2BDNH

Crystal structure of human mcp-1 bound to a blocking antibody, 11k2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
217
structure length
217
Chain Sequence
EVQLQQSGAELVKAGASVKLSCPASGLNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKFDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARGVFGFFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Small inducible cytokine A2
publication title Structure activity relationships of monocyte chemoattractant proteins in complex with a blocking antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2005-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnH02
4M6OH 1U3JA 1UWEL 1RZ8B 2R9HC 5CMAA 4ZO8A 4NQVB 1WBXB 3PABA 5BZDB 2BNRB 4KRPC 3S36L 5IV2B 4LVHB 1I7TB 5EA0H 1QSED 5KSAD 3C8KA 1GAFL 4YHLL 4NQUA 5FK9A 1HH9B 4U3CA 4UIKL 1WAAA 4LEXH 2DQHL 2A74B 4W4OC 5DUBB 4P4KA 2XWJB 4XP6H 3MV8D 4S1SL 4XGZB 5H8DA 2FIRT 3LKQB 1H3PH 4M3JA 3WXWL 3VXUA 1NDMA 1OGAA 1AC0A 4PJFE 1HHIB 4XC1L 3BP5B 3B9KA 5FHAH 5DJAA 4UDTB 2Z8SA 5IFHL 5E5MA 5SX4I 3A6BL 5MEOA 3G5XB 2UYLB 4AM0B 3S35H 2AGJH 3IETA 3QDGB 3BDYL 1QFUL 5GS0H 5BMFL 1S3KL 3GI8L 1KTRL 1JPST 1IC4L 2EE3A 4NO5A 1QVOA 1P7QB 1TJIH 4W68A 1S78D 1F6FB 1QRNB 4IOIB 1JWSB 5DMGC 5EU6D 4K71B 2HJKA 2YN3A 5F7KC 1RK0B 4Z7UF 1N6UA 1TZHB 1D5XA 2NXYC 3EYSH 1E4WL 1MAMH 4N0FA 4XNZC 1KTDA 4WI5A 4NOBA 1Z9SA 4AEHL 1UZ6E 3CU1A 2X4UB 2W65A 2BSSB 5E1AB 35C8L 5FYKE 3C2AH 4P5KB 3VXQB 4JGMA 4NM4L 3KPQA 1DBJL 4XP1H 4CADB 4HIEA 3QHZL 2CJUL 5F1NB 1IVLA 3KYOB 4Q6YA 2ZJSL 1QFWI 4IBLT 4NHCH 3V5HB 4RNRA 1P4IH 4JAMB 3KS0H 3CMOL 2Z9TA 5AZEH 2MKWA 3H9ZA 1WFNA 3D69A 2GTWA 1QLRA 1JPFA 1A2YA 5E9DD 1J8HE 2EDNA 4OLWH 2DB8A 5ESVA 4PGDA 5F7DA 3E0GA 4X6EA 3CFBB 4Y19B 4QF1B 4KGLA 3LOWA 1BQHA 2R1XA 4PJIB 3QI9D 5CJBA 1OHQA 3QR2A 1QUNA 1IAKA 5IFJA 3DUHA 1H3GA 4XTRD 4JREB 3BE1H 2K9UA 1HSAA 4OM1H 1W0WB 1E4XI 1XR9B 2ZPKL 3EJYC 4J4PC 4O5LH 1X5YA 4HDIB 1CXLA 5T5NF 3TH2T 2DYPD 2FR4A 2ADFL 1L6XA 2DJ4A 3H7BB 3MGTA 6CGTA 2PXYC 4D0CB 5FYJH 1KPUA 4J23A 1HEZA 2UWEB 2BNUB 2E8YA 4QTIH 4M61B 5DD0L 4TNWK 3VD7A 5E2VH 4NWUL 2VDOL 2VAAB 4LNVA 1UKQA 5HHPB 1XGYH 1D9KA 2N7BA 5IOPB 4Y2DD 3PIQA 1JGEB 2ORBL 4ZUWB 3LRHA 4ODTH 3LB6C 4GAYA 1OSZB 3X3GL 5ID1B 3NACH 5KSAA 1KTKE 4L29A 5EUKA 4ZODA 1BOGA 3D39B 1MHEB 5E4IA 3ARFA 3NCYS 4NRYA 5CGYC 3GJFK 2XPGB 3V4VL 5I18L 2OI9B 4PJHA 1IC1A 3BQUA 3DURA 3MV8A 3U4EA 4C4KO 2F54B 5BQ7B 3CVHB 1IZKA 3BIKA 5C0JA 1SBSL 3CX5J 4M7JL 2W9DH 1H0DB 1IKNC 4OD1L 2W0FB 1PW3A 3MRBA 1A3LH 1CK0L 1D3CA 1GGCH 4KK5C 5A1AA 1EJOH 4PREA 3VD5A 2OTWA 5C9KA 1KCRL 4APQB 3HMXA 4XXCA 1EHLH 1AE6H 1WK0A 5FFLA 3T3ME 3WO3B 4XBPA 2A83A 1W72B 2EEBA 4O2EA 3CFDB 2VLKD 1K4DB 1NGYB 2YPLB 3C6SA 4QKXB 5E95B 1UT9A 3IFOB 4OQTL 2R29H 3MODH 2BSTA 5ADOH 1M4KA 1SYSA 4GKZA 4KRNA 2NYYC 2X70A 4P2QB 3P77A 4MNQB 5EU6A 3MROA 3HZYA 1V7MH 3KPNA 1TXKA 3QCTH 1D5MB 3LRGA 4DOHB 2IMNA 1MNUH 3F12A 3H6JA 3QXTA 1R5VA 2X4RA 2FWOB 1XZ0B 5DD1L 2Y1VA 2EIDA 3SDCD 2XZCH 2CLVA 4X7TA 3UZVB 4KUZL 3RVTC 5GSRA 5F7WC 3WFEH 2CH8A 4HJ0C 4PGZA 5IG7A 5BZWB 4OZFH 5KZCD 3CFCL 4LQ1A 5I66A 4NFCA 4OLZL 2A0LD 1YY8B 3BKYL 1BP3B 4NPYB 3C60A 3CUPB 3KPMB 2DLFL 5D70L 3SE4C 5ESQA 1A7NL 2I07A 1YQ2A 4NCDA 3FCTA 3QEQD 5TE6L 12E8L 2Y5TB 1T3FB 2AI0H 3ESVF 1UM4L 2PW2A 4OI7A 3ULUH 3MRDB 1NL0H 1CGSH 4YHPA 1MFCH 5E9DA 4MA7L 5ESAB 4A6YL 1CBVH 4JO3L 1K8DA 2PO6B 3U6RB 2BOBB 2B4CC 4KFZC 3QSKB 3VE0A 2ICEB 4HQQL 3OKYA 5EFIB 2VXQL 3EYFA 5EIQA 5I1HH 4XZUA 4G6AD 1L9MA 5EO9A 4ZYKB 5F21B 2UUDH 4UQ3B 5CHNB 2DYPA 4PJEE 2YPVL 1JPTL 1EEZB 5K9KB 5GGRY 4KDTC 1GHFL 4QRPB 4TUJA 3S88H 1MFAL 1OD9A 2C1OB 1LEKA 3VJ6B 1RZ7H 2R8SH 4YHOL 4X7SH 1VERA 2J8UF 2G2RB 1MLCA 2R15A 1W8OA 3G6JA 1MCJA 3KYMB 4HFUH 5SWSD 2EC9T 2D03L 5HYQB 1BBJA 4ZD3L 3WN5B 1XF4B 3QUMB 5BS0E 5GGVY 1OQXA 1BM3H 3T4YA 3L5JA 4K7FB 1XIWC 2Z93B 3EGSB 4PJDF 4RMTA 1QHOA 5F89A 3SO3B 5GZNC 3R0NA 1MFBH 2XTJB 5K9OB 1M71B 4L3ED 5IMMA 4R3SB 1VENA 3ORJA 4YBQD 3OKDA 3DYOA 1U3HC 3HE6C 4HZAA 2FO4A 4P49A 4PJ5D 5BV7B 3RWGB 1B2WL 1H15A 4S1DD 1H3TA 3BFOA 1WZKA 2VDNH 4QT5B 4YDVB 5DK2A 1A7PL 4YC2B 3WIHL 2VLJD 4NWTL 5I71C 2XKNB 3GSOB 2PNDA 4JHAL 1RI8A 3INUL 3D2UB 5JZ7D 2AJUL 5D2LB 4U1JB 5D7IB 4FZEH 4G5ZH 3TIEB 1OF2A 3MACH 1KCVL 5ITFB 4FG6C 5CFHA 3VA2C 4DUVA 4H5SA 1Z9OA 1JHKH 1Q72L 4JM2D 5I1CH 3QEHB 5C92A 1NEZG 1QOKA 3RPIA 1WTGT 2JJSC 3THML 3NPSC 5C08B 2VLKA 5JNYA 1IGFH 2I60L 3VFVB 3VU2A 5E6IC 1FRGL 3DI3B 3FN0H 3O2WH 5KVFL 5EOCJ 1I8MB 5MEQB 1FG9C 4KZEH 1AHWA 1PKQE 1KEMH 5IM7A 4PG2A 3C6LB 4PJIF 3CFKA 4JRXB 4U6XA 5KANG 2XRAL 43CAA 3T0AA 2B4CL 3BZ4B 3SDCA 2ZSVA 3T77A 3ULVH 1IGJA 1ZGLM 2OL3B 3MRKA 4Z7UE 4DZ8A 2VQ1A 1XF5A 3O6LL 4F7PA 2JB5H 1Q0YL 3QQ4B 3KLHD 2CRIA 4FZ8L 3OR7B 3VMOA 1T1WB 2DM2A 5C07D 4YDIH 1MCNA 1GGIH 3OKEB 3DECA 3QEQA 4UBDD 3CNKA 3KYKL 1Y0LB 4Z7QF 1IAOB 2AEQL 5BXFB 1OP5K 1A6UH 1FL3A 5CGTA 2F5AH 1YEIH 1TCRB 4UZGA 3O3BA 4I2XB 5DJDA 3HR5B 1JGVL 1J05B 4NQCB 3IJHA 3PQYE 4JFDD 3TBVA 1RUQH 2Y9RT 2YD9A 4DZBA 1EK3A 4GW4B 2IG2H 3MOBL 4Q0XH 3G5VA 4DEPC 15C8H 4RWHA 1RPQA 2XICA 2FX8L 4O51A 1AGBA 3ARUA 3MGOA 4R26L 3G08B 4R4NC 3WFDL 5DD6A 4V1DD 5KG9A 1DQQB 4FQPA 5EORH 4XWOC 2NY5H 2BZDA 5JOEA 4LASH 3ZT6A 4TOYH 4ORZC 4WU7B 3ZKXC 3FMGL 5J1AA 3U4AA 1IGYA 1QBAA 3H9HB 3FOLB 5E8DH 1T03L 5HD8C 1JWMA 2R0WL 1IEAB 4K23L 4GRMA 4ETQB 4UV4L 4OZIB 4L3EA 5JDSA 2I9TB 4F57H 4KVCL 3FHAA 4XPGH 2X10A 3I50L 1XFPA 3TO4D 4PJ5A 3ZL4H 4EN3D 2CIKB 4K8RL 5CJXC 1RUAL 3FT4A 2VLJA 1AGFB 4EUPA 4IIQB 2CMRL 2HH0H 4Q9RL 2R56L 4L4TD 5KVDL 4XP9H 2KKQA 5H37G 3WSQH 3OGCB 1JRHI 1KOAA 4PJAE 1Y18A 1W0VB 2E7HA 4JM2A 3HNSL 3WNLA 4OLXL 3RWHA 5HI5C 3DX6A 4POZC 3L1OH 4A2LA 2NY0D 3W5MA 4PTUB 3BH9A 2D31B 2APXA 1NBZB 3QNYB 3VXOB 3PWVB 5A2IH 2R69L 1XF2B 5K9JH 3QDJD 2A77H 1WWCA 5FYJE 4PGEA 3BD3A 4QNPF 4EOWL 3U0TB 2DI9A 5CINL 2EH8H 4N0CC 4LLYA 2V7HB 5FAAA 5KVEL 3BX7C 2O5XL 3C08L 1I1YA 1WIUA 5T1KD 2L0DA 2Z91A 1R6VA 4FS0A 5ALBH 1N3NB 1ZWIA 3PWPE 1GH7A 3LPFA 4WFHE 3QHFL 4X9HA 1WV7T 5E2UH 3NZ8A 5I74B 2AVGA 5C07A 1N8ZA 4OFDA 5CAYB 1KB5H 1ITBB 2W92A 4YHZL 1E6OL 3ULSB 1U8IA 4KK6C 3V6FB 3EOAA 5DJ2A 3LZFH 5DO2C 5J11C 4HMEA 4W6YB 4X6FB 3PWNA 1I7UA 4G8GD 1UACH 2A73B 1C5CH 4MSWA 4NO0B 2OXGA 3H42L 4YK4B 1G7LA 1FZOA 1ETZA 3KPPB 1JGLH 4M1CD 4MZ3A 3MRPB 1LK2B 3BW9B 4JFDA 4ZAKD 1KLUB 1F8TH 3I2CH 1INEH 4BH8A 3PWLB 4B41A 4PRNB 5GRUL 2GJ6D 1V3LA 4F9LA 3DUUB 2OTPA 3N0PB 1J5OH 4W81A 1U8PA 1XMWA 3Q6FA 1T83C 4U4BA 5D7IF 2ZG1A 4V1DA 3IAGC 4LLUB 2QSVA 4KKNA 1K5NB 3IDMA 5BRZE 3CC5B 2OBGA 3RAJL 2JK5B 4WFFD 3F58H 3MUZ1 1IFHL 5JXEC 1G6RB 3MJ9L 4G8IB 3B5HA 4HGWB 1FO0A 2A6KA 1T66D 4UU9A 5IMLA 4OCYH 1J0JA 2J8UE 3GB7A 4JY6A 1DQTA 4LDLB 4X6DA 4Y4HD 2X1QA 2DQFB 4UT9H 3TO4A 1INDH 1QHPA 1U8LB 4Y16B 3D18B 2ZZUT 1MJ8L 3OKMA 4EN3A 4NZTH 3GSWA 4PJDE 4PUBL 1CLOH 2J6EL 4CVXA 3OZ9L 1U8HB 5I76A 1MHCA 2WIIB 4ZUTA 4Y88A 3UTTE 2F8OA 4WUUD 1T2JA 4ONGL 4NNYA 4UV7L 2K3TA 5FYLH 4L4TA 5CBAA 4ZTPH 4CN1A 4M9OA 1AY1L 3UXFA 3BPLB 4ZQKA 3AY4A 2DQUH 3LEVH 4Z0BL 3QIWD 5LGKA 2PW1B 3K2MC 3OX8A 4NBXB 3IDIB 1JGDA 4KK9C 3G04A 1NKOA 1QFWM 3OG4B 3QDJA 3GJEB 2VR5A 5DJZA 1KFAH 3MRHB 3BP6A 1ZVSB 4WTZG 1UVQA 3TCLB 1QNZL 3C2SA 1FE8L 3L5XH 5BW7C 2V2XA 3H9SE 3FAWA 4MB4A 5L8LB 4GBXB 3TBWA 5C9JA 3I3DA 1AD0B 2BSRA 4X83A 5T1KA 2XZAL 3ARBD 3ARDB 4Y19E 3MRQA 3TZVC 4PJIE 1UM6L 3PDOA 2Z8WC 1FZMA 4HUMB 2BRRL 5DJ8A 1QSFD 1DQDH 4JKWA 4GKSB 2A9ML 3W9DB 4PJBB 3X14B 1CGUA 2PYFB 4M1GH 3BP4B 4PGBA 4M43H 1OL0A 4P2RD 3SJVD 4U1MA 4Z8FL 4G8GA 1F6AB 4R9HA 3N85H 4HIHB 4MJ2A 1BAFL 3GMQA 4Y1AE 1TVBB 4I77H 5EO0B 1N2RB 2CLZB 4KJQD 2DLIA 5CBEB 4XNUH 2VN7A 3LS4H 2MPAL 4Z7QE 1AO7E 4HWUA 4ZAKA 4WO4B 4JQXC 3FB5B 3UZQA 1U8OB 2GJ6A 3QUKA 4MHHG 4TTDD 4P5TD 1L7TH 1JK8A 2EZ0D 5T33L 3X11B 4O02L 4YXKH 1YNTA 1B4RA 3LSOA 3O6ML 1NCNA 4JRWA 3CXDH 4I48B 5KANI 1FNGA 4JFPA 5CEZH 1WQVT 2BERA 4HIJA 1RUPH 1G84A 5FKAB 2GHWB 4WY7H 5IMKB 5TE4L 5FCUL 1WCBA 1CIUA 4YHNA 3R4DA 4URTB 1T89A 2PTUA 1AGEA 4G7VL 5F88A 3TJHC 3EYOA 2VIRB 3MXWL 1JN6A 3ETBF 1AXTL 4K7PX 3WUWG 5JA9A 3TT3L 4QYOB 4Y4HA 1NAMB 3PGCA 4RBPK 3VDCA 3D6GA 2ZCLH 1J1XL 2G5BB 4LCWD 4WUKH 1NFDF 4YDKH 2ZG2A 5GGTL 3ARXA 2V7NA 3MLVH 4X6CA 1QO3B 3DVFA 3EJZC 4DN4L 2DICA 4Y4KB 1OVZA 2ED9A 3EZJB 3RTQB 4HXBL 4WUUA 2XOTA 3WIIH 4WGVB 4MNQE 3LKPA 2CK0L 1HCFX 1WGOA 1P5VA 4R96B 2VISB 1XGRB 1YPZA 1MCOH 3QIWA 5F8QC 5E8NA 1KN2H 3GMOB 4MX7A 3BESR 1LILA 2PO6C 4MS8C 4WVRA 4RFOH 3EBAA 1GOHA 3KPLB 1WBYB 5C2BL 2CDEA 5FV1L 1C16A 4Z9KB 1K85A 1JGUH 4CBPA 3MLXH 4N1CA 4F7EB 2VUOA 1JMZA 2K7PA 1JZ4A 4V2BA 3QXWA 2EDWA 5DVKA 4OUUA 1DBAH 1P9MA 1ZE3C 3RVXC 5FDWA 1NCAH 2PF6A 1GZPA 4LSSL 3CVHL 3HC4L 3JUYA 3K1DA 1M7IA 4RAUB 5KOVC 4QNPE 4YDJB 1RMFH 1ACYL 1H3VA 3ARBA 1HXYA 2WW8A 4LAJH 3GHEL 5CMAB 5C6TL 3PABB 4JO4H 4WI9A 4QO1A 3WN5C 1QSFA 1RD6A 3CXHJ 3TNNA 3IDNA 3C8KB 4J1UA 1RZJH 4LLQA 1KJ2H 5T3ZH 5FK9B 1LE9A 4NFBA 2OYPA 2XTJC 1IL1A 5KW9H 4P4KB 3VA6A 1EAPA 4P2RA 3SJVA 3X3FH 5BV7C 4MVBC 3A6CH 4QRPE 3VXUB 1NDMB 2IPTL 4ONFL 1OGAB 1ZLSL 3NABL 5AYUL 3O3UN 1BGXL 4X4MA 2X41A 3B9KB 5LXGL 5DJAB 4HF5H 5E5MB 3ZKMD 5DXWA 5MEOB 4FQXD 3U30B 2VB5A 3IETB 1OW0A 1NAKH 1T04A 4HIXH 4LLVA 4P2CG 4P5TA 3JVGC 4JGJA 1WFOA 2XTJE 4FTVE 4HH9A 4NO5B 4NZUL 1QVOB 3VFTA 4F37K 2IANA 1HKFA 1MCRA 5GZOC 2DD8L 4OLUL 1UH2A 1FBIL 4YBHA 2NY2B 3K2UH 3S37H 3PWJA 3VXSD 4K94C 2QADD 5LQBH 2DTMH 1OAKH 2HJKB 5JORA 3WS6A 3E6FA 3BVNB 1GC1C 4JFZL 4G80A 5D7IE 4N0FB 3SGJA 4K3DH 1KTDB 4ODUA 3VDBA 1OAXL 1J8KA 5GISH 5AG8A 2VLRE 3C6LC 5HVFB 1SM3H 2NX5D 4U0RB 2P8LB 3QO1A 4LSTL 4JG1H 4P2OD 4LCWA 5J06A 5C08E 3KPQB 2BNQD 1I85A 4RNRB 5FA4A 3CDGB 5F9DC 1HH6A 1DEEA 3OKOB 1CYGA 3D69B 2Z31D 3SGDH 2W0KA 2GTWB 5I30H 4MMZC 1ZEAH 4S2SB 2HT3D 1QLRB 1S7QA 1JPFB 4ZXBD 3BH8A 5D1QB 2VXTH 4PGDB 2YRZA 3IU3A 1UFUA 4X6EB 3FQUA 5FM4A 1BQHB 2CGRL 1N7MH 4Z78A 4MXWL 5KTEH 4NZRL 3RVUC 2ESVE 2DM7A 5IFJB 5I1EH 4PJCB 2Y36L 2GW5A 3QUML 4XPFH 4HK3J 2WP3T 2FEDD 3MGTB 3HAEG 4FNLH 3P4MA 2D4FA 4RWYH 5BV7L 1KPUB 1HEZB 4OD2A 2QL1A 4NJ9H 3X13A 5A2LH 2IWGA 2E7LA 4LEOA 5E7BA 3IDGA 1PYWA 1NSNL 4OGXL 1G7MA 4JVPA 4PJGA 3GBMH 3UBXA 1VESA 2X4PA 3PIQB 1UKTA 3TBYA 4PJXA 4GAYB 4HD9A 1QSEB 5KSAB 4L29B 3HB3D 1BOGB 2E3VA 2W9LA 3PHQB 2BVPA 4WEBL 4HWNA 3W2DH 4NRYB 2HG5A 1CFBA 2GJJA 4PJHB 3MV8B 2EYRA 3DURB 4I9WE 1N0XH 4XRCA 1G7HA 2DLGA 3BIKB 4K94L 5C0JB 3NCJL 4RMQA 4LGPB 5FYLE 2NY6D 1GC1L 3LMJH 3MRBB 1TLKA 4IIQC 4N0RA 4PREB 2OTWB 1J0KA 1U91B 1RURH 1CD8A 3MNVA 4FQXA 3U82B 3SKNA 3EFDL 1HSBB 1AKJD 4XBPB 1SVCP 2A83B 2HTKC 4O2EB 5DUMH 1BMGA 4XNXL 4KMTH 4KV5F 3QP3A 4DTGH 1FFNB 2YBRA 4QLRA 3C6SB 4S10A 4GQ9L 3D1MC 1OD7A 5EBLA 2FLRT 2OL3L 3A6OA 1MCPH 4TNWF 4HSQA 1SBBA 2B1AH 5I9QB 1A7OH 1SYSB 1CGYA 4FRWA 1BJ1J 3VXSA 3P77B 5J9PA 2JKXA 1RK1A 2IH3A 3HZYB 3KPNB 4HJJH 5CLTA 2JJVA 3F12B 3OAUL 2X4RB 2GIYA 1S7VA 4NSKB 1BHGA 2NX5A 4NNXA 4RRPG 4X7TB 3FFCD 4YAQA 4P2OA 5GSRB 1MVUA 2FEEI 4L8SA 5IG7B 4CN6A 2BNQA 5I66B 2AEWA 4S1QH 4FQIH 1JE6A 5DYOA 4WFGE 4RISL 3RWFA 2Q87A 3UX9B 1PAMA 3HPLA 1CICD 5ESQB 2I07B 2VDPH 3T8XB 4HKBB 4TSBH 5HGGS 3UC0H 5L9DH 2Z31A 1KJ3L 2J4WH 1FAIH 1NFDE 2PW2B 1MWAA 1HN1A 1RZFL 3ROOA 4OM0L 1CFNA 4YHPB 5E9DB 4NQEE 5T5NG 1K8DB 5D6DA 2GEEA 4XBGA 4RQQA 4MHHI 2D7PA 1PSKH 3QI9B 1V7NH 5TGBA 1WCQA 4Z0XA 3EYFB 5HI4D 4DVRL 5DSCA 3H3PL 4IDLA 4XZUB 2ADJA 3TFKD 3T0ED 1WAAF 1D5BA 4YK4C 3RNKA 5C6WH 3MCKB 1OAQH 3WJJC 1OP3K 2CKBA 2DYPB 3KLAA 2XG5A 4D0BB 1MIML 1Q0XL 1OAUH 5CEZE 4G6JH 3QH3A 4TUJB 3Q2CA 5IVXA 1G7PA 1LEKB 2YA0A 1DFBL 2GSIA 1A1MA 2M1KA 3PUCA 3D25A 3AS3A 3G6JB 1J11A 2V9RA 1FH5L 4Y4FB 4P99A 2AKRA 3EW3B 4ZSOA 1EFXD 1BBJB 5F3HB 5C0BE 4JGUA 1G9NH 4Y2DB 3T4YB 2O5ZH 3NCCB 1TTGA 3BSZH 5F89B 5IWLA 4FFWD 2AXGA 4ERSL 1MUJA 5IMMB 3OKDB 5K93A 5LGJA 4RZCA 1BQSA 4ENEC 5LAXB 2FO4B 1OTTC 5JOPD 4JDVA 1A3RL 5EU3A 1H15B 3OBAA 5DK2B 4WV1A 3WNOA 4J8RA 4Y16C 5C7XL 3DX7A 4L8CA 3J7HA 5ADPL 3ALPA 3EOTH 4X9BA 1T7VA 4KVNL 2DDQL 5C6PB 2X1OA 3PL6D 4NM8L 3MRGA 2R4SL 3OJMB 5D93C 1CU4H 4HZLA 2VDML 2WQRA 1EO8H 3CFEA 1JHLH 4H5SB 3QXVA 3QFJE 5CSGA 4GT7A 1AKJA 3BKMH 3RPIB 4YX2L 5JNYB 2B1HL 1HDMA 3BPLC 2FJGA 3ARGD 5K33A 5BOZG 2RCSH 2Z92A 5L2KD 3BT2H 2GYSA 5CSZB 1YECL 4LFHD 2R0ZH 1AHWB 2YK1H 4QOKD 5IM7B 5DS8A 1LD9A 4GO6B 3CFKB 2QQKL 4U6XB 1A14L 4OUOA 5CWSA 43CAB 2HT4C 3SDYH 3ZDXF 1I7RA 3MLUL 5GPRA 3ALWA 1IGJB 3FFCA 3FO0L 4GBXC 2N4IA 4P3CL 4ESKA 1X5JA 3TH4T 1KCUH 3FONA 4ELMF 1E4KC 4J12A 4DZ8B 3G6DH 1XF5B 4F7PB 5KZCB 4K3EL 4WEMB 1MFDH 2EIZA 5GJSH 4KI5F 4JY4A 5T3ZE 3ARDC 4JDTL 4UTAH 5IJKC 4OD3L 5IFAH 3M8OH 2X4TA 2F8VA 1CICA 4Q9QL 6FABH 3QEQB 3CK0L 3O4LD 1P1ZA 5TQ0L 1VFUA 4K2UL 3FRPA 4PLNC 1MCBA 4Q97A 1FL3B 2PETA 5D96B 3MC0A 2BVYA 3FT2A 5EZOL 4JPVL 3QAZB 3MXVL 2YD8A 4NUGH 1G6RL 2VH5H 3LN5A 4LHUG 4NQDD 3BN9D 3IJHB 3HFML 3RIAK 4E9LA 3ARPA 2J88H 4OZFG 5J3HC 3HC0A 5EU5B 3G5VB 2MHAA 1RFDH 4WO4C 3T04D 2HFFA 5LGHH 4G42A 5SX5H 4O51B 3MV7A 3MGOB 1CWVA 5DK3A 3JSSA 5F96L 5DD6B 4PV9B 4X0KA 3MA9L 5JMOC 5CZVL 4TNVK 1JNLH 1RJZA 3MLSL 4XPAH 3NPZB 5SWSB 1EFXA 3GK8H 3HMWL 4M62H 2EYTA 1IGYB 3NCEB 2XZQH 1JWMB 3QPXH 1JV5A 2YZ8A 4GRMB 2NMSA 3RWDA 4L3EB 5EOQL 5JDSB 4LSQL 5DRZA 5J8OA 4PJ5B 4I1NB 2E8ZA 5DJ6B 2DQIH 2VLJB 1QBMH 1FC1A 4XPTL 5I19L 4JANB 4EUPB 4M5ZL 1F4XH 2LE9A 3PL6A 5HHQA 1X5ZA 5E8EA 5BVJA 5GXBB 3TBSA 4Y4KC 1U6AL 3BMWA 4BJLA 3RTQC 3SBWA 3VFUA 1R3IH 1Y18B 4JM2B 1GGUA 4XCCH 3U36A 5FYJU 3DX6B 5EBWA 1IGCL 3F7YA 4EDWH 1BJ8A 3BH9B 3ARGA 1KJVA 4J7RA 1BVKA 4S1RH 5L2KA 3DI2B 4RMRA 1UXWA 1KCSH 1YMHA 1I3VA 4ZFGL 4JG0H 3UPCA 4KV5E 5JPNB 2DWDA 1Y6MR 5L0QB 1P84J 4BH7A 1NLDL 4D94A 4LLYB 2IALA 3MFFB 1YEGL 5JUEH 3EYUL 4AH2A 4M6AA 1F4YL 4P0DA 1NCCL 5AYQA 5JQ6H 4YHMH 3RX8A 4KY1L 4QGYA 1I3GL 1ZWIB 4ETYA 1Z2KA 1RUKL 1KELL 3MO1B 4WWID 3K3QA 4U7MA 1MLBA 9CGTA 3RWJB 1N8ZB 2BK8A 3CSBA 4XI5C 1G9EA 2LABA 3G6JF 5E94A 5IEHA 1U8IB 5D7SL 4P48A 3BWAA 1IQWH 3EOAB 5DJ2B 3QWRD 3PWNB 1I7UB 4P4KC 2D9QB 4IRSA 2MCPH 4BQCA 4UOW1 2VLME 3IU4L 1MOEA 1K3IA 1G7LB 4IOFC 4NQDA 1NUFA 3B9KC 5CS7A 5IBTH 1NAML 3U30C 4NP4H 5GJTL 5KAQF 1U8PB 2EC9U 4PB9H 1KIRA 3Q6FB 3O6FD 1CTNA 5EWIH 3VW3H 4EBQL 1HQ4A 5IKCB 3IDMB 4PP1D 5CCKH 4P57A 3L95A 3MRNA 1ED3A 4XAWH 4AY0A 1OGAE 3FQRA 2NY2C 3W11C 1F45A 2A6KB 4UU9B 5IMLB 4KGJA 3MQIA 3GB7B 5B4MC 1VDGA 1GJIA 2RAMA 5T3XL 3RA7H 4N8VG 3S4SG 1X5LA 3TO4B 3LS5L 2ICES 3RGVD 5JW4M 2OZ4L 2CDFA 3OKMB 4OF6A 5CZKA 4EN3B 3B6SA 3GSWB 3QPQC 4HUUA 4CVXB 5ID0A 5I76B 1MHCB 1MRCL 5EH1A 4ZUTB 2OK0H 1MCQA 1Q9LA 2VDKH 5I17A 4OZHF 1XGUA 5L2JB 2VOTA 4UDUA 4ZUSA 4GKOA 2MQCA 4KJWD 1FYTD 4ZO7A 3JWDH 4ZQKB 3SKJL 3V0VA 3AB0B 4LPUA 1N5YH 1U42A 2DL9A 5HYIA 1OTSD 4TRPH 4XAKD 4ZTOL 1TJGH 2NY0B 3P4OA 5CEYA 3OX8B 2HKFL 3VFRA 4PIRF 3RP1A 3FB6A 2FBOJ 3IT8D 3QDJB 5DJZB 1MRFL 2QHRH 3P4NB 2DQEH 3QJFA 4KKLC 1CDUA 3BP6B 1XCQB 2YUVA 3WL9A 4KHXH 2E6PA 3PNWA 2V2XB 2YOCA 3ARYA 5DFTA 2DQTH 4KI5C 2AV7A 1N6VA 4XC3H 4F8TA 5FUZH 2BSRB 1BWMA 3P11H 1LO2H 1NMCB 4G6MH 4GXVL 1CXIA 3QYCA 2DQGL 4N8CL 4PJ7B 5T1KB 2ITCA 2YD7A 3MRQB 4CAGA 3UTSB 3PDOB 5IUSA 1NCBH 5I1GL 1FZMB 3NA9H 3O8XD 4TVPE 5DJ8B 2W59A 1Z0MA 3ZDXE 1D9KC 4K7PL 5EC1B 2BVQA 4ELME 5KSAC 1JPSL 1AXSB 4PGBB 1X5IA 3QWRA 5ANME 4KI5E 1G7QA 3ARFC 1OPGH 3UJTL 4G8GB 1GOGA 5DRXA 4HKJA 4I8DA 4GAJL 5E08L 3GMQB 5CILL 1MHHB 3BQUC 1V3KA 3HA0A 3G6AA 2R2BA 2LQRA 4NKIL 3U9PL 3WEXB 3RIFK 4ZAKB 1ZT7A 2YRLA 3EOBB 1U3YA 5DC0A 2GJ6B 3QUKB 4XXCC 2Y07L 4R4FL 3UJJL 3HC3H 1IAIL 3MLTA 3FFDA 3TPUB 4X5WA 2H9GB 1YNTB 1A7QL 1UQSA 3O6FA 4FQCH 4XNMA 1FNGB 4HIJB 1RVFL 4HLZG 1WCBB 3L5HA 4KAQH 3DRTB 1H3PL 2X9WA 5I9QC 1DL7H 1S78C 1NH6A 3Q1SL 4ISVA 4JM2F 4YHNB 2FL5A 2ZWLT 2NR6D 3VGAB 5F88B 2J3SA 2ZUSA 3EYOB 1PEWA 2BY0A 3VRLF 4DN3L 1JN6B 5D2NA 4U1SA 1RIHL 5LBSH 4LCCA 4RBPH 4Y4HB 2W9EL 3PGCB 4CMMA 3SQOL 1PQZB 1NCWH 3QQ9D 5GS0L 3RGVA 1A21A 5I0DA 3B4NA 3SGEH 1U8MB 4TVPL 4XBEH 2YD1A 4X6CB 1SEQH 4LCUA 4OLYH 3ES6A 4AT6B 3CZJA 1XGTA 1I9RH 3GMPA 2OR7A 3C5ZD 1IQDA 4WUUB 5HPMA 4OZGA 3QG6A 3MLWL 2DQDH 4KMLB 4H1LA 4M6NL 3LKPB 5EU6E 1QR4A 1SJHB 1EMTH 1FYTA 3E2HB 3GI9H 1FZKB 3VI4F 2P5ED 2NY4D 3T0DA 1YPZB 3QIWB 3WHE1 4HWEL 5E8NB 4Z7WA 1XGQA 4MX7B 1CCZA 5L88L 1R24A 4PRPD 1FO0H 32C2A 4XP5H 5TQ2L 1UB6A 4AYFA 1X5HA 2AQ3A 4PD4J 4DVBA 2CDEB 4MA8L 3FQWA 4WW2B 5CP3A 1AFVH 4XTRC 4U33A 4P9HH 4C4KT 2VDRL 4YXLL 1JTPA 1NFIA 1WFTA 4XT1C 4KTDH 4OUUB 4XCNA 3N1QC 1S7WB 4WDIB 1GZPB 3D0LA 5DJ0A 1FL6A 1NMBH 5GRZA 1A02N 1ROWA 4XPHH 3VWJD 3ARBB 5FOBA 1HXYB 3IDXH 4QHNB 4H8WC 1KXQE 3O8XA 3GM0A 3HMXL 1QSFB 2HLAA 3TNNB 3BE1L 3IDNB 2GSGA 4J1UB 4X98A 2I5YL 4LLQB 2MKLC 4UINL 1LE9B 1OARH 3FQXA 2QHLA 5ACZA 4P59H 4DKFL 1IL1B 4EEEA 4P2RB 3SJVB 2P49B 3FN9A 4LP5A 3RHWK 1KXTB 3X12A 1U95B 2OR9L 3QG7H 5KSBE 2FNBA 1KB9J 2IBGA 4DGVH 1CLCA 3G6JE 1P4LA 1PLGL 4GJTB 4X6DF 4KTEL 4JM4H 4JFXA 1CF8H 2VDLH 3HG1D 3NVQA 1T04B 2NY7L 4LLVB 1FNFA 2Y06H 4P5TB 1OLLA 5ISZD 2WBJD 4HH9B 3IJYB 3VFTB 3C5JA 1UM5L 3BEWA 2F9BT 3PWJB 4JFED 2COQA 1IT9L 3E6FB 3ESUF 3QO0A 3V2AR 3ARVA 4W70A 3MYZA 5EZLA 4M9PA 3MLYH 4G80B 1AHWC 4ZNEA 3P30L 5EUOA 1MEXH 3VH8G 4CVZA 4PG2C 3QO1B 1WSST 3GSQA 3VWKD 2IJ0C 2FO1A 4LCWB 3SDCC 3VXTA 3DVGA 3QHTC 4XCFL 2VLKE 1A5FL 5F9JA 4EZMA 1T6WA 4TSAL 4C55A 3C5ZA 5HHMD 2A0LC 1HH6B 1DEEB 1KG0A 4FFYL 2YRPA 2X09A 2YA1A 5CGMA 5DMKA 5FIEA 4UQ2A 1YNKH 1CN4A 2F19L 4PRIB 1P69B 5DLML 4O9HL 3R1GH 3HPJA 4TSCH 1S7QB 1BQLH 2E27L 3BH8B 5T5FH 4ELKA 2EC8A 2EXYD 1WLHA 3TN0D 1MHPH 3IU3B 2P5EA 5C09D 1DBML 3FQUB 3CLFH 4HJGB 4F37F 2C9AA 4OZHE 3LAFA 5E1HB 3QUZD 4H8WL 4PRPA 1EHAA 3MV01 1T20A 2QQNL 3B2VH 1I1FA 3QAZC 5D5MA 5I16A 1NBYA 1B6DA 2WUCH 4G6AC 5BOPA 3KHQA 4YUEL 4Z7VA 3P4MB 1U58B 1P6FA 3QEQE 4OD2B 3TWCH 3SKMA 3X13B 3OJVC 4QHUA 2OQJA 3BUYA 1BFVL 2BNRD 4J3OC 4KUCD 2P47B 4LEOB 3IDGB 1PYWB 4KK8C 4GAGL 4HT1H 1OM3L 1J7VR 2BY1A 2Y25A 2ZKHL 1G7MB 2KDGA 4JFFA 2GFBA 4PJGB 3UBXB 2X4PB 5T1LA 3ARSA 1WZ1L 1E27A 4PJXB 4KRLB 2IF7A 1XCTA 3LKRA 2R0LL 4LPVA 4XMPH 2BVPB 1RULL 3DHJA 2P5WE 1UCBL 4YBQC 4JPWL 1FSKB 1Q94A 2EYRB 4ZPVB 1S9WA 5A2JH 4XRCB 1G7HB 4S1DC 1CXHA 3S88L 1FCCA 1WITA 3BXNA 1RZ7L 4OB5L 3V6ZA 4MYWB 5E99L 4JO2L 1YEJH 4D0DA 4AJ0A 2HFEA 5EZIH 4HIIB 4AENA 5JZ7C 5C0CD 1N26A 4ODVL 4FQXB 2VDQH 2LTQB 4XVTH 3SKNB 3HG1A 4R0LA 3SE8L 1LO4L 4YHYC 4YEFA 4X6CF 3ET9F 1QRND 1TJHH 4K7PY 5ISZA 4JM2C 2WBJA 5EBLB 3O0RL 8FABB 4HK3N 1JFQL 4PJ5E 3QB7C 2VDNL 1K3ZA 3VXSB 4JFEA 2WUBH 1RK1B 3GHBL 4CU6A 2VKWA 2DBLL 1YPZF 1R5WA 4FXKA 3WE6B 3L7FA 1DBKH 1GVIA 3QEGL 5CUSL 2DM3A 5L0QC 1EPFA 4YNYA 1G9MC 3VMNA 2GT9A 4NT6A 2NX5B 4NNXB 1JHKL 4IRZL 4DW2L 4YAQB 3VWKA 1EGJH 4GMSL 1MVUB 4OI9A 3MJ9A 3P9MB 4L8SB 3I85A 4UUJA 3VRLE 1U8JA 3OQ3B 5DYOB 3V0WL 1RAMA 2CPCA 4X7CC 5F7MC 1QKZH 2EDTA 3HPLB 4XVSL 3O2WL 3KLHC 2G9HA 3MYJA 2Z31B 4WCYH 3V0AC 1MWAB 3ROOB 2Q8BH 4ZXBB 1LNUB 4UBDC 3EJJX 3ZT5A 1CFTA 5C09A 4XBGB 4RQQB 4FQQA 3KPTA 1UWGL 3BGFB 5IW6A 2FD6H 1GGTA 4Z0XB 3WJLA 4D3CH 1EO5A 5JW3L 5DSCB 4HPYL 2ADJB 1D5BB 3C09B 2BFVH 1OP3H 4WIQA 3VI4E 1HINL 2YR3A 1A6TA 1VGEH 4XB8A 3KLAB 3ARRA 5C07E 1IBGH 2CLRA 4Z77B 1G7PB 3Q6GH 3I9GH 1VADB 4NQVA 4F9LC 2GSIB 1A1MB 3GKWH 2BNRA 3D25B 1OT2A 4HUNB 4M8QA 3CMGA 2AKRB 1WT5A 4GSDH 5HYJB 1NDGA 3QJHB 4A2MA 2AXGB 3WV0A 4XGZA 4UNUA 3LKQA 3O6KL 1A7BA 4JFDE 1LO3H 5LGJB 5SWQA 4RZCB 2XQBL 1IGIL 4MJ6A 4RGOH 5I1IL 4TPRL 4JDVB 3BPNC 1HHIA 3TYGL 3EYVA 5HDBF 4L3CB 4WV1B 3TO4C 4APQD 1BFOA 1F00I 4M7LT 1R3JB 4EN3C 2NY6B 3U7AA 3N50A 3MRGB 4HC1A 4V1DE 5D1ZD 1MPAL 4HZLB 5C0CA 3T65A 1U36A 3CFEB 1SQ2N 1G9ML 5FO8A 2BJMH 1HNGA 1JPGB 3TA3D 1AKJB 3OF6D 4XWGL 1QRNA 1HDMB 1R3LA 4HXAH 4P2QD 4IOIA 1JWSA 1YEHL 4F57L 2FJGB 4X6DE 3AY4C 5D7LD 1RK0A 2P24A 3AC0A 2Z92B 5ITBH 3MOAH 1UA6L 1YMMD 4LLWB 3S36X 3EFFA 1L7IH 1G0YR 3JTTA 3N1GC 2BSSA 1RIVH 2NW3B 5DS8B 3IFPB 4GRWB 4LIQH 1LD9B 2APTA 5L6YH 2QSCL 4XCEA 5CWSB 4L4TE 1QFOA 3SE9H 5F1NA 1I7RB 1OWWA 2JJTA 5FV2A 2W91A 1F97A 1WWWX 1A3QA 1IC5H 1NMCC 4PS4L 4YWGL 1HHJA 4JY4B 2KQMA 4CVWA 1TCMA 2X4TB 5HDOA 3MNWA 1CICB 5CJQH 1NGQH 3CFBA 5IIEA 3TBTA 4DK3A 3QT2A 1N0LA 4D8PA 3D9AH 4HGKC 1EEUA 2JE8A 4PJGF 2AJSL 4PJXF 1Y6KR 1K8IB 1OSPH 2D0HA 2VR4A 3T1WA 2JIXB 5CEXA 5I8OL 2EDFA 3LN5B 5ALBL 1NC4D 3O11B 3T0EB 3M07A 4U6VL 3UO1H 1UC6A 5GGQH 3CVIH 1YN7B 4H20L 4M1CC 1CFVH 4LPTA 4J6RL 1HI6A 4ZAKC 3IDYC 2HFFB 4KMQA 4G42B 3L6FA 4NO3A 5HHPA 4JJHA 3Q48A 1WEJL 1JGEA 4O58L 4X0KB 3QZWA 5FO9A 4XXDA 1OSZA 4OLVL 5HHOD 4B7LA 1RJZB 4G8GE 4G9FD 1EFXB 4RMWA 2EYTB 1BJMA 4XVJL 1MHEA 2H8PB 4H25A 1LE5B 4L8BA 2FECI 1JV5B 1T89C 4FXLA 5JR1H 3VGAC 2V6HA 3TPKA 4LSUH 3RWDB 3S97C 1T66C 2FYYA 1H0DA 2O93L 1JIBA 3GIZH 2GJ6E 4Y4HC 3UJIH 3I6KA 5JHDE 4AL8L 1HIMH 3MSPA 1J5OL 4APQA 2CKBH 4XNYH 4HUWA 2JJUA 5F6IB 3EO9H 2A38A 1AI1H 4XX1E 1T7ZA 1W72A 2Q7YA 3PL6B 5HHQB 4WJ5A 5E8EB 3RIAF 4C57C 3KS0J 1EO7A 3V7AE 3TBSB 1K4DA 1G1YA 4LL9A 2YPLA 2K7QA 3IFOA 1R3KA 3VFUB 4L9LA 3TA3A 3OF6A 3UYRH 5SV4A 3U36B 1RHHA 3FHQA 3P0YL 3E2HC 5EBWB 1TNMA 4JN1H 4P2QA 1YQVH 4ALAL 1BQHG 3ARGB 4RAVA 2F5BH 4TNVF 3A67H 3HI5L 5D7LA 3QIWC 1RUMH 1KJVB 1BVKB 1CQYA 1YMMA 4DGYH 1NEZA 4JRXD 2IGFL 1Z3GH 1UXWB 4NN6B 1ZT4A 1YMHB 3MCLL 1YEEH 4X6CE 1FORL 4QOKB 2DWDB 3ZMRA 4WUUE 4BH7B 2IFFL 1K6QH 4JHWH 4G7YH 2IALB 5C0AD 3MGAA 1T5XA 4NPYA 3JV6B 1VKXA 2E9JA 5TPWH 3KPMA 5AZ2L 4L3AA 1P9MC 4AH2B 1KLGA 2VMFA 5DVNA 3X17A 3O3EA 3O4OB 1LVEA 4E41D 2EO1A 1YPZE 1E28A 2Y5TA 2AQ1A 5M95B 1N5AA 3ARBC 1CL7H 5IVXF 1DQMH 3EO0A 4X7FC 3VFGL 3BUTA 4TQEL 4YFDB 5MEND 4YHKL 1OT1A 4JEGB 5E94B 1ZTXH 3FO9A 4YLQT 4HEME 2ICEA 2UZIL 3O4LB 4JHZA 5EFIA 2C3XA 1QG3A 3IRZA 3NTCH 1JNHB 2FJHB 1I8LA 1ZS8B 2B5IB 2XA3A 1CDGA 1ZKAA 4UQ3A 1O0VA 3OAZK 3WDJA 2WIMA 1IEBB 2WANA 2GK0A 1I9IL 2PN5A 1FC2D 2ICWI 4N90D 4NQDB 1NC4A 4KJQC 1N59A 3VXPA 3V52L 3K46A 1AD9A 3OXSA 1J9CT 5F6HI 4OBSA 1VACA 1OW0C 5GGSY 2OS7A 5D8JH 4I0PB 4TTDC 3ZKQD 4M1GL 4P5TC 1KIRB 1XF4A 1CR9H 4M43L 2FCBA 3SJVE 1HQ4B 1MJ7L 1RY7B 1EAJA 5HHOA 4P57B 3L95B 3MRNB 4G9FA 1ED3B 1JZ3A 4I77L 3FQRB 5K59F 4X4ME 3WS6C 5SV3A 1BEYL 4QXUL 4BSWB 43C9A 3GSOA 1AGCA 4JFOA 3SGJC 5HYSG 4G3YH 2BC4B 4OV6F 5IQ7H 5D2LA 3RI5K 2A9NH 1CG9A 5DJCA 3W0WE 2CDFB 5DMJB 3B6SB 5HHNB 3KXFD 1G7JA 4BZ1H 3O3DB 5DURD 5ID0B 3IF1B 1CLZL 1TENA 2Q3AA 2G75A 1Q9LB 3D3VD 2IANE 5I17B 1XGUB 4UDUB 5EN2A 1I85C 4TUOA 4ZUSB 3RVWD 4LQFL 4PY7B 1FV1A 1MREH 4N9GA 1CGTA 5EG6C 3EKCA 3DVIA 2H2PD 1TZGH 2FZ3A 2XWBA 5C0ND 4KQ3L 1CGVA 3STZB 1ZANH 3HZVA 1BIHA 1HILA 5CEYB 2E6JA 2IPKB 5F7EH 3HS0A 1TTFA 3VFRB 2D0FA 2ZCLL 4QRRD 4LCWE 2YZ1A 5K9QG 1JWUA 4OIBA 4X5LA 4JRXA 4I3RL 4XB7A 4NQXA 3SGDI 3QJFB 4L5FL 3GSXB 3T0VA 3IXAA 2X4OA 1UWEH 2F53B 1JF5A 2JJWA 1CD1A 2H2SD 3WL9B 1DVFD 2HRPL 3S36H 4GXUM 1A7RL 5C0AA 1GAFH 4EI6A 4PB0H 2AV7B 3QQ4A 4YHLH 1U0QA 1MCIA 3LY6A 1NQBA 4UIKH 4YPGB 3UCRA 2ITCB 2H26B 4E41A 4IJ3C 4S1SH 3OKEA 2E7LC 5DD5L 2DMKA 3WXWH 3TCXA 3UEZA 4L9DA 5IK3A 3D0VB 1F3JA 1HWGB 4RCAA 3U83A 3GSNA 4XC1H 1P2CA 5IFHH 5MENA 2OTUA 3A6BH 4CDGC 2BVQB 4JQIL 5C1MB 3T09A 2EKJA 3HR5A 1G7QB 1QFUH 5BMFH 1J05A 1S3KH 3GI8H 5DRXB 4W6XB 4LRNL 2LFGA 4IS6A 5KAQG 3EDKA 3S6CA 2BCKA 3LPWA 4LSRL 3G6AB 1IC4H 2PUQT 4DUWA 3SDXB 1YN6A 4Y5VA 2CK2A 1I1RA 1U8QB 1ZT7B 2QTEA 4KC3B 3ZKMC 3QDHA 3NAAL 2X1PA 1DQQA 1I3UA 4FQXC 5CIPH 2LTQC 2XXMB 1RZJL 3MLTB 3FFDB 4WU7A 2BVTA 3S9DB 3SPVA 3KJ6L 1UQSB 2KUTA 3LD8B 3O6FB 1I9EA 4XNMB 1IEAA 5EBGA 3EDDA 35C8H 3RL1B 2D7TL 4OZIA 5DZOA 4HWBA 4NM4H 3RVVD 1DBJH 4ISVB 1I3RB 2FL5B 2CJUH 3NCBB 4PJ8D 4FFZL 1T7XA 4R8WL 2ZJSH 1HXMA 2QADC 5C8JA 4H0GA 5D2NB 5DMGD 2EE9A 1SMAA 2CR3A 3EYQC 3CMOH 4OFPA 1C1EH 5IHUL 4LCCB 3ELAT 2DL2A 3QWOB 4IMLA 2RFXA 3SHSA 4CMMB 3RGVB 1J8HD 4LF3B 4P2OC 3KXFA 3OGCA 5IT2L 1K4CB 4LCUB 3ES6B 4L8SC 4PGCA 4JCLA 1PEZA 4P3DB 3PGDA 3D3VA 2R1WA 5E2TL 3RIFF 1NUNB 3QG6B 2CRZA 3K2UL 3S37L 4H1LB 3VXSE 1DLFL 2ZPKH 3KR3L 1FYTB 2AP2A 1NBZA 2Z31C 2ADFH 3PWVA 5JW4N 4N9OB 5E03A 4JZOA 2HT3C 5FGRA 1NGWA 2I26N 4Z7WB 1HHHA 1XGQB 2NNAA 2NX5E 1R24B 5D6DC 5HGBA 3U0TA 2HP4A 4Q7DA 1A1NB 32C2B 4QRRA 1UB6B 1T80A 4NC2B 5DD0H 5J12B 4DVBB 1V3JA 2BNQE 3KHOA 5T1DL 4NWUH 2VDOH 3UYPA 2MTPA 3ZYIA 2ORBH 1DVFA 1YY9C 4WW1A 1NFIB 2FEDC 1F2QA 1M7XA 4GW1B 4XCNB 2VO5A 3DX9A 3X3GH 4P4RA 5BVPH 1R0AL 5FYKH 5I75C 3T4AA 2L4OA 3D0LB 2C1PB 5DJ0B 1FL6B 1OB1A 1NJ9A 3QBTB 3V4VH 5I18H 4M6ML 5FOBB 2Q6WA 1KYOJ 4HKXA 4JR9L 4Y2OA 1SBSH 1X5KA 4M7JH 1ULVA 3O8XB 4OD1H 2HLAB 4PJFA 1CK0H 2GSGB 4X98B 5IWLC 3FQXB 3KYNA 4NRXB 1KCRH 1KENL 5ACZB 3GMLB 3F8UB 1QA9B 1YA5A 2AJ3B 1LK2A 1FG2B 5TFSL 2O5YH 5IVXE 4BSJA 4G8FB 3PWLA 1GIGL 1KLFA 1T1YB 3HLAA 4WV1C 3RUGA 4OQTH 1P4LB 1F11A 2NY6C 4ZSOE 2H1PL 4JFQA 4JB9L 1K5NA 3C9NA 4NYLA 5ERWA 4J3WA 4O4YL 5ENWB 4RX4A 4PRHB 5DD1H 2AQ2A 3C5JB 3ZZ1A 5FUCC 1R3HA 4ODHL 4KUZH 3GSUA 1PX4A 3BEWB 2YN5A 1CDYA 3LHPL 3CFCH 4OLZH 4PJ8A 3BKYH 1MAKA 3K4ZA 1U8LA 4HKZA 2E7BA 5EZLB 3PGFL 1UB5A 1MWAL 2DLFH 5D70H 4I4WA 5EUOB 2EIEA 1A7NH 4CVZB 5TE6H 12E8H 2WIIA 1JZ8A 3O3AA 3GSQB 3RHWF 3F5WA 2BHUA 1EA9C 5HPOA 4A6YH 4MA7H 3RU8L 5F9JB 5K59E 1X7QA 4JO3H 3WUWA 3TVMD 4UTBL 4KKAD 3C5ZB 4NKOB 4KDWA 4HQQH 1KG0B 2VXQH 4QY8A 5DMKB 3A0OA 4UQ2B 1CICC 3CX2A 3HPJB 5B3JF 4KDVA 3LQAC 2X4NB 5IMOB 4XNQA 5DF0A 1YC7A 1AP2A 1JPTH 2APBA 2P5EB 2NY4B 1D6EA 1QBBA 5TF1H 5CD5D 1GHFH 2YD6A 2Z8RA 1MFAH 4OLEA 2WV3A 3FFCE 5DHVH 3ALXA 5AD0B 5GRJL 4OFYD 5D5MB 4JFYA 3TFKC 1NBYB 3MRJB 4ZD3H 5F7YC 2L7JA 1IKFL 1MCDA 4RMUA 4GS7B 4Z7VB 3VD3A 3GRWL 3SKMB 2OQJB 3BUYB 4MAYB 4DAGL 1B2WH 1OGTA 4GKSA 3SY0A 3VWJB 5EOCL 1A7PH 2GFBB 5F9WB 1S9YA 3WIHH 3BP4A 3HRPA 3N1PC 4NWTH 4JHAH 5ICXA 3INUH 2GJZA 5IW3A 4JO1L 2AJUH 2B8OT 3WUZA 1XCTB 2ADIA 4FFWC 1OAQL 4NZJA 1TVBA 1FPTL 5GZND 4LPCA 3MJ8B 3QQ3A 1Q72H 4BK5A 1WBZB 3THMH 1BFSA 3DUSA 3OXRA 3OKNB 2AJZA 4LKXA 3MV7E 2ZP0T 4BZ2L 3BXNB 2F74A 3V6ZB 4YPJA 2I60H 3FB5A 4XCYB 4D0DB 3RPKA 4AENB 5F6IC 4X4ZA 3PL6C 3X11A 4R2GD 4BQ8A 5KVFH 5K9QI 2GKIA 4ORGA 3ME0A 1G9NL 3HG1B 4RGNB 4R0LB 1QSZA 3SBWC 4U31A 1S7SB 2XN9E 1I8KA 4FG6D 2OLDA 4X6BB 5DA0B 5B38G 5ISZB 2WBJB 4K9EL 4NQTA 4OZGF 2B4CH 2IADB 4OFIA 3IGAB 5F44A 2VIRA 2AJYL 3ARGC 1P6AB 2BP3A 3IVKA 5B21A 5F9AC 4QYOA 1NAMA 4JFEB 3O6LH 3EOTL 4EDXA 1S5HB 4FQLL 1V3MA 4NN6C 1JTTA 1Q0YH 3LQAL 3L7FB 5I1KL 4Z7WF 4FZ8H 4LMQE 1VB9A 4NN7B 1V5JA 3ZKND 3SGKA 4YNYB 4NT6B 2H6PB 1JBJA 2X2YA 5DD3L 1LHZA 4U1NA 3VWKB 4GG6B 3KYKH 2AEQH 4KKCD 4OIIL 1JTOA 1U8JB 3TVMA 3EDJA 2RCSL 2SEBA 5D1XD 1M1SA 4JKKA 5DT1L 5HHMB 5L2KE 5IB2A 1YYLL 4R96A 4P46D 2OJEB 1XGRA 4YO0A 1UWXK 1JGVH 5GS0D 2QQLL 4M4PA 4PPTA 2OZ4A 1T2QL 2RIKA 1JYWA 3MOBH 1KBGL 1WBYA 2HLFD 3TN0B 1CFTB 5C09B 5IBLD 1VFBA 4FQQB 2FX8H 1DBBH 2JCCE 3QUZB 4BQ9A 4U1IA 4R26H 4F7EA 3BRFA 2B5IC 3WFDH 4IRSC 4KJPC 5DTFA 1EEQA 4OFYA 1DQLL 1RQ5A 4B0MM 1A6TB 3FMGH 4CUCA 2V5MA 3BN9C 3JV5A 1KV3A 1T03H 1BF2A 2DKMA 4WFEE 3RY4A 2R0WH 3AS2A 4K23H 4YDJA 1IMHC 5DK0B 2CLRB 4KH2A 3MUJA 3I50H 4XX1G 3GBLA 4M8QB 3V7AG 2XV6B 1U8NA 3JXAA 5A3ID 1TNNA 3MFGB 4K8RH 4HPOL 1RUAH 3T2NL 4KI1A 1NDGB 5EU4A 3B2UD 2CMRH 1KF9B 1ZHNA 1NUDA 4Q9RH 4NQDE 2R56H 2J88L 1B4JL 2OX5A 4HS3B 5KVDH 2WNGA 5SWQB 4MJ6B 4N5UA 4NQSB 3EYVB 4G9DA 3HNSH 3L3KA 3P0GB 4OLXH 4BFBD 1BFOB 2VZVA 3KNBB 3OTTA 3MLPA 5HGHA 2PTTB 5C0CB 3T65B 5FO8B 5GIRB 5EDXA 3BD5A 5FYJD 4X9IA 1PKQA 3VXMD 4EOWH 2IC2A 5CINH 1YC8A 1R3LB 1EXUB 1E6JL 3BVNA 1FFOA 2P24B 5KVEH 2O5XH 3W9EA 1BREA 1DR9A 5C0EA 3C08H 3EFFB 1T1ZA 4Z7UA 4HCRH 3JTTB 1T4KA 1WVZA 2P8LA 5JIKA 4D9QD 3PWPD 4P5MA 5DEGA 4YDLB 5D71L 1H5BB 3QHFH 3IKKA 4XCEB 3CDCA 4DJMA 2VITA 2ZUTA 3JV4B 4JRYD 3V4UL 4KHTL 4YHZH 1E6OH 3LDBC 4OF3A 3CDGA 2NCMA 3OKOA 3LH2H 4S11A 2XNAA 1VFOA 2HFTA 3NIFF 3V6OA 3S34L 4LSVL 3VGDA 3HNTL 3BP7A 4L8DA 4S2SA 3D85B 5D1XA 1HHJB 4Z7VF 4C59B 4C83A 1ADQL 3H42H 5D1QA 3MNWB 1MFEL 4P46A 2ICWJ 5IIEB 3HZKA 1F58L 3TBTB 2FRGP 4NKDA 4AEFA 4M48L 1KUMA 4QRTA 2FIKA 2FX7L 3U0WL 4OCWL 4D8PB 5F3BA 4OGYL 1TIUA 4PJCA 5GRUH 3IS1X 5F6HJ 4HMDA 3BKCL 4ZOEA 5TDNA 3LEYL 1QFPA 3DYMA 3CU7A 1YEKL 5CEXB 1CVSC 2APFA 5BRZD 5B3JE 3RAJH 1BIIA 3QUYD 5I1DA 1IFHH 4HG4K 3MJ9H 3FRUB 1HI6B 4OKDA 4Y4FD 1JMXA 2LU3A 3GO1L 5IGXL 2ZOKB 4HS8L 3L6FB 3VG0L 4NO3B 4X7DC 2XA8L 1KGCD 5DC4B 4WHCA 3QZWB 5FO9B 3LD8C 3O6FC 4XXDB 1QSEA 1FFPA 3PHQA 4PP1C 5I8CB 2ZNWA 3NCYP 2J6EH 3OZ9H 2G60L 4H25B 4L8BB 5EULV 3UTTD 4U2YA 3ULUD 4ONGH 5F93C 3DV6B 4UV7H 5IBTL 5D2NC 2FYYB 2ZUVA 3DMMD 1NFKA 3TC9A 1Y6NR 4LCCC 4PJAA 3I6KB 5JQHC 1AY1H 3ABZA 3DRQA 4G6KL 4JPIA 1U91A 4LLMA 3RGVC 4HUWB 2EDKA 3RZCD 3V5KB 4X8JA 1HSBA 5EWIL 3ZHLA 3VW3L 4U6HA 2Q7YB 4L4VE 4WJ5B 5D1ZB 3UROR 3TJEL 1LMKA 3JWNC 1J86A 1MRDL 4F15B 1T1XA 1FFNA 1LO5A 4LKCA 1M05A 2AS5M 3WLWD 1R3KB 3NIDF 2X05A 4L9LB 3TA3B 4U1HA 4IEFB 3VXMA 2EDOA 4KJWC 2Z8VC 3SGEI 1RHHB 3IS0X 1QNZH 3SCMD 1MI5D 3H9SD 3WNMA 4JZNA 5FHBL 2ARJB 5HHVL 3GSRA 3V4PL 4RAVB 5D7LB 4U6YB 1OWRM 1L4IA 4M5YL 1OTSC 1YMMB 4AEIH 1NEZB 2NLJB 2APWA 2XZAH 1ZT4B 4NSKA 4PLJD 3TV3L 2CUIA 3TGXA 3U7YL 1UM6H 2ERJB 4BK4A 2BRRH 4OZGE 1GRWA 2ZOLB 5ECJE 4E0RA 1G0XA 1HZHL 1F3DH 1T5XB 2PYEE 1VKXB 3NBNA 1FYTE 4JRYA 3JWDL 4LCIL 1KLGB 4ZDHA 3O3EB 5TDPA 1MIEL 3BPOB 4WRLA 3T8XA 4HKBA 1E28B 1MJUL 5I8EA 4Z8FH 3WHXA 2EDJA 3QXAA 3TYFB 1XF3A 4Y1AD 1IC7L 1N5AB 3FB8A 1BAFH 1QFWL 3TP4A 5SWZD 3EO0B 3O8XC 2QHRL 1FIGL 5HY9A 5ICZB 3P3YA 4KUCF 2MPAH 3FO9B 3QI9A 4FFVD 2Z0BA 2KQNA 2J1KA 4DKEL 4IRJD 3OAZH 2DI8A 1MFNA 3QUXD 3WHE0 3MCKA 5T33H 3U0PB 4O02H 4R97C 3O6MH 2GK0B 4AK1A 4D0BA 2ARWA 1A6ZA 1LO0L 1ZLVK 1NC4B 1KT2A 1E4XL 1N59B 1AXIB 2NY1D 5FCUH 3VXPB 3QUYA 1AD9B 3OXSB 4G7VH 1VACB 4Y4FA 3ULVD 2AK4E 3MXWH 1NUGA 2E9WA 1AXTH 4NCC1 5F3HA 2OMBA 5DDHB 1EVUA 1FVDA 2DMCA 4OZFA 4Y2DA 4Q74A 1AIFA 3UP1A 1DJSA 4G43A 1J1XH 3ISWA 1GYAA 4U1GB 3P2TA 5HHOB 4MNGB 3OHXA 4G9FB 5GGTH 2AJXL 5MP6H 5LAXA 5DFWH 5E6YA 4DN4H 1A9EA 3UTTA 4C56D 4HXBH 2NR6C 2I27N 2X44D 2P8MA 43C9B 1AGCB 4JFOB 5ALCH 3OG6B 3DMMA 3RWIA 2CK0H 4Z95H 1CG9B 5DJCB 3HC3L 5GS1A 2OJZL 3QQ9C 1G7JB 2IFGA 1EX0A 3RZCA 2C4XA 2G75B 3J8F7 3NOIA 5EN2B 2ZNXA 5LKNA 4TUOB 3C5ZC 1FV1B 4N9GB 1FL5B 3TLRA 2DQCL 5IVNA 3M1BB 1BVZA 2FZ3B 2XWBB 3IXTA 3ILPA 5ELIA 2FATL 5HXMA 2J5LB 4RIRA 3HZVB 1J0YA 2EECA 4K8RC 5CSZA 1MI5A 3RJQB 3SCMA 3H9SA 1HILB 2K1MA 3HS0B 1NGPL 3L3OB 3FT3A 2DIBA 4QXGL 1JWUB 4LSSH 3CVHH 3HC4H 2E7CA 4F7TA 4NQXB 2P42B 4GLRH 5IB3A 1ACYH 3IXAB 4OLYL 2X4OB 4X8XA 1DN2A 1CD1B 4PLKD 3DARA 4LGRB 5C6TH 5EPMA 3TT1L 2I25N 2PR4L 5C0AB 4EI6B 3RI5F 3CFJB 4LNRB 3FN3A 2UWEF 3PE9A 4J3VA 3RVXD 2P5EE 5DI8A 4E41B 5FECB 3V7MA 5DQ9A 4TTGA 4U6TA 2IPTH 4ONFH 4PRPE 2X1WL 3K1KC 5IK3B 2JF1A 4DKDC 1KPVA 4KJYA 1CD9B 1F3JB 1PY9A 5AYUH 1BGXH 3JWOC 3GSNB 3QXDA 5SWZA 3KWWA 1ZXQA 5LCVL 1P2CB 3T08A 3B9EA 4YXHH 5B39A 5LXGH 5MENB 1AFVL 2OTUB 4NNPL 3LPGA 5DWUL 3NIFE 4EXPX 4LP4A 4NBYB 4Z7VE 4IDJL 3IYLW 4IRJA 1A1OA 3QUXA 4KU1A 4IS6B 4KPHH 1EIBA 2EYSA 4XVUD 2BCKB 5EU5A 3WKNA 4NZUH 4MVBD 5CJOL 1YN6B 2DD8H 4OLUH 4Y5VB 5JIIA 4JFFE 1FBIH 3E3QC 2WWKO 2VXVL 3WO4C 4PV9A 2MNUA 3OSKA 4XH2A 1T0PB 4JFZH 4R0LC 5SWSA 2XT1B 3ARED 1YZZA 1OARL 2R39A 3P4LA 3WS3A 2YD5A 3SPVB 1OAXH 2VLRD 1IE5A 1DANT 1CZ8L 3GEWB 5DJXA 4XHJD 2WBJC 1XAUA 4LSTH 2C3VA 3EAKA 1V8HA 2P46B 4YBLB 2NZ9D 1YEFL 1BF8A 2DN7A 1PGRB 1OQOA 1HXMB 5C8JB 2EDBA 3OAYK 1JZ2A 4FQ2L 4C56A 5DJ6A 4KQ4L 2VRAA 3TNMB 2LAGB 4JANA 4IMLB 2RFXB 5FGCB 5C86A 4NN7C 2OP4L 1JL8A 4NDMB 5L7XL 2DM4A 4ODSL 5ISZE 3PV6A 3VWKC 4UAOB 3MRMA 3KXFB 5C71A 3V6BR 5DURB 1CE6B 2CGRH 1D5IL 3DETD 4PGCB 1PKOA 1TQCB 2OSLA 2ESVD 2XQYG 3D3VB 2V17L 3PGDB 4MXWH 4NZRH 5I1JL 2H32B 2R1WB 4TULL 4OIAA 3QUMH 2VJXA 3DSNA 1A6AA 1UJ3A 2WBWB 3MNZA 3RX5A 1DCLA 4HBCL 1ZGLP 5HVWA 4JZOB 1D6VL 1KN4L 1NGWB 3PP4L 3DSFH 1HHHB 5BV7H 2NNAB 2EXYC 5HGBB 5JPNA 1J88A 4DCQB 1JNNL 4QRRB 5IBUG 2R2EB 5GHWL 2V2WA 3JWOL 3NIDE 3WJLC 3MFFA 1NSNH 2RBLA 4OGXH 1GPOL 3KJ4B 5J6HA 2NTSP 5E4EB 4AMKL 1DQJB 2DIJA 1DVFB 5I6XB 4WW1B 4NOFA 1KULA 3DX9B 2IH1A 4P4RB 3UTSD 5LWYH 3T4AB 1DUZB 1CGWA 1A4KA 3MO1A 3WFHA 1JNJA 1OB1B 2X7LA 1NJ9B 4NN5B 3RWJA 3ECBB 4F58H 4I9WD 4LVHC 2Q6WB 4HKXB 1PG7W 1U2CA 4K94H 5HHXL 5C3TA 3NCJH 5FYLD 4HLZH 1WT5C 4OGZA 3GMNA 1BD2D 3RY6A 1GC1H 4PJFB 5CLWA 1NC2B 4GXUN 1DLHA 1G7IA 3MRLB 3KYNB 1F90L 5IB4A 1RZIB 1CGXA 4UB0L 3LRSA 4WI7A 3EFDH 1QPXA 3WIFA 3GSVA 5F8RC 5KJRL 4CRPA 2WLYA 4XNXH 2QSTA 3BDBA 4GQ9H 3RUGB 3HLAB 2OL3H 2BNRE 1C7SA 1JI2A 4HT1L 2ZUUA 1F11B 4LAQL 3NH7L 4M00A 1I8IA 2YD4A 4MD4A 2J12B 5D2LF 1TETH 3MJ7B 3CH1B 4JFQB 5IKCA 5TDOA 3C9NB 1MCSA 2XI9A 1YNLL 4NYLB 4EQ2A 5ERWB 3U7WL 1OAYL 3AREA 3OAUH 4XMPL 2B0SL 2VLRA 2BDNH 4FMFA 4GMTL 4K71C 1UKSA 1R3HB 4KZDH 3TIDA 3GSUB 4EXKA 3OR6A 2JELL 3MRCB 3JUZA 4Q9BA 4Z6AT 4LFHG 5INCB 2DKUA 2GCYA 3QDGE 4PJ8B 2YKLL 4RISH 3E1F1 1KB5A 4HKZB 1PG7L 2AK1H 3QDAA 4AG4L 1UB5B 3BD4A 2X9YA 4I4WB 5C0CE 2V5RA 4HX1A 4HEPG 4YGAB 3O3AB 1KJ3H 4XNZB 3F5WB 3MOQA 1KXVC 5GSVA 5JW5A 4OM0H 5L2JA 2VQTA 1F42A 1QRNE 1J8HB 2JJTC 1WZLA 2HYMA 1X7QB 3WUWB 4U49A 1FGNH 3F7PC 5DRNA 4K3JL 2XZZA 1CDHA 2ESVA 4PBVC 1IJ9A 3L3DA 3L9RB 4LGSB 4U7SA 1VSCA 3GIVA 4QY8B 4DVRH 3H3PH 3DXAD 3BKJL 1JRHL 1IZJA 1RIUL 2DMBA 4U1LA 3S5LG 7FABH 1KACB 4XNQB 4CGTA 2FX9L 1FLRL 1AP2B 4N0YL 4NGHL 1D6EB 3HN3A 5CEZD 1MIMH 2D3VA 1Q0XH 3P4NA 3R8BB 4JREC 2NW2B 5DZLA 1A9BA 1XCQA 2VL5A 1DFBH 1NBVL 2VE6A 3WCYA 1FH5H 4CMHB 2EDHA 4AQOA 4JFYB 5HVHB 5FOJA 5C0BD 4N0UA 1TVHA 5IR1B 4PJ7A 2KZWA 1YUHB 1ZOXA 1MH5A 4CKVX 4ERSH 3DO7B 3UTSA 4XMKL 2DI7A 4M7LL 4OCRL 1OGTB 2VZSA 5EC1A 3SY0B 4HC1L 1LDSA 4M1DL 4I0KA 4S0TD 1S9YB 5IB5B 5C7XH 5JTWA 1AXSA 2DKSA 5ICXB 4KVNH 3OPZL 2DDQH 1X5GA 2GJZB 1BD2A 2DBJA 3U4BL 5DUPL 4U3HA 5DR5L 2R4SH 3PDGA 2ADIB 1IGML 2UWEE 2VDMH 2OI9C 1CFSB 1H8OA 1MHHA 3S3SA 3QFJD 4OZIF 1MCLA 3QQ3B 3LKNA 1KYOK 4N1EA 4PRAA 5F1OB 3DPBA 2IQAA 3WEXA 3DUSB 3OXRB 4PV8A 2AJZB 1MJJA 2B1HH 2FB4H 4LKXB 3VXNA 1U93A 3I9GL 4LLDB 2F74B 3EOBA 3GKWL 4APQC 2WLZA 4OBRA 5FUOL 1UYWL 5DHVB 3TPUA 2H9GA 3D39E 1X5XA 1YECH 4ORGB 4F15C 5C0DB 1EHNA 1ZHKA 1I8KB 3MRIA 4MB5A 3MBXH 1GGBL 2F54E 4L9LC 3TA3C 3DRTA 5DEZA 4ZS7L 2QQKH 1QYGL 3RL2A 1A14H 1PZ5A 1P4BL 3MLUH 3QA3A 3GMMB 3FO0H 3Q5TA 4P3CH 3IVKB 5C2UB 4XP4H 1T21A 3BN3B 3MTRA 5DGRA 3HI6L 4JY5H 4EDXB 5C0RH 4K3EH 1Z5LA 1F4AA 4TUKL 3U2SB 3VD9A 1PQZA 5T3ZD 1SMOA 4JDTH 1MQKL 5DMIL 4OD3H 1U8MA 3PF2A 4R7DA 2ERJC 2YPLE 3GNML 4Q9QH 4WI6A 1GGYA 1TMCB 4AT6A 1EBAA 4PRDA 4U1NB 3CK0H 1IRAY 1NFDA 4Z5RA 4F2MB 1A6PA 2AABL 5TQ0H 1IEHA 4K2UH 3N06B 4P2QE 4PRID 3TVMB 1SJHA 2LVEA 2SEBB 3B8YA 5D7LE 4PYGA 5EZOH 4DOHE 1UWXH 5IB2B 1FZKA 3MXVH 4NKMB 1U8KA 4YO0B 1FVCB 3BIAX 1G6RH 4F7CB 3DXAA 3T2PA 3MBED 5GRYA 3HFMH 3NMEA 4LIQL 3MPCA 4PJEB 1ZHBA 4YHIB 4Y8DC 3HNVL 4WW2A 1SYVA 1VFBB 2X89D 1CL7I 1I8LC 4YJZL 4U1IB 2YXMA 4OCXL 1B0RA 5F96H 2Q86A 1BBDL 1TFHA 5DTFB 1J0HA 3MA9H 4UT6H 5CZVH 1N64L 5JIHA 4I18A 3MLSH 1VEPA 1BZ9B 3S35X 1S7WA 4WDIA 3HMWH 3SE3A 5C0BA 2R1YA 5F70A 5C3LD 3RUGF 3KVQA 5EOQH 4QHNA 4LSQH 1HHGB 4TN9A 5ILTL 2DS4A 1CIDA 4MAUL 4CU7A 3HAEB 1KJMA 1W72L 4LSPH 1U8NB 1JF1A 3SO3C 4U1GC 2DWEA 3P0VL 1OAZL 4XPTH 5I19H 5EU4B 4NJAL 1ZHNB 2XY1A 1UZ6F 5HGDA 5IEKB 1U95A 4PFEA 1U6AH 1I4FB 4YC2C 3QFJA 4ZUUA 4G9DB 2YUWA 1U3HB 3L3KB 3HE6B 3NA4A 2HKHL 1IGCH 2R0KL 4PGJA 3LIZL 4QRUB 3TF7C 5E70A 5HGHB 1HHKA 1CT8A 5HHOE 4H1LG 3IJYA 4G9FE 3T2QA 4R2GB 4ZFGH 1AR1D 1PKQB 4DQOL 4JKPL 4WHDA 2Q20A 4P23D 5FYKU 5F7FA 3BYYA 3QNXA 2AJVL 1FFOB 4N5EC 1X44A 2B2XL 3W9EB 3QXUA 3VGHA 5C0EB 5D2LE 3L3HA 1YEGH 4UMGA 4NHUA 3EYUH 1T1ZB 4Z7UB 3ZTNL 1F4YH 1NCCH 1T4KB 1Q9OA 4KY1H 3BDXA 3EO9L 2ICWA 3DVNA 5AAWA 1KJ2A 1I3GH 2GY7B 2QV2A 4P5MB 5DEGB 3BGMB 1RUKH 2YUXA 1KELH 2YMXL 4O00A 2VITB 2VXSL 3IFNL 3CLEL 2VXUH 1A0QH 1Q1JL 5D7SH 2CXKA 3E8UL 4OJFL 2XNAB 1ZVHA 1YQVL 3HZMA 4HFWA 4PRIA 4DGIL 3BP7B 3V79C 1CLYL 4L8DB 5FDYA 5D1XB 5E6ZA 2UZYB 2HTLD 2VZ1A 1AQKL 2VLMD 2WSKA 4NC1C 4C83B 3IU4H 2FBJL 4JRXE 4P46B 4HJGA 3HZKB 4NKDB 3MBEA 4QRTB 3NFSL 2FIKB 1FNSL 1LK3L 4QWWD 4LMQI 5F3BB 2AEPL 4PJBF 1NANH 2Z4QA 1NAMH 3F7QA 5GJTH 4YE4L 5C0AE 5TDNB 2X89A 4QXTB 1DTUA 2P8PA 3OJ2C 4M7KL 1NCDL 2ZCHL 1FHGA 4OTXL 3AM8A 1WC7A 4EBQH 1U58A 4E41E 4NC1E 4CW1A 1BIIB 1KIPA 4Y5VC 1UEMA 5I1DB 1C5BL 1ZSDA 5IESL 5MENE 3DGCR 5HYJD 2EDRA 5F71A 1JYVA 5T3XH 4I2XE 1RZKL 3P73A 3LS5H 2EDLA 3STLB 4AEEA 4NQCE 1FFPB 3R06A 3LVEA 4QXWA 3ZDYF 3C8DA 1HKLL 3GJFH 4YBLC 4I5BA 1NMAL 1MRCH 4ZPVA 1PDKA 4N90E 3VMPA 5FF6A 4X4YA 2MWCA 4H88L 3L7EA 4AZ8A 5HYEA 4PJAB 4WNQA 4HIIA 3DRQB 3KLSA 4JPIB 3SKJH 3O41A 4LLMB 5E24E 4ZTOH 5F7LB 4X8JB 4UAOC 4NO2A 3KG5A 2HKFH 4U6HB 4WU5B 4RFEB 4JFHE 1T1XB 4OZIE 1LO5B 4I0CC 3HE7D 4LKCB 1LP9A 1M05B 2IBZX 1S7UA 1MRFH 8FABA 3RVWC 4U1HB 3VXMB 4E5XA 2CD0A 2H2PC 4P23A 5C0NC 4JZNB 4B5EA 4E42B 3GSRB 5FGCE 3AXLA 2X42A 3WE6A 1QBLL 1VCAA 4GXVH 4O2CA 2VLLA 2DQGH 4N8CH 2CDGA 4MJID 4OGAD 1VFAA 3KXFE 4X9GA 5AWNL 2VKXA 3GSNL 3VGBA 2CUHA 5GGVL 3PWPB 5I1GH 1EV2E 3KJ4C 4KKLD 3SDDD 3P9MA 4E0RB 1FQ9C 4K7PH 2H2SC 4UT7L 1DVFC 4JRYB 1JPSH 4ZDHB 5TDPB 3G5ZB 4QHKI 4MB3A 5BO1L 3UJTH 5I8EB 3WHXB 3QXAB 5I74C 1XF3B 4GAJH 3FB8B 5E08H 5CILH 5ICYB 5IHLB 4ZXBA 1LNUA 4QRRE 3AGVA 5INDB 4NKIH 5E2JA 1YJDC 5I73B 5HY9B 3U9PH 3V8OA 4QHMA 1D9KD 3LN4B 4KKBD 5JHLH 3FO2A 2CO7B 2JIXD 1YEDA 2HMID 4UILH 1PY4A 1XT5A 2Y07H 4R4FH 3UJJH 1IAIH 4PB0L 3NIGF 1MF2H 1S9XA 1A7QH 3ARFD 5DRWA 3B3IB 4HWBL 5J11B 4YZFF 3ARWA 1ZLVH 1EVTC 1A6ZB 4RGMB 1BVLA 4OCLC 1RVFH 5BRZB 1S5IL 3BQUD 2D7NA 1KT2B 5F9OL 4Z77A 5J7CC 1CDCA 1VADA 3Q1SH 3QUYB 4LVEA 3SKUD 4DN3H 2YWZA 4LHUB 4WI8A 2J8UB 1RIHH 2E9IA 4FHBD 1CDJA 5HYJA 3QJHA 3GM8A 1FVDB 4OZFB 2W9EH 4X80H 1AIFB 3SQOH 4G43B 1WIOA 2IQ9L 3I3EA 3OHXB 2E5EA 4TVPH 4PJDB 4HAFA 3BO8A 3RUGE 5IROA 1KTLB 3RVVC 1SVZA 1A9EB 3GRWA 4CL7A 3UTTB 1XEDA 2FH8A 4PJ8C 4Q6IA 4L3CA 2P8MB 1M6OB 1C12A 3MLWH 4FQ1L 4M6NH 1R3JA 4MNHB 3DMMB 1TDQA 3RWIB 2RHEA 5GS1B 5I15L 3LKOB 4BKLA 3VG9B 5I8KL 3RZCB 4HWEH 1J1OL 1JPGA 5EU7C 5GS2H 5L88H 2MSPA 5I1LA 3CX5K 3LKSB 4QRSA 5TQ2H 5EIIB 1S9VA 1WIPA 3HE7A 4MA8H 2A1WL 1F02I 1SHMA 3C60D 4FQJL 3LQZA 4LLWA 1ND0A 3QCUL 3IXTB 3S3PA 3ILPB 1PJ9A 4RIRB 2VDRH 3SCMB 1C1EL 1MI5B 4YXLH 3H9SB 1TTUA 1FNEB 2R23B 3HHRB 2NW3A 3VRIB 3FT3B 3IFPA 3RWCA 1EZVX 4F7TB 5EU7E 4MQTB 5IB3B 4MJIA 1YJDL 4PJCF 4JJ5A 4CMHC 4ZFOA 3V8CA 1FP5A 5EPMB 3H2WA 3HMXH 5DQDL 3GZKA 5HVHC 3SDDA 1S7RA 3WNPA 3MR9B 2I5YH 4UINH 2O61A 5D7KD 4ELMA 4DKFH 3RBGA 3DJ9A 4LARL 1U41A 2ZCKH 2FEEL 5ANMA 5DI8B 4X99A 1IM3B 1TQBB 5EZJB 5DQ9B 2EXWC 2OR9H 4Y1AB 1OP5H 3IFLL 2HWZL 1KPVB 2P7TB 4KJYB 3QXDB 5SWZB 3KWWB 1PLGH 3TZVB 5B39B 3LCYA 4KTEH 1K8IA 2CR6A 1AO7B 5E7FA 1HK6A 2EDQA 2JIXA 1S9KC 3NZHL 2NY7H 4JLRB 3O11A 3T0EA 4IRJB 1A1OB 5J89A 3BPCA 5BVPL 3QUXB 3WD5L 1FLTX 1B3JA 1YN7A 5FYKL 4I3GA 2EYSB 1HYSD 4PJHF 4PP2A 1TPXB 4PJBE 4OCSL 4I0PD 3WNKA 1WF5A 1UM5H 4PJAF 2NY1B 1ZVYA 1RHFA 3OV6A 5EO1B 2FGWL 1IT9H 2RR3A 4XH2B 2YPKB 1ZGLA 4GG8A 3BZEA 4OT1L 1BZ7A 3DGGA 2B20A 3P30H 4R90L 3WS3B 4LVOB 2H8PA 5DJXB 1LE5A 1XGPA 2LU7A 2C3VB 4OAWB 3ZE2F 3ZT7A 4XCFH 2O5YL 3VFMB 1DSFL 3AUVA 3RKPA 1A5FH 2CRMA 3BAEL 4R7NA 4TSAH 3OAYH 3UTOA 4C56B 4KTYA 3WXVL 1QLEL 4FFYH 1LDPL 4P9ML 3BWUC 2F19H 3SGKC 4FABL 4HUXA 4NRZA 4O9HH 5DLMH 3ZDYE 1Q8MA 2Y23A 2MFNA 3MUY1 2E27H 3PV6B 5E00A 3MRMB 5J57B 5KBNC 1DBMH 5HYSA 1S7TA 4N8VB 4N8PA 2OSLB 3S4SB 4DK6A 2EE6A 4H8WH 3TVMC 5F1KC 3P9LA 1SJVA 4KKAC 2QQNH 1A6AB 1UJ3B 5MERA 2D7QA 3MNZB 2IPUK 4UIMB 3W5NA 1DEDA 4YUEH 1MCFA 4Z7NF 2F53D 4QOKA 5CD5C 1CE1L 3AROA 1BFVH 1I1AD 2B7DT 1OCWL 2UY6A 2ATPA 2V2WB 3Q0HA 4Y89A 4D9LL 4GAGH 3MMEA 1OM3H 3KPRD 5MHSD 2P1YA 2ZKHH 2X4SA 3JV6A 5IW1A 3QCVL 5J6HB 2ADGA 5C0GB 1A6VL 1WZ1H 4Y5YA 2P43B 3N9GL 5T3XE 4EIGB 2R0LH 2IH1B 1UGNA 4GOSA 1MAJA 2P5WD 1RU9L 1RULH 1A4KB 3WFBL 3O2DL 3WFHB 1UCBH 5FO7B 3QZWG 4JPWH 2X7LB 5TF1L 3GMRA 1F4WL 1A6WL 25C8H 5KSBA 3O4LA 1ZLWK 4KK8D 4OB5H 3GMNB 5E99H 1WISA 3DIFA 4JO2H 2Q8AL 1JNHA 2FJHA 1ZS8A 4G6FD 1DLHB 1G7IB 1JCKA 3ZLQC 3GBNL 4ODVH 4D9RD 5IB4B 4FP8H 1MQ8A 4GUPA 1IEBA 3F65A 3LRSB 3CD4A 3WIFB 3SE8H 1LO4H 3GSVB 3HCVA 3DBXA 4FTVB 1ADQA 1ZLUK 2HFGL 3RKDD 3ULUF 3O0RH 4Z76A 4ONOA 5A16B 1JFQH 1I8IB 2W0PA 4MD4B 4I0PA 4Y7MA 2W0LA 1JZ5A 1WAAE 2XQYK 3GHBH 3EO1A 3FZUD 4R2GC 1YYML 2DBLH 5TDOB 3NIGE 4GH7B 3QEGH 1U9KA 4YZFE 3AREB 3VXUE 5CUSH 5JOFA 3FOMB 4LU5L 2VLRB 3C5SA 3D48R 4IRZH 2D9CA 3TIDB 3WKML 4DW2H 4GMSH 3OR6B 1X6LA 3RDTD 5C0FB 4I3SL 4BSWA 5HGAB 1KC5L 2BC4A 2GCYB 2HAZA 3V0WH 1KB5B 4U0RC 1N4XL 4OV5B 3CH8A 1I9JL 2X40A 5HHNA 4XVSH 2ZUWA 5GGUA 3MLZH 3O3DA 4HX1B 3IF1A 1JUFB 1ZA3B 2D7OA 1KEGL 3ZKNC 4KXZH 5GSVB 4M8VA 5JW5B 4PY7A 3P40A 5AEAA 4OZHA 5DRNB 2VTFA 4KKCC 3V6OC 5F1SA 3T0XA 1UWGH 2BVEA 4HWZA 2ESVB 3L3DB 5D1XC 3GIVB 2F15A 3STZA 5JW3H 4HPYH 4JN2A 1FDLL 1YDPA 5D1QC 2IPKA 4P46C 4U1LB 1HINH 5GS0C 2OXHA 3S96B 5AAMA 4CN4A 5DQJB 2HT2D 4FXGA 5D9SA 3U1SL 5J6GA 2V2TB 3GSXA 1J10A 3MLRL 2F53A 5TE7L 2HLFC 3UZEA 4RSVA 1A9BB 5IBLC 2VL5B 3Q5YA 2ICCA 1I1AA 2VE6B 4EUPH 3V6OE 1HQRB 2R4RL 3KPRA 1AJ7L 1FCGA 4N0UB 1TVHB 4JPKH 4EI5D 3AVEA 4YPGA 2YSSA 1MH5B 2V5SA 2H26A 5A2KH 5DEFB 5DHYA 1SY6L 1O7SA 1WWAX 3O6KH 5GGSA 2P5WA 2XQBH 1IGIH 3D0VA 5I1IH 4PJCE 4TPRH 3WFCL 3TYGH 5JXAL 1J1PL 3FQTA 2D0GA 1DBBL 5H2BB 3VRJA 4OZ4A 3VFNB 4XPBL 5SX5K 1NEUA 3ULVF 1BX2A 5A3IC 3QRFM 5D72H 1BD2B 3K0WA 4EVNB 3PG2A 3RRQA 1MPAH 3B2UC 5CD3A 1G9MH 2CO6B 1NLBL 3FB7A 2EH7H 3LKNB 3W39A 4PRAB 1J0IA 4WI4A 3SDXA 2F58H 4M6OL 2IQAB 3CDFA 4XWGH 5BCAA 1U8QA 4PV8B 1MJJB 4ZOAA 3VXNB 1U93B 3RWEA 1YEHH 3K81A 5JPMA 3TM6A 1U2HA 1UH4A 5EA0L 3WDIA 1UA6H 1QSEE 4EJ1C 4LEXL 4PRHD 1DANU 4BSVA 1ZHKB 4XP6L 3SO5A 1V05A 3AS1A 3CSPA 3MRIB 3MV8E 4IMKA 4PJHE 4X4XB 1VPOH 1I7ZA 3RL1A 1EEYA 1UENA 3ZYJA 2QSCH