1YLBB

Nmr solution structure of the reduced spinach plastocyanin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Plastocyanin, chloroplast
publication title Structure of the Intermolecular Complex between Plastocyanin and Cytochrome f from Spinach.
pubmed doi rcsb
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ylbB00
2XX0A 3FU8A 1KDIA 2HRHA 3UGEA 5B1JA 2PP7A 1MDAA 2CALA 4F2EA 3DKHA 4KNSA 3WIAA 2XXFA 3CVBA 2XVBA 2Q5BA 3QQXA 4ZK8A 2BHFA 4AKQA 2YAOA 3FYIB 1SF3A 1HAUA 1ADWA 1EZLA 1NWOA 3S8FB 1B3IA 1AZUA 1SDDA 4HIPA 1PZBA 1NIAA 1AAJA 1EHKB 1XMEB 5B1BB 1JXDA 3S3DB 1NIDA 2WO2B 1AS7A 5AKRA 4YSRA 2BP0B 2XU9A 1NZRA 2VM4A 2IDUA 2XXGA 3UABA 2I7SA 3OMIB 4FAAB 5IY5B 3SQRA 4F2FA 5TK4A 3D12B 4E9TA 1OCOB 2XWZA 3HB3B 4KO5A 5D4JA 3FPYA 3QJQB 1X9RA 2IH9A 2GC7C 2ZOOA 1L9QA 3KW7A 4M4RB 1FWXA 4GP5B 2I7OA 2IH8A 1GY1A 2OCCB 1GYCA 2Y1AA 2VN3A 1IUZA 2YAFA 3X1FA 4F7KA 3UACA 1YLBB 4DP9X 4NB7A 4RH4A 3NJFA 4YSEA 1CUOA 3WKQA 2GSMB 2W88A 3NSFA 4K9JA 1L9TA 3FSAA 1ASPA 3ZDWA 1PF3A 1MZZA 4QLWA 4KOCA 2PCYA 2VW7A 1HFUA 2XV3A 1AACA 3AW5A 2N0MA 3TASA 1J5CA 4YSQA 3HEIB 1T5KA 1CYWA 1OCCB 2DYSB 1AOZA 3T6VA 2XLLA 1BXUA 1OF0A 1PLCA 1J5DA 5ANHA 1PNCA 1A8ZA 3WKPA 3PLYA 4HCGA 1AZRA 1J9TA 2HRGA 1BXVA 1OE2A 1JXFA 3IN0A 2HX8A 2PPEA 3WNJA 4CSPA 2GC4C 4KNTA 1OV8A 4L0PB 1QLEB 3OMNB 1ZIAA 4G71B 4ENZA 5I26A 2BZ7A 1SDDB 3CVDA 1ET7A 4GXFA 3L45A 1ET5A 4PAZA 1JZFA 1NIBA 2YAPA 5F7BA 1OE3A 2AVFA 3T9WA 3EH4B 2ZWNA 4A67A 2EIJB 3FQ2A 2FWLB 4DP8X 4Q89A 4WTQA 1PLAA 5I5MA 2OJ1A 1E5YA 2E86A 2FQEA 5A7EA 3NP4A 5EHFA 1ZPUA 3CDZA 2IDTA 2YARA 4AI7A 2VW4A 2Y69B 4A68A 1ETJA 1RKRA 4HZ1A 2PPCA 1L9PA 1PNDA 3CG8A 1WAEA 1MG2C 4UF7C 3X1GA 1L9OA 2GHZA 5D4IA 3IE9A 1ASQA 1TKWA 1JXGA 4WKXA 3FU7B 1SHWA 2YAQA 1ASOA 2MRYA 4KOBA 2NRDA 2P80D 4E9RA 1V54B 4BDVA 2YAEA 1JZGA 3EH3B 3IEAA 1SFDA 4G70B 1GS8A 4A2DA 2FT8A 1SF5A 3BQVA 4PCYA 2GI0A 3ABLB 1IBYA 2PCFA 2BP8B 2CJ3A 1RZQA 3ABMB 2PLTA 2VMJA 1OCRB 2W8CA 2YXVA 3NJLA 4HHWA 3T6XA 3DIVA 3QJRB 2PP9A 2AZAA 1BQ5A 1A4AA 2B08A 3NJKA 1NTDA 3NSDA 1SHXA 4GYBA 1ILUA 3WNIA 3FSZA 3JTBA 1J9RA 2TSBA 4YVNA 2HX9A 3PXLA 2DYRB 5AFAA 9PCYA 2QDVA 4HAKA 1SJMA 3FU9A 2FT6A 1ZIBA 4GY4A 2GIMA 5PCYA 1JVOA 3PAZA 1URIA 2J56A 2WO3B 3G5WA 1DZ0A 3C75A 3QJUB 3WG7B 4BWWA 1JERA 1KCWA 2TSAA 4KO9A 1OE1A 3X1NA 4E9VA 7PCYA 1GS6X 1VLXA 2JKWA 1PMYA 3DTUB 2VW6A 1ET8A 1BAWA 1AS6A 2H3XC 2DWTA 4DP2X 2LLNA 2UXTA 3UAEA 2EIKB 2FQDA 4P5SA 4A2GA 1BYOA 1IBZA 1W6LA 3SBPA 1NDTA 3KW8A 3OD3A 4YSTA 4YVUA 5F7AA 1TEFA 1L9SA 4G7RB 4DP6X 3ZBMA 3TA4D 3QJSB 1KGYE 1NPNA 1UATA 3NP3A 4HHGA 2ZXWB 2IWEA 2X87A 3AZUA 4KO7A 2BWDA 1L9RA 5B1AB 1AG6A 2P80A 1PCSA 1WS7A 2X88A 2QPDB 4KNUA 1NIEA 1TEGA 3FQ1A 5B7FA 5E9NA 1KV7A 5I5IA 1JZHA 1WA1X 1NIFA 2A3TA 2I85A 4UAHA 2H47C 1PLBA 1ZDQA 2RACA 2BP0A 1A4CA 1BEXA 2VSMB 2IWFA 1NICA 2BW5A 2VSKB 3NJIA 1JZEA 2IWKA 3FYEB 3QPKA 2QDWA 3PAVA 2PP8A 3CVCA 3GXUB 3AG1B 3SBRA 1AZNA 3ERXA 3UAAA 6PAZA 5B1KA 4AKPA 4G7SB 4Q8BA 1CURA 5I6LA 3V9CA 4E9XA 2ZONA 2MTAA 1PY0A 3ASOB 1PAZA 4TXVB 4E9SA 3FQYA 1N68A 3H4HA 1J9SA 4A2FA 4DPAX 4AKOA 4G7QB 1KCBA 3S3BB 3T6WA 3N2JA 3FSVA 4UANA 1BYPA 3AG3B 3EF4A 2XV0A 1GY2A 1N70A 2AANA 3ASNB 4A2EA 4NAJA 3N55A 1KYAA 2FQFA 2BWIA 3S8GB 2DWSA 4DPCX 2XUWA 2JXMA 1AANA 2IDFA 4DP7X 4N8UA 3ABGA 8PAZA 4JHVA 3NJJA 1HAWA 1X9UA 3SBQA 1XB6A 2HX7A 1AQ8A 2UXFA 2YQBA 1KDJA 5B3SB 1F56A 2PPDA 3AG4B 4X4KA 1ZV2A 4JKNA 2HXAA 3U25A 3UADA 1GW0A 3TBCA 2R7EA 2YXWA 1NWPA 1A3ZA 3NSCA 3MBWB 5LDUA 3IN2A 1GSKA 5I6MA 3PCYA 1JVLA 2J57A 4GP8B 3GYRA 3FT0A 4JHUA 1SNRA 4KO6A 1E5ZA 5I6NA 3ZIYA 2FTAA 1TU2A 1QHQA 1QNIA 2IAAC 2GBAA 3AG2B 2XYBA 1NINA 3NJHA 2JFCA 1J9QA 2J5WA 3ZX1A 1FA4A 1JOIA 1AZCA 1MZYA 2QT6A 5PAZA 1DYZA 1AG0A 1FFTB 1XB3A 3BVDB 4MFHA 1CC3A 3GDCA 4YSPA 2QPEB 4GP4B 1PZCA 1V55B 5I6KA 1JZIA 3V9EA 4AX3A 3TU6A 3OM3B 5B7EA 1R1CA 2AZUA 1BXAA 5B7MA 1SFHA 2CBPA 4BXVA 4DP5X 3NJNA 5I6PA 2UX7A 3IBOA 4YSCA 1ZDSA 5D4HA 3RYMA 1I53A 2VM3A 2DY2A 3NYKA 2XV2A 4DP0X 2CUAA 1AZBA 3CDZB 4YSDA 3WI9A 4A66A 3JT2A 1RCYA 2HZHA 2PPFA 3NJMA 2YAHA 3FU7A 1ILSA 2CAKA 5I28A 1IKOP 1IC0A 3FS9A 3X1EA 3NSYA 3PAUA 1AIZA 7PAZA 3EHBB 1WA2X 2BO0A 4NERA 3TBBA 3AY2A 2GB2A 2OV0A 3FPXA 4A2HA 4YSSA 1PZAA 2EILB 1KBVA 1W8EA 2XX1A 1AR1B 1ID2A 1M56B 2BW4A 1E67A 4W9ZA 4E9WA 2UXVA 3QJTB 1E30A 1JZJA 2BP8A 4DPBX 4BDVB 2FJSA 3T6ZA 1A65A 1BQRA 2HLEB 1E65A 4YSUA 2WSDA 3CZUB 4YSOA 4AZUA 4CSZA 3S3CB 1BQKA 1M57B 2PPAA 2J55A 4BXSV 2FT7A 1OCZB 2BZCA 2EINB 2Q9OA 2R7EB 4QKTA 1CYXA 3ABKB 3OMAB 4E9QA 1M9WA 4DP4X 4HCFA 1W6WA 4G72B 4P5RA 1GS7A 3NJGA 3MX0B 5I6OA 5TK2A 2DV6A 1XB8A 1WA0X 6PCYA 2IDSA 4BWUA 3NT0A 1RZPA 5FC9A 1OOWA 2YAMA 4W1TA 4DP1X 1MG3C 3QJVB 4BWTA 5B1JC 3H56A 2FNWA 1KBWA 4BK5C 1NPJA 2FQGA 4M3HA 2H5UA 5I5JA 2EIMB 1GR7A 1WS8A 4YL4A 2CCWA 5AZUA 4YSAA 2AFNA 1A4BA 4E9YA 1V10A 4HCIA 4EF3A 3PPSA 3X1BA 2IDQA 2UXGA 3T71A 4N4YB 3EH5B 3OQRA 2B3IA 4HALA 3X2QB 2UX6A 4FA7B 1AS8A 3H4FA 3FSWA
chains in the Genus database with same CATH superfamily
4FLSA 2WXFA 5DGQA 1F1GA 2JKLA 2UY6B 4BUGA 1VIWA 2F0CA 2XBTA 4YZFE 3WMPA 3EIFA 3TN0A 1YEGH 1WC7B 3MGTA 4AYBA 1WZ1L 3P0GB 1T0NB 4YDJB 2ORBL 3D0LB 2F74B 3QNFA 3UTSD 4R4NC 4EDWH 4D0DA 2ESVB 4PG2C 3MUUA 4GI9A 4IW4C 1ADQA 4APXA 4DVRH 5EPMB 2OXGB 3CPLB 4OF8A 4WNSA 4QY8B 2DBJA 4TUKH 4YC2B 1OQOA 1VEPA 1EHKB 5K39B 1I1CA 2BIPA 5F6IC 1QSEA 3WFDH 3H9SA 1A6AA 1JTPA 2VDPB 3BQUB 3CD4A 3BZFA 3PXJA 2VQ4A 2PCPA 3CFBA 5G5DB 4QXGL 2MMXA 4K3EL 1PAMA 4U31A 4X9HA 3UTQB 5JXEA 4DHLA 4X5QA 4JFDB 2A6KB 4UTBH 4DTGL 4JFHE 5GS0L 2VMDA 1D5IL 1SLUA 3WMSA 4EI5D 3NMEA 5KJRL 4ABWA 4IKIA 1G1CA 1K4DA 4Z5RA 1HH6A 4TVPD 1ZTXL 1IAOA 4Z0XB 1YEDB 2CIIB 2BOBA 1IM3B 1LP9E 2AK4A 4P5MA 5D96B 2X3CA 3BPOB 3VFVA 4YDIH 4XNUH 1HOCB 3SGDH 5C71A 2A77H 4N1CA 3G6DH 3WS6A 4QHUA 4KX9A 4NZUH 4RDQG 1UQSB 4LRNH 4XOCA 3N42F 1KGJA 3QDJE 1F4WL 2WCSA 5KN5B 3ZUNC 3IETA 1PKOA 1UOVA 2EDKA 3VXUA 1DQDL 3HEIB 4MMXA 3ZDXE 1NGWA 2Q76B 4P2OB 3FL7A 3CLFH 2KQNA 4ZMXA 1HHKB 4O00A 3BC9A 2A83B 4J6RL 1NL0H 5L2KD 3HZVB 3F12B 5J12B 2WP3O 1NGYA 4RAVB 4YWGH 4BQBA 2DQGH 4HFWA 5CZXD 2ZAGA 6TAAA 3RPIA 2AP2A 3G5XB 3DYMA 3WKPA 3PQYB 1BA9A 4AM0A 3BN9C 4H8QA 4Q2ZB 2XWDA 5C07E 1KJMA 1I9IH 3V6OA 1NOAA 3RTQA 4TUUA 2WINA 4FMKA 3QORB 4ZUWA 5SV3A 5D1ZB 3TZVD 5EUOE 3VXSE 2WANA 1Y07A 4D8PA 2OP4L 2YPVA 5I26A 4EO5A 1FC2D 3QQDA 4GXFA 4MMZC 5DVKA 5A2BA 2Y1VA 1JZFA 1CTNA 4PJ8A 4CU8A 5MP6H 1YDPA 5IVXE 4P9HC 4W9GC 3TN0C 3PUCA 4I13B 1OE3A 3KWTA 1SPDA 43C9B 1UENA 3O2WL 4MA1C 5EU5A 3V7MA 5I23A 1EGJA 1MI5E 3G08B 2DICA 3II2A 1BM7A 1ZANH 2XQBH 5E03A 4JJ5A 4X99A 4GOSA 2G9HA 1BVNT 3O3DA 4PJIE 5JR1H 4KVPA 3W38A 3P4NA 4WSGA 5I66A 1CGTA 4PJXF 1A7OH 5IBTL 4G82A 4FJYA 4ZODA 3RVUD 1QAWA 4D0BA 4FQXD 4NKIH 4YR6B 2FD6L 2PYEB 4N0YL 5K1VA 5IGXL 4FG2A 2WWMD 1XH1A 1G5AA 3KPRD 1P84J 3GMQA 3BCFA 5BVJB 1GMIA 2VABA 4HLZG 3T8XA 2IDCA 5FUZH 4UAOC 4I77L 2QADC 2YEZA 4X6FA 4IIQA 2LFEA 2P80D 3PY9A 2ZE0A 3TCTA 4XCNA 2YAEA 3CSBA 4DW2L 1JGEB 2XACC 3K6IA 1A7PH 2EDJA 1RU9H 3K3QA 3VI4F 4BRVA 1BD2E 1J0KA 1WTGT 2BSRB 2CXGA 3GMMA 2Q0ZX 3AQZA 3KLLA 3RGVA 2NSMA 3U4EB 2B1OA 3EYUH 5K9KA 4N2DA 5D7IE 4XO9A 2H9GB 2BP8B 2P24A 1JSYA 3FBQA 4CN4A 1JGLL 3I02A 3NPZB 1E4XH 1C5CH 1TETH 4HP5A 2DQIH 4M43H 1CYGA 2EYTB 3V5DA 4CKQA 3QB7C 3WNIA 1HHJA 5EOTA 3G5YA 2FUQA 3N1FC 1MFAL 5FW8A 1SLXA 1YJDL 3GKZA 3LXAA 1EUTA 2QDVA 4RQQB 1SYVA 4CKVX 2CKNA 5D2NB 1R47A 1KCUH 1Q8MA 1OD7A 3BD3A 3UIYA 4YXKL 1OP9A 1UA3A 2Z4TA 2EEDA 2WO3B 3MOBL 4R2GC 4NO0D 2JKJA 3AREA 3ZTJH 1T83C 3KVQA 4B95C 1XZ0B 4WFFE 2X09A 4K9EL 4HJ1A 4Z7VE 2X9ZA 2XN9E 3GIZL 3QIUA 1IE4A 3RBGA 1RMFH 2G5BA 2VUKA 2YOCA 3F6IA 4ZQTA 4HKJA 1T22A 3ZYOA 3BDYL 2FQDA 3RTQC 2ZYSA 5IUCA 1E28A 3DHPA 4GQZA 5KBDA 3FTWA 1D5ZB 4YSTA 2HKFH 1NUFA 1BZ8A 4KQ3L 4OIIH 4XB8A 2V9TA 5BW7A 4Q97A 2MCG1 4LOUD 4NBZB 3T6QC 2GAZB 2WZPA 1MCWM 3OGCA 3HS8A 4HJSA 5CFAA 3HCVA 1XF3A 4PYHA 4YX2H 4OR1A 1I8AA 1LEGA 4PJ8C 5T5FA 3NP3A 1MSPA 1MWAL 2RQ8A 4XTRD 3B2MA 5D71H 1FIGL 3T0EE 4J4PC 4LGPB 2VXQL 2COVD 1QNZL 3O8XB 1Y1UA 1FG2B 4OFVA 1G9ML 3MAWA 2DQEL 1TSRA 1T7ZA 1D5MB 1WFMA 4FQ1L 1FE8H 3CTTA 1KV7A 2KPWA 1KIUB 2A3TA 3MJ8B 3NFNA 3BGMA 4JN2B 4Z78A 3STLB 4ZW5A 1C1EL 2CGRH 4XMVA 3L1OH 5GRZA 1TLKA 3DXAE 3HI6H 5AB1A 1B6DA 5EBMA 2A6JB 1BEXA 5DZOA 3WAJA 2TRYA 1GA2A 1JWSA 2OCFD 5DA0B 2NNRA 3H3BC 1WYJA 2WJ5A 3AY4C 2IAMC 3FYEB 5FYKU 1T7VA 2BNQE 3FRPB 3FB5A 1P7QD 1QW9A 1UB5B 3EFOB 5ENWB 1ZLUK 2IV9A 1AZNA 1CTMA 4LSRH 3UCQA 3MV01 3VWJD 3GK8H 1NAMB 1UOWA 2E7MA 2VLLB 5I2IB 4AL8L 5HHMD 3KR3L 4KGLA 4ZG1A 1N59A 2BY1A 1PY0A 4G83A 2NY3D 3K4AA 2ZCHH 2P52A 3VXPB 3QCUH 4LBAA 3QJXA 4NOFA 1KB9J 4FGMA 3VMNA 5FV2A 3RGVC 1YYLH 3LZFH 2PXYC 3PXHA 4ZXBD 4KMQA 2K8MA 2WPGA 4V1DE 4YDVA 4PV9B 1GY2A 4O4YL 4NAJA 4OFKA 2GFBA 2FE0A 3OZLA 5DURB 1KYAA 2HLAA 1ZLSH 4I2XA 4GIOA 4QEGA 2C9VA 3TWCL 3I9GH 3QS3A 2IH3A 3GSXB 3N1QC 4DP7X 3NAAH 4NO3A 4MD4A 4P57B 8PAZA 1REIA 1KEMH 1TO4A 3G5VB 1AIFB 2YBRA 4OAWB 4G42B 5D2LE 5A16B 5L6YH 4J7RA 4Q52A 1ZGLP 4B9KC 5F6HI 3VGEA 1EJOL 3HIZA 2W0KA 5L4MA 3ZKQD 25C8H 5I6MA 3U0PB 1DP0A 2XXCB 2VITB 3SKOB 5F7KC 2YMXL 3CHOA 2EXYC 1YA5A 4Y2DC 5IQ9B 2DI9A 4M3JA 1E2VA 3ULSB 4Y9BA 3SJVA 4OZIB 1L7TH 4AEIH 2C4FT 1MHHA 1FJ1B 4DO4A 3P4MB 1E40A 2J5WA 5DJ6B 3ZSSA 1JOIA 5HHPA 3QULB 4LDOB 3PL6C 2IPKA 1NJ9B 4KJPC 4LXFA 3BPLC 4Y1TA 1UB6B 3OKLB 3V0EA 1DVFA 4BZ1H 1VCBC 4U1JB 2RR3A 3MA7B 2H41A 5ELIA 3V9EA 3P0YL 3RZCB 4WI8A 5I0YA 4OIBA 2WKOA 3QUKB 3IKCA 1HINH 4UDUB 3SQOL 1SFHA 4IRZA 3NJNA 2QV2A 1K85A 2ZF8A 3LKOA 4Y16C 5IV2A 2XQYK 4PMFA 1CI5A 2ZG1A 2I9LB 4I0KA 4DP0X 5FEBA 3EJCA 3JTTA 3MACH 2A1WH 1ILSA 3PWJA 4JFZL 1WAPA 4LKXA 2NY2B 2QR0B 4LOEA 3WIIH 3A6BH 4XMZA 2CHZA 2J2ZB 2C1PB 1AGDA 1RP8A 1PW3A 1B4JH 1QBLL 1WP6A 3BGFC 3N0PB 2VLJD 5IFAH 3HI5H 3BH9B 1W8EA 1M71A 3OJDA 1VJSA 1E67A 5DJXB 3HA0A 3MOAH 4OFPA 3L2NA 4JKMA 1INEH 4KKQA 2BIOA 3B2DC 3Q43A 4KX8A 4X6BA 5E8PB 1QSFE 3CZUB 3IXTA 5FHBH 3HNTL 3H6AA 4FNSA 4WU7B 5C0CD 2PWDA 2EO1A 4D9LL 2XA8H 2FT7A 1BGXH 3AM8A 4JY4A 4QNPF 5TTRA 3ABKB 5I9QC 1RH8A 2JLLA 3HZYB 3FFDB 2GUOA 1I8UA 2PTTB 5DRZA 5F1IB 2W07A 4FXTA 5I1IH 2ZUQB 4FNUA 1NUGA 2FSEB 2DV6A 1XB8A 5C0GA 3QQ9C 1MFVA 2WVUA 3FCTA 1YO4A 1KYFA 4CBZA 4QR7A 4IMLB 5FYLE 3G6AA 4N25A 3NPSC 3H56A 3N85L 1WTLA 1YPZF 1OTSD 3P4OB 4XVTH 2Y22A 1PSKL 3U0TB 3ZOAA 1NDGA 5DHYA 1MQ8A 1ZA3B 2OULB 2FIKB 3KH4A 4PJBB 4LB8A 4R7DB 3ROLB 1P4LB 1ERNA 4EQ2A 1MRCH 1HWHB 4MSWB 5CJQH 3I9PA 3LKQB 4YQXL 4HCIA 2DQTL 3FU6A 4KTYA 3HRZA 2Z7UA 4XX1E 1QLFB 3HC4H 1KIPB 1IT9H 3ULVL 5K69A 8FABB 5LXVA 3AS3A 4TOYH 4X5PA 5F7HA 1M7DB 2WYTA 1JHTA 3ZDZB 3REWB 1AS8A 3IGAA 2C34A 3FXIC 2QGCA 4ETQB 4NQEE 2HRHA 3MRFA 1P1ZA 4Z23A 4R83A 3IAQA 3B9KB 1H5BA 1WIPA 4GRWF 1AHWA 2Y07L 1QHPA 2IGLA 3UL4A 2BVYA 4OGAC 3HHSB 4OZHB 1F90H 1CFQA 1E43A 5DEGB 1DVXA 5HJBA 3TBSA 2AJSL 4V11A 3CSTA 4W9EC 1OL0A 2ZUTA 4CMHC 1OAZL 3WXWL 5AVUB 2XZAL 1MI5D 4J2QA 1MPAH 4XXCC 5IEKA 1CF8H 5JOFB 4XZUA 2LOEA 2A9MH 3F7LA 4OLYL 1PZBA 5IMKB 3TTSA 4WNJA 4B6ZA 4G6AC 4P23B 2BIHA 4J1UA 4LL9A 2YXMA 4GSRA 4JRXE 5DJAB 5BCAA 4Z3JA 3DO4A 1FO0L 5C0RL 3QXVA 1NCDL 4XE5B 3TONA 3UBFA 5JQIB 2HN7A 3KPMA 1DJIA 1JCKA 1GPOH 1QEWA 1Q9WA 2OAAA 3V5HA 1XCTB 2O61B 2ITDA 4LAQL 4L2LA 4N8VG 4E9TA 2EDBA 1BP3B 3MJGX 3RY4A 2CO7B 3RRQA 4NJAH 4LEXL 5FYKD 4KI5D 12E8L 1JGDB 2KKQA 4ZSOA 3SDDD 2IH1A 4ZBJA 1HKLH 5IK3A 1ESOA 1IUZA 5EU3A 3TP4A 4APQB 3MRRB 3NFSH 2HJFB 3LQMA 5DFWH 2N4IA 4ENED 2I32A 2EDFA 3ARDB 1T2JA 3D8MA 3QCVH 1GGBL 3V2AR 4I0PD 3CMOH 5E99H 4Q9BA 4N1HB 1LO3L 2G2NA 4GMSH 3FFCB 3LHAA 3AM8C 2BRQA 4JRYA 3RWCB 3FSAA 3THMH 2FEEI 1JRHH 5FIEA 2AHIA 1IV8A 4GQ9L 4I3SH 2X4TA 4XBGB 1OGPA 4L2YA 5A6MA 3CN3A 3BI9X 3NCCB 4NC0B 3DX3A 4PJDE 3ZQWA 3LAFA 3NOIA 3NACH 1MLCB 1A6VH 3BEVB 3QA3B 4N2FA 1CFNB 2CZNA 1U8IA 3I6KB 4F8OA 5CBAB 4QRUB 3SGJA 4XNBA 1J86A 1E9QB 3FN0H 5DD6A 3RDTC 3FONA 1XSJA 5JA8B 3EG9A 1ETB1 3P73A 3U4BH 4KU1A 4WHTA 1OARL 3MODL 1KJVB 1CQYA 4QTIL 3SDXB 1BXVA 2D2CC 3IN0A 1GC1L 3RVTC 2VDRB 4QJ5B 4EN2A 1W8NA 4AK2A 4KNTA 4WFFD 4U6VL 4W68A 1G6RA 4Y7MA 3W9EB 5I0VA 2ARJQ 3QUZC 1UWGL 1BG1A 3EBIA 3AXLA 5JQ6L 1ET7A 4LFHD 1MHEA 3PP3H 2ZXGA 5E9DD 1ET5A 3IS0X 4UOJA 3D30A 1JZ4A 1A1MA 1X4YA 4GKZA 1UWXK 1A3LL 2VQ1A 4AV4A 4YDKH 2YBGA 2G2PA 4LCWE 5E8OA 2WK2A 2BCKA 2D9CA 1I9JL 5D55A 4OFYD 1GTNA 3HVDA 4L8SA 4KKAD 2BXYA 1BVLA 3KG5A 1IVTA 2AKRB 4HJIA 3FTVA 4ZX5A 4I88A 5DRWA 1IAKB 3AWEA 5KYXB 3PJSB 3DTXB 3PDOA 1T7WA 5J13B 4X83A 2A73B 1ETJA 3EGXB 4U05A 3JV4A 3CHQA 1T2XA 3QRLA 3DXAD 1K5NB 1IM9A 2NY1D 1V7NL 4FI7A 4YLCA 4LGSB 5IREA 3FZUD 3GZPA 4TRPL 3CIAA 3L5IA 1DQMH 2AXWA 2LTQB 1ZHKA 2F8VA 1PJWA 3R1GH 4GI6A 4PMEA 4AW7A 1DQLH 1SHWA 5TF1L 1AP2A 1JF5A 3ES6A 1WD8A 3WLWC 4E9RA 1QR1B 1L7IL 4N8CL 4BDVA 1MNUH 1QKZH 1YUHB 2ZWSA 3SOBH 1XF5A 1YNKL 2AGJL 1KNOA 1HNGA 1IEHA 5DD0H 5E6YA 1FP5A 2VC2B 3UG3A 4F7CB 1NC2A 3KYOA 4DESA 5F9JA 3EH2A 5C6WH 2G3XA 4AK1A 1BM3H 3EKCA 4PJCA 4GAFB 2GI0A 3ARYA 4YHPB 4R90H 5DD5L 4FXKB 3ZKXC 2VE6A 1CO1A 3RB5A 2XPZA 4W9FC 3ABMB 1NCTA 1X9LA 1N5AA 2R9HD 4MZRA 1C5DA 4K7PL 5AQ0A 4MA7L 3U0WL 3AT8A 1NTDA 2Z6FA 1NCWH 3K2IA 4JFYB 4PJEF 4WWKA 5T3ZH 3O2DH 3M17A 3WSQL 5BUAA 3SKUD 4LOVA 2OTWB 4XGZB 5BQDA 3WIFA 1CK0L 3TVMB 3L5WB 3RWFB 3H1ZA 3HE7B 4C56A 5E6IB 3WY2A 4OQTA 1IC1A 2WWKT 4JDVA 2KLTA 1NCAL 2EICA 4G9DA 3IJSA 4LOFA 5KTEH 1OWWA 3GMOB 3WN6A 3DTUB 5FO9A 5FGSA 1ET8A 3NCJH 5GSRA 4K5LA 1YEGL 3KPOB 7CGTA 2UXTA 4PRIE 1AXSB 4X98B 1JGUH 4S1DC 3GIVB 5H2BA 4OCMC 1U8QA 4WV1A 1CXEA 1Z5LA 4H25A 3RGBA 5HYJB 1WC7A 4EDWL 3LPWA 3RUGB 1JNJA 5CS7A 5E4EB 4D9QE 3ZBMA 1HQ4A 2XWTA 4F8TA 2PYFA 4MZ2A 4JZOB 4PIRF 1HILA 4NM4H 1N6QH 4HOXA 2ESVA 4WKZB 1EZVY 1YNTF 2XY2A 2CU9A 4QHMA 3BUTA 5EPMA 3WFDL 3HNVH 5BZDA 4XN2A 1ONQA 3ZJAA 1LO0H 3BKJL 4JO2H 2NTFB 5I1DA 1O7DC 3F84A 4FP8L 1CLVA 1ZTMA 3BQUA 4OM0H 2X05A 4JR9H 5DC0A 2HG0A 1MW0A 2AAVA 1YC8A 4UTAH 3NABH 3HS0A 4EJ1C 4IOFC 4KK9D 1TLMA 1ZHNA 1MJUH 2A9CA 4KKBD 5AZEL 2ZSWA 3JTSA 1G5GA 5FCUL 5CBEA 2BH0A 4OI7A 4HD5A 5MENA 1JYNA 4FTVB 3LKPA 2VISB 2JF1A 3V4VH 3D25B 1Z9MA 4IQHA 1H19A 5B1KA 3IFLL 4RWHA 4XC1H 3BRFA 4XNUL 3MRHA 1Y1DA 2CIIA 4FFZA 2A77L 1KN4H 3FUHA 3G6DL 3MV9A 3OR7A 5GRJH 2AEPH 3ASOB 3P0VH 5IQNA 4NZUL 3ZQXA 3ARQA 1YEIH 4LRNL 2JI3A 5DA4A 1M9SA 2W94A 5KZCD 2YRPA 1DR9A 2QKIB 4A2FA 1KCBA 1MCDA 2YZ1A 4XAWH 3UYRL 1MH5B 5EMYA 2AJVH 3CLFL 3QNZA 5BV7B 3NCYP 2WSPA 3ABZA 2G5RA 1GZPB 5A2CA 2YS4A 2Q76A 2FGWL 2NUPB 4YWGL 2DQGL 4K8RC 4GAYB 2P26A 4LASH 5ISZA 2Y7OA 3D33A 4AYDC 3F12A 3AT0A 3ENEA 3DYPA 3QQ4B 2J3SA 4PJGA 4RAVA 1I9IL 2ALWA 3BJLA 5AOJA 5E1HB 1C7SA 1KDJA 3AITA 3G5XA 5DZJA 3WEXA 3PQYA 5C09E 1MKFA 4ILDA 3RWGA 5INDB 4KKNA 4PRPE 4OI8A 1MCOL 3GMNA 4QKXB 5FYLD 2CLRB 2J57A 2GHWB 3K81A 5TDOB 4C83B 3DIDA 5C8JA 3VNYA 5EZOL 2B0SH 3UX9B 2W91A 3ZIYA 4XNXH 1CDHA 2C7FA 3CDYA 3NH7H 4H1LG 4J27A 3VA6A 3VW3H 5T3XH 3GINA 1FFRA 3ASWA 1HH9A 5JR1L 4FG6C 3FULA 4ONHB 1NLBL 4HWEL 4LPTA 2EADA 3TFBA 3HNSH 4GAAA 1TJHH 5DS8B 4F9PA 4WW2B 4KKPA 4ZFFA 1AG0A 1FFTB 1FNHA 2PTVA 1LEIA 1FFNA 3LZPA 1CC3A 3GDCA 3MSPA 2Z4QA 4WWNA 4IK6A 3CHSA 1OAQH 1RZKH 4F1SA 3KDPB 1AKJB 4GS7B 4YC2C 3CFMA 3TU6A 3L4XA 1VESA 4YR6A 3L4WA 2LAAA 3QO1B 4MNGB 3LN4B 4P5TB 3ESNA 4QRPD 1I9EA 1Y18B 3BQUC 3MBXH 2EZ0C 5FUZL 5ABDE 1IGJA 4YSCA 1SDAB 4JVPA 4OJAA 1WT5A 2X2YA 4DIXA 5CJ5A 4X5WB 4NIKB 2PKDA 2R4RH 4YAQB 3K71A 4NWUH 3KL5A 2PPFA 4RBPH 3WJLA 4NWTL 1RU9L 2CAKA 4LDCA 3EO1B 1INQB 3PJLA 2K6YA 2YD0A 1E4JA 3NCEB 2HMID 3ZTDC 3IU3A 3CZEA 5JDJA 3FO0H 2BSRA 4QOKB 3ZUCA 4FX5A 2WTOA 1TKWB 4HKXB 1AY1H 3U4EA 1BECA 1KBBA 2G2RB 5AD0B 4M5ZH 5BO0D 1AR1B 1ID2A 1IB5A 1E4XL 3KGRA 3BPOC 1HDMB 3GZOA 2BP8A 5B39G 5KBLA 4JM2D 4K0OA 1A65A 3ET9F 4UDTA 3CLWA 1ZLVK 1TQCB 3QZBA 4X6CF 3IAPA 4UV4H 1TQUA 1YY9D 4A39A 2R27A 1BQKA 1P9MA 2XC8A 4R9HA 2J55A 3CZLA 1CE1H 3I50H 2V37A 2DYPA 4Z95L 3UTZA 2NX5B 5GS3A 4DO6A 2DMCA 5DJDA 4E9QA 5E2TH 3DETC 2P48B 4P2OC 4KKLC 4HPOH 3PWPB 4TL4A 5IMMB 4PSPA 3L6FB 3X13B 1IIIA 3WTUA 4RMTA 4XPBL 1IQWL 3B7YA 4B7LA 4EI6A 3Q06A 5JUEH 5J12C 4OV5B 2HTLD 1R0AH 3DBXA 2ZOWA 2LT9A 4KHTH 1J11A 4Y4HB 4UTBA 3N44F 3QEGH 2FQGA 3LNDA 3KYNB 2HKFL 1NGPL 3WNMA 2XXMB 1RZFH 4OIIL 2DH2A 4H0GA 1QLEL 4H44C 2O6CA 3BUBA 5EORH 4YX2L 4QRFA 3QORC 5K59F 1D5ZA 4WWPA 5D1ZC 5D7JD 3R7QA 4Y4FB 1XGTA 2VR8A 5CEZE 4FYTA 1JZ6A 2IDQA 5HJDA 2XVGA 5D71L 3PRZA 1R46A 3D06A 3RX5A 3P9LB 5H35A 1LO2H 3EZ8A 4G2AA 1NCBH 3MBEA 4BFIB 3FQUB 3LQZB 3PE9A 1FE8L 4BV1A 1E7VA 5TFSH 2JTDA 3VFSB 5ADOL 4ISVB 1PY9A 3L1OL 2Y5TA 3WFBH 4DJMA 4H5SA 2I26N 3CFUA 1Z5YD 3HI6L 2CDGB 3L9BA 1FLRH 4L3EA 5F8RC 5FKPB 4M00A 2E74C 1THAA 3SQBA 3MJ8A 2Q5BA 3STLA 3RX7A 1S8DA 4ORGA 4W6WB 5CCGE 4LARH 4NQDE 5E6SB 4LFHG 2R39A 2A6JA 5B21A 1AZUA 5AW6B 3KPSE 3LB6C 4HMDA 3N50A 5HHVL 3M88A 3RI5F 3IJHB 1EFXB 3CN0A 2ZXEB 3GK8L 1WT5C 4J8QA 3VYOA 2AQTA 2HPTA 3FRPA 5SWZD 4JPVL 2CRMA 4M29A 1UB5A 1UA7A 2UY7A 1MCWW 2Q3XA 1NZRA 4KTEH 4ONFH 2GTZB 3UABA 5F7FA 1NAMA 4AQZA 2WQRA 2VUYA 2ZCHL 5I2IA 3UPRB 5JHDE 3QCUL 1OT2A 4KTDH 5GSVB 3BWAB 4PS7A 3LZFL 4RGNE 4NQQA 4JM4H 5IROA 4LSQH 4EN3D 9CGTA 4MKMA 1YZZA 3CFJB 4TPRH 3IGKA 3DMMD 1N12A 3V6ZB 3DHJA 3CQFA 4EKXA 1G87A 3I3EA 2B4CC 4M8VA 2AJ3B 2BJML 1ZLSL 2D31B 5IEHB 1OOAA 1J1XH 3UACA 5IB5B 1FGVH 4ZDHA 4MJIE 3GB7A 5SWSE 4RH4A 3KPPB 4H8HA 4ODWB 4U6YB 2B59B 4R26H 3O6FD 1KEML 5LG6A 4DWHA 2NY6B 3JWNG 2FEEL 5F3BB 1EVTC 3GSXA 2GJPA 3X12B 2WXJA 2WZ6A 2X4QB 3TEXA 1IE5A 1LMKA 1YQ2A 3QUXA 3G5VA 2X9WA 5D2NC 3GLZA 4GQRA 25C8L 4R3SB 3ZE2B 5IHZB 1MCPL 2H6PA 4KHXH 2Q1EA 4ELMF 4S0HA 4PQXA 1SOXA 4AM0Q 3HR6A 3MR9A 1GYVA 2R59A 4WI3A 5T5NG 1DVQA 3U82B 3WEBA 3MNWB 1KXQE 4L4JA 4ZNEA 1L7TL 3EOAB 4AEIL 3VVWA 4P4RB 1A8ZA 2G3MA 5CEXB 4IIZA 15C8H 1EXHA 4WO4C 1T5WB 1FNAA 1HYSD 3O9WD 2MPVA 1WO2A 3STBA 4OZIA 3C9NA 4PW9A 5D1QD 1MEXL 1NBVH 1QD0A 2JIXD 2PPEA 3P4MA 4MBOA 4CMMB 4AVJA 5DJ6A 3MCG1 1VZHA 3AAZB 1P2CB 4L0PB 3WDJA 1SVBA 4CSTA 4N1EA 3TA3B 1NJ9A 2HH0L 3H54A 3POHA 2VL5B 1SDDB 3KXFD 1UB6A 1UVQB 2IALB 1OGAE 2ZPKL 4P9HL 4A04A 4OCSH 4L8CB 1O9WA 4S0TD 1HINL 2OYMA 3L4ZA 3CHXA 3O8XC 5FYJU 3U48A 2K9UA 4UT7H 4JPSA 2X4OB 3RZCA 3WNPA 5ERWB 1OW0A 2ZWNA 2VLMD 3B3IB 2EIJB 2FX7L 3PU7A 1R5VB 1FDLL 1SXZA 1W72L 5CJ8A 1UGKA 2MSPA 4WJG3 4JZJB 2OJ1A 4GIPD 3DYOA 4MAYD 3O3AA 4HIXH 1EX0A 3EGDB 3QDAA 5DI8A 2GBVA 4ZAKA 3A6BL 2OS7A 3LS5H 4GMTH 4XXDB 4NPYB 2GJJA 1CTOA 4PH8A 1AHKA 3TC9A 1X5YA 1JPSH 2XT1B 1BMWA 3IPBA 4HS3B 2NNAA 2J2ZA 2C1PA 3EJQA 1G43A 3CIQA 2IV8A 3ZHDA 1INEL 2J44A 4XVSH 5SX5H 3FU7B 3BH9A 1T20A 3E0GA 1T21B 5FHBL 3KPNB 4XAKE 2KDYA 1V54B 4ZJ9A 2BERA 5E8PA 1NAKL 2G4EA 5C6TH 1IGIL 5BRPA 5JXAH 5JORA 2Q7NA 5BOZG 2VM9A 1TQVA 4WU7A 5IHLB 3C6LC 4LNRA 3L4CA 1GKEA 7FABL 1N2RA 1AKPA 4JM0A 5DZ9A 5I1IL 1D6VL 3FO9B 3VG9B 4Z7OE 2HTKC 2PCFA 4KDVA 4IKLA 2ICES 1WZLA 3Q2NA 4BUHA 2PTTA 4YDMA 5F1IA 5EEZA 2NMSA 4EPSA 2FSEA 1DL7H 4PJ7E 1B88A 3CC1A 2CO4A 4JUSA 4NFDA 5C0NC 1FN4A 4NZJA 1BREA 3EXLA 4YVNA 2TSBA 2HX9A 2VZVA 3MRGB 4PR5B 5D7KE 1SUJA 1MRCL 4L0ZA 5EIIG 3U0TA 1U95A 4TVPH 3H6JA 4OLUH 1DEDA 2XZZA 1ZIBA 1F6AA 5D6DC 1ZA3A 3SGEI 1P4LA 1BFTA 1T0PB 3G5WA 5C0IB 1T04A 3BEWB 4K23H 4D3CH 2X4UA 1K4CA 1DTUA 3ARZA 4ODBD 1QFUH 4POUB 4XBPA 1QABA 4OT1H 5C09D 5FR3A 2Z93B 4PRPD 1QTSA 3PABB 3FUEA 2R2HA 4WQOA 3ZU8A 3ZZLA 4XNQA 3EYSL 3NEEA 4ETQA 1HCZA 4F2MB 3IDJB 2V4LA 3JUZA 1KC5L 2CWRA 2DOCA 2ERJC 2MNJB 2CHDA 5EOCH 5TE6L 5MEPB 3BD5A 2NTSP 4ZFZB 4OZHA 1MPAL 4NUGH 1FYTE 32C2B 1CF8L 5I76A 3PP4L 2A9ML 4UT6H 1U8LA 2UYLA 3MJ6A 3RZCC 5HD8D 5F6HJ 3IGFA 1HWGB 3K6FA 4K7FB 4LDEB 3RVVD 4JMXA 4CC4A 4KBPA 5D7EA 3ZKNC 4F7PB 2E9GA 4P05A 4KX7A 4XX1G 1P6FA 4OGXH 4P23A 1MCBA 1BAFL 3GXNA 1GPOL 4S11A 1O5PA 5DJAA 2W59A 5GRUL 3TNNB 1S7RA 3IDIA 3U6XS 1W16A 1UURA 3HJ0A 5GZNC 1O6SA 2BSCA 2WBKA 4YOKA 3LZNA 3INOA 2MCMA 5E8EB 3O3UN 2O61A 4O51B 3LPGA 1LWHA 4NJAL 4Q0XH 3G6JB 1IJ9A 4U1LB 2PO6D 1NICA 2ARWA 1FZOB 4PS8A 2RD0A 4MNQA 1QSED 3WTXA 1G4RA 5CKGA 2CO7A 1RIUH 3C5SB 3H9SD 1INDH 3IPEA 2H1PL 3NFSL 2ADGB 2BNUB 3BH8B 1JGDA 4F9LA 1U8KB 5JXED 3QCVL 2ZOKA 5E99L 3MRRA 3QJHA 3V9CA 5LXGH 4TNGA 2VXVH 3P9MB 4F58H 4N2AA 4GMSL 3QGVA 4JRLA 1OVZA 4POZC 4D2NA 3R8BB 1JRHL 3ZKSD 1P7KB 1KULA 4BZ1A 4HWUA 4DPAX 2H6UA 2P9RA 3FFCA 4YS4A 3UPAA 2EDLA 2MOGA 4B9CA 3EBAA 3CUPA 1OM9A 4UANA 3NACL 3EF4A 2CK0H 3GHPA 2YD5A 3MV8E 2RA1A 2ZUQC 4GBXB 1FV1B 4HDIA 3DV4A 3FN0L 5SWQB 1MLCA 3BEVA 3QA3A 4YPGA 5GPRA 2B9BA 3PFQA 2QHRH 4GO9A 3U4BL 3UBXG 4KMLB 1ES0B 1GSMA 3TYFB 2DLTA 3SYOA 4PVBA 5HI3C 1TJMA 3L3OB 2VRKA 4IRSA 1NFDA 4MRCA 4PJFA 2YA1A 4HIJB 4LVHB 3SDXA 1R3HA 1NWPA 4IBZA 3WTWA 1KPVA 1T6WA 1BG9A 3K8MA 5AG8A 1P4IL 2DS4A 5HY9B 5CFHA 2R1YA 2MEJB 4YDKL 1F5WA 1RD6A 1TEYA 4JY6A 1AQKL 5K33A 2XBZA 3FUNA 5EC2B 3QUYA 1BX2B 4FNLL 3PGDA 3B9KC 5KBKA 4PY7B 3AGWA 3LEYH 3NRFA 5IQMA 2F53A 3UG4A 3VYPA 2NR6C 4BZ2H 2F7RA 5IOPB 1V5JA 3GJFB 4BQ8A 2WQWA 1OB1B 4TQEH 3QYMA 1JPST 4YJZL 4I9WD 3J27A 5KYUA 4YSPA 3SGKC 3SOTA 5CD5C 4BGLA 1IAKA 4DCQA 4TTDD 2BNRA 5KYXA 4BINA 2F54E 3DTXA 3WTTA 5HHQA 1XCQB 5FYJD 3DURA 2VZOA 4P23C 5B7EA 4EI5B 1RHHA 2DI8A 1OP3K 3GTVA 4X6EB 3TEZA 1U8PB 1N64H 1EEYA 3OMZA 5AW5B 3I3BA 1EO8H 2YGNA 4KI1A 3R1GL 4ONGH 3RYMA 4FA8A 5KAQG 4HJ0D 2Z0UA 3K2KA 3VU1A 3MRQB 2EXWD 4X8JB 1MNUL 2F68X 3SOBL 3WI9A 1OT1A 3B5GA 5MEOA 2YAHA 2E0PA 2H32H 2M1KA 2EDOA 1HWWA 4XMPH 2NY5C 4OF0A 1QR1A 4QAWA 1MCSA 2EC8A 2ETWA 4NSKB 4YUEH 5I75B 4Z1PA 3WJMB 4G1EB 5A1AA 3L95B 4APQC 5JHDD 2PWEA 3J2PA 3CDCA 1I9RL 4JL2A 4JHWH 3ARDC 4LPXA 2J4WL 1OK0A 4JBSA 1M56B 4RGND 4W70A 4YHPA 2W65B 3OLGA 5DR5L 4PP1C 1I85C 4Y19E 4YSUA 5T3ZL 1PEZA 2HT3C 3KCWA 3O2DL 2OTUB 1PZDA 3ZMEA 5J3HD 1ZV5A 3BXNB 5DFTA 3O0RL 4ESKA 4JFYA 2Y6SD 3LQAH 3QDMB 4QO1B 5SWSD 4YDLB 4PLKC 2F1AA 4BHUA 1DUZA 4GT0A 1P7BA 1X5AA 2BC4B 3TVMA 3L5WA 1TVBB 5D7HA 5BJTB 2IG2H 3OAZH 1KBKA 3TZVB 3K46A 4NQCE 3GS4A 3UO1H 3HRPA 3MLZH 4LLMB 4QRBA 1RZPA 1OOWA 2ZYRA 1KCKA 4DP1X 4LPWA 3L4VA 1JGUL 2EDDA 1G0YR 4Y8DC 4BK5C 5J8OA 3QUHA 1WS8A 4OKDA 2YSSB 3MRPB 5DHEA 2JB5L 4X98A 1A4BA 3DX4A 1LDSA 3LNEA 4P46A 3GIVA 2JH2A 3ARED 1GYWA 2FJGB 5D1ZI 1RUMH 2VN6A 4NM4L 1N6QL 1AXIB 3MPCA 4DKFH 2WQXA 1C12A 1S78D 2AXGA 3HNVL 3SE3A 4FQXB 4JZOA 5DUMH 3QWRA 3K72A 1ZS8A 4WKZA 4IBVA 1E4KA 3RG1C 1CMOA 1HC1A 1UA6L 2NLJA 4M6OL 5GS0D 1KEGH 1RURH 2PP7A 4WGKA 2EE3A 3KPRB 4V2BA 4FNPA 3S96B 5AKTA 4KKCC 3SZKC 3B1TA 4HH8A 3IFNH 3TO4A 2A74B 3FOLA 4OM0L 4XWOC 5GGQH 1I7ZB 4G8GD 1OGAD 2WZPD 2NXZB 4XN8A 3NABL 4FXGB 3U1PA 2QSQA 4I87A 4HU2A 1AGFB 1HE7A 3BP6A 5EO0A 4BFGA 5CLZA 5J13C 4Q9QL 2DLEA 4G43A 1I3GL 3CSPA 1ID5I 4LPUA 4FYSA 4NUJA 1EMTH 3E7JA 5HDBE 2EDHA 4LEEA 2YGQA 1K8IB 1W9XA 2Z31B 3S3DB 4XC1L 1QVOB 1UYWL 4X6DB 1KN4L 3QZWG 2LTQC 3L7EB 2APXA 4HEME 2XU9A 1YN6B 1EUUA 5HHOE 3P0VL 3L48A 5CJXA 2CM5A 4OV6F 4U4BA 4FEIA 3V4PB 3ZL4H 5IY5B 2EACA 1JN6B 1YEIL 4NM8H 2NZ9D 3UEZA 5I30H 1KCSH 4KO5A 1EHAA 2Y72A 4MX7A 2ADYA 4ALAH 4Y88A 5C7XL 5AOMA 2R29A 4B96A 3LRSA 4ICWA 2D7PA 2BMKA 1UACH 2AJVL 2E8YA 3HG3A 4HOMA 3ARGA 4ZMLA 4AWJC 2HVBA 4N0UE 3FKUS 4YXLH 2YRBA 2B77A 5D5ME 1OO2A 4HX1B 4FXKC 2H26A 1LMIA 4B27A 2EH7L 1KJ3H 3QR1A 2VDKB 4L8BB 1JNHB 3WEMA 3D18A 3GXFA 5KUMA 5BZZA 4D9RE 4P2QD 2UVEA 2CRZA 2VDQB 2NUPA 3D85B 5CZVH 3WKYA 2OK0H 2VR4A 1DVZA 4K2UL 4N90E 4G3YH 4AVHA 2D4DA 2CIKB 2YC1A 3K6DA 4GW4B 3LKNB 4R97B 1WAAE 4AEEA 2IANA 1AFVL 2X2UA 3VTMA 3TVMC 3BZ4B 3LHPL 1B0RA 3E3QE 2N0MA 2P49B 3HE7C 2VUOA 1CN4A 1JGVL 2WXNA 5E6IC 4S2SA 2DYSB 3WO3B 1B0GA 2CLRA 4PUBH 2XLLA 3APCA 1KPRB 3D2UD 5IB3A 3VTTA 1CXLA 3BPNC 2CKBL 1AZVA 2WGXA 1ETZA 1R4XA 3LKRB 5T3XL 2BXZA 2UWEB 3FMGH 4R4BA 4AEHL 1G7PA 3GRWL 2OLDA 3NIFB 5DO2D 1FZJB 3HNSL 1TJHL 4U4IA 1G7QA 1MFCH 2OL3H 3MXWH 4LKCB 3AMKA 4P8QA 5DZNA 3P4LA 1ZY9A 3FO1B 3W0WE 5I8KH 3GSNB 5E4EC 1KB5H 5AW8B 1T89A 2XKSA 5DS8A 3HN3A 3B7TA 1RZKL 1ZWIA 1A4KA 4HUKB 4RFNB 3SE3C 4HC1H 1QBMH 1NCJA 4HPYH 4WI2A 4BBWA 4GQQA 1GMEA 5L0QB 3HAEB 3GEFA 2C9RA 4QHNB 3LMJH 5TD4A 2FLRT 5EU6B 1FZKB 1TTAA 4KK5D 1FYTD 4GEIA 1P7QB 3LN4A 3BIBX 3SDAD 3VWJB 2FWLB 4Y1SA 1KGUA 1S9YB 2VXUH 1Y18A 3BE1H 4NWUL 4XNYL 2QFPA 3VXOB 2P42B 1XXDC 5HHMB 3VD5A 1KGWA 5A7EA 5M95B 3NP4A 3D4ZA 2F7OA 4GUPA 4HWBL 1RL1A 3K91A 1MCCA 2NY3B 5CD3A 4IHOB 4JCLA 1DCEA 1SLWA 4WNQB 2D73A 1NFIA 1KBGH 3VFGH 4FNQA 5DYOB 1AY1L 4U6XB 3ZR5A 4ZXBB 1JTOA 1G7LB 5CMAB 2M83A 43CAA 2P5WA 4H88L 5JDSB 1ZS2A 3RWEB 2X2JA 4L29A 4XZ4A 5KVGL 1RK7A 1ASQA 1TKWA 2E59A 4HKXA 3F7VB 1HCYA 2G2RA 1J87A 4UV4L 1ASOA 1A7RL 4QRSA 3RNKB 4HEPA 4DUXA 4P06A 5J1AA 4NUQA 1CE1L 2QKIC 3IEAA 4GO6B 5C0DB 3I50L 4X4MA 2D7QA 2NY0B 1JWMB 3AU1B 5E2VH 5E6ZA 1IIKA 3QEHA 1CXIA 1T1XB 4HPOL 2DMHA 5BV7C 1HXKA 1AO7B 1UG9A 3IF1A 2NW2A 1R0AL 3PWPA 3T6XA 3GI8H 4P59L 4QYOA 5C1MB 5GS1B 3NJKA 3QEGL 4UYPA 1ILUA 3GXMA 4IU3B 4UTAA 3WOVA 1RZFL 1A3RL 2HFEB 1E42A 4PN6A 4HW6A 1DZBA 1JDAA 3DOIA 3HMWL 2CA3A 3PXLA 4PJBF 4Y4HA 5EORL 3KH3A 5LVEA 2K0RA 4MD5B 3RBSA 3DX8A 4JFEE 4ZMZA 5DWUH 3PAZA 1URIA 1UT1A 3V4VA 2J56A 1DZ0A 4Z7WA 4LSDA 5KBPA 1FL6B 3ZDZF 1GS6X 5F7MC 4M6ML 2JJSA 5TFSL 3P9LA 2W38A 2VW6A 1UT9A 1R5WB 4CW1A 2D7OA 4P3DA 3QO0B 4UOZA 5F7UA 4X9GA 4F93B 5DJZB 3LQZA 3VFTA 4PLJD 2O5YL 1FLRL 3VFSA 4JL1A 1T89C 4OZHF 3SBPA 5J11B 3KW8A 3SPVB 4WW2C 3EO9H 4ISVA 3BKCL 4E9LA 3UYPA 5EIQA 3F7YA 4G7RB 2IADA 3FB8B 5FKPA 3VXMD 2FO4B 3UYOD 4DP6X 2P8LB 4NPKA 3TA4D 4XBEH 1XL4A 4V2CB 4KDTA 1KENH 1K2DB 3VE0B 4GS7C 2LE9A 2OPCA 2VKXA 3ZLQC 2B9AA 1WS7A 5ITBL 1DQJA 5JNYB 2DH3A 2X88A 2QPDB 3H2PA 3QZPA 4P5TC 4H40A 1HNFA 5A6IA 2J1KA 3KBEA 2OXHB 4KTEL 4HUVA 2VLJB 3IJHA 1EFXA 4ONFL 4HOWA 4GXUM 4GW5B 4UZSA 1DLFH 3K4DA 3LEXA 2VSCA 5A43C 2J8UB 2VMEA 1NFAA 3DC0A 2X40A 5FA4B 4CA4A 3VQLA 3BP5B 3NCWA 3V52H 3JZ7A 3AQXA 4GUOA 4LSQL 4KPHL 4O02B 4PJ9B 4PJAA 4H20H 1I3RA 5BRQA 1HN1A 1WBXB 4TPRL 5I1EH 4DGVL 2WQ8A 2X70A 2IMMA 1HU8A 3N91A 4NCDA 4ZUVA 5C0CB 4S1QH 3WV0A 5IIEA 1J1XL 4WUKH 3QG7L 3CFJA 1ZHBB 1M05A 5KW9H 3TBVB 4F57H 3V6ZA 1AR1C 4TVSa 4R26L 2VLRE 4I3RH 3S48A 4U1MA 1QBBA 1DVSA 2ZONA 5IB5A 1HEHC 3BIKB 3GSOA 1S9VB 2L8AA 1TQCC 3A21A 3IXAB 3NRPA 4ODWA 4NNXA 4DAGH 3O3BB 1UKQA 1WICA 5E24E 1EZVX 1IMHC 1MELA 4I1RA 3ISRA 4O58H 5T1MB 1DDTA 4H1LB 2J6WA 3HFFA 4JDZA 5FO2A 2ITCA 3P3TA 4QT5B 5E8DH 5LGJB 4Y19D 4TL5A 3U7YL 3ZKMC 5FHAL 4IBWA 5HDWA 4YHZH 2PTUA 2C26A 1RK0B 3EJYC 4PJ5B 5CEZH 1JPGB 1BF2A 4HKZA 15C8L 4K3DL 4U3CA 3D52A 4JHVA 2FX8H 4LLUB 4X5XA 4Q4IA 4Y4HC 3MNWA 1XB6A 4L4TA 5CEYB 1KTCA 1HTYA 4PJXE 5F9WB 1NBVL 1F56A 2MH4A 4PWJA 4Z3GA 3ARVA 3BW9A 3GBEA 3UADA 3DHUA 4N2IA 4PTUA 1ZA6B 2WYIA 3CFIC 5CUSH 2X4SA 2Y7LA 2EE6A 3NSCA 4Y4FC 3IN2A 2VIRA 4KY1H 1PBYA 4OCSL 1SNRA 3VB8A 2K4WA 2X41A 3VRIB 2DW5A 4ODVH 1Z3GL 1Y6NR 2NY4D 4NENB 3NIDB 3TA3A 4O2EB 1OGSA 2VCOA 4UT7L 3E6FA 3TEWA 1HZLA 2QSVA 4P4KA 3MJ7B 1ROCA 2X44D 3T4AB 5AWNH 2IAAC 3FUMA 1WWAX 3MRLB 4LBEB 2YQ3A 3CE1A 4RNRB 3QEQE 3RZWA 3CV5A 5C0BE 3ISWA 1R5VA 1DYZA 2FRGP 2ZX7A 2X4RB 3VI4E 3HMXA 1EAPA 3MNDA 3MXVH 4DVBA 4GMTL 4PB0H 4HWZB 4M62L 4AJWA 4PWKA 5B39B 4GP4B 5J57B 2CNZA 1KELL 1JPSL 3BHBA 3BP4B 2GI7A 3QDGE 4HIQA 3OM3B 4NPYA 1SMOA 2KQMA 3ME0A 1MJ8H 3GI9H 4PRDA 5GJTL 2D2OA 3UP6A 5C08E 1F1DA 3K4ZA 5KWYC 2CBPA 2FJFA 1YN7B 3WJJC 1QRNE 1UXWA 1KLFB 2PW1A 3I84A 2CUAA 1A1NB 2UV3A 4YSDA 4ZX6A 5L7XH 3OV6A 1PD1A 4QXUH 4WLCA 4AGQA 2G60H 1LO4H 3VSVA 2HZHA 4I0PB 4RBPK 3FU7A 4K5OA 5F1NA 5C6TL 4WJ5B 3VCLB 6FABH 5JXAL 1YAIA 1A6UH 5D1XB 3QI9B 3S34L 4E41E 1IM9D 4BSJA 5HHOD 5EFIA 3RI5K 4ELKB 1S9KC 2FEDD 2OV0A 1UC6A 1KCRL 1HXYA 4W9ZA 2AJYH 1EERB 2Y3NA 1A4JB 4L05A 3VYNA 1CVRA 2X4NB 5I24A 1XX9C 4JFFE 3QFDB 2VLKD 3ULVD 1CIDA 1H6EA 1SJXA 2BPBA 3D07A 4OLUL 1S7TB 4HOZA 1RZ7H 2A4EA 1XTLA 1LK2B 3A5VA 4AQ8A 5BV7H 5K9QG 4DERA 2WZ5A 2XFXB 3AADB 4PGCB 1M9WA 3PWUB 1FIEA 4K23L 1TG8A 4LPVA 4DP4X 4GKNA 4P5RA 4Z7IA 3D3VE 4NHUB 1QFUL 2I25N 2DJUA 4FNRA 4WUUE 3ZDYB 1WA0X 2K3TA 2IDSA 3RKDD 1U8HA 2DWDB 2YAMA 4XMWA 1QFWI 1UZ8A 5HVHB 5E9DB 3D0VB 1PKQE 5MHSE 2W60B 5AVYB 4J8RB 2WMPB 3ARPA 3PABA 4JAMA 5EOCL 3U4KA 4LIQL 4J3OD 5HSFA 3RUGF 3WHE0 5IMLB 1TQBB 4NUGL 1CD1B 3DO7A 1F02I 4UT6L 2WP3T 4NZRL 1JHLH 4QHKJ 3TXAA 5D2LF 1I8IB 2CCLA 3EH5B 3WFEH 3F3HA 2IOMA 3L3IB 4L4VB 5KSAB 32C2A 4FL4B 2I60L 3CVHH 3RVXD 3W0WD 4OGXL 2XTJD 4Z7UA 3WUZA 2YZ8A 3HI1A 3R06A 3PG2A 2OKMA 4HULB 2VDOH 1QZ1A 2OQJB 2BFVH 2RAMA 4QRRE 4OTXH 4JZJC 1N4XL 1XGYL 2KZ1B 1GCFA 1ROWA 3OLDA 3R4DA 3WFCH 5FM4A 4Q0XL 3JYCA 2DIBA 4HBQA 5IBLD 2P7TB 4BKSC 2FR4B 1L0QA 3OL2A 3HPLB 5I1LA 3K6OA 2HCZX 5LN4A 4O51A 1RIUL 1INDL 3TTYA 3G6JA 3V0JA 4EUPG 1QPPA 3GLDA 4U1LA 3CDGA 2FECI 2CDEB 4AXWB 5IWLC 2NYYC 2OZ4H 3C5SA 2JVUA 5LXGL 2VXVL 1J88A 3BH8A 1FCGA 3Q48A 3RDJA 4OCRH 4F58L 3FUKA 2R8SL 2YGOA 4QIRA 1DO6A 2JTYA 2I7SA 2Q2EB 2WN3A 4M5YH 4PRHA 4FQJL 3QIWA 2H2PC 5TK4A 1FBIH 1ACYH 1KYUA 3U83A 3HOGA 3CHPA 3ARBA 1QO3A 2DF3A 2B4CL 2C5DC 5AAPA 3GUTA 1I3UA 2CK0L 3OX8A 5I73B 2VDNB 1CLCA 1M3IA 3MRNA 3F00A 4JQVC 3VG9C 2YAFA 5ITFB 5LUMA 3EYOB 3QCTH 1SOQA 4Q6IA 3K6NA 5C86A 1MCNA 4NB7A 1N5YL 2QHRL 3V79C 4X8GA 1CICA 1TXKA 1SZNA 3UIZA 4G9FD 1FV1A 3FQNA 2C4FU 5J89A 2W9LA 2NXYB 3DIFB 4NYLA 1HHIA 4U1IB 4LNVA 1NCIA 5ACMA 3DVNB 1ES0A 2WBWB 4BHUI 3FUIA 3S5ZA 3UGUA 3L3OA 1IC5H 4AIXA 1DJZA 3QXWA 3TASA 1CXKA 1MCLA 1W15A 2AEIT 5JIHA 1G1YA 1I3VA 4PGEA 3OAUH 4DZBA 1II4E 3KM2A 2FJUB 2YKKA 1MVUB 4Y89A 4PCTA 1OF0A 3UTSA 3B2UC 1J5DA 2SEBA 3A47A 4QI3A 1AD9B 3H7LA 2X12A 4BZ2L 3QH3B 1X7QB 4IGBC 4Y9GA 4YHNB 1BX2A 3V6FA 5BXFB 2ATPA 4N2LA 4Y1AE 4R6UA 4WW2F 4TQEL 5HTSA 1JXFA 4PY7A 1XGPA 5DJ8A 2JE8A 3BVNB 3KYMB 4Z18A 2GC4C 1JCVA 4M5TA 3GJFA 2R0KH 4W9JC 1GKOA 3DHMA 2XHNA 3P2TA 4ETYA 4GUQA 2EC9T 2QVFB 4PRNB 5CSGA 3AS0A 5HJ3A 4XHJD 3RIKA 1XGQA 4IRJA 1N64L 2IQAA 3TCLB 1BQLH 1XCQA 4JQXC 2V7NA 3OR6B 1OP5K 3T9WA 3C2SA 1M2VA 1MFDL 3LS4H 4XN9A 1R3LA 4OFQA 3B43A 3GRGA 1A14H 2EDWA 4KJWD 1SEQH 3DRTB 2F58L 5LDSA 4XMPL 3F64A 3T65B 1A3QA 1KFGA 5IB4A 2CE6A 4QNPE 3QS2A 3ZGHA 1I7UB 3BDXA 5ICYB 3CFKA 4CSSA 2DKUA 4Y4KB 5DHVB 3PWNB 3V0VB 5KZCB 3ELAT 3VFNA 1G7IB 2HG5B 4JQIL 3INUH 3PNWB 3QNYA 4NZFA 3ILEA 4HKBB 5AYUH 3WJMA 3L3JB 5D4IA 3HBGA 1HZHH 1YPZE 1XH2A 2P5EB 5SX5K 4X4XB 4YHLH 3FO2B 4FNTA 3EH3B 4FEMA 5L2KA 4X7TB 4ATTA 4CDGC 4G8EA 4AQ1B 4S1SH 4O2CB 4YN3A 3RWIA 3TT3H 1FL5A 3JWDH 3SZ6A 1HHHA 4PFEA 1A9BB 3TCXA 2YQ2A 4QO1A 2J1YA 2MIZA 4GBXC 5CSBA 3AJ7A 1EWHA 2BC4A 3QW9A 1TVBA 4HHWA 4PGDA 3S3SA 4XP9H 3TZVA 2BIIA 4GRWE 2JKXA 2LU4A 1U3HB 4TUJA 5KSBB 2A9AA 4HCRH 2BS8A 5E1GA 4XMXA 2P4AB 5GISL 5CXPA 3M1BB 4LCUA 5E5MB 4LVHC 2YSSA 4LQFH 3LZQA 4NJ9H 3CQQA 1A0QH 2GCYA 3ECQA 3C8HA 2H0JA 4CJ1A 3KGUA 1CDBA 5DUML 1G7HB 3FQRA 3ZMRA 4BSWB 3SY0A 4E2OA 4R0LA 2GQHA 4CVXB 2B5IB 3V0IA 1FH5L 4N8VA 1BAWA 4FQXA 2ARJB 1VFOA 1LWRA 2WUBL 3IFNL 1OZTG 5GGQL 3VD1A 1T0MA 1PZ2A 1R24B 4QRPB 5E5LA 2AQ2A 4UILH 3KPRA 3OD3A 5FO7A 3JV6A 4PBVC 1VGEH 4EBQH 1WZAA 1RZIA 2QQLH 3A67H 3QXDB 1NPNA 1X5MA 2XETA 2AK4E 2ZICA 4KO7A 1AGFA 4W4OA 3IJEB 1VGKB 4W6YB 5IVZA 4RDQF 2P80A 4EI5C 1Z5HA 4UI2A 5E0QA 4U3XA 1JMZA 1NIEA 2E7LA 3WDHA 1EV2E 2ZXQA 1CCZA 3D69B 2ICWJ 3BGAA 5T1DH 2E27H 4L3ED 2EDMA 4YFLF 1NIFA 3ZRFC 5JZ7D 5AZ2H 4NM8L 1PLBA 2RACA 5I30L 2PETA 4X50A 4X6DA 1VENA 1EH9A 4NPJA 3FTSA 3L7EA 5DUJA 4LAJH 4XP1L 4JM2B 2IFFH 5C08D 1MLBA 2WQSA 1JV2B 1UACL 3UBXB 1X5GA 2OMWB 5DK2B 1IGYA 3ZN6A 4YXLL 4AIZA 5I75C 1LXMA 1VF5C 4HETA 2X38A 1BVZA 3U1SH 1MFUA 1KJ3L 2WM0A 1H9DA 3TV3H 1Z9SA 4JPQA 3PYCA 1WCBA 4HH9B 4HX1A 3CC5B 4E9XA 4XPGH 5I6LA 1QWHA 2VYRE 3ARXA 4L8BA 4E41D 2OK0L 4MJ5B 1UJ3A 4NO0A 2DJSA 1MJJA 3JXAA 2E3VA 1Q4NX 3MO1B 4JVUA 4OM1H 3RIFF 5IROD 3QRGH 4RDBA 1S7UA 4E9SA 4DSYA 1N68A 1PDKA 3KLSA 4LESA 1XBRA 1PZ5B 4XN4A 4AIEA 3HUJB 3WN5B 4KDWA 2DDQH 4LLWB 4GW4A 2R51A 3LKNA 1H0DA 2KYIA 4G7QB 4YDLC 3ZE2F 3IVKB 3RX8A 1B9ZA 3BUPA 2R69A 4PUBL 1IFHH 4I18A 3HG1D 3UEQA 4Y5XB 5D7JB 3BAEH 3TZVC 5EU4B 2DQDH 5F7EL 4ZMVA 1YEFH 3QIBD 3S35X 3FMGL 2Z8WC 4LHQB 4MRBA 2XUWA 2JXMA 1AANA 1B9KA 4EE2A 1KPRA 4DK6A 5BRZE 3LKRA 2OL3L 3MXWL 2HFFB 1BIHA 3TYGH 4ZS6D 2C9AA 2PPDA 4A38A 1FZJA 1WF5A 4UQDA 1CI3M 2VJXA 2DIAA 4N0FB 3N41F 4HC1L 3BUIA 1QBML 5LDUA 2X0VA 1RZ8B 3GSNA 1Q9OB 4NKDB 2WVSA 1YMMD 3RVUC 3SEPA 4OF7A 3TT1L 3HB3D 3ZT6A 1S7VB 2FYVA 3LMJL 3O6LH 1ED3B 5A6LA 5BZWB 4E42B 1YEHH 2WWMC 4JFQB 4R8WH 4NZTH 3LCYA 1DQKA 3HC0B 4A7VA 4UNTA 3L54A 4FCAA 4QHNA 2XTSA 3D87B 3BE1L 3GO1L 2OYKA 2A74C 4J3OG 3VRJB 5F7DA 5SWZB 1FZKA 1RZJH 2NXZC 1AGEB 3IS1X 4FC3E 3OWEA 1P7QA 4FXGC 2V7HA 4HJJH 3VWJA 5GGUB 4AYEC 1S9YA 3CXHK 1LK3L 3MUGA 4GNKB 4OU3A 2WBJD 2QPSA 3HC3L 3VXOA 4U6TA 1KBGL 3HW7A 3VFGL 4NOBA 3CXFA 2XN1A 4ODUA 4QRRD 2E7LC 1OB0A 1TQSA 3IDMA 1MNNA 3DVGA 5EOCJ 5FGBC 1DFXA 5D7LB 3UZQB 3VFOB 4WNQA 3WD5L 2Z31C 3MRDB 4EN3B 2XG4B 2OMYB 5A40E 1W0WB 1HL5A 1S2EA 2JJVA 4TSAL 5I6PA 3TH4T 4U6XA 2FBOJ 4NDMA 4M61B 4ZXBA 2YQGA 1IZKA 1G7LA 4YFLI 5JDSA 5H37H 1IKFH 1OSYA 4PJEE 5DJCB 4JX0A 4DKEL 3F7VA 3L8QA 3O6FB 3TV8A 1SBSH 4LCCB 5TGBB 1IC4L 3QR2A 4UOQA 4ADGA 3FS9A 2OMVB 1PPIA 4ICXA 4GXVH 3ARFD 3NSYA 5C0DA 3UBGA 1U4EA 1JWMA 3NIGB 2X1OA 5EBWB 2FHBA 5GS2D 3VGHA 1T1XA 3WBDA 3GI8L 4JZNA 4I89A 4JFWA 5F96H 2CLVB 4XN1A 4AH2A 1EAJA 3FQ4A 4L3FA 1VACB 5F7WC 4AZ8A 3M8OH 3V5KB 1BFVH 2ODHA 1VFAB 1YNLH 3ML9A 4LCVA 4R97C 5IJBC 3C5ZB 3NUKA 1UM6H 4HIIB 2YPLB 2K6WA 3L3GB 4WSKA 3ZR6A 2BZCA 4BZYA 3FH5A 1Q0YL 4AC2A 4OZFH 4YHKL 4FQCH 4OZGA 2OMUA 3OMAB 5D1QB 4M7LH 4YHMH 4TLTA 3TX4A 3L3KB 2E4TA 4MD5A 4MZIA 2AV7A 4RA3A 1JZDC 5TE7L 3NJGA 4OZ4A 2DTMH 4MHHG 5MI0B 1MFEH 1LDPH 1FHNA 3KXFB 3LDBB 3CFQA 4XTRC 5HGAB 4W1TA 1XIWA 4JO1H 2ZOLA 5LCVA 5D9SB 1RULH 4NQXB 4UQEA 3WFHB 4BKLB 2VDRL 4B41A 1KPUA 3EO9L 1W0YT 3OHMB 4CC0A 4RZKA 4FXLA 5G4MA 1XSOA 4NAQA 4B97A 4XBEL 3SPVA 4RFNC 1KENL 4MAYB 4G80A 5IFHL 2DIEA 2M2DA 4GG6B 3QPXH 3OXSA 5DU7A 5EZLA 2W0FB 4UNVA 2P8LA 2VDMB 4I5BB 3F01A 5L0QC 3VE0A 1X7SA 3H4FA 3VGAB 5DSCB 3FU8A 3UROR 5B1JA 1TZHB 4H8WC 2FAUA 1DLFL 3RA7L 4FHBD 3RU8L 3VWJC 4Z3HA 3Q3GA 3T77B 1MIMH 2GT9B 4A6YH 5KVEE 4M8QA 2VLJA 2N59A 5T1KD 3V52L 3BZEB 1VKXA 2VXTH 4XCEA 4H20L 4OLXL 3RWHB 3NDYE 2AI0H 5AALA 5I1EL 5FA4A 3G6JF 2NY3C 3BP5A 5H4ZA 2HRLA 3MRIB 5M7QA 4I2XE 2FECL 5DK3A 5T1LA 3MLTB 4A7GF 1USQA 2N56A 3QXUA 1NGQH 1QRKA 1WBXA 4WUKL 5AAWC 5ALCL 1XMEB 2ZX8A 4ZXBC 1HT6A 1RUAH 4F24A 1BSIA 1N7MH 5C0CA 1HL9A 3CK0L 4FF9A 3EDJA 5E4AA 3B9EA 4B5EA 1A66A 4G5ZL 3LN9A 3GZQA 3QWOB 2WQUA 3KLAA 4GRMB 2F5BL 4DAGL 1KB5A 3U9UB 2ATAA 4O58L 3IU4H 4MNQD 4N2HA 4XB3A 3AB0B 3TJPA 3IXAA 3Q01A 1X5HA 5E8DL 2JCWA 2NY0C 3KW7A 3F05A 3EOTH 3QDJA 3GSQA 1U8JA 1A6WH 4X5RA 1CT8B 3MUY1 2QMKA 3BN9D 5CINH 1RP9A 4PJHB 4QT5A 3ECVA 2KDGA 3OSVA 3SJVE 2AJZB 4C8XA 3S8WA 5LGJA 4ZFOB 4PTTA 3NG5A 5CEZL 4P2RE 1SGKA 4HZLB 4NN7C 4YSEA 1KEGL 3S36X 2FX8L 5GS1C 2QJDA 1GJWA 2W5PA 3E1F1 4UU9B 4JFUA 3VD4A 3SE8L 4AMKH 4DGIH 2IPTH 2VR6A 2YJQA 3Q5OA 5BVPH 2DL9A 3U6RA 5I74C 2J88L 4KOCA 1LNUA 4XO5A 2DJ4A 2XV3A 1I1AB 4KY1L 3F7KA 3KD4A 5ESVB 5EUOA 1TTFA 5LGKA 1T7XA 2LABA 1MWOA 1ZA6A 3VA2C 2ZTBA 5AYTA 3ZHFA 5LO7A 3REVB 2XIIA 3SKMA 5I15H 4NBYB 1JPFB 5AWNL 4KVNL 1Q1JL 3NCFB 2VERN 1MI5A 4O2EA 1KN2L 2AITA 4MB1A 4OB5H 3T3PB 1M2OA 3GSVA 4OD3H 3B2VL 3MGTB 4PJIA 3EXJA 1J9TA 1CFVH 1F3DJ 3RWJA 4AGNA 2HX8A 2ATKA 3MXVL 1E6JH 5F0PB 4ES8A 4KWUA 4PB0L 4D0DB 4HXBH 5J1SC 2D03H 3DWTA 4LVOB 4E5XA 2QSTA 1CE6A 1G7JA 2ORBH 4HWZA 1MJ8L 3GI9L 5B39A 3QUYD 2PO6B 2YAPA 2DKSA 2ZUUA 4LSTH 4UCFA 3BP4A 1QSEB 3D4GA 3IK2A 3L08A 3M7FB 3Q8CA 1SN0A 3H9SB 1A6AB 1FQ9C 3JV5A 3SPHA 3T2LA 4NFCA 2BVOB 2KH2B 1ZLUH 2DPKA 2PCPB 3M7OA 5LB1A 4DP8X 3SDDA 2G75A 3CFBB 4X6CE 4BK4A 1PLAA 2G60L 1YN7A 5I5MA 1AE6L 6FABL 2TAAA 1KLFA 2FQEA 2XWEA 3NQKA 2BNRD 4PJ9C 1A6UL 1RJYA 4YMPA 3BZDA 4R5VA 1BD2A 4I0PA 2KT6A 5FUOL 3U2IA 1TQTA 4DTGH 5GS0H 3FTXA 1K4DB 1SM3H 2QVTA 3IJ8A 3FTYA 4Z5RB 2X0UA 1C7TA 1HH6B 1LEKB 3CU1A 3MRCA 1TJXA 2QTEA 1JL8A 1IAOB 1TYEB 2GTWA 4ELKA 5KJRH 2BOBB 1L9OA 2AJYL 1NKRA 4L1HA 4P5MB 2VERA 2ADIB 2AJUH 2V5MA 1MVYA 5T3XE 2X7LA 3QG6B 3RIAF 4AVKA 1AI1L 1FVDB 5AKVA 5EU7C 3A3YB 2YHGA 3R0NA 5JW4R 3SYPA 4QHUB 4MXWH 3OKDA 2AEOA 1H8NA 1GVIA 1WWBX 3OPZH 4G70B 1SFDA 4M7LT 3QFDA 4U33A 4KXZH 2JKRM 4MBRA 5CIPB 3RAJL 4FRWA 4A2DA 5BV7L 2FT8A 1CIUA 1DSFH 3IETB 3VXUB 5HGBB 3Q2CA 4MMXB 4GKOA 1CZ8L 1LK2A 2HKAA 4LDLB 3LX9A 2CJ3A 2X1XR 3PWUA 4OUOA 1J8HD 4N2BA 3SD5A 4K4KA 2Z91A 1VFUA 5LBSL 3DIVA 4NHUA 4Z7VA 2XN9A 3DGCR 1F1AA 1NGYB 2A9NH 5DQDH 3RPIB 1IAII 5FCSH 4DKTA 4J4PD 5C9JA 2KS0A 5IT2H 1KJMB 4KFMA 4XH2A 4J8RA 1MW3A 2WMPA 3FU9A 2FT6A 1JHLL 5IM7B 2WINB 4H8UA 4ZUWB 3WFEL 3ZL1A 4XVUD 5IMLA 1FVCB 2AMGA 3CBRA 4OFYA 1ZVSB 4D8PB 4E0RA 3C75A 3NK3A 3CVHL 4BWWA 3QQDB 2N1KA 1HEZA 2TSAA 3HLAA 3X1NA 4X7FC 3IMVA 2ZSVA 3U2JA 1NUDA 1YDPB 3L3IA 1CBVH 1KTJA 2WN2A 1T1YB 5EU5B 2HJKA 3T4AC 3QWQB 5C0AE 1RPUA 1KLUA 4OTXL 2CO3A 5KVGE 4JJ5B 4Z7QB 2G9HB 2JJTA 1W6LA 3EUUA 3O3DB 5IB1A 3WFCL 2MCAA 3DXAA 3O2WH 5F7AA 4XBMA 5I66B 4MLIA 3I9IA 4PU2A 3W81A 1CL7I 1U8MA 4QTFA 2R0LL 2MQ0A 1UATA 4OCLC 3VXTB 4D8OA 1YMHA 4UB0H 2DBLL 2QV4A 2OZ4L 3QFJD 3C60D 4KI5C 2WVVA 2FD6H 4N0YH 3TO4D 5E9NA 3SCMA 5DLMH 3TFKD 4JRYE 4AXWA 2VABB 3T8XB 3ALWA 1WWWX 5H94A 3ZTNL 4M5YL 2M26A 4NRXA 4ENEC 2MOQA 3MC0A 1FBIL 2YEZB 3ATAA 1ACYL 4IIQB 4I0PC 4X7CC 1F4XL 4B50A 4PP2B 5D1XC 5BS0D 3HS9A 3QI9C 3OVUB 3ILPA 2YEQA 4EUPH 4ELME 2E9IA 1DQTA 3QPKA 4V1DA 4DW2H 2N3JA 3QCTL 5K9KB 1XR8A 3GXUB 5FM5O 4P9MH 1KZYA 2H0FA 2P24B 3HN5A 3W9DA 5ID0A 1X6LA 3MLRL 1HSBA 1I8KA 5DF0A 3I02B 3AQDA 3ZTJG 3AQYA 1R75A 3V5DB 3FUDA 4BELD 3G5YB 4E36A 5HVFB 1I7RB 4FE9A 4XMUA 1JZ5A 4PI0A 1CFMA 2YD4A 4NKQB 1XCWA 1IC5L 3ARGD 4NT6B 1SYVB 2APTA 3RJDA 2E75C 1MFAH 1ZEAL 4GXUN 1OTUD 2XVLA 3AREB 1OAUH 3PL6D 2BFGA 2GKIA 2Z35A 2MQ3A 4F8PA 3FOMA 2UWEF 2Y5EA 5HVHC 2FH8A 4N8UA 1MVUA 3AXIA 3GDBA 2G5BB 1O7DE 3NIFF 4QCIB 4HKJB 1T22B 3BZ5A 5C3LD 1GCYA 2MNUA 4CUCA 1AD9A 4K9EH 4MXQD 4NQTA 1TF4A 3LVTA 2R0KL 1TQBC 2XNAA 3GMLA 1YECH 4KKAC 4G8GB 4Y16D 3OGCB 1R5IA 3A22A 3HCVB 1XF3B 3BVNA 1LEGB 2WC7A 5HVGB 4JS7A 5KSAC 1U2HA 4FL4C 3SYQA 4YIQA 2EAEA 1KJ2H 4ZZKA 4PRNA 3PHSA 4JFOA 2NW3A 1DJXA 4HGWB 5DDHA 3D39D 4GW1B 1F3JA 3RFZA 1QNZH 3BGMB 3NFNB 3RFRA 4Z78B 3FZUC 1G9MH 5DUBA 4GAGL 5PAZA 4AYID 4LRIA 5FO8A 1NKGA 1BDYA 2AEWA 3L4YA 1CFTB 1C1EH 1T4KA 3IM1A 4BH8B 1JWSB 3N40F 4A63A 1WH0A 2DLIA 4KITB 1KXVC 5ICYA 1TZIA 2IPUK 4FG4A 1GJIA 3G9AB 3FB5B 4QLRA 5T3ZD 5DHVA 1TDQA 1DBKH 4FQ2L 2NUTA 4ELDA 1X5ZA 4BXVA 2N01B 2KC0A 2UX7A 1CBJA 2HG5A 5EIIA 1FPTH 1IFRA 3EZJB 3FTGB 1N59B 3L3JA 4WK4B 1QSFA 1G1OA 2R9HC 3BVTA 2EKSB 3KVPA 1CR9H 4AGMA 4P2QB 4S1SL 4W9CC 1G9EA 2A6IA 2O5NA 3JWDL 1XO8A 4M6AA 3RHWF 5I73C 1J0HA 4YDVB 4F15B 3BP7B 3GMRA 2GFBB 2X9XA 5I8EA 2C4XA 1A9BA 4YHYB 2OMXA 2IXQB 4XP9L 4DNLA 3IDXL 4YHIA 2IH3B 4E9WA 3QJTB 1JZJA 4I7ZC 4HSCX 3N06B 4WGVB 4HCRL 1WG3A 2ZXDA 3D2UB 1W91A 4TLUA 2NXYC 3TH3T 5FFLA 2YBRB 1Q9LA 3S3CB 5L4JA 2ESVE 1MIEL 1FGNH 1V3KA 1PIGA 2VOTA 5KSBA 4LQFL 3HN8A 2L7EA 2PN5A 4NLAA 1YEEH 3F7RA 4HK3J 3OHXB 5AVTB 1A0QL 1DEEB 2A6DA 4PSRA 5IHWA 3I75A 3AS2A 2N0KA 2OR8A 2X6CA 3K80A 3LPPA 2BVPB 2X9YA 3H55A 4MB5A 3PHOA 4Y5VC 1EJOH 3N9GL 3IRZA 4HA1A 4XPAL 3L1GA 1P7HL 3VMOA 3NEXA 3QJVB 3QYCA 4BSWA 3UTTD 4YLQT 1UWXH 4UILL 1MHHB 4JFDE 4G6AD 4K3GA 2CCWA 3FU5A 5AZUA 5BMFH 5HHPB 1VGEL 4UZUA 3B8SA 2IPKB 3FHQA 3S36H 4QRPA 2QQLL 3D51A 4YNYB 1DVFB 2X10A 3L2LA 3Q8FA 3ZSTA 4N2EA 3LRLA 3X2QB 3QXDA 4KK9C 1GOGA 4GLRH 4N2OA 4KQ4L 3IKCB 4KRPD 4W4NA 5T1DL 1VGKA 2E27L 2XX0A 3P3SA 5T8IA 1H6TA 3LKOB 1OAKH 2HSIA 5AZ2L 1ZCRA 1CVSC 2J8UF 3D69A 2CALA 3FSOA 3SQOH 3JTTB 4O9HL 1HS6A 2XXFA 3CFDB 2GJ6D 3PWJB 4N22A 2WCPA 4FFYA 4JG9A 1EZLA 1KB3A 5E1AA 4N85A 1M1SA 4Y4KC 1AGDB 1YG9A 3U1SL 3FN9A 4M1DH 1JV2A 4JFZH 1AAJA 3HHRB 1TFHA 3TV3L 3Q9PA 5HGGS 2OMWA 5DK2A 2FJHA 3AUVA 4J12A 4YDZA 2F61A 3FQWA 4R7XA 5I1CL 5AKRA 2DAVA 1M71B 4XPGL 1LD9B 3OJDB 2IMNA 1JYWA 1QBLH 2VDLH 1RIHL 3EO0A 3PQYE 4OM1L 4BQCA 2VO8A 4AGLA 4NQVA 4HH9A 5KYNA 3QRGL 3SKNB 4X6BB 4TQIA 3CC5A 3RGHA 5F72S 2X3BA 3IXTB 2B16A 1ICTA 4X4ZA 1W0VA 5FUCC 2YPKB 2Z1PA 4MJ5A 4N28A 1NOFA 4TNVF 4N3UA 4LIQE 3Q7JA 4HWNA 4AQ1C 5FECB 4TNFA 5GGVY 2VGLM 2QSCL 4FFVC 3VTAA 1MWAB 5T3XD 3DX6B 3FF7A 4JY4B 5GHWL 3PV7A 3WN5A 4PJDA 4R84A 1GYCA 2GABA 2Y1AA 4N5EC 3BAEL 3BAIA 1UWEH 5F9OL 3WELA 1YEFL 2GUOB 3X1FA 1T5XA 4D9LH 2W07B 2VL4A 5C0GB 5C2UB 1PG7H 4YH6A 4C58B 3FCTB 3QUZD 4M3KB 3G6AB 1U3HC 3M45A 3U36B 1A6TA 3TYGL 3ULUC 3S2CA 1XHHA 4K9JA 1CLOH 3DDGA 5DHYB 3T1WA 2PCYA 4I48A 5FM8A 2PYEE 2B20A 5D4QA 1OM3L 1U2CA 3QC5X 4Q56A 4WFGE 3TJEL 3VXMB 2AC0A 1URZA 3MYJA 3NIDF 5HXMA 1RZ8A 2WLKA 4YQXH 5EEUA 2WVTA 1JHTB 3WE6A 2B5IC 4KXAA 4R8WL 4L4TD 4NZTL 5DK0A 4BUQA 1TYRA 1DSYA 3GSWA 3MRFB 1P1ZB 1EZUA 4TUOB 4NO5A 2WNXA 1H5BB 1RZJL 1AHWB 3WIHH 4HJJL 5CP7A 2HRGA 4UWQB 1DDHA 3OGOE 3UH8A 1KY7A 5J5EA 3TBSB 3ZO9A 4ZMAT 2Y07H 5C0AD 4U7SA 1J5IA 1TU2B 1AQDB 3MCLH 4P4KD 4XZUB 4C4UA 1JD9A 4BQ6A 1I1FA 2AJSH 4ORZC 4G6MH 3KL3A 5CGBA 4P2AA 1NIBA 1OAZH 4KI5F 4J1UB 4WEBH 1NSNL 2XZAH 2ZNWA 3O4LD 1F4YH 3L4UA 4M9OA 2ZKXA 4NZ8A 5K93A 2WAQA 1W2KT 4EN3A 2CO1A 5IG7A 5TQ0L 3MRDA 2HN7B 3KPMB 1W0WA 3DMMA 3KBHE 1QEWB 1Q9WB 1XDTT 1UXMA 3UP1A 4O5LL 1H3GA 1FO0H 5C0RH 2QEJA 3KZ8A 1NCDH 1OSPH 5D2NE 4JM2C 4AYFA 3LXUX 3E80A 5CR8A 2CR3A 5EHFA 5IHUL 5JMRA 5AB9A 1EQWA 3JQOB 4JO4L 4GXVL 1YY9C 3O6FA 1FFOA