1YLBB

Nmr solution structure of the reduced spinach plastocyanin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Intermolecular Complex between Plastocyanin and Cytochrome f from Spinach.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin, chloroplast
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ylbB00
1SHXA 2YXVA 4YSPA 2IWKA 3PCYA 5I6OA 5AZUA 1XB3A 1OE2A 3FQ1A 2UXTA 1X9RA 3WIAA 2AFNA 5I5MA 1OE3A 1OCRB 1BXUA 4EF3A 2W88A 2BP8A 1JZEA 1I53A 1A4AA 1ET8A 3NP4A 4E9QA 3EH4B 1URIA 4HIPA 3KW8A 3X1BA 3N2JA 1BXVA 4HHWA 2XUWA 3WI9A 2HRGA 4UANA 2IH8A 2WSDA 2Y1AA 4CSZA 4AKPA 3QJVB 2BZ7A 3AG4B 1J9TA 1KBVA 4WTQA 9PCYA 1N70A 4AKOA 1PLBA 1NICA 1GW0A 1AZCA 2GI0A 1PCSA 4RH4A 5I5IA 1A8ZA 1PF3A 2VSMB 4BK5C 1AR1B 3G5WA 4KNTA 3FSZA 5B7MA 1PMYA 2IH9A 2LLNA 2CBPA 4UF7C 2QDVA 3H4HA 1BQ5A 3NJHA 4HAKA 2VSKB 1HAWA 2YAHA 4M4RB 5B1KA 5FC9A 2FJSA 2OV0A 5I6MA 1J9SA 2XX0A 3U25A 3S3DB 3T6WA 3TBBA 1ASPA 4YSEA 1V10A 4E9WA 1L9SA 1AQ8A 1FA4A 3IEAA 1PY0A 3ERXA 2HLEB 3NJIA 1NIDA 1W6LA 2H5UA 2I85A 2NRDA 3ZX1A 2VW6A 1AANA 2UXGA 3BQVA 4K9JA 1R1CA 3WKQA 1WA1X 2X88A 4Q8BA 5B1BB 3T6VA 3WNJA 2IDFA 3MX0B 2EINB 1NWOA 1ZIBA 4YSRA 3RYMA 4P5SA 3PAUA 2XLLA 2GB2A 1ZDSA 3H56A 1PLCA 3OMNB 2EIMB 2XWZA 3FPXA 1OCZB 1JZJA 3EHBB 3EF4A 2ZWNA 1EZLA 4KOBA 2CALA 1JZIA 1NPNA 4A2DA 3SQRA 5F7BA 3NT0A 2JFCA 2B3IA 1KV7A 3D12B 1JVLA 4HZ1A 3AG1B 1AS8A 2CCWA 2BWIA 2IWEA 1CUOA 2PCYA 2XX1A 2YAQA 4KNUA 1J5CA 2BO0A 1T5KA 2FQDA 2H3XC 1QHQA 1NWPA 4A68A 2IDQA 2PCFA 3S3CB 1TU2A 1WA0X 1L9PA 2VMJA 1ASOA 4HHGA 1AZRA 5I5JA 4ZK8A 3FU7B 1N68A 3T9WA 2PP7A 4CSPA 2HZHA 1ETJA 2EIKB 2DYRB 4L0PB 1SDDB 4A2GA 1XMEB 4E9SA 2BP8B 1KGYE 1JXGA 4YSTA 1XB6A 3IE9A 3MBWB 1WAEA 1NINA 1BYPA 3QPKA 3N55A 2MTAA 4PCYA 1TEFA 2UXFA 5I26A 5TK2A 1MZZA 3FQ2A 2QT6A 2I7OA 4DP4X 2ZONA 5AKRA 2R7EA 1QLEB 3T6XA 3FT0A 3QQXA 3T71A 1E67A 3NJMA 4PAZA 2Q5BA 3OD3A 5E9NA 1MZYA 3CDZB 3NJNA 3FSWA 2YAOA 3ABLB 5I28A 2X87A 1J5DA 1BXAA 3WG7B 1AG6A 2Y69B 3NJGA 3TA4D 1ZDQA 1GS7A 3TBCA 1OF0A 1TKWA 1GSKA 4QLWA 4YL4A 4WKXA 4A2HA 3DTUB 4HCFA 4TXVB 3FU8A 4BDVB 2HX9A 4P5RA 2ZOOA 1XB8A 5PAZA 4M3HA 5F7AA 5I6KA 1CYWA 3AZUA 4UAHA 1AZUA 3FPYA 1KDIA 3L45A 3OM3B 1RKRA 5PCYA 1AOZA 1NZRA 2WO3B 5LDUA 1L9QA 1PZAA 3FSAA 1AZNA 4A2FA 1ILUA 4N4YB 2YARA 4YSQA 4BDVA 3UACA 4GXFA 4A2EA 2YAPA 1M56B 4GP8B 1VLXA 1HFUA 2BW5A 4BWUA 3CVCA 3AG3B 2TSBA 1DYZA 1JERA 2FT8A 1JZHA 1NIAA 4KO7A 1FFTB 3UAEA 1MG3C 3NSDA 1L9TA 2PPCA 1SFHA 1X9UA 1CURA 1ZIAA 3ZDWA 7PAZA 4DP0X 2PLTA 1PNDA 3JT2A 1ID2A 1IUZA 4KO5A 6PAZA 5AFAA 1V55B 4G72B 1A4CA 4E9YA 3IN2A 2XXFA 2XU9A 1BQKA 5B1AB 4A67A 4DPAX 2A3TA 4FA7B 1PZBA 1M9WA 1ADWA 1GY1A 4NB7A 4W1TA 1V54B 4DP8X 3JTBA 2DV6A 4JHVA 2IAAC 5EHFA 5B7FA 2VW4A 2W8CA 2BZCA 2GIMA 1AACA 1B3IA 2EIJB 3X1EA 4X4KA 4DPCX 1BEXA 5B1JC 3V9CA 1NDTA 1SDDA 2XV2A 2FT7A 2ZXWB 1AZBA 3AY2A 1A4BA 2J56A 3FYEB 2J55A 4DP7X 1ET5A 3H4FA 2EILB 2HRHA 1E65A 2DY2A 3BVDB 3UAAA 3PAVA 2BW4A 2PPDA 4G7QB 2FT6A 3HB3B 1SHWA 4AI7A 4AZUA 4F2EA 4BWTA 3UADA 3X1NA 2CAKA 1A3ZA 4YVNA 1RCYA 1SJMA 2FQFA 1JZGA 4QKTA 1J9RA 2DWTA 2J57A 2YXWA 1W6WA 2FTAA 2OCCB 2GBAA 4MFHA 1AS6A 4GP4B 3SBRA 2GSMB 2FQGA 3QJUB 3C75A 4E9TA 1TEGA 3FYIB 3UABA 2DWSA 2AZAA 1WA2X 2QPDB 3S8FB 3CVBA 3V9EA 1WS8A 3CZUB 4G71B 1W8EA 3X1FA 3DIVA 1JVOA 2BP0A 2BP0B 4DPBX 2UXVA 3HEIB 1L9RA 2UX6A 1IBYA 3NSCA 4E9RA 4JKNA 4YSSA 2BWDA 1SF3A 2I7SA 3TU6A 1PZCA 1AIZA 1E5ZA 1ET7A 3NSFA 4Q89A 1JXDA 2CUAA 2XXGA 2DYSB 5B1JA 3X1GA 4DP1X 1GS6X 3WNIA 1IKOP 4NERA 2PPEA 2VM4A 2IDTA 1CYXA 1JOIA 1MDAA 1ZV2A 1RZPA 2XV3A 4N8UA 2TSAA 2PPAA 5I6PA 5D4IA 2XVBA 3ZIYA 3OQRA 2AVFA 1OE1A 3NSYA 2YAEA 4W9ZA 3ABKB 2YAFA 4GYBA 1SFDA 4JHUA 2HXAA 3GDCA 3T6ZA 3S8GB 1NIBA 2OJ1A 2P80A 1GYCA 3QJQB 1M57B 1PNCA 2JXMA 3SBQA 3WKPA 3PLYA 1YLBB 1MG2C 2PP8A 1OV8A 5B7EA 2N0MA 2HX7A 1EHKB 3GYRA 4G7SB 1GR7A 4HCGA 3EH3B 3S3BB 1AAJA 2GC4C 3DKHA 1OCCB 4DP9X 5D4JA 3TASA 3OMAB 3GXUB 4BXVA 1WS7A 2FWLB 3CG8A 2YAMA 3CVDA 1E30A 1IC0A 2IDUA 1NPJA 4E9VA 2RACA 3AG2B 2H47C 4FAAB 3ASOB 2MRYA 4DP2X 4KOCA 3KW7A 1SNRA 1KCWA 3IBOA 3CDZA 3NJJA 3NJLA 4YSUA 2AANA 3IN0A 1SF5A 1KYAA 4F7KA 3NP3A 4HCIA 1NTDA 4AX3A 1BAWA 5TK4A 2VM3A 7PCYA 2GC7C 1AG0A 4AKQA 1HAUA 3ABGA 3UGEA 3QJRB 1E5YA 2JKWA 5I6NA 1ASQA 1IBZA 3PPSA 1DZ0A 1RZQA 1JXFA 4NAJA 2VN3A 1ILSA 3ABMB 2P80D 2XV0A 2E86A 4E9XA 1KBWA 4YSAA 2AZUA 2UX7A 4GY4A 2FQEA 1L9OA 1F56A 1BQRA 1OCOB 5IY5B 3QJSB 4A66A 3PAZA 4KO6A 1KCBA 1QNIA 2QPEB 4G7RB 2IWFA 1FWXA 4G70B 5I6LA 4HALA 3FS9A 2FNWA 1KDJA 5B3SB 1CC3A 2IDSA 3PXLA 1BYOA 1J9QA 2Q9OA 2YQBA 3FSVA 4BWWA 6PCYA 4ENZA 1GS8A 3NJFA 1ZPUA 2B08A 1PLAA 3X2QB 3FU7A 3FQYA 3NYKA 4YSCA 4F2FA 3ZBMA 2HX8A 4KO9A 2J5WA 4YVUA 3OMIB 5A7EA 2BHFA 1GY2A 4DP6X 4YSOA 2PPFA 1A65A 1UATA 5ANHA 1OOWA 5D4HA 2QDWA 1NIEA 4GP5B 2PP9A 3SBPA 8PAZA 1NIFA 3QJTB 3EH5B 4DP5X 2CJ3A 2R7EB 1AS7A 1PAZA 3ASNB 3NJKA 4YSDA 2VW7A 2WO2B 4KNSA 3FU9A 4BXSV 3AW5A 1JZFA 2GHZA 2XYBA
chains in the Genus database with same CATH superfamily
1PAMA 4AC2A 5I6OA 5AZUA 3G6JF 3UZVB 2XN9D 3MFGB 5EC2A 2DF3A 2IXQA 5D2NE 4LHJB 4WQOA 4EDWH 4JFTA 4FCAA 4CL7A 2GQHA 3HFMH 4DJMA 3VXRE 3ZRSA 3C60C 2BP8A 2P24B 1SBSL 1RZJL 1IC4L 3X1BA 2X09A 1GXEA 2BXYA 3MVSA 2QADC 3NIFB 5E6ZA 1GGCH 4UANA 5DURB 2WSDA 5LBVA 2DKMA 2HFTA 5DD0L 5EB9A 2Y36L 4WO4B 4AYBA 3AG4B 4FKEA 4Z7NF 3RUGA 1J8HB 1HI6B 5IOKA 1N70A 1N0XL 4FQXB 2NY5L 2ZJSH 5FB8B 3MBED 5L88H 3GSVA 1A3QA 1FH5H 4TTDC 5LXVA 5F9DC 1N3NA 3BP4A 1XBDA 1QP1A 1P4LA 1VFMA 1Y07A 2A2QT 2NY3D 3HC2A 3QXDB 4KNTA 2OI9C 3EYUH 1IL1A 4PGCB 2NY2B 5C08E 1GZHA 5CKGA 4XPGH 4ZTPL 2AQTA 3CDCA 1KT2A 2Y06L 3MV8E 5DJAA 4AENB 3CPLA 1I1AD 3VU1A 5IF0A 3UPCA 1T80A 3MV7D 4LCWE 5FC9A 3VFRA 5HHQA 2FL5B 1JJUA 4X7TA 1YHPA 4N0CD 3MA7B 4BSWB 4L3EE 5DVMA 1NLBH 1NMCC 4PJFA 4HWBL 4PRAA 4JRYB 1S7RA 3FQRB 4UILL 1ROWA 3ZYZA 1A6UL 2I32A 2WSKA 2PXYC 3UTQA 1U3HB 1VRSA 2G2PA 1G1YA 4JR9L 3WKQA 4HOZA 5ICUA 4J3TA 2X88A 3SGDI 3CVHA 2GIXA 4OM1H 2WXIA 4G80A 2IXQB 4WWKD 4MJIB 3M17A 2NY5C 3K7UA 4PLKD 3MJ8A 4RQQB 4YSRA 1G6VK 3L5XL 3PWVB 3KWXA 5CEXA 3HN3A 1KENH 1AC0A 2VLJB 3CJJA 2Z6FA 1AO7E 1ADQH 2CIIB 1PLCA 1X5IA 2ARJB 2HKFL 2IPKB 2ATPB 4Y19B 3T3MB 1LWRA 3GJEA 1FNAA 2VDQB 3TS8A 3O9WA 3K46A 4L8SA 2KQMA 2HG0A 2D7TH 2CO2A 3UYRH 3VD7A 4MMYA 3ZGIA 4B9YA 1FGVL 2WLIB 1JVLA 3AC0A 1ACZA 1UWXK 4JZNB 2BWIA 1GGCL 2C3GA 3FQTB 4NIYE 1ZTXH 4D3CL 3PAYA 4RGOH 4DFHA 4I9WD 3KPRB 1ASOA 4HBCH 2DEYX 4GFXA 1T4KB 3UTSE 5I5JA 1KJMB 1X5YA 4K3DH 4I48A 4NUGL 3PIQA 3L3HA 2BC4A 1V3LA 5F7EH 1VADB 3B7TA 3IE9A 3RB5A 4PBXA 3VG9B 2GAZA 5CWSA 1ONQA 4G8GE 3IT8D 1S8DA 3M8OH 1DJWA 3CHRA 3OPZH 4K94L 4KK6D 5AG8A 3I9GL 4Z95H 3ARSA 5E1HB 1T1YB 2YD4A 3K72A 3ZU8A 2UXFA 1S7TB 1SLUA 3NMEA 5LNDA 1O7DE 4NM8L 1A9EB 1KJVA 3B2UC 1ID5I 3Q01A 4D8PB 2I7OA 3QNZA 1A7NL 2B59B 5H37G 2WLIA 1IKNA 4XCFH 2KH2B 2ESVE 2FJGA 1CD9B 3HRPA 1T7WA 3L1FA 5ADPL 3V0JA 3FT0A 1J9CT 4HZAA 1F4WL 2EECA 4NFCA 5AG9A 4U3SA 3LD8B 1RI8A 2EXSA 2GW5A 1GGIL 2FDBP 3EYOA 4GW1A 1Q1JH 3EBIA 4J4PC 2DOCA 1QZ1A 2FHFA 2ZXDA 2QSCH 1RSFA 2BCKB 3K3QA 5HGAB 4RQQA 3KPSE 1U92B 2NX5A 4RWYL 5AZ2H 1RZIB 2VERN 4PN6A 4OB5H 2H3NB 3WIIH 2YLKA 4HMCA 4LLAA 3VXUB 4CSTA 5ABAA 1HDMA 5GGQH 2ZCZA 2ZKXA 5E8EB 3WS6A 1EHLL 3DTUB 1NBCA 2VM9A 1LEIA 1IV8A 3Q8EA 4JRXA 1ZHLA 5I82A 1JCVA 2M26A 1S7RB 1JDAA 3V9FA 2FRGP 3LNFA 2X2YA 3QC6X 3VXNB 1XF2A 4KKLD 1JXJA 1SJHA 3B7RL 4GEIA 4XHQA 4ZUWB 1Z9LA 4HK3J 3EUUA 3BP5B 5HHQB 3K6SA 3FSAA 3RVTD 3SO3C 5DQ9A 3ZSTA 5IJKA 5FYLL 4A2EA 5DFTA 5LN4A 4Y4FC 2MH4A 2XZQL 2Y6SD 4KJPD 4K3EH 3OR7B 5IR1B 5DWUL 4LGPB 4QMEA 4WI3A 4O02B 3TBVB 4J3XA 3VMOA 2ICWI 5HPOA 1JZHA 1SOXA 2WIIA 3F6JA 4IGBA 1HQRB 1SFHA 3OKEA 1E5AA 4BFRA 5FYJE 2UYLB 4HKZB 3F7KA 4NO5B 5EZPA 2Y07L 2ENPA 1ND0A 2VGLM 5EZLA 3VMNA 3UTTD 3QPXL 1KB5B 5D7HA 1A5FL 5CGMA 4FFWC 5DD1H 3TIEA 5IOPB 3AU1A 3BUYB 1CF8L 4ZMYA 4MJ6B 1CGVA 3JWOL 4LLDA 4W9DC 3VB9A 5DURD 3WEXB 4W1TA 3ARFC 5HDOA 1CJYA 5EBLB 3QG7L 4NO0B 4Y16C 4J6RH 3QFJD 3FQWA 1B0WA 4HPYH 4JHWL 3W9DB 5BV7B 3V6OC 2DQMA 4H20H 1IAKA 5DWPA 1KXQA 3SGKC 4I0CC 5ITFA 1AACA 3D39D 1DN0A 1T5XA 1BF5A 2AK4B 4GKOA 2BSED 4JL2A 4E41D 3QZBA 1SDDA 3HR5B 4ZAKD 4AM0Q 3UC0H 4ES9A 2VDKL 3DIFA 2X4OA 4YHPA 4XOBA 1M3JA 3FT4B 2EYTB 4DERA 2XSKA 4FA6A 4DP7X 3F7RA 1H3PL 1D6EB 3DNKA 2Q3AA 3BVDB 3KPNA 2JKXA 3EOBA 3LIZA 5DJCA 2VDML 3S7GA 1E4JA 1B2YA 5KVEH 1TVHA 4UWQB 3ENEA 4F2EA 2X9ZA 3CDYA 2O26U 4IBYA 4X5XB 3T77A 4GAYB 4FQJL 3BVUA 3A4AA 4PUBH 5ECJE 1VEOA 5B1CA 1KACB 2QR0A 4UOW0 1KG0B 1GRWA 1QSVA 4MJ2A 2GBAA 3FT1A 2RH0A 4MQSB 2JI2A 5CP7A 2GSMB 2A83A 4OZ4B 5F97E 2ARJQ 2B1HH 1QAWA 1NGPH 3QBTB 3ZZQA 4P5TD 3CVBA 2D4FA 1U8CB 2UY6B 1UWGH 2HFGL 5D1QE 3W0WB 2N1TE 4IRJB 2NZ9C 1IAOB 4HWBH 1G6RH 2UWEA 5IHZB 5DRWB 1HIMH 4F9LA 4M6OH 5TDPB 3AM8C 1KCKA 3H9HA 3S4SG 3CFDB 2J72A 4RRPM 1ZEAH 3IMWA 5DGRA 4CN6A 1PZCA 3C6LA 3HE7C 4OM1L 4MMXC 3EGSA 3I9IA 2JCCB 4M3KB 4QRRA 1CK0H 2ROXA 2GVYA 3NSJA 1H6UA 3P0GB 3PDDA 4QTFA 2XA3A 3MKKA 2ROYA 2ZNXA 4YUEL 5AW1B 4AQZA 4ZD3H 3B6SA 3GLZA 2CPUA 2GJJA 3MLTA 3FONA 3O4OC 3BQUA 5KSBF 3M6DA 1HILA 1MW2A 3RZCB 1XGQB 3APMA 5I1JH 2HKAA 5JIHA 3T6ZA 2D2CC 2F53D 2WOYA 5IBUG 4F37F 3IGAA 5I0YA 2FJUB 3I74A 4PLOB 1B3JA 2Q7YA 2A6IA 3JZYA 1G9NC 4OAWA 1XV8A 3ZKNC 4HUVA 4K71B 5GS3A 4QRQA 4IS6B 2AABH 1BVNP 3KPMA 1A6ZB 2DIJA 1BGXL 3ES6A 5KVEL 1AC6A 2R4RH 4XNZB 3MCG1 1NEPA 4AM0B 3K6FA 1O5DT 3KLAA 1HHJB 4G8GA 3RFZB 1IC0A 5KSVB 3TCXA 5BOZG 2AXGB 4AH2A 3OF6D 4U6HA 3ILPB 4E9VA 3FZUD 3CFBA 5BZWB 2YQGA 1MIMH 2H8PA 2J21A 3GBDA 5FHAH 4TNEA 3KW7A 4FABH 1IBFA 1C5CH 4M93B 2K7PA 3F7VB 4H1LA 5EOTA 4OZFH 3MJ7A 2DLFL 2WLKA 5FV1L 1KWGA 4I2XE 4ZUUB 4JFDE 2WQAA 4BZ2L 7PCYA 1YN6A 1DJIA 2Y2WA 1E5YA 4PD4K 1IVLA 5HHPA 5I6NA 1MJJB 1TFHA 2E75C 4HSQA 2VR3A 1SUJA 4LXFA 3MRPB 3P4OA 4WZ9A 4RDQF 2Z91B 2R29L 1CQYA 4YNYA 1WK0A 2YN3A 5I1LA 3S5LB 4WTZA 2JB5L 1YMMD 2VC2H 2DM4A 3IJHB 4X5LA 1QFUL 3FUEA 4POZC 4F3FA 5IQ7L 5IQ9B 1KIRB 2J5LC 3RL2A 1JNJA 2P5PA 1I3GH 4DO4A 4N90E 1Z6JT 4G7RB 3RWHB 3DURB 5D1QB 3W0WE 4NJ9L 2F58L 2FNWA 1JK9A 5C3LD 3S3SA 3OKMA 4WGWB 1CFMA 1QLEL 2J7LA 4Z7UE 5AYQA 1Q94B 5HYJA 2EVFA 2A73A 2DYPA 1K5NA 4C4KO 4OSUL 1MY5A 4L4VA 1QBML 3FQYA 4N2HA 2MMXA 1JVKA 3GSWB 1XHHA 3KR3L 3PHOB 4FOMA 4MZIA 4OCWH 4LLWA 5ANME 2ADJB 1TYJA 4FFYA 2J3SA 1NCCH 3TT1H 3X12B 2AJSL 5D7JC 2YA1A 3ZKXB 3UBXA 2ITCB 1VA9A 5E4OA 3O6FA 1BREA 4WVRA 3L6FA 4MBOA 3OX8B 3LN5A 4PJ8C 1OP5K 3C09B 4ZO6A 4RGNB 1JTTA 4IMLA 1Z0MA 2W60B 3K4DA 4FQHA 4WHYG 5KW9H 1HILB 1L3NA 1P6AB 2QQNL 2VW7A 3OKLA 4U49A 3IFOB 4YSDA 3TT3H 5EU6E 4N0YL 3SGJA 4ZS6D 2J5LB 4MJ4A 2XYBA 5C0IA 2YXVA 2P5WA 2CKNA 5I1EH 1A3LL 4M5YH 1XZ0B 2KDGA 3MYJB 4LAJH 4Q6YA 4UQ2B 4UUJB 4Z7UF 2P8MA 3SQBB 3VI4F 3GEWB 5GRWA 4DKTA 1L7IH 1X9RA 4JHWH 4G7YH 3UP1A 3CZNA 2I60L 3MOQA 2LTQB 3PJNA 4WDIA 4H20L 1LQSR 3ARBB 2EDNA 1W91A 2ZTBA 1MAJA 5FWRA 3NABH 4YXHH 1FNSH 4HT1L 4Y4HA 4IU3A 2ZKYA 2FYYA 3WLWD 1QR1A 1MCSA 1IAOA 3N2JA 1BZ9B 1BXVA 3TPKA 1PCXA 4D0DA 3DSFL 1OAZL 1KF9B 2RFXB 4MA3B 1P7QD 5AOZA 4XHJC 2DQTH 1EJ8A 3F7PC 4NLAA 4P06A 4ATTA 4RGMC 1WZKA 4I7ZC 4PJIB 4WTQA 1OARH 3NK4A 2EVHA 3BWUF 1OAQH 4PJIF 4OZ4A 3BKCL 3M1OA 1Y0LA 1J87A 1GW0A 4OD3H 1HCVA 4EQ3A 5L6YH 2ZQKA 3KYKL 2BHZA 4GJTB 2QGBA 3DECA 2EO9A 4RGNE 1AR1B 3C8DA 4HZLA 4IRJD 4XO3A 2UVFA 3WNPA 4NNPH 1FIGL 3OV6A 4HS3B 5F9OL 4L1HA 3CZKA 3MXVL 4JREC 3QEHA 5DR5L 4UF7C 5J6GB 1FFPB 1TVHB 4ABQA 2K4WA 3GI9L 4L4TD 1U8PB 4LLMA 3FRUB 3ZE2F 2YAHA 3AXLA 4PLJC 3J07A 5C0GB 9CGTA 1HESA 4MVBC 3WIFA 4J8QA 3LZFL 1U8LB 2JKLA 5DJ6B 1IGYB 5I1CH 1RJZB 2R29A 2WAHA 1ZWIB 2DJUA 1JYXA 3WO4C 2X4OB 2G0LA 3DIFB 4YHPB 5I2IA 1OSPH 5CN1A 5LG6A 5HDLA 3ZX1A 4P59L 1OTUD 1INDH 4G11A 4GS7C 4M7LH 4X50A 1N5AB 4XNMA 4TVPH 1VCAA 3LKPB 2BCMA 1E27B 1N6QH 2L7QA 2KS0A 1F0LA 2HKHL 3PAUA 4OZFB 4PRPA 1D5IL 2IPUG 4WY7H 4YIQB 2R83A 3L7EB 5C86A 1J18A 3DI3B 1CFQB 3NRQA 1QLRB 5E99L 2ISDA 3VSTA 4OD1L 4ODUB 3OHXC 3KHQA 1I9JH 5KTEL 5IOPA 4W81A 2ZOKA 1EZLA 4AOFA 4GKSA 3NZ8B 4O2EB 4DK5A 1B0RB 3MOBL 2XZCH 1FJ1B 3Q06A 4IRSD 4NRYA 5D9SB 5K5YA 1A6WL 3ZMRA 5FUOH 3AG1B 3EBGA 4FXKA 3ZMEA 3BT2L 4XC1H 3T0EA 4YZFE 5A43C 3D5OF 2IH1B 4FQ2L 4PGEA 3DO7A 7TAAA 1I8LA 4TULH 4FYRA 2WKLA 3K0YA 4P2RA 4UNUA 3DRQA 3FK3A 1X44A 5HI4D 3EJJX 2DJ4A 5A2AA 3NQKA 5E2WL 1Z32X 1RSYA 3BIAX 1XMEB 2DBLH 5C6TH 3RU8L 4DUXA 4HIXL 3QB7C 3K6SB 2W9EH 1KYOJ 2ZSVA 4NGHL 5MEPB 3N55A 4XVSL 3NA9L 3LQAL 2A9MH 3QO1B 5I19L 2OQJB 3TEUA 3N1GC 2HN7A 4KWUA 3AVEA 1CFSB 1U2CA 2FEDD 4MTMA 4ODHL 5EUOA 5HJBA 4Y7OC 1OWRM 4EVNA 5BQ7B 4JPKL 1VFUA 4YQXL 1SEQH 3EJTA 2ED6A 4Y5XB 3GINA 1BVZA 4Q14A 3L3GB 1HEZA 3V52L 3SKUD 2BX5A 4PAZA 3C60A 1M4KA 4ZPVB 2Q5BA 4GQZA 3BD4A 2YHGA 1NBQA 1DFXA 1LK2B 1BZEA 4FGMA 3KYAA 3MTXA 2D7OA 1WHOA 1MIEH 3DX9A 4LVOC 3VE0B 4NQEE 2XJLA 3IGKA 4IHBA 1WCQA 3MLSL 4FFYH 1OTSD 1OANA 3BN9D 3HN8A 5D7SL 2B0SL 4EZJA 1J1PH 3LHPH 3NPZB 3PQYD 5D93C 3QS2A 2ZT9C 4IRSA 1X5HA 3FT3B 3QORA 4PIBA 5T1KB 1YUKB 1MNUL 3CFEA 4BDVB 1A9EA 1KJVB 2VC2L 4JFSA 2XQYK 1RZGB 2DLEA 2P3YA 1UQSB 1EZSA 3QDJD 4MD0A 5T1DH 1IQWH 2F8IA 3AREA 3B7UX 5F7AA 3FTXA 1AR2A 1KJ2A 3HE6D 4LCCB 1FE8H 1QNZH 3JWDH 1CGSH 1F4YL 1NZRA 4BJLA 2AEIT 2OYPA 3O6LH 4LBAA 2YARA 3QQ9C 4YSQA 2PF6A 1G84A 4ZQKB 4XMPL 4NWTH 1HFUA 8FABB 1K4CB 2O5YL 4XAKD 3HS0B 3AG3B 1XR9B 4YMPA 4E5XA 3D0LA 1VJSA 4JN2B 4NI3A 5TE4L 1MAMH 1HSAB 1ZIAA 4U3CA 5MEQA 1ZXKA 4G42A 1IM3A 3OKKA 4GIPD 5EU3A 2V5SA 3EADA 4LEXH 4OJFH 3REVB 1XCTA 4G72B 4NQVA 3BDXA 4OI7A 5FYKL 3QXAB 3ESOA 2XXFA 2CE6A 2VLRB 1TZHA 4F27A 4J4PA 4C83A 5A2FA 1Z3GL 1CFBA 4L1DA 4OF5A 4GMSH 3ELAT 1SEQL 4ZS6C 4C4BA 3OF6A 4R6UA 3LNEA 4K5PA 3QQ4A 3M17B 4NOFA 5AUMB 3V52H 1TTAA 1Z0NA 3W39B 4FG0A 3FXIC 5IZ7A 3GS4A 1K6QH 1IB5A 1BEXA 1DE4B 3RVVD 3RY6C 3ZR5A 4KVNL 3DOHA 3HFML 4PJ8D 4ETQA 4G5AA 3TJHC 3QIBC 3EJRA 4TQEH 5C07D 1TZGL 3MA7A 2B0SH 5J1AA 3B2MA 4Y4HD 3KPOA 5FOBA 2Y36H 1F18A 5B3NA 2CO7A 3WFEL 1EV2E 1DUYA 4ZTOH 3B34A 3OKOA 1JZ5A 4GKNA 2PO6A 4QF1B 1WG3A 3UO8B 1FO0A 3TZVC 1PG7H 4Q4EA 1NFDA 4LPVA 4P5MA 1A3ZA 4G5ZH 4APQC 3KLLA 5LNEA 3LKRB 5DJ2B 3UAJA 5A1AA 3G6JE 1J9RA 3UGUA 4A7GA 4R26L 1OZUA 3IKCB 4JBSA 2BSCA 5EG6C 3QIWA 4JE4B 1IIKA 1I7TA 3FCTA 3BMWA 1E42A 3QJUB 4BZ1H 1EAPA 3GI9H 2WB7A 4P5KB 1J8HA 3Q05A 2P43B 3B56A 4MLIA 3KPPB 4H40A 3KPRE 5KOMC 3ZL1A 3VD4A 5E8PB 3RIFK 4ZMVA 4HPOL 5C07A 2UXVA 3BP6B 3WDIA 5IGXH 1KGJA 2APSA 3QUXC 2G75A 2OP4L 2G5UA 2WXOA 4NLHA 1INDL 3T8XB 1O6VA 5DI8B 2W07A 1IAIH 3EIFA 1RIVL 1WIPA 2AXFA 4JB9H 3A3YB 1A7RL 2CO1A 2FO4A 4QI3A 4DZ8A 3M7OA 1VZIA 4NERA 1BWMA 1X4XA 5DUBB 1KV3A 4QRRE 3MNZA 1ZV2A 4RIRB 4N8UA 1BQLH 2R59A 4PRHE 1HSBA 4B9PA 3I6LE 5B38B 3B83A 4I77L 1ZCRA 5ICYB 4LSDA 1E2ZA 1R24B 2YAEA 5HI5D 1I85A 1TNNA 1LO2H 1XH3A 1ZVSA 2D31B 3BPCA 3MOBH 4AIOA 4X6EB 2ZUYA 2KUTA 5TJWK 2ENSA 4ZX4A 1QBLL 4L8CA 5DQJA 2HTLC 5BNXD 3AU0A 3FO9A 1RP9A 1GZQA 1U8JA 1DFBL 2MQ0A 4X7SH 5GGTA 1N64H 3GIVA 3F6LA 1QVOA 1GR7A 3HZVA 4HCRH 1LEKA 3U6XS 3VXQB 2GC4C 5EU5B 5KWYC 4IGBC 3WFEH 1IC7H 2D0GA 2WQXA 4MS8D 1ML0A 2P1YA 2HFFB 3H2PA 5DJ8A 5IUSA 1T6VN 1UFGA 2VH5H 3HE7D 1XF3A 1W0VB 2Z31A 2CLZA 3U30B 4EDXB 1NSNH 3O3DB 3QXTA 1GIGH 4ZMZA 4FMFA 3RX7A 3CUPA 3ZHDA 4K3HA 2PCXA 2OSXA 4G7VL 5A40E 1NEZG 2H47C 1F6FB 2BY2A 1OGTA 1ZV9A 4UV4L 3O2WH 1QUNB 3GKWL 5E9DB 4PRHB 3VB8A 5AW4B 2VDRH 3NJLA 1OAUL 4QRSB 3B2PA 4YSUA 5CR8A 2ZG3A 4ELMB 4M7KH 4U6XA 3T0VA 4DCQB 1B2WH 4JKWA 4WWPA 2VMFA 3DVGA 4PVNA 5CSBA 1F4WH 1UXSA 3UGEA 3PPEA 5FFGA 2HFEA 1GGIH 1LNUA 3L1EA 3QDGA 5B4MD 5CEYB 3U0WH 1YCSA 2NDGA 3HZYB 1RZQA 3RA7L 4HKXA 3W37A 2NZ9D 3B9AA 2P80D 2XYCA 1CICB 1EJOH 3P0YH 3C09C 1EFXA 3O3DA 4GI9A 3LIUA 2FWSA 1BMGA 3KS0J 4XO5A 2YGVA 4GSRA 2LABA 1B88A 1EHLH 5LG1A 3FQNB 3NCEB 2EABA 3S34L 1CFTA 2CRZA 4FQ1L 2DKUA 5CN2A 4EAEA 1Q0XH 4XN2A 5EEZA 4OTXH 4GG6B 4TUUA 3FO2A 2WOBA 2OPCA 4G3YL 2UV3A 3GPEA 1NCBL 4JDEA 4F33A 2XVLA 5BZDA 1FVEB 5JW3H 3TM6A 2IDSA 2DDQL 4IKLA 5AL8A 6PCYA 5FPIA 4Q6IC 4RX4D 1G5AA 4F2FA 1QSEE 4KO9A 4F9PC 1OIOA 2FIKB 1AKJB 4OZIE 3EO9H 4D7BA 4L3CB 5J3HD 3GF8A 3X11B 4LSUH 3TH3T 1A3RH 3QXVA 2X6BA 4DGYL 3POCA 1IKFH 2M8XA 5K9OB 3D3VE 4LLVB 3K1DA 5EUKB 3U83A 1PKOA 4LGSB 5SWZE 4H0GA 3C6EA 5DZOA 4DZ8B 2X2HA 1N8OE 1UWEH 1G5GA 2NPLX 1L7TH 3ECBB 1SQMA 4ACTA 1OHQA 5BV7L 3EH5B 4IQHA 5DZPA 1AS7A 2P5EB 3ARGC 3EFFA 3VFVA 1Y18A 2NTFB 3UTZB 4OBSA 1MRFH 4LEBA 3AW5A 2CGYA 2IWGA 1O75A 5C07B 2VDRL 4ODWB 4MSWB 1DJGA 3MRIA 4XP9H 3SDXF 3X14A 1NEUA 2ZWLT 3FB8A 4W70A 1FN4B 4ES8A 1EUTA 1Q9LA 2V5TA 4XVTH 2DQJL 1RK1A 4Y5YA 3WIAA 5F7HA 1UKQA 1A1OB 1UEYA 2D4DA 5I5MA 3G5XA 2GK0B 1QTYT 1OE3A 2VN5A 1D5BA 1I7RA 2KI6A 4H2AA 5KANG 4E9QA 5IMLA 3MV7E 4BZ1A 1VGKA 1DCEA 2MQGA 3D48R 3FQ4A 3HE6B 3U82B 1PFCA 4XN1A 3S37X 2QVFB 1EO8L 3BQUD 3TCTA 3LKRA 5DJ2A 5IREA 3TJHD 1OAKL 1R19A 2FH8A 5EU4A 1J8HD 2CBOA 2X3AA 1B4JH 3QHZL 1IGFH 1T1XB 3V0EA 1PZUB 5MHSE 4HV8A 2HUHA 2X6CA 4QTHB 1NICA 3MUHL 3HG1B 2F9BT 1EVUA 1RHHA 5E5MA 3FNKA 1NFDE 2P4AB 3MRQA 2EIBA 4ZSOE 4Z7WB 3RWJB 5FOBB 3KPOB 1B90A 3HAEG 4DGIH 3VU2A 5C9KA 2E27H 2D03L 1QBBA 3PDGA 4JMXA 5BS0B 1YN7B 4XMKL 4MXQD 3C5JB 4ATWA 2A4ZA 3DX7B 1PX4A 3JVGC 1GZPA 1P9MA 1R17A 3BUQA 1MPAL 2IANA 4W93A 4H8WC 3L3KA 1BJMA 5LQBH 4JPWL 4ZBJA 1OSEA 1HH9A 4JRYD 3QZNA 2HLEB 4MJ5A 1G7QB 5FYKU 4EUPB 4JX0A 1NIDA 1F3DJ 1OXYA 2AAAA 1NGXB 1XGYH 5E2VH 3U7YL 1C5BH 1UWEL 5JPNA 3CN1A 4KROD 1NMBH 1R1CA 3N1MC 2VWEE 1KXTB 1JPFB 1ZLDA 2DTMH 1HZLA 1OY3B 2QQKH 3DJ9A 3DETD 3DGGA 5EU3B 4MJID 5D96C 1B0IA 1Q9WB 2WZ0A 1IM3D 4UIKL 1JWUB 1EEZA 1QSEB 4AQAA 3UPRA 4OCYH 3LHAA 4LFHG 1U42A 4FKKA 2DQJH 3O0RH 3SYOA 4Y16A 2A6DA 5FYKE 4KV5F 3MRNB 5DEZA 4X6FB 4XE5B 4CMHC 4AL8L 4Q6KA 4UDUB 4IK6A 3WD5L 3SDXE 2P8LA 3D12B 5DQDL 3MREA 2ZKHH 1IVTA 2G4GA 3TBSB 5T1KD 2N4IA 4FNTA 2OTWA 1HYSD 1M2VB 4I0PD 5CMAB 3OAWA 5HHOA 3SPCA 1T6WA 1NC2B 2VQUA 1PKQA 5GS0C 3VDBA 4XBMA 3T3PB 4O58H 1U8IA 1QHQA 4KH9A 1IM9A 2XG4A 3GMQA 4LCCA 4D9LH 4GSUA 3CFKB 4IU2B 5E2TL 3AREB 4PM1A 4TLKA 4JZJA 5HDBB 5IFJA 2YA0A 3D39E 4JHBA 4JQIL 3IVKB 4Z77A 3MBWB 5HDBF 3CVIL 3WLBB 1TTGA 3TO4A 3LKSB 3RURA 1CE6A 4G1MB 1ZA6A 3HNSH 3V4VB 1RHFA 2G3ZA 2X6UA 5F7DB 2GY5A 2BOCB 3HBZA 5I71B 1IQDB 2NXYB 1TIUA 2MIZA 2QVMA 4PW3A 1LK2A 1QPPA 2A6JA 5F89A 5JNYB 2QT6A 4OT1L 4C56E 2OMYA 2AEQL 2GSGB 2AGJH 3OGCB 3T6XA 1CFVH 4QRPE 2W95A 3G5ZA 3QQXA 1HEHC 3MACH 1RZFH 1H15A 1Z9SA 4H13C 4Y88A 1DANU 3OD3A 4BZ2H 1CLYH 3QYMA 3U7YH 1JPTL 1LM8V 2X0WA 3A0OA 4P3CH 2GT9A 1FVCB 3SSGA 2F7QA 3EO1A 4GW5B 4P2AA 2B2XH 3T3PE 2CK2A 4LEOB 6TAAA 1AG6A 5EN2A 3BDYH 4ZSOA 2XVKA 3VWJA 3E2HC 1GS7A 2GKIA 5HDQH 4JG5A 5DLMH 4ZFFB 5C0EA 5J13B 4P5RA 1AGEA 3F64A 5F1KC 2ZOOA 5FO8B 3V6FB 1JTPA 2A5UA 1JE6A 2XWJB 3ATFA 4Q97A 4KITB 3GM8A 4PJBB 4K0OA 1W15A 1R3JB 3SKMB 2K9FB 4PJ9A 3CXHK 2VL4A 5DQDH 2P52A 1KCRL 3VI4E 3V6FA 2VL5B 5C6WH 2VSDA 4GKZB 3UACA 4CNIA 4F7CB 3O2DH 4M7JL 3LRSA 3HMXA 5EOQL 1UACH 2H0PA 2VR7A 1EEYB 2E7HA 1MCPH 3MRFB 4NCC2 1QUPA 2I24N 4OCWL 4P2QD 3PL6B 1NIAA 3UAEA 4PG2A 3TYFA 5GRVK 3WAKA 4NO0D 2O6EA 3L7EA 3ZTNL 3ATDA 4ZTEA 1NDGA 3EYVB 4KKQA 3SDYH 3U0TB 3IMBA 2E6PA 3ZK0A 3IDGB 1FL6B 1V55B 1FBIH 5DRZB 2V5YA 3LRKA 1GTFA 2A3TA 1MCOL 3EOTL 3TT3L 2C3VA 1JG9A 3KEDA 4R8WH 3VXSD 1AZVA 1MRFL 4HMDA 1DUZB 3OHXA 4BA0A 3IJ7A 3HUJA 1IGYA 3QPQC 4M1DH 3CK0L 2XQYA 4FHBD 4MXWL 3KNBA 5DFVC 3WHXB 3G5VB 1KGIA 1N8ZA 4B3VA 4D0CB 1D5ZA 3P73B 3FHEA 4NNYA 1YZZA 2VABA 3D39B 1MQKL 4LLMB 1A7PH 3I6GB 4OGAC 1FYTB 4Y1TA 2Y25A 5JYMA 3EYQC 1KULA 1FNSL 1Q9KA 2P26A 2XV2A 1KFGA 4HJ0D 5J6GA 3FB5A 4M00A 4APXA 3G5YB 4MA8H 4HS3A 3ZHFA 3FO0L 1MEXL 3GMQB 4U05A 4C58B 2PUQT 4Y9GA 3WJLA 5HDQL 5F6IB 1ZHNB 3II3A 2PWGA 4PJCE 1OP9A 5I9QB 4U1KB 5TH2B 4JMNA 1SDAB 3VYOA 2FCBA 4RFEB 3QA3A 2XJKA 4Z7OE 4ZX6A 3Q5OA 1U2YA 2X4NB 3F01A 4M8UA 1OP3H 3PGFL 3UADA 1T89A 3KDMA 2WNKA 1YSOA 1ZHNA 4PJXF 3NRPA 2ZCLH 4Z5RB 3U48A 2A6DB 4NKQB 1ETZB 3QI9A 4O2CB 4CVZA 4DSYA 4U0QB 4BKSC 1T22A 3ILQD 4AQAB 1WGOA 1U3ZA 4OZGA 2WQVA 1UM5H 3C5SB 3ZQ9A 5IV2A 2EUXA 5EOQH 3V0GA 2ZUUA 3OWRA 4U3HA 1ZY9A 2D7TL 4YLCA 4ONHB 1P7QA 3T2QA 2GJZA 1VF5C 4K71C 2WLMA 3NFSH 4F58H 1MN4A 3F58H 3LZFH 3RKDC 4Z3IA 4HK0A 3V4PH 1G7HB 1RPUA 5AOMA 1TNMA 3IETA 4GQPH 4HXBL 3BAEH 3TN0D 1F90H 1FF5A 3T4YA 4YHML 3SJVB 2CDFB 5E8OB 2I7SA 2W60A 4FQHB 2X6AA 3ISRA 4QKXB 5ID1A 1WEJL 3VI3B 2QGDA 3NSFA 3EOTH 3KL5A 1IKOP 2IDTA 4P23C 1SN0A 2WLYA 4PWGA 2V8MA 2ADIA 3QUXD 3V0DA 2FLRT 3UXFA 1LP9B 2VQ1B 5CJ8A 1WJ3A 1EDHA 2DZEA 5E99H 2DS4A 3H2QA 3RWFA 3UYRL 2FAUA 3ZGHA 5HXMA 1QTPA 5HTSA 3OPUA 2F7PA 32C2B 2HXAA 3BYYA 1Y1UA 2EDFA 4JY6B 5E5MB 5JOPD 4N2IA 4CNIB 3MNWA 1U4FA 2P80A 5KAQF 4M7ZB 5EEUA 1E4XL 2NT0A 3JTSB 5I1AA 1PX8A 3GSOB 1MEXH 5B7EA 4BK4A 2FB4L 1BD2D 4NHUB 1R3JA 5FO7B 3SKMA 4YDLB 3QI9C 1NBZA 3DKHA 3VH8G 1T1ZA 3D33A 3TZVB 3QEQA 3QDMB 4W68A 1MUJB 2EXWC 3GRWA 4CSSA 4PS4L 1O0VA 4GB9A 2FH6A 5DJ0A 3C87A 3IDMB 1FSKC 1WBXA 3SJVE 1N26A 4ZMOA 4LT7A 3NIGE 1ED3B 2FJHB 2FWUA 1MCWM 5BXFA 1NGZB 1U3JA 4JO2L 5G4MA 4AZ8A 1FAIL 1BVLA 1XGUB 3O81A 4RCAA 3BEWA 3UYOD 2MRYA 3RHWF 4APQB 4ADIA 2GT9B 4UT9H 1UT1A 2VDPL 1MVFA 3N5AA 1M1XA 4HIHB 1SNRA 2XIDA 1J5HA 1A7NH 1I7ZA 2ADFL 2BINA 2H7WA 1MHCB 1DQMH 2ADGA 4P23D 4F7KA 1OTTD 2V9TA 5FGBA 3UROR 1E8WA 2EDWA 2AQPA 3BAXA 2NY0D 4D9QD 1AG0A 2RQ8A 4UDTB 2CO3A 5ALCH 4AC4A 3MACL 1HTYA 1OGAA 3AS3A 5JNYA 5FW8A 2QVTA 1OGSA 2JKWA 5EUKA 3FU3A 2HA1A 1MCFA 2VC2B 2H2SD 3HMXH 1DZ0A 2PXYA 4X6DE 4ZUSB 1TSRA 1AQMA 1AXIB 3I9PA 1VPOH 1ILSA 4ZMXA 4PLNC 3AUWB 2XV0A 3H7BB 1KBKA 4OZHE 3MJ6A 4YSAA 2B4CC 2JQAA 4FYTA 5C0CB 4BQBA 5DO2C 5BV7C 1PFOA 4Z77B 3DOIA 1R9FA 3A6CH 2Q86B 2GITA 1UYWH 2XA8H 2XFGB 4LHUB 4DK3A 5I1DB 1OALA 3ARYA 3II1A 4ZUVB 43C9A 4BQCA 3CFKA 4IU2A 1A4KA 2V17H 1KTDA 5DMIL 2CHWA 2CLRB 2A6KB 2XNAB 2E7BA 5SWSB 2XFXB 2PYFA 1FLRH 3P3TA 3GMLB 5HHOB 4YO0A 1J9QA 3IPEA 1I9RL 3EF7A 1IGIH 5DWUH 4ZW7A 3IU3B 2HVBA 2JVUA 1JZ2A 2XOTA 4P2OA 4HJEA 2IFFL 3NK3A 2YJLA 4WK2B 4YVUA 5C92A 2BY1A 2WANA 4OLVH 1BZ7B 3IJYB 5H35A 1DO6A 3MLTB 1JRHL 3HC0A 5CEYA 1UATA 3BUTA 1YEIH 2JXMB 4PS4H 4XXCC 1OOWA 5BZXA 3MCLH 3CFNA 1U41A 3SE3A 2BJML 2WVVB 4MQXD 4I9XA 4S1DC 3NIFE 3VQ2C 3DBXA 3FUHA 4OH2A 4MNGB 5DGQA 2EO1A 4GAFB 2X4UB 2AS5M 3NESA 4OZIB 3GLDA 1QUNA 4Q7DA 4G6JH 4LZKA 4YAQB 5GZOA 3F2LA 2J8HA 3O6MH 1LO4L 4LLUB 4PB9L 4HJJL 2Z35B 4GAJH 4BFEA 2XC8A 5CLTA 3WMPA 4Y5XC 4OLZH 4C8XA 5F8QC 3BKJL 2ZP0T 1BXUA 4EF3A 2NNCA 5LAXA 4A2LA 1BVNT 1W0WA 2ZD0A 2VJ0A 3PG2A 3WI9A 1DVFB 2IH8A 4MCZA 4P57B 1DDHB 1BZQK 3GMOB 2R1YA 3Q6FB 4O4YL 1KBVA 1XSKA 1YA5A 4N1EA 5T1LB 3S37L 3SBWA 4U4IA 1R3HB 1BX2B 1RPQA 4QT5A 1BIHA 1S9WB 3WS6C 4O9HH 1L6PA 1SYSA 5DC4B 5DJCB 1QLFA 3CDGA 4FQJH 1E8XA 4R3SA 2MSPA 4WUKH 1WAAF 3T2NH 5IEKB 2OYMA 2VISB 2OMWB 3WIHL 1GJUA 2APBA 4WSGA 5EU4B 4AY0A 5AVXB 4JPVL 1QA9A 4MNGE 4FNLL 1CU4H 5HHNA 4HAFA 2BIOA 3M46A 1FSKB 2J2ZB 4FTVD 4K3JL 3VSVA 4BHUI 1D5XA 3L3DA 5DJYA 4PV9B 3FF8A 5IT2H 1JV2B 5F0LB 3CNKA 3JTTB 2OX5B 4PCTA 2DMCA 2AXFB 3SCMA 4N0RA 5HD8C 1IAKB 3O2VL 1ASPA 1HWHB 3MRLA 4JQIA 4AW4A 5I17A 1Z9PA 1E0OB 1UB5B 3HG1E 2HJLA 2DQUH 4UU9B 2WINB 3ARTA 4GXVH 3WEXA 2GUYA 2O5ZH 4M5TA 3RIFF 1QEXA 2VW6A 4DUWA 3WTVA 1VEMA 1IKNC 3HCVB 4GO9A 5JQ6H 2XN9E 1S7XB 1KB5A 2X2UA 3GS7A 2FD6L 4U1JB 3ZRCC 1SUHA 2CUHA 4IOFC 1CI5A 1JV2A 4P5SA 4WF7A 5JOPE 3BZEB 5GGQL 3SODB 5EA0L 5AVUB 5C08A 3IKCA 3KGRA 2B3RA 3RPKA 1QZNA 4FE9A 1YRKA 5MP6H 2YGOA 1JZIA 4OLZL 4P5MB 3S0PA 3U9UA 2OL3H 1QPXA 2FECI 3ETBF 4D7PA 1A6VH 3OJDA 5CLYA 3TO2B 2JKRM 2XX1A 3GI8H 1RU9H 3SZKC 5L2KB 3FHAA 3NTCL 4NZRH 4K3EL 1WZ1H 1DFBH 2DD8H 4K9EL 3S3CB 4B6ZA 4X4XB 4FLOA 5I18L 3TEWA 4NCDA 3A67H 3MRBA 5AYUL 3FQNA 3GRWL 3T9WA 4JRXB 1RUKL 1EO7A 2DYRB 2EIKB 3VMPA 4BEIA 2CR3A 1I82A 4PJHE 1KOAA 4QNPE 1DSYA 1QQDB 5BO0D 2CH8A 4B9KC 1RJCA 3I9AA 3CXDL 3ARGA 3QR1A 4WCYL 1ZS8B 1DBBH 5DD1L 5CO1A 1QFUH 2BCKA 1NUDA 5I26A 5IQ7H 1ZVHA 1CF8H 3ZT6A 4PJXA 5JPNC 4NNXA 4C83B 2WQSA 3C5ZC 2I9LA 3L4CA 3O11B 3PQYB 4ZNEA 5FGCE 5JZ7D 1OAUH 4YHNB 1NCDL 4ABUA 1YUHB 2K8QA 1ZLUH 1XCTB 1CGUA 4F7PB 2CKBB 4HFUH 3OC8A 4JJOA 4JCMA 2YRBA 5MEQB 4LGRB 5BO1L 1QI3A 3CDFA 5AVRB 1AJ7H 1HSAA 4QCIB 1S7TA 5ISZE 3I6SA 3K72B 4BFGA 5HDWA 1GGTA 3T2LA 3UO1H 5AVWB 1XEUA 2VITA 2MOQA 3SGKA 2WXFA 2G5RA 3GNML 3QCUL 2ALWA 2CLZB 3JYBA 5IVZA 2R39A 2H6PA 3SGEI 4D8OA 5JXED 4OGXH 1DLHA 4JGUA 1GJIA 4ILDA 1T4KA 4DN3H 1HKFA 1XWVA 4ENEC 3ZHKA 4U7SA 2E59A 4JM4L 5SWSA 3U4EB 1KDIA 4DT2A 3LRMA 4EQ2A 5DMGC 4XWGH 5JQIB 3K8LA 4XB8A 2EKJA 4JZJC 3DXAA 4R97B 5I1EL 4LU5H 1RU9L 3UTSD 4BDVA 5J11C 4UOQA 1CN4A 2L0DA 4GW4A 5FO2A 1RZ7L 2VRAA 1IGIL 2C9AA 3CVCA 4RDQG 3LXCA 4IJ3B 3A24A 2I69A 4XNXL 5AB0A 3HC3H 5ICYA 1ZSDA 3SDXA 5AYUH 3HI1B 5JA8B 4PG9A 4A39A 2IAMC 4PMEA 1R3LB 1RVFL 5F7NC 5DFAA 2EUWA 5J89A 2CU9A 4F57L 2UZIL 3WENA 3MNZB 1NGYA 1S5HA 4N0CC 4RMQA 4LKXA 3GO1L 4YHKH 4ZPVA 2Z31C 3QGVA 2CJSA 5FUCE 2WTRB 1T3FB 5DI8A 4FTVA 5HGDB 4DQOH 5B1AB 3SOBH 4GRWE 4S0SD 4DWHA 3KH3A 4WI0A 3HRZB 3VFOA 1UWFA 1J0IA 4A2MA 4U1GB 2BVEA 4TUOA 5EEVA 3VA6A 2HT2C 3TNMA 4QXUH 3DX0A 1Q9OA 2L04A 2K4AA 4W6YB 5BJTA 1CMOA 5KVGE 1UD8A 2IGTA 1NJ9A 5JIQA 2AW2A 5CSZB 1WZAA 4AE1A 2VR6A 3TNMB 1NFIB 2AAVA 3REWB 5BO1H 1ORQB 2JKNA 4UYQA 2IDCA 5JQHC 2LAAA 1JGUL 1JRHI 3AY2A 2J56A 1BQSA 5CJXC 3KL0A 1TQBB 1XH1A 4PPTA 1SMAA 2J8UB 4JG0H 4EI5A 3UTOA 3U30C 1AYOA 1W0YT 3GSUA 1U91B 4JY4A 3ZHLA 3FCUB 3ZTDC 2X89A 3OKOB 4PWIA 2ZNWA 3QH3A 4G6AD 4ONFH 2GJPA 5EOCH 2QLYA 2BH0A 1BFSA 3H1ZA 5EO1B 1J5IA 4JM4H 4K94C 4YDKL 4PCKA 2KL6A 3Q8BA 2GSIA 4XP4L 2NR6A 3VDAA 1A22B 3RWFB 4F7EB 3ULVE 2VYRE 3DHPA 1YMHB 3BLPX 4HJIA 4ZXBD 5JUEH 5DJXA 2OCCB 3D4YA 2D03H 4U31A 1KGUA 5DD6A 4FFVC 4PP1D 3DXAB 4XNZC 3TJEH 1TEGA 2BIPA 2A77L 3UTTB 4XNUL 4Y2OA 2XZCL 1SEBA 2A0LD 1OD9A 1U30A 2F7IA 2FBOJ 4I18B 4NSKA 4PJIE 5GS1C 2CDFA 4N8CL 5E8OA 5ISZA 3RZCC 4F92B 4PJBE 3CZUB 4JFQA 3QZMA 3TBWB 2WK2A 3IRCA 1JVOA 4P46D 1NL0L 4B60A 1AH1A 4YH6A 1BW8A 1JPGB 5E6UB 3W1ZA 3NH7L 4A7VA 4P07A 5F9JA 3WUZA 1H3TA 3U1SL 3WTTA 1YNKH 5JXEA 1WH0A 3QXAA 5INCB 5ESAA 2VITB 4ONHA 5MENE 2Y0SA 3T1FB 1WHPA 1G87A 1EMTH 2I07B 3R1GH 3LKOB 2PPEA 3V7AE 5D8JH 2G2RA 1AO7A 4OZGB 3DI2B 1FFPA 2NY6C 4UIKH 1RUPL 5D4IA 3EJUA 5I16A 1OOAA 1E40A 3RG1C 1OE1A 3UYPA 3WJLC 3NSYA 1E5BA 1Q8MA 3RGVD 1XR9A 5HI3D 1T5WB 1TJGH 4OQTH 5C7ZA 3ZUCA 8FABA 1S3RA 3BT2H 4HUMB 4XC1L 3P3SA 1A6VL 1GCFA 4MAUH 4KTGA 1XSOA 3KPSD 4OJEH 4W6WB 1P7HL 1R75A 4Y5VA 4FNQA 2BVOB 2VJ8A 4IRZL 4O58L 4BH8A 2DH3A 3L5HA 4LSQH 3RVWC 5TGBB 5JW5A 4KAQH 5BRZB 1BZ9A 2H26B 3TASA 5HHVL 4RMVA 1MCCA 2EVGA 4R96A 4S1QH 4IU3B 4UOZA 3GSRA 3CVDA 3HPJA 5CXPA 2C1OB 4JFXB 2X4TA 3OAZK 4RZCA 1KPUA 4X4XA 5FYLD 4BGDA 4AW7A 1T03H 1BEYH 4JVPA 3WLWC 4EPSA 3ASOB 4FXGA 1KXVA 2P5WB 3IDYB 3VFWB 3ROOA 3PNWB 3S5YA 2AJUL 3OKLB 4IKNA 2ORBL 1YEWA 1A3LH 4ZAKC 3B9VA 3DMMD 4NN6B 5GIRB 1R5VB 5LWYL 1BFTA 2YPKA 3GIZH 5IW1A 3FTGA 4KU1A 3EYVA 3P9WB 3U0TA 1DQJA 1Q4NX 2QGCA 1DVQA 4U1SA 3SPHA 2EIEA 3OZ9L 2HN7B 5SV3A 4JE0A 1RZJH 4MDJB 4FG6C 3UBXB 3FB7A 1BHGA 1DJHA 3I50H 4E9XA 4XNBA 3N40F 1EMTL 1F6AB 4F1SA 2ZSVB 3ULUC 2RGSA 3BDYL 5IFAL 1T7XA 3F85A 3VFMA 2AEPH 2FGWL 2X1XR 1KEGH 5F7FA 3MLUH 2XWDA 4BKLB 4XT1C 3GXDA 5K1JA 1UB5A 4TTGA 1FE8L 1QNZL 1QNIA 3OKMB 3T0XA 2QPEB 4EJ1C 3DDGA 2OXHA 3PRZA 5F0JB 1KDJA 3SN6N 1DBAH 1J0YA 1P4BL 4MMZA 4WU5B 2LW3A 2Y22A 5MHSD 1T21A 4JZOB 4IMKC 2WLNA 4UQCA 2NUPA 5SX5K 5I24A 1BP3B 3VFPB 4C4KT 4LU5L 3X2QB 3GHBL 3MODH 4QPEA 1FJ1A 2Z7UA 4XN7A 1LDPH 2YO3A 1O6SA 3ZYJA 5CBEB 5GS0L 5DYOB 3NZ8A 4LSQL 2J5WA 4PJ7B 3L2MA 1GY2A 2D3JA 1FVCA 4FERA 5FYKD 3ZR6A 1H6EA 1UJ3B 1E4XI 4K55A 1MCDA 1QHOA 4Q9QL 3BN3B 5TFSL 3D05A 2X4SB 2Z34A 5DLLA 4H5SA 4MJJA 5ICZB 4R7NA 3BC9A 3ARDC 1JHTA 3OKNA 4NDMA 2XPGA 4RMTA 3BO8B 3UJTH 5DZ9A 1FCCA 1UFUA 3MJ7B 4MB1A 5EEWA 3IFNL 3ESUF 3LVTA 2FECL 2GHZA 4YSPA 4NRZB 2H8PB 4LARL 5EZOL 2Q2EB 4FG2A 1TO4A 3C9NA 4MB4A 1PJ9A 4A6YL 4ANKA 1E7VA 5I0DA 4GT7A 3SHSA 4LOEA 2AMUA 4QXUL 4R26H 2ZUXA 4G8GB 3LKNB 4ODTH 3JZ7A 5LNGA 1AP2A 3CHQA 4FJZA 3WFDL 1YECH 5B3JE 1A6ZA 3Q6GL 3CZFB 3D2UB 4JUTA 1NKRA 5A2CA 1A02N 5DMKA 1UB6B 3MV11 3PL6C 3EH2A 2Z8RA 1U8IB 4YZFF 1D7FA 1NDMB 2BZ7A 3UAJD 3KLSA 1YDPB 2FBRA 5IGXL 3WN6A 4N0UA 3QIWD 2OTWB 5A7BA 3C5ZB 3MREB 5AAWA 5GS2H 5JLZB 3P0VL 5C0DB 3WFBH 4GQ9L 4JKPH 3ZKND 3V0WL 4N85A 4XMXA 4FP8H 1X5AA 4Q4IA 3CAFA 5H35B 3IJYA 2W9EL 4PJEF 1ZAGA 3OSKA 1TTFA 4ZX5A 2ZAGA 3TPUA 1CDHA 2CHXA 2RFXA 4NT6B 3UOAB 5C0JB 3VG9C 4W9CC 4XXCA 2KDYA 5JUEL 3D09A 1UXWB 1BQ5A 1CTNA 1MWAA 3TFKD 4AITA 4PWEA 2ZXQA 3P9MA 4M4RB 2CGRL 3C6LB 2LR4A 3TBBA 2XNAA 1FNLA 2DEWX 2W81C 4FQCH 1AQ8A 1UGKA 1XR8B 3IEAA 3SQBA 4TQIA 3DK2A 5GGVH 3HBQA 1J8KA 3ERXA 3HLAA 4PG2C 4L3AA 4ICXA 3DWTA 2ZUQB 4LHUA 4X99A 3FOLB 2KKQA 4P2QE 3S3JA 5SWZB 1AIFA 3IFOA 2VERA 3LXUX 5ACZA 1HH9B 4LDEB 4OLXH 3WFHA 2UY6A 2IV9A 4L23A 3CBJB 4OF8A 2WNXA 3UJJL 3VGAB 3UEQA 3NCYP 3DRTA 4L4TE 1ZLSL 1NWOA 3RYMA 4KBPA 3UFIA 2A83B 2PTUA 1GKOA 4QXTA 4XX1G 2GB2A 1JCKA 1LD9A 4HH9A 2N7BA 1PZ2A 3PS6A 4IOSA 5BW7A 4X6CF 3P4NA 1RPKA 1AHMA 1PPIA 2VZ3A 4KMQA 5ID0A 3HPLA 4NO2B 4Z7NB 5HHMB 2CALA 3IDIA 4YX2H 1NPNA 3E6FA 4FRWA 4XZUB 5E0FA 3OZKA 3R8QA 1L5GA 2PYEA 3U2SA 3VWKB 4A2DA 1XQ4A 4R7NB 3PHOA 3TH2T 4E41A 3EGXA 2QHLA 4DHLA 4ZZKA 4WNSA 1AFVH 2PWEA 4L3ED 3KLKA 4HS8H 4L8BB 1FL5A 1UJ3A 5FYLH 4EN3B 3K5SA 4WW2F 3ZO0A 2E76C 3KPSB 1YPZA 2BNQD 2E9IA 1B9ZA 4PJ7A 4Z7OF 1BLNB 3VXSA 1WD9A 4UB0L 2C7FA 4KKAD 1E4KC 1WBXB 4XN9A 4DTGL 3FN3A 4PWHA 4AGQA 4ZK8A 3QUGA 3D52A 5TE4H 4NKOA 4W9EC 2KMWA 3BKYL 3BSHA 4QLRA 2EICA 1T5XB 5DZVA 1WAEA 3Q3GB 3QDMA 5ITFB 25C8L 4WO4C 4MQTB 2EACA 2PCFB 2OMXA 2MTAA 3MJ9H 1FN4A 4NO0A 3MRHA 3JTSA 4EN3A 2BLFA 5DTFA 3SY0A 3AY4C 3RNKB 1Z3GH 2K9UA 4G1EA 5J0BA 4FNUA 3S88L 3EYFA 4H8HA 4J5VA 2YK1L 4ZUUA 1NCBH 1V3MA 1D9KA 3L9RA 5CEZE 1QHPA 1AY1L 1E67A 1TJMA 1UUNA 4M61A 5ID0B 2VJXA 5LWYH 1EXUB 4MDJA 1OAXL 4KUZL 3BJLA 4NPYB 5DUPH 1DQIA 4KY1H 2PR4H 5IW1B 5EBWB 5GIRA 2VT0A 4HLZG 5DDHA 2HLAA 4BELD 3LPFA 1QRNE 3SJVA 3QCVH 4CC1A 1OSYA 1UOKA 2WC7A 5IR1A 4AM0A 4Y2NA 2F54A 3VTTA 3LEYL 3WELA 4P23A 4MD5A 1Q0XL 4N3UA 1M7UA 4QHNB 3VXOB 4M62L 4UM8B 1X5XA 2EADA 3O45B 3DX6B 3BCDA 1A47A 1H8NA 4FFZA 3CH1A 4NJAH 1SGKA 5F3HB 2WBJD 2WXRA 1YJDC 1YNLL 1UXWA 3IMUA 3G6AA 1VLXA 3MRDA 4MAYD 4XXWA 5E9AA 3JVGA 5JW5B 3AS2A 3GHBH 3MODL 4Z5RA 3RWIA 1G7PA 3UAJC 3FONB 1IFGA 5DO8A 3E80A 3MLXH 3RX9A 3N91A 4PIRF 5JLZA 5J9PB 3C5ZA 1BD2E 2HT3D 2B9BA 3F00A 3JT2A 4M8RA 3BVXA 2OMTA 4KO5A 4D0BB 1CR9L 3RWEA 2BVPB 2NTSP 4XZ4A 2BJMH 3DA0A 4OJYA 4UQ3B 2RCSL 3TA3D 1BQKA 1R4XA 5DO2D 5C09A 3RVUC 4A67A 4ORGA 1BZOA 3LS5H 3DX8A 5I16B 1M9WA 1GY1A 3STLB 3TV8A 4JM2D 1UENA 2R56L 4KK8D 4JFVA 1OGTB 4WNQB 1DVZA 3JWOC 4TUKH 1NCJA 3KCWA 3O6ML 2NZ1A 3QRGL 5HHXL 4LARH 3D3VB 5EZOH 3EYSH 4CAGA 5HHOD 5K33A 3FBKA 5C3TA 4PB9H 3WHXA 5C97A 5INCA 2I26N 3E9UA 5L2JA 3HE7A 3HTLX 4KUZH 2AJVH 4NQTA 3C9NB 3ARDD 4OF0A 4HFWA 1G7JA 2D9QB 4FZEH 4NRZA 4LCWA 3NJXA 3IDYC 3AQYA 4KGJA 4CVWA 4XVJH 3MPCA 1NAML 3QZPA 3RJOA 4OFIA 3ZLQC 1BJ1H 3KPRA 4YDNA 4X8GA 3U1QA 1H9DA 3BO8A 1WICA 4TOYH 4TVSa 1MCWW 3IMSA 3I3EA 1DLFL 4NSKB 4PJCA 4Z7VB 1MHHB 2HRHA 2DY2A 4Y2OB 5D7LB 5GHWL 3PNRB 1GZQB 1U8JB 3FT2A 3MO1B 5ILTH 1QKZH 4G7QB 2X4SA 2DQHH 4DN4H 5KBMA 2L7JA 4OCSL 4OCRL 5HYSG 4ELMF 4OIFA 1GOFA 2XWRA 5JA9A 1ZVSB 2D31A 3BPCB 3D06A 4LOVA 4ZPTA 5JOFA 4NZTL 2EXTA 2YD2A 3LB6D 1MAKA 5GSVA 3KM2A 3FT4A 4F8QA 3INUH 5CF3A 1HSBB 2OZ4L 2NYKA 1T20A 2A7BA 2R0ZL 4F7CA 3CXHJ 3QH3B 3HR5A 4BCXA 1S9VB 4LSSL 4PRDB 3MROA 5GZNA 2QVKA 1T21B 1IRAY 4Y7MA 4MMZB 4A7SA 4IIZA 4F9PA 3S8FB 4D9QE 4J3OF 2MJWA 3Q13A 2CGRH 4Z0XA 2EEDA 3O2VH 4HF5L 4PJBA 2XWJA 4ZNCD 4PJ7F 3BVWA 1P1VA 2X4QB 3QQNA 1X5MA 3HEIB 5F96H 5L4IA 4ZFFA 2F2HA 1C1EL 2B77A 5D72L 1NJ9B 4JO4L 1BG1A 1U58A 4Y2DB 1JXDA 4LEOA 1EJOL 1XDTT 2DYSB 3NCYS 3ZE1B 3P30H 2VM4A 4G8FB 5M95B 1RERA 1MDAA 2OR8A 3CSFA 4TUOB 3L5XH 4P4KC 3PY9A 5CJ5A 5IBTL 1P6WA 1S5IL 2YPKB 2X42A 4GUPA 1WGVA 3JV5A 3MA9H 1DEEB 4FTVB 4X80L 5TDOB 5FK9A 3PABA 4XVOA 1KYUA 1I3RA 2F58H 5INDA 1T0MA 4PRBA 2DKSA 2YPLA 1FGVH 3SKJL 3ILDA 1GYCA 3WSQL 4U1NB 5F89B 3PLYA 3VXMB 1YLBB 2BOCA 4MB5A 1R3KB 2PW1A 4UCFA 1BZ8A 5MENB 4HX1B 4PTUA 4ZUWA 4PG9B 2G4EA 5E0QA 1PKQE 5I15H 3KYOA 1DBKH 1TR7A 3TCLA 1E5UI 1C7SA 1AR1C 3QEQE 4CVXA 1CE6B 2FHBA 1OCCB 4G1MA 1NCCL 1BQUA 2WUCH 3HJEA 4RZCB 2P46B 3TT1L 4P3CL 4CBZA 1KB5L 5F7LB 4OCRH 1Q72L 3BH8B 2F68X 5F3FA 2C7UA 2Z92B 2ZAHA 4JS7A 3FBQA 2NQDA 2HWZH 4PP2B 4OM0H 4LOUD 4JREB 3VXUA 3BXNA 4IHOA 2BVOA 3K2MC 5CGYC 2ZCHH 3ZW3A 2FX8L 3QQ4B 2RACA 2EE3A 4P9HL 5DHYA 2W80C 6FABH 1DBBL 3IRPX 1G7IB 1WAAE 2YZ8A 2JK5A 2LU4A 1TQCB 3IBOA 3PFQA 4N0YH 4ZDHA 3SE4C 3WO4B 4HOXA 1JNLL 3D18A 4J2QA 5IVZB 4K8RC 3BZFB 4Z3GA 1KB9J 1DBML 3EDFA 4FF9A 4HYTB 4KDTA 2AXWA 3C6LC 4XPGL 3MRNA 4ZTPH 5CU5A 3VFGH 4Y16B 3O9WD 2B59A 4LPTA 2Y7QA 1XF5B 4MXVE 4Z7WF 1JWUA 3WGVB 4QJ5B 4LBEA 1PU0A 3ARQA 5C6PB 1OAZH 5C0CD 3UIZA 3LY6A 3T1FA 2IBZY 4HS6A 4NAMA 2G5BA 2P28B 3BE1H 4Y5YC 1PZ5A 2HPOA 3VFNA 3D18B 3BAWA 1OCOB 2APTA 1MHEB 2R51A 3LSOA 4W4OC 1JPGA 1IGTA 1MXGA 4BFNA 1OAQL 1NGXA 3MAWA 4L1TA 4RGMB 4EIBA 5E08L 1S4IA 1SJEB 4GRWF 4WEEA 4UQEA 2JI3A 2K45A 5I6LA 5DS1A 3C2AL 1CT8A 4PSRA 4X9FA 3HI6L 4NJAL 1NMAL 2YA2A 4YHOH 1YEEH 2NUTB 1YG9A 1N2RA 2Q9OA 4PJFE 3JYCA 1GS8A 3BH8A 4M1DL 2Q3XA 1YNLH 4C47A 1UKSA 5GJTH 3CFJA 4G6AC 4EUPH 3NYKA 1G9HA 2J6WA 5C07E 5FEBA 5D5MB 4KKNA 2Q3ZA 3ZKXC 4HJTA 1L6ZA 4AEHL 4OCXH 5L4FA 4DP6X 4YSOA 5FM4A 2XWEA 5D1QD 1KCUL 2IGFL 4PTTB 1LTXA 3SYQA 4MA8L 3TO2A 1RZJC 1UVQA 3O8XA 4HUUA 5CIPH 3RL1B 4OM0L 4QRBA 1J11A 1GC1H 4YE0A 2OL3B 2DWEB 1OP5H 5EMYA 1T1XA 2PP9A 4Z6AT 3KBPA 3KYMA 5L9DH 1CICC 3X3GL 2QSTA 4RGNC 4JKKA 3WBDA 4DP5X 1JF6A 3HHSB 4R0LA 4XP1L 1OM3L 2HVKA 4KNSA 1ACYL 3L08A 4MCMA 2R1WB 5EF3A 4N20A 3PGDA 3UZQB 2OMNA 2V33A 5AAMA 1BDYA 4G8FA 3PCYA 5JHLL 3CQFA 4K94H 3K80A 2GK0A 2H0FA 4TPRL 1KN4L 2ZCKH 2WWKT 4JG1L 5CSZA 2UXTA 4Y2DA 3E3QC 2FL5A 1UKTA 4NBXB 5T33L 3W38A 5E1IA 1LL1A 4G83A 2NXZB 3CPLB 1XFPA 1RURL 3NCBB 4CUCA 3OLEA 2COQA 4OGYL 4JFEE 3ZDZB 1IGCH 4HHWA 4QHMA 1T66D 5I1GL 3UTZA 4LKCA 4LL4A 5DVPA 3WJMB 3L5WA 3N50A 3OB0K 3MRLB 5I8CA 5GRUH 2CRIA 1UHVA 3BMVA 4TOYL 4QHUA 2H41A 4UTCA 3MROB 4PRDA 5DJYB 4J7RA 3L3DB 4FXKC 2AJYL 5IBLD 1EQWA 1QYGL 2DBLL 4BK5C 1KSRA 5FKAA 2DRUA 1KFAH 1BM3H 3N42B 4AJVA 2RIKA 1UXLA 4ERSL 2WYHA 1NMAH 2IH9A 3MQIA 3NA9H 4ZW6A 2FX9H 1QLRA 4UTBL 1LILA 4Y9CA 4R3SB 3MV8A 3GMNB 2WXLA 4NI6A 5LXGH 3D34A 4IKKA 2E46A 3PJSB 4TLUA 4Y2DD 4BV1A 1DO5A 4ZAKA 1J8HE 4KTDL 1FVEA 1M6OA 1ZMYA 4PJCB 3ZE1F 3CZJA 4ZNEE 1BOGB 5DVNA 2AQ2A 4JPQA 4GG6A 4ZUTB 3BAYA 3EO0A 3NIDB 4O5LH 4X8JB 4ZFOA 2XZQH 5TQ2H 2VAAA 4NKDB 4GINA 3II2A 2I85A 2BSEA 1F8TH 3O2DA 3QCTL 5JMRA 3GUFA 3W11C 1G6RL 3I3DA 1ZWIA 4TUJA 1CD1A 2EDTA 5CZRA 3VGHA 1HHGB 2F1BA 2X89D 2HT4C 3ZO9A 4U1IA 1AE6L 5FYJL 1SZNA 4ANWA 3R1GL 2YKLL 3EUDA 1ZOXA 3QDGB 4NENA 3HFFA 4HJUA 1NMCB 2O5XH 3DX8B 2EIMB 5D96B 5C09B 4WW1A 5IB4A 1PIGA 2YWZA 5EU6D 1FFOB 2PYEE 4FQXD 5KYYB 4D0BA 5I1JL 1UM6H 1O9VA 3O6LL 1UEMA 4NNXB 3FB6B 1E4XH 4Q9CA 4PV8B 2PCYA 3SPJA 4CMHB 1P7BA 1VENA 3B9EA 2I5YL 3HC0B 2BO0A 4YDJA 3O3AB 3FCSA 4HBQA 5KVGL 1JPSL 2VLLA 4N5UA 5AD0B 2BHUA 4GAAA 3MGOA 4IIQC 3WY2A 4P2OB 5K59F 4HHGA 3TA3C 2I9TB 3BWSA 4XB3A 1XF3B 2FYYB 2HZHA 3K6IA 3DJRA 2X1PA 3WTYA 1TVBA 1X9QA 2KERA 1MH5A 5F8RC 1XB6A 5F3HA 3V5HB 1NCGA 5CZVL 3SY6A 3GK8H 4CW1B 3VH8A 1E9OA 4UT9L 2VDNL 4QRFA 4KI5C 5DK0B 2NY6B 5TK2A 1MZZA 5DHVA 3BAKA 3X13B 1QOKA 1OAYL 3FFDA 2AKRA 3OXSB 4JDTL 5AKRA 3V6BR 3WL9A 1XH3B 1A6TA 4AYEC 3ULVL 4YE4H 1PLGL 4PLKC 2H32H 3H7BA 4NQXA 2XWBB 1XCWA 1AKPA 2CSPA 3TP4A 3CZLA 3OX8A 2WZAA 3L6FB 4X2UA 3RBSA 1Q0YH 5C08B 3TBYA 1ZE3C 3BUBA 3LZOA 4N9GB 4UBDD 1OGAB 2GEEA 3FQXA 4KXCA 1JNHB 5AW2B 1YYLL 2R0LH 4HAGA 1WT5C 5GRXG 4Z76A 3L9RB 2YGQA 4G6FD 1U4EA 4POUB 4DGUA 2R29H 4DVRH 2QHRH 1UYWL 3W3BA 4L4VB 3TO4D 3QEQD 3ULVD 2VOTA 2XQYG 4X6BB 2E7LA 3RQ3A 1IIIA 4OD2A 2HJLB 2VZTA 2MCPL 4XMUA 3MRGA 1IFHL 1THCA 3OM3B 4J39A 4YZWA 1M7IA 1A8JH 4GSDH 3SCMB 3BGFB 4G6JL 1PZAA 4P5KA 5GRYA 1JGVH 1CXEA 4YDIH 4M5ZL 5DZLA 1EAPB 4NYLB 5E5LA 3NFNA 1F3DH 4I0PA 1BLIA 1QRNB 1UM5L 2NW2B 3MBEC 5KZCB 1YEDB 4WI2A 2B4CH 1HINL 3BKJH 4TSAL 1MFAH 1YAIA 2NY1B 5FO7A 4UQIM 1IGML 2NCMA 4M1GL 4P9MH 1SBSH 3B1TA 3EJZD 5CJOL 4AVJA 1FO0B 2ZXEB 1X9UA 2XTJB 3NFSL 2NY7L 1CURA 3ZDWA 2JWYA 4L8BA 3S5ZA 2JIXA 5HYEA 1N6QL 5LKNA 1G9MH 5BVJB 1S9WA 1KCUH 1DUYB 1PNDA 2IGFH 3THML 2ATAA 4NQDE 2FSDA 5C9JA 5KYWA 2PYEB 1L5GB 3VWKA 2XG5B 1WFOA 3MV8D 1DDHA 1I9JL 2VLRD 3NCFB 4XPHH 5KTEH 1SHSA 1WWAX 1FH5L 3FTZA 4HJGA 4WFFD 5AALA 3UG3A 1AQDB 3HAEB 4OCMC 4HJJH 4JFED 4JHVA 4MNQA 5BZWA 1U8QB 3EYUL 3CE1A 4P4RB 2RR3A 3VFTB 4IDJL 2VXQH 3EJYC 3DVNB 4F8NA 3MJ9A 5LGHL 4G8EA 4G7YL 1HHJA 3T4YB 4Q6IB 2H9GA 3ULVF 2BFVL 1NANH 1V3KA 1HK6A 1NM4A 1BBDL 4P2QB 4JJHA 1GH7A 2Q87A 1KCSL 2D0FA 3VFSB 1AZBA 5H2BB 3DSFH 2X28A 1XSJA 1N64L 1DQTA 2FZ3B 5DCCA 2A6IB 4DVRL 1W72A 2PN5A 4MJIE 3LH9A 1ZLWK 1H3VA 1HNGA 2BW4A 3QJFA 5IB2A 2QLVB 2FT6A 5I19H 1IO4C 4LCUA 2BWQA 5DMGD 4OKDA 5FO9A 4QJ4B 1SM3L 5E2JA 3WFBL 4JPVH 1F58H 3D0LB 5HHME 2JB5H 2XIIA 4F20A 4JW3A 2F54E 1I8IA 1QASA 3FOMA 4CN1A 3RPIB 1E6JL 3TC9A 1FZOA 1IAIM 5ESQB 2D2OA 2ZG2A 4TF4A 5IQNA 5TH2A 2B4CL 5H37H 3U36B 2AZAA 1T0NB 4HGKC 2OL3L 2EKSB 2VDKB 4P9ML 1RV6X 1XH2A 2A6KA 1UA6L 2CLRA 2FEJA 5CU9A 3OWEA 1M9SA 1MHPL 3G5YA 4JHZA 3X17A 4GXVL 5I1HH 4ZMQA 2OXGA 4NZFA 1LYQA 1RZGA 4MD0B 5C09D 2WKGA 2Q86A 5MI0B 3H9SA 4XI5D 4I9WE 3SDAD 1AP2B 2YRPA 2B7DT 4NNYB 2VDMB 3P73A 5I8KH 3RJQB 1QABA 3MUZ1 1IBHA 2BWDA 2XHNA 2XN9A 3C5ZD 1RUAH 4GS7B 1GS6X 3JWNH 3TNNA 4DP1X 4I2XB 4WEUD 4X4MA 1KIQB 4ZUSA 3B2DC 3QDME 2XV3A 4JRWA 2YSSA 4M93C 1MREH 4MNQD 4B9JA 3SE9H 4U7KA 4UDTA 3DOSA 1KTJA 1TITA 2AVFA 4DKAA 4KZEH 4P05A 1C5DB 3CBRA 3ULUE 2WWKO 1TG8A 3A22A 4X6CE 2Z0UA 4GRWH 4S1SH 5FA3B 5F1NA 4XWOD 3RWCB 3WKPA 5DEFA 4R5XA 1J5OL 4APQA 1BVLB 2YBRB 2DM2A 3FU5A 3GYRA 2V0AA 4XAKE 2J8UE 1O6SB 3LIZL 3ZTEA 4U4BA 1CFNB 3CV5A 1AJ7L 1EXGA 5DJ0B 3ULAB 2Z4TA 5KYNA 1TUPA 3EJCA 5D1XE 4LCIL 4RRPG 4I3RL 2FWLB 4GQRA 5FKPB 5AAWC 4DEWA 1MUJA 1DN0B 3L13A 1OSZB 2HG5B 1DANT 2EIZA 3TVMB 3ARRA 3QCUH 3NEXA 3K0WA 3GSNH 2ENYA 4R2GD 2OA9A 3V5DA 4FAAB 2PTVA 1A2YA 3MJ9L 4PGDA 4PR5B 1MFBH 1NFDF 4HEMA 5SWSD 4DUVA 2MKWA 1WAAA 4I5BA 4P4KB 5IEHB 5C0EB 1MFVA 1MRCH 2XVGA 1JI1A 4JY6A 32C2A 3O3BB 2E7DA 4NRYB 5D9SA 4MMXB 3E6HA 4OIAA 2K3HA 2CMRH 3S35X 1BAWA 1SXBA 1BZDA 1FL3A 2ZOKB 3DJTA 4GAJL 3V7MA 3ULVH 3B9DA 4HIJA 1D7CA 3QUYB 1AY1H 2YUWA 1G7LB 3ABGA 5L7XL 3C5XA 4ZMTA 1JZ6A 3FTVA 3GM0A 3AT0A 5G4OA 2Z4QB 2W65B 2R1XB 3QUZB 5ACMA 4OZFA 1HQRA 4UT7H 4Y8DC 3NEEA 1GC1C 4KY1L 3SE8H 2VN3A 2BNRD 2V2TA 1CICD 2ATKB 1DP0A 2HPTA 3TBVA 1PIFA 3T2OA 1CGYA 2UX7A 3QYNA 3RVXC 1F56A 4P59H 3ZQWA 3AAZA 3CC5A 3FRPG 5D1XB 5G2NA 4N2DA 4RWHA 5G4NA 3H2WA 1G7HA 3QQDA 1JV5B 3R06A 1A7OH 3GRGA 4HWZB 1MWAL 4S2SA 4NAQA 3JWNE 5FUZH 1QO3B 4JQXA 5GGRY 3MBWA 1GSMA 1QSFA 5AKVA 3ZYIA 1KYOK 1URLA 4PWJA 1IJNA 2WBXA 4F2ME 4NC0B 3C8KA 5BRZA 5AYTA 3ET9F 4NQDD 4PJEB 1P5VB 2C9SA 1HCFX 3QXWA 3QQ3A 2E7MA 1U92A 2NX5B 3MN8A 1RUMH 2B1AH 1IEAA 5TE6L 1NC2A 4I4WB 4LCIH 3RGBA 3I02A 2AK1H 4KVCL 3QA3B 2DQUL 3RGHA 1AQKL 5D4HA 4PRPE 4CU8A 1QI4A 4GP5B 4KI1A 3G9VA 3U7WH 1UM4H 3JWDC 3FU9A 5IG7A 5EU6A 2VDQL 3ALWA 1MCJA 4G9DB 4OFKA 1QR1B 2XXGA 4MA7L 4ZJ9A 4CU6A 1FYTA 2IAND 4YHZH 1EJ6A 1WVZA 3LKOA 2BVQA 4XVSH 5D6DC 4PREB 3EOAB 1E5CA 3G5VA 3MLZL 5HPMB 1S8DB 4B0MM 1BBJA 1YMMB 3WFZA 1ACXA 1UD6A 5KSAA 3LS4H 1U93A 2WWOA 3GXIA 3NCXA 2AI0H 4ZFZA 3KBHE 5G5DA 3RDTA 2N1KA 2BIMA 2HVJA 5CGYD 3QFGA 5JHAA 4MX7A 4CSZA 4UTAH 4I18A 1G7MB 1Y6MR 1IC5H 1AI1H 3C5JA 2ZWSA 3IDGA 4QGYA 1E8ZA 2PO6D 4FFYL 1TF4A 2QKIA 1FFQA 2VSMB 2GABA 3SO3B 1QMUA 2XPYA 4BQ8A 3SZ6A 5IJBC 5D7JA 3L4WA 5HI4C 4OI8A 3CPUA 7FABH 1PMYA 1CK0L 3K2KA 2GSIB 1NEZA 4LCCC 4Z7WA 3F5WB 2DL9A 3L3IA 3N85L 4M6NL 2WVUA 3H4HA 1ZHKB 3NJHA 1LHZA 2CUIA 5CD5C 2GTQA 5D1XC 1KMGA 4DKDC 5FGRA 4YDVA 3R4RA 3MJ8B 1WIOA 4WI4A 3ARVA 3J7HA 4KDTC 5GISH 1OP3K 4Z78B 5HYJD 2AEQH 4PEEA 4AYID 1V10A 4ZXBC 2F53E 1T04B 5CM1A 4RBPH 4TSCL 4MNQB 3NJIA 4PJ5B 2VQTA 5FO8A 1VFAB 2AJXH 5HHMD 4ELDA 4JFYB 3BZ4A 4BKTC 4PJFB 5LUMA 1SVBA 3SDCB 5E1QA 5I1LB 3MBXH 4HKBA 2VO5A 4BQ6A 3T6VA 1C1EH 2ICEA 1Q9LB 3MX0B 3VFRB 3MGTB 1HYRC 4BFFA 1JHLH 4HEPG 1ZLVK 2Y1YA 4WFEE 4G3YH 2BVUA 5B39A 1Y6NR 5KEZA 3G3LA 3VFOB 3H56A 1OTUC 4GRLA 2G60L 1H15B 3EF4A 2ZWNA 1T03L 1AXTH 4I18C 4B96A 4CJ0A 4FJ6A 4XCYB 4XBEH 1D5MB 3KWVA 1P84J 4K5MA 4HUNB 2EDRA 3KDPB 2OMYB 3RDJA 4HZ1A 4LKXB 3UBXI 3VRJB 1H9VA 4PGBA 1IQDA 2NLJA 4Q2ZA 4KNUA 1DSFL 2CNZA 3HBPA 5C2UB 5F7DA 1J8SA 2NNAA 3HI1A 4XMWA 4AIEA 4A68A 3TZVD 1QSZA 1E50A 5LBSA 3GXTA 3UJIH 4Q9BA 5D2LB 4LPWA 4NUMA 3HKZA 1N68A 5HYSB 1CL7H 2MPAH 1PZDA 4K23H 3OMZA 2BP8B 4YSTA 1JXGA 3V4PB 2PWDA 3UEZA 4YHKL 1D7DA 1BYPA 3PYCA 5KZCD 2EDKA 1YMME 2HWZL 3FO2B 1IM9B 2XG4B 4UTBA 1C8PA 4N2LA 2Q7YB 1TEFA 3VSUA 1IBBA 1OB0A 3DO4A 1MI5B 2X2JA 1TQUA 3KCPA 1I3GL 3TBYB 5I0XA 1TCRA 1E3FA 5CN3A 1Z9MA 3PWNB 3AADB 1YEFL 3F7YB 5HYQB 2YFNA 3CTTA 1KTLB 1KIPA 4R90L 4DKFL 4PJDA 3RZCA 3NIGF 4TVUA 4U33A 4GMTL 3KYNA 5D2NA 1OAKH 3OZ9H 3UPRB 1KLGB 1M42A 1QSEA 1B4JL 3QHZH 4MB3A 3KJ6H 1ANUA 2KT6A 3VXRA 5C0NC 5H4ZA 1IBGH 3GBNH 4PV1C 4BCZA 4OZHA