1YLBB

Nmr solution structure of the reduced spinach plastocyanin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
b'VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin, chloroplast
publication title Structure of the Intermolecular Complex between Plastocyanin and Cytochrome f from Spinach.
pubmed doi rcsb
molecule tags Electron transport
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ylbB00
2OCCB 3WNJA 2CUAA 4BXSV 5A7EA 2FNWA 2FQGA 2FWLB 4YSEA 2XX1A 2JXMA 3OMIB 1BQRA 2QDVA 3NSFA 3X1GA 4WKXA 1PAZA 3UAEA 1PNCA 2GI0A 1OF0A 2HX9A 3HEIB 3IBOA 1XB3A 3UADA 8PAZA 1SNRA 3FSZA 1AG0A 1FWXA 2XU9A 3WI9A 1BXVA 1E67A 5I26A 3V9EA 2YAMA 1TEGA 1MZZA 4NERA 2EINB 2VN3A 1GW0A 4BXVA 1ZPUA 4HCIA 1NIEA 2NRDA 2BP0B 2YAFA 2XV2A 3NJLA 5B1AB 3S3CB 5B7FA 2IWEA 1JZGA 3TA4D 2BZCA 3T9WA 2J55A 2Q5BA 3DIVA 2XXFA 4AX3A 1CUOA 1AZUA 1AZRA 4GYBA 3C75A 2DY2A 2XX0A 1SF5A 3UAAA 4DP7X 3WKQA 2DWTA 2YAPA 1ASOA 2Q9OA 3ABLB 4KNUA 2BWIA 1NIFA 3CVCA 3AG3B 1AS6A 1KBVA 1N70A 2J57A 1E5ZA 2FQDA 2YAEA 3DKHA 2IDTA 5I6NA 5E9NA 1AZNA 1A65A 2H5UA 1SHWA 2QT6A 2MTAA 4G7QB 3SBQA 3FU8A 3WKPA 4G71B 4F2FA 4HHGA 4A2DA 4A2FA 4DP5X 1FA4A 2IDFA 2VSKB 2HX8A 1OCRB 4YSRA 3AW5A 1KDIA 1SF3A 4BDVB 4BWUA 4E9TA 1EHKB 1HAWA 3CVDA 4ZK8A 1N68A 2UX6A 3WG7B 3IN2A 3ZDWA 4M3HA 3QJRB 1JVOA 2JFCA 5I5JA 4KO5A 7PAZA 1NIDA 2FQEA 1AANA 1WAEA 1JXFA 2Y69B 4DP4X 3TBBA 2YQBA 4YL4A 2AFNA 2PPEA 3NSDA 2AANA 4KO7A 1SFDA 2AZUA 4DPAX 4AKOA 2FJSA 1NIAA 2HXAA 2HRGA 1L9RA 2XV0A 3OD3A 2BW4A 1L9SA 4YSOA 2YAHA 6PAZA 2B3IA 3PAZA 1OCCB 4TXVB 3NP4A 4KNSA 1M57B 3EF4A 1NICA 4RH4A 3MX0B 2IAAC 2WO2B 5IY5B 1NPNA 2CBPA 2I7OA 3PAUA 4JHUA 3QJUB 4BWTA 4G7SB 1CURA 4DP6X 1PNDA 2EIKB 1JXDA 3AG2B 4YSAA 3NJGA 1GS6X 2YXWA 1NWPA 1IBYA 1ZIBA 4KO9A 4W1TA 4HHWA 3NSYA 1JZFA 2BP8B 3KW8A 1PY0A 2GSMB 1A4BA 1MG2C 1IC0A 2YAQA 2E86A 2HX7A 3IEAA 3FSWA 1JZEA 3FQYA 4FAAB 2XYBA 1V10A 2PPAA 3FQ2A 1L9TA 3MBWB 2A3TA 1A4CA 1KYAA 5PAZA 2OJ1A 2UXGA 1W6WA 1W6LA 3T6VA 1PZBA 1A8ZA 1ID2A 1PZCA 2IDSA 4GY4A 1GYCA 1E30A 4JKNA 3N2JA 3U25A 2RACA 3QJTB 6PCYA 2OV0A 3HB3B 4DPBX 1WA1X 5AFAA 1GSKA 3KW7A 1AG6A 1AS7A 1A3ZA 2UXTA 1KDJA 3QQXA 1AACA 4GXFA 4GP8B 4KOCA 3NJKA 1JZIA 1OE3A 1AZBA 3CG8A 4L0PB 2YARA 2GB2A 4M4RB 1L9OA 1OCZB 3OMNB 3AY2A 3DTUB 3GDCA 3S8FB 4GP5B 4N4YB 4UF7C 2H47C 3WIAA 1CYXA 1SDDA 4F7KA 3EH4B 1L9PA 2YXVA 1AZCA 4HALA 4HCFA 7PCYA 1IBZA 1WA0X 1TU2A 5I6PA 1V55B 3CDZA 1IKOP 2PCYA 2AVFA 1IUZA 2BWDA 3SBPA 1T5KA 1KV7A 1PLAA 3NP3A 1AOZA 1NDTA 2VSMB 4KO6A 4P5RA 1SFHA 4CSZA 2J5WA 3FU9A 1WS7A 5EHFA 1OE2A 1KCWA 2R7EB 3FU7B 2TSBA 4Q89A 9PCYA 1ET8A 1F56A 1I53A 1MZYA 3AG4B 5I6MA 2TSAA 4KNTA 2GBAA 5I5IA 1CYWA 2VW7A 4YVNA 1PLBA 1RCYA 4K9JA 1OV8A 3NYKA 1B3IA 1TKWA 2PP7A 4BK5C 4G70B 2IH8A 2IDUA 1OE1A 1ETJA 1JVLA 2N0MA 2VW4A 3OQRA 1M9WA 4HZ1A 3RYMA 3ZIYA 4E9SA 4JHVA 1E5YA 3EH5B 2W88A 2YAOA 1BQKA 4YSTA 1BAWA 1PLCA 1NPJA 4MFHA 1ZV2A 1NIBA 3JTBA 1BYOA 1GY1A 1KCBA 1CC3A 1AR1B 1ILSA 1JXGA 2DV6A 4YSDA 3FT0A 3NJIA 3OM3B 1ET5A 3IN0A 4NAJA 4DPCX 2ZOOA 1QHQA 3ABGA 1WS8A 3CZUB 1SHXA 2HZHA 4HIPA 2IWKA 2MRYA 4E9YA 1ZIAA 1HAUA 3EHBB 2UX7A 4YSPA 2CAKA 4X4KA 3G5WA 5I28A 1AIZA 1R1CA 2BP0A 3QJQB 1NZRA 1BXUA 1YLBB 3FPYA 5AKRA 5ANHA 3X1EA 2IH9A 2GC7C 2XXGA 3QJVB 4F2EA 1JOIA 5B1KA 4ENZA 1MDAA 2J56A 3T6WA 1M56B 1ASPA 1GS8A 2BZ7A 2DYSB 2JKWA 1X9RA 4HCGA 5TK4A 4A2HA 2VM4A 4UAHA 3V9CA 1SJMA 2DYRB 4A66A 3FPXA 4E9VA 1AQ8A 3FSAA 5PCYA 3X1BA 3FSVA 3PAVA 4A2EA 1GR7A 5FC9A 2XWZA 3N55A 2GIMA 1HFUA 1ZDSA 2FT6A 2CCWA 3X1NA 1JZJA 2FTAA 3SBRA 2BW5A 1J5CA 1J9SA 3NJFA 2IWFA 3QPKA 3ASNB 4YSUA 4YVUA 4DP2X 1RZPA 5B1BB 3JT2A 3T71A 5B3SB 1EZLA 4BDVA 2EIJB 2UXFA 1ET7A 1KGYE 1QNIA 4Q8BA 3PCYA 4G7RB 1NTDA 1RKRA 5B7MA 3FYEB 4DP8X 2ZONA 1X9UA 1QLEB 2GC4C 2PPCA 3X2QB 3NJMA 3NJHA 5B1JA 3L45A 4A67A 1UATA 2P80D 3WNIA 5TK2A 2BO0A 2HRHA 2UXVA 2IDQA 1J9TA 2PPDA 1XB8A 1GY2A 3NSCA 4PAZA 2XVBA 4AKPA 1NWOA 4P5SA 2P80A 2GHZA 3T6ZA 1XB6A 3T6XA 1WA2X 1PZAA 3ABMB 2FT8A 4E9WA 2PP8A 2W8CA 3NJNA 2PCFA 2QPEB 2XUWA 3NJJA 2PLTA 3H56A 2X87A 1JZHA 1FFTB 1RZQA 2QDWA 4WTQA 3ERXA 2PP9A 1BYPA 2EIMB 3AZUA 3UABA 4PCYA 1OCOB 4FA7B 4QLWA 1VLXA 3FQ1A 1V54B 3H4FA 4A2GA 2BP8A 2ZWNA 4YSCA 3TASA 1MG3C 4YSSA 1ADWA 1GS7A 5D4HA 2ZXWB 3ZX1A 4E9RA 3PLYA 3TBCA 1KBWA 1ILUA 2WO3B 5D4IA 3ZBMA 1J9RA 1DZ0A 4UANA 4BWWA 1E65A 4NB7A 1W8EA 1BQ5A 1XMEB 1TEFA 1PCSA 1PF3A 5AZUA 4GP4B 1PMYA 2VW6A 3UACA 2XV3A 4E9QA 1DYZA 2FQFA 5B7EA 3S3BB 1J5DA 3S3DB 3SQRA 4G72B 2AZAA 1SDDB 3ASOB 3ABKB 1L9QA 4A68A 4AZUA 3CVBA 3CDZB 1BXAA 3QJSB 2VM3A 4N8UA 2CALA 2DWSA 3FYIB 2LLNA 4KOBA 4AI7A 3PPSA 3PXLA 3GXUB 1JERA 5LDUA 4QKTA 3UGEA 1AAJA 1ASQA 2HLEB 1BEXA 3AG1B 2H3XC 2I7SA 3TU6A 3D12B 2WSDA 4AKQA 2FT7A 4CSPA 3H4HA 3EH3B 1OOWA 1ZDQA 4HAKA 3S8GB 2QPDB 5D4JA 2Y1AA 2CJ3A 4E9XA 1A4AA 1URIA 2PPFA 3IE9A 3OMAB 5I6OA 3BVDB 3BQVA 5I6LA 5F7BA 3NT0A 2B08A 3GYRA 4YSQA 1AS8A 4W9ZA 2VMJA 2XLLA 4DP1X 2EILB 3X1FA 4EF3A 2R7EA 3FU7A 5F7AA 5I5MA 4DP9X 1J9QA 2BHFA 1NINA 2X88A 3FS9A 5I6KA 5B1JC 4DP0X 2I85A
chains in the Genus database with same CATH superfamily
2J1XA 4IBYA 3H6JA 1JF1B 1KULA 4JHZA 1QBBA 1SY6L 3OQ3B 3P9LA 4GMSH 4ZDHB 2R29A 2PN5A 3U48A 5IIEB 4JN2A 2UVFA 4JLRA 1EJOH 4JKWA 3SPJA 2J3SA 4G8FA 1V7NH 5I1JL 3EO9H 2XU9A 5GJTH 3ZZ1A 3Q8EA 1OVZA 5I73C 3WMQA 4OVVA 2YRBA 5BUAA 2CLZA 3VVVA 3I2CL 3MNVA 3IPEA 1JGDB 3LMJH 2BZDA 4DETA 2OZ4A 3GO1L 3MRNA 4PJIE 2WKOA 3NZHH 5F7EL 3CXFA 3WXWL 2WSPA 4FMFA 1CGVA 1VEOA 2I69A 2XXFA 2YK1H 1U3HB 4LCYA 2JCCA 2EDQA 3G6JB 5HVWA 3VRLE 5ECGA 3LPPA 5KN5B 1GOGA 4BRVA 5E9DB 4DERA 4I87A 2BLFA 2ZOLB 4P8QA 4DP7X 4CJ1A 4AQOA 2Q9OA 1CU4L 3V6OA 4DFHA 4CVZA 4PJCF 3ZKSD 3WD5L 4AENB 4D0BA 4R2GB 2G3XA 5IF0A 1HU8A 4XHQA 1XF3A 1BFVH 2G2PA 1OP9A 2YRZA 1Q9KB 5JHLH 2A0LD 2UZPA 2JKNA 3ETBF 4ZBJA 4KROC 5D72L 3ZDZE 5ITBH 2EYTB 2FAUA 4YDLC 4YAQA 1GGTA 1RJZB 3CMOH 4X98A 1GH7A 1OP4A 2H0JA 1QA9B 5IG7B 3QIUC 3U1PA 3SE9L 3CUPA 2GABA 4LQFL 4Z7UA 4DKTA 5JIHA 3KGTA 4OCLC 5D71L 3HC0B 4MSWB 4X9FA 4X0KB 2PYEE 3Q48A 4JFED 2UX6A 4HYTB 5CD5C 3L5XH 1PL3A 3SPVA 1SN5A 3WG7B 3FQTB 1A6WH 2J2ZB 5D6CA 4L8DB 3V0GA 2AP2A 2NXZB 2XZCL 4AEIL 3L95B 4NNPL 5JR1H 2LT9A 5J4MA 4ZS6C 1BQSA 2UWEF 5F7HA 2A83A 4GRMA 4PLJD 3VFWB 3GTNA 4R5XA 4IRSA 4H25B 1BFOA 4S1QH 2AZUA 2WLYA 4A6YL 5EBWA 4XWGL 1S4IA 1NIAA 3AVEA 3WO4B 5EZLA 4GUQA 1L9SA 1THAA 2FUQA 4OLWH 3QXDA 5BRZD 5C0BB 4G1MB 5D7JD 3AS0A 2MMXA 4NENA 3FOLA 1JPSH 3EF4A 35C8H 3FU6A 4L2YA 4QRRE 1ZHBA 4C83A 4F8LA 3SKOA 3HNVH 1HSAB 1S3RA 4ZMXA 3NFNB 1O7SA 4UOW0 2BRRL 4BRJA 3BZ4A 2YPKA 5H37G 3NK4A 5E2WL 4WHDA 1RUPH 1XGUB 1IV8A 4ODXA 2E4FA 3VXMA 4IHBA 1RHHA 5AVWB 3VGAC 2Q3ZA 3BRFA 1MHCA 3SDXB 4WY7L 4OZIF 3AT8A 5FS5A 3G6AB 4KUCD 4LMQE 2YAQA 1IC4L 2RJMA 3NTCH 3V4UL 4GJTB 5ABDE 4PJXA 3HNSL 1KN2H 3PWNB 4NI6A 2AQ1A 2ILLA 2WXRA 3ILPA 3O3UN 3KPOB 4X6DA 5F9AC 3JVGA 1NGWA 3CFKB 4FYTA 2M1KA 2ESVD 2B7DT 3DJZA 4FQXA 1RL1A 2ZNWA 1E3FA 1PZBA 4B95C 4XHJD 2FK9A 3E8UL 4QXGH 5C6TH 2P8PB 4UDUA 4MHHG 3MBED 1AR1D 4G1EA 5FV2A 5ESQA 2W9EH 1ED3B 5DRZA 1J8RA 4F15C 3L4TA 3QCVL 5GGSB 4K8RL 1I7RA 1FGNL 1ETB1 4NQEB 2FR4A 1AS7A 2WCGA 3BZEA 2X4NA 4I1NB 2EO7A 2VAJA 1MCCA 2R0LL 1QFWH 5MEPA 4NBXB 4AQZA 1E2WA 4NIKB 2Q8AL 2G4GA 1OCZB 4OZFH 5I74C 1CFTA 2E75C 4OQTL 5KAQG 3BGFB 3VAEA 4A38A 3KG5A 1HCZA 5C9JA 2CHZA 5DQJA 4HHAA 1JPGA 4RGOL 1TFHA 1U3ZA 4WGKA 4JFPA 3L3KA 2VNCA 4WO0A 5E0FA 2BXZA 3L2MA 3FDWA 3QPQC 5GGRY 1C5DB 1F4XL 4F7MA 1IUZA 2CO2A 4XPTH 1J0JA 2WXQA 1T2QH 4QNPF 2QTEA 3RY6A 3NP3A 4NKMA 2YEQA 2YWYA 1H3VA 3ASWA 4FQ2H 1NCCL 4IIQB 4BIKA 1ETZA 3IDYC 1JSYA 4FXGA 1N59B 1SFHA 4ZUTA 3CLFL 3FTVA 4U1JB 2YMTA 1A6TA 3H9SB 1XT5A 1B3JA 1R17A 3APCA 4HGWB 3MRGA 4MXVF 2KLTA 3MLUL 2UZYA 2KLSA 1CFVL 1RZKC 4Q6KA 2XTJB 4NRZA 4WFGE 3RTLA 3BUDA 4LHJB 5D1ZD 3CBRA 1DO6A 2VUYA 5KBPA 1CIDA 1TDQA 5C0ND 1E4WL 1PZ2A 3P9LB 1TKWA 2EE0A 4FEMA 4JN2B 4YN3A 4BK5C 4XPGH 4JLRB 4LVHB 4LLDA 4MNGA 4AG4L 4L5FE 4FKKA 5FYLD 1WCBB 4HPHA 1BLNA 4G8FB 2ZSVA 4KUZL 5HD8D 1FRGH 4YDIL 1ZY9A 3EG9A 1MDTA 5SWZA 1NMBH 1OTUC 2W0PA 3SO3B 4YXLL 1BG1A 3DRQA 1GY1A 1NM9A 1ZTXL 2CLZB 3DIDA 3S3SA 1KBGL 3O0LA 3MNVB 1JXGA 4M9PA 2BOCA 4F2ME 1N4XL 2A9NL 1JYNA 3MRNB 5BVPL 1O7DC 1V05A 3FF8A 1ZHKA 5JQIB 4KJQC 1A0QL 3CDGA 3RVWC 4B0MB 1QATA 4M6NL 4LCYB 2DB8A 2JCCB 4LE8A 1KFAH 1MFAL 1IILE 2WB7A 3I02A 4PWJA 5CEZE 4X4KA 5DS8A 2HFGH 2VMEA 1F90H 4PJGA 5F7YC 4CVZB 4EBQL 5TF1H 5AKRA 3X1EA 4OGZA 4D0BB 5IF0B 2Z31D 4XNZC 4HKXA 5ICYA 1XF3B 2IJ0C 4G43A 1JPFA 4W9GC 1UKTA 2J56A 3PUUA 4MA3A 4AUUA 4B9GA 4M8VA 2NNCA 4ZRGA 3HMXA 4YAQB 1XIWC 5KVGL 4Q9QL 4I2XE 2E74C 3WELA 1MJUL 4LCWE 3QQDA 4KTDL 2Y7SA 3CUPB 1AQ8A 1J86A 4PB9H 3L4XA 1E7UA 2DDQH 4Z7UB 3X1BA 1P69B 1CE1H 1GHFL 1VFOA 1R6VA 3MUHL 2AJVL 5D1QC 3S97C 3ZR5A 3N55A 4HIQA 1KT2A 5AAMA 4N2OA 3TWYA 3FB8A 4RA3A 2YHGA 4FXTA 5DC2A 5FM4A 4FTVE 5C7ZA 1KC5H 3PNRB 1WUZA 5D6CB 5IMOA 1BJ1H 3QS2A 3EH2A 1B0GA 2B1HL 1SDYA 1XR8B 3ASNB 1EDYA 2C3WA 2EDFA 3ATDA 2JLLA 3AXIA 4PG2A 1HL9A 4L9DA 3I3DA 1T0MA 3ULVH 4XVTL 2A83B 4GRMB 5KBLA 3F6JA 1EZLA 2NX5A 4W9HC 1DL7H 4BFOA 4IRSB 3D50A 1BFOB 3CC1A 5CNHA 1CZ8H 5EBWB 4AQ1B 3H2QA 4AQAA 4XZ4A 1BV8A 5EZLB 1NQBA 3ZQWA 1D9KA 1K5NA 2OR7A 3FYEB 5E6UB 4GBXA 4AM0Q 2HKAA 3QXDB 3SE6A 4BBWA 4C8XA 3UBGA 4ZMAT 2VDNL 3AREA 4NENB 4ZFOL 5KYYA 3FOLB 4UIMA 5GISH 4CN6A 3D34A 3N6YA 4JPIA 4NM8H 5TK2A 3S2CA 1ZHBB 5GS1C 4L29A 3SKOB 4C83B 2PPDA 4RISH 5KOMC 2BDNH 2VSCA 4AKPA 3IGLA 2KZ1B 3MKGA 1FFOA 2YPKB 3BZ4B 1DCLA 2GHZA 2J71A 4JW3A 4EO5A 4ODXB 1NLDH 3VXMB 4XNDA 1RHHB 4LHUA 1KJMA 1KYUA 3RHWK 1MHCB 3ALPA 4QXVA 1JE6A 5FHAL 3UBXG 2FWSA 3K6DA 1DJSA 2ZF9A 1G5AA 2KI6A 4PJXB 1P1ZA 1RZQA 2BVPA 2E7DA 2CRMA 3ILPB 4DZBA 4X6DB 4D9QD 1QTPA 1NCOA 1BZQK 1NGWB 4XTRC 4Z3EA 12E8L 2N7SA 1HEHC 1EEUA 1QLRA 2B1AL 4XCEA 5T3ZH 3ULSA 1UG9A 5SV4A 1DLFH 4UDUB 4Z1PA 4G1EB 4YSCA 5KJRL 5ESQB 5L2KE 4I89A 4TRPH 5DRZB 1NAMA 2FEEL 5D1ZI 5HI4D 4PJAA 4E9RA 2IPTL 2WO3B 1I7RB 3PP3K 5D4IA 3EOYG 1J9RA 2FR4B 4I77H 3BZEB 3RX9A 5IHUH 1KCVH 4Z7VE 5JPMC 3EJZC 1XMEB 2YKKA 2X4NB 4JFFA 1YJDC 5KVEH 5MEPB 1NBCA 2XFXA 4XPFH 4NQED 3RAJL 5DTFA 5AYQA 3HC3H 1T80A 3QHFH 4FLOA 1MHEA 3S3BB 3WTXA 5HDRA 4HSCX 1CDGA 1CFTB 4JPKH 1OQXA 4P4KA 3QXAA 5C9JB 1YO4A 4IKJA 2WXFA 5DQJB 3ABKB 3SSGA 3RHWF 4JFXA 3KLHC 3NEEA 1JPGB 4HHAB 3L3KB 4AIOA 1N6UA 4F7MB 1OSEA 1WP6A 3QJSB 2EDYA 2OMYA 3DYOA 1HYRC 3OHXA 3S5YA 4NKMB 4LCVA 4PJFA 1BBDH 4KITB 1ETZB 4FXGB 4WV1C 4ZUTB 2F7RA 4QXUL 1A6TB 4FD0A 5EIVA 3FTGA 1T5WA 2Q6WA 3MRGB 3TT1L 3KDMA 4LCIH 4WVRA 3MN8A 1E9OA 2UZYB 3CWGA 3IE4A 1LNUA 3EH3B 5FLUA 5FX3A 4KK8D 4NRZB 3I6SA 3RPKA 2NLJA 3MRHA 4KDTC 4R26L 4PJ9D 4J1UA 4GSUA 5AQ0A 3GLZA 5DJAA 5DMGD 3JYBA 1TKWB 3ETBJ 3GYRA 3P9MA 2PWHA 5JQHC 3WHE0 1YAIA 2R7EA 2HT3D 4LLDB 1QSFE 4MNGB 2NNRA 4BD4A 5J1TC 4RFOH 1BLNB 3FS9A 3MO1A 2ZSVB 2FECI 5E8DH 4CRPA 3HPLA 3D4CA 3EG9B 4M5YL 4UT9H 3OZ9L 5SWZB 4X6CF 1Y6NR 3EOBA 2XNAA 3Q1SH 4YJZL 3QRLA 1XH1A 3DRQB 4G6JL 4XMLH 4UT6L 2HFTA 2R0WH 4NXKA 2BOCB 4P23C 1T7YA 2CKBA 4J3BA 5I8OH 4FN0A 5KWYC 3JVFC 1J5OH 1OF0A 3OXSA 4HISA 2ZE0A 4YDJA 5EU6A 1MRDH 6CGTA 1ZHKB 1KCRL 3IU4L 1DEDA 3CDGB 1P4LA 5ANME 4I9WD 4MQTB 1PZ5A 3I02B 3ZE1F 1BOGA 1FLRH 3EF7A 5DS8B 4B9CA 4A04A 4PJGB 1BM3H 2XHNA 4JAMA 4TNFA 1TQUA 5CLTA 2YSTA 2HTKC 4JE4B 1ZS2A 3U1SL 3T9WA 1A6PA 4HKXB 3S35H 2J5LB 2VAAA 3ARGA 5ICYB 2I60L 2NY0D 4G43B 1JPFB 3AFLA 1MFVA 4IRZA 3GS7A 4P5TC 3N44B 1AZRA 4S1SL 4MA3B 4J8RA 1BF8A 3FO9A 5IM7A 4U49A 3WKQA 4ALAL 5F97E 3LTVA 3CVCA 4JO2L 3QQDB 2DZEA 5LG1A 5K93A 2FWUA 3U6XA 5E9NA 4WUUD 4XNXL 1SHWA 2HFEA 2MTAA 3FQUA 1KT2B 4JJ5A 1CIUA 2WQXA 3IMRA 4Y4FC 5HGGS 3FB8B 4XVUD 3FTXA 5IBLC 4BHUA 3HZVA 2VLKE 3VGDA 3T0VA 3GMMA 3ZHDA 4LSSH 4U2ZA 5IMOB 1BMZA 1B0GB 2BVYA 4FFVC 4IBSA 4HJJH 4N20A 1PAMA 3V6ZA 4PHZA 3P0VH 1T0MB 4RA0C 4LLAA 1I9IL 2NX5B 3QRGL 4AE0A 3MXWL 4HIIA 4BQBA 3I6LE 5FKPB 3NIFB 5LJYH 3L3IA 1KJ3H 1P4IL 1JK8A 4QRPE 5T5FL 2DQHH 5JYMA 1NEZA 4AQAB 2DLFH 3T2QA 4HCRL 2Y5QA 1D9KB 1K5NB 4GBXB 3WDJA 1R3IH 1G1CA 1U8LB 3IETA 1AANA 3AREB 2VDQL 1AY1L 4X5QA 5KYYB 5AKSA 3A6CL 4JPIB 5KVDH 4L29B 4O02H 3BWZA 1SPDA 4DPAX 5FYKL 2KPWA 1B4LA 3VD9A 3S36L 4NN7B 1FFOB 1MIEH 1BP3B 2N01B 4G7YH 4XB3A 4HGKC 4FQIH 1DVFA 5CU9A 4LHUB 5AVXB 1KJMB 4PRIE 3LZFL 1UM6L 3R8BB 5F7WC 5FUCC 3WJLA 3K0WA 5ITFA 5I8CA 2WO2B 3VXMD 1P1ZB 1QKZH 3MLTA 2BVPB 5FYJD 4BWTA 1E2ZA 3HAEH 4DZBB 4F92B 4H4NA 4OD1L 3NJGA 3GI9L 2AJXH 1CD8A 1QLRB 4XCEB 1QTYT 3ULSB 1NWPA 4ZMOA 5B8CC 1WWCA 5CZKA 5GZND 2YRPA 1JMZA 3K4AA 3M07A 2BCMA 3BT2L 1YNTA 3DX1A 2O6EA 4GI9A 3ZYIA 2VDLL 1NAMB 3IDXL 3MGAA 2WQ8A 4PJAB 4KKBD 2MQCA 4AYGA 3T09A 1CDBA 5F1OB 3WE6A 2JIXA 4E42A 5JW4Q 4EXPX 5JIPA 2F5BL 2FX7L 4JFFB 3O8XA 4GKZA 4OH2A 2XFXB 5DTFB 5JXAL 2B5IC 2MKWA 3L1OL 1MHEB 4B9ZA 5C0EA 2V6HA 4P4KB 3TVMA 3QXAB 2XA3A 5E00A 3O6FC 2PTVA 4FQLH 4JFXB 3ATBA 3FBQA 4HLZG 5I75C 1P5UA 1I9RL 3FUFA 5EEXA 2QGDA 3LQAL 4HC1L 5CJQH 4UOJA 4D9LH 4KVNL 4XOEA 2OMYB 3FCSB 3LEVL 5SX5K 3HC2A 5T5NG 3OHXB 4P4RA 4BV1A 2KHAA 3TBSA 4PJFB 2YWZA 2WQUA 5I30H 4A2MA 2ORBL 3GUFA 4X7FC 2H47C 2J72A 3PHSA 5T5NF 3WKMH 2XIDA 2DQTL 3FTGB 3AM8A 1T5WB 2Q6WB 3SGKA 3KDMB 1TTBA 2V3DA 3MYZA 1E9OB 3Q3GA 1AD9A 2AGJL 2QQNH 4OUOA 2XC8A 4AZ8A 1LNUB 2IIJA 2K7PA 2YA0A 4N28A 4S1DC 5HYJE 2ZKYA 4A1RA 2NLJB 3L4UA 3MRHB 4L8BA 1KV7A 2BH0A 3O45A 4J1UB 5DJAB 4HQQL 2X42A 3W0WE 2ZWKA 1T1ZA 3P9MB 4ANVA 2ZD0A 5DUPL 3DHPA 3GPEA 5AB9A 3OJVC 2R7EB 4HS6A 2ETWA 5I76A 3D7PA 1OGTA 2VLJE 1QW9A 3MO1B 4I7ZC 3HPLB 5HJBA 4I18A 1CGYA 3EOBB 2XNAB 2WXPA 4XP1H 2DI7A 1YEEL 4M7ZB 1CGTA 1JVKA 5TQ0L 3ALXA 4JY5L 2CKBB 3NCYS 4M43L 2VLLA 3D06A 3OXSB 3DVFA 4FEIA 4G70B 2IH8A 1G6RL 4YDJB 1IKNC 5EU6B 1UH3A 1Q0XH 3E3QE 4LO9A 5FGRA 1P4LB 2DD8H 2B1OA 4BFJA 4Y5XC 1M6OA 5C70A 4U7SA 1HL4A 1JNNL 2E7LC 1CC3A 1PZ5B 1BOGB 2CJUL 3V4VL 4C4KT 1AKJA 1UT2A 4JAMB 2QQLH 1ET5A 3LS5L 1S9VA 2ZOOA 4XNUL 2OJZL 1IGMH 3NPZB 3OB8A 2VAAB 3ARGB 3CZUB 3TNMA 2C9UA 2OMXA 2P1YA 3IDIB 3STZA 1KEML 4NBZB 4HBCH 1AR2A 1E4KC 4R4FL 5HHMB 1S5IL 2CO3A 4KK9D 4M8RA 1ZLVH 4J8RB 4K2UH 3QQ3A 1JD7A 3GK8L 4F3FA 3FO9B 3ZDYB 5IM7B 3ZJAA 4OZHA 2LTQC 2PTUA 3BUYA 5F6IB 1CD0A 3INOA 4YK4B 2P5WA 1CCZA 1W0WA 5ANHA 3K0YA 3WFHA 2G60L 1V8HA 4F2EA 4RGNC 2ZYRA 2HFEB 4RRPM 1QBMH 1XO8A 3FQUB 4JJ5B 1MDAA 2K8QA 3H3PH 3MV01 5E9AA 3WTVA 3HZVB 1CLZL 2VLRA 1IL1A 3OSVA 4AOFA 3GMMB 2WM0A 3K4DA 1HWGB 2HN7A 3UTSA 1FGVL 3B56A 3CZLA 2YD7A 2DYRB 3V6ZB 5JHMA 4E9VA 3KE0A 3QEUA 5J13C 4A2EA 4HIIB 3MLYH 4ODTH 5DD5L 1RVFL 3D4ZA 3L3IB 4M3JA 4BSJA 2JELH 1JK8B 1ZDSA 3B3IA 4A6YA 5E4OA 4ELMA 3UAJA 4DTGH 1NEZB 4FG0A 3U0TA 3ZL1A 1U8CA 4U3CA 3KVDD 3WMPA 2IGTA 3KBFA 2EABA 3ESUF 1UZ8A 5LAXA 4FQQA 3F12A 1KN4H 3IETB 3PFQA 3BAWA 4YVUA 3IJ7A 3FN3A 4PMFA 1A6AA 1FNFA 1D9KD 2IO5A 5FYLH 6FABL 5I71C 1P2CA 2EIJB 2Z6FA 1UXMA 3WS6C 1MAML 3HFFA 3QIBD 3RWIA 5DC9B 2Y24A 4YUEL 4KX8A 2XWDA 2LABA 2NY5H 4D2NA 4DP8X 2YA1A 1QUNA 3LIZH 1X9UA 5ESAA 1DVFB 4J3OG 4O00A 5ISZE 3NJHA 5B1JA 5L8KB 2ZCZA 3UMNA 3WNIA 2A9MH 5ITFB 4DO4A 3V4PH 3EJPA 5DRWA 1LQSR 3MLTB 2XQBH 5G5DA 3T8VA 1L9MA 2ZUWA 3ZDXF 4A7TA 4X5XA 4PJ7F 7CGTA 1XGRA 2F8OA 1X5YA 1IAIH 4HSAC 1CXFA 3ZE2F 3ZRSA 1YNTB 3EH1A 1EA9C 4QRBA 2X87A 5D1XD 2QV4A 1JXJA 3ULVC 1JZHA 5J12C 4YGAB 3ZPDA 1HKFA 2IOIA 3WE6B 2JIXB 3BPNC 4E42B 1HZHL 1MJ7H 1OAZL 3QI9A 5JDJA 1ZT4A 3L3OA 2K3TA 5T33L 5DK3A 4K7PL 3O8XB 4GKZB 3M7FB 3VDBA 2R69H 1IQWH 4CBZA 3B5HA 2OM5A 1BZEA 3BUIA 4H7VA 2O5YL 4CAGA 4QD2E 5C0EB 5JXEA 3U0WL 1MHHA 5B3JE 3TVMB 2EDJA 1MWAL 2LU5A 4OQTA 5E00B 1MCSA 5DS2A 4GSQA 4JL1A 3D3VA 1P5UB 1VCAA 4LARL 3MBWA 4BWWA 4MB5A 5JHAA 1OXYA 1GMIA 1ZPLA 1BQ5A 4UT7H 2Z1PA 2DQGL 4U1IA 1GAFH 3B83A 3G5YA 3TT3L 2YO3A 5AZUA 3M7OA 3O3BA 4P4RB 4O5LH 1X3DA 3TBSB 3ZIMA 2EDDA 1IC5L 4AJWA 4Y0GA 4PVNA 2XT1B 1GCFA 2VDRB 4LNVA 1CXEA 2E27L 4KHTH 3BLPX 4MD4A 1AQKH 1T03L 1DCEA 3B9EA 1RU9H 3Q3GB 1AD9B 4B5ZA 4MAYC 1YMMD 4AZ8B 4YDVA 5E2VH 4MJ2A 4L8BB 5MERA 3P3TA 3MTRA 1J11A 3O45B 3KZ8A 4LLUA 5EIIA 4CGTA 4KQ0A 3P11L 1JZ5A 1DDTA 1T1ZB 4KQ3L 1I75A 3AMLA 4GW1A 5T1LD 4HS6B 4R7LA 1VHPA 4NUPA 3SE4C 2X4PA 4HKBA 4U7KA 5I76B 1IM3A 1OGTB 2EICA 2P5EA 3B1TA 5DR5L 1MCLA 3HR5A 1XGPA 1W72L 2X9YA 3OLIA 1SLUA 1UC6A 3EUUA 4ZMVA 1MJ8H 2O1AA 2QPDB 2BP5M 4I18B 2CJ3A 1CFBA 5L7XL 5HPMA 1H3WM 2ED6A 5F3FA 5F7BA 3T0AA 25C8H 2VLLB 3HG2A 1LWRA 4W9ZA 2H0EA 1P5VA 4RDBA 3TYGL 5I15L 2X0VA 3CIQA 5GGTL 5ALBL 5BS0D 1M6OB 4U4IA 3NDZE 3ZZLA 4DEUA 3WNJA 1P4BH 2NY4B 2P26A 3V4LA 5J6GA 3PWLA 2FVNA 1AKJB 1B0WA 5TE4L 4Q2ZA 2OP4H 1F0LA 4DAGL 3DHUA 1S9VB 3PP4H 2WBJD 3TNMB 2OMXB 3STZB 5MEOA 3TX4A 1AG0A 4BUQA 2WWNA 1E67A 3D2TA 4IBZA 2WNXA 3QQ3B 4GG6F 3BP7A 4F3FB 2AQSA 5I17A 3F00A 4OZHB 3BUYB 4LSVL 3KAAA 2P5WB 3NH7L 2CCVA 1W0WB 2ZP8A 4DGWC 1CF8L 3WFHB 1UWEH 4JEGB 4OLUL 5AWNH 2A6KA 3QUZC 1VJSA 3N1FC 1F3DH 5AG9A 5J06A 4ZTPH 1LO2L 4K5LA 2A1WL 5HVHC 3HUJF 5IB2A 2AJSH 3QDME 2JLPA 4NZ8A 1TITA 2VLRB 4KPHH 1IL1B 4YHML 1HZLA 2A6JA 3QH3A 2HN7B 3UTSB 2E76C 2A9DA 4DGIH 4F58L 5C0IA 1AO7E 4JPVH 4Z3GA 4YZFE 2J57A 5AALA 3A4FA 3QEUB 2FSEA 2FH8A 3QFJA 5L4IA 1A65A 1P4UA 1Z5HA 1SQMA 4YX2L 3BISA 3QR1A 3B3IB 1DQIA 4A6YB 4BFEA 4ELMB 3KJ4C 3IBEA 3U0TB 3V0HA 1F45A 1SOQA 1NGPL 1U8CB 3BHBA 2VQUA 2YN3A 3ZYOA 5GJSL 3PREA 1FA4A 2GY7B 2D3NA 1JGLH 1UZ8B 5DJXA 5LAXB 4FQQB 3F12B 3VA6A 4HP5A 3ZUCA 1S8DA 1A6AB 1EMTH 4ZFOA 1NCIA 5AOJA 3HE7A 4CU7A 1SF3A 3ZT6A 3MV7E 3KMDA 3UMTA 5DJ2A 1P2CB 3VFPA 4DVBA 1NOFA 1XHHA 4LVNC 4TF4A 2R29H 1YG9A 1N68A 3RWIB 4AYID 2FBOJ 1J8HD 3BKML 3CV5A 3EFDL 1QUNB 2CJTA 4ZAKC 3RVUC 1NIDA 1JZ4A 3K3QA 3UEZA 3UYOD 2A99A 2JJTA 4BH7A 2BVEA 1QBLH 4YL4A 5CSZA 1DVFD 2C9SA 2OZ4H 2ZP9A 5TPWH 3MJ8A 4G83A 5DRWB 5DSCA 3V0AC 1U58A 4F93B 1CXLA 3U9PL 4ANUA 5G5DB 1WIUA 2HRGA 3BLBA 4UNTA 5DLML 4D7PA 5C6PB 1S7WA 5DZPA 6PAZA 1MCRA 3QDGD 4X5XB 1XGRB 4LT7A 2YUWA 3VFMB 3W57A 4DCQA 4EDWL 2WP3T 2QVMA 3D9AL 4UUJA 3UOAB 5IY5B 3ZQXA 4AUJA 1YQ2A 4KX9A 4FP8H 1I8LC 2VXVH 2ZQKA 3GIZH 3MLPA 2ENPA 2GHWB 3QI9B 1KBKA 1UVQA 1ZT4B 3L3OB 3Q06A 5CR1A 2P5PA 2VWEC 4JDEA 3BCDA 3KLDA 4DKEL 5BQ7A 1IGYA 1UKQA 2V8MA 4ABVA 1JZFA 4LDEB 1WZ1L 4FA8A 1FBIH 2GSMB 1NCWH 1A4BA 2FYVA 5IROD 2P28B 4N2KA 1MHHB 2GTWA 3O8XD 4K0OA 5E0QA 1IAIM 1X4ZA 1NAKH 3AXHA 1V10A 5JIMA 4QRFA 4OKVA 3D3VB 2YJLA 3MBWB 4L9LC 4E41E 3BDYL 4JE0A 2V4LA 2XOTA 2WYIA 4U1IB 5DF0A 3G5YB 4LEXH 5F0MB 1EZSA 3VB9A 2WZAA 3QBTB 3O3BB 4NLAA 3C60A 1TQCB 1DJIA 3RWJA 6TAAA 2ZXCA 3SOBH 3NSJA 5KSAA 3N85H 3TOPA 4ECNA 2YUXA 1CVSC 3GBDA 4MD4B 4OSUH 1NMCC 4XXCC 4DW2H 2W80C 5ADOH 2H32A 3QORC 4YDVB 3LKNA 1E7VA 5E95B 3FMGH 4M7JH 1YQVH 1U92A 2E3VA 1NC2D 5DXWA 4PJCA 1K72A 2Z4QA 5MERB 1Z66A 4LLUB 1YCSA 1GGIL 3FB5A 4OZ4A 1YEHL 5EIIB 4FX5A 2MPAL 5L6YH 5ACMA 5T1MA 2B2XL 3P69A 4GW1B 5C2BL 1LILA 1RJLA 2EO9A 2X4PB 2YSSA 4HKBB 2A0LC 1IM3B 5FUZL 5TFSH 1MJJA 3CHXA 2P5EB 3QWRD 3C8HA 4NQVA 5EBMA 1TJHL 1YC7A 2XKSA 1XGPB 2BIHA 3A23A 3HR5B 3OKEB 1M05A 5JOEA 3CZSA 4XMPL 1AP2A 3HZKA 2KUTA 3DI3B 5HPMB 2P47B 1UHVA 4UT6A 4KO6A 1F6AA 2JKXA 3MV9E 1YNLH 1P5VB 5E7FA 5LKNA 1KIPA 2UZIH 4RIRA 3WEBA 2EDOA 5MHSD 1E4XH 2TSAA 3FK3A 2GEQA 5I0DA 4PW3A 4UBDC 3WBDA 4ZO8A 1WIPA 4Y8DC 3PWVA 3LZPA 4N8CH 2D03L 2VW7A 4ZI8A 1C7SA 1PLBA 5CJXC 5IFJA 2BERA 2UWEA 5J6GB 5C07E 3VFGH 1RULH 3ARBC 5TD4A 3VD3A 2GI7A 1BAFH 1G94A 4NQQA 4Q2ZB 3TWCH 5GZOA 1OE1A 2Y2YA 1TVBB 3RUGE 3US0A 1N9PA 4X42A 3RYMA 2C9VA 3B2XA 5D7SL 4YDKH 5MEOB 4BZ1H 1AKJD 1XSOA 1RUML 5IMMA 4BINA 1X5KA 1OGAD 5D7JC 3BP7B 4WO4A 5I17B 5CM1A 1TF4A 2HVKA 1A7OL 4OF5A 1MRCH 1QFUL 5E8PA 3L16A 4DPCX 4K55A 4N5ED 3VG9B 1RPUA 1WS8A 5E1AA 2A6KB 3IAPA 3GKZA 1D3CA 4L4TA 2P5WD 5D96B 5D7LE 5IB2B 3D51A 4FNSA 3V55A 4WWKA 4KVCH 2A6JB 3O6KL 4OBSA 3QH3B 1GJIA 4I48A 3IKCA 4X4ME 3TBYA 1B4JH 2BP0A 1NZRA 4J4PA 5C0IB 4IGBA 3L1EA 4RFNC 1KXQE 1NGQH 2VLRD 2ADFH 1TVDA 3QZPA 2FSEB 3QFJB 3BPLC 3QZNA 1OB1A 4JY4A 5FCUH 1OPGL 3VGGA 3L54A 5LGJA 5I8CB 4JZJA 5T5FA 3BHBB 1ML0A 1X5HA 2EEXA 2IH3A 2WZ0A 4HCRA 3I50H 4XZUA 4O58L 3I9IA 5DJXB 1S8DB 2DAVA 4WNJA 1OSYA 4WU5A 3NUKA 4M61A 4ZFOB 3HE7B 4XO9A 3UZQA 3I6GA 3PAVA 4U0RC 1S7SA 5DJ2B 3D25A 5K33A 3VFPB 4DVBB 4XO5A 1SXZA 1JZJA 5EF1A 3RX5A 3SYAA 1KTKE 1J5CA 1J9SA 3NJFA 1JJUA 4BZYA 2QBWA 4JO1H 4QPEA 5TE7H 5DD0H 2MOQA 4ZX5A 1FL6A 5B39G 5C0AE 3CPLA 5E56A 4BH7B 5IV2A 3T0EA 1GMEA 5CSZB 2GW5A 4NAMA 3MJ8B 4Q0XH 5DSCB 3B4NA 2W5PA 1U58B 1LM8V 2ICWA 4YDZA 4XODA 2OX5A 5CCGE 1GZPA 1XX9C 1S7WB 4KK5D 4RDQF 4NQDE 3I9GH 2C4FU 3P0GB 3QNFA 4DCQB 4OGXH 3HLAA 3LB6D 3MCLL 4UUJB 3LSOA 4X6EA 2W59A 3NCXA 1BREA 4UWQB 4Z7IA 1K3IA 2A77L 3BO8A 2BNRA 1DJYA 2VN5A 2F68X 4X8JA 4LESA 1UVQB 3CFDA 3REWA 4JDEB 4K3GA 1UXLA 2Z8WC 4YMPA 5BQ7B 2BHYA 3AACA 1IGYB 2W94A 3TYFA 2TRYA 5C0NC 3HMXH 2ZCKH 1MSPA 4A7GF 2GTWB 3GBEA 2D7PA 3AWGA 4OT1H 4Y9GA 3O0RH 2HP4A 5HD8C 4OKVB 3L4YA 1KWKA 1MHPH 4BJLA 2NY5C 4GKLA 3JTTA 4HC1A 3R8QA 4C4UA 4UQBA 3KWTA 3H4FA 3OKDA 3C60B 3H9HA 5AVRB 4YSSA 3RWJB 3BUTA 3ILQD 2RA1A 3MRJA 5MEND 4FL4B 3VW3H 5KSAB 2WOYA 2XTSA 3W11D 4JDTL 3T1FA 3BP6A 3GGWA 3M8OH 1LP9A 5D70L 5DT1L 1F02I 4NO2A 1W8EA 2H32B 4OF8A 1BZ8A 1B2WH 1I7ZA 4I3SL 4I3RH 3LKNB 4FKHA 3WFEH 3PRZA 4YHLH 1U92B 2XXCB 4F7PA 2YXMA 4PJCB 1U3HC 2Z4QB 3FB5B 5B7EA 2NY1B 4OZ4B 5ALCL 3ZSSA 1E8WA 3NN8A 4TV3A 4M02A 4GW5A 5T1MB 4IIZA 4EN2A 5J1AA 4XPBH 1RJLB 2DIBA 2XZAH 2ZF8A 2YSSB 2PKDA 5FHBH 1G9MH 1MJJB 4NQVB 3NFSH 1BVLA 4JFHE 5EBMB 3B9KC 5EZIL 4OZIE 3QDJE 4R2GC 1KENH 1NFAA 1M05B 2FNBA 1VZIA 1S3KH 3LYRA 3MCYA 1AP2B 4R9HA 1YEIL 4M4RA 2APBA 3HZKB 1IM3D 3EYUH 4R7DA 2YN5A 2Z7WA 1F6AB 1T2JA 1UA7A 3MRBA 5LDUA 3D4GA 2X2IA 3L5WA 1KFGA 5HI5D 4D3CH 4FQ1L 3A5VA 2EDXA 1MFMA 2R0ZL 3NOIA 1KIPB 5G2NA 1P9MC 1G6RA 4RIRB 1IC7L 2BVTA 1KBBA 2HLFD 1UJ3A 4O4YL 1EO7A 1KIQA 2DJSA 3PWVB 4JUTA 4FNPA 1OAQH 1VPOH 3A3YB 3KPRE 5IFJB 1P7BA 2UWEB 3Q5YA 3V4VA 3CHSA 3NT0A 1O9VA 4L1HA 4EN3A 1JGEA 4EI6A 1T0OA 2NXZC 3Q6FA 3D30A 4FI7A 2BRQA 4N2CA 1DBBH 2X88A 5EF2A 4N0YL 4HEME 4MA1B 1NAMH 5KTEH 5IUSA 4P2RE 3VXUA 3WN5A 2NYZA 5CUSH 5IMMB 3VI3A 1TTGA 1MQ8A 3V7AG 2XX1A 4WO4B 2E8YA 4OB5L 1RUQL 2HVKB 3VXSE 3WO4C 5HHOE 3MLVH 5E8PB 1LO4H 4KJWC 4NCDA 5IESH 4BSWA 1CYGA 2LV4A 2NCEA 2Y6TE 3TF4A 5E1AB 4MNHA 3X3FH 4L4TB 3K2MC 4Z8FH 4JO3H 4TUJA 2Q8BL 3KWXA 3WI9A 4Z7NF 5ESVA 2XG4A 2YAMA 4WWKB 2FL5A 2GPZA 4BKTC 1QPKA 4WFEE 5EO1A 5IR1A 1K8DA 4I48B 3QZLA 5J3HC 3IKCB 4N0FA 5SWSE 1U41A 4KHXL 3TBYB 2XPYA 2BP0B 1X5FA 5I1IL 1RH8A 4IGBB 4M48L 5FPIA 1NDGA 2IMMA 2EDWA 1OB1B 1W16A 3BLKA 4JY4B 4PJ6A 4ZXBA 5E51A 7TAAA 5LGJB 4BK8A 5H8DA 4JZJB 1S9WA 1DO5A 1CB4A 4NHCL 2MH4A 5E6ZA 2IH3B 2F19H 3VXNB 1QMUA 4W9FC 1HL8A 4XZUB 1NFIA 1NIFA 3UO1L 1RLWA 5BZXA 3B43A 1KSRA 4WU5B 3ZTDC 4FMVA 4M61B 4BZ2L 3UZQB 3I6GB 5BMFH 1AZNA 5AYTA 1EEYA 1S7SB 4UQCA 3D25B 3VXRA 3WFDL 1U8HA 3A4AA 5GJTL 1NCBH 2KYIA 3VGEA 1GZHC 1SXNA 1NPUA 2Q87A 1JI1A 2JB5H 2O6FA 3I75A 5DJYA 3AJ7A 4MMYA 5CCHE 2EYSA 3C5ZA 2F74A 4CGUB 4KRPB 5DA0B 1FL6B 3FUDA 3GZPA 3CPLB 5IV2B 3T0EB 3KXFA 3NQIA 3F7PC 4MRBA 2CKBH 4ZOBA 4URKA 1MCKA 2OR9H 2ICWB 2ZWYA 3HG1E 2R51A 2C9AA 2OX5B 1GZPB 2YPLE 3BGFC 3BH9B 3IN2A 3QJRB 3MBXL 4GQ9H 4QRQA 3GFUA 1Z0MA 1A3RH 5FYJU 4LPVA 2F54E 1U4FA 1Z0NA 2DRUA 3GNML 2XI9A 4PWKA 3HLAB 4BELD 4YWGH 4YEFA 5J1SC 3LSOB 4X6EB 3ARDA 3JT0A 4KO7A 4MQSB 1ODUA 5JHLL 2VDLB 4IIQC 1F11A 3CBKB 2FJSA 3ARSA 3BO8B 3PWUA 4D9RD 2BNRB 3U30B 4X8JB 2H41A 5HDQH 5A16A 5CP3A 3WTTA 3CFDB 3PL6A 3REWB 4LDCA 3W5NA 4IRZH 4PM1A 3TYFB 1X7QA 3OB0H 2EDKA 5DMGC 2OAAA 4BQCA 2XTJC 3K6FA 4RH4A 2PMZA 3PABA 3IGKA 1C08A 1F6LL 2I7OA 4PBWD 3L9RA 3U4BH 5T1DL 1MREL 3B2DC 4A2LA 1MWAA 3L5XL 4X9IA 5CJOL 2AK4D 2B14A 1A6WL 4LEBA 2EIKB 3UERA 3W2DH 2UY6A 2QKIA 1JWUA 4LVHC 1U21A 3IDNA 4MS8C 3L1FA 5KYXA 3JTTB 4KO9A 2DQIH 1E5BA 1XWVA 1ZV5A 4NCC2 3OKDB 4FJ6A 3H9HB 1X5LA 4OCWH 4GAYB 4H1LA 3P3SA 3SO3C 3MRJB 2V8LA 2DM3A 4M6OH 4EQ3A 2MEJB 4AGOA 2DYPA 2E0PA 1OP5K 3T1FB 3BP6B 3GGWB 4UV4L 4MXQD 1LP9B 2YD0A 1A4CA 3S36X 4JFSA 4NO2B 1M2VA 4K3EH 3O2WH 4YHZL 1I7ZB 4UIKL 2CCLA 2GK0A 4F7TB 1DJWA 4HEPA 1ID2A 4F7PB 2CDGA 1LEKA 3TH2T 2VCOA 1GYVA 4OGAC 2RACA 3HNVL 6PCYA 4HZLA 3NN8B 3AMKA 4JR9H 3LHPH 4GW5B 5J1AB 3V6OC 3JV5A 4YHOL 4AJ0A 4AV5A 1ITCA 2OFQA 3DROA 1AACA 2DQUL 4FNLL 2NY1D 1BVLB 4AJYV 3BT0A 1ZSHA 4QTIL 1W72A 4ZZFA 3KYNA 4M4RB 3DDGA 3MODH 4LP8A 4R7DB 3EYVA 2QJDA 3MRBB 3L5WB 2IANE 3NTCL 4HF5L 4QHLA 1U3YA 5EA0L 1SMDA 4LSRH 1EXHA 4J6RL 1IBHA 2EP6A 2XKNA 3PV6A 1G6RB 2LFEA 3U4KA 5GGTA 5I6PA 1UJ3B 4XVUC 4AW4A 2UUDK 1O75A 2PO6A 2AVFA 4M1DH 3FT1A 1KIQB 3OAZK 1PLAA 4WJG3 1WZAA 1CJYA 1ONQA 1WVZA 2W9EL 1TLMA 2CSPA 3V4VB 2LAAA 5JMOC 4TN9A 3FU9A 5EU7C 3WMSA 4EN3B 3SKJH 1JGEB 4EI6B 2KZWA 3Q6FB 4OU3A 1MFNA 1D6VL 2TSBA 2BNQA 1GOHA 4MBOA 4WTWA 4U6VH 5K39A 3VXUB 2FHBA 3SIKA 4NN6C 3WN5B 1YECL 3V10A 4IRSC 1I1YA 4LL4A 3VI3B 5GZOD 4ABQA 3B9AA 3KJ6L 2ZX7A 2VM9A 4H8QA 3S3PA 1HOCA 3A4EA 3QZOA 2OMZA 1TQBB 4GEJA 4NPJA 5AVQB 2PP7A 4BSWB 4UYPA 3TJPA 4MZRA 2V9TA 2N0MA 4HWEL 4HZ1A 4MNHB 1HYSD 4UQDA 2WLHA 1U3JA 3MLXH 4DQOH 4JCMA 3V5HA 4HPOH 1E5YA 1RUKL 3EH5B 4C4KO 3BVWA 4TUJB 3VSQA 1G0YR 1HHJA 5ESVB 2XG4B 4XMKH 3SQOL 4MA8L 5EN3A 3MC0A 3T04D 2FL5B 4IU3B 4JDVA 5EO1B 4L4TD 4PVLA 1K8DB 5IR1B 4N0FB 4MNQE 4QO1B 1FNGA 4QRRD 3OGCA 1G1KA 4HIXL 5LO7A 5JDSB 3ESVF 3TFKD 1NDGB 1WISA 1QABA 4V1DA 4AH2B 3D1MC 4ZXBB 3DPBA 1K4DA 2VDRH 4HIEB 3MRKA 4P9MH 1ZLDA 4IGBD 5IW1A 1S9WB 1OT1A 1IAII 2WBKA 4Y7OC 3BE1H 4Z95L 3G5WA 3RL1A 1HINL 3IWUA 1NFIB 3DX4A 1JRHL 3JVGC 2A4ZA 4FQXC 3GINA 1BXUA 5I19L 2PCXA 4KV5F 4N0CD 1I8UA 4M5SA 5ID0A 2CM5A 2WQSA 1EEYB 1FFPA 4JPWL 3VXRB 4PCTA 4X6CE 4QY8A 1U8HB 1H19A 3BZFA 1EBPA 4LOUD 4H20H 4TSBL 5AW3B 3T6WA 3DX0A 1UZ6F 3I75B 1JXKA 1PD0A 5DJYB 4MMYB 2EYSB 1AXTL 3C5ZB 2F74B 3RDTA 2FRGP 1V3JA 4J3UA 4G7VL 4EZJA 1H6TA 5FYKD 4LRNL 4WW1A 2DL2A 3IS0X 5C08E 1GYWA 3KXFB 3K2UL 4NAQA 4QJ4B 3I2CH 4YHYB 4ZMTA 4KRPD 2GIMA 3QQ9D 2E47A 3GO1H 3ZE1E 5F7EH 4AV4A 4POZD 3WXWH 4X2UA 2ENQA 4QRQB 1NUNB 4IEFA 1BECA 5J9PA 3EBIA 1FH5L 4UU9A 5FM5M 1EANA 3II3A 5DEZA 3N3EA 5DVPA 5F1IA 3ARDB 3MLRL 5E8OA 3RY6C 2VH5L 1CU4H 1EX0A 2ATAA 4Q8BA 1F11B 1PLGH 1DQJA 3WD5H 3BDBA 3PWUB 1MFDH 4FXGC 2ENYA 4I13B 3GBMH 5A16B 2YBGA 5C3LD 3PL6B 3QFDA 2GIYA 2X6AA 3BKJL 2A38A 2C4XA 1X7QB 4Q58C 4KUCF 4H8PA 2DDQL 1P84K 4RMRA 5D72H 2Q2EB 3PABB 1G1YA 1C08B 1B0IA 1XB8A 4NUGL 3L9RB 2XVGA 4OY9A 3U9UA 2ZYSA 1MWAB 5CBAA 1BJ1J 4NQUA 4WFGD 4LQFH 1KC5L 1MN4A 2IBBA 2XN9E 3JV4A 1JWUB 2QKIB 2UY6B 4WHTA 5KYXB 3IDNB 1M9SA 2ZX5A 2MQ3A 4N8VG 1PIFA 2ZAIA 3DJSA 4QCIA 1QLFA 2QFPA 5L88L 3VFRA 2WTPA 1R47A 3SKNA 1Y6KR 3HS8A 1NBVL 2Z34A 3DSFH 5LLIC 4H1LB 5FCSH 1RPQA 4NNPH 3BD4A 4YBQC 2DYPB 5GS0D 1I3UA 4CC4A 3L1GA 1MY7A 2C8NA 1DFBH 2IFFL 1M2VB 5DRXA 3KPQA 2NR6A 1BVNT 2GK0B 4IMLA 2NXYB 3ZTNH 1XCTA 4A6YH 2CDGB 4XWGH 3FJTA 1LEKB 3G08A 4OCSL 1KWGA 1MFEL 2BY2A 3GKWL 3FSOA 4RISL 2ZXWB 4HZLB 4HU8A 1UOVA 3S88L 1IFHL 5GRVL 2O5NA 3QJFA 5D2NA 2EUVA 1B9ZA 5EBGA 4HOXA 3OWRA 2FEDD 2IGFL 3DROB 4IBLT 3DMMA 3O4OB 4B9FA 2QHRH 3TO2A 3HCVA 4Z3HA 1NLDL 4C56A 5IVXF 2MCG1 2J5LC 2VE6A 2G2NA 1WTLA 3KYNB 3KCPA 1FYTE 4WWID 4ZO7A 2XV3A 4LNRA 3CXHK 3EYVB 5KVMC 5E2WH 3P3RA 1F42A 3WNNA 4QHLB 4EKJA 4G9FA 4MB3A 4CMHB 2OYLA 4WY7H 3VA2C 3FCUB 2BIPA 2XKNB 3PV6B 4ZFGL 1X6LA 1PY4A 3Q2WA 4IKLA 2PO6B 1IC4H 3V4UH 4XVSL 3ISYA 5T3ZL 4K7PX 3HNSH 1DLFL 4LCWD 4KY2A 2LLNA 1S2EA 5AAMC 3PPSA 1WGOA 1XF1A 2KQNA 4BFGA 2D2OA 1ONQB 1F5WA 4KXAA 1MH5A 1XFPA 1IVLA 1T6BX 2AAVA 4QKTA 1AGBA 3O11A 3AG1B 1ZHLA 3E8UH 1BOYA 3CN1A 1DBJH 2BNQB 4HV8A 4PG2C 1H5BB 3SGEI 1KXVA 4YNYA 1MCBA 4FTVD 1JGUH 5K39B 2IDCA 3LKPA 1O9WA 1Q0YL 5B3NA 5KVEL 1BSIA 3HOGA 2X2HA 2ZCLL 2OMBA 3QCVH 1TO4A 1I1YB 4R90L 2Y1YA 4K8RH 5J56B 1FGNH 1URIA 1HOCB 1WT5A 3DV6A 2OMZB 4XCFL 5I6LA 4FG6D 4X80L 1D9KC 2B08A 4GBXC 4DP1X 4YC2B 3RZWA 3FFCE 1Z9MA 4DP9X 4OF7A 2WB1A 4OAWA 4XRCA 2Q8AH 3AREC 1QI3A 2NDGA 3AS2A 3V5HB 4MDJB 2EDLA 4J7RA 2FX9H 1GPOL 4OQTH 1G9MC 2B20A 1HHJB 5A7EA 1RZ8A 2MTPA 4RGOH 5JIQA 3CX2A 4JDVB 2VN7A 4NN7C 5G55A 1FNGB 1PAZA 3OGCB 3GHEL 4TTGA 1CQKA 1QPXA 3ESPA 3IJ9A 4R97B 2Z35A 3QUGA 1NC4D 1NCCH 4G8GE 4V1DB 1TXKA 2VMFA 3O4LA 3DPBB 1MXDA 1K4DB 4AGPA 3CLFH 1VERA 3MRKB 1MVUA 4PJ7A 5IW1B 2X2UA 4AYSA 4IBWA 4ADGA 3SEPA 3GSQA 3CSPA 4GXVL 4IRJA 4IQHA 3MLUH 3RL1B 2DBLL 4CN4A 1NIEA 2XTLA 1CFVH 1VGKA 2XV2A 5DK0A 4P48A 1AYRA 2D7NA 3J7HA 3T3MB 5GRUL 5ID0B 3E38A 3U4EA 2NOYA 1FFPB 1WLHA 4PJ5E 1OZTG 4QY8B 5JIDA 2CUMA 4UM9A 1E4WH 3BZFB 1A2YA 1FUNA 3EJTA 3Q1SL 5E5RB 3C75A 1NLBL 4PBVC 2XX0A 4AG4H 3VG0L 1R5VA 4MCMA 4DT2A 1A6UL 4KUZH 4Y5YA 3RDTB 3CZKA 1JTPA 4YDIH 4UCFA 3S34L 1AS6A 1N2RA 1OW0A 4NO3A 4MKTA 4K23L 2J73A 5GGSY 2ADJA 4MZ3A 1MRDL 4GSRA 4YXLH 3WLWD 5ID1A 1ZTXH 1KBGH 4K5NA 1MELA 1N4XH 2A9NH 3ARFA 5DQ9A 4EVNA 4P4KC 1O5PA 3EBGA 5I5RA 1FLRL 2IQAA 4C55A 4EKXA 4OM1H 3S4SG 3RB5A 5EEUA 1A0QH 4IEFB 3CMGA 3ML9A 5I1DA 5I1AA 4M6NH 2CLRA 5LXGL 2AJYH 2DLEA 3PS6A 4UU9B 4GI6A 2V9QA 2GSGA 1MFAH 4XNMA 4Y2LA 2VDOL 1M7IA 2YD6A 5E8OB 5F1IB 3OHXC 4CU6A 1HNGA 4PS4L 4EBQH 1DQJB 2G5BA 4UNUA 4KZEL 2ZKWA 5HHNA 3RWHA 3AT9A 3IJHA 3VFVA 1ZRUA 4F7EA 4L48A 2FLRT 5JIKA 2IV9A 3ARDD 3QFDB 3WKNA 3MNMA 1WFOA 5DUML 1KIRA 4FF9A 1EHXA 1Y18A 3FC8A 4I9XA 4ZUUA 1ZAGA 2ZX9A 2LHAA 1CL7L 4OZGF 5KVGH 4WQOA 4Q9QH 4ZD3H 5KSBF 5F71A 1FIGL 4FOMA 4LLWA 3VQ2C 3U9UB 4KTDH 4LQ1A 1NCUA 1PGRB 5CBAB 1A9VA 5CXPA 1IJ9A 3JV4B 1GHFH 4WHTB 3FRUB 2AJVH 4FQHA 4UILL 1GZQA 2MCPL 3KBEA 4HJJL 4TXVB 4O2EA 4QCIB 1QLFB 3VFRB 4WI3A 3SKNB 1CFNA 3OR7A 2ZXBA 4ZYKA 1QSFD 3RURA 1MCJA 5FM8A 1NPNA 3P2BA 2AI0L 4M7ZC 3LHAA 4Q4IA 2V2WA 2J1WA 3P02A 3NFPA 2E9GA 4XVTH 2COVD 5DRXB 3KPQB 2L7JA 2Q10A 4IMLB 1VFAA 1XCTB 1ZIBA 2G30A 2X9WA 2GK2A 3UYPA 1O7DE 4P2CG 3G08B 3LRKA 4H0LC 5KVDL 3APMA 2EC9U 4O02L 3OJDA 1KIUA 2WAQA 4Z23A 4FAAB 4YPJA 1FZKA 1CGXA 3QJFB 2P49B 5D2NB 4KRLB 3DMMB 1OK0A 2QADD 1MIEL 3CXDH 3HG5A 2BY0A 3TO2B 3ARTA 3HCVB 4GG6A 4UQIM 4LIQL 4C56B 3ARGC 2VE6B 2DW5A 3K74B 1VDGA 1XD0A 3KCPB 4P05A 5C2UB 4K94L 4F27A 3SCMA 3N2JA 3G04A 2W81C 1FO0L 4G9FB 1ADQL 2OMUA 3N1MC 3TL5A 3QVAA 5F6IC 3ZDXE 4YK4C 4ATTA 4OR1A 3HUJA 5FHAH 5SX4H 1WWAX 1ZLUK 2VZVA 2AJXL 2F53A 3LKSA 4DOHB 4LU5L 1AZBA 3ZE2E 5BCAA 1IT9L 1DR9A 4M9OA 2VJXA 3OMNB 3H9ZA 1MH5B 2L0DA 2V17L 12E8H 3NABH 4X9HA 5D1QE 4HGMA 2OJEA 2PO6D 3O11B 4AMKL 4G3YL 5F7LB 2B1AH 2ZKXA 2NZ9C 1ZHLB 4JRWA 1CGWA 2BFGA 2GQHA 3EYFA 4HALA 4HV8B 3RTQA 3T77A 1TU2A 4YNYB 2E9JA 2VYRE 4EJ1C 1V55B 3VRIA 5KJRH 2VLKD 2AQRA 2PCYA 3LKPB 4DN3L 4F80A 1S9KC 5L2JA 2IPTH 4ZPTA 2XWJA 2BWDA 5E4EB 1T5KA 2BNQD 2XFGB 2R4RL 1EERB 1NFDA 2ZUQB 3ARUA 3DV6B 5EMYA 4I4WA 4PJBE 3ZOAA 5EORH 3DARA 3I6LD 3LZRA 4EIUA 2VIRA 3IKKA 5IJVA 3RAJH 4U3SA 1T1XA 4HWBL 4OAWB 4QRPD 1BZOA 4XRCB 3BQUA 2CBMA 4IDJH 4MJIA 4JVUA 4KNTA 5E6ID 3UG3A 4L18A 5IHWA 4PWFA 1RZ8B 5C86A 3V52L 4HKJA 2W0KA 1SYSA 3OLGA 2DN7A 3BWUC 2O6DA 1ZS8A 2OS7A 4WI6A 3WKML 4ZFFA 1JGVL 2FJGA 1DVFC 3GHBL 4NZUH 4ABUA 3PXJA 4HFUL 2DPKA 3UIYA 1HXMA 4PJEF 2Z35B 3QAQA 3Q43A 4JHVA 5GQBA 3O4LB 3WJLC 1QQDA 4PJDF 4QXUH 5AVYB 1PLCA 1MVUB 1TSHA 4PJ7B 3TT1H 3GSQB 2D8KA 4IRJB 1UOKA 2H32H 4KKCD 2YKLL 1BM7A 1VGKB 4HUMB 5DK0B 1OZUA 2N4IA 4XC3L 4XB7A 3U4EB 4BZ2A 1OD9A 1E4HA 4PSRA 3RY5A 2F1AA 3HVDA 5G4OA 4UM9B 1A2YB 1Q90A 1IQDA 1KY6A 2YUZA 4LSDA 4OFVA 4WK4B 4JFVA 2DMBA 4J39A 3APNA 1FVEA 1SGKA 3H9YA 2C7FA 1R5VB 4Y5YB 5C3IA 1PX4A 4KRMB 4M5YH 1N2RB 3QJQB 4NO3B 3AWEA 4P04A 3O8XC 2ADJB 4JM0A 5ID1B 2Y7NA 2PTTA 3RDTD 4KI5D 4NWTL 4TUUA 3ARFB 3E7JA 5DQ9B 4EVNB 1W9XA 2F7PA 4TL4A 4HUUA 3TVMC 5FO7A 2WLMA 2IQAB 1KCRH 1FFNB 1X9RA 3IU4H 1P5UC 5I1DB 4P2YA 3FHEA 1FHNA 5I1AB 2CLRB 3MDJA 4M8QA 4YIQA 2GSGB 3TEXA 5J8OA 3F2LA 4JFDA 4XNMB 5ACZA 1M7IB 1AI1L 2XQ0A 2K4WA 4BA0A 1QTSA 1WO2A 2G5BB 4UV7L 4JFOA 5HHNB 3RWHB 1DBAH 3IJHB 3VFVB 3U1SH 4F7EB 4RX4A 3ZMEA 3AM8C 3NSXA 2I60H 3SGKC 2JTDA 2HKHL 1QI4A 1KIRB 1XV8A 1RZPA 4S1SH 1Y18B 1YYMH 4ZUUB 2PWEA 2HVBA 3E80A 2UXFA 5I8KL 4ALAH 4LLWB 4YZWA 4P9HL 3ZN6A 3INUL 2MCMA 4PJXF 2WW8A 4FQHB 1GZQB 2GC4C 2WN3A 3A22A 4O2EB 2JK5A 1VFUA 3VXTA 1QR4A 3LEXA 3PIQA 1CFNB 4I18C 3OR7B 4ZYKB 3O2DL 1J0KA 2VLJD 5LN8A 4Y4KA 3R4RA 2X6VA 1HN1A 2V2WB 3C6EA 1ZK5A 3NFPB 2DF3A 3BDXA 3DETD 4Y4HD 4IHOA 1I9IH 3QRGH 3MXWH 1YEFH 3JV6B 1SOKA 3AB0B 1VFAB 1J8SA 1P4IH 5JHDE 3UYPB 4ATWA 5T5FH 2PP8A 3MZTA 4HCRH 1TJMA 2X6BA 3CX5J 1WRFA 4L8CA 4W9CC 1KGUA 2CKNA 2IG2L 2NY4C 3OJDB 1JIBA 1KIUB 4PS8A 5HDBF 1FZKB 3ERXA 1QFOA 1AY1H 2CO1A 4Y2DA 4QRSA 2ZXQA 4JRYE 3A6CH 1IBBA 4GG6B 1LL1A 3VXPA 1PZUB 5FYKH 5C0GA 1PX8A 1HHKB 2DICA 3S36H 3SCMB 4YHKL 5B22A 3G04B 2A9ML 2AEQL 3V4PL 1H8NA 4LAQL 5JUEL 2M8XA 4RLDA 2OMUB 5HI3D 3LZFH 1DZ0A 1LYQA 1ACXA 3HUJB 1PFOA 1CDHA 4ES9A 1PZDA 1UT1A 3QW9A 3HE6A 3HW7A 4DVRL 2F53B 4D8OA 4E2OA 3ZHNA 3LKSB 1TEFA 2KBGA 4J28A 1CTNA 1YYLL 3BIAX 3M1BA 1S5HB 1J5DA 3S3DB 2OJEB 2CBOA 3GI9H 3C5JA 4LVEA 4LCUA 1L9QA 4N26A 1F6FB 1KGCD 2NYKA 3EYFB 4A68A 4B53A 4BA8A 3RTQB 3T77B 3BT2H 1TU2B 2HWZL 5AZEH 1CD9B 5DWUL 3VRIB 2VDLH 1XF4A 4KU1A 3IDXH 4LDLB 5IVZA 5L2JB 4FNQA 4DK5A 4N3UA 2B59A 4ZPTB 1IQWL 2GAZA 2XWJB 4QRTA 2TRHA 4HIHA 4TNEA 1NFDB 2XWBA 3WEOA 3T8MA 3E1ZA 2F5BH 4I4WB 3UAJC 3VYNA 2FX7H 3NDYE 5E99L 1P0SE 2VGLM 2APTA 3A6OA 5IJVB 2VIRB 4ONFL 2NY6B 1QW8A 4U3SB 2X12A 1T1XB 2WIMA 5JXAH 3BQUB 3CC5B 3L1OH 4CSTA 4MJIB 4XN8A 1UADC 4UT7L 5DC4B 1GAFL 3WY3A 5KG9A 3VD0A 4WF7A 3DK0A 4H88H 3JQOB 2GVYA 3HLKA 1YEJH 4O5LL 3MLWH 4KRNA 4HKJB 1I9RH 1K8IB 2VN4A 4L1TA 1SYSB 1QVOA 4QOKE 4N6RB 3LQAH 4HPYL 1ZS8B 4YPGA 5K9KA 2VKWA 3CQPA 5F0PB 4ZFFB 2FJGB 2QELA 3LEVH 3LNGA 3BUPA 4ZJ9A 3KPMA 5B39A 1HXMB 3C6SA 4HUXA 1RU9L 4PJGF 3DGGA 3A21A 5B1JC 1A5FL 4ZW6A 2JTYA 2ORBH 4J3OD 1QQDB 4R4NC 1FVCA 2WLZA 5E2VL 5HGDA 1T7ZA 4I3GA 2DQTH 4Y1AE 2PXYA 3AUVA 2ZIDA 3WAKA 3ZHLA 5FUCE 5ISZD 1JK9A 2F58L 2HUHA 2I9TA 3PDGA 3N44F 1ZOXA 4DKDC 2AGJH 4Y9CA 5KANI 1V3KA 4NNYA 2WQAA 3ES6A 3WTYA 3IBOA 1XB3A 4WSJA 2NY3B 3QPXH 1PD6A 3A6BL 1T83A 5LAPA 2D7MA 4ODHL 2UY7A 2MHAA 4LOFA 4HQQH 1MJ8L 2IAMD 1IQDB 1BXVA 3BCFA 2X1WL 5I26A 5FKAA 2E6PA 3DOSA 5DUPH 2OPCA 1JUFA 3ZY7A 4NERA 5D4QA 4X99A 2OYMA 1FVEB 2WTRA 1P1VA 4AVKA 5EDSA 4K8RC 4UM9D 4A7GA 4WENB 2DM4A 3F7RA 1F4AA 3QI9C 4ZSOA 3L3OC 4L3EA 1BXXA 3OPZL 3S3CB 2IWEA 2J55A 5FUOH 4CW1A 1YEEH 3DRTA 2R4SL 2PTTB 2H3KA 2D31A 2QL1A 2Y2WA 2YLKA 2ZYHA 3L08A 2KS0A 1PFCA 5LCVL 5TQ0H 1XBRA 3AQZA 2BCKA 3W1ZA 1NEPA 4M43H 1P4BL 5JXEC 1SJXA 3AC0A 4HUUB 1AMXA 3HI6L 2DWXA 5AB1A 5FO7B 1OTTC 2W07A 5GXBB 3QUYD 4KNUA 2E4TA 5FR3A 3ARFD 2OP4L 2NT1A 1AGEA 1N8ZA 4M8QB 4YIQB 1NCNA 2YAEA 2BXYA 2XWXA 1KGXA 1X5MA 3KPLA 3QG6A 4JFDB 3GTVA 5ACZB 1BVZA 2CJUH 2DIEA 3V4VH 4LPYA 3SDCD 5E5MA 3GMRA 1TQCC 2D9QB 4L4VE 3TIEA 2OMWA 2WUBL 3LS5H 2W91A 4JFOB 1YYCA 5CLYA 2HTLC 2OJZH 2N0KA 3MLZL 1RZ7L 1KEMH 1DVSA 4R4FH 2VSKB 1S5IH 4LP4A 3BVXA 4OD3L 4N25A 1F3DJ 4TNVF 4XN9A 3O9WA 1TEYA 1H8OA 4E9TA 1MCQA 4HT1L 5D7KE 4ZK8A 2ZG3A 4TVPL 1VSCA 3PJSA 2DM7A 4YHPA 1TENA 2G60H 2X6MA 1TQTA 2X38A 2LFGA 4JO8A 3LZQA 2IMNA 4PRPE 2JK5B 1PQZA 2CG9X 3BXNA 3P4MA 1MI5E 1TTRA 3LEXB 5HI5C 1RIVH 3PIQB 3CSTA 1CLZH 2YQBA 4GAGL 2AVGA 3RILA 5DD3L 5IMLA 2GBVA 1SFDA 4Y4KB 4MTMA 3D09A 4UMSA 4NXSA 5HJ3A 4HWUA 3WUWG 1R34A 1C12A 2Z0BA 4R0LA 2BW4A 4IHOB 4YSOA 4FJYA 1EH9A 2ZJSL 5AVVB 1HWHB 2IQ9L 3SE3A 4FTDA 5DD5H 2C3GA 1SHMA 2OW7A 3NP4A 4KH9A 4JK0D 1NICA 1IC1A 3QJOA 4G6AD 4OZFG 4X5RA 1XDTT 1MCOL 3EJJX 3DO7A 4L8CB 1IEBB 1N0LA 2PR4L 1C5BL 3K8MA 2X4QA 2QGEA 4Y2DB 4QRSB 2OMVA 6FABH 4A55A 5EF3A 4GXUN 1BQHG 3VXPB 2AW2A 1YY9D 3TO4A 4I0PD 1UD5A 5C0GB 4F1ZA 4NZJA 3FT2A 4YUEH 1JWSA 3VQ1C 4ISVA 5I6XB 2EIEA 4MASA 2EVHA 3HRZA 2LOEA 3NCMA 2W38A 4URTB 4PJFF 5AG8A 4ODWB 5F72S 3NIDE 5TDPA 3SCMD 3UG4A 1KB9K 5AD0A 4QHNA 3ZLQC 3VG9C 4XP6L 3HE6B 2EDNA 3DOIA 5C0RL 3GMQA 3RI5K 3SGDH 3M1BB 5D96C 5C09A 4F57H 4N0UE 3DURA 4QXWA 4RGNE 5KVFH 4JMXA 3EDEA 3WIIL 2F53D 4GAJL 3C5JB 2CHNA 4DPBX 1Z5YD 1I8IA 5DEGA 3S6CA 3NCEB 2ADYA 2D73A 4LCUB 5IVOA 1XH3A 3H6AA 1DJHA 4FNTA 1VACB 2HG5A 3QDMD 4N9OB 1XF4B 4N2GA 5IVZB 3S37L 4KWUA 3V8OA 3WKYA 2B59B 2GAZB 4QRTB 4S0HA 4HIHB 2OI9B 1CLVA 1L9OA 3RTQD 1FBIL 5CP3H 1HZHH 2XWBB 1OAZH 3FCGA 4IJ3B 3PP3H 2H4EA 4K7PH 3PWJA 4N4YB 1XR9A 3L13A 4POUB 3WIAA 4DUXA 4HUWA 4ANXA 3FQNA 1BBJB 1GKOA 3T2NL 5IB5A 1IB5A 1WA0X 3KPSE 3JV0A 2P42B 5KG9B 4EIGB 4NO0A 3HE7C 3U0WH 1MWAH 2NCMA 4PW9A 3D4YA 1WAPA 2WXIA 4LARH 1CS6A 3BQUD 4ZQKA 4MJID 1QVOB 2HUEA 3G5XA 4UI2A 2DQGH 3MV7D 4M7LT 3N85L 4YPGB 5K9KB 1U8PA 3EJYC 3RKDD 1QSEA 4OSUL 9PCYA 3KPMB 5GRYA 5B39B 3RI5F 3C6SB 4HUXB 2Z0UA 4TUOA 2JJTC 3DGGB 4UOW1 5H2BA 2WC7A 2HFFA 1FVCB 5HGDB 3VWJD 3BKCL 5T1KA 4M7JL 2OQJA 2CZNA 2PXYB 2E27H 2WXMA 3QZWG 1JK9B 2APVA 4OKDA 1T03H 3B7TA 3EFOA 5AVZB 5C0CE 2MIZA 5F7MC 2I9TB 2WSKA 2VERA 3ES6B 1WDAA 2VO5A 4Q7DA 2H0FA 1H0DA 2UY7B 2MHAB 4KFMA 1WYJA 3RQ3A 3P11H 2ITEA 2N1KA 4XP4L 4MKMA 4KQ3H 2ID5A 5FKAB 3DOSB 1Q94A 3K6OA 1JUFB 3ET9F 2WK2A 4ETQB 4X99B 2WTRB 2CK2A 1OSZA 3QXUA 5DR5H 1WH0A 3ULVE 5FYJL 2K6WA 3QJHA 4ZSOB 2XBDA 4NAJA 4L3EB 1SBSH 2I07A 3FFOA 4XMWA 1T6VN 3ZKXB 2UZIL 4CW1B 5L7XH 3DRTB 1E4XL 2D31B 3LS4L 3Q6GL 4JG1L 3MOBL 2BCKB 1WZLA 4N8CL 4CBPA 3EHBB 2EVJA 4OCXL 3TYGH 1Y0LA 2FWOA 5K59F 2W07B 5CSBA 5GGTH 5ALBH 4XAKE 3VFGL 1CBVL 1RULL 3FUMA 3KNBA 2DS4A 2QR0A 1AVAA 5I1HL 1YLBB 1AGEB 1N8ZB 1AGCA 3T6QC 3VH8G 4G8EA 4PGJA 3QG6B 1T2XA 1Z3RA 3KPLB 2BIOA 4QT5A 1I9JL 1GVIA 4YDKL 3C60C 2KT6A 3GMRB 4MXQC 5E5MB 4BZ1L 1KPUA 1S7QA 4KVPA 1B4RA 2WQWA 3TIEB 2CH8A 2OMWB 4DAGH 3I84A 3GBNL 2Y9RT 2UYLA 4AQ8A 4FL4C 2NTSP 5KSAC 1U8IA 2GJ6A 4E36A 2BZ7A 2JKWA 2QMKA 2VOTA 3GXTA 4ENED 5TK4A 3AU0A 4HUVA 3D85A 1MW1A 1GGBL 1UM4L 3O9WB 2AQPA 3N91A 3S5ZA 2VZUA 4RX4D 4ANWA 1CDUA 4JB9L 4Z7NE 4LSVH 5HBBA 1HFUA 2NY1C 3NH7H 4HK3J 3RDJA 3PJSB 1CF8H 5FFOA 4YHPB 1E90A 4Q14A 5T3ZE 5KBNC 3JWNG 1UENA 5C0DA 1Z9OA 1LO2H 3SDYL 2ZCHL 5J7CC 3DXAA 1PQZB 3BXNB 1NGQL 2VQ4A 4YHMH 4P5MA 4DKAA 2NZIA 5IMLB 3QJZA 1Z9PA 2WN2A 3VFOA 1QNIA 4RMWA 1R33A 2IV8A 3PCYA 2HRLA 5HJ3B 3B1UA 3UGUA 4GPVA 4R0LB 3AQDA 5KVEE 1WTGT 1SXBA 3EADA 4KTEL 4M4PA 3ECUA 3CHRA 4X8CA 2IALA 3MFGB 4Y4KD 4XP5H 4YX2H 3AWFA 1MNUL 1KYOJ 4CVUA 3NJMA 3C08L 3L45A 3MV9D 1B6UA 1NGPH 1UATA 4W9JC 2ICEA 2UXVA 3DO7B 5GJSH 1J9TA 5EEWA 1N0LB 2VKXA 4RWYL 5CINL 4HA1A 2X4QB 2R27A 4PRHE 5BNXD 3B7SA 5DUBA 2OMVB 1TO5A 1UUSA 1T66D 5GZOC 3K2IA 3VM5A 1BFTA 3UTTA 1R3KA 3SODB 3TO4B 5C07D 4MA1C 4E68A 3FT2B 2EE9A 2W8CA 1JWSB 4Y2DD 3HA0A 4ISVB 3BKMH 5DVKA 2ZX8A 3EFDH 3STLA 3HRZB 4WO4C 1FO0A 1HYSC 2FEJA 1ADQA 5TDPB 4ALAC 2H2SD 5AD0B 5EU5A 2Q7YB 1ROWA 3GMQB 3N1QC 3DHJA 4GFTB 3NZSA 3U9PH 4HLZH 5C09B 1X6NA 2H2PD 4QAWA 1SMOA 3DURB 4O2FA 5D4HA 5ILTL 3HE6D 5C0FA 4WWKC 2XY2A 5DEGB 1I8IB 1SEBA 1XH3B 1D7FA 5D7LD 3WCYA 2HG5B 4NC1C 4J4PC 3D9AH 4IGBC 2NYYC 4PJHE 4WEEA 2WZPD 2A74A 1VFBA 4XB8A 1J1OL 3KD4A 2D3VA 3PXHA 2N7BA 3KLSA 2CUIA 1IBGH 4JZJC 4MJ6A 4N0CC 3PWJB 4OT1L 5C92A 1F18A 1XR9B 3VWKA 4DKEH 1FNAA 1IGTA 4HUWB 3FQNB 4XX5A 1H15A 5IB5B 4WIQA 1PZSA 4AZUA 1WZ1H 5GS3A 4HWBA 4LOUC 4AVIA 4J2QA 1Z9SA 5DVOA 4HMCA 4NO0B 3RIKA 1RPKA 2Y22A 4LAJH 4PV8A 4ZQKB 5FDYA 3Q05A 3ORJA 3G5XB 5DURD 4RRPG 5FGCB 3WFCL 3VW3L 1U8PB 2H3XC 1QSEB 2EDEA 3M8OL 4KRPC 4MDRA 3GXFA 4TUOB 5D7HA 4UZGA 3H4HA 5H2BB 4UINH 5SX5H 4POZC 2HFFB 3RFRA 1CN4A 5EOQL 4JRXE 5BRZA 3T0EC 5T1KB 2OQJB 4PWGA 5MI0B 3VGHA 4H0IA 3ZZSA 3PWPB 5HDOA 3FQ4A 5I6OA 3EFOB 5IQOA 5E70A 4M1CD 1A1MA 1E6JL 2PXYD 4G5ZL 2D9CA 4KGJA 5LQBL 4OZHF 5E2TL 5FHBL 1H0DB 1GGIH 1YEHH 3WY1A 1KENL 1QRNE 2MPAH 3POHA 4NQDD 2B2XH 5AW9B 4ZFZA 1G4MA 1Q94B 2FNWA 2FQGA 4DO5A 1JDCA 1MOEA 3VDAA 1OSZB 4OLVL 4POYA 1TJHH 1MXGA 2GCYA 2V5SA 2XIIA 3U30C 3QJHB 5HSFA 3HEIB 3E6HA 1T20A 2I07B 4WSGA 4XMPH 4KK6C 2BINA 2ROXA 2DTSA 1DN0A 2ESVA 1SNRA 5IHBA 2VWEE 5DJDA 3K71A 4K3HA 4L3ED 3IRCA 2LU4A 4H26A 1CFQA 4WLCA 4XBEL 1Y0LB 3MBEA 2EINB 3IMWA 2DQEL 3KNBB 1SJHA 2DM2A 4ELMF 2NRDA 1EFXA 2QR0B 3EDDA 1X5GA 4OUUA 2D4FA 5KVDE 1AGCB 2EH8L 2D03H 4G8EB 1R5WA 3LQAC 5GRWA 3TA4D 4ZG1A 3KGUA 1DBBL 2C3XA 4QT5B 4D8PA 5IW3A 2Q5BA 3DIVA 4HXAH 5I66A 2VDOB 3CK0L 1KPUB 1S7QB 4S1RL 2HB0A 3HC4L 2OSWA 2UYLB 1JV2A 5DO2C 1A1NA 1U8IB 2GJ6B 2P8MB 4JFQA 1KPVA 5D7SH 5HHPA 4CKQA 1NCDL 1S9YA 4HUVB 1LO4L 3D85B 4XWOC 1RUMH 3DX8A 4TULL 3IPFA 3VJ6A 2QT6A 4S11A 2FEDC 1A7OH 4JO3L 3BI9X 1QFUH 5DMKA 1JN6A 4NN5B 1WFMA 3I85A 3O9WD 1JMXA 2X9XA 4LZKA 4ERSL 5C0DB 4KKAD 5EPMA 3OZLA 3DXAB 5GIRA 5IP4A 1LMIA 2RQ8A 3D08A 3UROR 1INEH 3RGVD 4H8WL 3LV3A 1BJMA 2OZNA 4YGVA 4P5MB 3WDHA 3WHE1 2VT0A 32C2A 4RNRA 3CVDA 3O2DA 4J3OH 5SX4I 3VFOB 5FV1L 3MRDA 1EZUA 3CFQA 3QDJD 4WI0A 5FW7A 5EUOF 2LGNA 5D1ZA 3TGXA 5BV7L 1E43A 2HT4C 3ZKMC 2IALB 2X1OA 4KO5A 3ZTEA 1OPGH 2EXYC 2FQEA 3B2UD 1UJ3C 4XX1G 1JXFA 4ANKA 2ZP0T 4P2QA 1PKQA 2AXHA 4JFEE 2ZWSA 3OKOA 5BMFL 2AFNA 2ICEB 4Z7AA 4O58H 2OBGA 2B8OT 2FEEI 3H2WA 3SYCA 3K5SA 1UZ6E 4JM2A 1ES0A 2VRAA 4EN3C 5DUBB 5CMAA 5IQNA 1BD2A 1BIHA 2ATKB 2B3IA 3UTTB 1R3KB 1DJZA 4ZX3A 1LTXA 4NZFA 4FG6C 3GQFA 4N2HA 3WN5C 2WINA 5DEFA 2G5UA 1TJIL 3STLB 2CBPA 2CKBL 4J3VA 3V4PA 1FO0B 3PAUA 4G5AA 4YO0A 4P2RD 2H1LM 1NCGA 2EO1A 1TQBC 4O2CA 3GIVA 3P54A 4DP6X 3GXNA 2RH0A 5EU5B 1FSKB 1FJ1A 3FCBA 1DVYA 2Z7ZA 3B8YA 5CU5A 1QWNA 2VABA 4ICXA 4W1TA 3VXSD 3TXAA 1B6DA 1G7MA 1ZWIA 3D33A 3GXIA 1YPZF 5HHOD 4AL8H 3O6LL 1FL5A 1MIML 4Z7WE 2Z31A 4O2FB 3N43B 4PD4J 5C0FB 3VNYA 3T4YA 3IEAA 2XN1A 1U2HA 1JZEA 1SEBB