1YLBB

Nmr solution structure of the reduced spinach plastocyanin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin, chloroplast
publication title Structure of the Intermolecular Complex between Plastocyanin and Cytochrome f from Spinach.
pubmed doi rcsb
molecule tags Electron transport
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ylbB00
2IDFA 2EIJB 1A65A 2BO0A 3NJKA 4GY4A 4E9XA 2IWKA 4JHUA 1J5DA 2AZAA 4FAAB 1E5YA 3FU7B 4P5RA 1NDTA 4KNTA 2PPFA 4AKQA 4G72B 1SHXA 5B7MA 1CYWA 1V55B 3BQVA 4TXVB 3CZUB 1AG6A 2UXTA 2VMJA 3QJRB 4G7RB 4NERA 4AKPA 1BEXA 4PCYA 2QPEB 2UX6A 2IAAC 1NIEA 3TU6A 4E9RA 1HAUA 3X1BA 4YSEA 3PAVA 4A2FA 5B3SB 1PLBA 5I6PA 4A66A 1ZIAA 1I53A 1OCOB 1J9QA 3UADA 2I7SA 1JZFA 4DP5X 6PCYA 1AZUA 1MDAA 3NJIA 5I6OA 1J9SA 2FT6A 3L45A 1QNIA 1AZBA 2I7OA 3NJHA 3ABMB 3WI9A 3FU9A 2HRHA 4AI7A 4BWWA 1RZQA 3FPXA 3BVDB 1WA0X 3OMNB 2YAOA 4F2FA 3PCYA 5B1AB 2BP8A 3T6ZA 1JVLA 4PAZA 2H3XC 1VLXA 3FS9A 2DYRB 1BXAA 4ENZA 2QPDB 1AZRA 2X88A 4YSTA 1TEGA 4DP0X 2BWDA 3EH4B 3MX0B 3FYEB 3NYKA 3ABGA 4UF7C 2JKWA 1OCZB 3SBRA 4EF3A 3N2JA 3NJGA 4HZ1A 3U25A 1PF3A 2YXVA 5F7AA 2YAPA 3PLYA 4RH4A 1M56B 4DP4X 2XYBA 1ET5A 5PAZA 1OOWA 3WIAA 1KYAA 2YAHA 4YSCA 1DZ0A 4N4YB 2CUAA 2YAEA 1NPJA 2HXAA 5A7EA 1AACA 2XXGA 3AG1B 1HFUA 2HLEB 4M3HA 3SBQA 1M57B 1GS7A 4YSDA 2YAQA 2MTAA 2YAFA 7PAZA 3FQYA 4KO9A 3UAAA 1JERA 2ZONA 4YSQA 2CBPA 1W6LA 1J5CA 5B1BB 1ILUA 1UATA 2TSBA 2PP9A 1XB6A 2GB2A 3TASA 2YXWA 1GYCA 3UGEA 1NIBA 1OE1A 2Q9OA 5F7BA 4W1TA 4YVNA 1TU2A 1L9SA 1OF0A 2EILB 3CDZB 3FSAA 4L0PB 1NPNA 3NP4A 4FA7B 3QJTB 1WS7A 1ETJA 4DP8X 4HCFA 2PLTA 1AAJA 2BZ7A 2WO2B 1BQKA 1NWPA 1V10A 2BP0B 3NSYA 4E9YA 2E86A 4W9ZA 1BQRA 1PNDA 1E67A 4A2DA 2OV0A 1BYOA 2I85A 1CC3A 4HCIA 2OCCB 2CJ3A 2UX7A 5I5JA 5B1JA 2UXFA 1YLBB 3OQRA 1RKRA 1CUOA 1BQ5A 3NSFA 3X1GA 4BDVA 1NIFA 1KDJA 1PCSA 2CALA 1RCYA 2QDVA 3HB3B 3OMIB 2FT8A 4Q8BA 1W8EA 3AW5A 1ZDSA 2PP8A 3H4HA 1X9RA 2BHFA 3WNJA 1SNRA 1FWXA 2GSMB 2JFCA 3T6VA 3IBOA 2HZHA 1AG0A 2AANA 1SF3A 1MZZA 2IDTA 1JZGA 3S3BB 2Q5BA 4G70B 6PAZA 3QPKA 1AS6A 2HX8A 1SFHA 3ABKB 5IY5B 1AS7A 3WG7B 1IUZA 4M4RB 1AANA 1PAZA 2JXMA 1W6WA 2VM3A 3ZDWA 2PPEA 3X1EA 2J57A 2GIMA 2H47C 2ZOOA 4KNUA 1ZDQA 3EH3B 3T6WA 2QDWA 3WNIA 2J55A 1IKOP 2VW4A 3JT2A 2FTAA 4A2HA 3PAUA 1GSKA 1OCRB 1SDDA 5B1KA 4E9QA 5TK4A 2FJSA 4UANA 4DPBX 3KW7A 1OE3A 1EZLA 1PY0A 4BWTA 3PAZA 4QLWA 1JZHA 2B3IA 2R7EA 3N55A 1GS8A 3S3DB 3TBCA 4BXSV 3OMAB 1PZAA 1XMEB 3CVBA 1KDIA 4UAHA 4ZK8A 1GW0A 4JKNA 4P5SA 1PZCA 2BP8B 4GP8B 1EHKB 1BXVA 3JTBA 5AZUA 1OCCB 1SFDA 3IN0A 5AFAA 2Y1AA 2GBAA 1WAEA 3ASNB 3IN2A 1ASOA 4A68A 4AX3A 1B3IA 2Y69B 3GYRA 4BWUA 5I6MA 4YSUA 4YSPA 3SQRA 1JZEA 1GR7A 2ZWNA 2FWLB 3NJLA 1IBZA 3AG4B 4MFHA 4YSOA 3ZBMA 2N0MA 3V9CA 3CVCA 4GXFA 3AG3B 4KO5A 1KV7A 2PCYA 4BK5C 1A4AA 2FQFA 3DKHA 3D12B 5I28A 4KOCA 1AR1B 3NJMA 2XU9A 1J9TA 5D4HA 1BXUA 2BZCA 4DP9X 2PPDA 2DWTA 3ABLB 3C75A 4G7QB 1MG3C 4A67A 1A8ZA 2YAMA 4GP5B 1ZPUA 1JZIA 2XX1A 2YARA 3QJUB 2RACA 5ANHA 3PPSA 4YSAA 1JXFA 1SHWA 7PCYA 2DY2A 2TSAA 1ILSA 3DTUB 1L9OA 4E9TA 4DP7X 2W8CA 1PNCA 2EINB 5TK2A 2FQGA 2BWIA 4F2EA 2B08A 1IBYA 5E9NA 1JXGA 3AZUA 1L9PA 1MZYA 9PCYA 8PAZA 2AVFA 3FSZA 1ET7A 2WO3B 4DP6X 2VW6A 4YSSA 1FA4A 1E65A 3FU7A 1QLEB 3FT0A 4HALA 2A3TA 3EH5B 3FQ1A 3NT0A 1A3ZA 3ASOB 1HAWA 1AQ8A 1WA2X 2UXGA 3ZIYA 2FQDA 2DWSA 3GDCA 4DP1X 3OD3A 5AKRA 2GC7C 4DP2X 2P80D 2XVBA 4HIPA 3QQXA 3NSCA 4KNSA 1AIZA 1M9WA 3FQ2A 1KGYE 4CSPA 1JOIA 2XLLA 1WS8A 1PZBA 1KCBA 1NTDA 3NJNA 1FFTB 2CAKA 5B7FA 1X9UA 1AZNA 4WTQA 2BW5A 2XWZA 5B7EA 1SF5A 4BDVB 4KO7A 3SBPA 2X87A 2XV3A 4YSRA 1L9RA 3ERXA 4QKTA 1DYZA 3HEIB 3UAEA 4G71B 2LLNA 3FSWA 2W88A 4NB7A 2PCFA 1JXDA 1E30A 2IDQA 5I5IA 1N70A 3EF4A 4KO6A 4A2EA 2AZUA 1OV8A 1ASQA 2NRDA 1XB3A 2XUWA 1GY1A 2FT7A 1NINA 4N8UA 1V54B 1A4BA 3DIVA 4CSZA 1R1CA 4AZUA 2VM4A 3GXUB 1GY2A 3NJFA 4YVUA 2XV0A 4JHVA 4HHWA 1GS6X 2DV6A 2GHZA 1BAWA 4E9VA 3G5WA 3V9EA 1BYPA 4BXVA 2EIKB 1ZIBA 5I26A 3FU8A 4E9WA 1SJMA 3IEAA 1CURA 2GC4C 2HRGA 5B1JC 4NAJA 3X2QB 3X1NA 1ASPA 1ADWA 5FC9A 4DPAX 5I5MA 1SDDB 3NP3A 3S8FB 1A4CA 3T6XA 3CG8A 2BW4A 3QJQB 3TA4D 2WSDA 4F7KA 3QJVB 2UXVA 2J5WA 2R7EB 3T9WA 1QHQA 1E5ZA 2YQBA 4GYBA 1TKWA 2IWFA 4AKOA 1F56A 1MG2C 2OJ1A 4X4KA 1KCWA 1JVOA 3FPYA 3H4FA 2HX7A 2P80A 2IH9A 1JZJA 1RZPA 1PMYA 4DPCX 1PLAA 1NIDA 2IDUA 1TEFA 4HHGA 5I6KA 2PPAA 3ZX1A 3NJJA 3UACA 4HCGA 2J56A 4Q89A 1XB8A 4HAKA 1ID2A 4KOBA 3RYMA 2XXFA 3AG2B 5I6NA 2XX0A 4K9JA 3PXLA 2VSMB 3AY2A 3CDZA 5I6LA 2H5UA 1AS8A 3OM3B 4A2GA 1J9RA 2FQEA 4GP4B 1NIAA 3CVDA 2PP7A 1KBVA 1KBWA 1IC0A 2GI0A 1AOZA 1NICA 2IDSA 4E9SA 2QT6A 2ZXWB 2HX9A 3WKPA 2BP0A 5EHFA 4WKXA 2CCWA 1L9TA 2DYSB 2VN3A 3FYIB 1ET8A 4YL4A 3IE9A 1NZRA 1OE2A 4G7SB 2IH8A 1CYXA 3FSVA 3H56A 1NWOA 2AFNA 3TBBA 3S3CB 2EIMB 2XV2A 1L9QA 1N68A 5PCYA 3NSDA 2VW7A 1ZV2A 3EHBB 3X1FA 2VSKB 3KW8A 3MBWB 3QJSB 5D4JA 1AZCA 1T5KA 2MRYA 3T71A 1URIA 1WA1X 3WKQA 2IWEA 5LDUA 3S8GB 3UABA 2FNWA 5D4IA 2PPCA 1PLCA
chains in the Genus database with same CATH superfamily
2ZCKH 2KLRA 3CLEL 4QHMA 2CKNA 4MVBC 3VCLA 1HOCA 1IFGA 5BOZG 1RUML 3C87A 2VDLB 5IW6A 2EYRA 3L9RB 3MV9B 4KTGA 1AD0B 2MOGA 1WITA 3RWIA 3TF7C 4AQEA 2Y22A 2PPFA 2YD4A 1KYDA 5T1KD 4EN3B 1P5UC 4ZUVA 3CZUB 3MO1B 4N2DA 4R8WL 1BEXA 1RZKH 3TS8A 2CDEB 3UTZA 4RZKA 3WUWG 3PAVA 5HDLA 2VR6A 2DLFL 3NCWA 3KYKL 4KH2A 3VTTA 2W9EH 4GMSL 3QUYA 4NKOA 1XF4B 5FF6B 4ORZC 3BC9A 4N87A 3QIWC 2WBJA 1JZFA 3SPVA 3V4PH 2CJUL 3DUUB 2VZ1A 2R2EB 2ZUQB 2ED7A 1DQQA 2R4SH 3IRPX 4KK6C 5EU7E 3K74B 3KGSA 3WIFA 5IV2B 1CDGA 4AI7A 3KPNB 1U9KA 5H94B 4C83B 1J12A 3LHAA 3FQUA 4OH2A 3VXSD 4J6IA 1RH8A 1BBJA 1M42A 4NO5B 4KH9A 4NQCD 5KG9A 4HUVA 2XWTA 1WD8A 2BP8A 3B4NA 2MCMA 3QDGE 1F11A 3CSFA 3HPJA 1YQ2A 1RZ7L 1B6UA 1NGWB 4CMHC 4JANA 4HV8A 4JL2A 3QORD 5FW8A 3TV3L 4MXQC 1PEWA 1E4JA 1R5VB 5B38A 4ZSOA 5DJ8A 3RIKA 3HCVB 5GSVA 5ILTL 1ANUA 2GSGA 3I50H 1JD7A 2IH1A 4P4KB 2APXA 1TOXA 3FFOA 5E4EC 1N7ML 4NGHL 2W0FB 5IW3A 4BRJA 3DXAD 2CQVA 1Z32X 2D7OA 2GCYB 2B4CC 2VERA 1Z0MA 4JM2D 1Y1DA 4F8NA 3KZ8A 1F2QA 1RU9H 5FX3A 4XNUH 3ZHKA 4MBRA 3KYMB 3AXLB 1VFBB 5FFOA 1EANA 1X3DA 3QG7L 4NFCA 1EX0A 3WO4C 4ZTPL 1KYAA 1Q72H 1T3FB 2AJZB 3OJ2C 2NCMA 1FYTE 1BP3B 1UWFA 2JKRM 4X0KA 2MTPA 3LNHA 2Y1VA 3OPZH 3QC6X 3FB8B 5E9AA 4F93B 5HI3C 5HHNA 1QFOA 1IJNA 1KELH 2E4FA 4FNLL 3U1QA 2WNKA 3FCUB 5ALCH 3TBVB 2HTLD 3I3BA 4Y1TA 4WDIA 2FRGP 4MA8L 5JHDE 3MJ9H 3JWOC 5I6XB 1I7RB 3P4OB 2UZIH 3G5VA 4YIQA 5AOMA 5J11B 2Q1EA 5DRZA 3APNA 5D96C 1XGZA 1IEAA 1PDKB 1EJOL 1AGDA 4B5ZA 2HFGL 1ZHKA 4Y19B 5EOCJ 5ETUB 1RSYA 5EZLB 5E8OA 3BGFC 5BVJA 5KYYB 5H2BA 2XZZA 3S4SG 4P5KB 5C0AA 1E8XA 4WY7H 4W9FC 3HG0A 4V33A 1BA9A 3ZE1F 5DJZB 2CRIA 1K5WA 1CFQB 1X7TA 3BZ4B 3UP6A 2BVQB 1W8NA 1DLHA 4ONGH 5GS2D 3N04A 2CJ3A 4X6CE 2EVJA 3C6LA 4TL4A 3F05A 3BSHA 2B2XL 1UA7A 4W9HC 4BDVA 2P5EE 2YUVA 1N8ZB 2MKLC 1T4KA 3ZE2F 5KN5B 5IMLA 5K9JH 1BQSA 1T2QL 4KI5F 5CILH 1NFDE 1QFUH 1UXWA 2OTWB 1BZDA 4OQTL 5SWZB 4AH2A 5FGCB 1SM3L 3HNVH 1SNRA 4QHMB 3MCLL 1DHKA 4NCDA 3VCLB 4JLRA 3FFCE 1HOCB 1RUMH 5KS9F 2VIRA 3S3BB 2P26A 3LXBA 2EYRB 1GL4B 5IW6B 3D30A 4UI2A 3TESA 2K8QA 4OQTA 3EO9L 3RWIB 3VGDA 1YMMD 1AS7A 3QCVL 4AQEB 1ZK9A 2Z7YA 1SYSA 4G7VL 4NQSA 2C8NA 4XN9A 1WUNT 3NCJL 4KY1H 4ZUVB 5TQ2L 1I1AA 4R8WH 3TVMD 3E80A 3V0WH 5J6GA 3V6ZA 4DTGH 3R1GH 5TE4H 3UTZB 4JY4A 4D2NA 4K94L 3KYKH 1IKOP 3HE6C 2NQCA 3T2LA 4D9QD 1MY7A 2EDOA 1KBKA 3HAEA 3QUYB 4QRTA 2JLLA 3QFJD 1LP9F 4NKOB 4JHBA 4ZPTB 4A63A 4JDTL 2WBJB 3SPVB 2WP3T 2EE0A 2CJUH 4WWNA 3KG5A 2XY1A 4KJQC 2FJSA 4PD4J 1GTNA 2XWJA 3V6OE 4O02L 1MRDL 2HVBA 2XN9D 3PV6A 4FFWC 1PY0A 5F6HI 5BV7C 1DQQB 1RURL 1UGNA 3CFBA 3WIFB 1CI5A 2R29H 2CPUA 1PZAA 4MJ4A 3FQUB 1BBJB 3WXWL 5A6IA 5KG9B 4HUVB 5HHMB 2XWTB 3RL2A 2BP8B 4O02A 4UOJA 1F11B 3HPJB 3CUPA 2W9LA 1ZA3A 5JHLA 2DICA 3TV3H 4JANB 4HV8B 4JO4H 4EI5C 1R3KA 1B3IA 5B38B 4ZSOB 3M1OA 1BJ1J 2UWEF 5DJ8B 5GSVB 2GSGB 3BP4A 5KSAD 2IH1B 4R9HA 1EK3A 1QOKA 1N7MH 2F7IA 3LB6D 3U7WL 1Y07A 2DM2A 5EU3A 3RIAK 1IAIM 1TFHA 4AGOA 4QRRE 4N90D 5HGHA 4AV0A 1JRHH 4S2SA 4M7KH 4YO0A 3VGGA 2XU9A 2Z34A 3R4DA 1AMXA 4FEMA 4FA6A 5TDNA 5K5YA 5CCHE 1U91A 2VR5A 3QG7H 3FHQA 4NJ9L 4L2LA 4Z7VF 3ATBA 1PTZA 4OI8A 3MV8D 2RACA 4UNTA 4X0KB 1LO4H 2VQTA 3DI2B 3TH4T 4AYSA 4U1LA 1HHHA 3RVVD 3ZE0B 4KHTL 4CC4A 5I2IA 3BAXA 5DJYA 5HHNB 3NEEA 4OD1H 4Y4FD 4XCCL 4Y5YC 2CU9A 3VSVA 4FNLH 1MCQA 5E2VH 4CA4A 5I8EA 1R24A 1G7HA 4DQAA 3ZDZF 1CDBA 4WDIB 1J88A 3SDDA 3MRJA 2DI8A 4MJID 4YIQB 3G5VB 4YSSA 3B7TA 3D3VD 4I9XA 1FA4A 5DRZB 4F8QA 4GIAA 5GGRY 3MRIA 1XSOA 1IEAB 2VTFA 3BKCH 1BAGA 3T5WA 1AGDB 2WXGA 5LUMA 3H3KA 3SE9L 2HFGH 2YZ1A 4U0RC 1ZHKB 5CZVL 1ITCA 1HAWA 4XN8A 5EC1A 5E8OB 4LQ1A 3FU5A 1EHXA 3ZIYA 2OMWA 2X53A 4KJPC 4WFHE 5H2BB 2FQDA 5BVJB 2BMKA 4LHQB 5C0AB 1UOVA 1JNHA 4BHUI 4DP2X 5F9OH 4BSVA 5HYJA 3HLAA 3BT0A 3S37X 4DO5A 5JQHC 3QZOA 1FAIL 5DJDA 1DVTA 2ZYRA 1AO7E 1E6JH 5MI0C 5I1GL 3P3YA 4X80H 3TA3C 3LXCA 1DLHB 3V52L 3K4AA 1TPXB 1GOGA 2WLNA 3C6LB 3MBEC 1UURA 4A39A 1HXMA 5H35A 1I1FA 2XKSA 4QGYA 4FFVC 2X5PA 4UM9D 1MREL 3MVSA 5FYLE 4BDVB 2ROXA 2K3HA 1T4KB 1N4XH 3GJFH 5IMLB 3MRDA 5ACLA 2EVHA 5I15L 4OQTH 2LLNA 1UXWB 2FHCA 1SM3H 2QADB 4AH2B 3MCLH 3L4UA 3NUKA 4JLRB 4FXKC 1NCDL 1TENA 2VIRB 5AW6B 3DHPA 1MJUL 4U31A 4BK8A 1AVAA 3EGXA 1RSFA 2ZAHA 3EO9H 1YSOA 1W2KT 3QGVA 4NI3A 3QCVH 4CSZA 1R1CA 5AB2A 4OM0H 1P4LA 1SYSB 2AQSA 3NCJH 2G2PA 4NQSB 3S5YA 1Z3GL 1I1AB 3TXAA 5D71L 4GXUM 1GGCL 4LSVL 2GHZA 2AEWA 4PRPD 4DEWA 1H3PL 4OLYL 4QTIL 3V6ZB 4Q6KA 5J6GB 4UT6L 3TM6A 1G7PA 1B2WL 2G4GA 2WCPA 4JY4B 4PW9A 2EIKB 3AQDA 3HAEB 4FQIH 3DGDA 4QOKD 4QRTB 4E9WA 2HH0L 4MMXA 4JDTH 3X2QB 2YMOA 3WY1A 5EEZA 4BH7A 3D85D 2HLFD 4PI0A 3BVXA 2Q7AA 4PLKD 4UT6A 5LAPA 1KBGL 3FHAA 4OF6A 1S7TA 2DAVA 2YQ3A 3QDJA 4O02H 4XVUC 2M8XA 3PV6B 4N5UA 3V0VA 5E5UB 1NBQA 4QJ3B 3CFBB 3QEQA 1XCWA 3FN0L 5DEFA 3WXWH 3GXDA 3IAPA 4AKOA 3PY9A 4P4RA 1UWYA 1E7VA 5EO1A 4BUGA 1KCWA 3PRZA 3RL2B 1OTSD 4R3SA 4ERSH 4O02B 4OFQA 3WGVB 1WEJH 4D9RD 3CUPB 3N43B 4DETA 3P4MA 2P8LA 1ZA3B 2OFQA 4XR8C 4BH8A 5FO8B 1E42A 5I75B 2ZUTA 1IBFA 3WU1A 1R3KB 4DH2A 2PWGA 1ID2A 4WWKD 3BP4B 3BPNB 3SPIA 2H5UA 3P0GB 1RIVL 4HT1H 3U7WH 5ITFA 1U3HC 2V5YA 3NCFB 2VAAA 5JHDD 1YPZF 2WQWA 4OZHF 5EU3B 4NQTA 1TF4A 4G8IA 3RKDC 4TUKL 1W8OA 2ZXWB 5HGHB 2XQYG 2DMKA 4JRWA 2ILLA 2LABA 4S2SB 4YO0B 1A7QH 4I1NB 2RFXA 4LMQI 3FTSA 2NPLX 1X4YA 4KKBD 5TDNB 1U91B 4XBEL 4NJ9H 4LCWA 3C8HA 2VW7A 4DCQA 3WOVA 3L3DA 1Z5HA 4UBDC 5AW1B 1FAKT 1IGJA 1HHHB 1J0HA 3G6DH 4U1LB 3ZT7A 4OLVH 5I2IB 5DJYB 1MIEL 1KIRA 1TETL 1H3UA 3J2PA 4M9OA 5E5LA 1FSKB 2P46B 2PWDA 4A68A 5I8EB 5LBGA 1YNTF 2N56A 1R24B 5CN1A 4QI3A 1G7HB 1RJZA 1QD0A 3SDDB 3HRZA 1SEQL 3MRJB 4MVBD 5C6PB 2CR3A 4AVIA 3NZUA 1J5DA 4LIQL 1HL8A 4NQDD 4RDBA 3MRIB 2KZBA 4MJ5A 3TJPA 3ZR6A 1E4KC 1X4ZA 2XWDA 4G72B 1ZXQA 3QRBA 1R3HA 1RQ5A 1HWWA 4HDIA 4Y1SA 2VMJA 4HXBL 1XAUA 4PIBA 5CZVH 1BJMA 4JQIA 3QDMD 3DWTA 4JRFA 5EC1B 3HMWL 2IAND 2OMWB 4BYHA 3G6JE 1XL4A 5ALBL 2BMKB 1KY7A 4G6KL 1JNHB 2IBGA 2FGWH 3HBZA 3O2VH 4BSVB 4FI8A 5BZDA 3WFHA 5HYJB 1JV2A 4LSSH 2GITA 3HLAB 4HGWA 4G8EB 4K9EL 5DJDB 5KSUA 5I1GH 2X4RA 2GVYA 1JNNL 4AL8C 3QIWD 1ZLSL 1WGVA 2EEBA 2AC0A 1WIUA 2YN5A 3IE4A 1HXMB 4Z3HA 5H35B 4MKTA 4LPXA 3LHPL 3PUUA 3FU9A 2JCCE 4HIEA 2XVLA 4WEBH 5I15H 3BVNA 3MRDB 2WC7A 2YAOA 3N0AA 4P2QE 4U1KA 1G9NC 4KV5E 2DQHH 5F7NC 2J44A 4X7FC 5BS0A 4D3CL 1MHHA 3ML8A 1IAIL 2UUDK 4M8RA 2H3XC 1VLXA 3CSYA 4R4FH 4LDCA 2DYRB 3TZVA 1YY9D 1FNSH 3O6ML 1MJUH 3DRQA 3AMKA 3UPAA 3EGXB 3OR7A 1WBXA 5FECA 2DBJA 1WK0A 4W9JC 4MXQD 1P4LB 1MPAH 1Z3GH 3NYKA 1A8JH 3LZPA 4P8QA 5D71H 4LSVH 1MLCA 1FFQA 2G4EA 2JKWA 1OCZB 1CLOL 2EDXA 4KI5C 2LTQC 5JW3L 2WYTA 3KLSA 4E42A 4Q6IA 1BDYA 2ICWA 4UT6H 1B2WH 1G7PB 1N6UA 3V4LA 4PJEF 1PKOA 1Z5LA 2HH0H 1UWXK 4MMXB 4QXVA 2CRZA 3SE6A 2X9WA 4BH7B 2PYFA 3Q43A 4NXSA 5INDA 1KG0A 4MNGA 4NQVA 4DIXA 1BPLB 3CD4A 1B3JA 4WF7A 4I1PA 1S7TB 3EOYG 3QDJB 4QRRD 3WE6A 2OMBA 3V0VB 1IRAY 3ATEA 2KL6A 1RK1A 4UV7H 3M1BA 4WSJA 3FN0H 3QEQB 4OCMC 1A6TA 2TRHA 3GLZA 3IXAA 4LEXL 4M3HA 1E90A 4ONFL 5DEFB 3UX9B 12E8H 4ALAH 4P4RB 2VR4A 1GS7A 5EO1B 1JNJA 3KR3L 5HI3D 4R3SB 43C9A 4MCNA 4NKIL 2Q8BH 2A6DA 3ZOAA 3P4MB 1TZ8A 2P8LB 4HJEA 4G5ZH 4BH8B 2H45A 3GSUA 4L48A 4V11A 4ZUTA 4RFOH 5K69A 2BP5M 4TVSa 2BSDA 3BKJL 2GJPA 2X6VA 2Q9OA 4X98A 4LO9A 3PU7A 1PJ9A 1KGUA 3KBHE 1SN5A 2JI3A 2DWDA 5ITFB 2CHWA 5DFVD 4HCFA 4IIQC 2FLMA 2P24A 2VAAB 5DVKA 3A23A 3KGUA 4G8IB 4TUKH 1JZ3A 1BQKA 2BINA 5LWYH 4OJEH 1OIOA 3LX9A 2RFXB 2VLRA 4XCFH 3VXQA 1DVSA 1OOAA 4L3ED 4KKQA 2V4LA 3NACH 2I85A 4OI9A 4LCWB 4PVNA 1BW8A 5B1JA 2F6AA 3V6BR 4DCQB 5DC2A 3L3DB 3BQUA 1AY1L 4K4KA 1JSYA 4OLZH 3OQRA 1G7LA 1OGAE 1BQ5A 1IGJB 4ACPA 1PKQE 4BSWA 1TNNA 2H26A 1KIRB 3KJ6H 4IGBC 5F7EL 2VR8A 5INCA 3DO3A 2W0KA 1ZDSA 3HC3H 4ZTOH 5GGVH 3K6SA 4NKMA 4M62L 1HT6A 1KYOK 1RJZB 3FL7A 3QYCA 4GFXA 5C1MB 3HRZB 5FYLD 3U9PL 5IJKA 4FHJA 3VDBA 5IR1A 1OPGL 4U1IA 4LIQH 2WAHA 2DL2A 3J7HA 4OVUA 3FTWA 4TNWF 5IY5B 4MJ5B 5A6LA 4HJTA 5HHOE 4ZX5A 1R3HB 4HXBH 4HDIB 3RBGA 2AKRA 1UXLA 2JXMA 5E56A 4OGAC 1G9EA 3X1EA 3QB7C 2JELL 2H47C 5GZOC 4KNUA 4HJ0C 3T6WA 4NEHB 5HPMA 1GMIA 1IARB 2R1WA 3I2CH 5BZDB 3WFHB 5C9KA 1JV2B 2GITB 4HGWB 3HE6D 1ZLDA 1DFXA 5KSUB 2X4RB 2R0ZH 3QQ4A 1CD9B 1JMXA 3MA7A 3T0VA 1F45A 1M3IA 1T66C 4ANWA 1ZLVK 5FFLA 1LQSR 4KJQD 5HHQA 5E2WL 4BWTA 4OCRL 3VXUA 4FFWD 2R7EA 1JP5A 4NCC1 4IU2A 3E8VA 4WHTA 3BP5A 4HIEB 1MFMA 1XMEB 4I3RL 3BVNB 1PZUB 3T0EC 2A0LC 3H3PL 1W91A 3R7QA 4U1KB 2VR3A 1Y1UA 3M8OH 4PUBL 3WN6A 2WANA 4Z7OE 3UFIA 4D3CH 5BS0B 1K5NA 1MHHB 3ZE2E 2FGZA 3TZVB 2VDOL 3CSYB 1OCCB 3RGVA 3UXFA 4KI5E 2ERJC 3DRQB 3KHQA 4MAYD 4KWUA 4N9OB 3SO5A 3IN2A 3V8OA 1DVUA 3OR7B 1WBXB 4AVHA 1YYML 5FECB 3Q2WA 4EI5D 4YSUA 5KS9E 3SQRA 4PV9A 3NA9H 2XQYK 4MYWB 3STZA 5C0RH 2VXSL 5JW3H 1MAKA 1MLCB 4YDKH 3JWDH 1CDCA 2F5BL 4E42B 1HSBA 3KGRA 2ICWB 4Q6IB 4C56E 5CINL 5IFHL 4F7CA 4KOCA 4TN9A 4GRWH 2GHWB 3JWNG 3BDYL 3B2DC 3EZ8A 1Z5LB 2CKBL 1A1OA 3T0BA 1KBPA 1I7ZA 1BJ8A 3GXTA 3ZHFA 4QHKI 2PYFB 3PXJA 2OI9C 5T3XD 1KG0B 4MNGB 4NQVB 1F3JA 5F3HA 3D5OF 5INDB 1XDTT 2QKIC 1LP9E 3QJUB 3QA3A 3WE6B 1JXFA 4U1HA 3GMNA 2WQSA 3CZEA 4AMKL 3M1BB 2Q10A 3ZMNA 3UGXA 1A6TB 3IXAB 1SY6L 3JV0A 2XY2A 1DVFC 4HPOH 2B8OT 1PNCA 1WBZA 3WY3A 4P46A 1G7QA 1KENL 4L8SC 4LVHB 4NZUL 43C9B 4NWTL 3BH8A 3KDMB 3UC0L 4X7SH 2A6DB 3CQFA 2BS71 3RE0A 2A83A 2OSYA 2C3HA 8PAZA 1CIDA 4ZUTB 1RP9A 1SY6A 3BKJH 2C7UA 3IGFA 4NC0B 2AK4E 4X98B 5FAAA 1Q1PA 4M7LH 4NO2A 3TIEA 4IJ3B 2RQEA 4ZYKA 2DWDB 3GBEA 4K3EL 1XGUA 3GSXA 5GRVK 3RRQA 1B4JL 1WTLA 2P24B 2LU7A 2VJXA 2UWEE 2FX8L 3Q8AA 4KJPD 3I6KA 2WQ8A 1E5AA 1F5WA 3QNYA 3VQMA 4HEPG 5LN8A 1ACCA 2NY5H 5DWUH 1ORQA 2VLRB 3DX4A 3VXQB 3VTAA 2E7HA 4EIUA 1XEDA 3EO0A 1NJ9A 4HS3A 2K45A 2XCMC 1V3LA 1GGYA 3TA3D 3HC0A 2C9SA 15C8H 1AY1H 1DDHA 3MBED 3BQUB 4BFFA 2BIIA 1G7LB 2DQJL 3MODH 5AWNL 5J12B 4NQEA 4FFVD 2ZZUT 4BSWB 4M93B 4HK3N 2ZF8A 5F7EH 2H26B 1KXVA 3Q01A 1SLXA 5D7IA 1A7NL 3EYVA 5INCB 4BCYA 5JQIB 3K6SB 4M62H 4NKMB 4LMQE 4A2EA 4LXFA 1UEYA 3TWCH 3ZL2A 3ZMEA 1OPGH 5IR1B 4U1IB 1YNLH 1A4BA 2P5WA 2GY5A 2IXQA 4AGPA 2ENPA 3MRGA 3MX0A 4WK2B 1XGQA 4FLSA 2G60H 3GXUB 2AKRB 3FUNA 1J1PL 2JXMB 4FYQA 3KWVA 1JXKA 1BAWA 2APVA 1E9QA 1L9NA 5HPMB 4J3XA 2R1WB 3QUKA 3BFQG 1UHVA 4ZNEA 3VA2C 5I26A 2K6WA 3WS6C 4LT7A 3NCBB 4OF3A 2OULB 3QQ4B 2OS7A 3DO7A 4B50A 1EJFA 2NY0B 1ICTA 3MA7B 1WFTA 3NP3A 1JPFA 1PD6A 3RPKA 5HHQB 1RMFL 4OCRH 2WGNB 4XVUD 3VXUB 2J5WA 2R7EB 3VXMA 5IUCA 3S35X 4IU2B 4WHTB 3BP5B 3HKZA 4LL1A 5CS7A 1IAII 3H3PH 4PJ7A 4U05A 5LG6A 4OGXL 1JF5A 4Z23A 2ZUXA 4BQ6A 1XGPA 3Q8BA 2BXYA 3MNVA 4LQFH 4OFYD 1K5NB 2ICWI 4F1ZA 1TZOA 3RGVB 2J4WH 3GHBH 3MAWA 4KTYA 1SN2A 2PPAA 4YXKL 3SE3C 2V8LA 2VQ1A 4C4UA 2J56A 1AKJA 2VLJE 3FKUS 3N85L 1IILE 1MCKA 3PXLA 3VGAB 4PV9B 2KZ1B 3WO3B 2VDOB 2VXSH 3E38A 3FUHA 3STZB 4B9PA 3PGFL 2JKLA 4AW7A 1R75A 2F5BH 1KBWA 1U3HD 2MPAL 3BCFA 5CINH 1HSBB 4C4KO 4JFFE 1CTNA 1SLUA 4F7CB 5MEOA 1E9OA 3KMDA 3MSPA 4B41A 2CKBH 5C0BA 1JGUH 4WKZA 2YKLH 1C08A 4YL4A 4YHZL 4NZTL 1A1OB 1YEGH 3IMTA 3TH3T 1I7ZB 2FEEI 4RDQG 3EYFA 4M7JL 5J13B 2O93L 1L9QA 2G3NA 1KJ3H 5F3HB 5C7ZA 1F3JB 2BNUA 2D8KA 5CUSL 3QA3B 4YHOL 3PNRB 2I9LA 4U1HB 3GMNB 4AMKH 4UBDD 5B8CC 5LGJA 1OCWH 2NXZD 1SY6H 4JFXA 3QQ3A 2R69H 5L8KB 1HCVA 4J3SA 4OTXL 1WBZB 4P46B 4NZUH 1G7QB 3VI4F 4NWTH 4RAUA 3IJ8A 3BH8B 3PHSA 1EEUA 2G0KA 2A83B 4NNPH 5IT2H 1M2OA 4L0YA 3QE5A 4GAGL 1IAOB 5EIIG 2EO9A 5ADPL 3VWJC 5D93C 3GIZH 4P9ML 5FYJE 4KNTA 4DUWA 4WGKA 4UTBA 1JMZA 4NO2B 3TIEB 4JFDA 4K3EH 4ZYKB 4P57A 4RGNB 1XGUB 3GSXB 3MXWL 1HEHC 4MD4A 3TU6A 1THCA 2DQMA 3MJGX 3I6KB 3QNYB 3ASWA 2F54A 4FLQA 3ISYA 1XCXA 3MI6A 1ORQB 4DWHA 1YPZE 4OZHE 5HHOD 5KVGE 5HJBA 4ZDHA 3EO0B 1NJ9B 4V1DE 3DVFA 2F53A 2VAJA 4HS3B 3BP6A 3K0WA 1DQDL 2EXYC 3HC0B 3B5TA 4DP5X 3ULUL 2D3VA 1DDHB 1DFBH 1AZUA 1OF2A 4HLZH 2DQJH 3VAEA 3ELAT 4NQEB 1K3ZA 1NL0L 4N8VG 2F8OA 5IB3A 3L3OC 2EUVA 1PZ2A 3MLRL 1UD6A 5D7IB 4H8WC 4CN1A 4WI3A 2JK5A 3EYVB 5DK2A 5EBMA 1B0GA 1TVHA 3N1FC 3C6SA 4PHXA 2C1PA 3EGDA 4KVNH 2BSBA 2OCJA 3QCUL 2XKNA 5DD5L 2CG9X 2DH3A 3APMA 5DURD 4K2UL 2Y4SA 4MA1B 2P5WB 2IXQB 1KJMA 3MRGB 3MX0B 1XGQB 1CDJA 5AW8B 2JTYA 2X89A 2JKXA 2KDGA 2L3BA 4ECNA 4ANKA 1A6VH 4PB9H 3N2JA 3H2WA 1PX8A 4KI5D 5G4MA 3D06A 4XCNA 1E9QB 2HMIC 4M6AA 1F58L 1HEJC 1IQDA 4YHYC 3QUKB 4IDJL 4L1SA 4WGVB 3Q5YA 1HWHB 4LLDA 4S1DC 4DGWC 1TTGA 1MRCL 5C0CA 3LDBB 1OT1A 3DO7B 2XG5A 4JG9A 1QWUA 4LK4A 3S8WA 1JPFB 1IU1A 1RMFH 2FIKA 1GW6A 2YEQA 1PG7L 4Y2DA 3VXMB 1YEEL 1YG9A 3QRGL 5I82A 1OW0C 4L4VA 5BZZA 4DUXA 4AGQA 2ZUVA 1D7CA 3CHOA 4PJ7B 3SN6N 5KVEL 1XGPB 2JCWA 2R39A 2FVNA 3B7UX 3H0TA 3MNVB 3NIFF 4MQTB 2WXMA 4UTAL 4X7DC 5H37G 3BRFA 2VLLA 5B1BB 1ILUA 2MQ3A 4JPSA 1M05A 2VQ1B 5HYSA 4FXGA 3A24A 1NIBA 3IDNA 1AKJB 3L48A 3N85H 5K9QG 2WWKO 5E5MA 2P1YA 4P49A 3ULAB 1MCEA 3FF7A 3F6LA 4L0PB 1DVQA 1MRFL 2QJDA 4GSQA 1A6UL 4AENA 2E56A 2L7EA 3AUVA 3D7PA 2WTPA 4FERA 5MEOB 1NWPA 1E9OB 3H42H 2YFNA 5EOCH 3VD2A 2AK4D 2C9VA 2IOIA 5C0BB 2E86A 4WKZB 3H6AA 3INUH 4HJGA 4YHZH 1C08B 1G9ML 2FE0A 5KSVA 4M7JH 3EYFB 3O8XC 4CC1A 2X6BA 2FBJL 3RFZA 2V0AA 2BNUB 3H9SE 5GZNC 4KK8C 5A1AA 3R19A 2I9LB 4AGNA 1CGUA 1B88A 4M48L 5LGJB 2PO6D 4JFXB 2QDVA 1MHCA 4O51A 5DVOA 1EXHA 3ZDYF 3QQ3B 1OL0A 2WNGA 4IGBD 3INOA 4HBCL 4AW4A 4X7CC 4KXCA 4P2AA 4RAUB 3L95A 1P4IL 3IKCA 3WNJA 1FWXA 3T6VA 4JKPH 4CRPA 3FRPG 2FX7H 2ESVE 3AT0A 3DV6A 4GAGH 3X3FL 3DK0A 2BIQA 3FBKA 2Z8SA 1ZSDA 5GGQH 4I85A 4FFZL 1NMBL 3QPXH 2YD7A 1IUZA 3ZJAA 4HF5L 1UJ3C 2NX5A 5D6DA 4JFDB 4KFMA 3DGGA 5C0JB 4P57B 3MXWH 3CC5A 3FC8A 2BVYA 4XT1C 2ZOOA 1LK2A 1TCRA 2CK2A 4MD4B 3O11A 1O7DC 5IQ7H 4AQ8C 1RUQH 4HJ0D 1P7HL 4FFZA 4K3HA 4NAMA 3CMOL 3AAZA 4ZXBA 2DIEA 3VSQA 3UYPA 2F54B 3SGDH 2BNRA 1U2CA 4ZDHB 3EBGA 2F53B 4BQCA 1DQDH 3BP6B 5HHVL 4O58H 4LRNL 1EZSA 1MFAH 1OF2B 3UG5A 1T66D 3HC4L 5I71C 3BN9C 3IPEA 3D2UA 2Z0BA 2Q8AH 1LO2L 1YQVL 3AREA 4YXHL 1KTBA 4P99A 5IB3B 1RY7B 3O4OC 4TVPD 1BQLL 2XTJC 1RZFL 2JK5B 2VWEC 5DK2B 5EBMB 1B0GB 2I69A 2A0LD 1TVHB 3T0ED 3WELA 1X5KA 2G30A 3C6SB 2IBZX 2C1PB 2WM0A 3EGDB 4X6FA 5J5EA 3L5HA 3QCUH 3UL4A 5DD5H 2XKNB 4K73A 2GBAA 4DFIA 1JJUA 4F15B 1QEXA 2WXNA 4X42A 3TIDA 1F8TL 1WFMA 4U3HA 1KJMB 1FC2D 2P49B 3KPRD 1L0PA 4ELKA 3F58L 5FYKD 1RD6A 2R2HA 2ZWZA 1G4RA 3KVQA 4AUYA 4XCNB 1BJ1H 4B5EA 1F58H 2WMPA 5MEND 2BVPA 5IWLA 1IQDB 3D12B 4MB3A 4IDJH 5ESQA 2V7HA 3HS9A 1BF5A 4R4NC 4LLDB 1FIGL 5I1JH 7CGTA 4RWYH 2J72A 3E2HB 5C0CB 3KXFA 2XG5B 5J1TC 3E6FA 1HOEA 2EP6A 1U8QA 5LQBL 4AQ1C 3ARQA 2FIKB 4H13C 4HEME 4X4XA 2DEXX 5CSZA 4ANVA 3HZVA 1ZKAA 2XVGA 4IQHA 4Y2DB 3BWAA 3D4YA 4W4OC 3QRGH 4JKLA 4L4VB 1G43A 3VXOA 1EVTC 2DM4A 3RTQA 2WLLA 3BAEL 4TLSA 5HGGS 3P0VH 3MHZA 2YPKA 4I0KA 1DVFD 3H0TB 4N26A 5I0YA 4UTAH 1KB5H 5TDOA 2C1OA 2VLLB 3F7YA 5EU6D 3AZUA 1MZYA 4UQAA 2VSCA 2Y7MA 1YYLL 4Q74A 1M05B 5HYSB 5F0JB 1L6PA 4FXGB 4ELMF 5BPPA 3IDNB 2Q3AA 5E5MB 4GUPA 4ZMXA 4MZ2A 4PJ5D 3LRKA 4LOFA 5FB8A 5JIMA 4XP4H 3GBNL 1MRFH 4EN2A 2OK0L 3LOWA 3S0PA 5JTWA 3KPSD 4AENB 1SLWA 2ZCZA 1TTCA 2K7QA 4RZCA 4PPTA 1ZLWH 5IIEB 3IJYA 2WKOA 2XN1A 5DRNA 1G9MH 4HJGB 4LCUA 1M9WA 1J9CT 2NSMA 5KSVB 4LLWA 4FTVE 3FO1A 4POYA 3RFZB 2DBLH 1XSJA 1AQMA 2AXHA 4G2AA 2RA1A 4M48H 3L8QA 3QWOA 1AHWC 4HIIA 4HIXL 1MHCB 4O51B 4JG1L 4V1DD 2L04A 4FZEH 3RHWK 3Q6FA 4ZUWA 2D7QA 1P4IH 1MHPL 3L95B 2WNWA 3IKCB 3NZ8A 1QSEA 2EDLA 4P2RD 4XXCC 4UT9L 3CFCL 3P30L 3DV6B 1ASQA 3QR2A 2RCSL 4N8UA 1I9IH 3WY4A 1DVYA 1ZSDB 4EPSA 3NTCL 1NMBH 2D2CC 5FV2A 3UC2A 3FO2A 1CDUA 1OP9A 4HF5H 1RP8A 1U4EA 2WCSA 2NX5B 4UT9A 3A47A 3DGGB 5FIEA 3B5HA 2Z7UA 1IM9D 2GBTA 4O00A 4W9EC 3CC5B 2A9NH 5AW3B 3RVXC 1LK2B 1TCRB 2RBLA 3UEZA 2FUTA 3O11B 4UQIM 1UXMA 2XFGB 3U36A 1HH9A 3CMOH 2AXFA 1FO0A 2J8UA 3AAZB 4S1RH 4ZXBB 2OJZL 2QQKL 1ZIBA 2V9RA 3UYPB 3G04A 2BNRB 1R46A 4ODHH 3I3EA 5HHVH 4LRNH 4KHXL 5HDQH 3SGKC 2E0PA 5I5MA 4Z7QF 2XTJE 2VWEE 2PXYC 2H4EA 3UBFA 1Q0XL 3D69B 4GSRA 1HCYA 5C0EA 5AOKA 4JG0H 3D2UB 3SGJA 4E41E 5JHAA 5FCUH 5HI4C 3AREB 1Q0YL 3DOSA 3EJZC 2DD8H 2WUBL 1G6VK 2P47B 4XO4A 4Y4HA 1JVOA 4MNQA 3RILA 1XMWA 1NCIA 4X6FB 3QO1B 4WW2F 2EC9T 2IH9A 1JDAA 3X3GH 1J86A 1UM5L 3MV01 5TD4A 3TIDB 3WMSA 3SPJA 3Q48A 5ECGA 2XXFA 3IDJA 3KM1A 4ZNCD 2ZWYA 3QZLA 1T80A 1EMTL 4ELKB 5I6LA 3LQZA 1AC0A 4KMQA 2R2HB 4GP4B 1EH9A 5IROC 4FP8H 1FNLA 2E9IA 4A7VA 5AD0A 5MHSE 4LLYA 4RBPH 2WMPB 3GPSA 5GGTL 2BVPB 3MLTA 4MXVF 4TQ8A 3LH9A 5ESQB 4FLHA 2JMRA 5FK9A 2V7HB 3OWEA 4MDJA 4H0GA 2BS8A 1OHZA 2IOOA 4B3VA 2AEOA 1QHPA 2X42A 2HVKA 1VPOL 3FSVA 3KXFB 4U6VL 4EJ1C 1SGKA 3E6FB 4GQ9H 4KMLB 4XPAL 5GGTA 5LQBH 5LBVA 1U8QB 2ZOUA 2R0KL 4RMTA 1Q0EA 1N12A 4X4XB 4GT0A 5CSZB 5IHUL 3HZVB 3ZYIA 5FM8A 4K7PL 1VADA 3BAKA 4M1GH 3BWAB 4HUUA 2JKSA 1AZCA 1J8HE 1T5KA 4PLJD 3U6RA 4PGCB 4QT5A 3VXOB 2XZCH 3RTQB 2WTOA 4N2GA 2WLLB 3KYNA 2FNWA 2YPKB 4LLUA 5TDOB 3RAJH 2C1OB 5CJXC 3F7YB 3EW3B 2F7OA 4RGOL 3PNWA 3IKKA 1P53A 1YYLH 3PP4H 4TRPL 3WIIL 1IMHC 3QI9A 5D7LD 5KBPA 5CR8A 4B9FA 3U7YL 4WSGA 3WNMA 3DSFL 1XVSA 3VWJD 4GQPH 4GUPB 5FB8B 3GBNH 2W80C 3BQVA 2OK0H 5EUOA 4G7RB 3ELQA 3CMGA 3NCYS 4O9HL 4RZCB 4M7ZB 3QXDA 3FQNA 3SO3B 1HAUA 2ZP0T 1OQOA 3IJYB 5F6IB 4J8RA 3OC5A 1PPIA 4LLVA 2WN2A 5DRNB 2YUWA 3SZ6A 1I53A 4LCUB 4LDEB 4APQA 1AZVA 4LLWB 1N3NA 1CD0A 3FO1B 3L2NA 1B2YA 5CFAA 1XZWA 2AI0L 2DIJA 4O5LH 2EXYD 2Z4QA 3FB5A 1UH3A 4ZOCA 4P2OD 3WFZA 3P9WB 3UBHA 3QWOB 4J4PA 1QKZH 4HIIB 3AM8C 2YSTA 4JE4B 4M3JA 4CL7A 2YRLA 2VKXA 3EFOA 1E8YA 3Q6FB 2KDYA 3P4NA 4ZUWB 1QWNA 1BD2E 3C5XA 3E1F1 3NZ8B 1CPUA 1QSEB 4X8XA 5CZXC 2EICA 4BUHA 4X4MA 1T83C 2DQGL 3CFCH 3P30H 4BFEA 1A3RL 2RCSH 4PWKA 1FL5A 1I8KA 2C7FA 4S0SD 3NTCH 4N2OA 3AXIA 1AZRA 1DQTA 1EERB 5FA4A 4JO1H 3FO2B 2FBOJ 3F6IA 4ZW6A 3Q9PA 3LS5H 5IF0A 1OPOA 2J43A 3MBXH 2I60L 4GNKB 4NUQA 5BUAA 1JGEA 1T1ZA 3PWNA 1EGJL 3IBEA 4EOWL 2IBBA 3U36B 5F7WC 5FLUA 1HH9B 5F7AA 2AXFB 4A55A 1FO0B 4GSUA 2HMID 2J8UB 2OJZH 2QQKH 1NKOA 4EQ2A 5SX5K 5JOPE 3AADB 3DIFA 3G04B 4W6XB 1XGRA 2XYBA 3PDGA 4S1DD 5JXAL 4KHXH 1J11A 2QGEA 4XH2A 5IHLB 1CF8L 1FL3A 2NZ1A 1V3KA 1TZGH 1SXSA 3ARBA 4WAFA 4ZMYA 3LKRA 5C0EB 1MN4A 3ZE0F 5A7EA 3SYCA 4RMQA 2HN7A 5KW9L 2F8IA 4NJAL 1PSKL 3HW7A 4OU3A 2WUBH 3DOSB 2KKQA 1M57B 3K8KA 4Y4HB 1E5CA 4DO6A 4MNQB 4YDLC 4WFFE 1DBAH 1JERA 1JNLL 5I9QB 4LSDA 4YSQA 4ZFGH 1MIMH 1MFEH 4XMVA 4FLOA 1W6LA 1KPVA 1QSVA 1JD9A 2O30A 2O5YL 4E2OA 5IREA 4MB5A 2YXWA 3UGEA 4C55A 4FABH 3IDJB 4APXA 3CX5J 1TU2A 3LQZB 4MTMA 5LB1A 2AXJA 2EZ0C 4OIBA 3ZQXA 5AD0B 3R7RA 1FCCA 3EH2A 4LLYB 1F4WL 2QSVA 3MLTB 5FK9B 4MDJB 5BMFH 4NM8H 2XVKA 5ESAA 5BV7L 3RZCD 4G82A 1EHAA 1VPOH 1T5WA 4HZLA 4NUJA 4U6VH 2HVKB 4HCIA 4HUMB 4G8GA 3CHQA 3A4DA 4XPAH 2VDNL 1A6PA 4HX1A 3HE7A 4UNIA 3O8XD 1A6WH 4WLCA 2R0KH 3IMVA 1CFTA 3BIAX 3K2UL 1JIBA 4KK8D 5GZND 4Z7WA 1VADB 2C26A 2QHLA 3CVHA 2IGFH 2AEQH 3U6RB 4Z8FH 4QT5B 4K07A 2QPFA 2AJYL 3TCXA 3U79A 2GBVA 1NKRA 3KYNB 5E9DE 5ENWA 4LLUB 5B39A 1KFAH 1MCWW 3DTXA 2QV2A 4PWFA 4RGOH 3VX1A 3PNWB 4JPQA 4KMTH 5TDPA 3QI9B 3U7YH 3NIFE 3VFRA 1XF1A 2B4CH 3WNKA 1W15A 4H1LG 4PCTA 1BQHG 3A67H 5EUOB 4HISA 3HOGA 4GMTH 4O9HH 3ZZLA 1OTUC 3QXDB 3FQNB 4BQ8A 4XZ4A 5T3XL 3GTTA 4J8RB 4PRHE 4LLVB 3FNKA 3LRHA 1IT9L 2J8OA 4KQ3L 4W81A 1DEDA 4XVSL 4APQB 1BEYL 1TMQA 4N2CA 5DR5L 1N3NB 2W1NA 2AITA 4EUPA 3DX6A 3NIDB 1D9KA 1DBKL 1I8LA 2Z4QB 3FB5B 2NTFA 5FGBA 3UZVA 3AGVA 5J7CC 3BE1L 3S3DB 3ZO0A 4BXSV 1T7WA 2I9TA 2ATAA 3ZK0A 3JWOH 3EFOB 1QPKA 4M02A 4WJG3 1MLBA 4XE5B 1GW0A 2BIPA 3P4NB 4XPGL 4G6MH 1I3UA 5E8PA 4H4NA 3SPGA 1I9EA 2CMRL 3JTBA 2VH5L 2CIIA 3ZDYE 3IN0A 1MCOL 1QI5A 2HYMA 4C58B 1FL5B 1J18A 1I8KB 3PWVA 1ZANL 4LHUG 3GMQA 4AEIL 2AVGA 3H6JA 4OCXL 1AR2A 5FA4B 5IF0B 4U1SA 3DX8A 1W0VA 1G84A 3FMGH 1OWRM 4OLWL 2V7NA 3EJCA 4ABUA 1EGJH 1VF5C 1O9ZA 1JGEB 1T1ZB 3PWNB 2IDCA 1B4LA 5T1MA 4NHCL 1CGXA 1E0OB 4UILL 5T3ZD 4ODXA 1C8QA 3KWTA 4WEMB 1ZLEA 4MA7H 4B9YA 3DIFB 4FJYA 3NJMA 1KGIA 3QRLA 4R4ND 1XGRB 3I6SA 4YPGA 4F9LA 1T0PB 2Q76A 4GAYA 4YN3A 1CF8H 4XH2B 1FL3B 3FT2A 4P4KC 5F96L 4PJHA 3IETA 2J25A 3ARBB 2FHBA 2YARA 5F0LB 3LKRB 4G5AA 5JW5A 3MLVL 5KW9H 2HN7B 1PSKH 2BWQA 2F19H 3O6LL 5CSBA 3ARPA 1X6LA 3ALXA 4OCLC 4TSBL 1E3FA 3JTTA 5C0NC 2NUTA 2EDQA 3QZBA 3WFDL 4AG4L 3ZYZA 1JNLH 2NW2A 1MQKL 1Q9WA 2YPVA 4MB4A 5CEZE 1KPVB 1IEHA 1J8HD 2GK2A 5IQ9A 2CK0H 4APXB 1ZVHA 1CE6A 1TU2B 5GXBB 3VFGH 4GRLA 3NT0A 2YMXH 3HI6H 4WQOA 5FCSH 5CSGA 4I88A 1BREA 3UAJA 1T22A 5HDBF 2HUEA 3UMNA 4L8DA 5ANMA 2UXGA 2HA1A 4Z95L 4KUCF 1F4WH 2JIXD 2P42B 3OD3A 3ZL1A 4WW2C 3GZQA 4M6ML 3MRLA 3OLDA 5I6XC 2EC8A 2C34A 5ESAB 3IWUA 3HFMH 3P1VA 5BV7H 4NQQA 1K4DA 5J11C 1L0YA 2AERT 2N1KA 4RFEA 4NUJB 4DHLA 1T5WB 4HZLB 2Z3FA 5L9DL 4PMEA 4G8GB 4GIPD 1WZMA 4HUCA 4HX1B 3HE7B 5KYXA 2XETA 4OT1H 4B97A 5KJ7E 1CFTB 5DRXA 2PWEA 4Z7WB 4K5MA 5CCGE 3CVHB 4JFEE 2F15A 3WXVL 5EORL 4ANXA 3ARYA 3ERXA 2NXYC 4LVNB 2AJYH 1UD3A 2VDNB 4ETYA 3QUXA 5FPIA 1XL6A 5ENWB 2VYRE 5B39B 5I5IA 4WCYL 3DTXB 4G9FE 2UZXA 1JN6A 1TR7A 5TDPB 2FWOA 1QHOA 3E8UL 1IL1A 2YEZA 4WU7A 3UTSE 3VFRB 3VFTA 1NOLA 3KPPA 4KX9A 3O6FA 1GY2A 3TCTA 4LKCA 2MNJB 2YSSA 5D1ZI 5EV7A 3S6CA 4ELME 1GS6X 2DV6A 4JPVH 3RVXD 2W59A 5T3XH 4KRPB 3P2BA 3JXAA 4N0UE 5D1XA 3BJLA 3OBAA 4KQ3H 4BFKA 5L2KA 3IMBA 3JV5A 4YUEL 1ASPA 3EYSH 4FKEA 4ODSH 3WEAA 2ZCHH 2N7AA 4UQCA 3DX0A 4EUPB 3DX6B 4LCYA 1DBKH 4BRVA 1D9KB 2O6DA 2PXYD 2FZ3A 2NTFB 2VJ0A 1S2EA 4J3WA 4Z5RA 3UZVB 3BE1H 2X2HA 3HI1A 2ADIA 1HL5A 1NCCL 1NEZG 4XHQA 3LRLA 3OAUL 1NGQH 2I9TB 1BVNT 1ZTXH 5DFAA 5HI4D 1IGYA 4OGYL 3UTTD 3EJZD 1MLBB 2NT0A 3QUYC 3N40F 3CQQA 1IBHA 5JUEL 5AW2B 5E8PB 2CMRH 3DX7A 2CIIB 3L9YA 4EAEA 4LGRB 4P06A 1NCUA 3KAAA 3OTTA 3PWVB 1D3CA 1MNUL 3GMQB 1AI1L 4LVEA 4K9JA 4U1SB 3L1EA 3DX8B 1LYQA 1W0VB 3NRQA 5CZRA 1E3XA 3F6JA 4WFFD 2V7NB 4QRBA 2Q7NA 1H3TA 3BLPX 4PS8A 1U3ZA 5T1MB 3TO2A 5IROD 4L1HA 4WNQA 5DLML 3APFA 4DAGH 5ABZA 4ODXB 5BOJA 1GTFA 2PN5A 4H25A 4Z7UE 3TYGH 3QNXA 1TTFA 1OE2A 4YPGB 2Q76B 4I3SL 4GAYB 3WMQA 3TURA 3KEDA 4DGIH 5F96H 3FT2B 3O2DH 1J0KA 4KZ0A 4PJHB 3VNZA 3WNNA 2XPZA 3IETB 3QAQA 1XGYL 4K8RL 1BF2A 4PGJA 1DBJL 3EHBB 1A02N 3MLVH 3B56A 3O6LH 5JW5B 3B1UA 4Z7QE 4L37A 2VUYA 2MRYA 4MDIA 3JTTB 3AWGA 2CO3A 2E3VA 2NUTB 5AYTA 3SBWA 3WFDH 1PQZA 5D4IA 4AG4H 2NW2B 2LQRA 1MQKH 2YD3A 1P7QA 1Q9WB 4GO8A 1RULL 4MS6A 2QGDA 3S9DB 1DSWA 4AJYV 4NM4L 4FD0A 3SHSA 1PL3A 3SJVD 2ZXEB 1KTDA 1Z0NA 1FBIL 4GRLB 4M4RA 2VMCA 5E9DD 4TXVB 4MQSB 2UXTA 3GM0A 1T22B 4JFVA 1ZLUK 2IEPA 2QPEB 4L8DB 5ANMB 5DSCA 1SMOA 3SDAA 4HC1L 1TIUA 3ISWA 4TOYL 4HULB 5JQ6H 4M6MH 2H6OA 4QXGL 5B3SB 1MI5E 3CCHA 3MRLB 4Y19E 2X0WA 2P5PA 3P73A 5IB4A 2CO4A 2OSWA 4ZQTA 2I27N 1CGSL 1Q1JH 1AJ7L 3IJEA 1K4DB 3O3BA 3T3PF 3GXFA 5L9DH 4RFEB 1S3KL 3CFIC 3WTWA 4MXVE 5E4AA 4HC1A 1SJVA 4WSKA 3TJEH 5KYXB 1OALA 4U4BA 5I6OA 1J9SA 2WZ5A 5FO2A 5JOFA 5CWSB 5DRXB 2I7OA 1AE6L 3WI9A 1N18A 3WXVH 5EORH 4Z7NF 1IFHL 3PWPD 5I8KL 5G5DA 1MCBA 4KRLB 1NLDL 3OMNB 2WHVA 3QUXB 1TJIH 1JDDA 1IAKA 4BBWA 4LEBA 1CLZL 2WZPA 1T03L 1MCIA 1JVLA 3NPSB 2UZXB 1JN6B 5E70A 1ZT1A 5CZXD 1TPXC 5EA0H 1GC1L 3NCEB 3C6LC 3EDDA 4W9IC 4KK9C 3E8UH 1LTXA 2FWOB 3V0FA 4WUUA 2C9UA 4HYTB 1IL1B 2YEZB 4PJ8A 4WU7B 2WP3O 3VFTB 3DYOA 3IRCA 3O81A 2BWDA 2OMZA 5EF0A 3UTOA 3KPPB 4HPHA 3O6FB 5GPRA 3Q13A 2ZOWA 2VXQL 4LKCB 4TKWA 2YSSB 3GGWA 5EZIL 4AK1A 3SBRA 2A74A 4RNRA 2WLKA 2VDQH 2Q0ZX 4A6YH 1X5GA 4NYLA 5B3JE 4TNWK 4NQUA 4U6YA 5D1XB 3WUWA 5L2KB 4R90L 1E4XH 3MRFA 1V7NL 3BUYA 1QLFA 5K1NA 1DEEA 2WBWB 4LCYB 3VB9A 2ZOTA 3UPRA 1I1AC 4HFWA 3KS0J 3MLSL 5F7MC 4Z5RB 2YAEA 1W16A 3HI1B 4IKJA 3ZYJA 5AZ2L 1NCCH 2ADIB 2HVJA 1LLAA 2XXGA 3OAUH 4BV1A 4R5VA 1EAOA 2EXTA 1CK0L 1IGYB 1OTTC 3F7VA 4YSDA 4YE4L 5BXFA 2YA1A 4M6OL 2KMWA 3E0GA 3RKPA 1MW2A 3EFFA 2ZONA 3DX7B 3K2MC 4FOMA 4NLHA 4C4KT 2XPGA 4J3TA 5AKVA 2WLHA 1ACXA 5F7FA 4K94C 1HCFX 1HL4A 4DOHB 2Y72A 1AI1H 1VDGA 5EF1A 4Q4IA 4W9GC 5D8JL 3US9A 1I7TA 4ATTA 4OW6A 1I1CA 4GLRH 3QPQC 4QRSA 2B59A 5CEZD 3HG4A 3P3TA 1AAJA 4ZSOE 3C5ZA 2EZ0D 3TO2B 3VFMA 4M8UA 4WNQB 4J3OD 5L6YH 3RVUC 2WTRA 2GIXA 4H25B 5I75C 2ITFA 3JYBA 3BH9A 3KBEA 3QNXB 1NCTA 1UT1A 1UKQA 4WEUD 1QNZL 3MOAH 4HGMA 1EWHA 4M9PA 3BWUF 3BPNC 2UX7A 5KZCD 1DBJH 5ISZE 1G9NH 1NH6A 1QI4A 1YLBB 4FKKA 1BZ7A 1MJJA 4CW1A 2BIMA 4L37B 4PJCE 4MDIB 2ADJA 1PQZB 1OSZA 5DD1L 1NAKL 1P7QB 2AK1L 5CIPH 4JFUA 4Q4EA 1CGWA 1C7TA 1WAPA 3CK0H 1MFCL 1SZNA 2OP4L 1JZGA 3LIUA 4JJHA 4JFED 5DD0L 3ZTNH 2QMKA 4Y0GA 1KTDB 1PCXA 2Y25A 2IG2L 1G0YR 1FBIH 5D1QA 2EO7A 4CC4C 5DZNA 4M4RB 4QRPA 1AANA 3LN5A 1FSKC 4MQXC 5DSCB 2EH8L 4HC1H 4TOYH 4ZMPA 1EHLH 3SDAB 3UJTL 4QWWC 1OTUD 4QXGH 2D3NA 1QFWM 3CCHB 3S4SA 3SDDC 1S9WA 5EDXA 3P73B 3HBQA 1UYWL 7FABH 5IB4B 4UIMA 3VW3L 1AJ7H 3IJEB 3O3BB 1S3KH 2XTSA 3BUPA 3MV9D 3AQYA 4TNGA 4GIOA 3QUZA 5B1KA 4E9QA 4EKXA 4BJLA 4EN3D 1EAJA 2EUXA 1OE3A 5DUJA 5F9WC 5JOFB 1AE6H 3WKNA 2GTQA 3CXDL 1IFHH 5AL8A 5I8KH 1T1YA 3T4AC 1NLDH 5G5DB 5JDSA 1MCSA 3D9AL 3E9TA 1OP5K 3CVBA 2ENYA 4MKMA 4K3DH 4OJAA 4B95C 3FW6A 4QRFA 1CLZH 1IAKB 3EBAA 4NPKA 3K4DA 2Y5QA 3HUJE 3PREA 5AZUA 1ZT1B 4ZMTA 2GJZA 1JGDA 4UOW1 3AWEA 5DQ9A 1WAEA 4WUUB 4PJ8B 4S11A 4DVRL 2Y1ZA 5I6MA 1M4KA 2OMZB 4E36A 1QRNA 2VXQH 3K6IA 1S7WA 2ZWNA 1KULA 3GGWB 5EZIH 2A74B 4OM1H 3QXWA 3QDHA 4RNRB 5C08A 3RGBA 1B9ZA 4HWEL 4Q9BA 1RIHL 5ACMA 1JUFA 4NYLB 5FEBA 4Q9RL 2FQFA 4X0NA 3KH4A 4U6YB 3BAWA 3WUWB 3TP4A 1UOWA 2N0KA 3MRFB 4DW2L 5I66A 3ZDXB 3S98A 3W9EA 3BUYB 4FYSA 5FOJA 1QLFB 4AQOA 1DEEB 3RP1A 2Y7QA 1Y6KR 4RISH 3QHFL 3UPRB 2JV6A 4P4KD 4HFWB 3GZOA 5DMIH 4PRIB 3TTSA 4RLDA 1W80A 4PWHA 2HVJB 1TSRA 1JHLH 2X9ZA 3TBYA 4YE4H 3F7VB 4M6OH 5BXFB 3VXRE 3L16A 3WHXA 3TEXA 1E27B 4D94A 3S3SA 1I8UA 5C0ND 4MMXC 5I1AA 1CG9A 3EFFB 1TTBA 4MCYA 4F2EA 3PP3K 2XPGB 2APBA 2R1YA 1JXGA 1AIFA 4W93A 3NZHL 3M88A 4DP6X 5DQDL 3EBIA 4DUVA 1DJYA 4KTDL 1JK9A 3D39A 5C3LD 3MNMA 5D7JA 1I7TB 3MKGA 1C7SA 3NABL 5E1AA 1T6VN 4R4BA 3VGHA 2B59B 3W9DA 3ORJA 5EPMB 1QR4A 3C5ZB 3OKNA 4NP9A 3VFMB 3GDCA 4DP1X 2AV1A 1O9WA 3ARSA 5EZPA 2YLHA 4N8CL 1URZA 4JCMA 4S10A 2WTRB 3SQOH 4AUJA 4U1MA 2VDML 2YXMA 2PETA 3BH9B 5C0GA 2AJXL 4TVPH 1BZ8A 4IIZA 4OB5L 1IVLA 3LXAA 1YECH 3ARGC 4G7YL 5T5FA 1BZ7B 1MJJB 2BW5A 1JTTA 4Y19D 3WENA 2OMXA 3PQYA 1TJMA 4FTDA 4CW1B 2A77L 4P23A 4BCZA 4GSDL 5I1IL 3LAFA 2XV3A 1KTCA 2IPTH 1CWVA 1HDMA 3L5WA 3MLYH 3IU3A 1NCHA 4QKTA 2ADJB 2NXYD 2YRPA 2VL5A 1OSZB 4CBZA 5MP6L 4PJXF 3R18A 4YHLL 2IDQA 4ABQA 3OG6B 1IC4L 5FYKH 3MRHA 1Z1WA 3PYCA 5IVXA 2XRAL 2G9KA 3PDDA 1NINA 5GGSA 1MCDA 1HX0A 3BWSA 4WUKL 2IG2H 5F6HJ 2CHXA 2XN0A 1J87A 2YZ8A 3CFEA 5D1QB 4EZJA 1MW3A 4XRCA 2R1XA 1TLMA 4QRPB 4WK4B 5HHXL 2VDKL 3LN5B 1NC2D 3NJFA 1PZ3A 1GYVA 2JVUA 2X38A 2EH8H 5CJOL 3BEVA 4WZ9A 4JO3H 2EYTA 5SWZD 3RDTA 2ZXAA 3QXVA 4ZFOL 2VZSA 2BX5A 3B2VL 1CN4A 4FQ1L 5HDBE 3S4SB 3HRZC 1S9WB 4DKTA 3VW3H 4UIMB 1H3XA 3WTTA 3AT8A 2VABA 4R7XA 1EFXA 1I85A 1RAMA 3QUZB 4ZFOA 4HJSA 3UAFA 3OX8A 2W5PA 4F37F 2CLRA 1J0YA 3Q2VA 3S96A 4GYBA 1T1YB 3OZ9L 3D9AH 3NK4A 3ZHNA 5JDSB 3F7RA 1ZY9A 3CXHJ 1MF2L 1WZ1L 4LASL 1TEYA 3CFTA 3QUYD 3J07A 2VN6A 2O4EA 4AJ0A 1Q94A 5FO9A 5C09E 2GJZB 1JGDB 4FF9A 2H9GA 4HHGA 5DQ9B 1WSST 3NJJA 4DVRH 3JSSA 3V5HA 2E7LA 4K9EC 2XDHA 1NAMH 3Q05A 1LWJA 1QRNB 2I24N 5CM1A 5D2LF 1S7WB 4S1QL 4A2GA 4HLJA 3BH4A 3I85A 4XX5A 1JGIA 2XJKA 2EE2A 4PSPA 1DSFH 1MCPL 5CU5A 3TO4B 4LFHD 5C08B 5A3IC 5HHMD 1PJWA 4Q9RH 1JUFB 3TZVC 1KC5H 2GJ6A 3BIKA 3US1A 2XHNA 4U3CA 2DYSB 4CKQA 5I66B 3LS4L 1H15A 3W9EB 2IH8A 3ZT6A 4BK4A 2Z64C 4TPRH 2Y7QB 3W0WE 4P2CG 3DBSA 1G6RL 5AZEL 1C12A 3P02A 4F5CA 3KW8A 3CFKA 4Q6IC 4XNBA 3ZKXB 2AW2A 2X2IA 5IBUG 1U41A 3TBYB 4BINA 1G4MA 2VQUA 2GJJA 3S8GB 2XPYA 3WHXB 4F7PA 5I1AB 1SOKA 2DJ4A 5I24A 1G6RA 3QEQE 1CG9B 1R5IA 4Y1AE 5IVZA 1CL7L 1QZ1A 4MCYB 2B1HL 1OAUL 1SJXA 4JRXA 1AIFB 1NANH 4QMEA 1FC1A 5DQDH 2EIJB 3CGTA 4UOZA 5A2CA 4KTDH 5AW0B 3T2QA 4JFTA 1ZD6A 4JRYE 1JK9B 3D39B 1JPGA 4OCYH 3WY2A 1UM4H 4WHYH 2NOYA 3NABH 5D7JB 5KWYC 2J1KA 5E1AB 4R4BB 9CGTA 3W9DB 2X6AA 1OT4A 4AKPA 3CFNA 4F7EA 1CLCA 4PQXA 3C08L 2BVEA 2NYKA 5E6YA 2Z4TA 4AWJC 4FCHA 3OKNB 4JM2F 2FNBA 1ZVNA 2AV1B 5ADOL 4N8CH 4F8LA 2XKUA 4FQLH 4RQQA 4JW3A 2DI9A 1YC8A 4LNVA 4U1MB 3O3UN 2CBMA 2XQYA 2E9BA 4GUQA 5C0GB 2AJXH 2HPOA 4QD2E 2XIDA 2R56L 3KDPB 4IJ3C 1WC7A 2V3EA 2YPLE 2VRKA 3OB8A 5DEJA 2EJ1A 5I0VA 2VDMB 5I1IH 2OMXB 3PQYB 4GSDH 4JKWA 2EDHA 4P23B 4HFUL 3MV7A 4RGMB 4GKSA 4ZRGA 2C3GA 5T8IA 5C0AD 1HDMB 3L5WB 3IU3B 1A7RL 4UINL 4F3FA 2VL5B 2YD2A 5IZ7A 5B1AB 5MP6H 2ZP8A 4YHLH 2O5XL 1IC4H 4OAWA 4FA8A 1JF1A 4FZ8H 4H44C 1XSKA 3MRHB 4ZW8A 4XP6L 3QIUA 4PI2A 2XRAH 1OLZA 3BWUC 5IVXB 5KVMC 3C6LD 1IE5A 3BQUC 4KK9D 1BX2B 2QPDB 4WUKH 1H8OA 5GGSB 4PGZA 4XNYL 5J12C 1I9JH 4DP0X 1GYAA 3O0RL 3CFEB 4XE0A 5C2BL 4XRCB 2R1XB 4M93C 1HZLA 2B39A 2NT1A 2VDKH 3ABGA 3P54A 4UF7C 1BOGA 4YHNA 4I9WE 3H2PA 5CJOH 3NJGA 3BEVB 3EFDH 5GRVL 1ZT7A 4Q97A 2EYTB 3FT9A 3RDTB 1Z9SA 2FYYA 4FQ1H 1JYNA 3HS0A 4OIIL 5DJ0A 5IJKC 2QVTA 3CH1A 1JGVL 1E5BA 3MFFA 4NCC2 5T1DL 3U6XA 4LIQE 3U46B 2RGSA 2VABB 4ZMVA 2BJML 1EFXB 4IW4C 2QV4A 4XNQA 4ZFOB 4LLAA 4L1TA 1O0VA 1NCWL 3Q6GL 5GS1C 4MJHA 3T3PE 3OX8B 4NT6A 1I1AD 4MCZA 3ZKMC 4KQ0A 1EJ6A 2CLRB 1JFQL 4JFPA 2HRLA 3S96B 5J6HA 3EUDA 3KGTA 5HYEA 1MF2H 2BVOA 2HG5A 4LASH 4HWUA 2YAFA 5ELIA 1OTTD 4PBDA 4Y16A 5EO0A 1F4YL 4JN1H 2WIIA 4Z7NE 1F1GA 1BM3L 3OHXA 1RJCA 1Q94B 5FO9B 1TJGH 1UB6A 2NY0C 4QDGA 1XFPA 1UZ8A 2H9GB 5I1KL 2PP9A 5HYQA 1GYCA 3V5HB 6TAAA 3TNNA 2FB4H 1PU0A 1OB1A 2BVTA 4S1QH 2O6FA 4KNQA 3QPQD 3ML9A 4DP8X 1MCPH 3VJ6A 4DGYH 3QDGA 4J7RA 4X9BA 1UQSA 1DO5A 3RGVC 2GJ6B 4HG4J 1UH4A 2EC9U 4JFSA 5E03A 3KPLA 3VD9A 3BIKB 3RVUD 3OL2A 2ZG2A 4W9ZA 4XOEA 4Z3TA 1H15B 1R3IH 1XXDC 2J2ZA 3GSNH 5IB1A 2Y7OA 3SDXF 2HKHL 2QZQA 1HXYA 3VGAC 5B3NA 4AYID 2P43B 5LGKA 4YNYA 4FFTA 3D85A 4H8WH 2UXFA 3SPCA 3S88H 1RL1A 1A7BA 5AW9B 1C12B 3FONA 3QG6A 3CFKB 5D2NC 3SZKC 4OJCA 2VO5A 3HB3B 4LOVA 3LKNA 4XX1E 1LO5A 4FXTA 4GRWE 1FGNH 3E3QC 5FHAH 4F7PB 4GI8A 4RMWA 1W8EA 3HVNA 1G6RB 3H4HA 2LHAA 1FUNA 1CL7H 1R5IB 6FABL 5IVZB 1OAUH 3ZTJH 5J13C 4JRXB 3IJSA 4AOFA 5D4QA 2IDTA 1U2YA 4F8PA 1FYTA 4IMKA 3U0PA 2PCXA 3FSOA 3IFNL 6PAZA 1BOYA 3MRRA 1TTRA 4L8CA 3H8NA 2VLME 5T3ZL 1RZ8A 2J21A 2W94A 5JR1L 4R2GB 5AVQB 1CD1A 1HTYA 3C08H 1MVUA 3UTPD 3ZDWA 1WYJA 4F7EB 5IJBC 4P46C 1OM3L 4NIYE 4N2FA 3ILEA 4OR1A 4MQXD 4X83A 1UA6L 4ANUA 3QFDA 4RQQB 1EO8L 3SEPA 4QWWD 4JB9H 1OAZL 3SDDD 1FFRA 4FI7A 1DQKA 4IOFC 2FECL 1SDDA 4KKAC 4OZFH 5TK4A 3VFUA 2BNQE 1WC7B 4RGNC 1C9SA 4CADA 1GGBL 3Q0HA 1TQCB 3MV7B 4GKSB 3TT3L 1BWWA 1FDLH 4KUCD 2ZKHH 5E6SB 3U7AA 1PAMA 4F3FB 2GFBA 2QQNL 4FMVA 1YN7A 3MGOA 1JF1B 4OAWB 4OSUL 3HC2A 4X6CA 4XP6H 3X14A 1C5CH 2WLMA 1ORSA 1C5DA 1KYUA 3QIUB 4QHUA 5F93C 5FKPA 3SD5A 3VI3A 3G5ZA 4XBPA 3T0WA 4PJGF 4XNYH 4HKJA 1IGML 1EJ8A 4M1DL 3AWFA 2P5EA 2W91A 3O0RH 1JPTL 2DB8A 2DWXA 1KXVC 5KYWA 3A6BL 1BOGB 4YHNB 2RMNA 4XMLL 3COOA 5IJVA 2N0MA 4MAZA 4GXVL 1ZT7B 5I0ZA 1CBVH 5M94B 3WNLA 3U30C 1Z9SB 2FYYB 3DETC 4OIIH 3FFCA 3HS0B 2I32A 5DJ0B 3ZMRA 2XZQL 3CH1B 1NUGA 2WW8A 1UFUA 3MFFB 4MA1C 3VFWA 1BXUA 3W82A 2PPDA 5DUBA 3Q2CA 1U6AH 4L5FL 5ITBL 1VIWA 1DBML 4A67A 4XNQB 1NCWH 4XP1H 1IGIL 1IM3A 4MXWL 1ZS2A 4NT6B 4MCZB 3UGUA 1JFQH 4IS6A 1ZRUA 3V4VL 1T6WA 4JFPB 2ATPA 4WO4A 4A7GA 5AG8A 1YEHH 5J6HB 2BVOB 2HG5B 1F18A 2VKWA 5G4OA 4AV4A 4G3YL 3O6KL 1F4YH 2YQGA 4Y16B 5EO0B 1BM3H 2WIIB 1N26A 3OHXB 3V4VA 3L3JA 2VXUL 3LDBC 5AVXB 2VN7A 1UB6B 2C9AA 4MJJA 1RIUL 3V6OA 1UZ8B 4LPUA 1DDTA 3U4KA 1OD9A 5HYQB 2W81C 3MZGB 3QDJD 2XBDA 2AEPH 3RDJA 3C2AL 3TNNB 3WDJA 1OB1B 3WFEL 4U6XA 4RX4A 3T09A 3QEQD 5E24E 2CGYA 3EJSA 5KOMC 4POUB 4ICXA 3T6QC 4A7TA 3VJ6B 2VDPL 3QDGB 4GB9A 3VG0L 3WFCL 1UQSB 2BLFA 4FG2A 3PABA 2WKOF 4PJAF 1GYUA 4GAJH 4LSTL 4HS8H 3KPLB 4HQQL 5C07A 2ITEA 1X7SA 1X9LA 4KVCL 5D2NE 3FQ2A 2J2ZB 1JHTA 4KPHL 5EU5A 1JHKL 2HKHH 3AXHA 3L2LA 1YDPA 3T8XA 5IB1B 1HXYB 5EEXA 1KCBA 4YNYB 3D85B 4LLMA 4EQ3A 4JFYA 1GZHA 5HPOA 1AZNA 3FONB 3QG6B 5DS2A 5HVFB 4UM8A 4QRRA 4IYKA 5GRWA 3B7SA 2Q3ZA 3LKNB 2E46A 1LO5B 3D50A 1LEIA 1DJZA 3VFPA 3HEIB 4M5SA 4AEFA 5BOPA 1QFWI 3MOQA 1D5ZA 2ZJSL 3IJSB 4N0CC 5KVDH 4CN4A 1FYTB 1OV8A 4LCWD 1A2YA 3U0PB 4PJDA 3MRRB 3VO0A 1JWMA 3Q5TA 4L8CB 4NFDA 1NDMA 5F8QC 5T3ZH 1RZ8B 1YCSA 5JR1H 5CKGA 4FYTA 4IRJA 3M7OA 5EO9B 1CD1B 4HHWA 3VG9B 1MVUB 1L7IH 3WE1A 1UA6H 1YUHA 1S6NA 3G5WA 5DXWA 2CHDA 4YDIH 3RWFA 3QFDB 2AXWA 4BGDA 3FH5A 2J8UF 3IVKA 3FUJA 1NSNH 3N42B 1K8IA 4CDGC 1QSFE 4HEPA 4JAMA 1E2WA 2WXIA 4RFNB 4I9WD 1SDDB 1CFVH 4DK5A 3VFUB 3C09B 4DP9X 1AGEA 2WPGA 4ZAKA 3D0AA 2AABH 1GGTA 2WVSA 2YGVA 1GGBH 3EDFA 3T9WA 1V3MA 3BAIA 4QXUL 4X5XA 4Z0XA 4CADB 3TT3H 1FFPA 4I87A 3B83A 3GHPA 3ESUF 1U36A 3MNWA 2GFBB 2QQNH 5HHPA 4ODTL 1AO7A 3K7UA 2J1YA 1XV8A 4OSUH 2AQRA 43CAA 1YN7B 3MGOB 3X14B 4AV5A 5KSBF 3ARFA 4X6CB 4DPCX 1C5DB 5FKPB 4QHUB 1WHOA 3VI3B 3G5ZB 2CXGA 4XBPB 1IGMH 4M1DH 4HKJB 4PJXE 2P5EB 4CKVX 1A66A 4PGDA 4K7PY 2XX0A 2R0WH 3TONA 3H1ZA 1CTOA 3A6BH 5KYWB 1UT9A 3M45A 3VQLA 4UT7L 4HMDA 5IJVB 3ULUC 4YE0A 2NUPA 3CVDA 2PP7A 5F71A 2X0UA 1IBDA 1A7OL 1PBYA 2NY4B 3EAKA 3VMPA 5A3ID 1D5RA 3FJTA 3FFCB 2HTLC 5BS0D 4IBUA 1IFRA 3TZVD 3Q8CA 4R26L 4F15C 1L9TA 2DWYA 1NZRA 3C60A 3HRPA 3LIZL 2KYIA 3VFWB 1H3VA 3MRKA 5DUBB 2C5DC 5LDSA 4L5FH 1XH2A 5ITBH 3IXTA 4JPWL 3H9ZA 4JR9L 4PRNB 1IGIH 3OZKA 1D5XA 3EDKA 1F97A 1IM3B 2EH7L 1QA9A 3QJHA 4MXWH 2X4UB 1L3WA 2EEDA 4IS6B 3OG4B 2ATPB 4WO4B 1PD0A 3LIZA 4PJ6A 5T5NF 4EVNA 5LDUA 1OAYL 1VFOA 2YBGA 4AK2A 2V9UA 3O6KH 1YEIL 4G3YH 4WI2A 2RTTA 2K1MA 2VDRH 4FGMA 5IJCC 1RFDL 2VXUH 3E2HC 2JH2A 1PG7W 3L3JB 3V4VB 1F1AA 3ESNA 3ZRFC 1AQKH 4BE5A 3DRTA 2BO0A 5GRZA 4AQAA 4UU9A 4Y2DC 3U48A 3V2AR 2X9YA 4U6XB 5EUOF 1M6UA 3QJRB 3JWNH 3RA7H 1EAPA 2QSTA 3OAYH 4RMUA 2VDPH 3ETSA 1UZ6F 4LP8A 5DC9B 3NAAH 1KSRA 2ZYHA 5D2LE 4N22A 4LSTH 3PABB 1PLBA 4HQQH 2Y2YA 2UZPA 1UOLA 2VLMD 3VD1A 1HZHL 5C07B 3GWJA 5IK3A 2ED6A 1UH2A 1ZK5A 4KPHH 3DJRA 4FXGC 4RA0C 1JHTB 4HWZA 4H88L 5EU5B 3K71A 5TTRA 1YDPB 3T8XB 5A2BA 2XA3A 2VDPB 4JFHD 1ZXKA 3NIDF 3ROLA 3LEXB 3SKUD 4LLMB 3LNIA 4JFYB 4UM8B 4QRRB 3DVGA 4RETB 1U33A 3ZIMA 2HUHA 1LEIB 1WA0X 5LGHL 4TNVF 3VFPB 4XMKL 3T08A 1D5ZB 3KL3A 1DUYA 2VLRD 2ZJSH 1NMAH 1VJSA 3T6ZA 3GLEA 1ZJAA 4PAZA 3VXSE 4UMGA 4Y5YA 4UQBA 3RFZC 3TEZA 1DVZA 2I5YH 3ATAA 4NQCE 1A2YB 4UB0L 4X5RA 3GSOA 4PJDB 1JWMB 4B9KC 1NDMB 3BQUD 3P11H 2X3BA 3U83A 4WFED 3IGAA 3BIBX 1G9MC 5EIIA 5SX4H 4L18A 3S48A 4IRJB 2H0PA 4UCFA 5ICUA 4ZZKA 4HAFA 2H7WA 3QYNA 4OFKA 3DA0A 3PUCA 1YUHB 3GJFK 1S78D 3OHMB 3L3KA 3RWFB 4QRUA 2ICWJ 3IVKB 2FECI 1K8IB 1BHGA 1KEGL 3OB0K 3BESR 1KIQA 5PAZA 4JAMB 3NQKA 4MS8C 5IGXL 2K78A 3CLFL 4ADGA 4ESKA 1YUKB 4ACTA 1MUJA 3CE1A 5D6DC 1AGEB 3F84A 4ZAKB 1SJHA 1FE8L 3G6JA 1VESA 2ZQKA 5HDWA 3ZKMD 4X5XB 4Z0XB 1FFPB 4FFYH 1WCBA 3KS0H 1GIGL 5DI8A 4ZXBC 2J73A 1W72A 1UWGL 4L4JA 4MB1A 5C71A 4N6RA 4ODTH 3NSJA 5HHPB 3DMMA 1AO7B 1XH0A 3Q3GA 4BUQA 4E5XG 5KBLA 43CAB 2MSPA 2DQUL 3ARFB 2Y07L 1HL9A 3QZWG 3MDJA 4XB8A 5CJ8A 5TPWH 3UYRH 1UATA 2NY0D 2VLKE 1VHPA 1O75A 4TUUA 3F83A 5CBEA 3TASA 3CU1A 1XGTA 4FXKA 4PGDB 2JCCA 8FABA 4DKAA 1LNUA 4YVNA 3VXUD 1S9YA 2VGLM 3AREC 4UT7H 4P2QA 2JB5H 1VCBC 2WLZA 1ETJA 4AM0A 2NUPB 3ABZA 3BZEA 1XIWA 3EZJB 3ALPA 4RCAA 4ADIA 5E6RB 4R26H 3RGVD 3KEHA 2BRQA 4XPFL 4TUOA 3LIZH 1LE9A 1HKLH 3C60B 4HXAH 3MRKB 1XX9C 3IXTB 3FCSA 1BVNP 2EH7H 1D5XB 2WQXA 1IGCL 1QA9B 3QJHB 1H9DA 2X3AA 1MCCA 3PJLA 5F97E 4Z7WF 4KKNA 5CGMA 2CNYA 4EVNB 1OAYH 2F58L 2BIHA 4ZMNA 1YEIH 3G6AA 1RFDH 1W9XA 1WIOA 2F74A 2PP8A 4AIEA 4ONOA 3RX5A 3VRLF 1MQ8A 3GK8H 4YHML 4UZUA 4NN7B 2WNXA 5AAMA 5H37A 4NRYA 3DRTB 1AXSA 1CLVA 3QPKA 5IEHA 5IQOA 1E7UA 4AQAB 4UU9B 4XX1G 3D07A 3A3YB 1IO4C 4JX0A 5I1CL 1H6FA 3I3DA 2Z35A 4Y5XC 3GS0A 1EAPB 2G5RA 2MHAA 1YMME 3FTUA 3QC5X 4M5YL 2IALA 4P46D 4KKRA 3SPHA 4J1UA 5GRUH 2SODB 5IK3B 4XVJH 2B16A 3HHSA 4H88H 4HWZB 4Y9GA 3X17A 2JSFA 3K71B 4H8UA 1OCRB 3ROLB 4IOFD 4D9QE 4KKAD 3QFJE 4BD4A 5BRZA 5HXMA 3PAZA 3SDXE 4CGTA 1JZHA 2H0JA 4M7ZC 4RGND 3DVGB 4XOBA 3VD7A 3SO3C 2ETWA 4GW5A 1GOFA 3MOBL 5F6IC 5DZLA 1XF5A 3ZZQA 1TSHA 5LGHH 1BVLA 4LCCA 4PLNC 4P5SA 4EXPX 5DHVA 4EBQL 1VEPA 3P9MA 1HNFA 1DUYB 4H20L 1N6QL 4XP5L 1J1OL 5JIQA 1WZAA 2IH3A 3OKOA 4GEIA 1USQA 3M6DA 4PJIF 4UB0H 1YC7A 4Y5YB 5FGSA 3VQ1C 1IC5H 2HRPL 3GSOB 1Z7JA 3GPEA 1OGAA 3FRPA 2UY7A 2Y69B