4KQ0A

Crystal structure of double-helical cgg-repetitive rna 19mer complexed with rss p19
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
122
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
total genus 38
structure length 122
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kq0A01
4KTGA 4KNQA 4JK0D 4J39A 4JNXA 1RPUA 4JGNA 4KQ0A 1R9FA 4J5VA
chains in the Genus database with same CATH superfamily
3VXNA 2EVGA 3EYUH 2ADFL 4KJQC 1QNZH 3K0WA 4H8WC 1CR9L 1OWRM 1MF2L 3MV01 1QLEB 1TEFA 1F6FB 1BEYH 1BIIB 5E6IB 5BS0B 1Q4NX 4NUGH 3K8LA 2J4WL 1ZVHA 3PWUB 4XBEH 4W9GC 1KLFA 5IB1A 5EDSA 2Q20A 5CIPH 4YSOA 3RUGF 3VFVA 4IW4C 3TNMA 2WLYA 1P4BH 2EVJA 3DBXA 2VR3A 4NQUA 4FXGB 3SGJC 3QZWA 4OFYA 5D72H 3TTSA 4QHKJ 1XX9C 3BT2L 4KNUA 4FTVB 5DQ9B 3A4AA 5DMIH 1VESA 2Y25A 4FEIA 3J7HA 4WO4A 4KKBD 5AW8B 3P9WB 4DGIH 2R1WB 5B7MA 2ARJQ 2VDQH 2ICES 4OFIA 3RUGB 3MLZL 2GIYA 1MLCB 3C5JB 3EF4A 3O6FC 1BOYA 5D2NB 2V9TA 2ZKHH 3KPSE 4F9LA 3HAEG 2QQLH 3J2PA 1KGIA 1SLXA 1E5UI 2OMTA 4Z3EA 2WSKA 2LOEA 2YMOA 3MQIA 2FX9H 3MBEA 2PR4L 3IBOA 3O9WC 3FB6B 1IT9L 4KY1L 5EOQH 3WE6B 2WP3O 4M93C 1DR9A 4Y5VA 1HCYA 4FLHA 2YPVH 4KXAA 1KPRB 4NXKA 2X10A 2YEQA 4PRIE 3C8KB 2DTML 4UQDA 3ROLB 3QXDB 1GH7A 2UXTA 1R5WB 2A4EA 2GJZA 3L3OA 1ZLWH 3HRZC 2Q87A 2AQQA 3GINA 1G0YR 3WOVA 5EBWB 3PHOA 4K07A 2IBGA 3IJ9A 5DUML 4BWWA 5DMJB 5IR1A 3AU1A 2H4EA 1QG3A 3B8YA 3PS6A 4RAVB 4U6YA 4G7QB 2ENYA 4UZSA 1QWUA 1ZPLA 3WTTA 4DN4H 4U1IB 5IBLD 2ARJB 3TVMA 2ZXBA 3IMUA 3KYMA 1QW8A 4K7PX 2WMPA 4YK4C 4K3JH 1NSNH 2F5AL 1JF5A 2CO6B 3CQPA 4JQIH 1J9QA 1N68A 3L3DB 4I18B 5C0ND 2ZUXA 4UQ3A 2Z93B 4HOWA 3FOLA 2EABA 4GB9A 2E46A 4PSPA 2O5ZL 4PJFE 5EU4A 3RTQA 1BZDA 4OZHF 3V6ZA 5LDSA 5G5DA 4AENB 2G3XA 3IMRA 1JZJA 1IEBB 7FABH 2AXFB 3I6LE 1F41A 3LCYA 3QUHA 4A7QA 4DERA 4S0SD 4FZEL 4P5KA 3TEZA 3QEQD 3D4CA 1SGKA 3VUAA 3NGBB 2OTPA 3D09A 4D0CB 2DLTA 4OZHB 2QVIA 4QRAA 5M95B 2CQVA 4HIJB 5AW2B 2PXYB 4UM9A 4DO6A 4FABH 5F9OH 3QAQA 3L3KA 5F97E 4JFWA 3KPQB 1SXBA 2R9HC 2CH8A 2Q76B 3ABMB 4PVMA 1N0LA 4UQ9A 5DD6B 3VD9A 4QJ5B 1I3RA 2XRAL 1AZZC 2RACA 2VITB 1JBJA 3BMVA 4XODA 1AIFB 5I15H 4HJ0C 4J28A 1YEFH 3RIFF 5BS0E 4FX5A 5ANMB 4G6JH 3I9GL 2H2PC 2XVBA 1NH6A 2NZ1A 1ACYL 1IIIA 3V4PA 3HMXL 5FS5A 4APQA 3AB0B 4LPWA 3CDFA 4L8DA 4NENB 2ADGA 3VXOA 3ULUD 1NICA 2WQXA 5GGVH 4FQPA 3GGWB 3SD2A 4I0PB 2TRYA 1XCWA 4FTVE 4PJ9B 1G6RH 4WO0A 1LDSA 1Q0XH 1VEPA 4Y5XC 4WJ5A 4OFYD 5F9DC 1S3KL 1UACL 1BMWA 3FTZA 5D2NE 1S7TA 3L7FB 3QEQB 3MRQB 3S9DB 3GSOA 2VL4A 5LBSH 5FO8A 2HVBA 4GMTL 4TRPH 1Z5YD 3Q3GA 2TSBA 1XV8A 2GTWB 1HILA 1LO0H 2EDOA 4JO4L 5EC2A 5A40E 4W81A 2N1KA 4RDQG 4Y8AA 5D7LB 1R3LA 4HGWA 3BJ91 4NLHA 4CW1B 3GZQA 4BFOA 3MBED 5B21A 2BMKA 3HE6B 1I9RL 4XCFL 4M1CD 3R06A 5A2LH 4J4PC 2B59B 1NGYA 2CJSA 1HXMB 4AL8H 2DM2A 2AI0H 2O6PA 4QYAA 2VLRA 3FSOA 2C3VB 5HPMB 4P9MH 1P2CB 4UZGA 1U6AL 1RERA 1T7XA 1UJTA 1WHOA 4PCYA 4MYPA 4AEFA 2XXMB 1DEDA 1Y07A 4K2UL 4DH2A 2A9MH 3VXRA 4O00A 2BZCA 4G43B 1XCQB 1S5IH 3CSYA 2CD0A 4YOKA 4N6RA 5T1MB 1J9SA 4LOUD 3MJ7A 1G4MA 4NPYA 2XWJB 1BXVA 1Q0YL 3V5HA 4PJDA 2XU9A 3RTQD 1FFTB 1CDHA 4ODHL 3RBGA 4AVIA 4KMTL 5B3JF 1F4WH 5GZNA 3GK8L 1RZFL 3T0BA 1J9RA 2VLJA 1XGPA 1TVHB 1F3JA 3TN0B 4KWUA 2ATAA 3UTQA 1Z9SA 2MOVA 2NY4B 3QK0A 4KK5D 5ESAA 3B9KA 4BSVB 3KWTA 4ES8A 3QO0A 2YJLA 2KZ1B 4FHKA 2MKWA 4LPYA 1X9LA 1O6TA 3FUKA 1HE8A 2X2IA 1FVEA 4G1EA 4ODXA 3U0PB 1AGCB 1RUKH 4JHZA 4JHAL 3ULVD 3KYNA 4EN2A 4JZJC 3LXUX 1Q72L 2IGFL 4JFED 5D7IE 1Z3RA 3LPPA 4N9GB 1L3WA 3C6SA 3TEYA 4ZOEA 4IKIA 4H44C 1JGVH 1VFBB 2CLZA 2UV3A 5E70A 2P28B 4A7VA 2BVOB 3BRFA 5SX4H 3IPFA 1JIBA 2HX7A 2OXHB 4EE2A 2XV3A 2F54A 2ZUQC 3NA9H 4JO3L 5E0QA 5AZ2H 1NBCA 1K4DA 5IT2L 3L3HA 1J48A 1CS6A 2JCCF 4OCXH 2GTZA 2VKWA 3VTMA 4WW2A 4E9VA 4APQD 1U8CB 1T1ZA 2XTJB 5DVNA 5LGYA 1NBQA 1IQDB 3CN1A 2VXSL 5I1HL 2KZWA 4PFEA 4FCHA 2Q5BA 4HFUL 4TSBH 4DW2H 5LDUA 3BFOA 1HI6A 5E5MB 3F04A 1QI4A 3UZQB 1WS7A 3QEQE 4AE0A 4Z7AA 4E9WA 2EZ0D 2X2UA 1AGEA 4TPRL 3SE8L 2P42B 4A37A 1M7IB 3FU3A 4FLOA 5I6LA 3TIEB 1KG0B 4GQRA 5CINL 5HGDA 3ZTEA 3NFNB 3J07A 5AOJA 3H9HB 5I5IA 5INCB 2R29L 5I8CA 3ABZA 5I0YA 1DUYA 2A73A 2WQSA 2H32H 1T5KA 3WNLA 4K7PL 3FQNB 3VM5A 1VF5C 3EJCA 2BO0A 3L5IA 4ENEC 1A9EB 4JFEB 5AW5B 5IHHA 3GSRA 3QS3A 4LL1A 1NCGA 1ORQA 1XB8A 3RLSA 1EAPB 1TJGL 1JXKA 3CHOA 5HYEA 3QHFH 1ZDSA 1D6VH 2ARWA 2X5PA 4PJGF 5HVGB 5CSGA 3E8VA 5F7EH 2EH8H 5GRVK 1NIEA 3BUYA 5E6YA 3G6JA 2DPKA 2FB4H 1DVYA 3BE1H 3JZYA 4OM0H 2A1WH 4ZDHB 3OMAB 4BZ1A 1XSIA 3FU0A 1FIEA 2VLRD 5KOVC 4NRXA 3HVNA 1KLGA 4QJ4B 4G5ZH 3ULUE 3Q6FB 4Z7OB 4HHAB 3ZSTA 1VADB 2NY2B 5AALA 4PJGB 3BI9X 3C8DA 3DIVA 3GS7A 2Y7SA 5MP6L 4U1JB 4KH2A 5C3TA 2EVHA 3BGFC 2R59A 4MHHG 3VXRD 1Q9LB 43C9A 1T0MA 1JOIA 4U6VH 2XWTB 4XP1H 1G1KA 4G6ML 3NJIA 1YECH 1KCRL 4C8XA 1BQHG 1T21A 4GNKB 3SDXF 4Y4KC 1ZLVH 5EOCL 1XF4A 2C1OB 3LN5B 4OM1L 3BCDA 3OMZA 1N6UA 3VXTA 1UOKA 2CO7B 5GZND 5F6IB 1R3KA 4N3UA 3R4RA 4YSPA 4GW4B 4WEEA 4XVUC 4M61B 4Y4FC 1ZE3C 4OQTL 1I8IA 4FQIL 1CFSB 4Z9KB 3T65B 2H26A 1NCJA 3BCFA 3LD8C 5IP4A 4LLYA 3B9KD 3D05A 3BSHA 3MNVB 3RU8H 4FZ8L 4POUB 2K6WA 5J13B 1VGEH 1RZJH 3TH4T 4LSVH 4FLSA 4K3HA 3N5AA 4X9FA 2DKUA 4L1TA 3N1GC 3FT0A 1BX2A 2YAPA 4YSRA 3O6LL 1I7TA 1DBKH 3SKNA 5FV1L 2QJDA 1ETB1 2R51A 3ARFA 2DEWX 1OGTA 4ZPVB 4Y2OB 3O4LD 2YAHA 4MA7L 2E9WA 4HZLB 4HH8A 8CGTA 4WUKL 4AXWB 2F54D 1BVKB 2GPZA 1D2OA 2MNWA 2XTJE 4PJAA 2RAMA 2HFTA 4M48H 3TO4D 4LSRL 4UMGA 3D9AL 4CJ0A 1CPUA 5DJCB 3LNHA 2JKNA 1T2QL 1NJ9A 1H6TA 1WZ1H 2WGXA 4LIQL 4L8CA 4P3WA 4QHMB 5HJ3B 2PO6C 3OR6A 2RCSL 2C7UB 3K72B 4P3DB 3TBWB 1NBVH 4ZMOA 4RCAA 3MCG1 3T0AA 5BV7B 5HHOD 1O5DT 4LBEB 5AL8A 1OP5K 5HHVL 3BVTA 1H8SA 2HVKA 4KXZH 3D18A 5D7JC 4XN8A 5CU5A 4CSSA 2KPNA 5H4ZA 1QMUA 3I74A 4ZFFB 3VFMB 5IWLA 1KJ2B 2NLJA 2DM3A 3ULVE 2ZXDA 1SHMA 5IW6A 2EDEA 3FO0H 1XTLA 1DQQA 4HVBA 4KVNH 4JFEE 1G9NL 4ZW8A 2OM5A 3LS5H 4Y5YC 3S5LA 1SHWA 2GFBA 3GLZA 3L5WB 5IHLB 5J9PB 2BZDA 1FIGL 1RCYA 3MA7B 4K5NA 1M1XA 3ARXA 4Y2LA 1JDDA 3AG2B 3W9DA 3CVIL 3PCYA 1XMWA 1CFNA 3ZYIA 1F90L 1JNJA 1MG3C 1XGYL 3ASNB 1U42A 2HKHH 2CGRL 1YQ2A 1JXJA 3LH8A 3MLYL 1AKJD 4PWHA 2CRYA 4LL4A 3V4VA 1JVOA 1SF5A 4Z7OE 1ZS2A 4WKZB 2H1PH 1DLHA 2EKSA 3EG9A 1F2QA 1EV2E 2WNGA 5T5NF 1E7VA 1U3HD 2JLPA 2ZWZA 1HQRA 4PJGE 4MVBC 2ZQKA 3CU7A 3RWGB 3ARGA 4MNGA 2GJ6D 4N0YL 4EQ3A 2PCXA 5DFAA 5JW5A 4IU3A 4UAOB 2H9GA 4MWFA 5EIIG 4FG2A 5E9DA 2YK1H 3LXAA 3L2LA 3OAZH 4YHNB 1EERB 5FECB 5HGBA 5LG6A 3FUEA 1FORH 5HHXH 4QTIH 3ZTCC 3D52A 4LHUA 2OZ4L 3T1FA 4QLWA 3QQDB 1HXYB 3F7QA 1TQCC 3IFNH 3NP4A 4FXKC 4HF5H 4W9EC 2R2BB 4ECNA 1R6VA 2WYZA 4PJ7B 4GPVA 4FNSA 3KWUA 2DH2A 4GEJA 4G82A 1MW0A 3UJTL 4J3UA 3V4PH 3NIGF 3QO1A 2HT3C 4YHYC 3QIWC 1UH2A 4PS3A 4R96B 5TFSL 1N3NB 4M43L 1PZ5A 3OHMB 4OVUA 2EUVA 2YXFA 2FYYA 1I53A 2EYTA 3FU7B 4XPGH 3RVVD 2YAFA 4PV1C 4A2FA 3HNTH 1A2YB 4I3SH 4Z3FA 2J2ZB 3CPLA 5I17B 4MAUH 3H9SA 1BVNP 2R0LL 4K7PY 5DEFB 2XOTA 1AKJB 3MV9A 4FYQA 4OZ4B 2QSCH 4MDIB 3LQAC 2BOBA 5AAWC 4Q4IA 4CC0A 1U3HB 4UWQB 1JNLL 3NA4A 4AZ8A 1E40A 5AUMA 4KMQA 4Z1PA 2GJ6B 2X4TA 3NQKA 2EIJB 4QT5A 5JHDB 1TO5A 2ZXWB 3HI5L 1WQVT 3I50H 3VXRE 1A02N 1BYNA 4PJEE 7PAZA 1ZVYA 3MJ9H 2BOCB 1XVSA 3QHZL 4S1QL 1BQSA 2FUQA 4YHOH 4IBSA 5T1KB 4AYEC 3ECBB 3P1VA 3U25A 2VAAB 3WU1A 1UB5A 1I1AA 2D31B 4LRIC 5AQ0A 1DUZB 4PJDE 4XNZC 4Y7OC 2W60B 1WT5A 3OKKA 3BD3A 4Y9CA 3QEUA 4HIQA 4WJKB 1PW3A 5AW7B 1SN2A 3HZMA 3ZZLA 1X4YA 5DZ9A 4BA0A 1AC0A 4F3FA 2N7AA 4XO8A 5F7HA 3VFSB 5K9OA 2LTQC 2ZCLH 1D5IH 2C5DC 3HB3C 3L1FA 4OCLC 4QRRA 1PX4A 1S3RA 3BDYL 3HS8A 3O0RL 5FM4A 1PAZA 3OJDB 4NJAL 4PJ6A 2D2OA 5C07A 3C60A 1IAOB 2AKRA 1KIRA 2FGWL 3MCLL 4N2CA 3HZVA 1F4XL 4RZCB 4Y19B 5IV2B 4I0KA 1D5XA 2GITB 3BH8B 2UUDH 4HPOH 5KANI 3MODL 4LCYB 5ISZD 2DYRB 3DVNA 1EHLH 4M5TA 2R0WH 1BBDH 4Y2DC 3O4LE 4BFNA 1SEBA 2E7LA 2V9QA 3NQIA 3WKYA 4U6TA 5EDXA 4XN9A 1FGNL 2G5RA 4F7MA 2F54E 3SQOL 1K8DA 1SEQL 2MQCA 3QUYA 3ZE1F 1JHLH 5KSAA 3NRPA 1DDHB 1OE1A 3FTGB 4WRLA 1RULH 5DRWB 5EN3A 5D93C 4LHQB 1CLOH 5JIHA 4P5MA 1PIFA 1XF1A 3BAEL 2P8LB 2IV9A 3OKOB 4BDVB 1XXFC 5HHOE 4HIPA 4KGLA 1J05A 1BV8A 1E28B 4R4ND 4QDGA 2AJXL 1S7QA 4OF8A 3ZE1B 5IHWA 4GI8A 4K3EH 2X1QA 1LE9B 2DLIA 3DSFH 5I1AB 1IGTB 3TT1H 2EEBA 4B9FA 4ZMPA 1U91B 1CVSC 2GC7C 4S1DC 5E9DD 3VH8A 3UO1L 4D9QD 3U2JA 2HLAA 5KVFL 2OA9A 4E9RA 1T0NA 2GBVA 4GSRA 2EXWC 4PJ7E 5AZEL 3ECQA 1RUQH 3BW9A 4OIIH 5BVPL 4HYTB 3IDXH 4N22A 5ID0A 3MUUA 4OZIE 1D3CA 2COQA 3R7RA 1SMAA 1WK0A 1TJIL 1CXFA 3RWCB 4D9LH 5DZOA 3LKPB 5FYJD 2E9IA 5ISZB 1T1WA 5JDSA 3QC5X 2GSIA 1MFAH 3PU7A 3GBDA 4G71B 3IAQA 4ONFL 3L3IB 3IDGA 3GTTA 1JPTL 1G4RA 4ANXA 1ZV9A 2EDDA 2IQ9H 3KXFA 2JK5A 1LO3H 1UFUA 2ZYIA 1TTCA 2QELA 1V7NL 4XPHL 3ILPB 5I18L 5IMLA 1KWKA 1TXKA 5MEQB 4CN1A 1G7HB 2WINA 2IF7A 4C83A 3H9SD 2GJ6E 2E6PA 1XR9A 1GTFA 5I9QC 3MBXH 4WWKD 5TD4A 3PP4L 2VLKB 2FWUA 3DSNB 5I82A 2VQ1B 3IDIB 1O0VA 3AXIA 4I77H 3T4AA 4FP8H 5LGHL 5AYTA 2Q7NA 1C5BL 1FGVL 1TZGH 3B2PA 4ZXBA 4E9YA 2AF2A 3EGSB 5IEHB 2N1TE 5IJDC 1GA2A 5ESVA 1JFHA 1Z2KA 4UOW1 4QY8B 2X42A 3QUZC 3CZJA 3OAYK 4NAJA 3E6HA 1UXSA 4RISH 3KHOA 2C9UA 2EADA 3JVGA 3EDFA 4HKZA 3LZPA 2X3CA 1ID2A 1MNNA 4RNRB 1KJVB 2WO4A 3O3UN 4QWWC 4X5PA 3IU4H 4HZ1A 2WBXA 4N2GA 5DT1L 5KYXA 3AACA 5KYUA 4F8NA 5CEZL 4KUCF 1EQWA 2R2EA 5GSVA 2ZOKB 4DVBB 1C08A 4FMKA 1EANA 2YQBA 1BMZA 2C7FA 2D4DA 1IJ9A 1DQLH 4OGXL 2BPBA 4Q6IA 2V5MA 3CXHJ 4FHJA 5TE4H 1YPZF 2K9FB 2BRRH 3VVWA 1EO7A 2WO3B 4X7CC 3C60D 4DGYL 4N68A 5J1AB 5C3IA 3VGBA 3RWIA 4N87A 5ACZB 4K71C 1UT9A 2XBTA 4F92B 4KX8A 1T7VA 4UNIA 2BZ7A 4WWKB 4UOW0 5BZDB 5I5RA 3QAZB 1EXHA 4X4YB 2HTKC 4PVBA 3STLB 1SVBA 3JWDC 5K1NA 5L0QB 1QI5A 3EBIA 5CBEA 1OP3K 5C2UB 3HAEA 3QCVL 3MCYA 1GJUA 4OLXH 2IPUG 1SQMA 4LCUB 5KSAD 3FTWA 2K3HA 3ES6B 4G80A 5DD1H 5DJYB 5E2WL 4LVHC 1H6FA 2R4SH 2DMCA 2EIZB 3SO3B 1DQVA 1RUML 4MXWH 2GAZA 2ZX7A 3A6OA 5IMMA 3QULA 6FABH 3J8F7 1BFOA 1KCSH 1PKQB 4L4TA 3FRPG 4OCWL 3ET9F 4BKSC 3MREB 2DQDL 1MFCL 4JANB 5T3XL 4PV8B 5L4FA 1SYVB 4U1KA 5BQ7A 5C0JB 1A1NA 4NN5B 1JHKL 2WWNA 3LKOB 3Q8CA 2ZAIA 2IBZY 4AQZA 5DGQA 2VMCA 2R15A 2EE3A 4FFZH 5K39B 1JPSH 4TLUA 3BPNB 3VI3A 3ZTNL 1IC5L 2YOAA 5DD3H 4RGOL 4X99A 5ISZE 4PJCE 2QLYA 2APBA 3LKSB 2FIKB 2Z4QB 1J1OH 3IDJB 1ZANH 4MA3B 2HUHA 4P2QA 4YHIB 1HHGA 3RJQB 1F6AA 1IEAA 2HVJB 3NACH 1DCLA 5T5NG 3NJJA 5C6WH 2JXMB 4M8VA 4N90D 3UTSA 3QI9A 1RIUH 3DX4A 4X7EC 5D1ZB 4QXTA 5DO2C 4YXHL 4PJ8B 3FO9B 4MD0B 1BBJA 1YMMA 3WTVA 3RBSA 4IMLA 2YR3A 1INDH 2NYKA 2VLKE 3T8MA 1TLMA 2UXFA 5I1CL 2RJMA 5MEOB 3HS0C 2Y22A 4J6RH 5K93A 2B1HL 2PABA 1H15B 3FONB 5CP7A 1AOZA 4JAMA 4MX7A 4H5SB 3H6JA 4P5SA 2ZPKL 5HDLA 5FWRA 3FB5B 5E9DE 2IPKB 3EO1B 4XNMB 4GXVH 4D9QE 4LLUB 1VA9A 1SXNA 1R24A 4ZXBD 2DMBA 2RQ8A 4XZ4A 5IB5A 5ERWA 4TUKH 4OH2A 5IGXH 4WTXA 3GXUB 1AXTL 5MHSD 4DTGL 2W92A 1T4WA 1N64L 4YDNA 2F7QA 3TF4A 2XVKA 3O3BA 3S37X 2LW3A 3NMEA 2BFVH 2P8MA 2UY6A 5FYJE 1RK1A 3VSUA 2HFFA 4Y4HB 4QPEA 3RKPA 3SPGA 3DXAB 3PV6B 4IIZA 4K8RD 4AEHH 2JJTA 3T5WA 1G7QA 5F7AA 3UH8A 4YAQA 1E9PB 1B4LA 4M02A 2YOCA 1AHWA 1AE6L 4P05A 1BWWA 2FSEB 4LDEB 1SJVA 1OHZA 1SPDA 3H54A 1N2RA 5KW9L 5HI3D 1FZKB 4QEGA 3NBNA 2VCOA 1P84K 3H9SE 3BX7C 5GRJL 4ANUA 2P5EB 4B0MB 1YY8B 4HJ1A 3PWLB 4Y16B 1MW2A 4YZFF 4L37B 3V2AR 4H8PA 3NH7H 2GQHA 4NNYB 2J1ZA 5LCVA 1VLXA 1AO7A 5IBUB 5L2KB 4H20H 3PL6B 2WLMA 1ZHNA 3IETA 4NQQA 5E4EB 5GRVL 4XHJC 5GS0C 3VGHA 1BXXA 1MSPA 1NUGA 2Z64C 3B2VH 2ESVA 3VDBA 3ZDYB 5K59F 3UXFA 4AYMC 1KBWA 3KHQA 2IGTA 1FFPB 3BIKA 1YJDC 3H3PL 4I48B 1AD9A 4GUOA 1PKQE 3MCKB 5DR5H 2R8SH 2DLFH 4K23H 2XWXA 3MRIB 3VYNA 4G5AA 4YO0A 1W16A 1ONQB 1DFBH 2MH4A 3CFJB 4JJOA 3GIVB 1NINA 1M7XA 4ZAKD 5AZUA 4YN3A 3GRWA 2V7NB 3LH2H 3O45A 4L4TD 4DP1X 4QRPA 4K3GA 3LNEA 2Y07H 1SMOA 4NKIL 4ZO6A 1V27A 4MDJA 4TUOA 3QUMA 1UVQA 4MMZB 1JN6A 3KPOA 4CMHC 2QT6A 4OR1A 1E3FA 4OSUH 5ALCH 4LAQL 5GRXG 1FNEA 3LXCA 1AZUA 1LNUA 3MLWL 4XXWA 4QMEA 1OM3L 2NX5A 1A6TA 1G9ML 1MG2C 2DMHA 3V6OC 3PGFH 2VL5A 2VZVA 3PWPD 4WK4B 1S9XA 4MB1A 4J3OC 4HAGA 3MJWA 5HY9B 2AHIA 3OSVA 1J8HB 1F3DH 4LL9A 1A21A 4NQEB 2D73A 5F1IB 3JV6B 1CICC 5I6KA 1MPAH 3CG8A 4OLWL 3ZQXA 4KROC 2K7PA 1INQA 1Z66A 4N0FB 4PBDA 4ADIA 3QI9D 3BUQA 4PG9A 4F7EA 4OJCA 3B2DC 3IDNB 1B2WH 1EEZB 4HSQA 1YMMD 2WSPA 5GJSH 1F4YL 2WUBH 3PWJA 4RH4A 2V2TB 1OAZH 2AC0A 2ZYSA 6PAZA 1L9PA 3TNNB 3OZLA 2EE2A 4R90H 4JG1H 4ZAKB 4A6YA 5EG6C 4G8FA 3ARSA 2VXTH 1NKOA 3AQZA 3GI8H 5I74B 1UD8A 3MRBB 4EDWH 4U1HA 3V4UL 2XQYK 4S0HA 1IGCH 4XGZB 3E3QE 4HKXA 4N20A 1MCWW 3HPJA 4XX1E 4PRHA 3F7RA 3E38A 4E41A 3NN8B 3MC0A 3QA3B 3W2DH 1Q0EA 3M17A 4YE0A 1EO5A 3GKZA 2DQHH 2ZTBA 4OD3H 3N1PC 4BSWA 3H55A 3AXLA 1AQDA 4MMXA 1QFWI 1FNSL 1XEDA 3FQYA 4N90E 4BHUI 4HPYH 5JW4N 3MBWA 1X5XA 1M9SA 3EAKA 4XHQA 1AP2B 2BNRD 3P4NA 3GXNA 4DUVA 2Z8SA 1RUPL 3MXVL 4PLOB 4YX2H 1P4IL 2Q3ZA 3JV4B 4LRNL 2JKSA 2R0ZH 2P9RA 2IADA 4XH2B 3V5DB 3UYRL 2YPKB 2JKWA 2YSTA 4MBRA 1RD6A 3NFPA 4Z7VF 3S4SG 3V0HA 1HSBB 1GKOA 1WGVA 1BG1A 1AGBA 3O11A 2FHBA 5I5MA 3ME0B 4KNTA 25C8L 1NMBL 4LPTA 2BP8B 1EUTA 1FC1A 5BOPA 4IIQC 4GINA 1YUHA 1BOGB 1ZLSH 4PG2C 2L04A 4FFYA 4JQVC 3MV7D 1G0XA 5IOPB 3ZDYE 1S7VB 2RFXB 4UMSA 1FSKC 1J7VR 3AJ7A 4PY8I 4PS4L 4KV5E 4UT7H 4LARH 3UBXB 1FH5H 4V1DA 3ABGA 1OE3A 3VFOB 1F4HA 1J12A 5MHSE 4XPFH 2V4LA 3V79C 3LEVL 4N2DA 3U9PL 3FU8A 1MQKL 4EN3A 3AS3A 4GP5B 4GAYA 2XX0A 2WJ7A 3RUGA 2OJZL 1SVZA 4E68A 4MNHA 3X1BA 3QJUB 2H6PB 1R3HB 4JO2H 4AYSA 1KIQA 4GG8B 1FBIH 3APNA 4PGEA 4UDTA 2IJ0C 2OSXA 3LRLA 5DJZB 1Q90A 2A77L 3SE6A 2Y6TE 1FVCB 1KFAH 1URLA 1QP1A 3QCUH 3FCTB 2YBRB 4NN6C 4QRPD 3WE6A 4KTEH 1IO4C 3ZL1A 1PDKA 2BNRB 5F7DA 5TGBA 1XTMA 4UT6A 1RV6X 3CFMA 1HFUA 2AXJA 3K6OA 4ERSH 2AS5M 2V7HA 3CLWA 2R56H 3AT8A 4NQEE 3QXDA 5KBMA 1VDGA 1G7PB 4FQQA 2NX5D 4HLZH 2NY3C 5CXPA 3VJ6B 3HPLA 3ZHFA 4AMWA 5DRNA 1SOKA 2OFQA 3OLEA 4I9WD 3Q44A 5I73B 1CK0H 1ZTXL 4OFKA 3U1QA 1NMCB 5DJAA 4YEFA 1BQHA 1MIML 3CXFA 4HS8H 1AD0B 3WS6A 2ZCHH 2BSSB 3QIBD 4PLNC 3MV7B 2W0KA 1QEXA 3FNKA 4UU9B 4MAYA 3S37L 3VW3H 5J6HB 1JFQH 1B0RB 1AI1H 1GYCA 5EU7C 2OW6A 3MOBH 3OM3B 3THML 4Q4EA 1KELL 3D8MA 4LSTL 5LLIC 3CN3A 1K3IA 1MY7A 2Z93A 5DEGB 4IGBA 2W1NA 4RAHA 1FRGL 4HA1A 1E8WA 3EIFA 4FMFA 4F58L 5KSBF 4L4TE 5SWSB 1ZKAA 2FVNA 4P9HC 2BSEA 2I26N 5HYJB 2SEBB 5DEZA 4GUQA 1NLBL 2ZCZA 3NDYE 2EDJA 1IEBA 3WHE0 4KRLB 3UPRA 1CDYA 2JJSA 4PIBA 1W0YT 3IK2A 2XWRA 1QW9A 3PABA 4S1SL 4XMVA 3SE9L 3MRJB 3HG1A 3EOBB 3HKZA 1NEZA 3T6VA 3ZKXC 5L2JB 3PWPE 2OYPA 4D0CA 3TIDB 5KSBB 1IGFL 3MV8D 2AVGA 4IS6B 4PRHD 1JGUL 3HAEH 4E41D 1JGIA 1CGSL 2PXYA 1S7XB 2D03L 2Q7YB 2P24A 1KTDB 1DZ0A 1REIA 2NXZB 2QFRA 4ZPTB 2UVEA 4K9EL 5F0PB 4WEBH 4XBGB 5IK3B 2YGQA 4UTAA 1MJUL 4OAWB 2J44A 2W81C 1JNHB 4OCYL 8FABA 2H0JA 2XICA 3KAAA 1L0YA 2IOMA 4GAAA 1C1EL 3QIBB 5I5JA 3U1SH 5MI0C 4U4IA 1YMME 1DLFH 2WKOF 2E75C 3HG3A 2VITA 3BSZA 3DTUB 4LQFL 4O02B 5HGHA 5JXAH 1OAYL 4GY4A 3DGCR 3O3EB 2KLSA 3C6LC 1MXDA 1N7ML 3ECWA 3L4YA 2X6AA 5ANMA 3RWHA 4Z3GA 1KB9K 3GSQA 1TYRA 4XPBH 2P26A 3V10A 3ARUA 3D0VB 1HYSD 2APXA 5HVHC 3GFUA 3G6DL 1DBAL 2VDNL 5GIRB 4GP4B 2Q8AH 4LSDA 1LDPL 4NT6A 5TDOB 3W9EA 2DQIH 3PV7A 2GK0B 1KMGA 2OYKA 1MRFL 3D0LB 4PJ9A 3BO8B 3BP7B 4V1DD 1N5AA 3CZKA 3KPNA 4N8PA 1QHOA 2HTLD 4J5VA 4KJPD 1P5VB 3T71A 3RWDA 2IALA 2VUKA 1OGAB 3FOMA 3L7FA 3C9NB 3VDCA 3EJUA 1S7WB 4EN3D 3MUHL 5ABAA 3HBGA 3BZFA 4FJ6A 1YZZA 5J1TC 3QEHA 8PAZA 3GBNH 2GTWA 1I3GH 1PJ9A 2OCFD 2BNRE 2LAAA 4ZW5A 2RIKA 4ANKA 1KTJA 4Y89A 2AJSH 1GPOL 3HFMH 5I66A 2BCKB 3GHPA 4G7VL 5D6DA 4GQ9H 4WNQB 5EIIA 1HXMA 4FG6C 3U9UB 4B9KC 5ITBH 4U0RC 4J1UB 1N26A 3QB7C 2BVQA 3MV7E 3QDJD 4MS8C 1QFPA 1JZ6A 2HWZL 4BFBD 1S78C 4OD1L 2AJVH 4FKEA 2AV1A 5K9KB 5B8CB 1N9PA 5I8OH 2I60H 1G94A 3HS9A 1VGKB 5CJXC 4E42A 2XIBA 4MAYD 3OSKA 4BFEA 1UM5H 3QORA 4HMCA 3ILQD 4WEUD 2WJ5A 3H7BA 3QYMA 3X11B 5H37G 3MNZA 1G9EA 1A14H 1ETZA 2ED8A 5GJTH 1H6UA 2FZ3B 5EA0L 2P4AB 1KCVH 3B37A 4HUUB 3MTRA 2C9SA 1SLUA 1C8QA 2HX8A 3ZKQD 2W0PA 4IGBD 4ISVB 3IN2A 4NM4L 3HEIB 3PJSB 4RSYA 5D4JA 5BW7A 1WWBX 1E9OB 2EDHA 3FCSA 4EKXA 1JAEA 2YRZA 2MCG1 1AR1C 4LVNB 3WY1A 4NKOA 5LCVH 3WUZA 1DBML 4H0LC 2XSKA 3JT2A 1LEKB 1R33A 3X1GA 1F1GA 2LAGB 4LLQA 4X42A 4LCCA 1MJ7H 1UWXK 3F7KA 2NX5E 4WKXA 5HVFB 4IRJD 2AEPL 1O7DC 3BDXA 5F96L 2XV0A 3ARTA 3LKQA 4QRUB 5AB1A 4UILL 1L5GB 4I9WE 2DYPA 4RSVA 3GNML 1H3VA 3CLEH 1UWGL 32C2A 4A2GA 1U93A 1S6NA 1GIGH 5AKVA 3R8BB 5SX4I 1GGCL 3MRRA 2QLVB 2P80A 1CGXA 3DO3A 3N1FC 4PUBH 1HSAB 5EULV 1UURA 1VFBA 1WAAF 2ORBH 2OX5A 3AY2A 3R19A 4L5FE 3VA2C 3EYSL 4ORGB 1CCZA 2PP8A 2PW1B 1W80A 2YS4A 3GRWH 2HLFC 3SDYH 1ZGLM 2IG2H 3FZUD 1KYOK 4NQXB 4AJ0A 3TBCA 2OULB 1PIGA 3H3BC 4HUXA 4OCSH 2DI7A 2NYYC 3P77B 2OMZA 4O9HH 3DVFA 5GGQH 1MJ8H 2XFXB 4AC2A 4ZYKA 2F19H 1U8CA 2OYMA 4JKMA 3TV8A 3WIIH 3CHQA 1NCNA 4X5RA 4DGUA 3II3A 2KMWA 1JK9A 1ZLUH 2BWQA 2L3BA 3MLRL 4Z7UA 2CR3A 5IG7B 4LKCA 4ZOBA 3KPPB 1S5HA 4NP4L 1ZPUA 1IEHA 3WG7B 3MV8E 1CBVL 2JCCA 4PRHE 4E41E 2Y5TB 4F5CA 1PU0A 1S46A 3B7SA 3H9HA 3EDJA 4IRJB 1FZMB 1X7SA 4LP4A 1AY1L 1BZ9A 1V7ML 3UBXG 3ML8A 3S3JA 2J88L 3OVUB 4HT1H 2YKLL 1HNFA 1ZA6A 2FH8A 4N0UB 5CJ8A 5JR1L 1RK0A 4KXBA 1OVZA 3VFRB 2OYLA 1KDIA 3JWOL 1BQUA 4IOIB 5FOJA 5IB4B 1R3IH 2VDNB 4I5BA 1E2WA 1EVTC 3IMVA 3GBLA 5DZAA 3EGXB 4NN7B 3RIAK 1G1CA 4A66A 4E9QA 5EO1B 2MEJB 2DOCA 2NUPA 2VDKL 4A6YH 5GGTL 3HBPA 3BPCA 4MKMA 5HDWA 2CGZA 5E6SB 1PMYA 5D4HA 3MGAA 2KH2B 1IC7L 5FYLH 1JWMA 3L6FA 1WF5A 3MUJA 1JXDA 4NFCA 1IE5A 1A4AA 2AW2A 2Y6SC 3QJZA 3ZTJG 1FHGA 3EYVA 4JRXA 4Z8FH 4FYRA 3UFIA 4Q9QH 2HJLA 4V1DE 1U92A 4RX4D 4JDTH 1KBGH 4XC3H 3MFFA 4HJIA 4DP9X 1E3XA 2OMWB 1IZJA 1HAWA 4CU6A 2Q7AA 2VLMD 3TYFB 1PTZA 2HFEB 3SGJA 3VXUD 1TQBB 3QORD 1FYHB 2XWTA 3OD3A 1QKZH 2Q1EA 4Q9RH 1HXKA 3GO1L 2K8MA 4AQEA 3F85A 3CVDA 4H8WL 3B7YA 5F7BA 3ARRA 1RMFH 3MZGB 2PWFA 3DX6A 1YO4A 2ZKXA 4QXGH 1ZTXE 3LB6D 3GI9L 1P5UC 4PRAB 3UTZA 3SDCC 3BPLB 1QSED 3ARVA 3APDA 3AG4B 4H2AA 3OMNB 2ALWA 1X5KA 4GRLC 2R7EA 1KTLB 3FPXA 3JWNE 5DJ0B 1X4XA 4WNSA 1V5JA 1Y7VA 2OQJB 4X7SH 1QBML 2X9ZA 3SDXA 1TNMA 4YDVB 1OHQA 2B7DT 4BFRA 5JQHC 3MNVA 5DD5L 4FA8A 2F58L 4NC2B 3UCRA 1HN1A 2FD6H 2XUWA 3HLAB 3QDJE 1NCUA 3NVQA 2KHAA 1RJYB 2DQCL 4LCIH 4JJHA 4ZW6A 43CAB 1NUNB 1K5WA 3DROB 5EZJA 3KLHC 1BSIA 1U2HA 1L9RA 2QSQA 3N0AA 3QQ9C 1DN0B 4HU2A 3HRZA 5F88A 3H0TA 1RZ7H 2P80D 2FJFA 4O5LH 2FECI 1IILE 2Z7WA 1I7ZB 3N0PB 4ODTH 3JTTA 4LPCA 3GJEB 4M7JL 4TL5A 4XNXH 3SJVA 4LFHG 5F72S 1WBZB 4JFYB 4TM9A 3DIDA 3KJ6H 1KJMA 2QKIC 3T3PE 3DGGB 3IRPX 4KC3B 4TQEH 3DX3A 5E8PA 1XIWD 4I2XB 4OLYH 5HJBA 3VXUB 3KVDD 4QLRA 5FA4A 3D85A 4OJDH 2I32A 4IDJH 2OCJA 1NANI 3BLPX 4UT6H 2IDQA 3VGGA 5HDBB 5KVDH 1SJHB 2B4CH 5F44A 3ARBB 5E94A 3TWCH 4KXZI 4P3DA 4RBPH 2X88A 3LVTA 1M7UA 3VSTA 5SX5H 1YEDB 4HJGB 3L1OL 1SJMA 5CJOL 4J3TA 4APXA 4CC4A 1SJEB 5I1DB 1QSEB 4PW3A 1HH9B 1XF5A 2X7LA 3L95A 2EUXA 1WITA 3TZVC 5JO5B 1KIUB 4UOJA 3VFMA 6CGTA 5KVGL 4HLJA 1JNNH 3D3VB 1KPVA 4N0UE 4U49A 4L9LA 4TULL 3H42H 4P0DA 3MV11 3QUXC 1K8IB 5DHYB 2YPLB 3TJEH 1G7JA 4PGCB 3S8GB 3L5WA 1UGNA 2F8IA 5J9PA 5GS1A 4NM8L 1A9VA 1FNFA 3SYQA 4K0OA 4Q7DA 2DWDA 5I71C 2JI3A 1J0JA 2EDMA 3B5TA 4N5ED 4NQSA 4HULB 4L4VD 4BQ9A 2UZIH 2ZKWA 1F11B 3ASWA 3QZPA 3FRPA 3SOTA 5KVEL 3QRGL 4DAGH 3KLQA 2Z8RA 4X7TB 2QHLA 5JQ6H 5FUOL 1MUJB 2NY1C 3M7FB 4L29B 5DJ2A 5F9WC 3V0FA 1E4XH 3GMLB 2MPAL 1F1DA 2EKJA 2ZOLB 4FD0A 4HH9B 5MERB 5BMFH 4R3SB 4AG4H 2XLLA 4KJQD 2FJHB 3MJGX 3LVEA 4R0LC 1LP9F 3BPOC 2ZE0A 4OB5H 1NCDH 1EBPA 3SYCA 5FOBB 3NAAL 4LASH 3HLKA 2R29A 3LRSA 1YEEH 3JQOB 3O8XC 4JRXD 12E8H 1YNTF 4DCQB 2CWRA 2FQGA 35C8L 3BFQG 3PWVB 4GSDH 4XWGL 1YMHB 1HWGB 4ZMQA 4O2EB 4UTAH 5L4MA 2GBAA 4TV3A 1E67A 2VLLA 1LP9B 1Q9WB 4GFXA 4P8QA 1RIHL 4L3CB 1CLVA 4A1RA 1YNTB 3RAJL 4YH6A 4MCZB 1Y6NR 5IEKB 2QPEB 1RH8A 3ABLB 4YDLC 1ZS8B 3O6FD 4M3JA 4X6CB 1I82A 4POZC 1XGRB 5KYWB 1MH5A 1JSYA 3O9WD 3RL1B 4L4VB 3FU7A 4FFVC 2BJML 4XCEA 3CSGA 2JV6A 1FZOA 3D06A 5DEFA 2WLZA 3LNGA 1J1XH 2X9YA 4I3RH 4W1TA 1D5RA 1PSKL 1H3TA 2D8KA 4UB0L 3GRBA 4KZEL 2GY5A 4NNPL 2CUAA 2VMFA 5IJCC 3RFZA 2F5BL 2VLME 3EH1A 3I3DA 5ANHA 3SYOA 4AMKH 4M4PA 1X5MA 4A63A 2ROYA 3PQYA 3VXUE 5K5YA 1T4KB 2G0KA 1W8NA 4ZMNA 1U8MB 2ADFH 1OCRB 1A4JA 1ET7A 1CR9H 1QNIA 2HA1A 5HDBE 2ADIB 5ESQB 4P5TB 1GW0A 2BDNL 1DJIA 4ZMYA 2P47B 1FNLA 5IVXA 2B77A 3WJMB 2J4WH 3X1EA 1S9VA 2PPCA 2D31A 1FG2A 5F89B 1DUZA 2IQAB 1S7SA 3D85D 3EYOB 3VD5A 4EPSA 5CGMA 1QSEE 2IWKA 2NY6C 2VXQL 3F58L 2R23B 4WY7L 1GZQB 3HI1B 2X38A 5HDQL 3EJPA 3SBRA 4FQLL 1DCEA 1C5DB 3ATDA 5B1JC 3O6FB 5ECJE 1K72A 1KN4L 1JPFB 3IU3A 5FO7A 3BT2H 3HUJB 2ICWI 4XVSH 1VFAB 3E9UA 1JZDC 5FUCE 5ACLA 2YUXA 1OAQH 3DHJA 3MLZH 3WFBL 4HX1B 2J5LC 5I2IA 3R0NA 5C9JA 4HCIA 4M93B 4Y19A 4JBSA 4EAEA 3D69B 4EBQL 1TZOA 1ZWIB 4OFDA 3MGOB 4WTZG 3BVNA 2PR4H 4KY1H 1IT9H 4JM2F 3VYPA 3G9VA 1ZT4B 1HX0A 5GSRB 4NIKB 1RY7B 1SYSB 3NJHA 4GW1B 3RY6A 2R9HD 1KENL 2CDFB 3QXAA 2DTMH 3OPUA 3CQQA 1MAJA 5E7FA 2Z31C 1KSRA 3FRUB 4MZRA 5A43C 1Z9OA 1LLAA 3FTGA 1IKNC 1IBHA 4GS7C 4NFBA 2NTFB 3BVUA 2QBWA 3DV6B 4HJ0D 1AQ8A 4B9PA 1UADC 2B2XL 4YK4B 5D5MF 5DUMH 3T09A 4EUPA 2H2PD 3ALXA 5IMOA 1H19A 3SE4A 3V0WL 5E6RB 2D7OA 3GSUB 4Z7UE 2AEQH 5D70L 4GXFA 4X6FB 4EDXA 2JQMA 3BWUF 2AXGA 2CO4A 3G5VA 2B9AA 3ZT7A 3WGUB 1YN6B 2W07A 1UB6B 2F5AH 4AYGA 1IGTA 4AV5A 3L4XA 1AS7A 2B1OA 3ATAA 2ICEC 3B1UA 3HHSA 4XMUA 3RVTC 3WNPA 3CTTA 4BE6A 4F5CE 1OK8A 3IGUA 3S48A 3FHAA 4DESA 1ADQL 2O5ZH 2HPOA 4PTTB 1GR7A 4X6CE 3CH8A 2P8PA 3N9GL 2G75A 5EORL 4B96A 4RQQA 1KCLA 1YNLL 1AQMA 3I02A 3UOAB 1A9BB 4UQ2B 3G5WA 4L4VE 3F83A 4FZEH 1FL3B 1TETL 5LHDA 2K78A 5EF0A 3T2PA 4WV1C 5GISL 1MFDL 3WDIA 3TBYA 3L54A 2EC9T 4IBYA 4PWIA 4NZJA 1H0DA 1IUZA 2DJUA 3A67L 3QUKA 2WD0A 4L23A 4O2CB 5CZVL 2GEQA 4NO5B 1A7PH 4U4BA 1DSFL 3IJEA 4AGMA 5AKSA 4LLWA 1ITBB 3N44B 5AD0A 2BX5A 5B39A 2V3EA 1OSZA 1KOAA 4JRXE 4ACPA 1TTAA 4F2EA 1UH4A 1P53A 4X6DE 2XRAH 5DJDB 3EGDA 2XA8L 2C9VA 3KDMA 3CX5K 4ZTOL 4PP2B 3PQYD 2X05A 3EGSA 4M8QB 3I9GH 1RJLB 4KKQA 1ACYH 4ZUVA 4NO0D 3HMXH 3GMNB 4I87A 2MOGA 5DURD 4PJHF 2B14A 4FQXB 2C9PA 3PHQB 4Z18A 2H1LM 4LEOB 5A6MA 2N56A 4Y5XB 2VZ3A 3MMEB 1HHIA 4Y4KA 3S4SA 4Y88A 5TK2A 4CA4A 1KBKA 3HUJE 1ESOA 4LLVB 5SV4A 1KT2A 2BVPB 2ZOKA 3WLBA 1S3KH 1UACH 2E27L 3WIFB 4OGZA 1LO2L 3QNZB 5LXGL 1Y1DA 1RZKL 3ETTA 5DUPL 4GMTH 4AITA 3LQZB 1MCPL 2J7LA 2NY5L 1P4LA 2CM5A 2VM9A 3WEXB 1JV2A 3ULUC 2RH0A 4JO4H 3KPRA 1XH3A 1FZJB 4XMXA 4N9OB 1BMGA 3CFKA 4Q97A 1JWSA 4YDMA 4LHJB 5BRPA 5F7LB 5HHMB 3GXPA 3U1PA 1JTOA 1RZJC 5BZDA 3GTVA 1I9RH 4XCFH 2LU3A 1HWWA 1YPZA 3NTCL 4X9HA 1KTRL 2JE8A 3FQTB 3LEYL 4Z0BH 4UQAA 3HIZA 4DIXA 4Z5RB 5TE7L 3GEFA 4MXVE 1BFVL 4HUCA 2A5UA 4WO4C 5KVGE 1FO0B 3JUYA 1CTNA 2WXLA 3ES6A 2Q2EB 1BZEA 1FYTA 5F6HJ 2OMVA 4F9LC 1ZMYA 5B4MC 1Z1WA 3FTXA 5EN2B 3U9WA 4A7SA 5KS9B 1FL5A 1DJZA 3U83A 4P2OA 4IEFB 2AEIT 4CUCA 4HKJA 2H6OA 4P2RA 1T66C 1UZ8A 3L8QA 4K2UH 4Y5VC 4JZOB 5DS8A 3NEXA 4CRPA 4JANA 5DVLA 2O6CA 2WAQA 4ZUUA 1SYVA 4NGHH 3FBQA 2GC4C 3OX8B 5C0JA 4IRSB 1JUFA 3MNWA 4GAJL 3U2IA 3CFIC 2F1BA 1QO3B 2BERA 1A3LL 1R5VB 2P44B 4FI8A 1I75A 1XGQB 3QH3B 1Q0YH 4RESB 2IOIA 4PLKD 2QGEA 4PI2A 1WHPA 2BIPA 4LF3B 3V5KA 4ODHH 4KMTH 3GK8H 3LKSA 3HNVL 2DQFB 1RZFH 4Y5YA 3VU1A 4MA3A 2V2XA 3S5YA 4XOCA 3LSOA 3TVMC 4JPIA 4JZJB 4ENED 4NQVB 4PRNA 2JFCA 2VQUA 2H8PA 1T04B 4AUJA 1HWHB 4FL4C 2OMXB 3N55A 4LZKA 4QRTA 1OE2A 5IJVB 4JHAH 1AAJA 1JERA 3NIDB 1Q72H 4IKJA 2WANA 3ZDZE 3NJGA 1EZUA 2A6IB 2ZUQB 3JTBA 3T6ZA 5C6TL 5ICZA 1U8LB 5IKCA 5C92A 2H47C 4GUCA 2XZAL 4GI9A 5FYKL 3CZEA 4ACTA 5DUBA 3BP4A 2EXSA 3F6JA 2QEJA 1TKWB 4JO3H 1XZ0A 4XE5B 1X5IA 5IT2H 2PCPB 1B0WA 1UCBL 2WXNA 3L48A 3DIFA 5K1VA 2WO2B 3Q0HA 2FTAA 1A1MA 1EAOA 1H3XA 3AS2A 3DVGA 4DOHE 2YA0A 4EOWL 5I1HH 4GQZA 4ETQB 5IESL 3RPBA 4L1DA 4HFUH 1GCFA 3NPZB 1F45A 2QFPA 4NQTA 4Y4KD 1UZ6F 5CO1A 3RQ3A 3EHBB 3LX9A 4UAHA 5BZZA 2FK9A 1IE4A 3M46A 5D8JL 1NFDF 2ROXA 4TPRH 3SE8H 4CJ1A 2QPDB 5JLZA 4NQDA 4G7YL 1UTDA 3NT0A 2R29H 4Y4FD 4KK6D 3FTVA 4APQC 1KXTB 3K6IA 2JI2A 2NUTA 3WKNA 3IKCA 4JFFB 2F74B 4M6OH 3EO9L 4JDZB 4K7PH 3RWEA 1GCYA 2XPGB 3NDZE 1U8HB 3JSSA 4KKPA 4HPHA 2XWZA 4YHPA 4HUVB 2GG1A 3KPRD 3L9YA 4X8XA 2XG5B 3OAUL 1E4WL 1QFHA 3UEQA 1ZSDB 3PL6A 2HMIC 3US0A 4JFZL 2F6AA 2G9KA 1Q94B 5I24A 1A4KB 3ARDA 1B6DA 1TJGH 3VRJB 4QHPA 4XCNB 1UEMA 4RAUA 3T2NL 5HJDA 5JIPA 3K8MA 3QJHA 5KS9E 2XWCA 5KUKA 5IVXE 4RA3A 2F8VA 1BQ5A 2PUQT 2YWZA 5EBMA 5FLVA 3BGFB 2HZHA 4B5EA 2AJZA 2ITDB 4ELMB 1FYTD 1JVLA 5DLML 2WTPA 2X28A 1PZCA 3LQAL 3MRIA 1M2VA 3MLPA 2WUCL 4P2OD 5C6PB 2EIKB 3O6ML 1KC5L 5MP6H 2RTTA 1V54B 3FT3A 4K7FB 1J86A 2Z92A 4P2RD 3C08L 1I4FA 2X70A 2PO6D 4KGJA 4DZ8B 2F7RA 2YUWA 4G6MH 4H4NA 5DC2A 3K2KA 1S4IA 4WU7A 1KCRH 5GGSA 2F53B 4OIFA 4MXQC 15C8L 5EOCH 2WVSA 4OM1H 4F2MB 2E0PA 4P4KA 3DTXB 5IVZA 5H37A 2GUOB 4JDVB 1YQVH 4CMMA 1J8HA 4MLSA 4XNQA 2IDTA 2JVUA 3Q43A 4OQTH 1OD7A 1TTFA 3JV6A 1ZEAL 2O26U 4Y2DA 1HNYA 2YGOA 3HHMA 3NIDE 2XKNB 5HHQB 5F7WC 1F13A 2QTVA 4YVNA 4FZ8H 3CDCA 4OTXL 2WM0A 4NEHB 5H35B 5A2FA 5BZWB 1PPIA 1PG7X 2DMGA 5FK9A 1KTCA 4GSXA 2DWSA 3O6LH 1QAWA 5GZNC 4F7TB 5KN5B 5CCKL 1MCSA 3B2MA 2VZOA 4B5ZA 3Q8AA 4MA7H 2VXUL 5JHMA 4PWJA 3PAZA 4WUKH 4ZTPL 2Y3NA 2PO6B 3OTTA 4PJBB 4LSRH 1EDYA 5CHNA 3GXDA 3M86A 3CFBA 1P7HL 3D5OF 2BXZA 5HJGA 3VD7A 4POYA 3IMSA 1T2QH 2EUZA 2YD5A 1A64A 4MKTA 4LIQH 2XA3A 2NTSP 1TIUA 3C5SB 5D7JB 3PP3H 1EIBA 2RCSH 4W9FC 1JGDA 1JGEB 2DJ4A 2ZAGA 4E9TA 3PY9A 2EINB 1UENA 4WHTA 2IFFL 4WFED 5AOMA 5HHVH 2XQYG 3VX1A 1YC7A 2OL3A 3UJIL 4LE8A 3BUDA 2JKXA 3UIYA 5LGJB 4BWUA 4JFFE 1U8NA 2HT3D 3I85A 3QIWD 1ET5A 3IMBA 1G9NH 4NQDD 3LPGA 2FH6A 5A16B 4AYFB 3WL9B 1FIGH 3B7UX 1HQ4B 3HZYA 4M29A 3ME0A 4PD4J 4G6FB 3C5ZB 4NUQA 3RE0A 3MRCB 1BOGA 1PYWA 1L0PA 3CVIH 2BM3A 2KYIA 1F90H 3T0DA 2NW2A 1E65A 2ZCKL 3RKDC 3VRIA 1XGYH 3ARDD 1ND0B 1LWHA 2ZAHA 4NO3A 2FEJA 2CGRH 2JH2A 3MLYH 4Z7VA 4ELME 3WUWB 1HZLA 1SXSA 5CBAB 3S5ZA 1G1OA 5HTSA 3RIAF 1UZGA 3RGVA 2R1YA 2TRHA 4N0YH 3FFDB 1IL1B 5I16A 3LAFA 3BP6B 4QF1B 5CJBA 3VXQA 4UUJB 5IREA 2JKLA 2X09A 1FNGA 5B1KA 4Q89A 3X3FL 4GG8A 4JFQA 5C0BA 1L9QA 4AGLA 1TQCB 4FXKB 2F53E 4G6KH 5DJZA 4OBSA 1QTPA 3T3ME 3IFOB 3QRLA 1EHNA 1RZ8A 3FCTA 3SGEI 4BK5A 5EBLB 4EZMA 5L8JB 3HB3D 1NDTA 1QPPA 3QIWB 2DLEA 1DQIA 1WISA 5MEND 1ZSHA 2CALA 2IMMA 3GSXB 3KPRE 3N42F 2NZ9C 1BF2A 4MQ7B 2E56A 3U46B 2J12B 3FO2B 4PRDB 3UJTH 4EI6B 4P4KD 1N67A 5GGRA 4GG6F 5TFSH 1JGLL 4PLJC 4M43H 4RFOH 4GRWB 4CN6A 2V6HA 1D6EA 3V6FB 4NO2B 4S2SB 2WV3A 4Y2DD 2AJ3B 1QSVA 4ES9A 1B0RA 3N42B 2R0LH 1ZVNA 5BVJB 1D5MA 5C0EB 2FSDA 3WNKA 4BQ6A 1OPGL 3RGBA 5T1JA 5F0MB 4GG6B 2Y1ZA 4LGPB 1KGJA 1JNLH 1GY2A 2FIRT 5K1JA 4P2RE 1LK2A 4U7SA 5SWSA 3HI5H 4PJBE 4JX0A 5TQ0L 5HYJA 2F15A 1EAJA 4HWBA 2NSQA 2O4EA 3U2SA 2QSTA 1BZQK 2VM3A 5GRUL 3QJFA 4C56D 4W4NA 1B4TA 3EOBA 1L0XA 4DKEL 3AU0A 3SCMB 5JORB 4S1DD 2LTQB 4TVSa 4Y1SA 3HB3B 1QRNA 4DPRA 1UFGA 1HZKA 3SY6A 4IS6A 2ZX5A 4RWHA 5MENB 1HZHL 1TZIA 3OJ2C 1JTPA 2ZXGA 3GRGA 4YDIL 2VB5A 1HTYA 1KTDA 3GMRB 3ARFC 4WCYL 5CSBA 1A7NL 1JZGA 3B5HA 5AAMA 5C7XL 5C09A 1EJ6A 4UNVA 5FYKE 5HYSG 1HS6A 3BDYH 1DEEA 3O0RH 1O9VA 3IDMA 4ZS7L 5IK3A 4U31A 3PNRB 1JNHA 4NJAH 2YJQA 4D9RD 1M7DA 1CT8A 1C16B 1WZMA 3GHBL 4BUGA 4EIBA 2FGWH 4ZOCA 3V0AC 5DYOA 3MCLH 2X4SB 4R2GB 3VNYA 2D7MA 3ZKSD 5C3LD 1I8AA 4FNUA 3O3EA 2UYLB 4XPTL 4BH7B 3MODH 2DZEA 1E5ZA 4MD4A 4L3EA 5AL0A 3KYOA 2NDFA 1T5WA 3G5ZB 5KSUA 4L18A 1ZDQA 5D93B 4BH8B 1E9QB 1FGNH 3SZ6A 3HN3A 3SQOH 1SEQH 2AK4B 4LNRB 4FMVA 1XZWA 2EDNA 4YXKL 1DFXA 2JI1A 2BIOA 2QPUA 4KKNA 3MU3A 4C56B 3Q8BA 3BAEH 2JIXA 4CVXB 1EJFA 3U6XA 2DQ6A 3T6WA 1OGAA 4HWEL 2H45A 5CLTA 3RZCB 4XOEA 1S7WA 3QUZD 4WFEE 2V3DA 3GPEA 2AJXH 1CD1B 3ZMEA 4YLQT 3BH9B 1GJWA 1PG7L 2D7TL 4WW1A 2X6VA 1EBAA 1NCCL 5CM1A 2V5YA 5AW4B 4MCYA 4QWWD 5CGTA 5C0BD 1RUAL 2IANA 3QWOA 2YC1B 3K4AA 4NQDE 3U4EA 5GQBA 5KVFH 2KDYA 5C0RL 3S3PA 4JFTA 4M8RA 5AZEH 1JPGB 2R4RL 4PJXF 1JZ3A 1ES0A 5C0FA 1WBXB 1A4BA 4TVUA 2LGNA 2GT9B 4HBCL 4PJ5B 3ARGC 1U8PB 3KL5A 1TJIH 4GRWE 4R4NC 3ROOB 1BM7A 1H3UA 3MJ8A 5D7KD 4BWTA 1ROWA 1AZNA 1A8JH 4UI2A 3CLFL 2DWEB 1AGDA 3MGTA 1QSFB 4ONFH 2VDRB 4H7VA 1OALA 4YHLL 3BEWB 3RI5K 2NNRA 5B8CA 3US1A 2YMXH 1J0HA 3B5GA 5EZLB 4XPHH 5I18H 3GBML 3I3EA 1V7NH 4LSSL 4NRZB 1LHZA 1LO5B 2HTKD 3H4HA 4RIRA 4BKTC 3WMSA 2H3NA 3PFUA 3GSVB 4E0RB 5C0AD 4ZG1A 3GSNB 4WTQA 3ECVA 2BY1A 2NPLX 3AM8C 2X6BA 4KVCL 4HIHA 3PP4H 4U3HA 1I7UA 4FQHA 3DX9B 1JF1A 1SHXA 5LAPA 3UAFA 3NFSL 3QUZB 2PKDA 2H0EA 5LGHH 1C5BH 1FGVH 5HGGS 5DMYA 2QVMA 4KDVA 4JW3A 2C8NA 1XD0A 2BSTB 4IBLT 5GS0L 3F7PC 3RURA 2CK0L 2JTDA 3K2UL 4FN0A 3T2QA 4KI5F 5MENE 4HUNB 4R26L 1IM9D 2OTUA 4RZKA 2DBJA 4OCMC 2WWKT 4H8VA 3WSQL 1S7UB 3VWJA 1E50A 3PGCB 1OT2A 4M3KB 3TBSB 5DT1H 2GHZA 3V6OA 5CEZH 1ILSA 4LMQI 4UINL 1FCCA 3WE1A 3WTWA 2AZAA 2CA4A 5C09D 4HJUA 4OGXH 1JL8A 4K73A 4K71B 1ADWA 3DRTA 1SN5A 4KTDL 3I2CL 2CBOA 4DGYH 2EXTA 2FBRA 5E5LA 1WBYB 1I1AC 4NQXA 2ITFA 3ETSA 4N5UA 2A6KB 4X4XA 4PREB 5DO2D 4MTMA 3S96A 3WS3A 5E1AB 1WT5C 5C0AB 3CD4A 3QDGB 3N50A 3KBEA 3P73B 4FYSA 4ZUTB 1GOHA 3L4ZA 3QG7L 4LVHB 4X80L 5T3ZD 1C12A 4Y1AB 3VXPA 5DJXB 4D8PA 1JYXA 4BGLA 4C56E 3QCVH 1D7DA 1EEYA 3KS0J 5FR3A 1MY5A 4WTZA 5H37H 4IBQA 1PEZA 3A6CL 4PWKA 2ZONA 5E2WH 2FNBA 4YSAA 1C7TA 3PXJA 3O2WL 5DC0A 1IGJB 3CZFB 1RUMH 4G9DA 4QCIB 4JKWA 1MWAA 2Y5TA 4MBOA 1Y6MR 1X5AA 4PJIF 3CSFA 3LYRA 3CVHA 4P07A 2VUOA 3H56A 4OCWH 4DP7X 5JHLL 3V0IA 2D0HA 2E7LC 1CXLA 2DQDH 1MFCH 2J1KA 4HV8A 3VRLF 4Z77A 3NEEA 4UM8A 5T3XH 2IPTL 4D9RE 3QBTB 3A21A 3KVPA 3WUWG 3RDTA 3QUYC 4WI0A 5CEYB 3QQ3B 3VFRA 5KSAC 4AQOA 5JIIA 2X4OA 5JNYA 4KJWC 4OF7A 3GMPB 1BLNA 1IC5H 3T0WA 3ZTNH 4RGOH 1LYQA 5F9AC 2EIBA 4KHXL 1EJOL 3PWNA 1ITCA 1NUFA 1QX1A 3LIZA 3NCFB 4WAFA 2BHYA 3HJ0A 1XF3A 3VGAB 3WFHB 3B3IB 4W6XB 2D9QB 2BWIA 3SKOA 4U6HA 3L16A 2NR6A 1QATA 4I9XA 3OHXA 3PREA 1LQSR 5ADOL 3BQUA 5ENWA 1JXGA 3PDOA 4PG2A 1UG9A 3QNYA 1YY9D 4YXHH 3I6SA 2OI9C 4XR8C 4XHJD 4DVRL 3VD1A 1LEGB 1SFDA 1QBLL 1TCRB 2CJ3A 2OL3H 5CFHA 5I1CH 2H0PA 1CF1A 3QWRD 1HL9A 5EU3A 2B1HH 3PGDA 3P2TA 3C2AL 3DV4A 1M3JA 3MX0A 2APVA 3TO2A 2ZPKH 4ZFZA 5AAPA 1YAZA 2ATKA 1IB5A 3GMMB 2KKQA 5C0BE 1PX8A 1HCVA 4OD2B 4YGAB 4OLVL 1RHHA 1CGYA 4N28A 4E36A 4RLDA 3ECUA 2VIRB 2NQDA 4FS0A 2YAEA 4P46B 1AXTH 1H9VA 1ASQA 4DTGH 2X3AA 4PM1A 4KRMB 1N64H 1KGXA 1U95B 4XWOC 4JFDB 1KLUB 3EFOB 1F5WA 2XY2A 4YDVA 4GUPB 5D7KE 1FFOB 4IJTA 1EXGA 1E6OL 1NTDA 2JLLA 1MVUA 5F7KC 3T4AC 4C4KT 4C54A 1CL7I 3QRFM 4PTUB 4RRPG 4ZXBC 4AUUA 4Q9CA 2A0LC 4AKPA 4J3OD 1FNAA 4U1NA 5EF1A 3HNSL 3RPIB 3R4DA 4JJ5B 5KW9H 4HIEA 1CICD 2J1WA 1MEXL 1WBZA 5C0AE 2HT4C 5GRJH 3X12A 2KLTA 3LHPH 3JVGC 2DWYA 3T1WA 2ZP8A 4ODUB 1CFQA 1KNOB 5JPMA 4XVJH 3MRFA 4MA8L 4I2XA 5JPNA 2ATPB 3CN0A 4GRMB 1ICTA 3ZTJH 2G2RB 5E99L 2A74A 3W39B 3RRQA 3IRCA 4LXFA 4WSGA 1ZTMA 2UXGA 1MJJB 4X8JB 3ARBA 1TZHB 2B5IB 4GAFB 1KPUA 4Q6IC 2QADB 4U3SA 3CMOL 1PZBA 2HH0L 1NAKH 1S9YB 2R1XA 3MACL 5IB3A 1WA1X 3H3PH 3INOA 1IBBA 3ZQ9A 3WHXA 2C3XA 1RZGB 2CLRA 3D3VA 2CXGA 4OLZL 2QR0B 2B3IA 4M3HA 3V52L 2AVFA 3T2LA 4NXSA 1JD7A 2YPLA 2PYEB 1PFCA 4CMHB 1EJ8A 5BRQA 1U8IB 3BUPA 2I9LA 5CZRA 4NKIH 4Z7QF 3PDDA 4GO8A 2VDOL 3WFZA 3X13B 4OGYL 4DGVL 2GEEA 3BYTA 4UIMB 2Q3AA 2WLIA 3M7OA 4I4WB 2P43B 4LAQH 3FULA 3MLWH 1F11A 1OM3H 3P3SA 1OF2B 3UGXA 4HWBH 4WDIA 4KROB 5CJQL 2QMKA 4PS8A 1LEIB 4TVPL 4ZS6C 2CDGB 2JF1A 3KCPB 3EZ8A 3SEPA 3BXNA 3N91A 3K91A 5DRZA 1NBZA 2IXQA 1FL6A 5T3ZE 2NYZA 4OF6A 2ED7A 2YAOA 5C2BH 5BCAA 5HI4C 5HHNA 3IGLA 3KGSA 3KM2A 3ZTDC 1EFXD 4HEMA 4ZO7A 2CNYA 4J6IA 4QRQB 5TH2B 1A25A 3UZVB 5L8LB 1M57B 4PR5A 5KG9A 4J3XA 1F4YH 2E9BA 3AREB 4WI5A 3VCLB 2ZNXA 1S7RB 3VMNA 3QWQB 3T0VA 5HXMA 3FQXB 4KXCA 4M5SA 1X4ZA 2P49B 3HOGA 1QR1B 3HVDA 1Q9WA 2FWLB 3FO1B 4FFTA 3W11D 3WIAA 3IJ8A 4ZQKB 2WYIA 5GGTA 1AXSA 5K9QI 3EFDL 2FNWA 2EO9A 4BE5A 3QI9C 3UJJL 4F7CA 4U1LB 1CURA 1Z5LA 4JKPL 1EK3A 4JFDE 4PH8A 4YPGA 4LLAA 4J7RA 4WK0B 3PF2A 1SMDA 2DEYX 4P23C 5C0DA 1G7MA 2WBKA 4HEPG 4ENZA 5E2UL 1TVBB 2X87A 2WQRA 2DY2A 2C4FT 1OP5H 4GIAA 1I3VA 1A7OL 3ZDXE 3ZMRA 1O6SA 4GJTB 1FNSH 5DDHA 3T4YB 5IROC 3F05A 4H8HA 3IVKB 5J8OA 4Y1TA 3MXVH 3P9LB 1P4IH 1QFOA 4LRNH 5D6CB 3R1GL 2ZWLT 3UYRH 4U1MA 1EFXB 4AM0Q 1RAMA 4IIQB 4Q0XL 2EYSA 2PTTB 4O2FB 1HHHB 4ZOAA 5KYYA 1RJZB 1U4EA 4QRFA 3GUTA 1FSKB 4PBWD 2GSGB 2A6DA 5ESQA 4CL7A 4P5TA 1NMBH 1RVFL 5AFAA 1EEQA 1IM3B 1UXWB 1ZK9A 5HGAA 5KWYC 2JJTC 1H9DA 2BK8A 4PS4H 5EUOB 3PIQA 2R23A 3C75A 3FU5A 3D34A 1AHWC 1E4JA 1JZHA 4LKXB 5FO9B 5I1EL 1P6AB 4D3CL 2ZF9A 1UH3A 4A67A 5D96C 1RL1A 3UAEA 3DJTA 1C5DA 1D7FA 2I5YH 1F58L 2EEDA 4QHLA 3LH9A 3U9PH 3CFEA 1MQKH 4TQ8A 3W0WB 1CYXA 3KH4A 2WXHA 1A6ZA 1TPXB 4TNWK 2OJZH 5CNHA 3SDAC 5GZOA 1PQZA 3V6OE 4F80A 1R47A 2OK0L 4A2EA 4B9YA 2CKBL 4AM0B 1BD2D 2VDLB 3TA4D 2A77H 3IJSB 5FF6B 4FI7A 3VE0B 4BRJA 5HBBA 1DQJB 4N86A 1NAML 4BSJA 1SDYA 2NY3B 4TSCL 4GW1A 1D7CA 5I1KL 3BAYA 3K2MC 1AG0A 4NUJB 4ABVA 4WFGD 2MHAA 5TPWL 4U1GC 3BN9C 2NTFA 4N0CC 2JKRM 2VMJA 4ODWB 1W9XA 3QHTC 3C6LD 1MIMH 4JM2A 4UIKH 3WN5C 1KCKA 4JFXB 4X5WA 4GKLA 1UA7A 4G42A 1EH9A 3CDZB 1NDMB 3EJZC 3GSUA 4HUWB 3S37H 5A6IA 1L6ZA 2I85A 2G5BA 3KBHE 1Z6JT 4QHUA 3THMH 4XXWC 4Z78A 1KELH 4LSTH 2N7BA 2B1AL 4BZ2L 3U36A 2VDOB 4ZI8A 4N2LA 1FRGH 3S98A 2WLLB 4HUMB 5D5MA 1E5YA 1W72B 4F58H 4YGVB 1H8NA 1NGXB 2ZF8A 5C8JB 1NLBH 4BFJA 3DI2B 5FKAB 3DX7A 5D4QA 5KBDA 1HVXA 4YFEA 2GUYA 1I7RA 3EYQD 3QDMD 3HBZA 1Z0MA 4KJYA 2OCCB 4UQIM 1XT5A 1D5BA 3F7VA 5E8EB 2Z65C 3IEAA 1BF5A 1W0VB 4IBVA 3VFGL 3O2DA 1IGFH 5I19L 1T3FB 4M8UA 1B0IA 1JGUH 1YYML 4M7ZB 3D4GA 3DUUA 3U0WH 1DVSA 1CGSH 5A6LA 2D03H 3FFCB 1MLBB 4NO5A 4PRPA 5CGYC 4Z0XA 3RGHA 4OUUA 2XG4B 1D9KA 3P0YL 1ZXQA 4AOFA 4BHUA 4MRBA 1MJUH 3QG6B 4YIQA 2X4RA 2EYRA 2PW2A 1NGZB 4OCYH 5CR1A 4Z23A 2G4GA 3CFQA 4RFEB 1C1EH 4MS8D 5B3NA 4XE0A 4URKA 3N43F 2X0VA 1S78D 4LQFH 1OAYH 2W91A 1N7MH 2XQYA 4FJYA 3KW8A 1RJLA 1WO2A 4BFIA 5CEXB 1IGYB 4UZUA 5CIPA 4JS7A 5IQOA 5EUOE 1KCUL 3G6DH 1DBAH 2VDNH 2VSMB 4NIYE 4G72B 5LN8A 4YSUA 2IDSA 1LDPH 3RX7A 1AMYA 3Q5YA 4M1GL 3N43B 4Z3TA 2FLMA 5ICXB 2VRQA 2GCYB 5DJ6B 4OZGF 4DZBA 2F8OA 5DMKB 4EXKA 2BP0B 1LWJA 1P7QD 1UASA 4P4RA 3QDMB 4TUJB 4MFHA 4PJHA 1AR1D 2Q2LA 4NQCD 3X14B 1I8MA 1DQML 1W8OA 2PF6A 1HYSC 1BWMA 5F71A 1U3YA 3JTSB 2E9JA 5C0CA 3NZUA 5GZOD 1A66A 4ZUWA 4LPUA 1F2XK 1F00I 3X3GL 3KH3A 4M9PA 4UNTA 2IH1B 4DGIL 4FXGC 3ELAT 4U0RB 4DN3L 2L7UA 5DTFB 3SY0B 2CRMA 2K6YA 5HYFA 4G7VH 1AS6A 2YSSA 2VXQA 2ZKHL 1CDJA 3FT4A 4QTFA 3RNKB 4AK2A 4Z5RA 1YEGH 5EU7E 3BUBA 4W9JC 1PF3A 2IH3A 1ZLEA 2QKIA 5LO7A 3SBWA 3IFLH 3AFLA 3IGAB 3PG2A 5EOQL 4EMZA 1SDDA 2HWZH 2WLKA 3FN0H 2D0GA 2YPVL 1L4IA 5LWYH 5EN2A 3X1FA 2NYYD 4QKTA 1TSRA 4YDJB 4M4RA 4TNFA 1HEZA 4NWUL 5CAYB 3JWNC 3IJYA 4NZFA 2CKBB 2WOBA 3WJJA 3WV0A 3LKNB 2B4CC 1P7QB 2JCWA 2Z35B 1NAMB 3HC4L 4H1LB 4HSAC 2OBGA 5EA0H 4C55A 5LAXB 1AR1B 4NQCB 1IAMA 3EDEA 2O5NA 1CZ8L 1BVNT 2QQNL 1TJXA 4OI8A 1BD2E 4NM4H 2YKKA 3A5VA 1U8OA 1WP6A 2VR9A 3WS6C 5F9JA 1NSNL 1HDMB 4LB8A 3ZMNA 3OAYH 2ZX8A 2YQ2A 3ZYOA 4ALAL 4CSTA 1DBMH 5J57B 4MAYC 1FV1B 5E1GA 5CGBA 3QYNA 4RGND 2D3JA 3ILQC 1BZ7A 1F0LA 1MCLA 1PNCA 3CDGB 4PP1C 3AG3B 4XI5C 4WFGE 3SDDA 1T5XB 2AEPH 1T04A 5F96H 1R75A 3CUPB 3A4EA 1AXIB 4UILH 2K4AA 5ICYB 4F1SA 1BAFL 3GNMH 3UTTB 1UWGH 4E5XB 5IFJA 2QVFB 1GGCH 3DPDA 5LXVA 4LESA 1B4JL 3UROR 5D1QA 3A24A 3O3DB 1U8LA 3EYSH 2JJSC 3G04B 1ADQA 1TITA 3CZLA 3M8OL 4HOZA 1XGTA 1N5YL 4JHWH 1E42A 1H8OA 2Y6SD 2ZT9C 4BEIA 3QDAA 1VPOL 4X7FC 1WFUA 1X5LA 1T7ZA 5I0XA 4UYPA 5E00B 1E3ZA 3OQ3B 4G6AC 4FKHA 5C0GA 2PCPA 3ZE0E 5I0DA 5HYSA 4OIBA 1NGPL 3O3AA 2PXYC 1BM3L 4CBZA 3IF1B 2OMYB 4H26B 1OP3H 3EOYG 4PGBB 1IAII 4HSCX 4WWID 3STZA 3TBVA 1GAFL 1G6RA 2MIZA 1OTUC 2BIMA 5I15L 1CIUA 5AB9A 1RPKA 2BW5A 5I6XC 1L3NA 1OAXH 2XN9D 3QDME 3D48R 4LCWB 4IBZA 1EXUB 3GXMA 4NP4H 4YDKL 1U8JA 1CBVH 3SDCD 3CBKB 3QFJA 3QJRB 3CQFA 3REWB 1U8KB 4G70B 3RILA 5E08L 4IU2A 4GRLD 2CO2A 4B27A 2IAMB 1AY1H 1V7MH 2DRUA 2J88H 2YKLH 3M07A 4YHKL 5DK2A 1K6QL 2YHGA 4HFWB 4WI9A 1PZSA 1EGJL 3PAUA 4Q2ZB 3A47A 4I0PC 4TXVB 3JWOH 5FGBA 1NFDA 1CG9A 4YQXL 4PJ9C 4JMXA 4QRSB 4WGVB 1PZ3A 1IC1A 3NJNA 4MNQD 3FB7B 2VDKH 3KGRA 5GGTH 3BWSA 1QLEL 4GKSA 4MJ6B 5BQDA 5F3HA 1UXMA 2I9TA 4L1HA 2CBMA 4JN2A 2XNAB 3AS1A 2J6EL 4RMQA 2ITDA 5D2LE 1X44A 2EDBA 3S35X 4QXWA 2AQPA 4BFGA 4A04A 1HOCB 2CG9X 5I76B 2J8UB 1J0KA 1DO6A 3V9FA 4Y9GA 2XN9B 4A38A 3FQ2A 3KWWA 3SPVA 1E6JL 2E7BA 3P4LA 4Q6YA 4KO7A 4NQCE 4P57A 4U1SB 5CLXA 5D6DC 3RI5F 2BY0A 1P5UB 3D25A 3GO1H 4OFVA 1NOFA 2NCEA 1IARB 4H8WH 1NLDH 2VDQB 3CC5B 3GPSA 3OKLA 3ZQWA 4EI5A 5T1LB 4DEPC 1O7DE 4GRLB 3B7TA 3TZVD 1RU9L 2NW3B 4JDEA 4AGQA 1JCKA 4Q9BA 2YA2A 3GI9H 4F2MA 4QOKA 5J56B 3AWGA 3LPOA 4L1SA 4AI7A 5IM7A 1I3UA 2W9EL 3QUXD 4LSPL 1NGWA 1K2DB 2D4FA 3JYCA 5IMKA 1A7BA 3CFDA 2L7JA 3QORC 5C86A 3AS0A 3PAVA 1QBMH 2EDRA 3WNIA 1OT1A 4FI6A 4O51A 5F0JB 3X17A 5F3BB 1XH0A 4MNQB 5DD5H 2F58H 3SDDD 3VI4B 5D9SA 1GGBL 5GGUB 1E2VA 2E86A 2DQCH 2HJKB 1IBFA 3AXHA 1UJ3A 4RMUA 1I1YA 5BW7C 3LEXA 3H1ZA 3L1EA 2R69L 4LSQL 3Q6GL 4U2ZA 3MNDA 3VFTB 4KXDA 3TN0C 4M7JH 3VWKB 4YR6A 4GW5A 3TBTA 4X0NA 4KAQL 2NY4C 4QYOB 1GSMA 1T22B 3KPSB 3MKGA 4LCCC 3UYOD 2OJEB 3O8XD 3F01A 2DMKA 1I8KA 1QLRB 4GXUM 2EDYA 1B4RA 1H6EA 5CCHE 4B53A 2Q6WB 1JZFA 4NZRL 5B38A 3QISA 3TZVB 5TF1L 1JGEA 5FGSA 3L1OH 1VJSA 1NFIB 1PD1A 1PJWA 2P7TA 3P69A 4YE4L 5E4AA 4DETA 2J8OA 2V2WA 1OPOA 2L8AA 4OCXL 3RA7L 2UZPA 3DPBA 3NUKA 1F8TL 2H32A 2JNZA 4XXCA 2HX9A 1Q9OA 3V7AG 2XYCA 3IGKA 4ZZFA 3MLXH 1T1XB 2DIAA 2PYFB 4PCTA 4POZD 3ZSSA 3NCMA 4TQHA 1N19A 5FHBL 3P3RA 3QWNA 1I1FA 2XKSA 1M56B 4PSRA 4FFVD 2X6UA 3FUMA 5IF0A 5KSVA 1QEWB 2R2HA 4NM8H 5I0ZA 3K6NA 1CDUA 2O6EA 3FQWB 3CZGA 5IHZA 4GO9A 4AIZB 2A2QT 2CCVA 2WXFA 4PGDA 1AVAA 3NIFE 2NY1B 3MRCA 3UIZA 4Z6AT 4AT6B 4W9ZA 3L5HA 4X98A 3HCVA 1AS8A 5KVEH 1ZOXA 2CUIA 1JG9A 3DRQB 1A7RL 3QRGH 2BY2A 2WXQA 4A2HA 2WQWA 4R0LB 3HE7A 3MRLB 4NERA 3BPOB 3MRMB 5FUOH 1MCOH 3LN9A 3BKJL 3OPZH 3UZEA 2ZWYA 3O8XB 5BRZD 1ZT1A 3MLVL 1TR7A 1BG9A 2E8YA 2J8UE 3F6LA 5J6GB 3BWAA 4H88L 1L9TA 3SD5A 3O2DH 2XN9E 1ZGLB 2QSVA 3S2AA 4MGXA 4X9GA 2DEXX 3NAAH 5FV2A 5IJKA 2OTWA 5I28A 2EH8L 35C8H 3KE0A 4CC1A 2PCFB 4XWGH 1QOKA 2NY6D 3K6FA 1EO8L 5E4OA 2Y2WA 5C7ZA 3IFOA 5TJWK 3BEVB 1JWUA 3GLEA 1FC2D 4N8VB 1TZ8A 5EBLA 3VD0A 4YNYA 4YDLB 2FWOA 4MJ4A 4G9FA 3FT2A 2M1KA 3VFNB 2LR4A 4NHUB 2CLVB 4JQXA 1RIHH 1NPJA 4MRCA 3UBGA 4EI5D 1J10A 4XXDA 3GSXA 3RAJH 1AZBA 2JELL 4NCC1 4HK0B 3QIUA 2NNXA 4M6NL 2NY2C 4QOKD 1CDCA 1KXVA 4DEWA 3JUZA 4MNQE 2FQDA 2BNQB 3VI4E 3UGEA 4C4BA 4L3AA 2DI9A 3V6FA 5A2AA 4ONHB 2BJMH 5GGVY 1M05A 3OJVC 3HW7A 3EBAA 1NC4A 3S3BB 4F8TA 4W70A 4RWYL 1IV8A 1JD9A 4F9PA 1IAKA 1SLWA 2Z31D 2X1WL 4AQAB 4OZFB 1PSKH 4NBYB 4UB0H 5BRZB 1Y18B 4KZEH 3ULUL 4GG6A 4NNPH 5C08D 3RWJB 2C1PB 3FN3A 2AQTA 3DARA 4CDHA 2F5BH 5IUSA 5F6IC 3RDJA 5JW4R 4XRCA 4XP6L 4K5MA 3DX0A 2DKSA 5BOZG 1AKPA 4GKNB 4U6XB 4L0YA 3KLAB 2NY6B 1GRWA 1AZRA 2BH0A 5T1DL 1ERNA 4RRPA 2BDNH 1TU2B 4PY7B 4WHCA 3VQLA 1OCWL 1VERA 4IHOA 1MHPL 1X7TA 4GKZA 3RVTD 3WKPA 2VXQH 4WY7H 4I13B 3KLLA 1YLBB 3CVCA 2AV7A 3W38A 3BN3B 5HDQH 4AIEA 3LRGA 2CIIB 2J5LB 4FQLH 4JFOB 2CM6A 1KN4H 2A83A 4FULA 1EFQA 4YLCA 5SWQB 3S35L 4PMEA 1X7QA 3QPXL 4IBTA 4U05A 1ZA3B 2DQEL 3WFBH 3L3GA 3H3KA 2X4SA 3VXMA 3G08B 1QZNA 4IYKA 2W0LA 1UC6A 4EBQH 1UXLA 2GJPA 1I8UA 3QT2A 3V0VA 2Z31B 4NDMB 5CD3A 3K1DA 3VB9A 3T9WA 1WCBB 2WZAA 4PIRF 4NHCH 4GS7B 4L8SA 1KENH 2OSLB 4BH8A 4CC4C 3E6FB 2WQVA 1E9QA 2PWHA 1FVDB 3D4ZA 3IAPA 5IW1B 3TEUA 5FA3A 4O4YL 1KXQA 4OFQA 4R7NA 1FHNA 5MEPA 3SODB 3SIKA 4X6EB 4JY4B 5D7IF 4WQOA 1ZT7B 5D1ZI 3LN4A 4L9LC 3SGDH 4MQTB 1ROCA 1U8QA 5EBGA 2B2XH 4YFDB 4FTDA 3E1F1 4OCRL 5GS1C 5J06A 4WHDA 4JRYD 3V0WH 3RZCA 3PYCA 1KZYA 2ICEB 4NKMB 9CGTA 1OOAA 5D70H 1FFNA 1CD1A 2OKMA 2C3GA 1XR8B 4UBDD 1BJ1H 1UM4L 5EUKB 5D7IB 2Z91A 1XL6A 1BPVA 2NNFA 5EPMB 4UDUB 3AC0A 3WTYA 1ADQH 2DYSB 3DUSA 3QEGL 3ULVL 2H2SC 5C0IB 2YEZB 3MROB 4Z7WB 1SOQA 3F65A 3ZO0A 4B7IA 4G9FD 4G83A 1WBXA 2ZXAA 4ZUSA 4FC3E 4AH2B 2W59A 4FHBD 4PJ5A 4WV1B 5EORH 3TCLB 4GLRI 2BNQE 3LV3B 3ZR6A 1Z3GL 3MSPA 4PBXA 1TG8A 5EOTB 1RFDL 1TETH 5HHPA 3GMQB 3ZKMC 4UAOC 5FPIA 1RLWA 4GBXA 1B0GA 3EOAB 5GISH 3F7YB 4YSSA 4DP0X 2WXRA 3W3BA 4PJXA 5E5RB 4XAWL 1JJUA 5BRZE 2UY7A 3A67H 2Y69B 3Q2CA 5CZVH 5IIEA 1NC4D 2JJUA 1DSFH 1Y0LB 2XN1A 3GSVA 3IS1X 5ECGA 4E0RA 4S0TD 5SWZA 1J1PL 1QHQA 4WO4D 4N2AA 1X6NA 2UWEA 3CMGA 3QC6X 4XPGL 3MJ9A 5EC1B 4JRYB 2XA8H 1OP9A 4TNGA 2Y7QB 3CWGA 5E8NA 5B4MD 1R17A 3ESOA 4X0KB 5ALBH 5CP3A 4ZTOH 3HZKB 3BESR 4AW4A 3UYPA 2QSCL 5FDWB 2VISA 4KO9A 4N2EA 1JYNA 5HYQB 4CNIB 4JG0L 4ZSOB 1T66D 2GI0A 3ORJA 1CD8A 1YEIH 1BP3B 4HCGA 4TTDC 1WFTA 3LNIA 3ULUF 1H8LA 3L9RB 4XO4A 2Z7YA 3MRKA 4KQ3L 1S7UA 3VXNB 4QOKE 1M42A 2IBBA 3TBSA 3RFZC 3FU6A 3IXAA 2MCAA 1MW1A 2BFGA 1XDTT 1A3RL 4V11A 2R27A 2E27H 5IB1B 1QA9A 3WDHA 2ICWA 3VFVB 5LXGH 3L7EA 3D2UA 1RZKH 3TNMB 3TVMD 5DUPH 3DBXB 3KYKL 1MCPH 1FJ1A 2NY5H 3T77A 1OM9A 3VXSA 4B60A 4Z3HA 3QZWB 2DQUL 7TAAA 4U33A 3G3LA 3AABA 3REVA 5C08E 1NPUA 4PREA 1GC1L 3G6AA 3DKHA 2AZUA 3H2PA 3IBEA 5FM5M 3HR6A 3IXTA 3MR9A 2HN7A 1LILA 1G9HA 4R7DB 4TNWF 3QDGA 4WO4B 1PY4A 4MMYB 1XH2A 3QCTH 3Q9PA 4B9IA 3EDKA 3CK0L 3NTCH 5AWNL 4HUKB 1FDLL 3IS0X 3LEYH 4HK3N 1RURH 2OMTB 5TE7H 1JYVA 1BFVH 2ZUSA 2WNXA 3F8UB 2ZX6A 3MBEB