4KQ0A

Crystal structure of double-helical cgg-repetitive rna 19mer complexed with rss p19
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
122
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
total genus 38
structure length 122
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kq0A01
4J5VA 4JGNA 1RPUA 4JK0D 4KNQA 4JNXA 4KQ0A 4KTGA 1R9FA 4J39A
chains in the Genus database with same CATH superfamily
2EVJA 4Y5XB 3MDJA 4QTIH 2EKSA 4H8HA 4XVUC 3FT1A 3PDOB 4OZHA 3AAZA 4DFHA 1HCZA 4DKFH 4LF3A 4PCTA 1XHHA 3ZZ1A 1KLUA 5KYWB 5JPMC 4XH2B 4E41B 4XP9H 3ZIMA 2APXA 4GJTB 3S7GA 2GFBA 4A67A 2ZUWA 5DD0L 3FCGA 3R7QA 3S88H 1AQHA 4L8SC 1KLFB 4IRZA 5DZ9A 2EDJA 1I75A 3LPFA 5M7QA 5C92A 1FNGA 1S7RA 3D4YA 1UA7A 3GGWB 5FYJD 4I0KA 5C0CB 5FM5M 1VFUA 3TESA 4JFZH 2I07A 4LNVA 2WQXA 3O3UN 1P5UB 1I8IB 1WD9A 4O58L 3OC5A 1MHHA 2NYKA 3BGFB 2VXTL 3ABGA 4WJ5A 3U9PH 4F7PA 5F44A 3B5HA 4Z95L 1EVUA 3OG6B 4KQ4L 3ARBB 3Q5OA 3SGJA 1A9BA 3AY4C 5E2TH 3O11B 1J5DA 2BHZA 1JHLL 2G0LA 1O9WA 5DS2A 4K2UL 2LFGA 4HEMA 2K1MA 4Q9RL 2XV0A 1B4JH 4N28A 3A3YB 1WF5A 3B1UA 4EVNB 4Y8DC 3HUJA 3LKNB 4OW6A 3EJZD 2ADJA 1F6AB 3GS4A 3HRPA 2Y69B 1SVZA 1D2OA 2C9VA 3H9YA 1BXUA 1JI1A 1P84K 5HJDA 2MSPA 1KXVA 3S3CB 1DZBA 1I9RL 1TNMA 3GUFA 2AQSA 5C9KA 3WAJA 5I6OA 1OSEA 4WSJA 2OLDA 3NCYS 3MRPB 1NL0L 1BVKB 15C8H 1CJYA 1LM8V 4KOCA 3TCLB 5AW5B 5EZIH 2BSSA 5BZWA 3VG9B 2O30A 3PQYD 3TV8A 2GK0A 4Y2DD 4G80B 4Z77B 1GJUA 3DX4A 2V9UA 3JWNE 3U6RA 5AAMC 3VFMB 1XD0A 3FQTA 1LO3H 5D71H 1UHVA 5KANI 1SGKA 3B5TA 3ILQD 1HWWA 3UJTL 1N7ML 4JPSA 5KEZA 2PO6C 2BSED 1P1ZA 4I87A 2DQMA 1KBKA 4G7VH 4UILL 1TPXC 1M1SA 3Q6FB 1P0SE 1UD5A 5D93B 3T6WA 4GYBA 2YD3A 4P0DA 1CGTA 4LQ1A 2Y0SA 3PFUA 5IBTH 1OGSA 1PZ5A 2F19L 5F88B 3F84A 2JF1A 4UQ9A 4O58H 3CC5B 4X6BA 3VQ1C 1HNGA 1CXEA 1KPUB 3B8SA 1JNJA 4KJPD 3RRQA 4FG6D 3FAXA 2BVYA 2XTJB 3VACA 1KYDA 3IXTA 1WA1X 2XETA 4AQAB 3RPIA 4X5RA 1UOWA 2C4FT 4ZFZA 3VWKA 4Q0XL 2J88H 3CLEH 4H5SB 4HOZA 1RLBA 4UUJA 1JGUH 2AK1L 3B3IA 4A39A 2C9AA 1N5YL 1U95A 4QNPE 3KH4A 5C0IA 2EO7A 2UX6A 3IFPA 2ZWLT 4NNXB 5J5EA 5MERA 4JR9L 3BVDB 2OTWB 3UTZB 4PHXA 1J48A 4HV8A 3C60C 4Y5YB 4D0CA 2YBRB 1EZVY 2BP5M 2WTPA 4QOKB 1BOGB 2P5ED 1U2YA 4XP6L 2J12B 3TN0A 2H4EA 1ECZA 1KENH 1OD9A 3DURA 3NCFB 3PJLA 4PJ7F 5DHXB 4ERSL 3OPZL 1HAWA 2DLHA 1AGEA 2CLVA 2BNUA 3CVCA 3GMLA 3NSXA 4ZMWA 2BY2A 1F4XL 3FFCA 4XX1G 4KHTL 4F2ME 1WC7A 3CXHJ 4PJ5D 4TL5A 4QAWA 1KGUA 4KFMA 4P2RA 3ZT6A 3F6LA 4KXCA 4PGEB 3CG8A 2VAJA 3TIEB 3IMUA 1I8IA 5ANME 3DX9B 3IDNA 5GS1A 5FYKL 1EO7A 2QZ5A 4M48L 3EO9L 5JHDD 2VC2L 4M6NL 2XWRA 1Q1JH 2F8VA 2NW3B 4GEJA 1AS8A 3DV6B 4HFUH 3ZHKA 1OSPH 4M56A 2NZ1A 3LEYH 2R0KH 4G9FB 1WZMA 1CLCA 3DNKA 4X5XB 1W16A 2XJLA 4Q14A 4TYUA 1JDCA 3HG1B 3VE0B 2X4RA 3RL1A 5E99H 5FR3A 2I5YL 4MQXD 4EBQL 1Y0LB 5EBMB 2CBQA 2X4SA 1JFQH 4U05A 1YEHH 5LHDA 1T20B 3QUGA 3UBXA 5KYWA 3RAJL 1AACA 5AYUH 3GO1L 3GRWL 2BS9A 1CI3M 5D4HA 4FCHA 3PDGA 1GTFA 4F91B 3FT2A 4UTBH 1V8HA 1A3LL 4OJDH 5GRUH 3RWJB 3UADA 2K6YA 5DUPL 4WHYH 1T21A 4S1RL 2Y5TB 5F8RC 3JT0A 2NTSP 4OCNC 4OCMC 1ETJA 2EO1A 2VH5H 2YMXH 1LEGB 4XP1L 5L0QC 5MHSD 1CD1B 4NN5C 1TTUA 3LKQB 1JUFB 4XAWL 2BMKB 3U7AA 1PCSA 3VYNA 3N43B 2IPTH 2CRYA 1G7JA 3P9WB 1AS7A 3S37X 3ESPA 1C5DB 3L5HA 4H2AA 2DD8H 1DFBL 1UENA 4BFOA 3ESUF 3NZHH 2QKIC 4YOKA 4FA7B 3DVGB 2CRMA 4FDWA 4MNGA 2FATH 1GY2A 5ITFB 2FZ3A 1ND0A 3KYOA 1NAML 1ZDQA 4Q2ZB 1MIEH 3GZQA 3OGCB 2FSEB 5EORL 2IFFL 5HYJB 2FL5B 4H88H 1MIEL 4CMHC 3MV8D 1AKJD 1HH6A 3PP3H 3JV0A 3VGAB 3A67L 3QNYA 5I73C 1DTUA 1XF5A 4BBWA 3KPSB 2OK0L 1KEGH 1XT5A 5D9SB 5I71C 1QABA 2ROXA 3QUHA 3DX1A 1XGUB 5HVGB 3P4OA 4ODSL 1HKFA 4X8GA 1QEWA 2ICEA 5ADOL 2K7PA 3RUGA 4OM0L 1ITBB 4C57C 3QA3B 2NY6C 4F80A 1UGKA 4C56B 2BC4A 2YOCA 4FC3E 2R0KL 1PEZA 2E59A 3IF1A 3PNRB 2HN7A 4U6HA 1UT2A 1DDHB 1I3UA 3GXPA 2YWZA 4MTMA 1TQSA 2LLNA 2NQDA 3DJTA 4QXUL 1NEZB 4PGDB 5CJXC 1NSNH 1WH0A 2KC0A 5FKAA 3ZHFA 5I1DB 2X38A 2ZWYA 1NCUA 3CVBA 3RKDD 5KTEH 3QUZA 2W59A 2QPUA 1DDTA 5AVSB 2H3NA 4QOKE 2R27A 1NBCA 1B0RB 4V1DA 5IW1A 4P2RB 2NZIA 4NHUB 1FG2B 4GIPD 3GMRA 4ZAKD 3KWXA 2A4EA 4LDCA 4W6XB 4N6RB 3OKKB 5CZKA 3DSNA 3SKMA 1A4JB 2VW6A 3EFDL 3L1EA 3ECBB 1FPTH 3CVHB 4ONHA 1J1PH 2I9TA 4IBSA 2R69H 3BWAB 4ES9A 1SY6L 2GTWA 3SJVA 1L5GB 1I1RA 2ZKWA 5D6DC 2X28A 1YMMD 3KWWA 3QUYA 4K71C 4JZJA 1ZLSL 2BVEA 1OE1A 3UYPB 4ELDA 1OCWH 1NC4A 1HU8A 2LAGB 3AS1A 4PP2A 2CLRB 4ZT1A 5GGRB 2DM4A 4EAEA 5L0QB 2J6WA 3BEWB 1YYLH 5TDPA 1OF2A 4KTDH 1D6EA 2DLTA 5EOCH 3G6DH 1DEDA 1VDGA 4W9JC 2ITCB 2A74A 5GZOA 3Q8CA 4M48H 1UB5B 4ZODA 5G2NA 1E5BA 4AIXA 5E9DB 1AMXA 1INEL 3H2QA 3JWDC 3LRGA 2PTUA 4W68A 2DZEA 3FT4B 1COBA 3GEFA 2WK2A 3ZE1F 2OX5A 1VIWA 3WIIH 3GMNA 1FLTX 4JQVA 1NBYB 1GR7A 4WI0B 4EI5B 2OMVB 4P3DB 4Q4EA 2ZX6A 4MQXC 4FRWA 5BV7C 5CBEA 5C07E 4ZI8A 3L08A 1U2HA 3TBSA 2IWFA 1R3HB 2HT3D 1A3RL 4I5BA 2WLLA 4GT7A 4H8UA 4G6AD 1OAKL 1TETH 3EO0A 3MNWA 1JUFA 1RZPA 1EJOH 1A2YA 2B20A 3UJTH 4F7EB 2XFXB 2X6AA 4B53A 1CICA 1O7DC 3BCDA 3DO3A 1XH3B 1UQSA 1F8TL 2DYPB 4P3CL 4UB0H 4UQBA 3O4LA 1MFCL 3FPXA 3QIBD 2VR8A 1TENA 2BHFA 2VABB 3ECBA 5DD5L 4ZUUA 3B37A 1BVZA 3GJFH 2ZONA 4FXGC 2Y3NA 4U2ZA 4N6RA 5LXVA 1T22B 4XBEH 3NYKA 5JIPA 2NY7L 2PPAA 3QO0A 3BWZA 3KE0A 4HWBH 5FFOA 4R96B 4YHPA 1DBAH 1RZGA 3KPQA 3QG7H 3TT1L 4DHLA 2YZ1A 4P04A 2EABA 3S34L 3MMEA 3WXWL 2J5WA 4LSVH 4Y16C 1KYAA 3QIUA 3FB7B 3MLUH 2X6MA 3RFZC 5D4QA 2PPFA 5HDRA 3IFOB 5GXBB 3IMRA 2B59B 2JB5L 3A4FA 4GBXD 2AQRA 2D2CC 4PEEA 2BP3A 3NABH 1HH9A 1MN4A 3D2UB 2MCMA 1IEBA 5BQ7A 1IGCL 1YEJL 2X3CA 5FYJU 1FIGH 4LSTH 3U4EA 3CBRA 2BIHA 4PRBA 3KPRA 3Q9QA 5FYJE 2OX5B 1NFKA 1TXKA 3QO1B 5BCAA 2VXTH 3U9PL 3QEUB 2XXGA 3CDGB 1ZGLB 3DO7A 2DW5A 3FTXA 3D18B 2OI9C 1KOAA 3HR5A 4WW2A 5JMRA 1R3KB 3CVHA 2WQRA 1R4XA 1QLFB 4K71B 1GAFL 1GYAA 5J6GB 4ENEC 2H0JA 2UUDH 5EIIA 1H3PL 1S7WB 4AQZA 4H26A 1QFWL 2FL5A 4EXKA 4YHKL 2E7MA 5DZAA 4WW2C 1QACA 3MSPA 3UYPA 4Z3JA 3FB8B 4NOFA 5EU5A 1G9MC 4HCRL 4JFYB 1JRHL 5JXEC 4LSRH 1I31A 2O5YH 2XWBB 4Q7DA 3ZL4H 1K3IA 3EJRA 1T5KA 4PUBL 2FSDA 1QEWB 4NNPH 3B2UD 2GTWB 3SJVB 2XV2A 1GH7A 2PYEE 3HE7A 3FH5A 2VUKA 4ONHB 4PB0H 3V52L 4G6KH 1NOLA 2WTRB 3NP4A 4EZMA 3GS7A 1CQKA 3PWPE 1FE8L 3CFMA 4NNYA 3BWUF 4HAGA 1BV8A 5DC4B 2MHAA 1KIQB 3LB6C 3IJYB 4NQVA 4XB8A 2G2PA 3IS1X 1UWEL 3P2DA 4WKZA 2DMCA 4BZ2H 1AXSB 3H56A 4OZHB 3UIZA 3Q13A 3L17A 3P77A 4G5AA 2V17H 2PXYD 3TONA 3DYPA 2HB0A 4GMTL 3SCMC 5KYNA 1TVDA 3KGUA 4XPBH 3D2UD 1BLNA 4KNTA 4JFDD 3IDGA 2DI8A 4RA3A 4ZYKA 4JJ5B 4PS3A 1Q9LB 5B39A 2ATKB 3FT3B 3OAZK 4TULL 1UACL 4ZSOE 4WWKB 5DI8B 1NGXB 4K94H 1JPGB 4S2SB 1Q90A 3WNIA 4FLRA 4KJWD 4WCYL 2CKBB 5EOCL 2FX8H 2FJUB 1K5NA 3H85A 4UTBL 5GRUL 2A1WL 3EO0B 2AXWA 4IBVA 5FYJL 1U36A 1F90L 4BH7B 2UXFA 3LCYA 2ZZUT 2R0ZL 3L95B 3AU1B 1IAKA 1KPVB 4ZUWB 2H6PB 4OCLC 2WBJA 1E5CA 2ZUQB 4ODHH 2Y2YA 3LKOB 5GJTH 3CUPA 1RZIB 2O5YL 2AK4D 5F9WB 5HI3D 2CD0A 3FZUD 4KDWA 5IY5B 3IJ7A 3OMZA 4LQFL 1NWOA 5E9DA 2EDLA 2UZIH 5CBAB 4M62H 4L1SA 3MA9L 4FYTA 1JF1A 4HWEH 4XE5B 3RIFF 3DV6A 3TWCH 2Y5QA 5C2BH 2ZXGA 3B43A 3FB8A 4KUCD 1BYPA 3WFBH 4N2OA 4PW3A 4DEPC 3LPGA 5HJBA 1EIBA 3PCYA 4JB9H 2O26U 4NWUH 3UGUA 4HZAA 4J39A 2KUTA 1OTSC 3EBGA 5DD6A 5DJ0B 5KS9F 4ZK8A 1CD8A 1Y0LA 2AJUH 2EJ1A 5B21A 4ZFOB 5DT1L 3V6FB 1RERA 2DY2A 4NQEE 1FLRH 4WW2B 2O6CA 5E8OB 1FV1B 4QGTA 5A2BA 4RGNC 3UZVB 2XIIA 3IBOA 3GMLB 2E7CA 1D9KA 4J2QA 4ZMAT 5J11B 3VDBA 3U4EB 5A3ID 2MOQA 1KDIA 3MAWA 3CH1B 1IU1A 1KYOJ 1PZAA 2APVA 1RJLA 2WIIB 3BSZH 1LYQA 1D5ZB 1RMFH 3N44F 1X7QA 3N0PB 4LASL 4AGPA 4PGZA 1UWEH 4F33A 4GW5B 5HYSG 1J8SA 1XTMA 2IFFH 1YN6A 3TOPA 1HSAB 1J0YA 3HHMA 5KZCD 5HGDB 3AREA 1FNEA 2VM3A 3VO0A 1BIIA 3NN8A 5F6HI 1VACA 2IH3A 5HTSA 3WTWA 2FBJL 2WQSA 2AV7A 1SUHA 3QFGA 1MFEL 1TU2B 5KAQF 1PKQB 2XWXA 3P3RA 3L4VA 3P73A 5IVXF 2KZWA 1IFHL 1XL6A 1IQDB 2WVSA 4Q6IC 4QHMB 5DGRA 5C97A 1QFWM 3VD7A 1FVEA 5JDSA 2ZXEB 5AAWC 2WXQA 2BY3A 2Y3AA 3E3QE 1TMQA 3M6DA 2A77H 3SPHA 1B0IA 1R19A 4Y1AE 1DP0A 4HJGB 4N0CD 4JO5A 3U0TB 4N24A 1CICD 3GSWB 1RJZB 1QI5A 3I84A 2MNJB 2IANA 2EH7H 4JMNA 4TLKA 4HUVA 1B0WA 3FUMA 2JV6A 4YDJB 2Z8SA 2NLJA 4PJXF 1TJHL 3C12A 4HU8A 4OCWH 1JWMA 4AVKA 4DKEL 3PWVB 4GRWE 5HHXH 4Z76B 4IW4C 5EZIL 5IROC 3I02B 1J8RA 4PRIB 1OP5H 3D05A 5LBGA 1AGCA 2APFA 4DH2A 1PCXA 2OR7A 2YPKA 5DQ9B 2DIEA 1X5MA 3SGKC 4YHZL 4FFVD 5D7LE 4MVBD 3L3GB 1I1AB 4PJEB 4ZZFA 4FFYL 1S8DA 2V0AA 2GC4C 1S9XB 2K70A 2LABA 4MS8D 4UNIA 3B56A 3MV8E 3HI6H 5G5DA 1MRCL 3LKQA 1MFAL 4OLVH 1I8UA 3PGFL 5I5JA 4B27A 1L6PA 3ZYOA 2FD6L 4PQXA 1MFAH 2H2SD 2WLIA 3QPQC 5FA4B 3VXUD 3DIFA 4IK6A 5DD6B 1YPZA 2NOYA 5DHVB 4IMKA 3FTGA 2V9QA 5CJBA 4E5XA 4FTDA 4YHZH 3AREB 2DQGL 5C08A 4ZTEA 2X4OB 1QRNA 1G4RA 1UKSA 4JM0A 5F7EH 2DQGH 2H8PB 3P0VH 1KCKA 4NQED 4JGUA 4MCZA 1KT2B 3DGDA 5F7EL 5KSAC 3V4UH 4ZTPH 4HQQH 4Q74A 5KVEL 1TZIA 4N0UE 3QDGD 2H2PC 4RAVB 5GRWA 2GSGA 2JWYA 4U1HA 5K9KA 1EGJA 3JWDL 4BQCA 1WAPA 5KVGH 3LNDA 2AJVL 5HSFA 4JQVC 2JJWA 4M8QB 1XF2B 4XMVA 2HYMA 2EDQA 2VZUA 4WI8A 2VJXA 25C8L 4Z7VF 3IM1A 5I1DA 5IQMA 1DQKA 5FKAB 5KVEE 4PFEA 3S35H 3GHPA 4WFHD 1FNGB 3KBHE 4A68A 4P23A 1CDUA 2XN2A 1RI8A 2PR9A 3LVEA 1JV2B 4AEHH 1SEQL 3C60B 2PF6A 3DUSB 3LKPA 5HJGA 4YX2H 3CLFH 4CC0A 1Y6MR 3UTSE 4G82A 3LZLA 4X6DE 5DUBB 4R90H 3PF2A 3MO1B 3BPOC 2J43A 3BEVA 4BHUA 1JGLH 3BKJL 4G43B 4UIKL 1F86A 4O51A 5E8NB 4Q89A 1XEDA 4OTXH 5D1QE 2XRAL 5E0QA 5E2UH 1JAEA 5D7SH 2K6ZA 1XH1A 3L5IA 1ORQA 3AC0A 1ETA1 3CVHL 2OL3L 2AJYL 4ZXBB 4UU9B 1JPTL 2XYBA 2ZCKH 2FWOB 3QQXA 3GEWB 1VFMA 4YS4A 1XF5B 4OLYL 3AY2A 1MCRA 2PTVA 1ZS2A 3FQUB 4MASA 3MI6A 4PJ9B 1AS6A 4GI6A 1IGYA 3MXWH 4NO2B 5L4FA 3FU7A 4A63A 5KSBB 3QDMB 1S78D 1Z2KA 3NZHL 4PJBE 4CSTA 1CFVH 3W37A 4BCYA 3IT8D 4APQD 2AGJH 2X2UA 3VDCA 1S8DB 1EXGA 1QQDB 4JM4L 1JXJA 3G6JF 1JGEB 2Y06H 1LK3L 3LQZB 4PJHE 1KCBA 2PWHA 3LXUX 4XAWH 1K2DB 1MHCB 3QDJD 3I02A 3H3PL 4ELME 3LHPH 3K0YA 5B7FA 3FS9A 4YO0B 3IAGC 2MKWA 3DGGB 2APWA 2B5IC 1HHIB 3VD3A 4M6ML 2WJ5A 5CD3B 4S0SD 1MFVA 2BW5A 3FCUB 3SN6N 1E42A 5FV2A 4KX7A 2H9GB 1OGPA 2PO6D 2QQNL 5CINH 1IC0A 1RUMH 1QBMH 1XH0A 4MB1A 3SGDI 1T4KB 4HWNA 1YAZA 4IU2A 4WZ9A 3BPNB 2ZXAA 1YHPA 2HH0L 4TNVK 1YUHB 4FQJH 5IG7A 2NTFA 2FLRT 3D51A 2WSPA 1WV7T 1X5YA 3VXUE 2YEQA 4GO6B 4Z7VA 4OKDA 3CDGA 1ZGLA 5KJ4A 1WEJH 3EOTH 4N1EA 3CAFA 1GKEA 1TQBB 2D7TL 1M7UA 1XDTT 3IYLW 2LT9A 4XNDA 4Y2OA 4LVOC 4P9HL 4NQSB 4Y19D 2GK0B 4LVEA 5I75B 2VMEA 4QRUA 4YPJA 1MEXH 1IGJB 3RZCB 3WMSA 1IC4L 3S0PA 4PJ5E 3QR0A 5HGDA 3RVWD 1F97A 2DQCL 2VQ1B 2OZ4A 4G9FA 2DTSA 2FEDD 1AIFA 2NY4C 3SOTA 1OSZA 1S7UA 1VLXA 2N7BA 3NZ8A 1ULVA 4TQEL 4Z3FA 2XWTB 2E75C 2G2RB 1N4XL 3F2LA 3T9WA 5JHDA 3QCVL 2R56H 5IM7B 5EUOE 3PFQA 2ZUXA 4OKVA 4LAQL 4J8QA 1RJYA 2K3HA 2JQMA 1OARL 2TRYA 1VFAA 4KTYA 4LCWA 1PS3A 4CMMB 1DE4B 3U6XS 2VGLM 3H1ZA 3DPBB 1OTUD 4TNVF 5J06A 4TOYH 1CLZH 2VDKL 1FHNA 1SXAA 1XVSA 4IRZL 4KXZH 1NCCH 2CLZA 1TEGA 1KF9B 1MDTA 2QR0B 1AGEB 2CLVB 4GO9A 5JOFA 1EQWA 3CHPA 5DTFB 3DO7B 3AGWA 4Z7UA 4FX5A 4OIBA 4ACPA 1A14L 1YEEL 2X7LA 4UTCA 4R26H 4M61A 5H37H 1PX3A 3ARFC 1E8ZA 1KGXA 4O5LH 3HG1E 5DUML 4JKLA 1X6NA 3LN4B 1RURH 5E2JA 3AABA 2R29H 3QPXH 5C0GA 4AQEA 5JUEH 5BRZB 5HD8D 4Y9CA 3VXPA 1YN7B 1NCWL 2B16A 3I6SA 2YJQA 3FB7A 1LJMA 4FQXC 4JO2H 4NKOA 5IF0B 5B1AB 3N1QC 1D5IL 4JFTA 3QYNA 2QEJA 1ZD6A 2YGOA 4LCCB 2Y72A 3QHZL 4UQCA 2QZQA 2P47B 4MMXC 2V17L 1F6FB 2AQ3A 3NGBC 3QJUB 4P4RB 2ZCHH 4NM4L 4XCCL 3V9CA 4DGYH 5C70A 5LGJA 2I25N 3HE7D 3N9GL 4JG5A 2JJSA 3MRHA 4OZGB 1OP9A 2B8OT 4G7VL 3WDIA 3ULVC 4O02B 5J12B 2MOGA 1N64L 2B9AA 4GKLA 3QUXD 1UA3A 5FOBB 3MRFA 3EFFA 4Z7UE 5GS0L 1S3RA 2PXYA 3MLTB 4NC2B 3R0NA 4CNIB 4IJ3C 1MLBA 3U0PB 2MQ0A 3ARTA 1OLLA 2OFQA 4X8XA 5BVPH 4WWKA 1E4KC 1TQBC 2HFTA 4APQC 3T04D 2VSMB 4OUUA 5L6YH 3QORD 5TDOB 1MJUL 1FG2A 4C4BA 4EN2A 2YQ3A 3E2HB 1YEIL 3O6FC 2WQ8A 1WZ1H 5D55A 3DX7A 4F24A 3H42H 4R0LB 3QUMH 4RGNE 4D9RE 1MCIA 2QVKA 5DVNA 3ZKMD 2IC2A 3HUJE 3VI3F 3ZKNC 1FSKC 4IKNA 4U6VH 3SY0A 4YDVB 1Z32X 5TQ0H 2FHFA 1S7QB 4HGWB 2NZ9D 2XTSA 3GMMB 1NUGA 1WD8A 1FNFA 1M1XB 3FONB 1Y18B 4X7EC 2OQJA 4U1GB 1YY9C 2J1WA 3K6SA 3V5HA 5I0ZA 1F2XK 4IJTA 5CIPA 4AWJC 3VW3L 1ID2A 2VXQA 3IU3A 2L7UA 4DKEH 4OFVA 4JS7A 2DQHH 2F5AL 2LU5A 2ZOKB 3ZYIA 1DLHA 1FN4B 1TZHA 2YUWA 3X3FL 2CR3A 4FFYA 3L3IA 4CKQA 3ZTNL 4OF3A 4BH8A 5TD4A 2Y6SC 4PRBB 4FL4B 4FXGB 1A1NB 1DBBL 2XKUA 3G6JA 2ZPKL 3ZE0F 3FUKA 2OL3A 3O0LA 2HFEB 3CMOH 4PJIA 3AT8A 4Q6IA 1YY8B 2XZQL 3BUPA 3MUUA 5FWQA 4DP0X 2YPVH 5J6GA 1UFGA 2PCPB 3LH2L 4HH9B 5IESH 2OMTB 3O3BA 4YZFF 1V54B 2N1TE 3NFNB 3I74A 5DO2D 4Q2ZA 2CM5A 3QUZB 4K55A 3U4BH 4XP9L 5AWNH 3GLEA 3QIUD 2VXUH 3GXMA 4F7MB 2ZXQA 1JZ8A 3RFZB 2HRLA 1T6VN 5A40E 2K4WA 3BVNA 5ES4B 1NEZA 3RDJA 3H7BA 1KTDA 4AZ8B 4S0HA 1HXKA 2WWNA 2G60H 5DO8A 5K9JL 4LNRB 4P5KA 4WFGE 1EGJL 5L4MA 3EYSL 1O9ZA 1JZDC 1OTUC 3B7SA 1MNUL 1FGVH 2Q86A 2X9ZA 3WL9B 1ZHLB 5GZOD 4CNIA 3TZVC 1A6AA 3N43F 3VWJA 5IB2B 2QLVB 3PP3K 5C6WH 4Y5XA 4MQTB 1WIPA 3GSVB 1YNTA 1PZUB 3HZKA 3WFEH 2CUHA 3CQFA 2Z7ZA 3DVNB 4PJ8D 4FTVB 2CCLA 1A6VH 5E4EC 3WEXB 4XO8A 4KY1H 1S9WA 3ATDA 3ESMA 2HVJA 5BRQA 4X42A 1GYCA 3GI9L 4FLHA 4JY5L 4M5YL 4LLVA 4W9HC 3ILPA 4A6YL 2MQGA 4Z7NB 1SVCP 5E1QA 3WJJA 3PHSA 2WBJC 5T1MA 4JO1L 3DHPA 3QFJB 4JG9A 4DGVH 4P4RA 3I9PA 4GKNA 4PLJC 5C0JA 4JDEA 5JLZA 5T1KA 1O6SB 5KSVA 3BGMA 3MLXL 2WWMD 3FT4A 4GAJH 3CVDA 4P48A 5I74C 5ERWA 2FIRT 1NANH 5LGHH 1UCBH 4R0LC 3DX6A 1D5IH 2YA1A 3W5NA 3PWPA 2O6DA 1LEIB 2F58L 2Z1KA 3HAEH 1J5HA 4Y88A 3HJ0A 1R3HA 1C8QA 5EUKA 5C71A 2EIZA 2V2TA 4HEPA 4F3FB 5DVMA 1LK2B 2E27H 1AO7E 1CGSL 1OTTD 3K2IA 3TEWA 1HXYB 3GJEA 1U93B 3ULSB 3GXNA 3X14B 2CQVA 2FQFA 4XPTH 2X88A 4I1RA 4WI0A 4YMPA 1PSKL 2FEJA 2DYPD 4PJIB 2R1YA 4IEFA 3CZFB 4M3JA 4JFEE 2F1BA 1E4XI 3EO1B 4L2YA 3FFCB 1Q72H 4UQ2A 3UDWA 1JGDA 1ZT7A 5J7CC 3AUVA 1HL8A 1UOVA 5BMFL 3QIBC 4OGYH 4OVVA 1CE6B 3L4XA 3SE3C 3S3DB 1WPCA 43CAB 1KV3A 4ICXA 1M7XA 4Y2LA 3WS6C 2YC1B 3SDCD 3MFGB 2ZNWA 2MPVA 3IJHB 3K3QA 4S0TD 3VVWA 4XVSH 5TPWL 4MD4B 2CO7B 2NW2A 3ZZLA 3SDXB 2TSBA 2BHYA 2FX9L 2I85A 3IDXL 4WK0B 1N8ZA 4O2EB 3LEXA 4I3SH 4KK8C 2YAOA 4J6RH 1Y6KR 3UOAB 3K8LA 2HJFA 3D5OF 5CP3A 5EBLA 4CVWA 1EO5A 2M83A 1RZ8A 3FDWA 1BD2A 4K5LA 3ULUD 4IKLA 1I3RB 4LZKA 5IIEB 2NXZC 3MRDB 4LLWB 4NO0B 5INDA 1H3VA 5AD0B 2F54D 1NGYB 4FJZA 4TNEA 4XMPL 4OUUB 4BUQA 1QSEB 4B0MM 2LE9A 3FH8A 5B4MC 2P7TA 1WJ3A 4N3TA 4BFFA 4PRDB 4XP5H 4NRXB 1NDGB 1D7CA 1PG7W 3QZOA 4OT1L 3TZVB 4XP5L 2BERA 5JW5A 3IDXH 3GTTA 4LGRB 4ETQB 1DQJA 3EHBD 4XO5A 4MJJA 2ZKHH 4DZBB 1XAKA 5E4EB 3LIZL 1YQ2A 4OTXL 2ENPA 1OGAA 3K1DA 5F7WC 2EKJA 3EYVA 1HN1A 4L3FA 4NC0B 4WV1A 3BLBA 2BJMH 2OXHB 1A0QH 3RIFK 1ORSA 4PG9A 4LSPH 4S10A 1MW0A 1HHIA 1QASA 3L3HA 3PIQA 2GJJA 3C75A 1E9PB 2A5UA 2NY5H 4XAKD 1DFBH 4YFDB 2OYLA 4X7SL 3ILDA 2F2HA 1AQKH 2V2XA 1E9QA 3SYQA 1JGVH 5JXED 3VD9A 3GUTA 3FOMB 3QIUC 4W4NA 4LAJH 1HZLA 4LGSB 1I3VA 2VO8A 1KPRA 4HKJA 3OB0K 4BINA 3GSNA 1RUQH 3G9AB 4S1RH 5D70L 4J8RB 4LP5A 4KROC 4K5PA 4OLUL 5G55A 1C5DA 5AZ2L 2IQAB 1DQTA 4YFLI 4P4KD 4S11A 5JNYA 2GAZB 2XXCB 3CSTA 3A4AA 2KH2B 2QVIA 3WY4A 3O8XC 2FAUA 3DXAE 2ESVD 5KSBA 4WNQB 4F58H 5JHLH 1CGSH 1C12A 2X42A 1EMTL 4OLEA 5I1CH 3FCSA 2WSDA 2HUEA 4Q9CA 4OZHE 1JWSB 5DLMH 5HGHA 2F68X 5E08L 3HBPA 4OM1L 1CT8A 3K46A 3TEXA 1UCBL 3FB6A 2VRAA 3IN0A 2F9BT 1WVZA 3WO4B 4Q8BA 2TRHA 1EEUA 3S36H 1CMOA 4U1LB 1VPOH 3SHSA 3QJVB 5DJDA 2VC2H 4GW1B 3MRNA 5JPNA 3IAPA 3V8CA 4LSSL 3M7FB 4UT7H 3SD2A 4FXKA 4NQCB 1BD2E 1W0WB 3NRPA 4PRDA 2X70B 2P9RA 4NPJA 5DK0B 1MVYA 1MFNA 3KGRA 3E8UL 4X5XA 5ID1B 2UZYB 2E0PA 1U91A 1VSCA 2IGFL 4Z9KB 4BGDA 3DMMA 1WSST 2AMUA 2JKJA 3AVEA 4JFVA 4E0RA 3A24A 3NZ8B 3RG1C 1GC1L 2RCSH 3QNZB 2YAPA 3NCXA 3TEUA 3UZEA 5H8DA 1W72H 4GQRA 5GZND 3S4SA 2W91A 1G9EA 4Y7OC 2CGZA 2CJSA 1DLFL 4J3WA 4U49A 1KGCD 3DARA 1OAKH 1TETL 4Y2OB 4JFDB 2KKQA 2FT6A 3QR2A 5DA0B 2VDPH 3ULUE 3DROB 1T3FA 4WTWA 3HUJB 5IHZB 1I1AC 5IOKA 5FK9A 3FFCD 3HS8A 4NQDB 5DVKA 4YEEA 4LVHB 5AUMB 1NWPA 2ED7A 2ZUYA 1MNUH 4IDJL 2EKSB 4RSVA 4C56D 1EBPA 4M6OH 3EHBB 2GCYA 4IKKA 5DFVD 4LESA 1HT6A 2P5EA 1SXSA 4OZGF 4ENZA 5ADPH 1MY5A 3HN5A 5B38G 3STLA 4CVXB 5L2KA 3SDCC 1T4KA 1ZIAA 4P2OB 4PD4K 3ZZQA 4X6CA 1TYJA 3MJ6A 3ZL2A 3MJGX 4RX4D 4YDIH 3S37H 4NUPA 3VTTA 1OOAA 4LSSH 5SX5K 4KWUA 4KH2A 5TFSH 2GIMA 1J9CT 3VD5A 4KJYA 5E5LA 4D3CL 3T3MF 2AEWA 4H1LG 4CL7A 2G30A 4MMZC 2WBXA 5EUKB 4E9YA 2XQBH 2YXWA 3HN3A 2CNYA 4JHWH 4RBPH 1N12A 2OYPA 3ULUC 5DC9B 3FQRA 2ZOWA 1H3XA 1UM6H 3PQYA 2JTYA 5HHXL 5F8QC 1IEAA 2FX7L 1ZXKA 4PJGE 2HLFC 1BXVA 4YDJA 1U3ZA 2YR3A 5CD5C 1UWXK 3SE4C 1JCVA 3NA4A 3PWLB 3H55A 5IVZA 4BIKA 1FC1A 1ORSB 5FGCB 1UXLA 2P45B 2P26A 3Q2CA 4MXVF 4PBWD 4NGHL 1F02I 3BPOB 2UZXB 3F05A 1QO3B 2ZNXA 1MCQA 2A38A 1U3YA 5DK2A 3VWKB 4PLNC 1WAAA 1A6UL 2RAMA 3DBXA 3OKDB 5T1LD 3H9SE 5E4OA 4BFIA 4PWKA 4MD0A 5D7LD 1Z9LA 3PV7A 3WCYA 1EXHA 4OIIL 1MCFA 3TF4A 2XPGA 1UWGL 2WO3B 3V4PL 3WNPA 2ALAA 5LAPA 5BZDA 1BIIB 2FUTA 2WIIA 2CHZA 2HX9A 4CADA 1J05B 2FBOJ 1SQ2N 1NCDH 3IEAA 2VDPB 3ARPA 4Z3IA 1H6FA 2VERN 2X2HA 1AE6H 4GW5A 1IAII 2IQ9L 3QC6X 1U92B 1GGTA 1SDDA 3QEQE 4FOMA 3WE6A 3UZVA 3GZPA 3P11H 2NMSA 4A2GA 1QOKA 3TIDA 2GSGB 3MRJA 5ILTL 2A83B 2VLJD 2VYRE 2EDHA 3F04A 3ML9A 1GJWA 3MOBL 3MRLA 3WDJA 3MNMA 3CSPA 2W07A 4MSWA 4PJ7E 3WKMH 2ENYA 1AR1D 3UC0L 1N59A 5I1IL 4BDVA 1CBJA 4MVBC 5DRZB 4P2RE 3HCVB 4RDBA 1HHKB 3EF7A 1A9BB 3BSHA 1R33A 4KU1A 1QHPA 5IW3A 3OKOA 2DDQL 5AVWB 1XF3A 1R3IH 1B88A 4UZUA 1K8DA 3NZSA 1L4IA 5KVFL 4GXUN 4R4ND 1HDMB 2R0WH 2ZKYA 3VB8A 2WKOF 3PNWB 1AHMA 1T1WB 4JFEB 3IU3B 4HSCX 2BIOA 4AKQA 4L4VD 4R26L 1PAMA 4M8VA 1NMAL 2GK2A 2ZWZA 4XVJL 5KBLA 2FJHB 2XTJC 3O41B 4H0IA 2XSKA 3PRZA 3DHJA 4X80H 3TBCA 5D7JD 2WNGA 3WSQL 4GMTH 1MW1A 2Z8RA 3ERXA 4X80L 5IB1A 5CM1A 2W1NA 4PV1C 1TZOA 4UNVA 3JWNC 1EAQA 1GL4B 1CG9A 3HS9A 4ZUSB 3LZFH 3WHXA 4JVWA 4LE8A 4AIEA 4B6ZA 4LCUA 1HHHB 1L0YA 1IM9B 2A9ML 4OJEH 1NPNA 2ZG2A 2H2PD 2YBGA 1P5UA 4Q58C 1KJVA 4LFHG 1TJMA 1MI5E 3FTZA 1I1AD 4FQ1L 5E1AB 1M56B 1RUPH 4QF1B 2UWEE 2ICWI 1QBLL 2DKUA 3Q2LA 2HJLA 3N85L 1MCWW 4OZFA 4W93A 5F3HB 1JGIA 4B7IA 2I7SA 1TTFA 2NNFA 3W57A 4M00A 3VU1A 3FUFA 3HHRB 4HMCA 4Y5YC 1KJ3L 1ZSHA 4KVCH 3GIZL 1YCSA 2J6EA 3S2CA 5L88L 4IIQB 2QGDA 1I9JL 3KJ4C 4OFKA 3OKNB 2VKXA 3I3BA 1V3LA 2IANE 4HS3B 4ZPVB 1WFIA 1JPGA 4S2SA 4KQ3H 1BW8A 4ORGB 3BHBB 1YQVL 3TC9A 5IB4A 5AZEL 4BZ2L 4L0ZA 4TTDC 4Z8FH 3OKDA 1S7VA 4P46B 2OYKA 2E9IA 4DPBX 5I1HH 4DQAA 2P80D 1JBJA 3OZ9L 1Y7VA 3PXJA 3RVTD 3LIZA 2FECI 4J12A 4R7DB 1I82A 4AGOA 2XYCA 5HJ3A 3H7BB 5F7NC 1NBVH 4D0BB 3MA7A 5FHBH 5FF6A 4WO4D 2G9HB 5EZOL 3MACL 2XZCL 3P40A 2YKLL 4MD4A 3BPLC 4ORZC 3LVTA 1JNLL 1KENL 3NTCL 4XNMB 2BRRH 1P7HL 4N8CH 2Z7YA 3WV0A 4ZMOA 3BD3A 2WTRA 4BSVA 2A6DB 2WXOA 1YRKA 3V4PB 1ADWA 3QXUA 5AB0A 1TCRA 1XWVA 3SYPA 4PCSA 3VTMA 3VXSA 5D2LE 1NM4A 4ZUSA 1JGDB 5FM8A 3TVMC 4CU7A 3CIQA 3HR5B 4NKDB 1O0VA 4CGTA 1SFDA 3GJFB 5I19L 5J0BA 4N90E 4JDVA 2J6EH 4XC3H 4FI6A 5E6IA 3C5ZA 2P52A 1UH3A 2W07B 5GGSA 3GPSA 4YHIA 4AYFB 2ATAA 4E9LA 4JFED 1HIMH 4QHUB 3D30A 1DBBH 1BAGA 2A0LD 1L0PA 1U93A 2L3BA 3GD1C 4Y5VB 2AQ1A 5DD1H 3RX8A 2DQ6A 3ULSA 3K6SB 3MRJB 1FZKB 2EXWD 1HDMA 4P57A 3CMOL 1P1VA 4JCWA 4ODTH 2AJYH 3C5ZC 3OAUH 1N8ZB 1AHKA 1ZT7B 3HG4A 1KC5L 2V7NA 2Z8WC 3IN2A 3EH1A 2CIIB 3DTXB 1GA2A 3H9HA 3QDJE 4MX7B 3BVUA 1JNNL 1TZGL 5DQDH 3ZE2B 3VI3B 2K7QA 4DERA 5L9DL 5KYXB 2EDMA 5ABDE 4Q9QH 2PW1A 1MCJA 5BZDB 4NFCA 3RZCA 2XVBA 3B9EA 2WWKT 3OX8B 1HQ4B 2VRQA 2YUVA 4K4KA 5EU7E 2X53A 1Q94A 5EU4B 1CLOL 1S6NA 4IRSB 2VDQH 5C0BE 5CGYC 3UO1L 1XH2A 2VLKD 4HK3N 1U58B 4I0PA 2VRKA 1U92A 4PJCA 2YSSA 5HGGS 5BS0D 1OSYA 5FV1L 1XF4A 1U3JA 4OCXH 2VZTA 5BVPL 2CGRH 2R59A 5KSAA 3DC0A 6FABL 4F7CB 5L6YL 1RULH 3VB9A 4O4YH 3MCLH 2DLFL 3K91A 5IJBC 1C5BH 2RR3A 4F3FA 2VL5A 3SE8L 4H0GA 4PV8A 1UJ3C 5E8EB 3FN3A 4F7KA 1CGYA 2EDNA 1MSPA 4K23H 1QWHA 4OCYH 2DV6A 5EEUA 4EN3D 3QXDB 1E27B 2D0GA 1TZAA 2K0RA 5CCKL 3MBWB 1CYXA 3R06A 4R6UA 2EP6A 4BWUA 4XO3A 3V0EA 4AL8C 3NIGB 2H3KA 3GIVB 2CKNA 2HX8A 3DMMD 1A47A 3T1FA 1C5BL 4QHPA 4Y1AD 3QI9A 4HA1A 4L4TA 3ZDZF 4GBXB 5AG9A 3K8MA 1GTNA 5ICYB 2ZE0A 5LXGH 3DGCR 4I2XB 4OLWL 4R7DA 1R75A 1U8MA 3H9HB 4CU6A 4JZJB 2WUBL 5IMOA 3RWGA 2ESVE 1T1YB 4ELKB 2BNRB 1MRCH 1CDIA 5IJVB 5JIQA 1RURL 3CZUB 3ZXAC 2EDOA 4BCXA 1KBBA 5IEKA 3ME0B 4HT1H 2BINA 4GB9A 2FT8A 4FFYH 1OF2B 4XCNA 3CFQA 1A4JA 5FW7A 3VXMD 1TEYA 2J20A 1W0VB 3IDYC 1QFUL 5CSZB 3RVTC 3ISWA 5E6IB 5IBLC 2BH0A 5C6PB 4Q9QL 4JZNB 5L2KB 2WWOA 3KCPB 3NJXA 4PJAA 3QUXC 4Q97A 1XGYH 2B2XH 1GGCH 2MCAA 2XVLA 1JYXA 5JZ7C 5EF2A 2B14A 1FFTB 1ROWA 1F5WA 4PJ6A 5EU4A 1FPTL 4XXDB 2PW2B 3QFJD 1IFHH 5K33A 4H4NA 1DQVA 4HH9A 1O7SA 5KUMA 1T83A 5TE7L 2DWEA 4G6MH 2Y36L 2VXVL 1L9MA 3VFGH 4R8WH 4MNHA 3KDPB 4U31A 3BIBX 2J1ZA 3SPIA 1Z3RA 3EGDA 2G3XA 3ZKMC 5HDWA 1H15B 3L5JA 3MA7B 4JKNA 4M3KB 2CO7A 5FF6B 2LFEA 3E6HB 3K1KC 4GI9A 2B3RA 4GFXA 4RGOH 4YDKL 4B9JA 1CFTB 5HJ3B 2OXGB 5D1QA 4LCIH 3T0EC 1OCZB 1E2VA 5T3XD 3V0DA 3ZQWA 4F9LC 1MFDH 2DL9A 3BUIA 1BLIA 3V5HB 4YEFA 3FHQA 2A0LC 1XF1A 4JKPH 4XMUA 1XR9A 4M7JL 1R34A 3Q01A 1T2QH 2HKAA 2EXWC 3FONA 4AGNA 4ELKA 1F11A 4WUUB 4ZMXA 3QIBB 4N8CL 4O02H 3VFUB 1AO7A 4NENB 4WEEA 5I6MA 3HBGA 2DQUL 3HPJB 2GPZA 1VFBB 4WWPA 4M7LH 3VXSB 4XT1C 5ESVB 2X9XA 4KRLB 3ZGIA 1BAFH 3DX7B 4I18B 3GSRB 4YC2B 3V5DB 3DX8A 4IBYA 3OVUB 3QWOA 2WLLB 4JN2A 3BRGC 3O9WB 4X7TA 2OR9L 5D1QD 1QQDA 4JMXA 2CO2A 4JHVA 5E95B 5HDBB 1T2QL 4WO4B 4G8EA 3C5XA 3LRSB 3UL4A 4XI5C 3X3GH 1SDDB 4RFEA 5IGXH 3O3EB 4HIIB 2GI7A 3W82A 1DSFL 2JI3A 4PS8A 3WIFA 3P30L 3VFGL 4BA8A 4EI5D 4IOFD 2XACC 1MXGA 3KGSA 1JWUA 3SDCA 5JTWA 5E8EA 3QI9B 4ONGL 3JTSA 1RFDL 2BS8A 1YEGL 2MJWA 4HULB 1PD0A 3S98A 5C0CD 2MCPL 1FQ9C 1GS7A 1ILSA 3MA9H 1OZTG 4HWEL 2DI9A 1CFVL 4YK4C 1BZ9B 3QQ4A 3L81A 4XPHH 5C0AE 3RY6A 3BEWA 1ML0A 2YPLA 2YO3A 1M2VA 4GLRI 1RUPL 4ODUA 5F1IB 5H94A 1HOEA 1G7IA 4CGUB 1TU2A 1QFUH 1K8DB 4HCFA 4PM1A 3DVNA 3BEVB 2OJ1A 2HG5B 4D2NA 4EI6A 1LO2H 2UZXA 2VXQL 1ZK5A 3AQZA 4EN3C 3VE0A 3F00A 3BP6A 2E9GA 3ZTDC 3RX5A 4FQQA 2XQYA 1GOFA 2YEVB 2C9RA 3IJ8A 4NQDA 1NUNB 3O6ML 2V5MA 4IS6B 3WSQH 1HZKA 5FFLA 1AYRA 3PWPD 3S8WA 2WO2B 1IGJA 4YXHL 4TULH 5KN5A 2VWEC 1TQCB 3JT2A 3PAUA 4YXLL 2FTAA 3DUHA 3RHWK 2IADB 1KTDB 4AZ8A 2ZXCA 3K7UA 2QDWA 4N2LA 3QFJE 4ANXA 3EJPA 3EUUA 2ATPB 3T8VA 3SDXF 3JVFC 3WHXB 3FU0A 2YFNA 4W6YB 3QQ9C 1MAJA 3BZ5A 1RZ8B 1LNUA 2VDRL 1SM3H 3F6JA 5CLZA 2NTFB 4AI7A 2IDTA 1P5UC 4KZ0A 4QWWD 4U6YA 1U8LB 3DPBA 4GI8A 2ADGB 4G9DA 4OQTH 2CBTA 3SPJA 1YNTF 1G7LB 5HYEA 5T3XE 1JPST 2RCSL 2F5AH 5GRVK 5CD3A 4G6KL 3ABMB 1CXLA 2XHNA 2JCCB 1SYSA 4ADGA 1HIML 4Z7UF 4OLZL 3K0WA 4G8FB 3K4AA 1SFHA 2GJ6D 5D5MA 5JIIA 5AUMA 3S5ZA 4MXQC 1ZHBB 4JRXB 3LSOB 4Q9BA 1J9TA 4E9VA 3BH8B 4JO4H 5F97E 3ALXA 3NT0A 4U6VL 3QH3B 2R1YB 4IEFB 1I4FA 1DBMH 4H5SA 1BM7A 1LO3L 5D71L 3T3PF 4YSAA 2HMID 4F2MA 5FYLD 4EIGB 1QBBA 1Q0XL 2D7QA 2YN3A 1T03L 1AXTH 1OQXA 3PGFH 4CN1A 3QNXB 4Z7WB 1MQ8A 1ND0B 3KYOB 4POZC 2AK4E 3OWRA 2NR6C 4X6DB 5DMGD 3ZDXB 1FCCA 4XAKE 1E4HA 5HHVH 4FA8A 3MV9B 1AKJB 1MHCA 3X3FH 2FK9A 1B2YA 3DRTB 5MP6L 3HG1D 3T8XB 3K6NA 4HJ1A 5H94B 4H2CA 4KUZL 2J44A 2W5PA 4U1NA 3L5XL 2NR6A 4JY5H 3FSOA 3U2SA 3VFRA 1N7MH 2WZ5A 1WS7A 4PHZA 3TO4D 1ECYA 2FLBT 3FCTB 1CD1A 4H7VA 4P2QE 4EZKA 1BA9A 2GBUA 3TU6A 5FOBA 3DXAD 2JSFA 3P4NB 4ZW8A 1LVEA 2FX7H 2VZ3A 5IBTL 1JWUB 3SDCB 2XIDA 2FQDA 3GXTA 4FTVD 3S97C 4XXCC 2NY5L 3OB0H 1ZJAA 2WXLA 4F27A 4BM7A 2ZF9A 4ODTL 1OWWA 4RGNB 4O2CB 2FBJH 2ICWB 1P2CB 4G2AA 3UH8A 4LLDA 1KUMA 1WZLA 3WXWH 3OSKA 1M6OB 3BE1L 1KWGA 2WLJA 4M43H 4UB0L 3O4OB 3D39B 2W65A 2I69A 5HGBB 1FYHB 5BO1L 4XOBA 2NXYD 4QLWA 1G7MA 1NICA 4XC3L 5DJAB 5C0DA 3HG1A 4K9EC 3VI3A 1MVFA 3LEVL 3QXVA 1DVFD 4K0OA 1ZANH 3EYUH 2BSDA 2EIBA 1SOKA 3QDAA 4MHHG 5E5MB 4UV4L 2ZYSA 3SE4A 3LZOA 4KHXH 4NERA 2RD0A 2Q7AA 2YA2A 3O8XD 4LHUG 2BCMA 2AVFA 1OK8A 4WO4A 3RA7H 1JI2A 3H0TB 4KQ0A 3BP5B 3WD5L 1KC5H 1BBDH 3VRIA 1LHZA 3LSOA 3FTVA 3NPSC 3WNNA 4YAQB 4TOYL 1L6ZA 4QRAA 4Z7UB 1QSFE 3NEEA 1B3JA 2E47A 4GW1A 5DEZA 3KLAB 3D7PA 2OL3B 4ZUVB 5DU7A 3FTWA 4M7KL 4AENA 2WYHA 1SM3L 5CCJA 3N06B 4GOSA 2UY7B 5HGHB 4PJ5B 4ZW5A 5DVLA 3LPPA 3EOAB 4I77H 1XTLA 3KD4A 3VTAA 4U6XB 4C56E 2UXTA 3PWVA 4XE0A 1L7IL 1Z3GL 5IFHL 1J5IA 2CJUL 3CUPB 1QUPA 1MWOA 3DDFA 2P5WE 4FQCH 1DHKA 1KB3A 3GMPA 1QPXA 3VXSE 1U42A 1WFMA 2IDFA 5LJYH 2CPCA 1YEIH 4WIQA 1T66D 1I1AA 1DBJL 3QEQA 4Y4HA 4J8RA 1U91B 5DJ6B 2ED6A 1A7QL 1I7RA 4A7TA 1MHEA 3W5MA 1TFPA 2HVKA 2PMZA 1K3ZA 4L4TB 4NJAH 4R0LA 4MDJA 1CTOA 1YYCA 1CYGA 4N8UA 2VLME 4WQOA 1B4RA 5IK3B 3TV3H 2VIRB 4Z3HA 1P84J 2ZXBA 5GQBA 2JKSA 3RBSA 4OD1H 4NQDD 1NJ9A 2Q10A 5C07A 2AMGA 2GIXA 2CDGB 3MU3A 3TO2A 5HYJE 3S96A 5K39A 2FECL 4HIJB 3I6KA 4L23A 5JORA 5EO9A 4Z8FL 3M45A 5ETUA 1Z1WA 4L29A 1YLBB 2V9RA 2X89A 5CSZA 4DUVA 1OAXL 3WBDA 3R4DA 2J8UF 4PJHA 4G5ZH 4G1EA 1SZNA 3GIVA 3OLIA 3IJ9A 1KGCE 5IVXA 5CHNA 3LTVA 5EWIL 3EOTL 5KSAB 4TLUA 3KL5A 2Y7NA 3BN3B 2K8QA 3MBED 4AX3A 4YSTA 2GVYA 1TUPA 2VZSA 4FQLH 2Z64C 1XF4B 4I2XA 1K4CB 3UTPE 5F70A 3A5VA 2B4CH 4F7MA 5GGTA 4TUJA 3BGMB 5DJ2A 2CM6A 3MRMA 4JPVL 3QXAB 4JCMA 1P6AB 1PG7X 3L9EA 5CO1A 3HFFA 2VXSH 3ZE1B 5I15H 4XODA 5CEYB 3PQYB 3CK0H 1NLBH 2IBZY 3BKYH 3BGFC 2A9NL 3FQ2A 3TT3L 1F6AA 2OK0H 3UGXA 3BWSA 5TQ2L 3SDYH 4HLJA 1JGLL 4CBPA 1QBML 5C0NC 1AC6A 1J8HA 3WY2A 1M05B 4JE0A 4X4YA 4R4BB 1P5VB 1XCXA 4FE9A 5F7LB 1YNTB 1A7OL 1AO7D 2WKOA 3SQOL 2CRIA 4LK4A 1I9IH 4MBOA 2JIXB 4AMKH 5H2BA 3RWCA 1GGIH 2PYFB 2FJFB 3Q6GL 3DV4B 2P5WB 5BQ7B 4NGHH 5KS9A 2XV3A 3HI1A 2VZ1A 1KCSH 2WQUA 4NQSA 1CK0H 1QR4A 3EYFB 4Q52A 5GGSB 4GS7B 3SPGA 4JK0D 3O6LH 1IVTA 5JW3L 2ARJQ 3DHUA 3N1MC 1S9VB 4WY7L 1XF2A 1KG0B 3T2OA 4K5NA 1JE6A 3NABL 4CJ1A 3ZHLA 1KZQA 1DEEA 4KVPA 1FIGL 2XLLA 4YBLC 3DI2B 3OMNB 3S48A 1U8PB 1VKXB 4QRTA 4MDIB 5MP6H 1RIVL 2I5YH 2PW2A 2DJUA 1T04B 1G0YR 5CEZL 2VISB 3IDMA 4WUKH 1WE5A 5F7DA 1Z9SB 3SZ6A 1OEZW 4EUPB 3JTTB 4XRCA 4WENB 4LRIA 1SJHB 5G4MA 4PBXA 4WI9A 3HE6B 2G0KA 2CKBH 1TPXB 5D1ZB 1DR9A 1MKFA 1G9NL 2J4WH 5DK2B 2LW3A 4MRCA 2GJRA 2N4IA 4XVUD 1KCVL 1CICC 1G5AA 2E74C 1E9OB 5C09B 4KMLB 1RZIA 2GC7C 5DMIH 3U4AA 5J57B 1Q9WA 1DQDL 1HX0A 5IB4B 3D39E 4N8VG 5I76B 2VLJE 3LOWA 1KIQA 3FT3A 3L95A 4Y19E 1HL9A 1XD1A 3IJSB 3MRIB 1LEIA 3ZMEA 5ADPL 3C9NB 2LOEA 2XTJE 2H26A 3DX6B 2QQQA 3CDCA 3QNFA 4W9FC 4NQQA 3DJZA 1W91A 4MA3B 3RVVD 4HKXB 3POHA 3WTVA 3QI9D 5L2JA 3P3SA 4L5FE 4L3EA 2F61A 1XGTA 1C12B 2OCJA 4X5QA 4N0UB 2EAEA 1A7NL 4NQEA 4NCC1 1XCTB 2P44B 1ZSDB 3PJNA 1H8OA 1RPQA 1NGXA 4FQXA 3GRWA 1DQDH 1IEHA 1S46A 3Q2NA 4QT5B 3QWOB 5C7ZA 2ATKA 3ROOB 1IAIM 4DZBA 1K4DA 1PG7L 4L4VE 2W0LA 5BQDA 4EN3A 2F74B 1KY6A 3HZVA 4TF4A 4BFKA 2F1AA 1DVSA 2Q6WA 1WBYB 1MFEH 3TZVA 1OZUA 1ET7A 1JHTB 5MEQA 1LP9F 2A4CA 4A7QA 1I9EA 2FWOA 1KXTB 4K3HA 4OZFB 4ECNA 1VPOL 2QSQA 1FFOA 3OLGA 5EU5B 1I3GL 2Q3XA 4EDXB 4Q6KA 3Q9PA 3KPNA 2APSA 4LMQI 4OT1H 4N90D 4LCUB 3SE9H 4MZ2A 4V1DD 4Q0XH 3FQWB 1EO8L 1QPKA 5EBMA 5LUMA 3DTUB 1J1PL 4XMPH 4KH9A 1RIHL 2C7FA 3X1GA 3NIFF 1ZE3H 3P2BA 5BUAA 1SJXA 4EZJA 5FXCH 1MF2H 5FLVA 1GIGL 3X13A 3NCJH 3SKNB 4YUEL 5EN2B 3AB0C 5D1ZI 3F12B 2IAND 2PW1B 3DMMB 4AQEB 4ZNEA 1Y6NR 5E1HB 4IBTA 3LPWA 4RRPM 4DUWA 8FABB 5DSCB 1YC8A 2DLGA 2VMCA 1THAA 4UM9A 5JMOC 1TO4A 3NGBB 4RAVA 4FXKB 4NQCA 2IGFH 3VGHA 4XXWC 5JXEA 1BDYA 4G7YH 3BQUC 2PXYB 4XN7A 4MXVE 1JL8A 5DWPA 5FM5O 2HP4A 3U4KA 2ZCZA 5E9DE 4OZIA 1IEBB 2VLKE 1K6QL 1FJ1B 3V7AG 5J1AA 1A9EA 3S9DB 4WUKL 4JDVB 4FKHA 1OP3H 4FFTA 4XCYB 1IZKA 2ZF8A 3QQNA 4F15C 1MRDL 5KSUB 4GH7B 1MCPH 3RWIA 3ZKSD 1E4XH 2CR6A 1KGJA 2NY0C 3KW7A 1CF8L 3HNSH 4K15A 3FUJA 2DWXA 1UM4L 3BAKA 2XKNB 1XEUA 1AIFB 2Y24A 4JKPL 3T3ME 4N2CA 4X6EB 3SDYL 2QKIB 1PQZA 2A4ZA 1J0HA 1KEGL 1EHAA 4H8VA 2IOOA 2V5RA 2W65B 4LIQE 2R2CA 4XPAH 4GMSH 4Y1TA 2YPKB 4AXWB 4KI5C 5TDOA 3W11C 4MQSB 2NY1D 5IT2H 1G94A 4BFBD 1UFUA 4ZFZB 5C0AB 1CD9B 4DP4X 1YQVH 1SMDA 1CTMA 3QDMA 5JDSB 3US9A 4AQAA 4Y16A 2FVNA 5SWQB 2KQMA 5DJ8A 3CC5A 3HZKB 4PJ8B 1I8LA 5AQ0A 3SKJL 4I9WD 2AGJL 4LOUD 4J3TA 2VAAB 3DBSA 4WJG3 3BKML 2R15A 4I5BB 1Z66A 2CO1A 3MODH 1N8OE 3SKMB 5IEHB 1HKLH 12E8H 5ESAB 2GITB 5IQLA 1E40A 3RTQB 3VNZA 1M3IA 3EDFA 1AOHA 3VFRB 1I85A 4V1DB 3IDGB 4GRMB 4FQ1H 3FQRB 4PG2C 4B9ZA 2ZD0A 3HC2A 3U7YL 3DUSA 3DRTA 2WB1A 5LNGA 1NPUA 4P5MB 5I8OL 4R7LA 4AUJA 3KYAA 3LNIA 3ARDD 3S3PA 4DETA 1Q94B 5CN3A 3RWHB 2B3IA 4FQLL 4LO9A 1I7ZA 4BZ2A 3GLZA 5DRNB 3GMPB 5CJQH 4JRYE 5H35A 1H6UA 3BUYA 4Q56A 3DMMC 4WFGD 2GG1A 1QP1A 2AS5M 3D9AH 2K9FB 2CGYA 3D3VB 3C87A 1FLRL 3LQAL 2DQFB 4JM2B 1M7IA 1NTDA 1BJ8A 3QRLA 3ESVF 3NJNA 4YVNA 4B50A 4HIEA 5CUSH 5EDXA 1XXFC 1EPFA 4DEPB 1A1OA 2X4NB 5DHDA 1MZZA 2OMTA 3O3BB 4IBZA 5BZXA 1O7VA 1P6FA 5CZXC 2HTLD 1MJ7H 4L1LA 1YEKL 2VDOH 1ZS8B 4OGYL 5JO5B 1M57B 3VRIB 1TOXA 1B4LA 1G6RH 1XF3B 3C2AH 4ZX3A 1HE7A 2WPGA 3RNQB 2EINB 1TYRA 1X5ZA 5KOVC 3RB5A 4HUMB 1YNKH 3D4GA 2EYTB 1MG3C 3JYCA 3QEUA 4ZS6C 1UZ8A 3KLAA 2KMWA 4WTXA 4CN6A 3KZ8A 2NNAA 4U3XA 2BIQA 3OM3B 3IMSA 5JZ7D 1JZGA 4DW2L 4RMVA 2X6UA 3D0VB 3NFPB 2RB8A 1NIBA 1W72B 3O2WH 3QCTL 4ZO9A 1KN4H 2C3VB 5AVXB 3KPPB 4Z76A 1KCUL 1H3PH 2OULB 1VGEH 1YPZF 1M1XA 3D39A 3MFFB 3TBWA 5FLUA 3DX2A 4FI7A 5DQJB 1A22B 3QG7L 3RPIB 1RULL 3NCCB 5BV7H 1GYUA 3S2AA 2EIKB 3QIWD 3QPKA 4GO8A 4ZDHB 2HT3C 5D2LA 4LLVB 2IMNA 4L1BA 2DMHA 3S35X 1SHMA 4NP4H 2VLMD 5I1JH 1QLEB 1TVHA 2N1KA 3AU0A 3RWEA 4UU9A 3MV7D 4ZXBA 1C08A 4N2EA 2W0KA 4J4PA 5FPIA 4GQQA 2AABH 4Z5RB 2PP9A 3I3DA 5EB9A 2QVFB 1AGDB 1X4XA 3H6JA 4I0CC 4N3UA 1ZLEA 2NY6D 3DVFA 5B1JC 1I1FA 2WM0A 2R4RH 4XP4H 4HCRA 3KR3H 4JQXA 3SYOA 1FAIL 1SRDA 2IPKA 1BBJB 3FW6A 1BJ1H 5E2VL 1YNLL 4AYID 1A1MA 4JJ5A 4ZBJA 3IB4A 4RBPK 5L8LB 4BFEA 1DUZA 2R1WB 3RY4A 4GXVH 3K4DA 4TSCH 5F7YC 4AJWA 3SE9L 3LQZA 5E8PA 3M8OH 3WHE1 2JFCA 3I2CH 3FB5A 4QYAA 1O6TA 1H3UA 4WNQA 4JO2L 1RZ7L 4PGEA 3UFIA 1BXXA 1FC2D 2LTQB 4JN2B 1OVZA 2D7MA 5FX3A 2VJ0A 3AADB 3BVXA 4PUBH 2AC0A 3F62A 3DA0A 1RXLA 1N18A 1G9NC 1TR7A 5I17B 2BOBB 4K3DL 2ARWA 4Z7WE 2BXYA 2X09A 3AQXA 1JHKL 3P2TA 3T0VA 1Q9OA 3EUDA 4M93B 4H13C 1AZZC 4XOEA 1V10A 3ZZSA 3QIBA 1FV1A 1MFCH 4A7GA 1TFHA 2NY5C 3OBAA 3SQBA 5IWLA 3KVPA 3DECA 5T5NG 4OZIE 3L3HB 3LMJL 1A7NH 2Q9OA 3CHXA 3QH3A 3O2WL 3BOVA 3QCTH 4WJKB 4JG1L 1N64H 2VN6A 2YARA 1G7LA 5AAPA 4BELD 2IH3B 3DIVA 3VH8G 1AI1L 3AREC 2BPBA 2P43B 3N41F 4KX9A 2JCCE 2DIJA 4YXKL 3WKPA 1IGCH 1YEJH 3PDDA 4OJAA 5TE6H 1N68A 3KXFE 1M42A 4N85A 2V4LA 4R5XA 4ZW6A 1UD3A 3P9MB 3SDXA 5DR5H 2VR7A 2ZCHL 4KAQL 1T80A 1EHNA 3Q8AA 4NM4H 2VDOL 2PCFA 3WGVB 1H9DA 4JFFE 4WFED 4HXAH 1VGKB 3A6CH 1BQHG 3NCMA 5IJDC 1I9JH 3WIIL 1S4IA 2AEQL 1N6QH 4OFDA 2CPUA 3VFPA 4NRYA 1I3RA 5C0AD 2HJKA 4KK9C 4NUJA 3V95A 3O8XB 3WDHA 4UDTB 1NAMB 1VZIA 3HAEA 3RL2B 4UV7H 5GSRB 3ARDA 3ZN6A 1A4AA 3BDYL 4WKXA 3FRPG 1LQBC 1MDAA 5CEXA 1S5IH 4HJGA 4OM1H 3SCMD 3DRQB 1NM9A 2B1OA 1ZAGA 3GXUB 3H3KA 4ODHL 4EI6B 1R24B 4Z7QF 5CLXA 3T8MA 2EEAA 4B9KC 5LBSH 4ZMYA 4L8BB 4GRMA 3MRNB 1FP5A 4L0YA 1P4BL 2ZYRA 5CKGA 5CCHE 5F71A 4HWUA 4PU2A 2DM3A 3WMQA 3H4HA 3RI5F 3NK3A 3O3DB 4AKOA 1Q9OB 3C6LD 3CFCH 2VDQB 4HJJH 4ONGH 5D9SA 2HG5A 2P5EE 3BESR 1NKRA 3F7LA 3CX5K 2R29A 2YMOA 4TRPL 4MQ7B 4Y4KA 1OPGL 1HS6A 2C4FU 2A9AA 5CJOH 5BJTA 4IRZH 3LD8B 3N40F 3EG9B 3QDMD 1TJGL 4LSQL 4UAHA 3MNDA 2FJGA 4NZRH 4NEHB 5D1XC 4A04A 4OM0H 3QDGE 3MBWA 4UANA 5TDPB 2YD5A 2DTMH 3ZT5A 2R0WL 2LTQC 1LDPL 2AHIA 5E8PB 4NQXB 2IANB 1P7QA 3G6AB 3CQQA 1IJ9A 2BP0A 3NAAL 2VERA 3FFCE 5BZWB 5EC1B 1GJIA 1BBJA 3SBWC 1A9VA 1A64A 1ODUA 2A9NH 1SN5A 2A7BA 3QHFL 1MFBH 4AYSA 3MRGA 2Y7SA 1Q38A 3TJEL 3FO0L 1BQSA 3ISYA 2CLZB 2YRPA 3TJEH 5D7SL 4KKCD 4B9GA 3GSOA 2H41A 2VSCA 5D1ZD 1SJEB 3WEOA 1NKGA 2Y5EA 3F7YB 5GGVH 2ED9A 1ZRUA 1YY8A 2VNCA 3CFEB 5DHMC 2IAMC 3BVNB 1KIUA 1R3KA 4RLDA 3CCHB 3V4PH 4D7PA 4M4PA 2IWKA 4JREB 4PR5B 3KWWB 5DC2A 1ES0B 3F7RA 2L04A 4NSKA 1BF2A 2XWZA 1NLDH 1HQ4A 2Q86B 4X9YA 3QCVH 3FHEA 4V1DE 4AUYA 5A3IC 1W8EA 2XWCA 4JLRB 2IXQB 4JUSA 2CUAA 1P7QD 1WA2X 3BIKA 4YDNA 3QW9A 3H7LA 5INCB 2ODIA 4FZ8H 1QW8A 3MRQA 4L5FL 2NY4B 4MCYB 3HE7B 3CFIC 1E4KA 1J5OH 1EHKB 3W1ZA 3DX9A 3IDNB 1HJBC 3STZB 4AG4H 1BQHB 3MRRB 2ETWA 2QLYA 3GRWH 3O45B 5K9KB 1AY1H 1CF8H 3HNSL 1E6OL 1GZQA 4EF3A 3I50H 3HZMB 5TE7H 4NBXB 4EE2A 4KV5F 5L7XL 3GXFA 5IB5A 5A7EA 3CZSA 1BREA 2V5YA 2VMFA 3GMOB 2J7LA 4KJWC 4XMKH 1XCTA 4YPGB 4Z78B 3BDYH 2P24B 5AEAA 5JDJA 1JF6A 2R83A 5F1OB 1YEHL 1P9MC 1V7NL 1XH3A 3HPLB 2CG9X 1OT2A 1LWHA 1NMBH 4X98A 5FFGA 3UXFA 5IFHH 4AIOA 4N6QA 1LTXA 4KKAC 3G6AA 4JANB 2AJZA 4LKXB 4BRJA 5GGQL 4WF7A 4HP5A 5I1KL 3TBSB 4U4IA 4UIKH 3LD8C 4JAMA 5CN2A 4QY8A 4L8CB 5E9NA 2YSTA 4I2XE 3TURA 1Y07A 5JXAL 2LVCA 3VD0A 5FYLL 5IMOB 1KFAL 3SY0B 1YSOA 4PRHB 3MBEB 5FGCE 3JWDH 5KWYC 5ITFA 3MMEB 1KPRB 4GT0A 4HEME 4P2RD 3DVIA 3KPMB 2PKDA 4RRPA 4RSYA 3T1FB 3IRPX 5LAXA 4PGCA 4S1DC 4Z3GA 5DWUH 2AQTA 4K3EH 1T22A 2PP7A 1PZBA 4DOHE 4LDOB 4OUOA 1N0LA 2EDXA 1MPAL 2L7EA 3WIAA 4DKAA 3OHXC 3F5WB 4JFQA 1T20A 4L2LA 3UBXB 2BMKA 2J8UA 5KBMA 1L0QA 2ADYA 4WGWB 1A02N 3WUWB 1JVKA 1LWJA 3SDAA 3FRUB 1V27A 1FL3A 4L3AA 4M7LT 3OR6A 4PJ8A 5DUBA 4M02A 5KAQG 5K9JH 1WHPA 1CDGA 2ZX7A 2HFFA 3CN1A 5DVOA 1RK0A 1ZIBA 4BSJA 2VL5B 1T21B 5CP7B 3HI6L 1XZ0B 2OW6A 4AV0A 2JELL 3ZHDA 2J3SA 3I9GL 5EEXA 2OTUB 3BD5A 2IG2H 4ZMLA 2X9WA 4KRPC 5E1AA 1HQRA 2AKRB 2YPVL 5TH2B 1C7SA 4B95C 1SUJA 5CP3H 1VFAB 5ENWA 2VN5A 4HFUL 5I2IB 5DQDL 4KNQA 3ALPA 1D9KB 4NQDE 5F7BA 3K5SA 3X2QB 5HYJD 1RY7B 3GBEA 2Z8VC 4PBVC 4KVNL 1KJMA 5JHLL 2M2DA 1KG0A 4MLIA 3RIAF 3LZQA 1PYWA 3Q5TA 3VFSA 4LHUB 3RQ3A 1XCWA 1MCSA 1NC2B 2W60B 1AY1L 1RJLB 2Y1VA 5LB1A 3TM6A 1H8LA 1RSYA 43CAA 4KKQA 5EU6D 3IF1B 3EXJA 2D8KA 4KITB 1BP3B 2ED8A 5C0ND 1ZLVK 3UAJC 3NP3A 4HZLA 4L5FH 2VSKB 1RL1A 4HLZH 4R4FH 2M8XA 5E7BA 4JKKA 1M05A 3FCBA 3NIFB 5EZPA 2QFPA 2A77L 1INQA 2AJXL 2XC8A 6TAAA 1X6LA 2JI2A 4NT6B 2FYYB 3GXDA 3ULAB 4YSUA 5F0MB 3HMWL 3S88L 3CFBA 1ZSDA 5IVXB 2ZX5A 3A6OA 3QUZC 1MY7A 3F01A 4Y4FD 4DFIA 3VD1A 5CP7A 4PGCB 2YWYA 5E6ZA 2BX5A 2VN4A 2GYSA 2HFFB 3L2MA 2VZVA 4MA3A 3D39D 3BDBA 4PGDA 5I6PA 2GFBB 1U3NA 1RJZA 3JWNH 1ET5A 2CJTA 4E42A 2XOTA 3MBEA 4L4JA 2YD9A 5FYLE 5I2IA 4I1PA 3RP1A 3QORA 2OP4L 5DI8A 3I9AA 4AMXA 2H47C 4I88A 4WWKD 1FFOB 5DZOA 3N9GH 4LASH 2FX9H 2AJZB 4L9LC 4C4KT 1PBYA 1XZ0A 3OQ3B 2UXVA 3ZE2F 3T4AC 3MV7A 5IBUG 4PYGA 2Y1YA 3B2MA 5MEQB 4OIFA 3QUXA 3STZA 7PCYA 1WLHA 2XX1A 2FO8A 1SDAB 4FG6C 4MA1C 1L5GA 3WUWA 4LU5H 5H4YA 3GF8A 2E6PA 3R8BB 1I1YA 2MQ3A 3U9WA 3F5WA 4PREB 1NH6A 4PRAB 4N0FA 1JD7A 5IB5B 1NUFA 4HKBA 4Z7NF 3DK2A 4HUNB 3TH2T 5I5MA 1SJVA 1IGYB 2VR9A 4HHGA 4NO2A 3QJOA 4QKXB 4U6TA 4XWOC 2R29L 1N2RA 3ZDYB 1HC1A 1PSKH 1S2EA 2EDFA 3MRRA 5F9OH 4A55A 1B6DA 4W9ZA 5AVYB 3MTRA 2Y1AA 3IS0X 3RVWC 5F7UA 4NUGH 2VDRB 2W9LA 4F8TA 3CFBB 3T2PA 4DKFL 2F1EA 3U0WL 4FNPA 3MRPA 4J3OH 5F3BB 4AEIL 1ANUA 1IARB 3IJYA 4JAMB 2VSDA 4EBQH 5K93A 5HYIA 4N26A 4U1MA 2OV0A 5LGHL 2VLRA 5BPPA 2HFEA 2G4EA 4YSCA 4ZTOL 1IB5A 4QHNB 4PYHA 3SKJH 3D0LB 5J13C 4Y0GA 5I1GL 3RDTD 3NIDF 3C60A 3MN8A 2KZKA 2ITDB 1WBZB 1N3NA 3HE6A 2A73A 2D7OA 2XTJD 3VX1A 5IGXL 2R8SH 2L7QA 3WKNA 3UBFA 1W6LA 1G43A 1H5BC 2YGNA 3MLVL 5CMAB 1P6WA 5D8JH 2IOIA 3TFBA 4G43A 1J86A 2Y4SA 4FG2A 5T33H 5C0DB 1J8KA 5IHLB 2DQDL 4UOQA 4LCWD 3T71A 4F93B 1QSFD 3KNBB 1A7PH 3VFSB 4I77L 1S78C 2X4RB 3RL1B 1MEXL 2QSTA 1NFDF 1KTKE 5DRWB 4N1CA 5G5DB 5DD3H 4O2CA 3DKHA 4ZFGL 5L4JA 2I24N 3OJDA 1UWXH 4J3OD 1XX9C 4J7RA 1LEKB 3QIWB 1IKNA 3WLWC 2HH0H 3U1PA 2PYEB 1EGJH 5B8CA 2E9BA 4LCCC 5EBWB 3WOVA 4KRNA 4GSRA 4TUOA 3PY9A 4D9LH 4LKCA 1G7QB 4OBSA 3TEYA 4W9CC 1THCA 4ABUA 1Z3GH 4UMGA 3NIDE 2FR4A 4Z3EA 2ZOLA 4AYEC 2WN3A 2GITA 3ET9F 4JQXC 3VXME 4MCZB 1ADQH 3U4BL 3MRKB 3DX0A 3GM8A 4MD0B 5CZVL 3BQUD 1KNOA 3UYOD 1R3IL 4DWHA 3C2SA 4UQIM 4F8PA 4JRXD 3GSWA 3E1ZA 5J12C 4DEWA 4DGIH 4J4PC 1AANA 4MJ2A 5DD5H 5C3TA 2OW7A 5GSRA 4MAYA 3GHBH 2BO0A 4K3JL 4MA1B 4A2MA 3QUXB 2ZYIA 1FUNA 4M9PA 1UA6H 3H9SB 3HN8A 1UEYA 1IO4C 3QRBA 2HRPH 5FO9A 3ABKB 4NRYB 4I9WE 3EG9A 1BX2A 4ZSOB 5CCGE 1NCBL 4XN1A 4F1SA 3ETBF 3GHEL 1IC5H 2NY0D 3VXOA 4IHOA 1ONQA 2YPVA 5J3HD 1I4FB 4X6CE 3KWTA 5I18L 3EGSB 2RACA 3L3GA 3L3KA 4H8WH 4U7SA 3VW3H 1YYML 3KR3L 4BK4A 3QDME 5EEZA 1FSKB 1CE1L 1JZIA 5KVDE 2NY1C 2V2XB 4BUGA 1FVCB 2HJKB 3VNYA 3A0OA 2AK4B 3ZYZA 2DM7A 4FHJA 4U1GC 5KZCB 1UM4H 4WV1B 4YE0A 2Z35A 1VGKA 4JRYD 4MS6A 3WN5A 5IKCB 1WICA 3ZDYF 5CEXB 1DVYA 1BF5A 4BZ1L 4PLOB 3TO2B 1H0DA 4GRLC 4A6YA 2BY0A 4QTFA 3DJSA 3LAFA 1ZLSH 2A6JB 4U3SB 4F92B 4ALAL 1A25A 4N0RA 1DE4A 3UAEA 4CMMA 2E7LC 2VDPL 4QHMA 4P5TA 3L3OC 3QR1A 2PNDA 2IADA 4G7YL 5EBWA 3FAWA 5IHBA 5LO7A 3V0WH 1BPLB 5C0RL 3GBNH 2Y23A 5DMKA 2XN9B 4J1UB 4FQXD 2GKIA 3HS0C 2ZUQC 3INUH 3FPYA 1F4XH 4JDTL 1G7MB 1PY9A 5DJAA 3POCA 5GHWL 3MLYH 1Y1DA 1AQDB 2V8MA 2HRGA 4IHOB 1QD0A 3D3VD 5HHPA 4GUOA 2Y7LA 3WY1A 4ODUB 5F1IA 4HKZB 2BNQA 5CUSL 4M3HA 2ICEB 5FCUL 4LF3B 4FXLA 3G6DL 4NHCL 3RPKA 2VABA 1JF1B 3JV4B 5FWRA 1QRND 3TZVD 2A2QT 4JPWL 3AXLA 3ZKXB 3QNYB 2FEEL 1YJDL 1OCWL 1KTLA 1OM3H 3ARBA 1OP5K 2Z35B 4QRPB 2ZX8A 3FRUA 3TJHC 4F7TB 1NCAH 1HL4A 1W0YT 3QXWA 4JVPA 2NUTA 3T3PB 4LBEB 5KANG 3KPTA 4HIHA 4HMDA 5C0CA 2W88A 2C3XA 4ZS6D 4LEOB 4JGNA 3VAEA 3M88A 4G80A 1KB9K 5L2JB 5HDOA 1X5HA 3D0VA 2EVHA 2BOBA 1SPDA 4HZ1A 2G2NA 2NNAB 5ALBL 3B7UX 4I0PC 12E8L 4YQXH 5BOPA 1D3CA 3WTTA 2EYTA 3NJIA 3VXOB 3NJKA 1BYNA 4R3SA 3E80A 3P4LA 5CJ8A 3BISA 2VW4A 3W2DH 3OJVC 2MTAA 3KNBA 4PJIF 5HDLA 3LQAC 3UIYA 4GAAA 4KK6C 1GW6A 1MG2C 3EYOA 4PP2B 4KV5E 2ITEA 1MCOL 4EVNA 2K9UA 2BVPB 4HF5H 1OAJA 3L13A 1NFIB 5CLWA 3TVMA 4WFHE 1X5KA 2DQFA 4JM2A 2BNQB 3IFNL 2C9PA 1URZA 1N10A 2J25A 4CVZB 2A9BA 4JFYA 4XN5A 5BRZE 4GLRH 2EYSB 2AV7B 4CC1A 3ARRA 2CIKA 3EYQD 2JLPA 1G7QA 4MNQA 4P8QA 5JO5A 5TF1L 1AGDA 1F3RB 2Y7OA 3FK3A 2X2JA 4K7PL 5KG9A 5HDQL 1DQJB 2CMRH 1CXHA 1WTLA 2FBRA 7PAZA 5IHHA 4LEEA 3B9KD 5DO2C 3VVVA 1TMCB 2CHDA 1AKJA 3LQMA 3GPEA 2XUWA 1YECH 3J07A 4H1LB 2QQLL 2JNZA 3VM7A 4X6DA 1N19A 1BVKA 3ZE1E 1U0QA 5LCVL 2OJZH 3VA6A 4HMEA 5GS2H 1U3HC 1OHQA 1D5ZA 2V37A 4MD5A 3LNEA 5AW2B 4ZMVA 1AQKL 1WZKA 4NT6A 3S5YA 5F9JB 3IPBA 4YDKH 2CALA 2PWDA 3PHOB 3QVAA 3BYTA 4JLRA 4JO3H 3G3LA 2BJML 3U2JA 1NAKL 4AIZB 3EDKA 4B3EA 1QR1B 1DN0B 1GZHA 1A6PA 4CW1A 5BNXD 1OIOA 1EDQA 4WW2F 1CK0L 1BZEA 1O9VA 1AP2A 4WI5A 1R3JB 1R5VB 1XAUA 2BZCA 5HI5C 1YEWA 4ENED 1SYSB 4OD1L 2OKMA 3NG5A 4KHTH 5EHFA 1P69B 4MWFA 4HAKA 2Z91B 1T1XB 3DLQR 3MV7B 5DCCA 4L3CA 3B5GA 3E7JA 1JK8B 1CDJA 1FVCA 3H9SD 4NKQB 3ES6B 1NDMA 3V4VA 3FXIC 1NC2A 1NFAA 3CFCL 4HJJL 4ZQTA 1BQKA 1R3LA 4UAOC 3W9DA 2KS0A 1QA9B 2DQEL 2F53B 4TQIA 4NUQA 2JIXD 2JE8A 3GC3A 1KN2H 3N1FC 4DUXA 3MXWL 3QIUB 3IKKA 1OPGH 1A6WH 3BSZA 5T5NF 2BWDA 3NSFA 3L9BA 4L3EB 4U1KA 4PH8A 4HKXA 4XNZC 5EC1A 3KPQB 3SD5A 3ZE0B 2X1XR 1I3GH 4X2UA 2AK4A 4N22A 1N26A 1DJZA 3QEQD 2FRGP 3BXNB 5AKVA 3VRLE 4P2CG 3IJSA 1GHFH 3ETBJ 1O6SA 1TO5A 2VR5A 4JX0A 1OTTC 4N25A 4K7PH 2OSXA 3FSZA 5C0FA 1IGML 1OP3K 3S35L 1GGBL 2LHAA 1A9EB 2WMPA 1PL3A 4F7CA 4AXWA 4UBDD 4LIQL 3BIAX 4PJHB 1KXHA 5IVOA 3ARFA 5I1EL 4HCGA 1LEGA 4WNSA 2UUDK 4XMTA 4F7EA 3I6KB 4KKLD 2J1KA 4R5TA 3NOIA 3VA2C 4F8OA 2C1PB 4XN2A 2VJ8A 4BZ1A 3D25A 4ILDA 3PABA 4JFFD 4DCQA 3WXVH 1TG8A 3DOSA 2V8LA 5TF0A 2JJTC 1E50A 5KSBE 2IWEA 2V33A 4RETB 2CH8A 4Z7QB 2BOCA 4OZIB 2Q8BH 5I16A 5C09D 5E03A 2P5WD 5D1QB 4Y4HD 5JR1L 5FW6A 3ZDWA 4I0PD 5BS0A 5GRYA 2BK8A 3P0YL 3HAEB 2NW3A 4XNQB 2DLFH 1ZPLA 4WRLA 2C5DC 4XB3A 3FZUC 5C0GB 1BM3H 3RBGA 3D4ZA 3W39B 1DVFA 4V2CB 3TBYB 4PWFA 1JOIA 2WANA 4U33A 5F93C 4NO0D 2YRZA 3VRLF 4AGLA 3CJJA 1DJSA 1IGTA 2OCCB 3BD4A 3LN5B 5B38B 5ACZA 2D2OA 4A7UA 4N5EC 2PYFA 5ESVA 2OMUA 3V10A 4U1KB 4CA4A 2ITDA 5FO7A 3QXTA 1YDPA 4ODVH 4XNYL 5F89B 2PO6B 4PTUA 1NOFA 3NPZB 2P24A 3ULVH 1TSRA 4URKA 2C9UA 5AVTB 3EHBC 1F1DA 3MYJB 3APFA 3WFEL 1L3NA 4MXQD 3UERA 1YA5A 1YG9A 2BWIA 1TZGH 3FUNA 4MJIA 2A6IB 4MRBA 4K2UH 4TVPH 4YPGA 1SLWA 2YD1A 4FQPA 3UG5A 3V4PA 4M7KH 4P2OC 3AWEA 3DUUA 4ZPTB 4X9IA 1IC7L 1YNLH 1I7TA 3EOYG 2Z91A 1C1EL 3K2UL 3PE9A 3CZNA 2ZUVA 1ZVYA 3H4FA 4PRPD 1PNCA 1EAPA 1JXDA 4U7MA 3TO4A 3IK2A 1DQIA 4IOSD 4Y1SA 1WBZA 3K74B 1NCBH 3PYCA 3TTSA 4OCXL 3S3BB 4LHJB 4YGVA 2NR6D 3EGDB 4FAAB 1HCFX 1GIGH 2DAVA 5E6RB 1PLCA 4YHOH 2DWDB 3GNML 1MWAH 4FHBD 4TV3A 4BEIA 4WI3A 4Y2DA 5E8DH 1OLZA 2CDFA 2NY7H 1HH6B 3CXDH 3FQXB 1U8JA 2XWJB 2DS4A 4KNUA 4X8JA 2D4DA 3SO3C 1GGUA 3LHAA 4MA7H 2CCWA 2Z9TA 4XMLL 3WFDH 1CR9H 1U8CB 1CCZA 4AT6B 1FO0H 3GSXA 3KPSD 2VQUA 4MAYD 2APTA 3RVUD 3TT3H 1F00I 1TCMA 2QMJA 1RMFL 5DMJB 1XZWA 4D9RD 3EBIA 1L0XA 1MWAL 1PVHA 1KN4L 1F8TH 2QKSA 4MBRA 1WCBB 3EZ8A 2VLRE 3RTQA 1ZLVH 3M8OL 3TNNA 2FE0A 1N0LB 2LQRA 1BGXL 2XA8H 2H9GA 2BVUA 1LMKA 1Q9LA 4HETA 4N1HB 2B4CL 3MRGB 5PCYA 1G7HB 4TVPL 2YRBA 2G5UA 1E0OB 4X7DC 4OZGE 1YEFH 3EFFB 3VRJA 3CN2A 1QLRB 3GT6A 3LV3B 2L8AA 4GKZA 2H26B 5I30H 3KHOA 2P3YA 4N2BA 4JRLA 1KIPA 2VLLA 1V7ML 3BP7B 4G42B 2XG4A 4E9WA 2VR6A 3HBZA 4MJ6A 1UM5L 2VISA 3IDMB 3S8FB 4FQXB 1WQVT 4JHZA 3OGCA 1VZHA 2IXQA 4MDIA 2IDUA 1HWGB 2AJUL 4DZ8B 3MROB 1NBYA 2P46B 2PUQT 4FHKA 4X7CC 4ZNEE 1QWUA 4M5ZH 3DVGA 3WG7B 4A66A 3T0AA 2DQTL 3D52A 4JFFA 2N59A 2W9DL 4YWGH 5JR1H 5IJKC 4M62L 1HINH 1T89C 3C60D 3RDTA 1KCRL 3ZU8A 3QPQD 1CLZL 2VN3A 3L1FA 4EOWL 2YIHA 2W60A 3NRQA 1KXQE 4WI2A 2DH3A 3ECWA 1NC4D 4Q9RH 2DBJA 2VITA 1IE5A 3TYGL 2YGQA 1KTLB 3TA3B 1KLGB 5SWZA