA 3FU8A 3OMNB 4P5RA 4E9TA 2UXGA 3X2QB 1BYOA 3MX0B 3H4FA 2FQDA 1ET8A 3CVDA 1W6LA 5AZUA 1L9TA 4ZK8A 2DWTA 2PP8A 2VSKB 4HCIA 3UAEA 3T71A 2CJ3A 4HZ1A 2CAKA 4NAJA 4UANA 1SJMA 4X4KA 2PP9A 2I7SA 1OCRB 2HRHA 2XXGA 4E9QA 1MZZA 2BP8B 3NJMA 2ZXWB 3X1EA 2QDVA 1CURA 3AG4B 4F2FA 3NSDA 2MRYA 5D4JA 3UADA 4KOCA 4GP4B 1E5ZA 1W8EA 2IAAC 1HAUA 9PCYA 3FYEB 2I7OA 1V54B 2IDTA 2J55A 1KCWA 3AZUA 4DP9X 2YQBA 4HAKA 4GP5B 1GS7A 5TK4A 1A4BA 4K9JA 4W9ZA 1IUZA 1X9RA 1SHXA 1J9RA 3NP3A 4TXVB 3S3CB 4E9RA 2WO3B 3WI9A 2JFCA 4EF3A 3S8GB 1BEXA 2XX1A 5PAZA 1W6WA 2WSDA 1KV7A 2JKWA 1NIDA 3ERXA 3TBCA 2R7EA 2PCYA 3WKQA 2YAHA 4G70B 1MDAA 4E9VA 1L9RA 2XUWA 3GYRA 3UAAA 1ADWA 3ZDWA 2BWIA 1ZDQA 4YSSA 1AQ8A 4N4YB 1AS6A 3KW8A 1KYAA 3SQRA 3JTBA 1FWXA 1KDJA 4FAAB 2DV6A 4QLWA 3ASOB 5I6NA 3FSZA 3EH3B 3ABGA 1QLEB 1AZRA 3FYIB 3QQXA 1AR1B 2IDQA 2W8CA 2VM4A 2YAFA 4G7RB 1RCYA 5B1JC 1BQRA 3WIAA 1M57B 4DPAX 4DP6X 3AY2A 4KO6A 4E9WA 3ZBMA 1XMEB 3N55A 1A4CA 1NWPA 4BK5C 2HX9A 1JXFA 1EHKB 2ZONA 1JZEA 1RKRA 3C75A 1PCSA 2BO0A 5E9NA 1GSKA 1I53A 2GB2A 1N70A 5I28A 2VW4A 1WAEA 1ETJA 1KCBA 1E30A 3FSWA 2B08A 1PLAA 1WS7A 3NSCA 3OMAB 4NB7A 3X1GA 4AZUA 2UXVA 3N2JA 5I6LA 4A68A 3DTUB 1JXGA 2OJ1A 2Y69B 1BQ5A 1JZIA 1V10A 3WNJA 2BHFA 1WA1X 4BDVB 3FQ1A 4KNUA 4A2DA 2BWDA 2VW6A 1TKWA 4AX3A 1NIBA 4DP5X 1JOIA 4A2EA 5B7EA 2AZUA 1ASOA 1N68A 1IBYA 3WNIA 1VLXA 1OCOB 1GS6X 1TU2A 2YARA 2UXTA 4GY4A 5B1KA 1NICA 4DP0X 2X87A 4BXVA 3PLYA 2VMJA 4E9XA 5I6MA 3S3BB 3U25A 3QPKA 1E5YA 1AZCA 2FJSA 1AIZA 1OE1A 3QJRB 1E65A 3FPYA 3NJHA 3FQYA 4YVNA 2XVBA 1EZLA 2TSAA 3ABLB 4AKOA 2NRDA 4FA7B 1OOWA 1V55B 2IWKA 3IN0A 4YSQA 3CDZB 3SBPA 2DWSA 3BVDB 2IWEA 1SF3A 2GSMB 1PAZA 4AKQA 2IH8A 2XV0A 1PY0A 2CBPA 3OD3A 4QKTA 1M9WA 3NJFA 1AAJA 3RYMA 3TU6A 2W88A 4UAHA 3TBBA 3FQ2A 2HX7A 4HHGA 3QJTB 2VN3A 3PPSA 4N8UA 3H56A 2AVFA 5I6PA 4G7QB 3ABKB 5IY5B 4F2EA 1OE2A 2CALA 1A4AA 1ZV2A 2P80A 2HX8A 4BXSV 3T9WA 2J56A 5B7FA 2IDUA 5I26A 4A67A 3FU7B 3NJKA 4PCYA 3ZX1A 3IBOA 3UGEA 1JVOA 1DZ0A 1ILUA 2EIMB 3GDCA 4BWWA 2YAEA 4YL4A 3EF4A 2CUAA 1PZAA 2FQEA 3FSAA 2BP0B 1AOZA 2XLLA 3PAUA 2XU9A 3HB3B 3EH4B 1AS7A 3CVBA 7PAZA 1PZBA 3QJUB 1PNDA 1SHWA 1ZPUA 2QDWA 4W1TA 2PPEA 5EHFA 5TK2A 3ZIYA 1X9UA 2VSMB 3CVCA 2GIMA 2XXFA 2QT6A 1JXDA 2E86A 3NSYA 2Q9OA 2YAQA 2X88A 4E9YA 3UABA 4F7KA 4DPCX 3HEIB 4GYBA 4A2GA 3X1FA 2AFNA 3PCYA 1ET5A 1F56A 2OCCB 4CSPA 1NIAA 2YAOA 4DP7X 1BXVA 1URIA 4HCFA 2LLNA 1A3ZA 1GYCA 2FT6A 3T6VA 3JT2A 4KO7A 1XB6A 3AG2B 4GP8B 1BXUA 2PPCA 1CC3A 1AZUA 2GBAA 1J9QA 1NWOA 1RZPA 1SFHA 1AZNA 2QPEB 3S3DB 4HCGA 2OV0A 4DPBX 3CZUB 1M56B 4KNSA 3SBQA 1IC0A 2XYBA 1T5KA 2H3XC 3L45A 3ABMB 3FU7A 1OF0A 4E9SA 4ENZA 2UXFA 3EH5B 4YSUA 2FWLB 5A7EA 5I5IA 1UATA 1BXAA 1CUOA 2YXWA 4M3HA 1AG0A 3NJGA 2ZWNA 1OCZB 3NJLA 2EILB 2WO2B 5I6KA 4JHVA 3TASA 3FU9A 2QPDB 2VW7A 1B3IA 3NT0A 4PAZA 1FFTB 1FA4A 2PPDA 3TA4D 2DY2A 4KO9A 2PLTA 4JHUA 4DP1X 1J5CA 3MBWB 5ANHA 1SNRA 4YSAA 2YAPA 1JERA 1PF3A 3NJIA 3AW5A 4L0PB 3CDZA 2Q5BA 1BQKA 2BW4A 2JXMA 2EINB 1WA0X 1J9TA 1JVLA 2RACA 1SF5A 3IEAA 4AKPA 5F7AA 1J5DA 4NERA 5B1JA 4Q89A 1PMYA 3PAVA 4DP8X 1PLCA 1AZBA 1KBWA 2BP0A 1MG2C 3WKPA 2GC4C 2YXVA 3T6XA 5PCYA 1AANA 1DYZA 1KGYE 1PLBA 1L9OA 1AACA 2AANA 1XB8A 2BZCA 1L9QA 3PXLA 2H47C 2XX0A 4KO5A 3QJQB 4A66A 1KDIA 1NZRA 3V9CA 1PNCA 4YSOA 1HFUA 2GI0A 1ZIBA 3AG1B 4KNTA 2I85A 1QHQA 4G71B 1NPNA 1PZCA 5B7MA 1TEGA 4YSEA 3BQVA 3D12B 1JZGA 2GC7C 1TEFA 4BWTA 5B3SB 4KOBA 3WG7B 1A65A 2CCWA 3CG8A 3H4HA 3NSFA 3T6ZA 5FC9A 2MTAA 4GXFA 4JKNA 1A8ZA 2XWZA 1HAWA 2PCFA 3QJSB 1IBZA 7PCYA 1NIFA 5B1AB 2R7EB 1WS8A 4HIPA 1GW0A 3T6WA 2P80D 4HALA 4A2FA 2UX7A 2Y1AA 3QJVB 2EIJB 1AG6A 5AFAA 4YSCA 3V9EA 1L9PA 5D4IA 2J5WA 4P5SA 1AS8A 2GHZA 5B1BB 3X1NA 3FT0A 2IWFA 2BW5A 1GS8A 1JZHA 4UF7C 3NJJA 1XB3A 1GY1A 2HLEB 3DIVA 8PAZA 2FQFA 4YSRA 1MZYA 1GY2A 2PP7A 4G72B 3OM3B 1IKOP 1RZQA 1R1CA 1ID2A 2IDFA 2BZ7A 4RH4A 4YVUA 3PAZA 1OV8A 2HXAA 2VM3A 3NYKA 5I5JA 2H5UA 4DP2X 1YLBB 1JZFA 1SDDA 1BYPA 1MG3C 1WA2X 2ZOOA 2B3IA 2DYSB 4WTQA 2FT7A 1OCCB 2HRGA 3NP4A 1CYXA 5I6OA 1BAWA 4Q8BA 1NIEA 1GR7A 1NPJA 3G5WA 4HHWA 1J9SA 1NINA 1SDDB 1ASQA 2A3TA 1JZJA 2UX6A 2FQGA 5D4HA 2PPAA 3AG3B 6PCYA 3FS9A 2IH9A 5AKRA 4M4RB 2TSBA 1ASPA 1QNIA 2FTAA 3FPXA 2XV3A 2IDSA 4YSDA 1ILSA 2XV2A 2YAMA 3X1BA 3ASNB 1OE3A 2FT8A 1L9SA 4G7SB 4MFHA 2EIKB 1ET7A 2PPFA 3NJNA 1ZDSA 3UACA
chains in the Genus database with same CATH superfamily
1UGNA 4I0PB 2GW5A 4NKDA 1IAOA 5EEVA 1C8QA 5ANME 1JGIA 2NT0A 2H32H 5FGSA 5GGVL 3RWGA 1PS3A 3TCLA 4XAWL 2NT1A 1OSZB 4XVSH 1T2QH 4RISL 1VPOL 4X7CC 1E67A 4AQ1C 4MJID 1GIGL 2Z93A 4H26A 1ZIAA 3QFJE 4MDJA 5E00B 3CK0L 3HS0B 1H19A 4PRIB 2F68X 4XPGL 3OMIB 1TQSA 1G4RA 2I32A 2DWDB 3OJDB 2EUVA 4YBHA 2K1MA 4PJIA 1TJIH 3TJHC 3GK8L 1KN4L 3DBXA 3DSFL 5F7EH 3RL1A 2BFGA 1C08A 1E43A 4JFFB 4XXCC 2EC8A 2NY3D 4AYEC 2BMKB 2JKTM 2XY1A 4CNIB 3B6SA 4KY1H 1YQVL 2PP8A 4Y4FB 1MH5B 4PTUB 2IAMA 3BZ5A 3N41B 1OLZA 1MDTA 1BOYA 5D1ZI 2WW8A 4JQXA 3QIWA 3BJ91 1NDGB 4OLVH 1I1FB 1T1XB 2CE6A 3CXDH 1T0PB 3BGFC 4U1HB 4Y4FC 2VCOA 4NKDB 2QDVA 3O2DH 5GS3A 1FH5L 1BLNA 5KS9F 5D93C 4P3WA 1RZFH 1LILA 4PJGA 2AQ1A 4MNHA 4C56A 1CU4L 4O02A 4M6OH 4M9PA 1F3JB 1IGMH 3LQAC 5HHNA 4L0ZA 4IRZA 4KH9A 3SPVB 5HHPA 3VGHA 4MKMA 4JM2F 2COVD 5F1NA 1W8NA 1MRFH 1DQIA 3RRQA 2AEPH 1BFTA 4P4RA 4G9DA 4GUOA 4XNZC 5IR1B 4N8CH 1R5VA 1V3MA 4E9LA 3U4KA 1BEXA 4OJFL 1I8KA 5AKSA 3MRCA 1TYRA 2FEEL 2EXWD 2JF1A 4EN2A 1F13A 3F2LA 3ZHLA 5AZ2H 1AGFA 1A6WL 4YBQC 2R7EA 3O3BA 5T5FL 1A47A 1YMMA 3H53A 4NPKA 3UAAA 3R18A 4Z7NF 4N4YB 2XZAL 5D7KD 2FL5B 5FKAA 3CFNA 3Q5YA 4HKJB 1SPDA 4F27A 1E4JA 5I6NA 1MWAB 1BX2B 1T5XB 2D3JA 4I4WB 3S4SA 1NCCH 3J27A 4NM8L 3RAJL 3QZNA 4RBPK 3NZ8A 3HS0A 1J7VR 2JIXB 3AY2A 1XBRA 2GJ6A 4P04A 3BW9B 1GZHA 2IH3A 3KDMA 3L4UA 3CVHL 4OVUA 4GG6E 4X6EA 3CFEB 1PCSA 2ORBH 1HWGB 5E8EB 4I3SL 1N70A 1WZMA 5AKVA 3W39B 1A25A 3FB5B 1KJ2L 1SY6L 3IRPX 4F2ME 3LQZB 4H25B 2B5IC 3P0YL 1LEIA 5I74C 3FB8A 4JFOA 2VR6A 4A6YL 4U1JA 2BERA 1SBSH 2B08A 2QADD 4PGEA 4DIXA 2BINA 2V5YA 1U8KA 5AYUH 2M8XA 3V6ZB 5GGSA 3X3GH 1E9QA 5HXMA 4XC3H 3O4OB 1GH7A 3ZYOA 1I8IA 1FNGB 3QNZA 1E4WL 3TT3H 3DX9A 5AOKA 1LL1A 1BV8A 1QW9A 5JLZA 4HH9A 3ZQ9A 5EZPA 4CU6A 2A74B 2JK5A 1HOEA 1K9TA 3MV01 4FQ1L 3W9EA 4J8QA 5D1XE 3MMEB 4RAHA 5JW3L 3DNKA 4DP0X 4EDWL 3QCVL 1JGEB 4YHLL 4QTIL 1G87A 4PJIE 1DP0A 1S7WA 1IC1A 2QPUA 3WHE1 4PJDF 1KENL 1X7QA 4XAKE 3Q13A 4JO2L 1CE6A 1EBPA 4R4BA 2OMZB 3IDIB 3U25A 2R0KL 3QS2A 3RUGA 2B39A 3GMNB 1QUNA 1SJHA 3MFFA 3MJ9H 2UY6B 4Z7UB 1N3NA 4BD4A 5HJGA 1R3JA 1Z7JA 2P47B 1MFEL 1L6XA 4GW4B 5E9DE 5I8EB 5SX5K 3U1SL 2EDTA 4YE4H 5DURB 3WTVA 2FZ3B 3DGDA 4ZS6C 3IN0A 3CDZB 1ZLWH 3IT8D 4UTBA 4LVHC 1TZHA 4PJ7E 5B38B 5JHLA 5D4QA 5MP6L 2MKLC 2V2XB 4P2AA 4GKNB 4ZAKB 1ZGLP 4CDGC 3ZHKA 3MBEC 2GJJA 4MNQA 5T3ZD 1QHOA 1XGUB 3ARZA 3I3DA 4XNMB 4YDVB 5D5ME 1H3GA 2R2BB 1EEYB 3MLWH 5L9DL 4D3CL 4OKVB 3EOAB 1V7MH 1R3KB 4OGAC 4IIQB 2Z31D 4JVWA 4URKA 4F2EA 4B0MB 1MCCA 2DS4A 2X5PA 2AI0H 1QG3A 2D0FA 1FFOB 3LNGA 4E41B 2MQ0A 3FTXA 1G84A 5BVPL 1MQ8A 4BFOA 1CIDA 3I84A 4DUVA 5L7XL 3OAYH 3DXAE 4QRPE 4IRJD 4Y8AA 3P3SA 1HHKB 1CDYA 2ADFL 4AT6A 3DTXB 3KDMB 4N0FA 1ZAGA 4XB8A 2FQEA 4F7CB 1H3PH 4YH6A 4JN1H 1URLA 2VSCA 3QUZB 4PJHE 5JW4R 4L18A 4PB0H 2HKFH 5DJ8B 1PY4A 1XH3A 1DE4B 3LEXA 1JHKL 4HBQA 5ECGA 5HYQB 5IW6B 4KKLC 1R5IB 1L7TL 35C8H 4KI5F 4LVNC 4UT9L 1L0YA 4R4NC 2OZ4H 5CZXD 4KH2A 1CR9H 2DQEH 4NQCD 4HMDA 3EFFA 1TFPA 2GIMA 4YDKL 5D7JC 2HUHA 3T1FA 4NP4L 2QHLA 4LAQH 4HZAA 4JG5A 3DURA 2WXJA 5FA4A 2BIMA 1JGDA 2K8MA 5KSUA 1QWNA 1JGUL 2VLRE 4DPCX 4X7SH 3R06B 4Y19E 3RBSA 4GAJH 3IU3A 5JIPA 1XAUA 2I60H 3PCYA 3BFOA 3D0LB 4JM2A 4DP7X 4RETB 3IFLL 3JV0A 3QZWB 4NO3B 5DMIL 5I73B 2DJ4A 1D2OA 1QASA 4X9BA 4NGHH 2ITEA 2BSEA 3QO0B 2VE6A 2EE3A 3CHXA 5EEZA 4LHUA 1OWRM 1WEJL 3TA3C 1AC6A 1DBML 5LB1A 4OLZH 3KYNA 1P7BA 1U3ZA 2R0WL 2WV3A 1UQSB 1WIOA 5ESVB 1CICB 3SDXA 4AYSA 4DPBX 5J6GA 2BK8A 1A9VA 3DMMC 3VU1A 2W65A 5KANG 4LLVA 1I7TA 1IC0A 1S8DA 1YEJL 3ET9F 4HAFA 4U1NA 3EG9A 1T4WA 2N01B 3AU0A 3ABMB 4MQ7A 2WXLA 3QUMA 1UZ6F 2J1KA 5DF0A 3VXTA 4HEMA 1FNFA 3V9FA 4LRIA 2JKSA 2VDQL 1W72H 4R7NA 2Q7AA 5IVZA 3QW9A 1LO0L 4QMEA 4A7UA 4M3HA 1AG0A 2EKSA 5IWLA 3LZFL 4IHBA 5KG9A 2X2HA 1YYLL 4S1RH 3T0VA 3DARA 3QG7H 4OBSA 3TH4T 5BV7C 3PWPD 1RZ7L 3QQ3B 3DBSA 4RGNB 5IM7B 4XP9H 3ARUA 1BFOA 1NAMH 3F85A 1UD2A 4K7PL 2IPKB 3QUGA 2GK0B 3RVVD 1QSEE 3EW3B 5EZIL 3HOGA 3GBML 3CU1A 1FJ1A 1I7ZB 3Q6FB 1JGLL 2AQ2A 4GKNA 4KO9A 4F93B 4MDJB 3OXRA 3OPUA 4GLRI 4R3SB 2VLKD 2X6BA 3FAXA 3CFCH 4JZJA 5DJ0A 3IB4A 4POZC 5IMKA 3VI4A 1F02I 3WBDA 4X6CA 2WGXA 3D39E 2YO3A 1BQKA 5B8CB 4PRAA 4P2YA 1U3HA 1R5VB 5FYJL 5I24A 1O75A 1S9WA 5GGRY 1ZJBA 4P06A 4UB0L 2H1LM 2R83A 3FUEA 2VAAB 1BSIA 3QNYB 4QXWA 2QBWA 1I8UA 5D6DA 3CDYA 1FCCA 3HUJF 4PS3A 4ZFZB 4DP8X 1FFNB 3TBWA 3ZDZF 5ID0A 4ZX6A 4F7PB 3TO4A 3T2LA 1N0XH 4JHWH 3ZTEA 2DQDL 3OAZK 4X4MA 3LX9A 3AXHA 2EEXA 2G5UA 4IBSA 1ZK5A 2J8OA 4OD2B 4Z77B 3OF6A 1FV1A 3TEYA 3LZNA 1F3DJ 1YNTF 4C55A 3I02A 5DS1A 4BYHA 3GXTA 4N2DA 4MYWB 3D12B 4NN7B 5AENA 1YY9D 2YRBA 2XBZA 3P3UA 4KOBA 3CG8A 4MCNA 2F58L 3BKCL 5DT1H 1LD9B 2VN5A 3IFPA 4JKNA 4PBVC 4OFIA 1PYWA 1CVSC 3P2BA 2DQIH 1IBZA 5INCB 4OZGB 3HHSA 4YXHH 4TLKA 4HIPA 4ELDA 2UX7A 1NC2B 2Z8SA 3ZDYE 1LO3H 4EN3C 5BOPA 2Y3AA 3KYMB 1AG6A 3MJWA 4WAFA 2JELL 2Q3ZA 2VRQA 2RHEA 4YBLB 1WVZA 2O6DA 3C12A 3D0VB 3D4YA 4NZDA 4XP4H 1F4YH 6FABL 4MNQD 1XH2A 2X41A 2Z31B 4Y19D 3ZE2E 2LLGA 1U4EA 2OW7A 3ULVL 5F9JA 3JWDL 3HAEB 3Q01A 1CXIA 3I9IA 3VG9B 1OGAB 3N50A 4NZ8A 3M8OH 3BKMH 1IBDA 3QXAA 5SX4H 1UTDA 5DYOB 2GT9A 2WANA 1MZYA 1AXIB 5EIIB 4FTVA 2PP7A 4H0IA 4O2CB 4ODBD 4MJ6A 1ZS8B 4NS0A 3UJJH 4I89A 4H13C 3B7UX 4HSCX 4UNTA 3RVWD 3SYOA 1EEZB 1F58L 4N9GA 4EAEA 1C16B 4WHYH 2OMTB 5F9OH 1ZLUK 4EVNA 1DJSA 4Q2ZB 5E6UB 4S10A 5T3ZE 1NCGA 2DLHA 5AVVB 3WFDH 2BVYA 1RZJH 3F65A 4M7KH 4M8RA 5EDXA 5EUKB 4X50A 2BVPB 3QISA 3MBWA 3RWHA 5C07A 1CI3M 3EYFA 1F3DH 5EB9A 5AG8A 3C8DA 3HRZC 3DPBB 2NR6D 4Y2DB 2PPAA 2V9TA 4WI9A 5L4FA 1ZA3A 4KXAA 3E7JA 4L1SA 4MA1B 1NC2D 3CHRA 2BFVL 3KG5A 2VDPL 2OMBA 4G8EA 2NXYB 3MLUL 2BJMH 4FFTA 5FYLE 3RA7L 1MF2H 4CVZA 1TTCA 3O3EA 4UIKH 3IXAA 5CSZB 4FFZA 3VRJA 1F4AA 4XMZA 3T2OA 1EFXA 1AD0B 3BWAA 5LGHH 4UT6A 3LN5B 2B9AA 3MRDA 3X11A 4YSPA 2ARWA 3VFSB 4J3VA 4M7LT 2ZCHL 2D9QB 3O3DA 3NRFA 1HYSD 2JQZA 5I8OH 5GGVY 3C6LC 4DEPB 5C0RL 3K3QA 3IE4A 3LQMA 4DP4X 4NUQA 5CBEA 4BDVA 2V5RA 5EUOA 3SZ6A 5IMMB 1UUSA 4CN6A 4P07A 3BE1H 1MHCB 3MNZB 4DKDC 1P9MC 3ATBA 3MV11 3L1GA 2WLKA 4BFIB 1GGIL 2O5ZH 1P5UA 1YEJH 3BQUC 4BH8A 1N6QL 1L9TA 2WN2A 3O3AB 4XCFH 2EVHA 3G5VA 1DQDH 1TR7A 3JWNH 5D1XC 4FFWD 5ITFA 5AB9A 5AVSB 3DA0A 1CDCA 1AFVH 3DVGB 2FJFA 2PP9A 1RL1A 5FFOA 5KVFE 3FCUB 4N9GB 1BW8A 2I9TB 1KB5H 4AJWA 5IJDC 3T0DA 4S1QL 5E03A 4L29B 2X4RB 2AK1L 2VLLA 2CQVA 3CH1A 4MA3A 1P1VA 2XTSA 2Y2YA 4ES8A 2NR6A 5GZOC 4WTZG 4M7KL 2IGTA 2I7OA 3GF8A 4JANA 4OLUL 5DMGC 4AL8H 2C4FU 3AZUA 2CMRL 4B0MM 1W80A 4Y5XA 2AXGB 4BFGA 5GRZA 2CO4A 4OQTL 4P8QA 1A6ZA 2VDPH 1J9RA 2JLLA 4EBQH 2EZ0D 1RXLA 3BPLB 3LNIA 1XF3A 4BE6A 2JFCA 4OTXH 4ALAH 2EDXA 1MJJA 4HIXL 4XP1L 4KJQC 5DD3L 1TVDA 2JKWA 3CX5J 4TLTA 1H5BB 5HPMB 1F11A 3JUYA 3S6CA 2AJ3A 4MWFB 3VXMD 1B4RA 1TTGA 2FJFB 1QACA 1UZ8A 1VFAB 2VIRA 3GYRA 5I23A 1AS6A 3KW8A 2MNJB 1OP5K 2FCBA 2OS7A 1VKXB 1PSKH 1OGPA 1A64A 3NESA 3FT2A 5K1VA 3HPLB 5BZDB 1MCIA 4LQFL 2UZYB 4CGTA 2R2EA 4HEPG 5I9QB 1RP9A 3D1MC 4KXDA 3PUCA 1UA3A 1WBXB 2XZCL 4FXKB 5F3FA 5FECB 1AVAA 4QXTA 1YUKB 2AKRB 2IBGA 4RMQA 5CEYB 1TNMA 4F1ZA 2I07A 4XO4A 3L3KA 3J07A 3H9SE 3RNQB 3WELA 4KDWA 5I0ZA 5FB8A 1QPPA 2NUPB 1AO7A 1WWWX 2YPKB 3BP4B 1A7PH 1KPRB 2B1AL 4AGMA 4BZ2H 4JKKA 4UM8B 4KJPD 2B59B 1MWOA 1UM5H 3S36X 1VACB 4MBRA 3RAJH 1D9KB 1JUFB 1GCYA 3F64A 3PP3K 3DTUB 1B0GA 1EIBA 4CN4A 1IEHA 15C8H 2VR7A 4PB9L 5H8DA 2F53E 4JG9A 1WA1X 3KCPA 3MHZA 4CKQA 4N8PA 2LU3A 3VJ6B 4D9LL 1C5DB 2I60L 1XXDC 2RCSH 4J3TA 1MHEB 3TV8A 3NIDE 4EZMA 1Q9WB 3NQKA 3WE1A 3WYRA 2YUXA 2ED7A 3EIFA 1Z3RA 1JAEA 4QOKA 4PP2A 1DJGA 1TFHA 5DTFB 2FBOJ 3NEEA 3ZMNA 3C2AL 3FQNA 4KMTH 1TDQA 1WFIA 3ARVA 3IDMA 4J8RB 4XCCL 2M26A 1AY1H 1ZANL 4ZMPA 3RDJA 2WGNB 1IGTB 1U8JB 5G4OA 3VG0L 2WBKA 2PWFA 1MLBA 2P43B 4J1UA 3BEVB 1R6VA 3FPYA 2CK2A 3I6KA 4DF9A 1Q1JL 2VWEE 3RB7A 3BUYA 3ZW3A 1I9IH 4DZ8B 1N64H 2CPUA 5BVJA 2NXZB 4HJEA 2XN9B 4L8DB 2O93L 1KTLB 2Z92A 4KI5E 3RIAF 2IWEA 4O02L 1FO0B 2FLBT 4ODVL 1AO7D 5F8RC 3MLVH 1JRHL 4WK0B 5HHMB 1E9OB 4PGJA 2XN9E 1IBHA 4ZOBA 5C0BE 2F5AH 2V6HA 2GJZB 2E9BA 4M1CD 4TLUA 4JPWL 4LEEA 1JNLH 5EOQH 1CXLA 2AVFA 3RKPA 3C08L 4WW2B 2RA1A 1YUHB 5EEYA 3S88H 4LF3A 3QYNA 1VA9A 5EEXA 3SY0A 5T3XE 4Q0XH 4XPGH 4WGKA 4XPAL 2B5IB 3HLAA 5DEZA 4IMLB 4NUJB 5IQMA 2YPKA 1C7SA 2D7TL 5BNXD 5AUMB 3MCLH 1J05A 4PJ8D 4QTFA 3ZX1A 5I1JH 4KV5E 3TJEL 1KMGA 1JVOA 4JFSA 3IFOB 4MQXD 3WNKA 3EF4A 4KKQA 5DJ6B 2EYRA 1JL8A 3NJXA 5KVGE 3MLSL 1BDYA 4DVRL 3MRFA 2AJYH 1ND0A 3FONA 2WHVA 4JDEA 4KPHL 3WEXA 4BSWB 2BRQA 4PY8I 1WWCA 1AS7A 5TFSL 3KHQA 4AT6B 2ZPKL 1GYVA 4OVVA 4NC2B 4NQVA 2JB5L 4EPSA 2D3VA 2WQ8A 2ZKWA 1AQMA 2EVFA 2EP6A 2OPCA 3R19A 2G3XA 1OAZL 4E9YA 2ZE0A 1DQVA 2LLLA 4G3YH 4YHPA 1YHPA 3GT6A 4FQXA 4GYBA 2L0DA 4F7KA 5DR5L 1KC5L 4HIQA 4M5ZH 2F61A 1G7MB 4ODTH 2OCCB 5LG1A 2XZQL 1MHPL 3U0WH 3GSNA 4ZDHA 3VFWA 3HBPA 5DVNA 2XWRA 3RKDC 2C9VA 3UZVA 4P5KA 4TUUA 2YUWA 4P49A 4LCCB 2R51A 2YA1A 1OT1A 5E8PA 2Y07H 4PIRF 1E0OB 1JS4A 1ORQA 4H0GA 1CD8A 1GCFA 2F7RA 3CH1B 1V27A 4FKKA 1RZIA 1V7NL 3HS8A 4TSCH 2B4CH 2LV4A 4ZXBA 5LN4A 3ZGHA 4WJ5B 1XIWA 4W6WB 3GB7A 4EE2A 1OEZW 3HNSL 3ROLA 1PZ5A 2BSRA 2X4QA 4NWTL 4YSUA 4HGKC 1GC1C 3UXFA 4WGVB 4UUJB 3GMNA 5CO1A 3DOIA 3H2PA 3IKCB 3MV7B 2F15A 2HLFC 3ULUD 3F6LA 4QF1B 4LSSH 1KV3A 1WQVT 3KWXA 4XVSL 2Y7QA 4Y16A 1T66C 1E8ZA 4KROC 2K4AA 3LIZA 5DO2D 3ZYZA 2VW7A 3P0GB 2DMGA 4MA7L 2BHUA 3OG6B 1YEKH 1WHOA 3NT0A 3K72A 4JZNB 4F7EA 5JQ6L 1IIKA 3RWDB 4DP1X 4PD4J 5F2FA 1NJ9A 3SJVE 4L05A 3F58L 5HGAB 1H5BC 5EA0H 3QBTB 1MFBH 2W0FA 1TVHA 3P11H 3IWUA 3OHMB 4L0PB 4Q52A 5DI8B 4FQXD 5MP6H 2JXMA 5SWSD 4HWZB 2HFFB 3Q2WA 1UXLA 4QUOA 1J9TA 5B3JF 4YGVA 1BMZA 1UWEL 3VE0A 1IL1B 1B9ZA 1CCZA 3FQRB 3K2KA 5BRQA 4AKPA 1QMUA 2OP4H 1S6NA 3HNTH 4JLRA 4MZ2A 3MRKA 4U05A 4WSKA 4DN3H 4MS8C 3CWGA 1RPUA 3U4EB 5M95B 1VGEH 3BD4A 4QXUH 1KJ2A 3G08B 3II3A 3IDGB 3WIHL 1YSOA 1KCKA 3IGAA 4JJ5A 5I8CA 1P7KA 5F7UA 4B9CA 3OR7B 4HMEA 3RFRA 3ARGD 3MLYH 1FL3B 3A6BH 1NZRA 2LFGA 3D25B 3VCLB 3L7EB 2PR9A 4RAVB 1WITA 3TO2A 3MXVH 5D1XB 4I4WA 1QRNA 5B7MA 2MCMA 2JCCA 2HG5A 2B8OT 4U4BA 2BVUA 1NCAH 1T7WA 4LFHD 4YUEH 4B9YA 3ATDA 3CC5A 1QR1A 4LDLB 4PBXA 3K46A 4KZ0A 1F6AB 4GAYA 4RDQF 1DBBL 1ETA1 2CGYA 3MRRA 3WCYA 3BIAX 3KEDA 2WXQA 1E8YA 1EAPA 4FI6A 2CA4A 1U93A 3FRUA 5K5YA 4HIEB 3MJ8B 3Q3GA 3DV4B 4LCVA 4N5EC 4LIQL 2A9AA 3VMNA 3QUXC 2VNCA 3IDJA 1WICA 2AQPA 4OIAA 3GJFB 3IDXL 1CGXA 1C5DA 5AAMA 4IK6A 1SBBA 4R6UA 2ORBL 5F89A 4P59L 4NQEE 1F4YL 2ZUVA 4X98A 1IGYA 1QSFB 1NCTA 2YEZB 3AREB 4UTBL 1YNTB 4FP8H 3ZL4L 1EK3A 1MCOH 1WZLA 2CO7A 5DJCB 5CCKL 3D69A 2BC4B 4WU5B 5HGHA 3GMLA 3INUL 3TO4D 2JB6B 3TPKA 4I77L 5I73C 3CC5B 4QGTA 3NAAH 4OAWB 4E5XG 1OV8A 4AUJA 1QYGH 1FDLL 5IOPA 1DBKH 3CFDA 1MJ7H 2H2SD 2ZJSL 3PP4L 4O58L 4EJ1C 2ZOOA 4UYQA 2DYSB 2XTJC 3FF7A 3CD4A 1DCLA 1B4JL 4X99B 1ONQA 2WLNA 1B4TA 2ENJA 1K8DA 3EYUL 1K2DB 1SXBA 2HFEB 3OKKB 4MQ7B 4N2HA 5LCVA 3TNMB 4B9PA 5C3LD 5JOEA 1MCKA 4JFEA 4N86A 3FQXB 1AR1D 3CMOH 4HLZG 1HXKA 1CLVA 1PG7W 2VMEA 4ZBJA 4BZ2A 1MOEA 3VDBA 4Y1AA 2KZBA 2UX6A 1EDHA 1WWBX 2APTA 3C5ZC 3GFUA 5AKTA 3WKML 2G5BB 3FCTA 1HHIB 3OLIA 3FW6A 4WWKA 2BP3A 4KRPC 2EH7H 3KNBA 3QCVH 2DI7A 5HD8C 3D08A 5DO8A 2C7FA 2XI9A 4UOZA 4IU2A 2FT8A 3IFLH 1H8OA 1Q9KA 1ZTXE 3GXNA 4U7KA 3ESOA 4MFHA 3SD2A 1LO2H 2D7QA 4AYGA 4HWNA 4K94C 4N0YL 2CHZA 1TU2B 4WUUB 1O5PA 3NIGF 3KLSA 1J1OL 3O45A 2GAZA 1Z9NA 3FB5A 4FFYA 4R3SA 5DJDB 3BZFA 3CFJA 3KW7A 3P4MA 4F57L 4TVPD 4GXVH 3TC9A 4Z7WA 3V8OA 5L4IA 1ZGLB 4OZ4B 2X0UA 3K1KC 1YECH 2DH2A 3O6FB 1OCWL 2BP5M 2Z1PA 3T3PF 2A6JB 2P49B 3K0YA 5IEHA 2HZHA 4FXLA 3SBRA 4YXKH 4AENB 3P02A 5F7BA 1NOLA 1Q38A 3V55A 5AW0B 1R24B 1VIWA 4JANB 1WISA 2XG4B 1BYOA 4KRPB 3BISA 2WMPA 4C4BA 4IEFB 2W60B 4W6XB 3ZKXB 1MCWM 1HQ4B 1OP5H 1X5MA 1QYGL 3UTSD 4HC1A 2EDDA 1N4XH 3KS0J 1HHKA 4ZO6A 1RZ7H 3QIWC 5FB8B 4OCRL 3LEVL 4JM2D 3WY3A 3Q8CA 4OCLC 4OLWL 1UM5L 1BZ9B 4XAWH 5CN1A 1UB5B 3NJMA 2IQAB 1XEUA 2WUCH 3D33A 2BHYA 3KPNA 3U1QA 4S1DC 3LXBA 2WAHA 2DTSA 3L1OH 2XZAH 5T3ZL 1D2PA 3OPZH 2IAAC 2ZXDA 5TE4L 1ZK9A 3UC2A 3ZO0A 2EUWA 3ZU8A 5F44A 4OFVA 2J88H 5MENE 2PO6C 5LGJA 3GSNB 3FT9A 5SWZE 4I48A 1ZVNA 4YXLH 2NUTB 3OQ3B 4X6DA 1VAHA 4X6CE 4L1LA 2PYED 3S8GB 2DQFB 1T7ZA 3Q43A 5GGTH 5E5MB 1PX3A 3FFCA 4JO3H 3CFKB 3TESA 3A3YB 5D7JA 1FVCA 5DGQA 4PWIA 1IIIA 2NZ9D 1NMBH 2YAHA 3CZSA 3PQYA 3SGKA 3FUFA 1ICTA 1I1FA 3LNDA 3DIDA 2VDRB 3FDWA 1PQZA 3HI1B 2WIIB 3JTBA 3C6EA 1KDJA 4YC2B 3SKJL 5JZ7D 4UQCA 2DV6A 5DFTA 4NUPA 4ONGH 1UM6H 4XGZA 3MLYL 1Z9OA 2UV3A 4K9EL 1Q0YH 2ZWZA 2P3YA 1HHGA 2N0KA 4CKVX 5HGDB 4JRXB 3WENA 1M57B 1OSPH 4TSBH 2EECA 35C8L 3DPBA 1XMEB 3DYOA 4JRYB 1N59B 1R5WB 2GTWA 1FVEB 1HZHH 3DV6B 3C75A 3R4DA 2I27N 1PG7H 4Y16D 1NLBH 2DN7A 3G5ZA 4JN1L 4X9IA 1KXHA 2XN1A 5D9SA 3RGVA 3VWKD 4AYID 2ZSWA 4WWNA 3DRTA 5D5MB 3RFZA 2WJ5A 5EIIG 3A5VA 4I0PA 3ECQA 5CXPA 3P77B 4P0DA 4MJ2A 2GTZA 1ZE3H 3J2PA 1KCBA 2PW2A 1GIGH 2F74A 4KI1A 2BDNH 4LMQI 3WN5B 1U8KB 3VO0A 3HAEG 4URTB 4LF3B 3EYSH 4NBXB 3OJ2C 1M6OA 2WQVA 5EG6C 4DNLA 5CBAA 5I30H 4K3DL 4QHKI 2NY1B 3HG1B 4Z3FA 1LO5A 2FJHA 2YN3A 3FQWA 5DHVB 3PGFL 3VFSA 4G6KH 1LXMA 1HHHA 3EUUA 4JAMA 4AX3A 1P84J 1T83C 4DP5X 1YN6A 5JW4M 1SQ2N 1MPAH 4JGJA 3WNIA 2WNGA 2AJXL 2HJLA 4ODUA 4WK2B 3VXOB 5CJOH 2JIXD 2DLEA 5CP3H 2C9QA 4GQ9L 4NKIL 4U0QB 3SE4A 4ZUTB 3O4LE 3IJYB 3QUXA 5FHBL 1KCUL 2WTPA 4NT6B 2ZKMX 3RI5F 3VRLF 4ELKB 4Z76A 3IBEA 5AB0A 1JPFB 5JO5B 4HDIB 1S7UA 3OZKA 3RJDA 4TTDD 1R0AL 1J8HA 3LIZH 2DIJA 2JWYA 3L16A 3G6AB 1KEML 5F88A 3LQAL 4IBTA 2XVBA 3P30H 4HUWB 2H6UA 5JXED 2IVFC 4B9GA 2G2NA 2Y1YA 4JCMA 3H3PL 1OOWA 3QEHA 2HWZL 2X0VA 3L2NA 4G6FB 2Y07L 1KENH 1MJJB 5JLZB 1LDPH 1AD9B 1A66A 4LLQA 4PJGE 1EXUB 2MWCA 3ILQD 1OF2B 3KXFA 5FYJD 4EDWH 1TOXA 4EDXB 1X5YA 5MEPA 1WT5A 12E8L 2VQUA 2AP2A 5FX3A 1H3UA 2MMXA 2ZWYA 4AE0A 2WOYA 4JFUA 4NSKA 4JVUA 5ID0B 4TL4A 1MREL 2YKLH 4S2SA 3EDEA 4X7FC 3L4VA 3EO9H 4HS6B 1WAAE 1TJMA 2Y06H 4ATWA 1HESA 1TSHA 5FO9B 5GS0D 1V05A 4QXVA 1FHGA 4ZQKB 4EUPH 3GIZH 4ZSOE 3U6RB 1DANT 3ARFD 2IDUA 3CBRA 3MA7B 4A67A 1XR9B 1FYHB 1QFWH 2G9HB 3O2VH 4X4XA 3IAPA 5DS8B 1U41A 3VX0A 4M5YH 5FECA 5C2UB 1U3HC 1K4DA 4L23A 1JPSH 4DUXA 1NGQH 4BWWA 1KTKE 1HSAA 5EU7E 4G8GE 1A7NL 5KW9L 5DA4A 3RDTC 3NCXA 4UTAA 1E6OH 5GSVA 3V4PB 1Z9PA 2IOIA 4R2GD 5CZVL 2WIMA 4FXKA 4FYTA 5E6ZA 2OMNA 4AV0A 4U6VH 3C5JA 3QC6X 3JWOC 1CGTA 4HLJA 4JHAL 2DWDA 4K8RD 2ZSVA 3L3OA 5HY9B 1LO3L 3FBQA 1YMMB 2GIYA 2DQGL 3MC0A 2JJSA 1IM9B 4HC1H 3LOWA 4CSTA 3TN0D 3SCMB 3GUFA 2EDWA 4ZRGA 3VYOA 2N1KA 3LS5L 1IAII 2FX9L 1AYRA 3ETBF 3PWJB 3R8QA 1NGXB 4P2OA 4KVCH 1UD5A 2BSTA 4NXKA 3QH3B 5TQ0H 4HLZH 4RAUA 3DX7B 4QT5B 1NANI 2VXVH 1BZ8A 2MQCA 3BZ4B 4D0CA 1U2YA 2O4EA 5CGYD 3HG1A 4YS4A 1ZLWK 2HJFB 4NQTA 3EH2A 3F6IA 5IHBA 2X6CA 1NCWL 1J10A 2R0LL 4P3CH 4FABH 3MV9D 3C60C 3V0JA 2Y6SD 1P1ZB 1KJVB 2CU9A 3DMMA 3ILEA 1IGJB 4AJYV 4PJBA 3N9GL 3PHOA 4MD0B 1I9RH 2WNWA 5DMKB 3VFPA 5FDYA 3IFNL 1MREH 2YKLL 2A4CA 4PCSA 2E9WA 2AXJA 1G7PA 4ENZA 4NKMA 4NQCB 3TXAA 4WO4B 4JNXA 1XGRB 1OP3H 4IYKA 1LO4L 5SWQB 1E5BA 2AMUA 3HMWH 1FAIH 3LKQA 2WLLA 2H0JA 2YXMA 5CCGE 4OD1L 1QR4A 5L6YL 3CVHB 2YPVA 2C3WA 3BIBX 1HCVA 2EYSB 1ACYH 1CWVA 1UM6L 4BH8B 4WI8A 4JHVA 3SCMD 5KAQG 2ESVB 3IJ9A 4JG0H 1N8ZB 1JF1B 4G6AC 1JRHI 4ODHL 4OJEH 4WKZB 2OXGA 4FRWA 1KIQA 3AT8A 5DC9B 3H9ZA 2YFNA 5BMFL 1P9MA 4FHJA 1MJ7L 1QX1A 2X89A 5DRXA 4S0TD 1I9RL 1NAML 2H2PD 1WFOA 5FFLA 5AW7B 1R3HB 4K3JH 5KSBE 4M6NH 2IOOA 3DRQA 2ZOLB 5T1MB 4HJTA 4HF5H 2J1YA 3L17A 5C0JB 3V79C 1IBBA 3PV6B 4P3CL 4FABL 3EGDB 3P4OA 4P5TC 3FN9A 5D1ZD 1U58B 1XZWA 5HYIA 4Y9EA 1HNYA 1V3LA 4OM0L 4DEUA 3EYUH 4LHUB 5EORL 2R69A 1MJ8H 4L1DA 3U9UA 2BY1A 1IGIL 2HT4D 1F5WA 1KF9B 3AMLA 3MRBB 4ZSOA 3V0GA 4NNYA 4GG8A 4WFED 3RFZB 3I6GB 2Q86A 5E2VH 4Z78A 1OD7A 3U46A 2OR9H 3U82B 5MEOA 1DJXA 2BZCA 1DVYA 1OAYH 4WFFE 1G5GA 5F93C 3E6FA 2XX0A 1K8DB 4QAMB 2BXYA 4A7TA 3T1FB 3K6OA 1MCFA 5E2JA 4G71B 5HI3D 1NPNA 2D7OA 4PJCF 1A1NA 5I1EL 4UINL 3QXVA 3M1BB 1YAZA 3CDGA 3ZO9A 4GNKB 5I9QC 3T6ZA 4R2GB 5I0VA 2LTQB 2VZ1A 3N91A 1MW0A 2VAAA 5IHZA 1PEWA 4NQSB 2BNRB 3KLAA 4HIXH 4QCIB 2B20A 1BFSA 1A7QL 4GQQA 4RX4D 2P80D 2JTYA 2GUYA 3NN8A 3GLAA 5D2LE 4LARH 1D7FA 3TEZA 3RWIB 3FU3A 5F89B 5AFAA 3G6JF 3WIHH 3PFUA 3OLGA 1JZ8A 4CVXA 1IEBA 1AGCA 4JPKL 3WUZA 1TETH 4J28A 2O61B 2LT9A 1AE6L 1WZAA 1UYWH 3HNTL 1LEKA 3GBNL 1CF8H 1R19A 3GSWB 4L2YA 1LD9A 3S0PA 2G2RA 2FQFA 3UH8A 3BSZH 1HWHB 2EEFA 3CU7A 3FUJA 4YHYB 4XNMA 1COBA 4Y5YA 3VXRB 1WBYA 3KNBB 5IB5B 1HZLA 5KG9B 4M3JA 2BZ7A 1JFQL 4MDIA 1LWRA 1MFMA 3PNRB 5HGBA 4KPHH 2ATPB 3PYCA 5SV3A 1WFUA 2FX7L 4I9WD 3U2SA 3B4NA 5D1ZB 1RK0A 5TE4H 2HRGA 4OM0H 2ZJSH 4YO0A 3JBG7 2G0KA 4X5XA 3NBNA 3G5WA 2W65B 4HHWA 3WEOA 4D0BB 5JXAH 2KLTA 4L4VD 5AAPA 4WKZA 5AWNH 1E4XL 1MRDH 2FBJH 2H0PA 2P5WE 2W59A 3TEUA 3OAWA 3CBJB 3ARBD 1OPGL 1NM4A 1ILSA 2W9DL 2XRAL 2VQ1B 4K8RL 5BO1H 1YVLA 2EIBA 1N2RA 3F12B 4FEMA 4KC3B 2D2CC 4WUUE 2FATH 3HBGA 5CGBA 3K1DA 1U8LB 3G04B 3K5SA 2NDGA 3VFOA 4G6KL 1SEBA 1QEXA 1U4FA 4OB5H 5D1QB 1IARB 1BMWA 1JNNH 1SFDA 5KYYA 5JHAA 5CP3A 4B60A 3F84A 3H54A 5HGAA 3IE9A 5I5MA 2R23A 4IOSD 1YEFH 1U95B 5E6IA 3EZJB 3GHPA 4WEUD 1HOCA 1NPUA 5FV1L 1JD7A 3VXNB 4LSPH 5KTEH 3RVTC 2H1PH 1KCRH 4PJGF 2WKOF 1T1YA 3Q6GH 4HD5A 4S1SH 4L37B 4ANXA 1H0DA 4NQXA 3SKNB 4R96A 2E6QA 3TURA 4U1JB 1DQKA 3VMPA 1ZHKA 1KGXA 4C56B 5F8QC 4P5RA 4ELME 3H4FA 3GSNL 1ET8A 3BZ4A 3ESNA 4NPYA 3REWB 4F2MA 4Y16B 1W6LA 2GITA 5D7KE 4U0RB 2CWRA 5D1XA 4JG0L 4BFBD 4LPXA 1NGXA 4P2OB 4LLUA 1XIWC 1P84K 1S9VB 2KQNA 4EI5B 4DO6A 2I7SA 3MCG1 3OR7A 3V5HA 3VFVA 1S7XA 5DZJA 3S5YA 3NZHL 4FNSA 2NY0B 1IM9A 4N2LA 2R4RH 4UV7H 5IZ7A 1NCNA 4IBYA 1IMHC 5KYUB 4GT7A 3BLPX 5J89A 4WVRA 2IPTL 2P45B 1EHLL 1TCRA 5ID1B 1V54B 4NRXA 4Y4KA 1LWJA 3SDXB 2FL5A 5FKAB 3MGAA 4UZUA 1DUYA 3DWTA 3V7AG 3ECWA 5D7HA 4GOSA 3WHE0 3IVKA 4PJ9A 5GZNA 4E9RA 4MVBC 3HE7B 3WI9A 1N9PA 3BD3A 4PGBA 1KJMA 4EF3A 2A7BA 4HWZA 4YXHL 1LEKB 2XX1A 1SVZA 1ZV5A 4Q0XL 3GNML 2XIIA 1NL0H 1GL4B 1TVBA 1BZEA 1JIBA 4RGOL 4HHAB 3NVQA 3TBTA 3LKSB 4S1DD 1HXYB 3JZYA 4DGVL 1D5ZB 2GBVA 4CRPA 3D3VB 3L3JB 3MFFB 4XPTH 3MGTA 3QDGD 3U36A 3ESPA 4JZNA 3VVWA 1AQ8A 2BIIA 1JE6A 4H20H 3JV4B 3QQ4B 4UIMB 1Z9SA 5ACLA 4APQC 3SKMA 3VVVA 2HP4A 3UTZA 2VDLL 5DUBB 4F15B 5DHYB 1QFWL 2W8CA 3HB3C 3INUH 3MV8A 4OGXL 2R1YA 4ZFOL 3TO2B 4NM4H 1PSKL 4ZXBD 2A6IA 2OSWA 4U4IA 4N2CA 2NOYA 1A7OH 5J9PB 3IFOA 2K3HA 3GSRA 4H44C 1HVXA 5T1DL 2GJRA 5FIEA 4OIBA 1INDH 5HHME 4GG8B 3VM7A 1IFRA 3EOBB 3WKNA 4JG1H 1A7NH 3EOAA 4OKDA 3G08A 5AOZA 2DMHA 1WAEA 4OFPA 4UNUA 5ECJE 1AMYA 4NHCL 4M5YL 3FQUA 3FSWA 4MXWL 5K9KA 2WSPA 3HE6D 3GXFA 5DWUL 3QFGA 2F5BL 1JPFA 2W9LA 2WQAA 2OTUA 2X3CA 3NSCA 3N2JA 3RIAK 5JHDA 5JO5A 3PV6A 4ZAKD 5FK9B 1DTUA 4YHIA 1YEHL 4HOMA 3SYCA 4JDVB 4PTTA 3N41F 5ENWA 5GRUL 3BP7A 2VXUL 2AVGA 1PDKA 5E2WH 4LASL 3N40P 3ECVA 1KC5H 3DUSA 1LO2L 2ZCKH 3BT0A 2CIIB 3GK8H 3SQBA 5JQHC 1FNAA 5LAPA 2FZ3A 3DO7A 3EDJA 5GJSL 1RJYA 3HFFA 3RGBA 1A0QH 3V0HA 4GRLB 4N2BA 3HMXL 2I9LA 3FQWB 4OT1H 1PX8A 1XF5B 3MDJA 4OGQC 1YYLH 3PL6A 2K7QA 2M1KA 2P8LA 3H9SA 3MODH 1RVFL 3QIBA 3P11L 1QPXA 1BD2B 2BCKA 2ZXGA 3HUJB 3RTQB 4XCNB 3UO1H 4E9XA 4EMZA 4KTDL 5HP5A 2WM0A 4M62L 5I6MA 4MAYD 1EZSA 2F1BA 1UVQA 4PJCA 3MRGA 4J1UB 2AK4D 5FS5A 5HVHC 3LN4A 5HHOD 3V7AE 3N1MC 1RZKC 1BYNA 4ILDA 4Z7QF 1OQOA 4J8RA 2TSAA 1AHWA 2H3NA 2WLIB 5EBLB 2XWJA 5I30L 4TVUA 1G4MA 2X4QB 4ZMWA 2XRAH 2J21A 3K8KA 2NTFA 2DQJH 3VD9A 3QYCA 3HG0A 4AJ0A 1XIWB 1M1XA 3NSJA 1ODUA 25C8H 3HJEA 1VGKA 1WK0A 1IFHL 2JKXA 3SDDC 3HI5L 1PLGH 3TU6A 3NJFA 4ERSL 2AJVH 5K59F 1DQJA 2VABA 2HX7A 3QJTB 1TQCC 4R90H 3RPKA 4XN4A 1CICC 2NY3C 4F9PA 3L5WB 4LLDA 5EU6A 3B2UD 2VDMB 4B27A 1Z3GL 3M17B 4DAGL 4OV5A 5I6XB 3CLFL 2V8MA 3GLEA 1UCBL 4ZMVA 4L8BA 3S9DB 3DHUA 1WG3A 4P46B 4TQIA 3BFWA 4HKZA 4AZ8B 4LOFA 2V5SA 3GKZA 1JNHA 4PGDA 3RVWC 2ROYA 4KK8C 2QTEA 1X44A 2DTMH 4KAQL 2BMKA 1D5XB 3L3KB 4AL8L 5CZRA 3FSAA 3MLTB 4K5OA 3L95B 4M8UA 4G3YL 4RGNC 4BIKA 1G5AA 1N8ZA 2ZUQB 4RMUA 1CVRA 2Z0BA 5FGRA 1V8HA 2X4NB 3UYPB 1AKPA 1RJCA 1XCTB 2DKMA 3SDAD 1MWAA 5LVEA 2ICWI 4MHHI 4QY8A 1SBSL 2GTQA 1JNJA 1N7MH 5DZNA 2XXFA 5I19L 1T03H 4IJTA 2OK0L 3MA9H 3M8OL 4ETQA 1TJGL 2FSEA 1KPVA 3WGUB 2WBJA 2K9UA 5GGRA 1OTUC 5JTWA 1IAIH 1A8JH 2ALAA 2Z1KA 1HKLL 5I1HL 1ET5A 3SGEI 4WZ9A 4U6XA 5A3IC 5EPMA 1NUGA 1W72A 4C56E 1AQDB 4Y9FA 4E2OA 1BXVA 1KGIA 3P4LA 2PCXA 2X4SB 3GMQA 2VLJE 4G9FA 4PJBB 2C9UA 5EN3A 3JT2A 3AS3A 5CEZD 4WO0A 3MV7E 4XCYA 2GJZA 5ETUA 3BSZA 2R4SL 1TZGL 1NWOA 1C7TA 2IQ9H 3LKNA 3F7YB 4NZTH 3VFNB 4XXWC 2V2WA 1PZ2A 1S5IH 1YJDC 1KULA 1M56B 1EUUA 3PWNB 4PV8B 1ERNA 1THAA 3D3VE 3LZRA 2R0KH 4AYDC 4NOFA 1AIFA 3HFML 3CSBA 5C3TA 3DJSA 5IG7B 4XXDA 3TP4A 1CUOA 3VXQB 1J8KA 3BUQA 1TQTA 1JV5B 4CL7A 2ZWNA 3IS1X 4BHUI 4EKJA 5FW7A 3UZEC 5KVFH 1RPKA 2OYKA 4GXVL 4HUWA 3MGOB 4PREA 2VYRE 5L8JB 2DQDH 3FU9A 4LBEB 5LGHL 4M6OL 4JPVL 1KIRA 1M53A 1Z9LA 1RZGA 4XMUA 2PPDA 3BP5B 4Y4HD 3FO9A 3WO4C 4IBUA 1CXHA 1EEUA 4LRNL 5CF3A 5E00A 4XPFL 2FIRT 1CDJA 5KSAD 1H5BA 2PF6A 1T4KA 2DL2A 4MD4B 3THMH 5HPMA 4L1HA 4NJ9L 3TCLB 2F5BH 4B3EA 3SE8H 4ZODA 1E4KC 1CFVH 2WBJD 3D18A 4QXGH 5L6YH 4OI7A 3D87B 1OTSC 1HEHC 2XA8H 4JGUA 2NY2D 3NIDB 3ESMA 2FJHB 3UTSB 3MUGB 2ZP8A 2GKIA 2BVTA 3CFBA 4AMWA 5MEQA 4IRJA 4P5MA 1F1DA 1L3NA 4WV1B 2WXFA 3PAVA 3O8XB 3LD8B 2AJSH 1KBWA 4M7LH 3HNVH 1OSEA 3BAXA 5D71H 1XGQA 4YIQB 1OAUH 2WINB 1U0QA 3PG2A 2X4TB 2Q8AH 1LP9A 4LCUB 3SPGA 1QSFD 3ZTDC 3HCVB 5JYLA 3FRPG 2NY0C 1USQA 3O6FD 2E76C 5I66A 2NY4C 3DDFA 3UDWA 1RIHH 4YHKH 4M93C 3SYAA 2IV9A 2A9CA 3CX5K 1FVDA 1ZHLA 2IDCA 3LDBC 2DWYA 2XFXB 1IVTA 1QHQA 5E6SB 4L8CB 3IJEA 1VHPA 5AQ0A 4JFTA 1EGJH 1UB6B 3BQVA 1RD6A 2QGBA 3CLEL 3B3IA 1W91A 1QBML 4FS0A 3I6LE 1JXKA 2VM9A 3CN2A 5E9DA 3JYBA 1VZHA 3KAAA 4KK9D 4F9LC 4NOBA 2GIXA 2JELH 5ESQA 2ZX6A 4XPBL 1DN0B 2YHGA 3O3DB 2XT1B 3KVPA 4PRIE 4NGHL 5CCKH 4HKXA 3V10A 4YSCA 1I3UA 1MNUH 4QTHB 3LPPA 3LN5A 3MRDB 4JUTA 5E6RB 1X5LA 4JJ5B 1KNOA 5I8CB 4PLJC 2DQ6A 1HJBC 3WKYA 4I5BA 8FABA 1XB3A 5H37A 4DW2H 2ADYA 1XGPA 3NZSA 2ALWA 4G8EB 1T1WA 3N04A 4NI3A 3QQ9D 4R4ND 4HMCA 4OFKA 2BNQE 4ZPVA 3KH3A 5D8JL 1ID2A 3PJLA 4GUPA 3IFPB 3L48A 5DQ9A 5JA9A 1EFQA 1BF8A 2JE8A 5FUCC 3U79A 1YLBB 3ARED 5KVEE 4K71B 2VC2B 5E1HB 5C1MB 3H9SD 1KN4H 3BUTA 4XWOC 5HI5C 3G5ZB 3QHZH 4N2GA 2H32A 4OCSL 4ZMLA 2ZYSA 1IBGH 3HG4A 3N5AA 5DEGA 1NINA 4G8GB 4TOYL 2NX5D 3P9LA 4UBDD 3DSNB 3F7KA 3QG7L 3NFPA 3HC0B 3T0XA 4QNPE 4JQIA 4ZNEE 5T1KA 4Y8DC 1DR9A 1KPUB 5F1OB 4ZQTA 4HJ0D 5CLWA 5IJCC 4XN2A 4YHYC 3I75A 1U3NA 5DYOA 3ASNB 4BRJA 3LH2L 2WAQA 4K2UH 1ED3B 4U1LA 4ZO7A 1IAKB 4FNPA 4X8CA 3LXAA 1OZUA 1UWXH 4JFZL 3MYJB 4UT7L 3QRGH 4K8RH 1BD2A 2BCKB 3HUJA 4EEEA 4E68A 5EU6D 4XMLL 2ZXAA 1SUHA 3L4XA 3P4MB 3SOBH 3Q48A 4JY6B 1Q9KB 1XD0A 3MO1B 5I0WA 5EC1B 2WCGA 4D9QE 2FNWA 4J6RL 5GZOA 2NY5H 4FC3E 4EUPB 3BO8B 2XN2A 4NO2B 3SOTA 3S8FB 3FUNA 4Z7AA 5B3NA 4A7GF 1CD1B 2EVGA 5CZXC 4QKXB 4CSZA 2UZPA 3GRGA 2DLGA 3C8KA 5KSBF 3U48A 3UZVB 1SOSA 1U8PB 4A2HA 3C60A 3QI9C 4P9HH 1NBYA 3DO3A 1LP9E 3S35L 4NQDA 4DEWA 3ZE1B 1Y6KR 5L2JB 1G1YA 1Z6JT 2FO1A 2E27L 2GABA 2ITDB 1U2CA 2DWTA 4WI7A 3UO1L 2AITA 1PKQB 4N85A 5CKGA 3NUKA 4I3RH 2D0HA 4UANA 1M7DA 2N7BA 5FGBA 1NA8A 2Q10A 4E9QA 1XBDA 4UQBA 1UOWA 2X2YA 1JYVA 3SKUD 4PV8A 3B1UA 3GKWH 1PKQE 4KOCA 2NX5A 3JYCA 3WL9B 1I9JH 5INDB 4M8QB 4AGOA 2PXYA 2FLRT 4KXCA 5H35A 3WFDL 32C2B 4PJ9D 4LBAA 3ZT6A 4IBVA 3QXAB 2GY5A 1EH9A 1F58H 1FBIH 4TXVB 3ZKQD 5DHYA 2QTVA 4R97C 2YEZA 4RVBA 3CN4A 3QO0A 4AGLA 1JTTA 2DKUA 4HIJB 3I50L 4DERA 4FHBD 1NGYB 5CNHA 1HEZB 4KUCF 2CLRA 5FAAA 1KBKA 3O0RH 2COQA 3JWDH 4JY4B 2C4FT 3SGDI 3TBTB 3IGUA 4TNFA 1HSBA 4AC4A 5IEKA 1ADWA 4LPTA 3GSUB 1DSYA 4HV8A 4K7FB 4YSSA 3S8WA 1JWMB 3ES6A 3LHPL 5EZOL 1KLFB 3MLPA 3WUWA 3L7FA 3HPJA 4PRHA 1AXSA 1EMTL 1S7VA 3TOPA 3ZHFA 4I1NB 1MUJA 1QBBA 5F7FA 3MYZA 3PGDB 3UTTB 2D3NA 5FCSH 3RI5K 5BJTA 4D0BA 5C0AB 9CGTA 5D2NA 5HI4D 4CU8A 5KN5B 1ZVSB 2ZONA 1S46A 2AEQL 1EZVY 3QIUD 4GUCA 1OARL 2YRPA 1I1AB 4LLYA 1G7QB 3VFGH 3MUY1 1F2XK 3TL5A 4YDIH 1UJ3A 2Z8RA 5GRVL 5G4MA 5FHAH 3KJ6H 4EI0A 1CBVH 3PXHA 1E30A 4U49A 4ZFZA 5IQ9B 1G94A 2E7HA 3H9HA 4FQHA 1PLAA 4NQDB 3O8XC 2OMWA 1R3KA 2CDFA 1F97A 1UZ6E 2HFGH 4GXUN 3MJ9A 4YX2L 3NCEB 2YSSA 1OAUL 1QQDA 3GJEB 4UQ9A 1KG0B 2OJ1A 1DSFH 4AEIH 1XQ4A 3ZE0E 3T5WA 2BWDA 4RDBA 3EO0A 4FERA 1E9PB 3LZPA 5B7EA 3NRQA 3EGSB 4AM0B 1JDAA 1IBYA 1X5KA 2X70A 5KSVA 4UB0H 1UCTA 4JGMA 2R56H 5FW6A 3QPQD 1EXGA 3V5DB 4JREC 4X8XA 3FTGB 1DO5A 2ED6A 2OJZH 4ODVH 1XSOA 4MXWH 4LCWD 3B2VL 1EAPB 3VXUD 3W2DH 1VZGA 1EJOH 2Z34A 3CFIC 2A83B 2GVYA 1UKTA 5JA8B 3BDXA 4G83A 4F92B 1AZCA 3N0PB 1IBGL 1JWUB 4N0YH 4G5ZL 4KQ3H 1X7TA 3KYOB 5SWSA 2BHZA 3A6OA 2BSRB 4F7MB 2WYZA 4XCNA 1CDUA 2XWTA 1J8SA 1QATA 4L3FA 5KBLA 5L2KD 5L0QC 5JOPD 1BHGA 3VXTB 3MV7A 1ID5I 2BY2A 3BVNA 4BELD 3OKOB 2XKSA 5JW5A 1WE5A 2PYEB 5KVFL 3LXUX 1CBVL 1B0RB 3AVEA 3ROLB 4AQEB 1CLZH 1F8TH 2PR4L 3FB6B 3OD3A 2RB8A 2VDNL 3H42L 1KSRA 4BCZA 1X5ZA 4UAHA 1A4JA 1DVXA 4BSVA 4PJHB 5JHBA 4ICWA 4HHGA 1QLEH 3QQDB 1GA2A 3BN9D 3ENEA 4OKVA 1CLCA 5IB2A 2Y7NA 1ZXKA 3VD5A 4HV8B 5HYJD 4OIIH 1U58A 1A4AA 1NBVL 2AQQA 2NYYC 3HVDA 1P2CB 1XGPB 3K6NA 4FFWC 5HJ3A 4EZKA 1GAFH 1G1KA 1JDDA 2YK1H 4LO9A 4PJ5A 3UBFA 3K6FA 4N6QA 4AYFA 4HXAH 4TUKH 1UOLA 5I8KL 3JTTA 2V3DA 2YQ3A 3KJ6L 4N0CC 4UTBH 2HLAA 5D7IA 1KCSH 4FQXB 5CIPB 4X6EB 1TKWB 1K5WA 4KTEL 4AQ8C 3BPOB 3WFHA 4J3SA 2IBZX 4MCYB 4Z95H 4C4KT 4F1SA 4X4YA 3LNEA 4PJFB 5J57B 4M1DH 4OGAD 5IW6A 4XBGA 5LUMA 3WU1A 1BJ8A 3LYRA 2KKQA 3IRZA 4QCIA 5FKPB 3EXLA 1KFAL 2H0EA 2PPEA 4HULB 3GNMH 4TTGA 5E1GA 1W0WB 2BSSA 1E5UI 4QD2E 4EZJA 1S9YA 4N24A 2KZKA 2HMID 1IEAA 2YZ8A 4W9HC 3TWYA 2Q8AL 1MCDA 4WJKB 2APBA 2RIKA 1MRFL 3K0WA 4CMMA 5A1AA 1MCPL 5ADOH 1AE6H 5SWZB 1XTLA 1UENA 1XL6A 1B6UA 2RFXB 1XSJA 5CUSH 4XE0A 5FGBC 1I8KB 4L3CA 5C2BL 1YAIA 1BJMA 2DTML 2HT3C 3BVTA 3OHXA 3S3PA 5HVWA 3LRSA 4G9DB 5H37H 1AY1L 1ZANH 1U8PA 4QOKD 2BWQA 3I50H 1RURH 4GP8B 4PRDA 4R0LC 5FYJH 3QCTH 2QMKA 3K7UA 3KL0A 4KMTL 5IJVB 4M29A 1AOHA 4PQXA 2QFPA 2BRRH 4O02B 4PJBF 5D72H 3WN5C 2VR3A 4WNSA 1TZIA 3CZUB 3L5HA 4J5VA 2FHBA 4FKEA 2XNAB 4FEIA 4KNSA 1XCQA 4DW2L 1GGIH 3OGCA 2CIKA 4QXUL 4FHKA 1CFSA 3L45A 1AKJD 2NY6D 1OF0A 3FU7A 3QH3A 4E9SA 1H3PL 3FU6A 1RPQA 4GBXC 4IM8A 4OFDA 2IV8A 3O4LB 1JV2B 4FX5A 3MTRA 1ED3A 3QULA 3NJGA 4JDTL 5C7ZA 1SM3L 3NZ8B 4U1SB 3ZTCC 5CU5A 1NAMB 1C08B 1DDHA 2VDKL 3OLDA 4IS6A 2UYLB 4MMXA 5E9DB 2ZUQC 4NXSA 1ZT7B 4O4YH 3OAUL 2FB4H 3BFQG 2OAAA 4LBEA 5EZLB 4OLYL 1ZVHA 3RE0A 2X7LB 5EEWA 3HN5A 1BQHB 4G1MB 4IW4C 4WHDA 5J56B 5DVPA 4UZSA 2VMFA 1BOGA 2CR3A 3QUZD 3SDYH 2ZOKB 4PJ7F 4Y1AE 3SZKC 5HHOA 5FF6B 3DX8B 2EIZA 5E95B 1KGUA 5CLXA 3OJMB 3QUMH 2Q5BA 2OMUA 2ED9A 2XBTA 3D8MA 1DQML 1IJ9A 4XVJL 2BNRD 1CK0L 1DBMH 4AQZA 1XGQB 1WAAA 3LHPH 1J0IA 5EZOH 1A6VL 1RZKL 4YHML 4GJTB 4FTVB 1QLFA 4O2CA 4BKTC 1SJVA 1ESOA 2P24A 5IHUL 2Z91B 2PO6B 2N3JA 1RQ5A 2A73B 3ME0B 3IXTA 3KPOA 3WKPA 2GC4C 2A9MH 3GO1H 1JGUH 4MA1C 5SWZD 5L4MA 4PG9B 5ALBL 3MBEB 4WHTA 4L4VE 4LPVA 1OM9A 1AACA 5IF0A 3V4VA 3CFTA 3RY4A 2K6YA 4DN4L 3N43F 1RULH 2X53A 4B50A 5IMLB 4XX5A 1KPRA 5IK3B 4HKXB 3VXUA 1S7TA 2CCVA 1OTSD 1PPIA 2UY7B 3OLEA 2FSEB 3BHBA 5I1IL 5KYWB 5BVJB 3L3HB 3B6SB 1WHPA 3TM6A 1UA7A 4M1CC 4LESA 3PL6C 1U8QB 1JD9A 5F88B 3QIBC 3VRIA 3QIUB 3CZNA 4WUUD 5BS0D 1UACH 2DBLH 4NZRL 5C0DA 5A2IH 3DK0A 2AV7A 2XVKA 4KUZH 4P9ML 3NPSB 2NSXA 5J4MA 2AQTA 3RTQC 1MJUL 1SXZA 5F9OL 4JE4B 1QD0A 4F91B 25C8L 3RPIA 1YMHA 3SSGA 4JY5H 3I6SA 3FZUC 2NY4D 3HG2A 4L4TB 2EIJB 3BH9B 4ZZKA 3RVXD 3K4ZA 3V9EA 4JO4L 4R5XA 2FRGP 5HHVH 1W16A 1AGEA 4HXBL 4KFZC 5BRZB 1O9VA 4RWYL 5HYJB 2K7PA 5FO8B 3SB3A 3NFNB 4Y88A 2BW5A 5H94A 5T5FH 4GQZA 4UINH 4IU3A 3N6YA 4C83A 2H41A 1XEDA 4UNVA 2W9EL 2R9HD 4L1BA 3A21A 5BZZA 4M7JH 2VH5H 4NSKB 5I8OL 3W9DA 4DVBA 3CNKA 3S7GA 4Z7VF 4GQPH 3IDUA 3I9GH 1OF2A 3GDBA 3KXFB 4NN7C 1JZFA 1NFIB 2MEJB 2I25N 2FSDA 4ACTA 4KHTL 4NCC1 4KK6C 2FWUA 4JQXC 1A6UH 1JK8B 1EGJL 1NIEA 1M4KA 5DK3A 3T0AA 3Q8FA 4W9DC 3AQDA 3MRQB 2IADA 1E3FA 4B41A 1ETZB 3VACA 1RIUL 3MROA 4WTXA 5FOBB 1KLGB 2BY3A 4TF4A 3VNYA 4M4RB 1AXTL 3DGCR 4APQB 3CTTA 1I8LC 4U1IB 3U7WL 4JM4L 2XV2A 2J1WA 5EU5B 3ULSA 5ABZA 1R17A 4XWOD 4MQTB 3POCA 3WFEH 3VSTA 4PEEA 2AEOA 1DBAL 4FI8A 4WU7A 3V4PL 3HBQA 2VXUH 3T0EC 2YSTA 3V0DA 1LNUA 3TIEB 5KYWA 4F37K 1D5RA 3X3GL 2VRKA 2DYRB 4XNQB 3LRLA 3V6OE 5DWUH 3DUSB 2B1HH 3ULUL 3F7YA 3VFNA 4BH7A 4R97B 5E6ID 1FPTL 3PDGA 4TQ8A 3B9KA 1CYWA 5DEJA 2QKIB 4KTYA 4EIZC 1NEUA 4G2AA 5ACZA 3D9AH 4R0LA 1XGYL 3N85L 4W70A 3TV3L 1I7RA 1SJEB 1M71A 2QR0A 2QQQA 3DX0A 5I71B 1CQYA 3UAEA 5CMAB 1E2ZA 4HGWA 3RWFA 3SE9L 2CJ3A 4FLRA 3NABH 4JRLA 4X4KA 4PMFA 3PQYD 3QWNA 3WFCH 1VPOH 1RH8A 5KVEH 5DUJA 4NKMB 2E9GA 3HZMB 2HB0A 4LEBA 2KHAA 1B2YA 1KT2A 5ISZB 2BNUB 2Q76B 4ANVA 5GISL 3ALWA 1VF5C 5I15H 2E7CA 4JDZA 1X5GA 1HAUA 3H8NA 4DKAA 4D94A 2C34A 4D0DA 3W5MA 2R0ZH 3K5RA 5BUAA 3R1GH 2WSKA 4U7SA 4K4KA 3EHBD 2C7UB 1L0PA 5EIIA 1KJ3L 4K55A 3L3OC 3SJVA 1CE1L 4P48A 4P2RA 2BS9A 4JHBA 7TAAA 5EF3A 3N0AA 4H8WH 4JFQB 5JDSA 2ESVE 3ZGIA 4PJFA 3UPAA 3PWLB 1W6WA 3O2WH 2WSDA 4TM9A 3APMA 2HLFD 3CFKA 3ULUC 4N2KA 4E0RA 4G8FB 3ZOAA 4MJIB 4YEEA 3PU7A 1O7SA 3TBCA 3K6SB 4JO5A 2E7LC 2FIKA 3B8YA 1NLBL 4HZLA 4XNZB 5EOCL 4OZIE 2AJSL 1L9RA 1R4XA 2C9AA 4O2FB 4OUUB 4EZLA 1R3IH 1T22B 1IAIL 1VFMA 1U8HA 1ZDQA 4G5ZH 5J13B 5IREA 2ZIDA 1EHLH 4HPYL 3WNNA 4NQED 5DJXA 4HQQH 3FULA 5CJXC 1LK3H 1N10A 3BUIA 1FH5H 1IAMA 4R7DB 1XGUA 4YDVA 4BA8A 2QQKH 2G9KA 4EQ3A 5AW5B 2MSPA 3MV9E 4P2QA 4UDTB 4D9QD 1DBJL 2VZSA 3AUWB 5F0MB 1L7IL 5IKCB 3V4UL 2EUZA 2VXQL 5ADPH 4ZMXA 3FOLB 3S5ZA 3OHXB 4O2EB 5DUML 5EWIH 2HKFL 5LWYL 4D3CH 1I53A 3FTUA 4IOFC 1SJXA 4FYQA 2LVEA 1HQ4A 5LXVA 2IPUK 3TO4B 4GRWE 5ILTL 4ZTEA 2GSGB 4PW3A 1I9EA 3QPXL 3L8QA 5FFGA 3FRPB 1GVIA 3IPFA 1A7RL 4PS7A 4QHMB 1UZGA 1E4XH 3O6LH 1Z5LA 1CMOA 2LOEA 2A83A 4NB7A 1QNZH 3CJJA 1TLKA 1A6TA 3LH9A 3EFDH 3KYKL 5IEHB 3GQFA 5GS0L 4BSJA 4OH2A 3UTQB 1KXVC 2DRUA 1T1YB 4PUBL 4OB5L 4G59C 2EDFA 2Z4QA 3NCJL 2UZIH 1GW6A 2AJZA 4G6FD 1QSVA 1D5BA 1H3XA 2XKNA 4P5TB 3VGFA 3QYMA 3E6HA 3L6FA 4MDRA 5IFHL 1GYWA 4GS7C 4POUB 5LBSA 4B3VA 2VDRL 5MEPB 1TU2A 2VLME 4KTDH 3VD2A 1VCAA 1NMAL 3SN6N 3CPUA 2HVKB 3BZFB 3CFJB 2Y7SA 2JCWA 4K7PX 3P73A 2R0WH 3LEVH 3T2NH 3UAJD 1F4HA 1P4BH 3AWGA 5JHDB 4NUGH 1F6AA 5CU9A 5GSRB 2DQCH 2MQ3A 3SDCB 1YC7A 5EU3B 2Q7YB 1XX9C 4KNQA 1L0QA 4YZWA 5FYLD 5TE7H 3LEYH 4HSQA 5DMJB 1T1ZB 3NJHA 4F5CA 1N0LB 3AY4A 4HEME 5DZOA 4QWWC 2QADB 4NDMB 4XC3L 5JHDE 4EKXA 3ZY7A 2RJMA 1S8DB 2Y36L 3QPQC 2R4RL 4DFHA 3ABZA 4QJ3B 4BBWA 3ZHDA 3MTXA 3AB0C 2J1ZA 2ADIB 2IH8A 4YHLH 4AQAB 4MRBA 1UQSA 1UEYA 1AAJA 2KLRA 4O2EA 5DVMA 3EUDA 4PS4H 3JXAA 3Q2VA 4NC0B 4EXPX 1HE7A 4ORZC 1LWHA 3U4EA 5GGUA 5I18L 2QKIC 4P2QB 1XZ0B 4JB9L 2CJUL 1M2VA 1E4WH 2DQCL 4OGZA 4Y4HA 2XTJD 5TE6L 5C9KA 1ZV2A 3L7FB 1WH0A 4KAQH 4BXSV 2Y5QA 2VKWA 5KSUB 4PJCE 5HJBA 1YNTA 5B7FA 1QEWB 2DM7A 1E28B 3NJKA 5C09B 3V0WL 4K9EH 1BZQK 3CIQA 3D0LA 4OM1L 3QZBA 4WFHD 1WAAF 2BOBA 2J8UF 4U3XA 4YL9A 5F96L 4Z7NB 4DQOL 3UJIL 2A4ZA 5CINL 3R0MA 4Y2NA 5DGRA 4P4RB 2WK2A 2AJZB 3WJLA 2CUAA 4LDCA 5EO1A 1INDL 2QV4A 4G7VL 5CJ8A 4P2RE 2XLLA 1KN2H 2D31A 4OZHB 1KGCD 3MJ8A 3MOAL 3Q3GB 2IFGA 3D4ZA 2HN7A 3SIKA 4BGLA 4YNYA 2RMNA 2CUIA 4W1TA 5JIQA 3S2CA 4N2MA 5C97A 3QXUA 3ETBJ 2EXYD 2QPSA 3QORA 4TRPL 1OAXH 3EO1A 4XMWA 1WTGT 4ZOEA 1NLDL 5H35B 4M1GH 5IT2L 3J7HA 4PM1A 2E86A 1SEQL 4OZHE 1XT5A 4ZMQA 1N18A 3GINA 3VGEA 2VLRD 4JN2B 1YA5A 2L04A 1F90H 2QSVA 3HJ0A 3L2MA 4YWGL 3TYFB 3CDFA 3T6QC 4M43L 4WNQA 1G7QA 1QBMH 4PJEA 3HE6A 3ZHNA 1NIAA 3MCKA 3OC8A 4YXKL 1OB0A 2EEDA 1W0YT 3SPIA 1A3ZA 1NGWA 1YECL 2ZKHL 2GBTA 3EBAA 2ARJB 3QWOB 5IB4A 4H7VA 2PPCA 5JUEL 1UD6A 4JW3A 4Y2DD 4AYBA 4LCCA 3HI6L 3B9EA 2OZ4A 3LPOA 1KJ2B 2BCMA 4F8LA 4DGIL 3S3DB 3QNFA 1ZLVH 2Z7UA 3UC0H 3OAYK 4HQQL 3LRSB 1FSKC 5AOJA 1SXNA 2DAVA 5GJSH 1R3IL 1J8HE 5CM1A 2DB8A 1SVCP 3RNKB 1T0MB 4GKZA 1X4XA 3GSXA 3IU3B 5C0JA 2V2XA 5JPNC 4K7PY 4PGCB 1I4FA 5ALCH 2E9JA 3NPZB 4QNPF 4FLHA 5A6IA 1KELH 2ETWA 2XC8A 5JW5B 1HL4A 1AH1A 2V2TA 4OGYL 3ZE0F 3QUYC 1WBZB 3T3MF 1XIWD 1GXEA 1OK8A 2EILB 2YA2A 1OL0A 1G9ML 2E74C 3PP3H 4V2BA 3ZRCC 2J6EH 1NKGA 3PWPE 3VWJA 1H3VA 4FXTA 2CLVB 1G9NH 2B16A 1E3XA 2R69H 1KJ2H 2F53D 3LQAH 3IMBA 1QZNA 2B0SH 1MI5E 2EXTA 2JJSC 3ZT5A 1A5FL 2Z8WC 4LOVA 4QRUA 4C4UA 2FR4B 2WYTA 4A7QA 1K3ZA 2AXHA 4ZI8A 1J0HA 3QDMD 3DVNA 1JPST 1R34A 3EJRA 3NAAL 3U2SB 3P9LB 3QUKA 3VXPB 2V9RA 1BM3H 1S9KC 2ZUYA 4UU9A 1NC4B 3N42B 4HCRH 4P46C 1I1YA 2ZP9A 4NUMA 3L4WA 2YLKA 3CPLA 2H7WA 4P4KC 3KWWA 4N1HB 2RACA 1BIHA 4PW4A 5IWLC 4LVOB 1MIEL 5EFIB 1P4LB 1B4JH 3Q1SL 2VWEC 4LDEB 1H9VA 1UEMA 1MG2C 3H7BB 4QHPA 2OXHB 2YXVA 2ZTBA 3ZDYF 1KFGA 5EBMA 5DRZB 5PCYA 1DYZA 1E6JL 3BJLA 1GOGA 4MKTA 3E2HB 3OZLA 1HCZA 3DX7A 4OQTA 1PD1A 3GGWA 3LZLA 1K2DA 2HFEA 3OKKA 3V9CA 2WN3A 4P2CG 4WFHE 4JHAH 1ZIBA 1YEGL 2Z3FA 2DYPB 1H3WM 4W68A 1DL7H 5FM5M 4Z3EA 3WO3B 5EU4B 2AABL 3WFBL 3BQUB 3RPIB 2FEEI 3WG7B 1HZHL 4FQJH 1VCBC 5ITBL 1IC7H 3VFUB 4N0RA 1Q9OA 1GGBL 4MASA 1KXQA 2A0LC 2EC9T 3IJSB 3D69B 3ARQA 3P4NA 5I19H 1VEOA 2EYRB 2R7EB 1T03L 3CVHA 2G4EA 2OK0H 3U9WA 1ACYL 5LQBL 5E2TH 5DZPA 2P5WD 4ZS7H 4JFEE 1IM3A 4PMEA 4CVWA 5DJZB 2D73A 4Q6IC 4JY4A 5FOJA 4LCUA 2WZ0A 1LQBC 2VLJA 4G7YH 3IDJB 2AC0A 3ARBA 1RK1B 3U6XA 1B6DA 5H4YA 3TZVC 4ODSH 1JZHA 3DV4A 2LHAA 4NENA 1KZQA 3ARSA 3MLXL 8PAZA 1T3FB 5B4MC 1NFKA 1PVHA 1EV2E 4LSPL 5KTEL 3MRRB 4L5FH 3DXAB 4FQQA 32C2A 2AF2A 5TPWL 3UG5A 3VM5A 5CJOL 2F54E 1TYEB 2IMNA 2OMYB 3BMWA 3GXIA 3MUGA 3N1QC 4JFPB 4DP2X 2AJYL 3DC0A 1R3HA 1YJDL 3UCRA 4YDLB 4HUNB 1EXUA 2CJTA 2PWGA 3COOA 5DRXB 3G6JB 1WFTA 1SN2A 1HH9A 1OT4A 3C6SA 3MU3A 5F7MC 4JO4H 5HHOB 3UAJA 4QXTB 3F83A 3QXWA 4TUOB 1E27B 4M1GL 1EHAA 4TKWA 1SM3H 2VTFA 5T1JA 3MRJA 4M6NL 3AGVA 2NR6C 2OZNA 4Q74A 2PXYD 1N19A 5C0AD 2J8UE 4FL4C 4IBLT 4YSDA 4M6ML 4NIKB 2BLFA 1ROWA 3LPFA 5MI0C 1QSEB 1CO1A 5AW8B 3P9MB 4FXGA 5K59E 1QVOB 2VL4A 3HRPA 4YBQD 4LEOB 2PPFA 3ARDB 4G7YL 5B22A 1BBJB 1KGCE 2Z93B 3NCJH 4H26B 2CGZA 2D7NA 3VXSB 1TTFA 4MXQD 1UJ3C 1OSPL 4XZUB 43C9A 3P2TA 3C5ZD 1T0NB 1CJYA 4FA8A 4TL5A 1RVFH 4QHUA 3AABA 3LKNB 4LL9A 1IC5L 4I85A 3PS6A 5DMYA 4RMTA 1WJ3A 4BE5A 2KPNA 1QOKA 3PWNA 1VFBA 3OKEB 1UYWL 3OMNB 4NBYB 4NRYA 3ILDA 2IFFH 3MX0B 4MCMA 4N90D 4PRNA 3ZZSA 4U6XB 3AC0A 3C2SA 5GGTA 4XCCH 1R47A 4GEIA 3T71A 2WQSA 3CHSA 5DFVD 4LVHB 4NAJA 3BPCA 3QIWB 2HRHA 2X05A 4KQ4H 4CC4C 4LZKA 2DMKA 1MKFA 4FOMA 2E7DA 4B5ZA 2B2XH 2VXVL 1ZEAH 4YDJB 2C3GA 3HR5A 2APSA 5BW7A 2V37A 3P9WB 2BSSB 2QZ5A 4H0HB 4PJ6A 3B2XA 3BT2L 4PYHA 2IDTA 2J55A 5KBMA 3ZTJH 1T6BX 3K2UL 4BZYA 3QG6A 4JFFD 1HI6B 2ICEB 4XMKL 1U8CB 4ZFGL 3AXLA 5BZWA 4QDGA 1F41A 2DIBA 3MRJB 2P4AB 1U8NB 4LNRB 2JKJA 2SEBA 2MJWA 2YUZA 4MZRA 2W95A 3ZDYB 1AQHA 5LAXB 1NCWH 4ZDHB 3VFWB 4N1EA 2QPFA 1NFIA 5T5NG 5IG7A 4GQ9H 4NKIH 4UCFA 4Q6IB 3QDAA 2AJ3B 4MWFA 5DT1L 2P5EA 5T8IA 3HZKA 3RZWA 3IXAB 1MPAL 5HDBF 2MCAA 4BZ1A 1QLEL 1J0KA 3MJ7A 4YDZA 1P7QB 2G3ZA 5G5DA 3SQRA 2A99A 3B43A 3B9AA 4XO3A 2AXGA 1MW3A 5AZ2L 1NFDE 3EDDA 3FSZA 3QEQB 4R7VA 1D5IL 2O72A 2QGCA 3BKJH 5BV7H 3ARTA 4K3HA 5IB2B 3W56A 3G6DH 4G7RB 1H6UA 4XN1A 3WIAA 4NQDE 2ZX7A 2E47A 1A4CA 2Q1EA 2HKHL 1OB1A 1H6TA 4JB9H 3FJTA 4RIRA 4MAUL 3ZYIA 4NBZB 3E1F1 5ITFB 4YDLC 3L3IA 4BKLA 5JW4Q 2GB2A 4L8SA 2VT0A 4HX1A 5C0FA 1O7DE 1XXFC 1IT9L 1XO8A 5T1KD 4NHUB 5T1LB 1CGWA 5T3XD 3V4VL 3I85A 4Y4KC 1Z5YD 2WLJA 1FZKB 1RIUH 1VADA 3FTSA 3TEWA 2DEWX 3OL2A 2XWEA 3KL5A 1INEL 4W6YB 4L3EE 1TPXC 4D9RD 3S37H 2FECI 1L6ZA 3KLQA 4ONGL 1JSYA 2UY7A 1T21B 2CGRL 4ZMYA 5KS9E 5EUOE 3LV3B 2VW6A 3LRHA 5J3HD 3WFEL 3DHJA 3LS4H 4XXCA 4M48H 3UERA 4X2UA 3SDDA 2IXQA 4E42A 3GTTA 1X5FA 4HJJL 2HFGL 4OCXL 5DHVA 4CMHC 3I74A 1NICA 1U8NA 4H1LG 3TX4A 2EDLA 1N5YL 2PYEE 4GKLA 3VTAA 1IILE 3KPLB 3FT3A 5IJKC 3RZCC 3ARBC 1OP9A 2VMJA 4FP8L 1NMAH 4YXLL 2G75B 5EDSA 3QHFL 3UP1A 1U8CA 5K1NA 1QFUL 5D7JD 3T4AA 1QQDB 3GJEA 4Q9RH 4P59H 5B38G 2DYPD 2FO8A 2MCPL 5I76B 4RNRB 1OE1A 3QJRB 3H9HB 3TEXA 2UZIL 3P2DA 4TNWK 3UROR 3IDYB 3F7VA 5KVGL 1X9LA 3M7OA 1EDYA 3AU1A 3QR1A 5E8OA 2YPVL 5GS0H 3ZJAA 3JZ7A 3KM2A 1UC6A 3DGGA 2DWSA 4HC1L 4M3KB 1SF3A 3BSHA