4KQ0A

Crystal structure of double-helical cgg-repetitive rna 19mer complexed with rss p19
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
122
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
total genus 38
structure length 122
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kq0A01
4JGNA 1R9FA 4KTGA 4J39A 4JK0D 4JNXA 4J5VA 1RPUA 4KQ0A 4KNQA
chains in the Genus database with same CATH superfamily
1R9FA 1AXSA 2LV4A 1J0HA 5D7LE 4JM4H 5HSFA 4OGQC 2V4LA 4UDTA 3NFPB 1BQHB 3S37X 2FVNA 1BJ1J 2EKSA 3VE0A 4HUWB 1QLRB 3DK2A 4Y5YB 5DQJB 1Q90A 4NQEE 4LL1A 1RERA 3CHQA 3DX6A 1U8NB 5T1LA 2DQFA 2E4TA 5GGTL 5I0VA 4BHUI 1JDCA 2NY0D 1A14L 4XO9A 1JZ4A 4JZOB 4KDTC 4AL8H 2WOYA 2X0UA 1CBJA 3RE0A 2GUOB 1Q9OA 2JELL 4GQQA 5FF6B 5K39B 3KLAB 3UP1A 4KOBA 4N9GA 2CUIA 4N2GA 1QPPA 3LMJH 3SKMA 2HT4D 3LEVH 4MQXD 1WBZA 2VLJE 3MROB 1TZGL 3QORA 5K59F 5ID1B 1U4FA 1RKRA 1TR7A 4MQSB 5B1JC 4DFIA 2VDLH 1AE6H 4QTFA 3QWNA 2BPBA 1I8MB 1OCWH 5DJXA 1NPJA 4CU8A 1D6EA 2ZYRA 4BA0A 1C5CL 3G5YA 3P9LB 3O6FC 3QNZA 4NFBA 2Y7NA 2AFNA 3D51A 1DSWA 3UTTB 4IHOB 1ETZA 4ALAH 3VXQA 4AYMC 5BV7L 1QHPA 1E9OA 1UD5A 3CFJB 1BVOA 4IDJH 4RNRB 5CSGA 1RUKH 3FB6A 4YDZA 4NYLB 5C6TH 5E6YA 3LRMA 5J06A 5JORB 2FLRT 3APFA 3TPUA 2SEBA 3A3YB 3HG1A 4U1LB 1S7SA 2X6CA 2YGPA 4FZEH 4DTGH 1FA4A 4Y2OA 4Q2ZB 2BX5A 5KOVC 1JYXA 4TUJA 1QRKA 2R0KH 3UZEC 3I6KB 5CP3A 4PJDE 2Z8VC 1XF2B 4AQ1A 3WIHA 2A9MH 3MRBB 4GXUN 3A23A 3GGWA 1VFAB 4N87A 1AACA 3CVHH 5DJCB 4LLDB 5KVDH 1DE4A 3WNLA 2YAPA 3JV6B 1KG0A 4N2AA 3T0BA 2DQUL 3UMTA 1SYVA 4R26H 3QEHA 2E9IA 2IANE 1TYEB 2YWYA 3NZUA 5FUOL 5CLZA 4OCXL 4CBZA 3A47A 4PRPD 4YDLC 1XO8A 2HWZH 4PI2A 5IBUG 4RWYH 3FUFA 1IQWL 1I75A 4E41A 1P5UA 3FCUB 2XBDA 1S7UB 2QBWA 2B59B 2FGZA 2ZKHH 2R27A 2X9WA 3MRGA 5CHNB 5CN1A 4YHZL 3AG4B 4ZMPA 5CINH 4LIQE 5I8KH 3OLIA 4RMVA 5IW6B 3FFCA 3QNYA 1KF9B 1FNSL 3VMOA 4BDVB 5DZNA 4M9PA 4NUPA 1R3IH 1FL5B 1ZE3H 2XZCL 4LDOB 1ZOXA 4OCRH 2X10A 1V7NH 1YPZE 4PS7A 3WNIA 5K9QI 1BXVA 5IB2A 5GQBA 3MJ9H 5CFHA 1P5VB 4ES8A 3AGWA 2EXSA 3LS5H 1G5GA 2QSCL 4ABVA 5FDWA 2VZVA 4XWOC 5EV7A 1WWWX 4LARH 5H37H 5ITBL 1L4IA 1RZ8B 4QRSB 4XPTL 1UASA 4OBRA 1THCA 3JXAA 4PRPA 4XT1C 3F64A 1T5WB 3U4EB 1DJHA 3VJ6B 3V4VA 4JREB 5JHDD 4YDLB 1NEZG 2IADB 4XAKD 2IAMB 4LQ1A 5LNGA 1V10A 5IKCA 3D5OF 4XNXL 2VN7A 3IAQA 4YC2B 1INDH 1K4DB 1II4E 1SFDA 1X5KA 4QOKE 4PJIB 4ZMZA 4AQ8C 2AHIA 3EDKA 1QFWM 3EYSH 3LKQA 2BCKB 3MLVH 4UV4H 3DUUB 3TF4A 2LAGB 5E1QA 3X12A 1UKQA 3EOAB 2ODHA 2H2PD 4MBOA 3MGOA 1G7QA 4WW2B 3SGKC 2IH9A 3DVNB 1SMAA 3MTRA 4ILDA 3QQ4B 4KJWC 1KUMA 1QG3A 3MCKB 1WA2X 5T3ZE 4RZCB 3T4YB 3AJ7A 2OW6A 2HVJB 2XTJE 2FB4H 5J1AA 5TQ2H 3RZWA 1ITBB 3PP4L 2A38A 1HHIA 2NOYA 2F5AL 1QLFA 3TBTA 4LLMB 5KVEE 1E3ZA 1N9PA 5D2NC 5JIIA 1CGYA 3OR6A 4LEEA 4OLWL 5IBLD 1KGYE 3ZYZA 3QJFB 4L8DB 3S5LB 1KIRB 2XWJB 1RP8A 4PB9H 4GI8A 3LB6C 3L17A 3UZVB 3RA7H 1I1AB 3QUGA 3SDCC 4X7TA 2A74C 2BH0A 2R29A 3PP3H 3SD2A 1LO2H 1N7MH 3DDFA 3HZKA 5AEAA 4ORGA 4TQIA 2PTTA 2PO6B 5TE7L 4B9FA 4BHUA 5CEZD 1QLEL 3QIWA 4F27A 1CLCA 4MTMA 3VGBA 3ZGIA 2VGLM 3U9UB 3V4PB 1IT9L 4PGCA 1KBGH 3FQNA 1CGXA 3LEVL 1A5FL 4N0CD 3CZNA 4NX0A 1Z9NA 1KACB 1RUQH 3PNWB 4MAYC 4PJ8A 4PRAB 4Z76B 5JIMA 4P9ML 4KZDL 2Z7WA 1DVXA 2BSED 3M7FB 1K4CA 3CXDL 3QZMA 1EAOA 1CLZL 1JV5B 1Y07A 3PWVB 5JUEL 1X6LA 3DSNB 1EO8H 2L4OA 4U1NB 3STBA 1ZT7B 3MRLA 4QRRB 5DMGC 3HS9A 3RPIA 4F9PA 3IMVA 4J3TA 4DVRL 2GAZB 3O9WC 1X5AA 2OFQA 2R4SL 3SO3C 3CN3A 2WLMA 3FB8A 4IRJA 3QEUB 4M61B 1IEBA 3CPLB 1ZHKB 3ARFB 1LQSR 4ALAL 1E3XA 1RV6X 1KCSH 4AENB 4MCYB 2GK0A 4OF3A 2PXYA 3I9IA 2CMRH 2B8OT 5DWUH 3RVUD 2WXQA 3ASWA 1EJOH 2CD0A 1YYLH 4W81A 4DW2H 3V79C 1UJ3A 4KDWA 4X6DA 5I6KA 4FHBD 4MNGE 1OB1B 4TSBH 5I19H 4GQ9L 5I1KL 5ICZA 2VDOH 4BSVA 4JHAH 1F8TH 2EICA 1A0QH 4L1DA 1MELA 4JY6A 5I8EA 1HL5A 4MMXA 4WGKA 3U4AA 1GYCA 4H8QA 4PJ7B 3FT3A 5F8RC 4AM0Q 2VOTA 4PJFF 5E0FA 1KY7A 1XH3A 3ZZSA 2JK5A 3ZE1B 2M2DA 4E9SA 1COBA 2DQUH 5G4NA 2LTQB 4ZPTB 1MVYA 1DVQA 3FDWA 1AQDB 4R96A 4CKVX 4DPAX 1IGTB 5HYJD 5JMOC 1T21B 1T89A 5BQ7B 1Y7VA 2R4RH 4KUCF 5DRZB 4PJ5B 4RWYL 3K72A 2AQ3A 4LMQE 4QD2E 1KMGA 3KYOA 5E5RB 1EIBA 2YD5A 4GY4A 4YMPA 3GJFB 5T1LB 5F0MB 1MUJB 5GS0D 1Q0XL 1VZGA 1S7UA 2JKNA 2X2HA 4ODXB 5ABDE 1HJBC 1HH6B 1VF5C 3BAKA 3QP3A 2VR6A 4K55A 2QR0B 2OMZA 3U7YH 3VW3H 1TIUA 4KI1A 5C97A 3NVQA 2XQYA 2ZYIA 1BPLB 2OJEA 3JV0A 3WD5L 4L8CB 1N6VA 4D0BB 1A6VL 1WGVA 5FOJA 2NNXA 3BKMH 1CGSH 2H0JA 4NC2B 5HGHA 3EADA 5F97E 4S1QH 4KQ4H 3G9VA 2AQ1A 3FULA 4HEPA 4DFHA 5BO0D 3Q2LA 3RX9A 1CXIA 4NFCA 1BVLB 5HYSB 4Z7VA 3LKRB 1MNUH 1JV2A 5IOKA 2QELA 3AXIA 3S3DB 3JTBA 3O41B 4GEJA 2LVCA 4LEOA 4XCFH 1OGAD 2DWYA 4FCHA 1JWSB 1YDPA 3NFNB 5C92A 2BSBA 5J57B 5AB9A 4MNHB 3NEEA 1I1FB 4N2OA 3RFRA 2OXHB 1XCTA 4F33B 1TQVA 3W82A 2HRGA 2P7TB 1RXLA 4MAUL 2FYYB 1NM4A 1A4JA 2WBJC 3NN8B 5EZLB 35C8H 3WOVA 4J5VA 3VRLF 5KUKA 4QRPB 4XCEA 3LEXB 1D6EB 4YSQA 5IV2A 1W72B 4Y16C 4ZMYA 3BGFB 1JZEA 4ZO7A 2R0WL 3DX8B 3ZQWA 1MWAB 3WAKA 4W9KC 1GYVA 1AR1B 1DQDL 1LO3L 2O6EA 2JIXA 1U6AL 3E7JA 4FDWA 3WY1A 1ITCA 5JUEH 2OX5B 3APNA 1FZOA 1BVKB 1NWOA 2Q3ZA 3BVWA 1ZLWK 3EUUA 3SQOH 3EYVB 3IDYB 4UINL 4KZEH 1U9KA 1OL0A 4F8PA 2VDLB 4WI8A 4F7KA 3SDDD 4L9DA 1NBQA 4GMSL 4HHWA 1YYCA 2A3TA 3JYCA 2ICEB 3R19A 1VCAA 5TE6H 2YA0A 3NZSA 2VDPB 5I0DA 3V8OA 2ZOOA 3MX0A 4IOIB 4XNZB 2EEAA 1N10A 4YXHL 3O11A 1A7QH 3V0HA 3MV01 2OMWA 4YSEA 3HNSH 1N7ML 2ADGA 4G6MH 4UQCA 5IM7B 2JKRM 5J56B 4N8VB 3SIKA 4K3DL 3GSRA 2DWEB 3MCYA 1KZQA 2X88A 3VXSA 3GKWL 1NLDL 3IDNB 1A25A 4XPGL 3H85A 3QC6X 5L9DL 4NO0A 4HH9B 3II1A 3VFUB 4J27A 1NEPA 2YQ3A 1E5BA 4OUUB 5J6GB 5BRZB 3F6JA 3BPOC 4M3JA 1XFPA 2XI9A 1HHKB 5E9DE 2G0KA 3KHOA 1CFTA 3Q9PA 3WJLC 1FWXA 3PAZA 4UQ3A 4PJGF 5D2LE 4YDKH 3T6VA 1UD8A 4Y7OC 3H3PL 2EYRA 1RAMA 5EBGA 5AVTB 3NAAL 3DXAD 4L29A 4NUJB 3EO0B 3CFDA 5F1IA 5F7NC 5J6HA 1MF2H 1WYJA 1ZDQA 3CSGA 9PCYA 4ZXBA 2P8MA 3QIBD 2R4SH 1PZCA 4PRDA 4CGTA 5E8DH 1R3HB 3HMXL 1IGJB 3DHPA 1YEGH 3ZYOA 3QHTC 4IU2B 4WGWB 3MBXH 4JLRA 1Q94A 3AZUA 3V6OC 5AG9A 1DJGA 5B3JE 4TL4A 4QRQA 1HXMA 5K33A 1FE8H 3L4UA 2GC4C 1RZKC 2X41A 4S1SL 1HEJC 3MJ7A 4JFDD 3S98A 1QTSA 4JFOB 2BIQA 4HKZB 2QQNH 1OALA 4NPYA 1RZKL 3FAWA 3LSOA 3T0EA 3TT3L 3U0WL 2E47A 4AQEA 2AQNA 1K2DB 1T1ZA 2DYPA 3LN9A 4I4WA 3T6WA 4XTRC 4LOVA 3OXRA 3OPZH 1ILSA 2NY5H 3O3DA 3PAUA 4YSDA 4RIRB 5FO2A 2DYPD 5TPWH 3VFTB 1LYQA 3H9HA 2VISA 2BNUB 3BN9C 4FFWC 4X8CA 5BZWA 4A2FA 4GG6B 5D7KD 1AY1L 3DMMD 5T3XE 2YUZA 5KVMC 3KEHA 4KKCD 2HFEB 3BQUA 2UVEA 3MRIB 5E6IC 3JWOH 1GVIA 1JPSH 4H1LH 4MXQC 3WFEL 2G5RA 1E4XI 4CSZA 1BLNB 3AT0A 3MRPA 2QQKH 2YOAA 4KTDL 4JPIB 1JK8B 2CR0A 4Q52A 1DQDH 1LO3H 1O9WA 1ZTMA 4R2GB 4JJ5B 1NGYB 2WUCL 3N1QC 2VISB 4NAMA 1R24A 4L3FA 1U3YA 4XHQA 5D70H 2ED9A 2XFXA 4XNQB 4NGHL 3C75A 2MWCA 3WL9A 3VRLE 1SHWA 3S88L 4A2EA 4NO5B 4NRYB 4S2SB 5HI4C 3QJVB 4O58H 1BOGB 1XBDA 2EDEA 2V3EA 3ILEA 1EERB 5HGDB 4E5XA 4K8RC 2K4WA 1JGDA 1PLGL 3DRTA 1MHPL 1X9QA 4JW3A 2JTYA 3UBXG 2J5WA 1EDQA 3P3YA 5GGUB 3TV3H 1MNUL 1TVDA 2W9EL 4NZRL 2NY1C 2Y7LA 1OM9A 4LPWA 1LP9E 2PO6D 1EQWA 2IOMA 2X6UA 3OAYH 3DBXA 4NBZB 3HG0A 1PAMA 4KGLA 6PAZA 3T77A 2AK4D 3NCJH 4Z7OB 5IROC 5JO5B 1Q0YL 4AMXA 4NDMB 2E7LC 2VR7A 1YO4A 1D9KA 5LQBL 2VABB 2VDQL 3ZMRA 4BCZA 4JRYE 3Q8EA 5IMMB 2A6IA 3O6ML 3UYPB 2EUWA 1IC4L 1XDTT 4B9PA 2P8MB 1KBBA 3AS0A 5GGSY 4XX5A 4QXVA 5HDWA 3LN5B 4YAQA 1FLTX 4ADJA 1GTNA 2XN1A 4PJ9A 1QKZL 1UOLA 4JRLA 4RAVB 4A2GA 2VDMH 4GW5A 5AYUH 3ATAA 1SEQL 2NXYD 4DQOH 1MQKH 2WCPA 1KYFA 1G6RA 4Z7NB 3IJYB 1BBJA 4RAUB 2AJXH 2P1YA 3HZ3A 1AZNA 1O7DC 2XWRA 5BPPA 1A3LH 4GRLD 2Q6WB 3GEWB 1CFNB 3T3MF 3B1TA 2C3VB 3V6OE 2CDEB 4PJCA 4UINH 3B1UA 3WG7B 4RCAA 5KVDL 5KN5A 3DA0A 5DHXB 2YOCA 4N2BA 3EH2A 4GMSH 4Q89A 2VMDA 3OBAA 1WD9A 2CO6B 4QRTA 4QO1B 3S36X 4YHNB 3QXUA 4PCYA 1NIDA 3H56A 2OL3L 1JZ8A 5IB1A 4EDWH 1AGCA 3MV9E 4YE0A 4XXCA 3OG6B 3C8HA 4NXKA 5DK2B 1XB8A 4LMQI 1AHWC 3KH3A 4PJAB 3B9DA 1AGEB 3HLAB 5FHAL 4JKMA 1WD8A 1N64L 4FULA 2UVFA 1FZJA 1KXHA 1N5AB 2N7SA 5T1DL 3VXPB 5GZOD 4PRPE 4JHWH 2PWHA 4JRXA 5CJ8A 2YGVA 3EF4A 1OIOA 3OHXA 1FVCB 1ADQL 5TFSL 3CCHB 4JN1L 1ED3A 3B7RL 3WSQH 3H55A 5D1XC 3UJJH 4HCGA 4EQ3A 3MLUH 2KLSA 4XNUL 1TJGL 3KEDA 1QVOB 1ZHLA 4Z6AT 1DUYA 5CCHE 4JG0L 3ASNB 4DKTA 3SQRA 3ATDA 4K9JA 4FNRA 4IKNA 4LPYA 2VIRB 4WHYG 1A21A 1NGQH 5CJXC 2CBOA 1BMWA 3CFTA 4O00A 3PWLA 1I8IA 2AK4E 1QOKA 2XZQH 1D6VH 5CNHA 3VXUE 2IBZY 2YBRA 3BPNC 5CSZA 4MMYA 1I9IH 4MNQB 3O45B 5GZND 4AG4H 4J1UB 2UXVA 1IGMH 1JCKA 3HVNA 5I0ZA 3UAAA 3DJZA 2C9XA 3GJFH 5CKAA 2P8PB 5F7MC 1QFUL 3PJLA 4KZDH 4YZFF 1XZ0A 3KDMA 4JL1A 1DVUA 2J73A 1V3KA 2BZ7A 3P4MB 2AQ2A 1OE1A 4Z23A 4LSRL 3BDXA 1CFBA 3CG8A 2DLEA 4JGJA 2WD0A 3Q01A 3KBHE 1A7OH 3VMNA 4N90D 1BLIA 3OKLB 1HQRB 3PGCA 5GRJL 1TNMA 2X4PA 4Y4KB 2FGWL 3QRGH 1YQVH 4YEEA 5I1DA 1AXTH 1YEKL 3AB0B 2J88H 3ABKB 1P1ZA 4UT9H 4WSGA 3D69A 4XVOA 4MQ7B 2BDNL 4WWNA 4GLRI 4JM4L 4PBDA 4B9KC 4LCIL 4PGEB 4QWWD 5CFAA 5E2UH 1F8TL 4NCDA 3W9DA 4POYA 3N91A 3DGCR 4MJJA 1CF8L 3F04A 5DS8A 5I1LB 2VUKA 1CD8A 5F7LB 4YXLH 4YDVB 3TA3C 4QRUA 4ZW3A 2AXWA 1CS6A 1FL6B 4MMZC 1Z9SB 4UQIM 3LZQA 5DJ8B 5AYUL 5CWSA 2CRYA 3KYKH 5AG8A 5BQ7A 4K8RD 4X5WB 4O2CB 2NY3C 1U8CB 2D3JA 3HUJE 4A7UA 3TO4B 3K8KA 2DPKA 4XCYB 3RRQA 1U2YA 1XTMA 2ICWB 1TITA 2WCGA 2CR6A 2VXQH 2QV4A 4PRHE 3DPDA 4O58L 1TZGH 1BD2D 3GO1L 1A5FH 2J8UA 3D0VA 9CGTA 1E90A 2RALA 3FSOA 2GTZA 1R17A 2FLMA 2P44B 3GXPA 2AANA 4HK0B 2VN4A 3FCSA 1XIWA 4F7MA 4P9MH 3MCLL 3JWOC 2NY6C 4Z0XA 1USQA 2BIIA 4ELMF 5ANMB 2PP7A 2XZAL 3V7AE 2RR3A 3UTSE 1VGKB 4H88L 1QBBA 1NMAL 2BHFA 3LVEA 1MHHA 1FVDA 4U6HB 2RBLA 2H2SC 4NUGL 5B39B 3W2DL 4ODSL 3BZ5A 2BWQA 4Y4FD 2BOCA 5IEKB 4UBDC 3D0AA 2Q7NA 4NQSB 4BE6A 5B38B 3FTGA 5JW4M 4PJAE 5I73C 4NN7C 2XX0A 2D7NA 3HG2A 4QRRA 2R9HD 3HUJA 2QPSA 2EVJA 2FO1A 5L2JA 4MJIB 4JE0A 5C9JA 4KMTH 2OMUA 4HHGA 2XHNA 5CZXC 5GGSA 3U9WA 4CMHC 3NSXA 1R0AL 1SEQH 3AQZA 5IMOA 2XOTA 4JHAL 1IAIM 5H37G 3VWJB 1IE4A 4ANUA 4W6YB 3MV8E 2CIKB 3QJOA 3MBWA 1OWRM 3RUGF 3SPJA 1U0QA 1KN4L 3SDAB 1EPFA 2QADD 3WKYA 5DO8A 3V6BR 3F58H 4ADIA 2WW8A 2N0MA 4Z77A 3V0IA 5JQ6L 3RY6A 5EC1A 2IDUA 4MAZA 1VENA 1P5UC 4KK6D 3B9EA 4Q6KA 4Y9FA 1MFEL 4QNPE 4IBTA 1QWUA 1AZZC 3ARPA 1WUZA 4JRWA 2ZWNA 1XD1A 3LJ3A 3VI3B 1G6RH 2IPTL 3BC9A 2GK2A 2ZOKA 1YEHL 1IM3A 4MDRA 2NY4D 4NI3A 2HB0A 1MAJA 2OCJA 2YEQA 5GS0H 1TDQA 1ZD6A 1UACH 3BIKA 3EJZC 3F12A 1AHMA 4CC4A 1L0YA 4M6OH 1NFIA 5F6IB 2FGWH 1R3KB 1MJ8H 4KO6A 4I18B 4O2FA 5AVSB 3RTLA 2XETA 4QXGH 1S8DA 4JDZB 4FZEL 1TT6A 1CBVH 5GJSH 4N8PA 5DK0B 5D96C 4ZTPL 3N44B 4BFGA 4ZQTA 3NCMA 1EHLL 2N7BA 4YVUA 4MD0A 4UIMA 1SN5A 4HUNB 1A9VA 2XV6B 4ZAKD 4MA1C 4HJ1A 2ARJQ 1CE6B 2FEEL 5GGRY 2TRHA 1IC5H 3GSUB 3RQ3A 2EEFA 2VUOA 2WQ8A 3UACA 4FF9A 2WXOA 4NRXA 2L7EA 4XH2A 3RIFF 2Y5TA 1ZVSA 5GS1B 5KOMC 3EG9B 3IAGC 1U4EA 5ESVA 2WIIA 4LL9A 4AYID 4JY4A 2ENYA 2VXQL 2ICWJ 1GZHC 5J0BA 1XR9A 4OLXL 5ECJE 3WNKA 5L2KB 2HJKA 1SJVA 3ESUF 5D96B 1H3UA 1PLCA 2WHVA 1P7KB 4U0RB 2DWXA 5D7JD 1BREA 2W0FB 2VZUA 4YDIH 1T66D 1JFQH 3CXFA 5I6XC 2ERJB 5HJ3A 4XP4L 1QNZL 5M95B 1IFHH 3PDGA 1OGTA 3FB5A 2XC8A 1KGUA 3JTSA 5C8JA 3S5LG 3WTYA 2J43A 4QI3A 5I2IB 2IQAB 4PRHB 1PX4A 4DKFH 4AK2A 4OFYA 3FSZA 2W65A 3RL2B 4CADA 3ZLQC 2NSQA 3ML9A 4ODSH 3T2LA 2DKSA 4F7EB 1SF5A 1IBBA 4Y9GA 4C57C 3LZRA 5EPMA 5JXAL 1CXHA 3VCLA 4KOCA 1WC7B 5D7SH 2HG0A 2KLRA 4NRZA 3NFSL 5IK3B 3VRIB 4DZ8B 1XB6A 2DL9A 1ZGLP 5H35A 3F7LA 1GAFL 5F7EH 4BKTC 3M1BA 4L9LC 4BCXA 3WTWA 3TO2A 3DXAA 1QLEH 4UQBA 1S7RB 1JGEB 4FFVD 4Z1PA 3CSYB 2NY0C 5TE4H 4XR8C 2V33A 3GKWH 4M6ML 1NGXB 1I7ZA 5SWQA 5F70A 3OAWA 2K3HA 2BSTA 1A7PH 5I76B 1ONQB 3TT1H 4XOCA 3PV7A 3GSOA 3DXAE 4P5TA 4ZYKA 1YCSA 3WFEH 1KFGA 2EDDA 4U2YA 5D1QD 4XPFL 3U36B 4HZLA 2B1AL 4QF1B 2CJTA 4M6NH 4B0MB 2XJKA 4M3KB 1FZJB 4XE0A 4QHUA 1KGIA 1JUFB 3AC0A 2PYED 3CFKA 4KI5C 3L7EA 2ZCHH 1MQ8A 3L3KA 3O4LE 3PHSA 2JV6A 2C1PA 4LSVL 2PTVA 4HBQA 4XO3A 1QP1A 2NXYB 2EECA 1OK8A 3CXHJ 3GM8A 3ZTCC 1FYTA 3LQAH 4NO0D 4YLCA 1F13A 4WTXA 1EXGA 3ZTJH 1HSAA 5I17B 3T2NL 1MVUA 3BZ4B 2CG9X 3FQRA 4JB9H 2ITEA 1YYLL 3FCTA 3VDAA 2MPAH 1OP5K 2VE6A 3CK0H 3M1OA 2BNQE 1AQHA 4K7FB 4OB5L 1OHZA 4HKBA 2NT1A 4S0HA 2NY5C 3G5WA 3OVUB 4UIKH 2IH1A 5CJ5A 4BZYA 2YRLA 4BYHA 3QIBA 2AVFA 1DFBL 3S35H 1MHCA 4KO7A 5CR8A 5T1JA 2ZYHA 5DJ6B 1JZ2A 5KVFE 5JPMB 2GIYA 2KYIA 2VSKB 2NYYC 1H3PL 2EIZB 4JFUA 1MI5B 1NIAA 3LXBA 3HW7A 4GRMB 1IGFL 4Y16B 5I1HH 1GOGA 5H2BA 4YDNA 1HHHA 1JYWA 4HCFA 5EZJA 4LFHG 3HNVL 4JFPA 1T66C 5F88B 4PJHE 3PWPA 4IS6A 5DWPA 2HX7A 3SEPA 5D8JL 1YN7A 2OMXA 5DQJA 5DD1L 1YY9C 5KUMA 5E56A 5FO8B 1ZV9A 5MENA 1ECYA 3U6XS 1A6WL 4YDIL 4HQQL 4MS8C 3EW3B 1INQB 4JHVA 1TQUA 1TEFA 2B1HL 2ZNXA 4BQCA 3IRZA 1ILUA 3MJ9A 4FNSA 1A6VH 4HP5A 4PJEF 3ZR6A 4CVXB 5ITFA 5HY9B 3LHPL 4PV1C 5CO1A 4ZPVA 2VRKA 4N6RB 2FH6A 3UBXA 2JJSC 4DWHA 3GJFK 1G7MB 4Y19B 5AL0A 3K6SB 1JI1A 1YEJL 3H42H 4NKMA 3CBRA 1FDLH 3IPEA 3BUTA 4PVLA 3MRKA 4D0DB 4JO8A 4Z7OF 1KTDB 1HI6B 3BUYB 3JWNE 4XNYL 2P5ED 2MQGA 1U41A 3ET9F 4MYWB 4NZRH 4WTZA 3T3MB 3TJHD 3RPBA 4KWUA 4FQCL 5AKVA 2Y2YA 5ACZB 3ZE0E 1XV8A 2ZPKH 5IOPA 5EO0A 2ADIA 3T6QC 3B9KB 1BMGA 4MXQD 3APMA 4ANKA 4JKNA 2J44A 2OJZH 3AY2A 1YG9A 1WAEA 1U3HA 4G6JH 1AI1L 3X1EA 4OF6A 1OCCB 3MYJA 2ZSWA 2EEBA 5I5MA 5I1AB 4PN6A 3MLRH 3RFZB 1ZSDA 3QXTA 3P2BA 4YNYA 3AGVA 1IGML 4ZOEA 1EEUA 1BAFH 1XR8B 3FT2B 3DC0A 4U3CA 4F3FA 4MJ2A 3T9WA 4BXVA 1EFXA 3BEWA 4M7LH 1AC0A 5AOMA 3VI4F 1SNRA 3NCYS 4HG4J 3IKCA 1KB5L 5HHNA 5D1ZI 1FHGA 3CUPB 3MRNB 1MG3C 4K3EL 4JN2A 4QHNB 4HHAA 3NCWA 5EU4B 4JFOA 5CU5A 4XBMA 2CO2A 5D7JA 1KBVA 3QT2A 4FP8L 5DRWA 1MW1A 1LWJA 3FUKA 1J8HE 1QI3A 2HFFA 2C4FT 1BIIA 5L4FA 1WFMA 4OLVL 2GTWB 4YXHH 5BRZD 3GRWA 3IB4A 2W80C 1R3HA 2QQLH 4ZUTB 2GJ6B 3U7AA 2IOOA 5JOEA 4PRID 3NRFA 4IMKA 3UAJD 4NQEA 4UT9L 3OJDB 4GKOA 4TUOB 1V5JA 5FHAH 4B0MM 1IZJA 1SM3L 3W1ZA 4BKLA 4ZSOB 5F1KC 5DHVA 4UQ2A 2YD1A 1A2YA 4JHWL 3RWEB 1YEEL 4PRBB 3OKYA 2DLHA 1AIFA 1CN4A 1B0WA 5JZ7D 1H6TA 4KHTH 3TEYA 5AB2A 3QXDA 4CVXA 4XAWH 4X6BA 1MFNA 1ET7A 1H19A 5J6GA 3MJ8B 4XCNA 4JZJC 3PPEA 1GS7A 3QUHA 4I5BA 1XCXA 2G5BB 3ZGHA 3E8UH 3VXSB 4NQCA 3U0TB 5F9DC 2WAQA 1SJXA 3BRGC 3OKEA 3QUMA 1DDHB 5JW4Q 2IBBA 1WHPA 2YD7A 4UAHA 3SJVE 1J0YA 4FEIA 1MI5E 1F4WH 3D06A 1NGZB 1N2RB 3O8XA 3HMXH 1FYTD 2OZ4L 4XB8A 5M94B 2APTA 1FYTE 3P77A 1IM3D 1NMBL 4XVTH 2FL5A 1MCWM 2EXYD 1CYWA 3K8MA 4ZNCD 1H9VA 3VI4B 2VM4A 5J13B 1B9ZA 5LN8A 3RWEA 3REVA 1FFPA 4YVNA 5F1OB 1F1GA 3L1EA 1CGUA 4L3CA 1KPVA 3U2JA 5DO2D 4G6ML 5DI8A 2ETWA 5DT1H 1LLAA 3U4KA 2BO0A 4MA7L 4PEEA 5I8KL 4LOEA 4L4JA 3RVWC 3WKMH 3K5SA 4WWPA 1GRWA 4I77L 3WKNA 1DVSA 2H1XA 2WXKA 5JDJA 2AABH 1NL0L 3X17A 1XF3A 3HI1B 4ZS7H 3TX4A 1W72A 4XNYH 4LKXA 1WP6A 3QPKA 3C5JA 2ADFL 1S5IL 2P26A 2ZXDA 2UUDK 2XN9D 2BOBB 3QK0A 3X11B 3BW9B 2NPLX 3EGDB 2VN6A 2CQVA 4U31A 2YD9A 1KGWA 2HCZX 1HOCA 2ENPA 2NXZD 4D9RD 2PPEA 4J3UA 4MD4A 1XHHA 4U1IA 5B3SB 5F3BB 5DCCA 4BWTA 4ZUUB 3VXMD 3WS3B 1JYNA 4YR6B 5JDSB 2EIKB 1UT1A 3MXVL 1C5DB 1WUNT 4YL4A 1AKJB 1G9MH 1MFCH 3MHZA 2L04A 4WV1A 3WKQA 4MCMA 4PJXE 2X4NB 5FGSA 4JAMA 1OD7A 3L7FA 3OWEA 2WNKA 3C9NA 3KPRE 3O4OB 3QARA 1MCWW 2OBGA 3FQ1A 4G3YL 1LK3H 1U93A 5CP7A 4XMXA 4W6XB 5E1IA 5DC2A 3QR0A 4OFVA 4A6YH 5LAXB 5DJAB 4GAYA 4JO2H 4PY8J 4DGYL 4YBQC 2CBQA 4U1MB 5E51A 3QS2A 4NBYB 2C3HA 2Z65C 5FV2A 2X44D 1IL1B 1TTGA 3V6FA 1GZHA 4YWGH 4F7CA 2A73B 1D5ZB 4IYKA 1JXDA 3CX5J 5E4EC 3EYFA 3MOBH 4YLBA 5LBGA 1MLCB 1YRKA 2VXTL 3LDBB 4DUWA 5JZ7C 3G6DH 4AVHA 5L2KA 1J8HB 4HS8H 3PFUA 3P02A 2DDQH 2Z9TA 3NCJL 4LRNH 3KYOB 3CLFL 1L6ZA 4M03A 2V5YA 3GXIA 4S1DD 1D2OA 2VSDA 3FYEB 2GJ6E 2OJZL 3CZJA 1IIIA 3RVVC 3AQXA 2JB5H 4B6ZA 3D0LA 3J27A 5D7KE 2WUBH 3ZDXF 3GSWB 4PTTB 2O61B 1T1WA 4ZSOE 4WK4B 4ABUA 3E80A 1KCRL 2CCWA 4DOHE 1XF4A 5J9PA 4XNMB 1HSBB 2NY7L 3S8WA 3EFOA 2EQDA 5CEXA 4NGHH 3J7HA 3LMJL 3O3AA 4UNIA 4YGVB 4JJHA 4AVKA 4ZFOL 3PG2A 4PS8A 4Y9CA 1SN0A 4ZMLA 4GIAA 4LIQL 4WFEE 5KANG 1KGJA 4PVBA 1PZAA 4F1ZA 1FFTB 3SDAC 1DQJA 3Q6FB 4P3WA 5AWNL 2Y5QA 1NKOA 4ACTA 1YECH 1JFQL 4JMXA 1T4WA 3CV5A 2ITCA 3BIKB 4J6RH 4N3UA 2FJUB 5LBSH 1IAIL 4G8GD 1E6OH 5I16B 2HN7B 4MNGB 3GTVA 4G9FD 4JFQB 4L3EA 1RZJL 3IGAA 2ZOKB 3QCVL 3QAZC 4FFYH 1JWUA 5JOFB 3GBML 3HG1D 1YAZA 3UFIA 3MO1A 4DP5X 3BWSA 5FUZL 5FYKH 4W9GC 3VI4E 5EU6A 4LPXA 1NL0H 2H26A 3U2SA 1FL3B 3KD4A 1X5IA 1QO3A 5I75B 3B6SB 3L45A 3BVNB 4I2XA 4M62L 2WN2A 1BWWA 3NFSH 3NJFA 32C2B 5LGKA 1IX2A 3CDFA 3VH8B 5I18H 3QPXH 4PJEA 1HILA 4ZFGL 4JR9H 1J5DA 5TK4A 1RPUA 5DZOA 5AZEH 1XGYL 4HFUL 1UHVA 4CDGC 2XKUA 3L7EB 4LVOB 3VXRE 3C5ZC 1BOYA 3GZPA 4NZFA 5IB3B 5TK2A 4YEFA 3MXVH 1UCBL 2WVVA 4MJIA 5EWIH 5LG1A 5C9JB 1BZEA 4PJEE 3RJQB 2C4XA 2GFBB 4NP4L 3QZNA 1NBZB 3D33A 1HQ4A 2XBTA 2EE3A 3O81A 2IV9A 4ICWA 2VYRE 4X5PA 4OBSA 5EOQL 1FRGL 5DJZA 1XAUA 3JQOB 4U6HA 5B39A 5C7ZA 1M9WA 1H5BC 2DH2A 4A67A 4X98A 1P9MC 3HPLA 1NCHA 3UGEA 3BPLC 4GRWB 1EX0A 1ESOA 2WZ5A 4YHIB 3NA9L 1PL3A 2VDOB 5MI0C 3DO7A 4JGNA 2PCXA 3VSVA 3I6SA 3OMZA 4BFRA 3LQAL 4H5SA 4YH6A 1HILB 3DYOA 4OCRL 2GTZB 3C6SB 4E42B 5L2JB 3KNBB 4ZS7L 1UM4H 5C07A 4FQ2L 3L48A 3BVNA 4I2XB 3I74A 4TSAH 5E2TH 1UWXK 1G7QB 3D34A 3H9SA 1KTBA 3KJ6H 4QTIH 4X42A 1CT8B 2CDFB 5KS9E 2R2CA 5SWZE 3PPSA 4FFTA 4W9EC 2LFGA 3BXNB 2E46A 4CNIA 3OPUA 1DVFA 1U8CA 3GM0A 4HIPA 3WMPA 3B7TA 2N59A 1PKQB 1QX1A 4RA3A 1FLRH 1VKXA 4MNGA 4JM2F 3GRWH 3NIGE 1SJMA 4HXAL 4YX2L 5EO9A 5LGYA 1QUNB 5CD3A 1G9ML 1E8YA 5CGTA 3WLWD 4AIEA 3STZA 4R26L 3NQIA 3ROOB 4B97A 4NNXA 5I1HL 4QYOB 2LR4A 1BVZA 1OK0A 3N1PC 2VLKA 5HI3C 1Y0LA 3A24A 2KBGA 4PJDB 3ZRFC 4LASL 4XPAL 4K7PY 2VXVL 4Z7UE 3T08A 1IBZA 4IGBD 2XPGA 3LXAA 3BESR 2FX7L 3ULVH 4Q4EA 2MCPL 2DWDB 2P47B 4OIAA 3TIDA 3GT6A 4X5WA 5LBVA 3UAJA 4F37K 2R2HB 1MIEL 4FTVD 4WO4D 2IANB 1EBAA 3GSWA 4Q9BA 2B1HH 4QJ5B 2A4ZA 3KPQA 4R8WL 4WY7H 2DMHA 2Y7MA 3AROA 3KWWA 1O5PA 5FYLE 4HS8L 1FFRA 1QQDB 5D7LD 5AENA 2EUXA 1MRCH 2QSCH 4K7PX 4TNWK 2H3KA 4OLWH 2P9RA 2XKNB 4H8WC 3LS4L 5E08L 4DP9X 3QSKB 4G6AC 2FT6A 2MOGA 3FOLB 1E8XA 3AUVA 4QYOA 3ZHLA 4E42A 4FLSA 5GGVH 4LFHD 4GW1A 1KJMA 4JCLA 1C12A 1C8QA 1QUNA 4FKEA 1CURA 4YHIA 4GSRA 3CQFA 1GJWA 5E9AA 5FK9B 2V7HA 3TZVD 3JZ7A 4K3DH 5IIEA 3VGAB 3NSFA 1BQSA 1DVFB 4PP2B 1UCBH 3LKPB 4U6YB 3LD8B 4U1HB 5EWIL 4P2OD 3UYRH 1EJFA 3JWNH 1KBGL 1LGVA 1TVBA 2OSYA 3DV4A 3B8YA 5E6UB 2DD8L 2FWLB 1DLHA 1KCBA 3KPLA 3A4DA 1L6PA 3QO0B 5T1LD 5D1XE 3T3PE 1E5CA 4ANVA 1W2KT 4YDKL 1E5UI 2LLGA 4GBXD 4JANB 1GYUA 1XX9C 3FUDA 2CHZA 3RVXC 5JLZA 1AZCA 1QBLH 3NAAH 3L1OL 4L1LA 3WFZA 2YQGA 5H4YA 5GS0L 5F9WB 5F7AA 1MIMH 1CLOL 3W2DH 2O6FA 4WHCA 4BZ2A 3KL5A 5DUBB 4EI5B 2IWEA 3FFOA 1G7JA 4EN3D 4XP9L 5TF0A 1TVHA 4LLQA 1DLHB 4OLVH 1S7TA 3UIZA 3EDJA 3T0AA 3PABA 4M62H 5IFJA 2HXAA 3KJ6L 4TKWA 3V7MA 2VDQB 2P80D 4HIEA 4JO5A 3BSZL 3LKPA 1G9NL 3QPXL 4U6YA 4ZFGH 3U0PA 1JG9A 5ENWA 2WWKT 4PJ7F 2WVVB 4DAGH 4HJSA 4DP6X 2GSIA 1MRFL 2M8XA 1SM3H 4NPJA 1LEIB 5GGQH 1YEJH 3H42L 1SQ2N 1YY8A 4LQFH 2UWEB 4HUXB 5MI0B 3WS6A 4QHMB 1G0XA 1OF2A 3TZVC 4HXAH 3VXSD 4KJYB 1MCNA 3WXWL 4P04A 3HBZA 3QQNA 5CEZE 4ZXBC 5DXWA 3MLSH 1FIEA 3P30H 1WRFA 4EKXA 1T20A 3OHXC 3SYAA 3UTOA 3VFRB 4KX8A 4JREC 3RDJA 4X5LA 5HD8C 3D25B 5B8CB 3UADA 1CLZH 3F7YB 1MCEA 4MA8L 5BS0B 4NQDA 1QQDA 4LF3A 2O30A 1E4HA 2O72A 4IRJD 3QEQA 3EAKA 1VEMA 3MLRL 2R2HA 4LNVA 3ASOB 2JNZA 1FC1A 1F4AA 3G6AA 4NQCD 4OTXL 3G5ZA 5IMKA 1U2CA 3B37A 25C8H 4J3OF 1BAFL 4M8VA 3S3BB 3MRQB 5F0LB 5FR3A 4M5SA 3VFVA 4DEWA 3HUJF 3EJCA 1MCOL 5ERWB 1UWEH 1LEGB 1WPCA 4KGJA 4XO4A 1GMIA 2VZOA 2CJ3A 1WAAA 4XNQA 4AXWA 5CBEA 2Q8AH 3WKML 5J7CC 4W4OC 5I1EH 1UATA 4J12A 4GIOA 4PLJC 3K0WA 4K3HA 4JPWL 4Y4HB 2QQLL 3FO9B 2GJ6A 2O6PA 3DMMA 1S5IH 4ELMA 2P42B 3ZDYB 4F5CE 3BQUB 4FXLA 4KROD 1G9EA 3P4LA 1JIBA 2GJRA 4MRBA 4GXVL 3O0RH 1R34A 4JFEA 3NACL 3ECVA 4M6MH 3K46A 4KKLC 3MBEC 5SX4H 3H9SD 5AVRB 1KSRA 2J8UF 4IEFA 3Q1SH 3MA7A 3MJWA 2AC0A 3IRCA 5IVOA 4JN2B 4QHNA 2OQJA 4X6CE 3FFDB 4X4ZA 2YAHA 2XPZA 3OXRB 1P84J 4PJAF 4D3CH 3V4VH 1R5IA 4EUPB 1P0SE 1JOIA 2ZSVA 4MNQA 5HJGA 5F21B 2OP4L 2TAAA 3MV9B 4G72B 1C1EH 4QRPD 4PG9B 3U7YL 3ZQ9A 1GH7A 3LSOB 3L1OH 4KJQC 4KK8D 3FN0H 4HIIA 2ZSWB 3SPIA 1VB9A 3N6YA 4Z9KB 4YHOH 3MRIA 3ROLA 4HIHA 4JGMA 4XOBA 1NFAA 2OTWB 1JNNL 4FJ6A 3L95A 3UJIL 1CDHA 2EXWD 3MV11 1JPGA 4WZ9A 1Q9WB 2F7PA 5BZWB 4FFZA 4GG6A 3RZCD 2GI0A 1LVEA 1Q94B 1UZGA 2J2ZA 4LGPB 5F9JB 3GEFA 5J13C 3WJMB 5I23A 2YAFA 2E3VA 3C8KB 4S1RH 2VXTH 3G6JE 4DESA 3FTUA 3ZUCA 4B41A 4PJDF 3VFGH 2WP3O 4L3CB 1CTOA 2Y36H 3WN6A 3UBXB 2ITFA 3TFBA 4Q9RH 5F1SA 4OJYA 1OT4A 3HC4L 1XH1A 5BZZA 2NNRA 4AUJA 1Z9LA 4WW1B 5DVKA 2WWOA 3NCXA 4MNQE 2XVLA 3QUYB 5TFSH 2ESVB 3QO1A 4DN3H 1OAYH 4LPTA 3IFLH 1G7LB 2FJHA 3H3BC 1UQSB 2B39A 4H8WH 1IGFH 4KQ3H 2BOBA 4UMSA 1RJLB 1S5HB 2DIBA 2N3JA 4HPYL 3R8QA 4ZX4A 2OI9C 2NCEA 1A1OA 1MRDH 3LRSA 1D5MB 5EEWA 1HXKA 1BPVA 3C8DA 3OKEB 4ZXBB 4N8VA 3WUZA 3TC9A 3SBQA 4L3EB 3VFWB 1AFVL 4K94C 2XZZA 4LCWB 4QIRA 1T7XA 4YDJB 3HRZC 5LKNA 1J0ZA 3VYNA 3KYMA 3ZTJG 4CN6A 2AMGA 1CLOH 2XNAB 4RAVA 25C8L 2UUDH 4LAQL 2R0ZH 4Y16A 1MLBB 4X4XB 1I7RA 1FFQA 3QXDB 1I7TA 3IFPA 2QGCA 5DFVC 1A65A 1W0VA 1BFOB 1I85A 3B56A 4OZHE 1NCWH 2IALA 1S78D 3CZSA 1CFMA 4U6XB 3GSVA 3QIUB 3RY6C 2YGNA 4GRWF 5HPMB 1UWEL 3L16A 4BKLB 2ZCKH 3CFBA 4NO0B 2G5UA 1NA8A 3ZRCC 2DM7A 1TTUA 2XWXA 4LCWA 2W38A 2YXVA 3D87B 2VLKD 2CM6A 4N24A 3GBNH 3NJLA 4JO3L 3U4BL 3UAFA 6TAAA 1IJ9A 4YUEL 4AJ0A 5KSAC 4N2LA 4FABL 1CIUA 2QMJA 5SWZA 3D3VA 3HZYA 5F9WC 1JTPA 4ETYA 5L9DH 1L9OA 1ROCA 4F2EA 5HYJA 5FLUA 2GTWA 2E9JA 1USZA 2PWEA 3VXUA 5HGDA 4DEUA 1G7LA 1S9KC 5D1QB 5LDUA 4L2YA 3R18A 4G1MB 1BOGA 2OA9A 1TQTA 4PP1C 5J6SA 3Q3GB 4HAKA 5F8QC 2ZG2A 4FA8A 1OGSA 3T4AC 1IU1A 3KM2A 2IDTA 5A3ID 4D9RE 4WJKB 1RPQA 2CO4A 1XF1A 3VD9A 2YD4A 4ONFL 1EFXB 2KI6A 1QRND 3BEWB 5DJDB 1PY4A 3ECQA 4ZUSA 2FZ3B 1CDIA 3EOTH 2BFGA 5IW1B 5MHSE 3ZHKA 3NYKA 2VN5A 4ETQA 3CN1A 3PWUB 4XN5A 5J3HC 3RFZA 1MWAA 2ZICA 1W9XA 3K2KA 2FBJH 2OM5A 3GNMH 1XGUA 5HI5C 1YHPA 4MB1A 5DEJA 2K4AA 2ZIDA 5FA3B 2YWZA 2IXQB 5ANME 4FYSA 5ESAA 4P5TD 3EYSL 1RH8A 3MLVL 4TQPA 4UV4L 1HYSC 3D4YA 2X9ZA 4R4ND 3O2WL 1EO7A 1XCWA 4LLVB 3LKOA 5DFVD 1J86A 4XX1G 2IXQA 4HUUA 3V5DB 2P4AB 1C8PA 3L7FB 3QZWG 4A2DA 1OAQL 4PRNB 3DIFA 5DHYB 2BRRH 4X9FA 1T1XA 4ETQB 2W9EH 4W93A 3QWRA 2Z92B 4OKDA 3G3LA 3IDJA 1T1ZB 4OSUL 4EUPA 3DO3A 4N0FA 5DUJA 1T89C 4ZAKB 4QDGA 2OLDA 4PR5A 2OAAA 4QTIL 1G9HA 4OV5B 3I02B 1Q4NX 2J1KA 2FEDC 3SGJC 1CFSA 3GMMB 2FJSA 1OW0C 3PDDA 3O2VL 2Q8BH 3HC4H 1EBPA 1VZIA 3HPJA 4P3CL 3PWNB 3FQWB 3FSAA 4HIJA 5JW5A 4JFEB 3U83A 4YHYC 4LEXL 5TGBA 1OAZL 2EE9A 3LZFH 4IIQC 1S9XB 2WVUA 1U95B 5CJOH 3CH1B 4KMTL 3F7VB 3NJKA 2QKIB 4M7LL 4KXCA 4DK3A 4GAJH 4EMZA 3IYLW 2X1XR 1EZLA 2H1LM 1HEHC 3B8SA 3PLYA 4KKBD 4LHUA 4NUJA 4OLYH 4LVNC 5DI8B 4D9QE 2NSMA 5IVXA 2H4EA 2YPKA 5C08B 1YNLH 1JPFA 4E41E 3Q43A 3N1MC 3A6CH 4JY4B 4A7QA 1F6AB 4FP8H 3IN0A 4KHXH 2HVKA 2DLTA 3QJHA 3IFOA 2EH7H 2A77H 2X4UA 4NJ9L 5FWRA 4FFZL 5JPMA 1RZFH 2XQ0A 4MDJA 3P2TA 3C5ZB 1DBBH 3SGEI 4B9IA 1T5XA 2Z31A 5E00B 3MRRA 1ZHKA 3ARFA 2Y06H 5DFTA 1RU9L 4FXGB 4S1DC 1WA1X 4LCWE 4RMBA 2RJMA 3ARWA 3B2MA 1IBDA 2CK2A 4JVWA 2IQ9H 3Q2NA 4R83A 5F96H 1VAHA 4M56A 5C09A 3ZVVA 4Z7QE 4NHCL 3FT3B 3EOYG 5GJTH 1HINH 5LWYH 4UMGA 2V7NB 3UTPD 1GOFA 2VDNL 2YPLB 2VH5H 4AQAB 3ZO0A 5MEOB 4X80H 2DY2A 3C5ZA 1EXHA 4OGZA 3TEWA 1S8DB 2FEDD 3E2HC 4JDZA 1E65A 4X6BB 3FQNB 1H15B 3GUFA 4PGCB 4FL4B 4WW1A 3BT2H 5D2NB 1I7RB 1A14H 3PV6A 1NFIB 1DLFL 4NHUA 3IDMA 3G5XA 4E9YA 1JPFB 4EQ2A 4QHKI 4Z78A 3TP4A 2X4SA 5G5DA 2L7JA 3SDAD 4DSYA 5KYXB 1M4KA 1DTUA 1NCDL 2WQAA 1NFDA 2PCPB 4ONFH 4QRRE 3KCPA 2B5IB 5L2KE 2XG5B 4G7VL 3U82B 3MRLB 3CVDA 4HWEH 1UM6H 2F6AA 1UB5B 3FUNA 3S2CA 5A7BA 4JK0D 4BZ2H 3PNRB 4R4NC 4URKA 1J1XL 1AIZA 2W0KA 1NC4A 4IBUA 3BKJH 3TN0B 2B7DT 3T04D 3PWNA 4HIJB 5JW5B 5C08D 2ROXA 1TQWA 4NLHA 4OV5A 2PTUA 4PR5B 5C0AA 5BZDB 4IKKA 2GIMA 4XGZA 2HVJA 1R1CA 2E86A 5A3IC 3ULVE 5CILH 3BH8A 1R5VB 3QPQD 4WI5A 4PMEA 4PJ7E 1OTSD 4JVUA 5AOJA 2YA1A 2LAAA 2RQEA 2Q3AA 4MX7B 5HDOA 1EHAA 1NOLA 3L1GA 3FUMA 1PZDA 4HJUA 4AYBA 4LNRA 3IJHA 5GHWH 1MW2A 1XB3A 4P49A 4M7JL 4IEFB 1T6VN 4ZMQA 2XWJA 5GGVY 4J8RB 1BD2B 5HGHB 1TVBB 3R06A 4IRZL 4PM1A 4UAOB 2VLRA 4WDIA 1H6FA 3WUWB 1KJ2H 1V3LA 1N4XH 4BGLA 2FQFA 4HBCH 4RGMB 4ZW6A 1FV1B 1KXVC 5IF0B 3HE7A 3PYCA 3TNMB 4X99A 1C12B 3N3EA 4O02A 4WNQB 3FCSB 3MLSL 5DJDA 4F7MB 4F2ME 2AJ3B 5CBEB 1HL9A 4GKSB 4ONHB 3M17B 1WC7A 4PW3A 1TFPA 4A2MA 4G3YH 3W9EB 3GLDA 4OGYL 2IWFA 3MNWA 5BUPA 5AZUA 5CF3A 2AEPL 2ZD0A 4FNPA 3DHUA 4LSRH 3EOAA 3KGSA 3VFSA 4WFGD 1IGTA 2WLIA 1M7XA 1T0MA 4NJ9H 1NCBH 4ZX6A 3VXUB 5KVGL 3QUXC 4K7PL 4PJBE 4WWKC 2X28A 4PJIA 3V2AR 2OR8A 2Y5EA 1RZGA 5IMLB 3G04A 3GSUA 2NY0B 5DUML 1VIWA 1CGTA 3NK3A 5EMYA 5FPIA 5DJ8A 1EAJA 3RURA 1JBJA 1PLBA 2F1EA 3FKUS 3V4UH 2J1XA 4LCCB 4NHCH 4FFYL 2ZCHL 3P1VA 1EGJH 5C0FB 1K5WA 1FC2D 4MB4A 1P4BL 3QUKB 5ICZB 4KZEL 5D1XD 3DVIA 3N9GL 1IE5A 3BQUC 1CICC 1BMZA 2RCSH 1ERNA 1R3KA 3S4SG 1YUHA 3T2NH 5I6PA 4Z7QB 2BVPA 1WCBB 2R0LL 4PQXA 3DIDA 1RULL 3ROOA 2JKXA 2MPAL 1Y18A 2J8OA 3QIWC 2V0AA 4QHMA 4PCTA 3TVMB 3DX3A 3M8OH 4FXKA 4CSSA 1BZ7B 1XGYH 1INDL 1TYJA 4HFUH 4MJHA 2XTJD 3WAJA 1OTTC 1PG7X 3RPIB 2F53A 3QEQB 3MLYH 3O0RL 3FFCB 2YD2A 1CI5A 2QKSA 5E5LA 4U0RC 2NUTA 3S3SA 2EXTA 4W9IC 4CNIB 5DJ0B 2BHYA 2EIJB 2PUQT 3KYNA 3P4MA 3EYQC 4IOFC 4J4PC 4LLUB 5IVNA 5AVWB 2R2EB 2B15A 4YHKL 3FQRB 4WI6A 5EFIA 1MVUB 1EK3A 3E38A 4OU3A 5ADPL 2BM3A 5FAAA 5FYLD 1AMXA 1A3QA 4LU5L 4F8TA 2WZPD 4FLHA 4MA8H 4H4NA 5IMOB 1H3VA 2G0LA 3QCVH 3Q7JA 2P43B 4PJFA 4G7QB 2D3VA 1NBVH 3EJSA 5C0BE 1R47A 1ZAGA 1AC6A 1NCAH 4M8UA 4NM4L 4WFGE 2G3ZA 2CNYA 1TZHA 4NZTL 1Z66A 5BOPA 1F4HA 4K5OA 2EDTA 2QGDA 3MOQA 3UAEA 1MJUL 1M2OA 1QSZA 2RMNA 2CSPA 3D05A 3PABB 3TH3T 4ZMNA 4XP1H 4WENB 5C0EA 1NUFA 3IGFA 1NGXA 4Z7IA 5DZPA 4JPSA 5F7DB 3P73A 4M1CC 3W11C 1MHHB 2QQNL 1JCVA 5I0XA 1ZVYA 4NT6B 2BVTA 2ZWYA 5GZOA 4WIQA 3P9MA 1AMYA 2RTTA 4GS7B 2BY0A 4WK0B 3T4YA 4YQXH 1ZIBA 3HMXA 5I6OA 1SY6L 3FOLA 1MN4A 4NEHB 4EI5C 2CLRB 4DN4H 1ZE3C 5H4ZA 1T1YA 2DKMA 2ZPKL 5HYIA 3HMWH 5B4MC 2FDBP 2BOCB 5IEKA 3PQYD 3OR7B 4LASH 4PWKA 1A8ZA 4N0YL 4J6IA 2IPTH 3Q9QA 4RSYA 3B3BA 3MV8B 4HFWB 4RSVA 5DLML 4ELMB 2HZHA 2F54D 2IAMA 1IFRA 1TTFA 4IQHA 3RGVA 4FX5A 4JPVL 1OTUC 2VQ1B 1IAOA 3B7YA 1KB5H 3GS4A 1XMWA 4DW2L 3I50L 3RZCB 1P7QD 2F5AH 4TSAL 3O8XD 3OJVC 4F92B 4AQZA 1SUHA 3ULAB 1XT5A 3GI9H 3VGAC 2ENSA 2HFTA 3I6LD 1MY7A 4GT0A 4P2AA 4IRZA 5LVEA 5AW4B 3V9EA 1JVLA 3BGMB 4MCZA 4TLSA 2GQHA 1UC6A 4PY8I 4NNXB 5T5FL 3EOBB 1KC5H 3ZZLA 1J1OL 2WCSA 4BQ6A 1XCQB 4FABH 2K6ZA 1ZCRA 3QW9A 2YAQA 2X1WL 2HRHA 4GXUM 4HBCL 4U6VL 2IV8A 1ZA3B 3MV9D 3G6AB 4XMKH 3WCYA 4OZGF 1INEL 3WIIL 2W0PA 1JXJA 2GCYA 1GGBH 4D8OA 1GS6X 2AV7B 2F5BH 3ULSA 1N18A 1XEDA 4XVUC 1JZ6A 4TS6A 2N7AA 3CFIC 4PHZA 3ME0B 4I3GA 3H9SB 1YEEH 5F3HA 3TWCH 3QRFM 3OAZK 5HHMB 3W9EA 4KKAC 2V6HA 1T22A 4B5EA 2DQHL 2DM2A 1IIKA 1IKNC 4LT7A 5CEYB 1J9SA 1NGWB 4J8QA 5D4QA 3EFDL 3QEQE 3RWFA 3FYIB 1U58A 1MREL 4NO2B 4HPOH 4OGAC 3Q6GL 5DEGA 1ZWIA 3SODB 1B4JH 4FFYA 4G71B 1PY9A 2ED8A 5D6DA 1FVEA 4FQ1L 1D9KD 1UXLA 2B0SH 3OSVA 4HIEB 1ZS2A 4R7NA 2HLAA 1H0DA 5LXGL 1AHWB 3HA0A 5AOLA 3WO3B 1L3WA 4KU1A 4JDTH 4JFDB 3EJYC 1UCTA 3GS7A 3HB3B 4OQTH 3WTTA 1P2CB 3AB0C 4K07A 4XCFL 2YS4A 4U3SA 1BFVL 2VXUL 5C0BB 5I5JA 4I4WB 2Z0BA 4PG2C 3HLAA 2Y2TA 4AQOA 1TU2B 1N64H 4JDVB 4J3WA 2DJSA 2R1XB 2ZNWA 4WHTA 3RVVD 2DM3A 4FA6A 3G6JF 4UQEA 1GR7A 5D1ZA 3X13A 3EGDA 3UJJL 2P45B 2A1WL 2DBJA 2H6PA 2X0WA 3AG1B 2VKXA 3FTXA 4L1SA 4DTGL 2OCCB 3E0GA 5DC4B 1ZGLM 1GY1A 5KW9H 1B2WL 3WTXA 3SYOA 3KLHD 4Z0BH 5EUKA 3CFCL 3FS9A 4XN8A 3U46B 1VGEH 2P46B 1QBLL 3FHEA 1R4XA 5E9DD 5J6HB 4APXA 3EO0A 5F1IB 1FPTH 2ZWSA 4PJFE 3VDCA 1T3FA 5BXFA 2EYTB 1UZ8B 4YBLB 5BZXA 1CWVA 2EH7L 3DX6B 4GW1B 4JPVH 4UQ3B 1OT1A 1GMEA 5E03A 3KPRD 2R69L 2X4OA 3VH8A 2YXFA 4E9XA 3BD4A 4U4BA 4UOJA 5C0IB 5D93C 4Y4FB 3VXOA 4OLZL 3ZL2A 2EKSB 3QQDA 3VE0B 5LGJA 5DQDH 4P4RA 4R7XA 3SYPA 3P77B 4CVZA 2I7SA 3VFUA 4J3OG 4PS4L 2NW2B 4DKEH 3T3PF 1FI8C 2YFOA 1K85A 3BGAA 5CINL 1PW3A 4U4IA 2V7NA 1HNFA 5CLXA 1QEWB 3CDYA 1SYSB 3BCDA 4KKPA 5B1AB 4XMUA 3U0TA 3V4LA 4KJQD 2E8ZA 2AITA 1G7IB 5IJCC 1OZUA 3C87A 2AJSH 5FB8A 4ZDHA 2FIKB 2AZUA 1WGOA 3FB7B 3BE1H 5IBLC 3VFSB 4DN4L 2C9RA 4PJ8D 1CDGA 3ES6A 3RWCA 1F6FB 4X7FC 1F6AA 4NQDD 3IVKA 1A2YB 1D9KB 4LSTH 3CDZA 1R24B 2Z1PA 2JB5L 4Y1AD 1BQKA 3LRKA 3MREA 4I48B 4LCVA 4LHUB 4TLUA 5TDOA 3KMDA 2I60L 3FSVA 1GIGL 4MD5A 1HK6A 3GIZH 3GRGA 2LHAA 1E27A 3IGLA 3L5XL 2DJUA 1UG9A 4E9RA 4P2OC 4IRSB 3QUZB 4PFEA 1LQBC 4L1HA 3D07A 3TNNB 2VLKE 5K9JH 4OLYL 4X9IA 4L0YA 4ISVA 1X5HA 1L9MA 2X89D 4FNQA 4XMZA 5LCVA 4R0LC 3RGVD 4OM0L 2DJ4A 4RMQA 1ADWA 2PYEA 1BQLL 1PZ5A 2Q8AL 3TV8A 2XFXB 3KGTA 4ZJ9A 4MX7A 5AWNH 2F8VA 5IWLA 1CO1A 1FBIL 1DBBL 4CRPA 3IDJB 1LDPL 1T2JA 1IAIH 5IF0A 2VXUH 1BLNA 4O02H 2A73A 3T0EB 3WS3A 4KV5E 3AREC 2BY2A 1IEAA 1QHQA 3MYJB 4X8GA 3WUWA 4FTVE 3CHXA 4LESA 5JXEC 1YMHA 4RMSA 1HCVA 3HE6B 1EO5A 4G8FB 4RFEB 1Z3RA 1AI1H 1DUYB 2WMPB 3KZ8A 4X80L 4J8RA 2JMRA 5CP7B 1OPGH 2BSSB 4B9ZA 1MW0A 4IU2A 2NY4C 3MRCA 4HLZH 4WI9A 2QQKL 1B2WH 5TDNB 1JNJA 3L4ZA 1MCSA 1ML0A 2DKUA 1DLFH 1X5FA 3SGEH 2C26A 3V55A 2MCAA 3DWTA 4ODWB 4R0LB 1R0AH 5E2VL 1DSFH 2VAAA 1HCFX 4RGOL 4XGZB 3IJ9A 4Z78B 3HZVA 4GBXA 2XTJB 3LNDA 2XU9A 2VLLA 4OGXL 4HGMA 3ZN6A 1AGCB 3B2VL 5D2NA 4WK2B 2HKFL 3KLKA 3DX7B 3QI9B 4CU7A 3OM3B 2EABA 4D0DA 2QFPA 4QO1A 3VGFA 5DUMH 2ZXQA 3SY0A 3RP1A 1NGZA 4UU9B 1Q1PA 2JK5B 4OQTL 1I8AA 4Y9BA 4U3XA 1RJCA 5SWZB 1QSFA 1ZGLB 2VZSA 3ARFD 3D48R 4KTEH 3KWUA 3MLXL 3NA9H 2C9QA 1WZMA 5JHBA 2VDQH 3LYRA 2XWZA 2UZYA 1KCSL 3F7KA 2RHEA 3N5AA 1T7VA 1AZBA 2D31A 1X44A 1M3IA 4M48H 1UJ3B 1DQJB 2IALB 4UTAL 2CMRL 1FN4B 3OXSB 2F9BT 3EJUA 4FQ2H 1OD9A 1H15A 1QKZH 2ZXCA 2M83A 4G6FD 4NJAL 4K5NA 2IH3B 2VW6A 3WHXA 2QGBA 4KX9A 2YPKB 2Q86A 4TUOA 4HUCA 5IVXB 2WBJB 3KXFB 5B22A 1DYZA 1QUPA 5FO9B 4KXBA 2D4FA 5I15L 4TQEH 3EYUL 1UA3A 4AYFB 4CW1A 3F7VA 3CH1A 2MHAB 1KNOB 1FPTL 4F7TB 1IC5L 1S7XA 2WNXA 2YK1H 3LRSB 1AQMA 1EEZB 1CG9A 5E5MB 3VO0A 2YLKA 2ZKMX 4HKJA 1AJ7L 1ZV2A 1NCCH 2XIIA 4CMMA 4PIBA 1TLKA 2EE0A 3IFOB 5E95B 1AIFB 4HT1H 2DQEH 2PXYC 5CGYC 4JHUA 3D2UA 1YZZA 4JFVA 2Y07H 4ZI8A 1ZHBA 3MUJA 3WY3A 4Q6YA 2VDPL 2FT8A 4NCC1 3SJVB 2BP0B 2WSKA 4OZGE 1CR9L 5BOZG 4ZUWB 1BQ5A 1X9RA 2EDKA 2IAMD 3KWVA 1WTLA 3MOBL 2I07A 2CXGA 3LQZB 1EHKB 1ZLEA 3T8VA 1FO0B 1D7DA 4XN2A 3UX9B 1EGJL 2YHGA 1UWXH 2NY2D 3C09B 3NCYP 4LLVA 4KXDA 5B7EA 1DFXA 4EF3A 5D72H 4YSAA 3HE6A 4G8FA 5A1AA 4S1QL 5LQBH 3N1GC 4L8CA 1TPXB 4Y5XC 5ESAB 3N43F 3QEGH 4LLYA 1A6ZA 4IIQA 4E0RB 3KPNA 1U8HA 4M1GH 1S7RA 5E1GA 3GLZA 5FKAB 4KXZH 2CBTA 4S11A 5CXPA 2W95A 3T3PB 3W38A 1YMME 3LY6A 5KVDE 4NI6A 3REWB 1HAWA 3PL6D 4WUUD 1A1NA 2HPTA 2OTUA 3CPUA 3DVNA 3U25A 2Y2WA 2F15A 5HY9A 1RHHA 5HYFA 2DLGA 4A7SA 2EACA 3TFKD 2A77L 5LN4A 1FAIL 4FC3E 2VERA 1XF5B 2XWTA 2DI8A 3R8BB 3GSXB 3DX2A 4L4TB 4NZUL 4KVNH 3WLBB 2OJ1A 5J8OA 4G7SB 3QWQB 1JVKA 3ULUF 3WNNA 1D3CA 4PJ7A 3HI5H 1CJYA 1HOEA 2CIIB 3NJJA 4JFXB 4XBGB 1TPXC 4Y5XB 5EIIA 1J5CA 4LRNL 2IPKB 5F88A 1CFQB 1NMCB 2IEPA 2NNAA 2B2XL 3ZOAA 2PMZA 5C1MB 2UWEE 2X12A 1UWFA 3WHE0 2ZUXA 4MRCA 5AVYB 1A7NL 3GJEA 5DRZA 1W0WA 4FQXD 3A4AA 1LILA 5I71C 4YXLL 3SD5A 3FHAA 1FJ1A 1CPUA 1UT9A 4A66A 1Y6MR 4YPGA 2X05A 3QIBB 2CA4A 4O2EB 3VI3F 1VSCA 3HR6A 3WMSA 4GW4B 1HDMA 1U8JA 1IBYA 5KVFL 3SGJA 1ZT7A 2M1KA 2QVKA 1NLDH 2AV1B 3GMLB 4G7VH 3NEXA 4AKPA 2HA1A 1CF1A 4TVPE 4X8JA 4BKSC 4L37B 1A8JH 3L9YA 2J5LC 4CVZB 1SXZA 1IZKA 2VO5A 7CGTA 5DZ9A 1NCCL 1Z32X 2W07A 3GXDA 1MI5A 5I30H 2PXYB 2H32B 4MCYA 1YMMD 2EYSA 4UTCA 5LBSL 3AREB 15C8L 3I84A 4TTGA 2XZAH 1O6VA 3CPLA 3CU1A 3QIWB 2BNQB 3RVUC 3OKDB 1MF2L 3TVMC 4AC4A 3OJDA 4M6AA 3RB7A 1YSOA 3MRJB 4MBRA 4DGWC 4BK5A 5LWYL 2P5WD 2VRAA 4X7TB 4TXVB 2FAUA 2MTAA 2QQQA 4BSWB 5J11C 5AAPA 3C12A 4FYRA 2F8OA 4CJ0A 5A2JH 4P0DA 1X5LA 5I66A 4BUQA 2Z31C 3ZUNC 4WI4A 4GUQA 4UTAH 4AYEC 1DN2A 1M7DA 4LLWA 4OZGB 1TVHB 3L5IA 4PGZA 3LHPH 4AEIL 4N1EA 1AXIB 4E9WA 1G7PB 3GI9L 3T0XA 1DQLH 3I85A 3KG5A 2AEOA 1ZEAH 5JA9A 1I1FA 4DUVA 1EMTH 5DYOB 3ARGC 3U0WH 5T5FH 2ZUUA 4W4NA 5I1EL 4O4YH 2GI7A 3RIFK 4F3FB 2QSTA 3HN8A 1D5BB 4HWEL 4I1PA 3VB9A 1F45A 1GYAA 2CKBH 5TPWL 3CMOH 1NEUA 3M45A 5K69A 2BS71 4BM7A 1MZZA 5KSVA 4N25A 1SJHB 3X12B 5FYJH 2AGJH 4CADB 5DGRA 1UD6A 4ZOAA 1MJJB 2HLAB 3KLLA 3HN5A 4D0BA 3NJVA 5D9SA 2AJVH 3ROLB 4PRHA 4HJEA 1ZPUA 2FNBA 2VDPH 3JTSB 2NY2C 3NEOA 4APQD 4AW4A 5DS2A 4K71B 4CAGA 4AUYA 1ND0A 3BUQA 5J1AB 2B4CC 2B77A 3ZTNH 3BCFA 1MJ8L 3RU8L 3OG4B 4IK7A 2MQCA 3KCWA 4LCCC 5D70L 3PWJB 4ZO8A 3JV5A 1GS8A 2ADYA 1P4BH 4Y5VB 1O5DT 1LWHA 4WEEA 5A6MA 2PCYA 4F9PC 4ZS6D 4IJ3B 3Q8AA 4I0PD 2RGSA 2FECL 4WGVB 2OR7A 4XVSH 2AJUL 4F7EA 4C59B 2Y5TB 3K4ZA 2UX6A 4XHJC 2ZXGA 1AQDA 4DHLA 1ZIAA 3RA7L 4ODBD 5I2IA 5C8JB 3LVTA 5LGHL 3ZDWA 2W0FA 4P2CG 3V4VB 1K5NA 4EUPH 4Q58C 1XCQA 3AADB 4EPSA 3PWPB 4IS6B 2CDGA 4UDUB 5B1BB 1XR9B 3D25A 4RGMC 4AIZA 1U8PB 4NLAA 3U1QA 5KG9B 1IC4H 4IMLB 1HHHB 2VM3A 2NX5E 1AP2A 3L4YA 1SHMA 4XAWL 4FCAA 3LRHA 2XXCB 1EAQA 2DMBA 4L1TA 4LZKA 3AFLA 3IFLL 1UEYA 2FX7H 4PW9A 1ZLSL 2LT9A 3QQ9C 1H8OA 3ULVL 1IAOB 2BSRA 5A2IH 4XC3L 1FHNA 2YD3A 4OZHB 1MCPL 1MIEH 3DX0A 1QWNA 3E8UL 5C86A 3D3VE 1L0XA 4G8GE 3PFQA 1EO8L 2WXNA 1UD2A 1J9QA 4DKDC 3AG2B 3PCYA 4PREB 4Y8DC 3VI3A 3FF8A 1MRCL 2ENJA 4WO4C 5FGBA 1K4CB 4NKQB 3BHBB 2W60B 5CP3H 3AWEA 4JFFE 5GRVK 4AH2A 1YVLA 4LAQH 5E1AA 4XN4A 3D6GA 5JMRA 1JPST 2OL3H 2CLRA 4XP1L 1FBIH 5C7XH 2EVFA 1T0NB 5HGAA 3AM8A 5DUBA 1CBVL 4OF0A 1G7PA 4YHML 4M9OA 1PKOA 3ETBJ 1LDSA 4HVBA 3ULUC 4LPUA 4PD4K 3SDXB 4ZUVB 5DSCB 2QTVA 3DGGA 4NFDA 4HGWB 4LLDA 5IJDC 1OOWA 1A0QL 5E94A 2NT0A 1M7IB 1U92B 4GINA 1JUFA 3WGVB 2G75B 1OAUL 3VYOA 2CLZB 3KPSE 3UYRL 1QR1A 1NBYA 1GHFH 3SE8L 3QCTL 4P2QB 4C8XA 2ZUSA 1JHTA 4GIPD 5E2WH 2IGFL 3VG9B 4GO6B 1FZMA 1WO2A 4ZYKB 4KKCC 4C56A 1UH3A 3IDUA 3KM1A 2OXGB 3MROA 4O5LL 5AFAA 1FG2A 4LVNB 3J8F7 1CDJA 1ED3B 1IC0A 1GPOL 2IIJA 3ELQA 3MUY1 2G3MA 2Y1AA 2F54A 1I8LC 2QKIC 3CHRA 1HWWA 4UBDD 5I24A 5D93B 5C09E 4AYGA 2H32A 5FKPB 1FFNA 4QLWA 4G1EA 3ZE1E 1BZ9B 1D6VL 2H9GA 2CGRH 2MKLC 3QNZB 2R56H 1V7ML 1TYRA 4F7PA 3N41B 3MUGB 4F58L 2HKFH 3JTTB 3ARTA 2NTFB 3O4LA 4U1JA 5CS7A 1X5GA 2VM9A 1MJUH 4OCLC 1MCBA 3II3A 3LQAC 1FGNL 2W88A 5EFIB 4FAAB 3RNKA 4UDTB 5I1IL 1TJHL 2YC1B 2ZYSA 3O2WH 4FTVA 3CVIL 2GSGB 3D9AH 2C3VA 4WEBH 2CCVA 2ZG3A 1KCUH 2A7BA 4LBEA 1JZFA 3WIHH 4NN7B 4A39A 5AAWA 1DFBH 4LOFA 3QJUB 3KPMB 5LNDA 3ZZ1A 2EVGA 2VL5A 4HX1B 1SFHA 4BQBA 4AWJC 2ROYA 2NR6C 4GUPA 3RILA 2DICA 3FBQA 4PJ9B 3DPBB 3BISA 5BCAA 1E8WA 1QTPA 3CLFH 5F7HA 5E6IA 5C0CE 4KRPC 5I74C 5C08E 5IMMA 3B5HA 2FQDA 2EZ0D 5D8JH 3M6DA 2JXMA 1AXSB 5F6HI 3T77B 1PX3A 4AGLA 3EFOB 1IKFL 4A6YB 4XX1E 3W0WE 2GT9B 2PNDA 4X9BA 4D8PA 3ATBA 1UH2A 2NZIA 3O6FD 2BRQA 2GVYA 3BLKA 2E6JA 2D7OA 1O7VA 4N2NA 1U6AH 1B4JL 4P46C 3T4AB 3PHAA 3RNQA 43C9A 3MZTA 3UTTE 3MRGB 3HFFA 3PHOB 2YMXL 1JNNH 3BUIA 4L4VD 3Q05A 1ZT4B 4TNEA 3FO2A 4G80B 1HZHH 3OC5A 5LNEA 5EHFA 5BJTB 3MR9A 3KPNB 4OD2A 1AO7A 2D2OA 1OQXA 1XSJA 4U6VH 4KC3B 4JPIA 4WSKA 2J6WA 1BFVH 3DARA 1TSRA 1GSKA 4P46B 3FOMB 1HCYA 2C9AA 3GMPB 3MPCA 1NLBL 1GGBL 1JTOA 1NMAH 3DHMA 3MRBA 4U1MA 4G6KL 2ZWLT 5GJTL 3GXUB 2IWKA 1W16A 3OD3A 4HMDA 2FHFA 3IGKA 4WKZB 2VH5L 1I31A 3R06B 1T7ZA 3ARZA 1YYML 4FQHA 2X87A 4M1GL 1E5ZA 2XFGB 3IXTA 3Q8CA 3UBGA 1G0YR 3CNKA 4S0TD 4D3CL 2CKBB 3L3IA 5DD0L 2H8PA 3FU8A 4JR9L 5E8PB 1Z1WA 1C1EL 4HPOL 4IHOA 2CIKA 1PZUB 3FU3A 4BCYA 3WS6C 2G60H 2JCWA 3IF1A 1NEZB 4QKXB 4TQ8A 2DW5A 3ZXAC 3IXAB 1MAMH 5B7FA 3ULUD 3UC2A 1KN4H 1M71A 3BDYL 5TDOB 3QZWB 1RK7A 4W9JC 4X5XA 2MHAA 3ARXA 3K6OA 3NPSB 3ISRA 3VMPA 5ID1A 2VCOA 1KT2A 1TTAA 1TQBC 4W6WB 3X11A 1QO3B 4GPVA 4S1SH 3UTZB 1VRSA 4P4KD 2ZCKL 4YHMH 3CSFA 1QI5A 2Q6WA 4YFLF 3CVIH 4ZFZA 1IVTA 3LB6D 3P3TA 4TN9A 2PCPA 5K39A 3TT3H 2F7QA 4GYBA 4U1KA 5ACMA 4DP2X 4GW5B 4AEHH 3AS3A 5CILL 4KKNA 4M6OL 1XIWB 1FFPB 1Z2KA 3I9GL 2DQFB 1AD0B 4BH8A 4HK0A 3RGHA 1CYGA 4UOZA 5IB1B 2IGFH 2HPOA 3NUKA 3JUYA 4M7JH 1KDIA 3FUIA 2ZZUT 3MACL 4LCYB 3QULB 4MAYB 1UEMA 3VG9C 1SXCA 3RHWF 3TO4A 3C6LA 5IG7A 3RBSA 1XF4B 4FG2A 3MLZH 4GRWE 4PJBB 3S2AA 1OKEA 3ARED 4BK8A 1Z9SA 4LVOC 5D7HA 2A4CA 2GBVA 4JFZL 4ZTOH 5HDBE 5K93A 1DANT 4TUKH 3LPFA 3WN5B 3VXME 2PXYD 1P6WA 3DVGA 2XYBA 5I1LA 1Y1DA 1MDAA 3IDXH 3UBFA 5D7LA 1ULVA 3A0OA 4R0LA 4BFEA 5L8JB 2MOQA 4A38A 12E8H 2FHBA 5IFHH 2EKJA 5DHVB 3PQYB 3SE9L 3RWJB 2ISDA 2AEWA 1J8HA 2WXPA 4GO9A 1NGYA 1AGDB 4Q9CA 3LPOA 3O8XC 5DD5L 1JGUL 2BP8B 3L2MA 2X70A 1HSBA 5J4MA 1G7HA 4PJ6A 5AOIA 2C9UA 3RVTC 3QJXA 5EUOA 5E70A 3BPCA 1F86A 3NIGB 4OZFG 2HKHL 1E50A 3HAEA 4DKFL 4F8QA 4X83A 3QA3B 2OW7A 4N4YB 2JCCB 3FQWA 4F2MA 1YJDL 2I5YH 5C2BL 3GSNL 5JXAH 1H3TA 1E43A 5GS3A 1O0VA 1YNKL 1FORL 3CUPA 3MRNA 5GGVL 1NAML 4HAGA 4WV1B 3W0WA 2R0LH 3H7BA 1MLCA 3QZOA 4JDEA 4JJ5A 3EFFB 4L5FE 5CJOL 3TBWB 1Q38A 4MMYB 3X1BA 5DA0B 3GNML 2EIEA 3GDBA 3CHOA 2C34A 1G9MC 3PJSB 4JQIL 4MVBD 5AUMB 5J1TC 2XG4A 4PJGB 3FQ2A 4PWFA 4B7IA 5CGMA 5MHSD 1MAML 4M7ZC 3T2QA 5KSUB 1C5BH 1NAKL 3UG4A 5L0QB 4TVPH 4UM9D 3ECUA 3ZJAA 5L4IA 2DWTA 2ZUQB 1VDGA 2JQZA 4GEIA 3RWDB 1AGDA 2FSDA 3GXMA 2R7EB 3G6JA 2R23A 5HGGS 3H9HB 5DMKB 3CDZB 3EH5B 1T80A 2ZUWA 3QJRB 1TETH 2VJ8A 2MJWA 5GGTA 3H7LA 2Z7UA 3G08A 5E6IB 1UH4A 4XVJH 3L5JA 5DK3A 1LDPH 3QDJD 4PJBF 2FSEA 4Y8AA 5C07E 1NC2B 1HHJB 3F5WB 4DP7X 3VM7A 1NLBH 5DEFA 1U33A 4YR6A 1MIML 4TVUA 4HETA 5SWZD 1JD9A 2AJUH 1PY0A 4P3CH 3TM6A 4G42A 1CL7I 4HG4K 3UTSD 4Z3EA 4GUOA 5IWLC 4JKPL 3UZEA 1KIQB 3CFEB 3SBWA 4R96B 3HG1E 1OPGL 4QY8A 4RMRA 4NQUA 5T5NF 4NJAH 3CLEH 3GYRA 1E4KC 1WEJH 2Y6SC 4LCYA 3LNFA 4X6CF 3Q2WA 4M29A 2FBRA 2UXFA 5F7UA 3V6ZB 1M1XB 5TTRA 1K8DA 3NJHA 3DI2B 3AM8C 4IM8A 3OAZH 4TQEL 2AJZB 1O75A 2EO9A 4WKXA 2A74A 1LL1A 3ESVF 2NTFA 4UIKL 2HG5B 3KPTA 2P8LA 4BSVB 1YNLL 2FO8A 4BWUA 2F58L 3P3UA 4G59C 3A6CL 4BZ2L 1WE5A 4ENEC 4UT6L 4X5QA 4TUKL 2XJLA 4UM8B 4WEUD 3L2LA 1J1XH 1MCLA 4M4RA 5ALBL 2WGXA 3FRPA 3CVBA 4PVNA 4JZNB 1IBGL 4B95C 4HXBL 5ICUA 4AENA 2VABA 3FTZA 1HE8A 43CAA 2R1YB 4H1LB 4YPJA 4PJCE 4RX4A 5C3LD 5HDBB 3DUSB 5DD1H 4CC4C 3ABGA 5FUZH 1PD6A 1LO4L 3WI9A 1IFGA 1A6WH 3BQVA 5C3TA 3QYNA 3DTXB 1QW9A 3I9GH 4XCEB 3QRGL 4IRJC 4OJEH 3BFQG 4RFOH 1AG6A 1RUAH 2YA2A 3ZE0F 1EVUA 3BAXA 4O51A 3P0YH 4WWID 5HYJE 2P7TA 4M02A 1W8NA 1FFOA 1P2CA 1QSVA 3CSTA 4MLIA 3MACH 5ANHA 1W0YT 5C2BH 2VDNB 4XVSL 1QNIA 2J5LB 3M88A 1KJ2L 3E2HB 3ML8A 3IKCB 3EYVA 4JFDA 2EC9U 1N70A 4FXGC 5BS0E 4M5ZL 5DR5H 3NOIA 5HVFB 3NZ8B 2YPLE 2W60A 4HJIA 2K45A 2FX8H 1RVFL 3ECBB 4ORGB 4EVNB 1MWAH 2KH2B 1O9ZA 3SE3A 4YSCA 4HKXA 4JPKL 3WJMA 4NM8H 1JPEA 4NZDA 1PNDA 2EXWC 4PWHA 2XXFA 1AR2A 1FRGH 3OL2A 1HZLA 1MCRA 4JZJB 5BO1L 4ELKB 3NACH 3L9EA 4TLKA 4BFIB 1I7ZB 5SWQB 3QUXA 4WWKA 4RRPM 3D39D 3OR6B 4AX3A 2E76C 2JQAA 2V9QA 4XBPB 3MAWA 4KAQL 2NNCA 4EAEA 2BW4A 1HI6A 3BUYA 3NFNA 5F3HB 3POHA 4JY5L 4J39A 2IFFL 1PDKA 2RA1A 4JKLA 4XVJL 4UDUA 3CN2A 3SPHA 4V1DD 3VRIA 5CN3A 5DMIL 2AV7A 2YSTA 5CN2A 1BVLA 1FH2A 4P5SA 3KGRA 5FGRA 3SGKA 1OVZA 2MCG1 5HHVH 4L18A 1HCZA 3QI9D 5D72L 4A2HA 5MEPA 4KX7A 1T21A 4ODHH 4I13B 3K1KC 3ZE0B 1KIPA 2DMGA 4JKPH 3WIHL 3E1ZA 4HU2A 3ARFC 3RUGB 5D2LB 1NAMA 1Q9KA 1RULH 1U3HC 5F7YC 1IGJA 4GQPH 5EOTA 2C5DC 4ZW8A 1AP2B 2G2RA 5HJ3B 1I8KB 2FO4A 4NBXB 5FO8A 3HBPA 4MMXB 2DEYX 2CPCA 3RZCA 4QT5B 4P2RD 2FJGA 2XQBH 1BZOA 3CFDB 4JG9A 5ABZA 1FIGH 3R4RA 3K6SA 2P49B 4GLRH 4I89A 3QDGA 1H8SA 5CCKH 1KV3A 1M05A 2DBLH 5HP5A 1DO6A 4J23A 3O3BB 4RRPA 3MOAL 4UM9B 5AOZA 2Z8WC 4DIXA 2D9CA 5HBBA 2D7QA 1NAMB 1FAIH 4O9HH 3RUGA 2ZT9C 3MRQA 1UM5H 1IBGH 5CZRA 3SOBL 1Z5HA 1TETL 5FYKD 1MFEH 1MRDL 2CGYA 3N41F 3ULVC 3V4UL 1QPXA 4U3HA 1Z5YD 4WY7L 1YEWA 2HJFA 3NSJA 4GRWH 4U1NA 4HCRH 4KTYA 2VAJA 1RPKA 2R56L 4NQDB 4HWZB 3U1PA 3LS4H 3JUZA 2NXZB 3FCTB 4FJYA 2D03H 4PRAA 4NWTH 4GOSA 4Z76A 3BPLB 3BDBA 1U91B 1UM4L 1T20B 3QZBA 1FFNB 3KAAA 5FO7B 4QXGL 3QVAA 4K3GA 1OCZB 2JTDA 1FGNH 4P99A 3UPRA 4TVSa 5ISZE 5IP4A 3ZDZE 4L5FH 4KJPC 4LLWB 1OF2B 5I1KH 1F3JA 1MJJA 4JZJA 4ELKA 2NX5D 3QEUA 4M61A 1MW3A 3FO0L 3B3IB 3PGFL 1Z9MA 1FZOB 4IRJB 3U4BH 4CN1A 1CD0A 3NJNA 3NG5A 1N26A 3BKYL 2ICES 2KDGA 2W8CA 4OD1L 4YSOA 5J12B 3MRHA 3V0VB 3PJNA 2CO1A 4UILH 4HKXB 5A2AA 1IO4C 1E2ZA 1W91A 2X9YA 5DS1A 4UT6H 1DBKL 3LEXA 4XMWA 1ZJAA 2OPCA 4JBSA 4ZQKA 1RQ5A 4EE2A 1Y6NR 4LB8A 1F3JB 1I1CA 4PCKA 1RK1A 2R4RL 3OGOE 1FYTB 2KQMA 3QNXB 3ZHFA 4LLMA 1T0NA 4I0CC 5HGAB 3UJTH 2NSXA 4MNHA 4JQVC 4JGUA 1X4YA 2UY6A 4ZRGA 1MWOA 2C1PB 2EE6A 4KI5E 3ULVD 5EF2A 3M1BB 2NQDA 3CIAA 2X38A 3KR3L 3QXWA 4HWZA 2WYTA 4L4VE 4LBAA 1UOVA 2KS0A 1YLBB 5GIRA 3RWGB 3TYFB 1F58L 4ZBJA 4PREA 3SOTA 1WJ3A 3FC8A 1EH9A 3FT4B 5AQ0A 3U48A 5EU7C 2BJML 3KPLB 1LK3L 2WKOA 3T0EE 1NGPL 2BIOA 4OJCA 1HDMB 2MNJB 2OI9B 3DV6A 4J3VA 4X9YA 5F7KC 3LDBC 2BSTB 3DUUA 1Y18B 3A67L 1CXLA 3TVMA 3EZ8A 5E7FA 4KQ4L 4P57B 4AGMA 2GG1A 1RIHL 1E28B 1ZEAL 4I7ZC 3CMGA 1EMTL 2R1WA 5E24E 1NBCA 1BQLH 5DVPA 2AMUA 4FXTA 4RDBA 2VMFA 4LQFL 3KLAA 4M8QB 4N0UE 3TOPA 3O3BA 4O4YL 5INCA 5HHPA 4AIZB 1INEH 1MWAL 4AGOA 2F74B 3Q13A 4AIOA 2WWMC 4ZMVA 5EIIB 1KGCE 5IQ9B 1WIOA 4NNYB 1KYUA 2NZ9D 2XDHA 3NRPA 4DP1X 2C4FU 4GKNA 4PBXA 5BO1H 2Q8BL 2DBLL 5FS5A 3HKZA 2GYSA 1YY9D 3VWKC 4NQTA 2DQ6A 3K2UH 1UWYA