2BDNH

Crystal structure of human mcp-1 bound to a blocking antibody, 11k2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
217
structure length
217
Chain Sequence
b'EVQLQQSGAELVKAGASVKLSCPASGLNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKFDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARGVFGFFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A2
publication title Structure activity relationships of monocyte chemoattractant proteins in complex with a blocking antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2005-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnH02
1CDHA 4MA3A 4YGVB 3GIVA 5T3XE 1CTNA 1J8HB 1IVLA 1C8PA 5IHBA 2HT3C 4JDTH 4ERSL 4R0LC 4G3YH 4JG1L 2VLRE 2CLRA 4LOUC 5HYSA 1LO5A 2DQHL 4HK0B 4H26B 5CP7A 4P2OA 5FCSH 1KPVB 3GSQA 3V4VL 1J0ZA 1IAOB 4X4XB 3HZMB 1F5WA 5CIPA 3B8YA 3FO0L 3GSUB 4U1JB 1WF5A 3WIHA 2H9GA 1CF8L 1FNEA 2B20A 1YEKH 1IEAA 5HGGS 1NMCC 2VZSA 1H8SA 1HKFA 4RQQB 3BGAA 4M62L 1RULH 1EHXA 1BZ7A 4G9FD 3MRRB 4HIHA 3TVMC 1DE4A 2HVKB 3QCTH 5J06A 1U8IB 3L9RB 4X6FA 3SE4A 1QSEA 3TA3B 5D7KD 2D31B 4M4PA 3C60C 4NSKA 2P8MA 4QXWA 2DN7A 7FABH 3B9VA 1FGNL 2OBGA 4LLVB 5IB5A 3SKOB 2FBJL 3PWUB 5TQ2H 4UQ3A 5TE4L 4GS7B 4EIZC 2YEZA 4XBGB 4JFFA 4M1CD 5I1GL 3VWJD 3G6JB 5ICYA 4LAQH 1X3DA 5GGUA 4WUUE 4U0RB 3U0WH 3MA9L 2H32H 4OCYH 2XZQL 3FZUD 3D25B 5ESVA 5F7MC 4NRYA 1KLGB 1RIVL 3IB4A 5HDQH 3SPVA 1MIEL 3MRGA 4MHHI 3TPUB 2Y5EA 4HS3B 4YHYC 3SDAD 4Y5VA 1QFPA 5ESQA 3QQ3B 3WL9B 4S1RH 5C0FA 1MJUH 4MNHB 4TTGA 1IC1A 1CDIA 1PG7L 3D39D 4PRBA 1D9KD 5EOQH 2KDGA 1FPTH 4F7EB 4BSJA 2O26U 1G84A 2XPGA 2AKRA 2DJSA 2DYPD 2FNBA 3B3IA 5I15L 1IM9D 4PJ7B 4YXHH 1KT2B 5EU6E 4PUBH 1I8MB 1URLA 5DUMH 5A40E 5FM4A 4JFOB 1K8IB 1L6XA 4OQ1A 5J57B 3MBEA 1FN4B 2APBA 2R23B 3UJIH 4MZ3A 4WI7A 3WLBB 1MCHA 3NCBB 3FTGB 5D7LD 5DS8A 3RI5K 3LKPA 3VW3H 5IF0B 2YRPA 2XY2A 4PJ5B 5CEYB 2IAMB 2DI9A 2BNUB 3GGWA 3W11C 1KN4H 4P4RA 3T77B 4MS8C 5B8CC 5KW9H 5EIVA 4Q6IB 1BWMA 4KQ4H 2ICES 1QSFB 3NIGE 2HT3D 3IETB 1QPXA 4UINL 4ETQA 1G9EA 1U8JA 1NSNL 3B6SB 3MV9B 4FQXB 3U2SA 3RZCA 1OB1A 5D70H 5T5FL 3QG6B 2VJXA 4KAQH 2D7QA 1L7TH 4KK5D 4GKOA 1FIGL 3MRNB 3MQIA 4BFIB 2CDEB 3X11A 2Z8RA 2BX5A 3L7FB 3EIFA 4ZO6A 2YMXH 4LBEA 3TJHC 3M1BB 2IQ9H 1IAMA 4NRZB 3O6KL 4GRMA 4B5EA 3O4OB 4W68A 4QOKA 1T1ZA 4Q9QH 1C08A 3I50L 4G7YH 2NY6D 4TUKL 5E8NB 3VFGH 1S7TB 3TVMD 1CZ8H 3PHSA 2Z31B 5GRXG 1INDL 3BP4A 3QEHA 3F12A 4OCSH 1SEBB 5D2NC 1JZ4A 1LK3H 5DVMA 4ZFOL 3C60D 1U92B 3DETC 1U91A 1ZLWK 2YC1A 1ACZA 3R1GL 1WAAE 1ZLSL 1ETZB 2Z35A 2R0WL 1S7WB 4QHUA 1W2KT 4Y4HA 2G2RB 4KHXH 1JTPA 1QUNA 1CWVA 1EDQA 5JXEA 1DTUA 1YNLH 1E6JH 3EUUA 1C12B 2AVGA 4J3WA 2GW5A 2VIRB 4HUUB 4LCWA 3LS5L 3SKMB 2GK2A 4WJ5B 1G7PA 3RL2A 3LD8C 2KUTA 5EO9B 2IPKB 4QTIL 5MENE 4LPYA 4KUCD 3MXWL 1QFWH 4QGTA 1EBPA 1KCUL 4X0KA 1LEKB 4CN4A 3HAEA 4AIOA 4PG9A 2P5WB 2CJUH 4GMTH 2BXYA 5BS0A 2BP3A 4WDIA 1LWRA 4NUJB 4PJHB 4TUJB 1JGVH 3HR6A 2E7CA 1PEZA 4JZOA 3W9EB 4P2RD 5D72L 1J0JA 5D1QB 3VMNA 2V2XB 1K5NA 4LHUD 3VXMB 1KJ2L 5MEND 5BRZD 1G9NH 2ATKB 5IV2A 3V5DB 1JF1B 1P6AB 3FB8B 4MXWL 3QHFH 4ODBD 2J5LC 3V5KA 1N5YH 4IHOB 2ADIB 2VH5H 3LKQB 5F7FA 3U7WH 1BZQK 1A6PA 4M7JH 4LF3B 5DJZA 5C6TL 4K3HA 4ZFFB 5SWZA 4KC3B 3QNXA 1I9JL 3DXAE 3GHEH 4W4OA 5ICXB 1HHGA 3MC0A 4OZHB 3W0WD 4RGNC 5DJ8A 1R3KA 1R5WA 4PP2A 5DWUL 1WEJH 3ARYA 3W11D 5FGBA 3K2UL 1VGEH 3VD7A 4Y5VC 4PJAE 3L3OA 4TVPL 4Z0XB 4K07A 3V7AE 5EOTA 3MJGX 1HHHB 2ITDB 3DX6B 4JFQB 2OL3H 1A02N 3THML 5ID0A 3TO4B 1PX3A 5EIIB 3VFSA 2R4SL 2HT2D 1AGFA 3V6BR 1JYNA 3IAGC 3TBWA 4Y4KC 5BXFA 5DJ2B 2HKHL 2W1NA 1FL5A 1SEQL 1NC4A 4XAKE 2AJZB 4I3SH 3UTSD 3W9DA 3ZDYF 5BV7B 4L1DA 3TJHD 1NFDA 3BKYH 2XI9A 3MBEC 3IDXL 5A1AA 4TTDD 3W5MA 4P9ML 2HJFA 5FGCB 3BPLB 3ZTJH 4KFZC 1U58B 1TIUA 2RFXA 3PXJA 2VWEE 2A83A 2M2DA 1CFNB 5CINH 3V0VA 4XB8A 1I9IL 4HLZG 3JZ7A 3GJFK 3SE9H 4Q7DA 3RZCC 3MA7B 4CRPA 4YDJB 4P2OD 2BC4B 4MA1C 1ZWIA 4R6UA 1X4ZA 3KPLA 4JY5L 1VPOH 1OAXL 4RIRA 2O5XL 2PO6B 1MFBH 2YA2A 3V6ZA 3VRLF 1MRFL 2JJVA 3IRZA 2G75A 3C08H 5C2UB 2BVOA 1CICA 5H94B 3OKLA 5ALBH 3UJJH 4X98A 4JFFE 3AAZA 3GHBL 4ZFZB 1JGLL 2CGRL 2CDFB 4H1LA 4UU9B 1T83A 3MRDA 3K8KA 4X6EB 1FFPB 3VXSB 1R3JB 3FOMA 1QSED 5T1KA 3BH9B 1V3LA 5ACZB 4FFYL 3MJ9L 1OP5H 2I9TB 4FQPA 4K3JL 5EZOH 1W0VA 1INEL 2AK4B 5FA4B 4DW2L 4OCWL 3TN0B 2VXUL 5BO1L 2H45A 5JUEL 3KLSA 4L3EB 1AXSB 1EGJL 1E28B 2BDNL 4PR5A 5JXEC 4JFFD 1OAQH 4MJIA 4BUGA 3CSBA 5KVGH 3QRFM 3OXSA 2EE2A 2XZZA 2DI8A 3CGTA 1OF2A 4YDIH 3A6OA 2ATPB 4ALAH 1MEXL 1XGPA 1N6QH 4JFZL 5FV1L 3MRPB 3EYQC 2UV3A 1OTUC 1IFHH 1KCVH 4MCZA 4RGND 1WC7B 4QHNB 2HFEB 3EYOA 5DHVA 4TPRH 1CDGA 4K7PH 3OR7B 5TQ0L 4ZAKB 1W0YT 3IFNL 3MNWA 3WFBL 2C1OA 1CD1A 4XNXL 4NJ9H 5EU4B 1WT5A 3BWAB 4XHJC 4K3EH 2FB4L 2BNQB 1AQDA 5HGDB 2JJSC 1YYLH 4IM8A 4L4VE 2K7QA 5J9PB 4X6CF 2DLTA 4OLVH 5HGAB 3ABZA 3MCLL 2ZSWB 3GKWH 3NACL 3A6CL 5EBMA 1MCBA 1KTDB 3RVVC 3IDGB 1HHJB 1K3IA 3LMJH 2OXGA 2AV1B 1F3DH 4TQEL 4AENB 3G6DL 4MXVE 3MBED 3FB5B 4JHAH 1BVZA 4QWWC 1I3VA 2ADJB 2ADGB 4MNGA 1T1WA 1PG7X 2EDXA 4W4OC 5IB1A 5E2WL 3NFSL 3QQ4B 4U0QB 2RIKA 2OJZH 4Z7UB 4L4TB 1QFWI 2IH1A 2H8PB 4K9EC 5HYQB 4R7DA 2VL5A 1LQSR 4HDIB 4D0DB 5EZLA 5C8JA 2X4NB 1Y18A 4X7TA 1NCWL 3MRLB 1ERNA 1OT1A 2HJKB 4K7PY 5IFHH 5IVXF 5JIPA 4U1IA 2AXJA 3O8XC 2Z4QB 2NXZC 3RZCD 2HN7B 3IFLH 4M7LH 3REVA 2LTQB 4D9LL 3CXDH 1R3LB 5GRZA 4OLWH 1IEHA 2ZKHH 1N7MH 1U93A 1EHAA 5EG6C 2AAVA 3UJTH 4KDVA 1AP2B 5JW4Q 5ERWB 4QOKD 4BELD 4ZNCD 1JHLH 4PRAA 1FAIH 3O4LB 3CDCA 3QG7L 5FUZL 4HBCH 4NQEA 4PY7A 5F9JA 4GG6B 3D85A 1EV2E 5EUOB 5EWIH 1MAJA 4LNRA 1DDHA 5IQ9A 1HXMA 3RVWC 3DYPA 4U6YA 1LMKA 4KQ3L 1PW3A 1A7RL 4Y4HD 1MNUH 3NH7L 2D4DA 5JXED 3HZKB 4OFDA 5BVJB 4NZRL 2XA8L 4LCWD 1RVFH 4IBLT 2VDMH 1F13A 4MHHG 5C7XL 6FABH 2DQIH 3O3BA 2EYRB 2W92A 1CICC 2BRQA 4PTUA 4M7LT 1FSKC 3G5ZB 3EBAA 1R0AH 4L3AA 5HYJE 1W72B 4Z7WE 1U36A 4NWUL 5F6IC 3TFKD 2HFFA 4HWBA 3ZHDA 2QADC 4QCIA 5IBTH 3GSXA 4ZPVB 4UB0H 2FYYB 3LCYA 3F8UB 1U8KA 5BS0D 3C2AH 1WJ3A 5C08B 2Z92B 3BRGC 1O0VA 3TH2T 1A7NH 1X5KA 5IVZA 3B2UC 4GKNB 5GGQL 1N2RB 3BDXA 3UZEA 3MGTB 3L3HA 4XHJD 1JGUL 1HXYB 4WW2A 1KXQE 4FQQA 3VFRB 4ZUVB 3DJ9A 4X99A 3WEXB 3IXAA 2XQBL 3NIFE 2FJGB 1I1RA 1QR1B 4HMDA 5IM7B 1DLFL 4PJBF 2HLFC 4TOYL 4OZ4A 3RGVA 5CIPH 4Z95H 3X13A 1X7QA 5LGJB 4AQOA 3RVVD 3AGVA 2CRZA 3GZKA 2HP4A 3WSQL 4BQBA 4HKJB 3WIHH 1C5DA 2FL5B 4NWTL 5SWZD 5DK0A 4DKDC 1JYXA 4WTXA 3B9KB 5LXGL 1P7QA 3GSNL 4OIAA 4GRWF 3L3JB 2VN4A 3QO0A 4G8GE 2H41A 3KYNB 5MEOA 1IGJB 5MEQA 2ZCLL 3T3PF 3CUPB 1HHIB 1CK0L 5DGRA 5LCVL 3RUGB 2PETA 1G7IA 3OZ9H 1PGRB 2Y36L 5HI3C 3IRPX 1NAMB 2NXZD 2MHAA 2C3XA 1OAKH 5JHDA 2PXYC 5L6YH 1GZQB 2MFNA 3HPLB 3UTOA 4ZFOA 1MOEA 2LABA 3OAUL 3H9SB 3OX8B 2ESVA 3PNWA 5KSBE 4OBRA 5CJXA 1PY9A 3DO7B 1TZIB 1NC4D 3UBXA 1GGCL 3RX7A 1MHEB 5F7WC 5J0BA 1UKTA 4PV9A 3C5JB 3TCLB 4RNRA 1WBXB 1TJIL 5E8OB 4Y8DC 4RAUA 1MREL 3DGGA 2DQGH 3UTTA 1FRGH 4M7KL 3IJSA 3TH3T 3VXQB 3FRUB 1CYGA 3O9WB 4YBQC 3BHBB 3OG4B 5J13C 3QDJB 5F1NB 5TDOB 1DQQB 3TBVB 3JV6B 3VXUB 2R56H 2ZUWA 4PIRF 4FQLL 4XP6H 4QHLB 4PJ9B 4P46C 4P2QE 3RX5A 1BAFL 3O45B 4HULB 4EDWH 3RVWD 5TE7L 3QPXH 4NO2A 3WIFB 3WS6A 2EDTA 4FQHB 3FQRB 3VXOA 5JW5A 1UEYA 1D5IL 2H2PC 3NA9H 3DSFH 4ODVL 1LK2B 3FAWA 4RZCA 4P59H 4X5XA 4N0FA 4R4BB 5IFJB 3P77B 1KJ2A 4KMTL 3D1MC 3JTTA 4LPXA 4KMQA 3DX8A 1GCFA 3A67H 4CUCA 5SX5K 4RGMC 4NC1C 3OB0H 4P5TA 2J4WH 5GGSY 1CICD 1QFWM 4LEXH 1UA6H 1ZSDA 4PV8B 1AY1L 3P0YL 3GMQB 4L3CA 2QADD 4P5KB 5FYKU 5LAXB 3C9NB 3ZE2E 2XWJB 5ECJE 5KANI 2XKNB 1JRHH 4YHKL 3RWJA 4QRUB 5T1KD 4PYGA 3ARBC 1ZA3B 5I18H 2DQCH 4UNTA 2A9NH 3MLTA 3D3VE 2BVUA 4PRHE 4NQCA 4BZ2H 5HGBA 3GMNA 3HC3L 1F4YL 4C4KT 4AZ8A 3D0VA 4J23A 4LQ1A 1U8NA 2ZOLA 5K59F 1NAKL 4MJID 3U4EA 1JIBA 4W6WB 4DKFH 2VXVH 2VDOL 1HNGA 3UROR 3PV6A 2L0DA 3OAYK 5DI8B 2B2XH 1M71A 2N7BA 3LVEA 4N0YL 4OTXL 3QDGB 4WU7B 3T0AA 4NUGH 2DBJA 1SQ2N 4RRPG 1J0IA 2J7LA 2JCCA 3KPOB 4GAJL 1AD0A 1XZ0A 4DTGL 4ZXBC 4OSUH 3ZHLA 4YHIB 1ZEAH 4YDLC 3PG2A 3U1SH 4XWGH 3W2DL 2A6IA 1FLTX 1NUFA 2EDOA 1NC2B 3ZKXB 2NZ9C 4LP5A 3TBSA 1NLBH 2PR4H 5GS1B 5MHSD 3L5WA 3VGHA 1RZFL 4NHUB 4M48L 1RUAL 2ZWLT 3C8HA 4DWHA 2KQNA 4UMGA 1PJ9A 1EJOH 5F7EL 5JIKA 4JRYE 4NQSB 4JDVB 2Q87A 4NKDB 1RIHH 1P4IH 3NCJH 1BOGA 4DN4L 3WS3A 3KXFB 4PRDA 4XMPL 5JLZA 3MV7A 1SM3H 4RISL 5EZIL 4GAYA 5J12B 3HAEH 5IHLB 1QSZA 3MODL 1FO0B 2E27L 4WWKA 4MLSA 3CZFB 4KXZI 4G8EA 3HB3D 1NEZA 1FLRL 5I1DB 3RP1A 1XIWB 4O2CB 3IVKB 1MY5A 5KG9B 3FFCA 4AT6B 3GUTA 1VA9A 4F9LC 3STLB 32C2B 3VA2C 4F33A 3IFOB 4N8VG 4CDHA 1J8HE 3GMRA 3MJ9A 4LVNB 2H2PD 5JW4N 1XGQB 3DGCR 5IB2B 5CZKA 3B9EA 4LAJH 2VOTA 1ORQA 4TN9A 5CJXC 3WJLA 4JM2B 4UTBH 3T2QA 1FL3A 4GBXA 4LVOB 4QHKJ 3VDCA 4KI5C 1EGJA 2BOBB 3HE7B 4ZO8A 1T2QH 4X83A 3LQAC 5GJSH 5E9DA 4IOFC 3L7EB 5GGRY 4NJAL 2WUCH 1BX2B 5JQHC 3QUZA 4M5YH 2L4OA 3P30L 2GY7B 3QT2A 4PRIA 1N59B 4S10A 3U6RB 4FABL 4WFGE 4WGWB 3MLSL 2Q8AH 3WHE1 1KEMH 3ARUA 4NQED 3D85D 3MFFB 1OSPH 3EJZD 3NPZB 2VLME 2R1WB 3DO3A 4K9EH 1ZGLB 4NPYB 4AEHL 4WW1A 5GSRA 3MV8E 4PGBA 3WS6C 1AXTL 3PGCB 4GSDL 1LE9B 5CUSH 5CEZL 2DQFA 2X5PA 4YWGH 5SWQB 3LB6D 4XXDA 4B50A 1J88A 1YPZE 1VESA 4XPHL 1GZPB 1ZHBB 2IEPA 1NMAH 2Q76A 5LWYL 5KJRL 5E8EA 4QTHB 4WFGD 4EBQH 3DUSA 1G1YA 1KN2L 2AABH 1LDPL 3IXTB 3PUCA 2ZCKH 2GSIA 1HEZB 2VLMD 3WHE0 1ES0B 3TT1L 5D8JH 1S9YB 3JWDH 1XR9B 5F8RC 2XWTB 4X9BA 4JY4A 1VKXA 1X5GA 1BF2A 2CKBL 1UJ3A 1Z2KA 5IK3B 1TJGH 2HKFL 2EYTA 4RWHA 5HY9A 3SKJH 4KVCH 3T0XA 4RMUA 3U4BH 5C9JB 5IR1B 1QYGL 4R26L 1UVQA 1Q72L 4NM4H 4IIQA 4HIJB 3HUJA 5HJ3B 3I02A 3Q1SH 2OZ4L 2VERN 4P2CG 4ODTL 3BP5A 4OGYL 1A6AB 4ONGH 2R0ZH 4GRLB 5C0GB 3QUYB 5FHAL 5ELIA 2CH8A 1CGSH 3RGVD 3V6OE 4ELMB 4C58B 2WW8A 1MF2L 1MUJB 3LV3B 4Y7MA 3MYJA 3UTZA 5LJYH 5B39G 1LE5B 2W65A 1IAIL 2GJZB 3RKDC 5B4MD 1P7QD 5ILTL 4K7FB 2ICEA 3P2TA 4WRLA 3U4AA 1YEHL 2XTJC 3B83A 3VXTA 1MLCB 1ZHNA 4Z7NF 1HZHH 4H1LH 4PRNB 3TJEL 2AV7B 4N90D 1T4KB 5TF0A 2XICA 2ZUVA 4HIXL 1Q38A 1S9VA 4PJ5E 4AG4L 4IRJB 1FFRA 1LO0L 2PYFB 4M1GL 4D9QD 3MNVB 3HC4L 2UUDH 3T0VA 2C4XA 3BJLA 4YUEH 1ACYH 5JHDD 1SY6L 2P1YA 1C7SA 1FYTE 3QXDA 1T5XB 3MV9E 1AD9B 4LRIA 1RZ7H 1ZTXH 3TBTB 3NA4A 2ESVD 4CN6A 5JW3L 2CMRH 1GAFH 3NN8A 4KI5D 3AREA 4BKLA 3T3MF 1FVEB 2FX7H 1LHZA 2AW2A 1WFNA 1HHKA 1NFDF 1JGDB 5DRZB 4IOFD 4MD5B 3QUKB 1OPGL 4LSUL 3LKSB 3UTTD 5TGBB 1NDMB 3ARFA 2IPTH 3MLYH 4V1DB 4U6XB 1S7UB 4DZBB 3WDHA 2VKXA 4Z7VA 4BH7A 1MJJA 5HVHB 3NOIA 3PGDA 3LEXA 4WWKC 1P53A 5DHVH 1JZ5A 4J8RA 3GJEB 3FHAA 4YFLF 1M6OB 3BMWA 4KU1A 3HLAB 4LSSH 3AMKA 5CSGA 5DMKB 4PG2C 4OLZL 1B2WH 2Q6WA 4E41A 2WBWB 3SHSA 4APQA 1TVDA 4ETYA 3CFKA 1M7IA 2YD6A 4KJWC 4HEME 3QEGL 2AEIT 5DHYB 4ERSH 3DSNA 3VFMB 3X12B 2EC9T 4BQ8A 3OJDB 3BESR 4P5TD 2DQHH 4JFDE 3QWQB 1I7TB 4HJGA 4NO5B 4O9HL 4R2GD 3U30C 2BRRL 4ODUA 3V4VH 2HAZA 4L29A 1IM3A 4GG8A 3OHXA 2OI9B 3BDYL 3QUZC 1CXIA 4XRCA 3OJVC 3ARGA 4HKXB 4NRXA 3H3BC 3FQUB 2NLJA 4PGEB 2XYCA 1CF8H 1L9NA 3NCMA 4YHLL 1R5VB 3L3IA 1ZLVH 3KLHC 1IKFL 3GSNA 4M62H 1WTLA 1VFBB 3IU4L 3QFDA 1OWWA 4NQCD 1AXIB 3O41A 1WBYB 2N7AA 3KPSB 2J88H 1A9EB 4MDJB 4ZUUB 4CVWA 5HD8C 4EI6B 3DROB 1HKLL 2UVEA 1RJYB 3KNBA 4TVPD 3E6FB 2CRIA 2QQLL 5D1ZB 3RZWA 1KCLA 3O6ML 4YC2B 4C56E 3PXHA 5LG1A 5IB3A 1ZHKA 3SGEI 1HSAB 4KRNA 4XC1L 2FBJH 2OMBA 2GJ6E 5TE4H 3KYKL 1AR2A 4K71C 1JZ6A 1CR9H 4PTTB 5I1GH 4GW5A 1JWUB 1NFIB 3ARPA 3RKDD 4M7ZC 4NKOA 3QISA 4P4KA 5D93B 3WKML 1UJ3C 1N26A 3MA9H 2D7MA 1Q9LB 4M61B 1J1PH 5EC2B 3D69A 2XZQH 5I17B 2QKIA 4IIQC 4GKSA 4JO4H 3PP3H 1MIEH 4HS6B 1GC1L 5ITFA 1B6UA 1JTTA 4E0RA 3AB0C 5ACMA 1V3KA 2NY5L 3IFPB 2BJML 2NY2B 4PJDB 1RZGB 4OM1H 4XI5D 4FXKA 3FFCE 4RBPH 5FHBL 1PG7H 4ZUSA 5L7XH 2NY4C 1D3CA 3MJ8B 2Z91B 1AO7A 2F53A 1NBYB 3X3FH 1M7XA 2GAZA 3MREA 2GCYB 3MV7D 3T4YA 3ZSSA 4HWBH 4GW1B 4XVUC 4X4YB 5FGCE 1BVLB 4WWKD 1XGUB 1UKSA 5DJYB 1NDGB 1MCQA 1FFNA 4FFZL 3FFCD 3SDXA 4OGXL 3LZFL 3ARVA 3WO4C 4UT7L 2O61A 3S98A 1KJVB 2X7LB 2D7TL 2NY0C 3PWJB 4N68A 4LIQL 4LRIC 2MQ0A 2YWYA 3OSKA 4JPIB 4KJWD 1EHLL 4YFLI 1YY9C 3K81A 3SKUD 3HMWL 4GBXD 1F4XL 1MWAL 4LCYA 1YECL 2B7DT 4P3DA 5T5FH 1WWWX 5J6HA 5E9DD 2GT9A 2Q20A 4EN3B 1U95A 1IGML 4OD1L 1FIGH 3QUZD 3TH4T 3EOBB 3U9PL 3ARFC 4PRID 3RJQB 1RZIA 3ESVF 1VDGA 4WO4B 3CVIL 4GFTB 3GSOA 5EFIA 5FV2A 1V7NL 4R8WL 3O6KH 4LDLB 3GMMB 3KLHD 5E56A 3VXSE 3BKCL 2OTWB 3CX2A 3I50H 4TUKH 4LHUG 2JJUA 2FECI 5HD8D 1CFQA 1I3RB 4JLRB 4MAUL 5LGKA 4APQC 1NCDL 3CCHA 3LN4A 3B2VL 3INUL 4I18A 4JFEB 3OAZH 3LKOA 2IALB 4WIQA 3R1GH 4KUZL 1MVUB 4O2FB 3DRQB 2R0WH 1BBJA 1YJDL 5JXAH 1WZMA 1S9KC 3E3QC 2F54B 3FT4B 1CVSC 3RKPA 2P24B 1ZE3C 2D03L 4X80L 3WNPA 2CR3A 4WHCA 1VCAA 4CNIA 3ULUE 3W5NA 3KGRA 2E7LA 4G42A 4FNLH 3UPAA 3G5VB 4QTIH 3OBAA 3MXWH 3T2NL 4HQQL 5L88H 1KCUH 2VQTA 1A1MA 3BN9C 1NLDL 1TCMA 5IJKC 1NCAH 3FQTB 3BPOC 1L7IL 3SO5A 2NW2A 3SEPA 3FRPG 1ZA6A 3OMZA 5ESAA 3MGOA 5B38B 3PHOB 2BNQE 4NQDA 1IJ9A 5D72H 5JIHA 5AEAA 1U3HA 2RAMA 5FO7B 2IGFL 1KJ2H 1DSFL 1PQZA 1KG0B 1OP5K 3AC0A 3KLAB 2NY4D 5ID1B 3K1KC 4MXWH 4XNYL 1A8JH 3QDMA 1QKZL 4NZJA 2GITB 2PYEB 4CW1A 3RA7L 4YQXL 4P4KC 5C6TH 4D2NA 4P3WA 4XVUD 2Y06L 3OGCA 5GSVA 4KJPC 1T6VN 4Z7UE 4P23B 3EHBC 4L4TE 4CVXA 4RFOH 1OHQA 3MLRH 4OZIB 2B39A 1FJ1A 3WXWL 1MELA 2IANE 4I5BB 1CFSA 4LDOB 2ZOKB 5DWUH 4Z8FL 2NY0D 5I1EL 1AKJB 1QRNB 2JTDA 1BEYL 4TVPH 1D5BB 1YY9D 2RJMA 1WCBB 1ZVSB 5JPNA 3MRQA 4CVUA 3GRWL 4F57L 3PJSA 4HUWA 3THMH 1NJ9B 1PYWB 1R3HA 2OSLB 1QLEL 4TSCL 3HNTL 4KI5F 3D48R 3F62A 4Q58C 2R4SH 4OAWB 3U0TB 4QHMB 1E4XL 3MRIA 2Y1VA 1WICA 1V7ML 5CD3A 2Y5TA 5JDJA 1B3JA 2HKHH 2X4OB 3ARFD 3FT3A 2NNAA 3F7RA 3VFTB 1HOCB 1SEQH 1S7QB 3DV4A 3FB6B 4OUUB 5I8CA 3PHQB 1A14L 3S88L 4G8FA 2OS7A 1LP9B 3IDXH 1Z0MA 4HUXA 1CTOA 3O4LE 4P9MH 4Q6YA 3RIAF 3QXWA 2CKBA 1H3VA 4OF6A 4GG6E 1UXSA 1NANI 3K1DA 1K85A 4C59B 5HHNB 4E41D 5DGQA 4APQD 4ZUWB 4FXGB 2MWCA 1I9IH 1MI5A 1D5ZB 1T1YB 4WHTB 4P9HL 2PCPB 1EH9A 4DGIH 5L2JB 2IPUG 3NFNB 3QZWB 3ZKMC 3O6FA 2B5IB 4OF3A 5EOCL 1UWXK 4AM0B 4DVBA 3W82A 1HK6A 1W0WB 4CMHB 2NQCA 2YBRA 3IS1X 4M93C 1FC1A 2R1XA 2IG2L 1K2DB 3HCVA 3I9GL 1K4CA 3R06B 4JY5H 4R7NA 4LL9A 1QFHA 3ARGD 1OAXH 2NY3C 4YIQA 3GB7B 2XN9A 3I6LD 1DEDA 2HRLA 1BVKA 2ZSVA 3N85L 4I48B 1D5MB 3GHBH 4G43A 2YPKA 1JGLH 3BN9D 2CGRH 2H6PB 4KJQC 5T33L 5DJCA 1T66D 3KWWB 4UDTA 1MFCL 2W9DL 4FFYH 3MJ9H 1YEDA 2CLZA 2DKMA 3WD5L 4I18C 4ZDHA 3X3GL 4K3JH 5I9QB 3RHWK 3I6KA 3BJ91 3ZDZE 4DW2H 4OCWH 5HGHA 3UPRB 3HN3A 4AEFA 1SY6A 4OLYL 1HINL 4XCFL 2VXUH 3ARDB 4DKAA 1G7QA 5BO1H 4JFXB 1JBJA 5FM8A 1NEUA 1EGJH 4QY8A 2BDNH 5DXWA 4CU7A 4GW4B 9CGTA 3L5IA 4BZYA 1TXKA 1UWEL 5D6DA 3BZDA 4LPVA 2AXGB 1MCOL 4P4KD 4X7DC 4L8BA 4F58H 3QUXB 3WFZA 1IGIL 1JP5A 4MD0A 2E7LC 2DM3A 4HPOL 1MEXH 4QF1B 4WTZA 4KJPD 1I4FA 1CLOL 4JFZH 4H0IA 3QIUC 4L9LA 4BA8A 3EHBD 1KTRL 4JGMA 2FZ3B 1TPXB 4NCC1 1AIFB 1XGRB 1B90A 4GT7A 3RUGE 5DFVC 4NN5B 1RZJC 5BV7L 2MQ3A 4DAGL 3SQBA 3V6FA 5TQ0H 3IFNH 4NDMB 4HV8A 1FG2A 3WFBH 4QRPA 4XNXH 1HI6B 1U3ZA 3AFLA 3IDJB 4NN6B 4HGWB 2G9HB 4PLKC 4NC2B 3TBYA 2X40A 3H9SE 3JVGA 4ZOCA 1BZ9B 2FB4H 1KJMB 1P2CA 3K7UA 5FF6A 1KGCD 3ZT5A 1AO7D 4POYA 5FO8B 2F53D 1TTUA 4HF5L 4ZTOL 3WDIA 3MCLH 4EUPB 2BSTA 2F74B 3PDGA 1GGYA 2VQ1B 1XCQB 4ZQKB 5K9QI 2BSSA 4Z76B 4CMMB 4TQEH 3G6DH 1P4LA 5E8PA 3AU1A 1D6VL 1VGKA 2KL6A 4U1SB 3NGBB 2IBBA 5E2WH 4PJCA 1Z5LB 3JV0A 3NFSH 1N64L 1CDUA 3DVFA 1DVFB 1CQYA 5E6ZA 5AZ2L 5KVEL 4XP4L 3RY6A 4IRZL 3VG9C 1DANU 5E03A 2UWEE 5C0AE 3SDCB 4E42B 4KZDL 2P46B 3HRZB 3L3GA 5L0QC 2X4RA 1FZOB 3N9GH 1OM3H 1N8ZA 4JE4B 1NCWH 4F80A 2HJLA 3QULB 1WIUA 4WHYH 2CO7B 3ZKMD 3PWLB 4KV5F 5CAYB 1PKQA 1Z6JT 1ZT7B 3OGOE 2H2SC 4UIMB 2R4RL 4QXTA 4U7MA 4JAMA 3RRQA 5FB8B 4JVWA 4QT5B 4D9LH 2P47B 2NY3D 4NKIH 5SV4A 2GUOA 5FYJE 5LVEA 2LU7A 3HZYB 5FUCC 2ZNXA 4NFCA 3NFPB 5DRWA 2GSGB 3HG1B 3BZEB 2OYPA 5F7HA 1ED3A 1T80A 4LLWB 4JANA 2IPUK 3S3PA 3QG7H 3TNNA 3BI9X 5HVWA 5FDYA 3FAXA 1C5CH 2C3VA 3S36H 3AS3A 5J56B 5FYKL 1EFXB 5E8DL 5JA9A 4KQ3H 3VE0A 5IUSA 3CFEA 1A7RH 2E8YA 3NH7H 4JHWH 4HG4K 4NZRH 1YMHB 1ULVA 2XA8H 2DWEB 3MUJA 4PJXB 4IOSD 4NM8L 1P7KB 3K0WA 3KYOB 3PE9A 5C7XH 4KK9C 5D5ME 2EDEA 3BDBA 3NIGF 2X4SB 4WFHD 4Z0BL 1DQJB 4NWUH 2ZP0T 3WJJC 1R3IL 3HUJF 4BQCA 3WFCL 1OGAE 5DC4B 1F3DJ 3BZFB 1IAOA 1H3UA 3HZMA 3BFOA 2AJSL 5I1HL 4I9WE 5T3ZE 4NQDD 2BHZA 3GSUA 4U1JA 1QSVA 2EO9A 4PLKD 2FGWL 1U3HD 2NZIA 3WNOA 1RIUH 5C0NC 5DYOA 4UV4L 1JGUH 5IMLB 4MNQB 3DX9B 4TRPL 1NFKA 4Y16B 4R3SB 1Q8MA 5D7IA 2XQBH 2F5AL 3FCTB 3QDMD 3T1WA 2VUOA 3FO2B 5JOPD 1UM6L 2VLLB 1MWAA 1DLFH 3BO8A 4TOYH 1BECA 5DQ9B 1TZHA 2AJXL 4HFWA 3WSQH 2D31A 1JNNL 2IH3B 5EBLA 4NWTH 1U8PB 5IFAL 5LXGH 3GSNH 4FP8L 5F9OL 3CLFL 3E8UL 4MAYB 3EKCA 4KMLB 2WBKA 3PWUA 5DK3A 3P9LA 2AXFA 4XBGA 5I1AB 2QQKL 4F8TA 1ZT1B 2ZCLH 3G6JA 1LEIA 5DJ6B 5C0BA 1Q9OB 3JVGC 4XMLL 1FZMA 2Y36H 2GIYA 4QRSA 5DK2B 5SWSB 3VFOB 3UO1L 1JCKA 1KTLB 3OAUH 2H2SD 1Y0LA 2I60H 1KLGA 4PJIB 4WI3A 4OFIA 3MRMB 3T0EB 2FLRT 2W9LA 4H1LG 2F15A 2VB5A 4U05A 4Y5XB 1FCCA 3TO2A 1GGCH 4FHBD 3TPUA 4Z7VF 2J8UB 1YC7A 2VLJB 2CLVA 1TJIH 3WL9A 5IMMB 1EVTC 1OQOA 1YMMA 1MREH 4MNHA 4B0MM 1K4DB 4UDUA 4M7KH 3MRKB 4O51A 1RHHB 3MXVL 2BSRB 4O2EA 3RY6C 3MNZA 3EJYD 3MPCA 3SJVA 4FQLH 1MI5D 1CFTB 3S7GA 1KB9J 4Q9RL 1H3GA 4QXGL 3P9MB 4PJ7A 1W72L 4IMKA 5DJDA 3NPSC 1JHKH 5TE7H 2A6KB 1KT2A 3P4NA 5F72S 3S5LB 4GMSL 3CPLB 1O7VA 1QOKA 1YEEL 2D2OA 1K8IA 2VTFA 4JFOA 2ADFL 3O6FD 4ODWA 4YHOL 1D5IH 3H42L 5JOFA 1FN4A 3IKCA 2R23A 4ODVH 1EO7A 1DEEB 3CSPA 3WLBA 5I1KL 1REIA 2A1WL 5H8DA 5EU3B 3RWEA 1BD2B 1I1AC 1KIQA 2P8PB 5CEYA 4KMTH 2R15A 1YDPA 4PJAF 1GGUA 2BNUA 3H7LA 1A7BA 1E6OL 3F7QA 1XH3A 4KK9D 2XN9D 1PKOA 3OWEA 3DYOA 2Q3AA 3V2AR 1QSFA 1AY1H 4ORGA 4OZGF 3P0YH 3IETA 4I4WA 4HKZB 2I5YL 3B6SA 1PZ5B 5IEHB 2FJHB 4ZPTA 3EZ8A 4JFYA 2AEQL 4YHKH 4EEEA 4EI5C 3B9AA 3O3EB 4H20L 1A4JB 5C09E 1QG3A 2W0KA 3FKUS 4EDXB 5CGYC 1GC1C 4PGJA 3L7FA 5C0ND 4PJGE 4JRXE 4F7CA 1RUKL 4NRZA 4JVUA 3HC3H 3NMEA 1LGVA 2RCSL 2W0FB 2NY5C 5EB9A 3TYGL 2ICWJ 3OKEA 1NAKH 1S7TA 2WANA 3GRWA 1CQKA 3OTTA 4MD4B 2VDOH 3L5JA 3WFEH 4JR9L 2JB5H 4LSRL 4YNYB 1NAML 5IEKB 4KRPB 3JUYA 1OSZB 4N0YH 4OTXH 3CFJB 3HE6A 4XX1G 2NTSP 3HC0A 3U7AA 1ETZA 3MRBB 4OKVA 3ZYZA 4U6VL 1RUQH 1EEYA 5DJXA 1TQCB 2G2RA 3LPWA 4GAJH 1P1ZA 2LU4A 2YOCA 3IGAB 1MLBA 1C12A 5IESH 2VIRA 3ILPB 2OR9H 4QRPD 1U42A 2I9LB 3W2DH 3GSWB 4WJ5A 3MLVH 3BYYA 4CADB 5EO9A 5C07A 3L5XL 1CU4L 4Z9KB 4EVNB 5BZWA 3QA3B 2WBJB 5CWSB 4MA8L 1HSBB 1RZFH 3MZGB 1RUAH 5BZDA 3N1MC 4Q0XL 2Z8SA 3SDDA 2APFA 5DMGC 1CD0A 3UTQA 4NUJA 4PJHA 4TUJA 3HI1A 3TA3C 3G5XB 4OCMC 1KENL 5IW3A 4ZUTB 3W9EA 4XPAL 4ZOAA 4DN4H 2N4IA 5F3HB 3BP7B 3D2UB 4YE4L 2D9CA 1SHMA 3D87B 4XMPH 5D7JB 2FEDD 3VXMA 2PTVA 4RISH 2ATKA 5I8EB 4GS7C 5HHPB 1JI2A 4NO0A 3V5DA 1JF1A 1QD0A 3MODH 4IHOA 4HT1L 2VAAB 5B39B 5JIIA 3P9WB 4LF3A 1FLRH 4FQJL 1NGYA 4U0RC 1OD7A 4BSVA 4LLMA 3RGHA 4G6FD 4MQXD 1T0MB 3PWVA 4UNVA 3PL6A 3TLRA 2MJWA 2KPNA 3DHMA 3V0WL 4OZHA 3QEUB 5ENWB 3U48A 3FHQA 5DZOA 2K1MA 1YJDC 5CEXB 3H0TB 1AE6L 5DEGB 4Z0XA 3FN0L 2MCPH 4NJAH 2YA0A 2ITDA 3DX6A 4L8DA 3ILQC 4FABH 3EJJX 3MLSH 2IADB 4MWFB 3CIQA 3V6OC 4O5LL 1D5XA 1RUML 1LVEA 1SMOA 1ZHLA 4P48A 5DJ2A 1OWRM 4G9FB 2C26A 4IMKC 3MLZL 4AEHH 1IQDB 4MXVF 1AXTH 5CGYD 2KQMA 4GSDH 2AJZA 3KPNB 2PW2B 1EO8L 2QHRL 2V5RA 4KKAC 5LBSL 1FFOB 3DV6B 3VD4A 4IJ3B 1MHHB 1S7SB 3OXRB 2Y07L 2OL3B 4EQ2A 4XPHH 1AHWA 1B4RA 4RGOH 4H25B 3LN5A 5LWYH 1FZKA 1DR9A 4RMVA 5EDXA 2IAMC 4J3SA 5C71A 1LDPH 2X9WA 5F7DB 4Q6IC 1RSFA 1P84J 4OI7A 1VACA 3TT1H 4S1DC 4YFEA 1CCZA 3ZE0F 1FV1A 1WFTA 4FQXC 1ZMYA 3EYVB 4YPGB 3MA7A 2CKBH 4TUOB 4MDIB 4NOBA 2HKFH 1UACL 3SY0B 1F6AB 1QYGH 4L9DA 4R26H 1Q72H 5DFTA 4FQ1H 5C92A 4DCQA 5K9QG 4WV1B 3SO3B 1CIDA 1O5DT 3O4OC 1FO0L 4ODTH 1JPFB 4OGYH 2DKUA 3QP3A 4UU9A 5FHAH 2Z31C 5GISL 5DMGD 5C0BE 1AGEA 3MV11 3VXRA 2FO4B 5ACZA 3VDAA 3DURA 3RY4A 5C2BH 1I85A 2I9TA 1A6TA 1IM9B 2FWOB 4B7LA 2AK4A 1IAIH 2O5ZL 4RFEB 4ENEC 5ILTH 1U8LB 1LO4L 4F7PB 1C16B 1YEHH 3LQZA 4Z18A 4L3EA 1E28A 3TJEH 2W07A 3M17B 4HIXH 4J2XA 4WTWA 1T03L 5H35A 4AG4H 2UZIL 2WP3O 1U8OB 5D7LB 1RPQA 5H37H 1LO0H 5C0BD 2ATPA 3UAJD 1OL0A 3NBNA 2VLKE 3KYMB 3SKNA 1FZJA 1IILE 1SY6H 1QO3B 4NYLB 5DQJB 4P9HC 5IVOA 4KZEH 5JW3H 5EU6B 4XZUB 5F8QC 4QHNA 2HFEA 1KYOK 4MJ2A 3U9UA 5T1MB 4W81A 4LSDA 1ZLWH 4KHTL 4ZAKA 4JB9L 4JPVL 3AS1A 2FIKB 4ZS6C 2EDYA 4YXLL 1YMMD 3O3AA 5D1QC 4LSUH 3MO1B 1TTGA 3RWFB 3HPJB 3G08B 3LKNA 3ILQD 4LKXB 3F7YB 3BEVB 1KCRL 4R4FL 5DUPL 2C9AA 5IMKA 3SJVD 1FNFA 2NY6B 1MIML 2W59A 4AEIL 5HHMD 4KKAD 2PNDA 3N06B 3P11L 3RI5F 4JFEE 1MCPL 4OLZH 3RNQB 2ADJA 5E2UL 2Y7QA 1ITBB 3MR9B 3IDIA 5EBWA 1MCDA 1DN0A 3QEGH 2VDKL 4JFHD 1PD6A 1RHFA 4NBYB 4X9HA 1YEFL 3RVTC 4CVZB 1JPTL 2EDBA 5KSAA 4WEMB 4AK1A 5EU7C 5L2KA 5KN5B 1NCBL 2BRRH 4KKNA 1QSFD 1QA9B 4FTVE 3GI8L 3MZTA 4S1DD 5FDWB 4D94A 3GFUA 3TO4C 2Z4QA 2HN7A 1H0DA 2VISA 3QI9A 4U1HB 1MFDL 4YHLH 1EZVX 3HMXL 3S35L 1IKFH 1T04A 4H5SA 3IU4H 1I3GH 5LQBL 5A2JH 2BMKB 5SX4I 5BV7C 2BVQB 3A0OA 1ONQB 3WHXA 1JK8A 3H9ZA 4YPJA 1SYVB 5C0EB 2XFXA 5FO9A 5KSUB 5ERWA 5F6HJ 4HKBA 3MUGB 1ZLUK 4P2RB 3BPLC 3PF2A 3O6MH 5FXCH 3MMEB 5MENB 3FO9A 4KROB 1ROWA 1GHFL 2A74A 5C07E 4XC1H 1RV6X 2PYEE 3KYKH 5EUOA 1F3JB 3HE6D 2YPLE 3K4DA 3BH8A 1WWAX 1RZ8B 5D71L 3ZYIA 1IGFL 4ENED 4YEFA 4AL8L 3WKMH 5HHVL 1KIUA 1R5IB 4X6DF 1X5AA 5BVJA 4X4MA 3GSRB 3W0WB 3C8KA 2R2HB 2EYSB 5MERA 2PO6C 1QRNE 4Y2DA 3EOYG 5HDLA 1KPRA 2P48B 3H9YA 5KS9E 1I1YB 1W72A 5ABDE 4N8CL 5HDBF 3RIAK 1FAKT 1LEGB 3SDDD 3LEVL 4DUVA 3DVIA 5FHBH 4KRMB 4RA0C 2OTUB 1YEGL 2IBGA 1I85C 2EEAA 4KRLB 2OR8A 3KPRE 3ARSA 3RWGB 3MGTA 1U8QA 4HW6A 3VXMD 3TN0C 4YK4B 3UTSB 1LP9E 1KTKE 4XNZB 4PJCF 5GGVL 3PGFH 5DD1L 4M02A 4NO0D 4O4YL 2X4PB 3TCXA 1T0NA 3RDTA 1JFQL 3AS2A 1N0XL 3MV01 3I85A 1QR1A 2VDLL 4WNQB 3CH8A 3LSOB 4L8CB 4OGXH 4U1LB 5LGJA 5TF1L 4HKJA 4UT7H 3PL6D 4Y5YB 2D7TH 4MA3B 4LIQH 1IC7L 3B9KA 3EDKA 4DZ8A 4J3XA 5L8KB 3C2SA 1EHLH 2YHGA 3HMWH 4RAVA 5HYSB 2DQDL 1LO5B 4QRRA 1F4XH 2Z9TA 4KJYA 3RVTD 1MWAH 4P2OB 5CP7B 4ZAKC 1T22B 2VR9A 1YECH 3GSQB 4XP1L 4X9IA 3OJ2C 3CUPA 4PB0L 3FMGH 4NKQB 1CGYA 1TVHB 4OD1H 3U9PH 2Q3ZA 4H88L 4PJEE 3VFUA 3IYLW 1FNEB 2B1HH 2NR6D 5KOVC 3CVIH 5KZCD 4XVTH 1V7NH 4R8WH 5C0DA 4PJFF 3RAJL 3OX8A 5FYLL 5IP4A 1BZ7B 3BKCH 3DO7A 5F71A 4WHYG 3QCUH 3MRFA 2ICWB 1E4JA 4X6FB 2DQTL 2B1AL 2VXQL 4MAUH 4PLNC 5E8OA 4NSKB 2P8MB 3UPCA 1NCDH 3WN5A 4L8SB 3DNKA 3B2VH 3INUH 3VXQA 3O9WA 5IB5B 2Q86A 3QDJA 4KUZH 4NQXA 4YHPA 5F1NA 5TDOA 5T5NF 3VXUA 4JFFB 1JMXA 4LPTA 4OZFA 4U6HB 2J5LB 1J87A 2J2ZA 4R96A 4PJ9A 2W0PA 3QIWA 1BM3L 2NW3A 4X5WA 3WIFA 5GGUB 3MBXH 4FQHA 1VHPA 2D03H 4X80H 4OD2A 1MFNA 3DMMA 2H1PL 3KPQA 4GXVL 1JPSL 5D6CA 2VDNL 3AMLA 2HH0L 3DIFB 3T2NH 4NRYB 3QEQA 4P5MA 3CAFA 4HQQH 4CDGC 3WDJA 2LTQC 2FX8L 3NZ8B 3MRGB 1SYSB 3CC5A 5GHWH 1JZ8A 5DO2D 4XP9L 2VDPH 1QNZH 1L7IH 5TH2A 4IEFB 4Y5VB 5ESQB 2X6MA 5L8JB 5JR1H 2LQRA 3GMQA 4I2XA 4W4NA 3CFCL 4P5KA 5D7IF 4XC3L 5I71B 5LAXA 5ANME 2XWJA 2M26A 4PRBB 1OLLA 3WNKA 2XKNA 1X4YA 4OF0A 2IGFH 4QRUA 3VXRD 3G04B 1DSFH 3BN3B 1ZA3A 4D3CL 5DRNA 2XPGB 1BJ1H 5B3JE 3IJYA 3B3IB 4NOFA 1BMGA 3GMPA 4XNYH 2AK4D 2IBZX 1J0KA 1QKZH 3BQUB 4TULL 4YQXH 1K8DA 1OAZL 1H5BA 3EYFA 3O2WL 4L3ED 3MBEB 1NMBL 2WQRA 1YQVL 3OKMA 2IFFL 5E2TL 4AMKH 1BFVH 3G6JF 1G6RB 3BISA 3LKPB 4HLZH 5E6YA 4Y1AA 4NN7C 4L4VB 3GGWB 3WXWH 2DBLH 4P4RB 4WU7A 3B9DA 4Z8FH 2AEWA 35C8H 3QDHA 5I1EH 3GIZL 1ORSB 4AH2A 5FYKD 5JHLL 3VFWA 3KPOA 5FFLA 4XT1C 2D0FA 4XP5L 3GRWH 2AQ1A 4F57H 3VU2A 4IOIA 4F37K 1QLEH 2R9HC 4ZAKD 3HNTH 3MUY1 2ZUQB 1E4XH 1EPFA 4BJLA 2BXZA 1V7MH 5J1AA 1CS6A 1NC2A 1SJXA 3KR3L 5FIEA 1UADC 4LBEB 1DJSA 4ZG1A 5E94A 3AM8A 4PGDB 2JE8A 3EDEA 4GRMB 4NHUA 5I1IL 2FATL 1A14H 3S88H 1NBVL 1UB5A 5A3IC 4LKCA 1T1ZB 3TZVA 5L2KE 2WWKT 4PJ7F 4NQSA 2P8LA 4UTAL 4NKDA 4ZYKB 3BP4B 3QEHB 3F12B 5C0CA 1L0XA 4XCEB 4JY6B 3B9KC 1U91B 4X6BA 1OAUH 5F7YC 1OGTB 4P9HH 4Y4HB 3EFFB 2R69H 3V95A 5KSAD 5GGRB 5EOCH 5L2KD 4LCWB 1XIWA 3WNLA 2ILLA 2ZUSA 3L3KA 1JWSA 5KG9A 3C09B 2IG2H 1G7PB 3DVNA 3I9GH 3JWOC 4AT6A 3STLA 1A9BA 3IFOA 1RUPL 1CL7I 3QI9D 4RFNB 3H8NA 4RA3A 5I16A 4X0KB 1JN6A 3QO1B 3N85H 1CE1L 3HAEB 4PG9B 2ENSA 3EGSB 4P57A 4UV7L 5BS0B 2BOBA 3HE7A 5T33H 5HHQA 4PB9H 3WUZA 2PUQT 1S9XA 4WI9A 4D8PA 1MFCH 1F6LL 4K3DL 2F19H 3L7EA 2W9DH 1R24B 1BX2A 2CXKA 3T2OA 4G6KL 2A9ML 1NGXB 3WD5H 1J0YA 3O9WC 5I6XB 1N59A 4MNQE 3X3GH 3ALWA 3U6RA 3ZT7A 4XTRC 5IV2B 3S35X 1ADQL 2CUMA 4OLYH 1HINH 5HYJB 4XCFH 4HZLB 4Z7WB 1P5VA 4PJ9C 1CG9B 1P7HL 2R1WA 5DJZB 1IAIM 3PGCA 1UWEH 2R8SH 1S78C 3PP4L 3S34L 1MCOH 3E1F1 3DMMC 5SWQA 1IGIH 2C4FU 4HPOH 3QNXB 3SCMA 1B4JL 4MJ6A 1GZPA 4KTDL 1CLOH 3KAAA 4L4JA 1HHGB 2CSPA 5I30L 5DJ8B 3UYRL 5E99L 5F7KC 2HT4C 1R5WB 4Y2DD 4XXCC 4PP2B 3UZQA 3RU8L 1PEWA 2YXFA 12E8L 5GS2D 3L3OB 4DAGH 2G60L 4LFHD 4X6CA 5GRJL 3ARXA 1KBGL 2XWTA 5SWSE 4OT1L 2EXWD 2HTLC 4AIZB 5ID0B 4NCC2 2NXZB 3BUYA 5IK3A 2RQ8A 3SQOL 3VFSB 4KK6C 2VXSL 2R9HD 5C08D 4PJHF 1AGFB 2EDKA 2P7TB 3TBWB 1KFAL 5DLML 1N6UA 5BXFB 3FN9A 4HF5H 1CD8A 2J8UE 4G8GB 4HIJA 1FL5B 4ZTOH 1NC4B 4DUWA 1B6DA 5HHXL 5HJ3A 1A6WL 3W9DB 1H5BC 2OX5A 2P42B 4QRRE 5ITBL 3O3DB 3FOLA 3RDTD 1A6AA 5A3ID 5SX5H 4GRLA 1D6VH 2HJFB 4WEUD 5F1SA 3VFVA 1SVCP 3WV0A 1AH1A 3GI9L 3MGAA 2A83B 1CXKA 4ELMA 5HPOA 1N64H 1MUJA 3LV3A 5E00A 3C5SA 5J8OA 1A6ZB 3HMXA 5AZ2H 1HH9B 5KVEH 4XP4H 4IRZH 5KSBB 4KZDH 3B9KD 3VH8G 2A6JB 4HFUL 4K7FA 1WUNT 3CNKA 3H9HA 4I77L 4OZHF 2F8XC 3O2VL 3KS0H 4QRRD 3S37L 4PRNA 2AV7A 1T4KA 1NBZA 2VDQL 5FKAA 4DKEL 2X42A 3KJ4B 4KKBC 1BD2E 3RL1A 5DR5L 1YUHA 3G5YA 4FFWC 1AJ7L 2PYFA 2R4RH 4RIRB 5EPMA 1I75A 3MNVA 3ZKXC 2E8ZA 4H8WL 5GS1C 4WFFE 4P2QB 3KVQA 3OKLB 1OW0C 1T5XA 5CLWA 1AD9A 4X98B 3AAZB 1M4KA 3OAYH 5EO1B 1U3JA 3QHZL 3V52L 1ZT4B 4GKZA 1T7XA 2YZ8A 5I8KH 1DQDL 1FVEA 5AZEL 3HI6L 3QNZA 2PKDA 1HILA 2UZYB 4E9LA 4XVSL 1QHPA 5DRZA 2YRZA 4JHZA 3QUKA 5AAWA 1XAUA 3LKSA 2ED7A 3TIEA 3O9WD 4V1DA 1S7UA 4WFFD 5J12C 3QDJD 5FYKH 5E8DH 3MCKA 4JFPB 3OJMB 3WFDL 3VXUD 3N50A 3U7YL 3N1GC 4PJ9D 2AS5M 1XIWC 3GJEA 3ZKND 3NTCL 1OF2B 4U4BA 2W9EH 4N1HB 3HLAA 1S78D 4NM8H 1S5IL 4LVNC 1DL7L 4J3TA 3DMMD 5I66B 1XF2B 2A77L 4UT6H 4Y88A 4PRHB 1MHPL 3QEQD 1UQSB 4OCRL 2DM2A 4JM2C 4MCZB 4Z0BH 4LVOC 1F6FB 1FL6A 3X12A 3HE7C 5IBLD 2F5BL 1R3IH 3EYOB 5DHVB 3OJDA 1MSPA 1I7TA 5BRZA 3MNWB 3HI5L 3WFCH 2C1OB 2LVCA 2LAAA 3F7VB 1CD1B 4WFED 3EO0A 2BOCA 4K23L 2AJSH 5I1HH 4LPWA 4HKXA 3EO1B 3ZDXF 2EEBA 2FGWH 5LGHH 4PGEA 4F7TA 1AQDB 3SGJC 5DTFA 4UV4H 2FECL 3CH1B 1XR8A 3U46A 5E4IA 4TRPH 1VFBA 1A6UL 3ARQA 2F5AH 5D1XB 3KPSA 2KBGA 5DVKA 5MP6L 5CJOH 1VB9A 1A9EA 2FR4A 4MDJA 1UM6H 5F97E 5GJTL 3DROA 3GSVA 1RJYA 2V7HA 4LGRB 3ZDYE 2AJXH 1MCFA 1JNNH 2XV6B 3NCCB 1HWHB 4XBPB 1T1WB 4HH9B 5B8CA 2D0GA 3VRJA 4OCLC 5IFAH 2VR5A 4FP8H 3QCVL 4Y1AD 3CLFH 3E8UH 3RTQB 2NX5A 3GEWB 1PAMA 3QDGD 5EO0A 2QQKH 1JWUA 5C8JB 1TNMA 1Y18B 4X7TB 4DGVL 3QIBA 4K8RL 4U3CA 4U1IB 2CK0L 2R0KL 2X10A 1FH5H 4XMLH 1KC5L 3UO1H 4KKBD 4JN2B 4BM7A 1D6EA 2D7PA 2B4CL 3BXNB 1NC2D 3R0NA 1U93B 3ORJA 3VRLE 3CMOL 3D9AL 5H37G 3IFPA 4GRLC 5FOBA 3QUYC 1Z9OA 5D2NA 3DX7A 4PJDA 4YDVB 3TZVD 4PRAB 3MXVH 2XT1B 2D7OA 4I3RL 1Q9WA 1L9MA 4G9FE 4A6YA 2DJUA 4TSAL 4PY7B 5F9JB 5C0CD 3D85B 1ODAA 2Z91A 1JF5A 5GS2H 5F9WB 1NBYA 1XF4B 1DDHB 3E2HB 1HXMB 5E7BA 5IQ9B 4Q9RH 4QXGH 4G6AC 1W72H 5D7KE 4GW1A 3SE3C 4X4YA 4GMSH 1YEEH 4YHOH 1I9RL 2AXHA 1T5WA 2ADFH 1XGUA 4G6ML 1OTSC 4WTZG 5DJYA 1XIWD 3MLXL 2IWGA 2AI0L 3CX5K 5I1KH 4XNMA 2A1WH 4C55A 4LLUA 4QKXB 5D7SL 2JF1A 1T3FA 4Q2ZB 1QBLH 3O3BB 2A73A 4PTUB 2VZTA 2EE3A 1E6OH 3LAFA 5IW1B 2AJUL 5JDSB 3MV8B 4JPIA 3VDBA 4QCIB 3GSXB 2XRAL 2I5YH 3HE7D 1I1FA 1YPZB 2VITA 1MRDL 2AEQH 4H20H 4NNXA 1NGZB 2BZDA 2AJVL 3EOBA 2EIZB 2OXHA 2G5BA 4WO4A 3L3HB 4WW2B 5HVHC 4FQQB 4X99B 1RUKH 1BFSA 1BIHA 5HHOA 1KF9B 5KAQG 1N6VA 3D39E 4ODXB 4J3OC 4GUPB 4GG6F 1NUDA 4JO1H 5EUOF 4YLQT 3TYGH 2BK8A 2DMKA 1LDSA 4JJHA 4X6CE 4OZ4B 3RGVB 1X7QB 2D9QB 1GJIA 2YKLL 4JR9H 4DK3A 1GIGL 4G80A 1C5DB 4LSRH 5DK0B 3SCMD 2H26A 3UZVB 3Q3GB 1FVCA 1GVIA 3P4MA 1HH6B 4DFIA 2A6DA 3QUMB 1MVUA 3QO0B 3DRQA 4U6VH 2VYRE 1XFPA 5MEOB 2QV2A 5D7LE 1S9WA 1HYSC 2OI9C 1T89C 1VADB 2F54A 3K4AA 1G7IB 4UUJA 4C83B 4Y4KA 5DD6B 5ISZA 5JHDB 3U82B 3L5XH 1CU4H 1JZ2A 5FOJA 5IVXE 1G7HA 1EIBA 1KCKA 4MA8H 5E5MA 3PNWB 4OZFH 3UBXB 2OLDA 4Q0XH 3BD3A 3FQTA 3CXHJ 4UQ2A 4PV9B 1IMHC 4PJ8B 4RNRB 1CXEA 4YHNA 3DARA 4RAUB 4UILH 1KENH 5D1ZC 3DGGB 4JM4L 1CDYA 4GRLD 3UTTB 3BP6B 3IJSB 1TITA 4XPAH 3P73B 4GQPH 1K9TA 2NY7L 5T1LA 1ZGLP 4YE4H 4D9RE 4LARL 3MOQA 2DQJH 1FYTB 3K8MA 1KG0A 3KLAA 1YA5A 4LOUD 5C3LD 1PY4A 1KV3A 4OCXL 4HT1H 1C5BL 1CVRA 3QIBC 4NO2B 1FGVL 5D2LA 2WNGA 4FQJH 4YBHA 5D93C 3VXOB 3N1FC 5T5NG 2K7PA 5JW5B 3P0VL 1A2YA 1QTYT 1RAMA 2BFVL 4DOHE 1HDMA 4O58H 4RZCB 1OTSD 4X5XB 5HI4C 3DUUA 5ICZA 2BCKA 4D9RD 5BW7A 1KJ2B 3V0WH 4OZIA 1F4AA 4YR6A 4AY0A 4S0SD 1CI5A 1ADQA 2OM5A 3S3JA 2ZOKA 4P5TB 5KW9L 3PABA 4PD4K 4MQTB 1AKJA 4R2GB 1ZSDB 1ZANH 2VSCA 1AE6H 2NY2C 4HIIB 3S37X 1RQ5A 1WCBA 5C0RL 1ZVSA 5BVPH 2XWBA 5BMFL 1PYWA 4ZSOA 3RWJB 3E6HA 3DVGA 3ULVL 2P49B 2DLGA 1FIEA 4O5LH 1RUMH 4NQCB 1TLKA 2X4OA 4KKLC 3LQAL 4V1DD 3PWPA 2EKSA 3MLZH 2YMXL 2EDWA 4JFDB 2JIXA 3LOWA 1EO8H 2QHRH 4P2RE 5LBSH 3D0VB 3QYCA 4XHQA 2ZOLB 1UFUA 3U4EB 2ITCA 4G7YL 5BRZE 2Y07H 1KLUA 4N5UA 4UI2A 1WIOA 2E6JA 5E0QA 1KB5H 1M71B 4PJBE 5TDPB 4ZUWA 4FXGA 2YSSA 4WU5A 1D5ZA 4WHTA 3TESA 2JCCB 3FL7A 1IC4L 1AD0B 2BSED 1XZ0B 1WFUA 2LFGA 4GRWE 3W0WE 5FKPA 4AM0A 4C56B 1HYSD 4EN3C 1UACH 2JJSA 3T3PE 3RWDB 3RVXC 3BGMB 1CXFA 4WO4C 2GJ6B 3NCEB 5GRVK 3TBSB 1OAYL 5DF0A 1P5UA 3L5WB 4G5ZL 2HLAB 4LVHB 2VNCA 4OLEA 1IKNA 2UYLB 4ZNEE 1D5MA 4X8JA 2CJUL 3KPSD 1J7VR 1EVUA 5JTWA 1HCFX 1GYAA 1I7ZA 3VJ6B 5GISH 1OP3K 1JGVL 2OQJA 1T6WA 3UTSE 3CK0L 1TMCB 4MS8D 1DBAL 2DMCA 2QSCH 5CSZA 3MV7B 1OCWL 3UPRA 2VZUA 1G9NL 4PRPA 4JGJA 1LO4H 2NX5D 3U79A 3ARDA 3QHFL 1G0XA 3O8XA 4L1HA 3RY5A 3VCLA 5FYLD 5DDHA 1QVOA 1NEZB 1YY8A 4M7JL 1H15B 4H0GA 1T03H 4U3HA 3FFCB 2UZIH 3QIBD 3S96B 5D2NE 3DYMA 4YX2L 3QUXA 3UMTA 4F33B 25C8L 4JN1H 1I8LA 1MCWW 4OF7A 3OKKA 5T3XL 4NT6B 5ALCL 3MOBL 1UZ6F 5HI4D 4N0UA 5K9KA 4GBXB 4HCRL 4KHTH 5CJQL 4JB9H 5E9DB 3O2DL 2FD6L 4JPVH 3IDMB 5B22A 2NY2D 3FQXA 3CDFA 4YXLH 2OL3L 1CGTA 5I74B 4HGWA 4PRIB 4OGAC 2HFTA 3DETD 3U36B 5IT2H 1BZ9A 1KJMA 1KCRH 4EKXA 5CJ5A 1SBBA 4R4FH 5DUPH 1T1XA 4LEOB 3OPZL 3GK8L 1FDLH 1QSEE 4WW1B 3D0LA 4EUPA 1MIMH 2P5EA 3CDGB 2VQ1A 3BKYL 4AEIH 1IAKB 1XCQA 4ZQKA 4HK3N 3JTSA 4CMMA 3P11H 1MCPH 1XF3B 2QSVA 2ARJA 4P23C 2Q76B 3GBML 4B53A 5E2UH 4LSQL 4M6AA 4MMXC 5BW7C 5K59E 2E6QA 1TNNA 5F3BB 3DUSB 1DVFA 1QLRB 2VDKH 2DLFL 4N5EC 1OARL 2JKXA 1KIRA 4G8IB 5TE6H 2GSIB 4M43L 1JPTH 1GGTA 4HMEA 1V3MA 4CJ1A 4LQFL 1CIUA 2DS4A 1NCBH 3CD4A 3STBA 1IGYB 3QQ9C 3GI8H 4JM2F 4TNWK 3QULA 5IG7A 4OV6F 1IT9H 1CE6B 1MH5B 1BPVA 1MFDH 4RGNE 1EMTL 1UVQB 2CRYA 4PY8J 5TDNA 2FH6A 3HMXH 4UIMA 3S35H 5FB8A 5F96L 5DT1H 1CT8A 4QT5A 3RVXD 4XBEL 5LQBH 3HUJB 4WO4D 3I02B 5HTSA 2EICA 4YHML 5KSVB 5HHOD 5INCA 4D0CB 3NFPA 2DKSA 2R2EB 2YD4A 5EUKA 3HG1A 3BZEA 2QR0B 2WQ8A 2I24N 4LLWA 3V5HA 3MYJB 3PIQB 4Q9CA 1GHFH 2W65B 5DEFA 5JORB 4RDQF 1V5JA 1VFOA 2ICEB 3VXTB 1RMFH 1IGFH 1EFXA 4XAWH 1QEWB 3UXFA 4AL8H 2VL4A 1RJLA 4NNPL 3DPBA 4Z7QF 2B5IC 2DWDB 3OKOA 5HHVH 3UTPD 4BFBD 3DI3B 4CMHC 2PXYA 1UKQA 1YMHA 4YDIL 2F54D 4ZMAT 4OFYA 4PJXA 4Y4KD 1TZGL 4Y4FB 4ALAL 5ISZD 4OM0L 2YUVA 3HS0B 3BZ4A 3KYOA 3QXDB 1HCVA 3ALXA 4XMKL 1IKNC 3ZT6A 1IFHL 3NN8B 4N8CH 1LNUA 1DUZA 2W60B 3JXAA 4ELKA 3AREB 4BKLB 2BNRA 5BJTA 3LEVH 1HWGB 3MLUL 3QHTC 4G7VL 1IL1A 2FSEA 2G5RA 5I9QC 4P46A 2IANB 1UWXH 4OGAD 4GH7B 4WI6A 4H8WC 4RAHA 5HYIA 5T1LD 4Z7VB 1WFOA 2EDHA 4QOKE 2YRLA 3ARDC 1LD9B 1MCIA 5GGVH 4ELMF 3LEXB 5DD1H 5IMLA 3DX9A 4O4YH 4KH2A 1N3NA 1JHTB 2OP4H 4Y16A 1JWMA 2V7NB 4FZEH 1JFQH 4J8RB 4WY7L 4MQSB 1TVBA 3FCTA 4NNYA 1R6VA 2VDLH 2Q8BL 2VDRL 2IFGA 2A2QT 2EKJA 3QUXC 4LASL 5IW6B 4OGZA 2Q6WB 1I8LC 4E41B 4RSVA 3CFKB 5EH1A 1M7IB 1U8PA 4P23D 1SJHB 4MSWA 1TQBB 1IC7H 3ECBA 1G7JA 3B8SA 1T20A 3WE6A 4KDTC 1ND0A 1UWGL 4JKPL 2YD2A 4NN5C 4LCWE 2DQDH 4GRWH 1AKJD 4QGYA 2P43B 4ODUB 4GG8B 5I1JH 3OQ3B 3ARBA 4NN6C 4PB0H 3ARGB 3OG6B 3WKNA 2NLJB 1Q9OA 4R90L 1GSMA 1A1OB 2VZVA 4OI9A 5AD0A 2EH8L 1EEQA 1KTLA 1B0GA 3QFDB 5BS0E 3RAJH 3E0GA 5FYLH 4HPYL 3O41B 3JUZA 1N7ML 3PWPD 4HXBL 3MJ6A 5TFSL 5I1CH 1PDKA 2WWMC 3K2MC 2JIXD 3TYFA 3TNMA 5FA3B 2DQTH 2VLJA 3KNBB 5I0DA 4XNUL 5C9KA 4FN0A 2VXQH 1JZ7A 5IMMA 3OF6A 1GPOL 1JHLL 1P9MA 4KXZH 1DQML 3NGBC 1NUNB 1ZHKB 1RHHA 2BSRA 3EYQD 5HI5C 1DVFC 1OTUD 3QRGL 4QEGA 4HBCL 4ZFGL 1Q0XL 3MYZA 3VI3F 3SDCC 5FGSA 4ZXBA 4GW5B 2AJ3B 5MI0B 4JPWL 4NKOB 1BM3H 1UM5L 2A6KA 5SWZE 1OLZA 3TP4A 3S5LA 2IMMA 4NHCL 1CGXA 4Z7NE 2JELL 5J11B 4GXVH 1JPSH 2VDNH 4A6YH 2HH0H 1BIIB 3EDFA 2QKIB 2H3NB 3EAKA 4GKSB 2FX8H 2DQIL 2JLLA 1F4WL 1RJZA 3HZVA 3J8F7 4PRPE 5ITFB 5IJVB 5EU5B 4XP9H 4E0RB 1JE6A 4WI5A 2PW1B 4K8RC 3QWRA 4QWWD 4XC3H 2X09A 4N0CC 4ZUSB 2FJHA 1KXTB 3RHWF 2DB8A 4UOJA 2BVPA 3T3ME 4D3CH 1A4JA 2B4CC 2GAZB 1NFDE 2HRPL 4M8QA 5GRUH 3T4YB 2ERJB 3ZHKA 1JNHA 4PRPD 2X2YA 2DTML 2MKLC 1P69B 4TULH 3ARDD 1OAZH 3O2WH 4F9LA 3O8XD 1A1NA 4U7KA 1NMBH 1YQVH 1FFNB 5E2TH 4JCMA 3T65B 4HZAA 5E08L 4LDEB 4LPCA 3SDXB 4JJ5A 5INDA 4YAQB 4XVJL 3QUXD 4YNYA 2O61B 5IEKA 1JPST 5E1AB 1EX0A 3ES6A 5CBAA 3CFJA 4GLRI 4NIKB 3GIZH 4ODHL 5EULV 4WCYL 3QXAB 3MRBA 2I26N 5JHLH 4HK3J 2C7UA 4LCYB 4XP5H 5DD0H 3IAPA 3V79C 3RX8A 2DICA 3ILPA 1MJ8L 2HVJB 2I9LA 1JMZA 2KH2B 1PLGL 4CADA 4PJDF 1RZIB 2MNUA 1NGWA 3X17A 1CDBA 3KR3H 4EVNA 2UWEB 3QA3A 5C0AB 2WBJA 3OL2A 2Z8WC 5IBUB 1HSBA 1SJVA 2NXYB 4Y16C 4WUKL 3QPQC 2FATH 1I8IB 1NBVH 1X9QA 3LPGA 3MX0A 2P5ED 2WWMD 2Q7YB 1CBVL 3Q6GL 2X89A 1CFQB 2QQQA 4UTAH 4KWUA 1I7RA 3C5ZB 4NFBA 1A3QA 3OKNA 4J6RL 3CCHB 3LN4B 5F3HA 3PQYA 3D2UA 3LKOB 4MAYC 4MJIE 1EXUA 1DVFD 4Y19A 5HHPA 4XP6L 3VGFA 2VAAA 4P3CL 4BFGA 3H7BB 4XWOC 3EDDA 4I0CC 2ZPKL 3B2UD 3QXUA 2ZG3A 4G42B 1T0MA 3Q0HA 3V4PL 5DUBA 1DANT 1RUPH 1TETL 1W8NA 4ORZC 4LFHG 3FQWA 1BJ1J 4MA7H 3T0EC 1Y6MR 4KK8C 5T1DL 3VI4F 1Q0YL 3A67L 4ESKA 3O81A 4Y5XC 4UV7H 1JI1A 2NW2B 4AYFA 2HLFD 1FYHB 1YYML 3H0TA 3SDYL 1J05A 5DEGA 5ESAB 4K3DH 3NABH 5MHSE 1P9MC 4NQDB 4G6KH 2A9MH 3HG1D 3T09A 4JKWA 5TPWH 1G6RL 1U3HB 1F11A 3REWA 5D5MB 3AY4C 3T0DA 3SGDH 3CVHB 1PQZB 5I18L 4X9GA 1ADQH 2DQCL 1VFAB 4JO2L 1MPAH 2VLRA 1LILA 3QDMB 1AGDA 1DN2A 4MGXA 4CW1B 1EFXD 4HCRA 3KPNA 2PW2A 5ETUA 1OGAB 1FFOA 3PP4H 3DV6A 3OGCB 4GO6B 4MNGE 4U1GB 5GSVB 5KVFL 3S34H 1WVZA 5A2IH 4KTEL 5HI3D 1ITCA 1S7SA 3O2DA 3OXRA 5DA4A 1BQHA 2PXYD 2YN3A 1B4JH 4KTDH 1U8HA 4CVXB 2WP3T 4H25A 4OFYD 2X4TA 2P45B 5C1MB 4GAFB 5I30H 3WO3B 1FJ1B 5I19H 3UYRH 4XX1E 1HQRB 3ROLB 4ACPA 3L6FA 4DVRL 2G60H 1H3WM 5GRJH 1KBGH 3I75B 5JPNB 4PGCA 1KJ3L 2C1PB 3EYVA 3PJSB 4HUWB 4OT1H 1R3HB 4YPGA 2BNRD 3VMPA 4YBQD 1KSRA 3SQOH 2VXSH 4XWGL 3SY0A 4I0PB 1JPGA 3MRIB 1RZJL 3CFIC 4XNQA 1KFAH 3KPTA 4NC1E 2Y5TB 2NNAB 4P46D 4Y0GA 2PR4L 3B5GA 5HHXH 5I8CB 1A6WH 4JVPA 4WV1A 3SGEH 5ITBH 4PG2A 4Y16D 4WENB 1JPFA 2FDBP 3QPQD 4HUXB 4WUUA 4K7PX 5CZVL 3LRHA 1IC5L 2CKBB 4NQEE 2IQAA 3BPNB 3QFJA 4E5XA 1XGTA 5ADPL 5D2LF 1YN6B 1QQDA 1WBZB 4KRPC 3ULVC 3CJJA 1G7LA 4OZFG 3BPCA 3PV7A 2FWOA 1XEDA 1U8LA 4HFUH 3J7HA 4IRSB 1C16A 3DI2B 3T2PA 1TQCC 4I77H 3UC0H 4OZIF 3O2VH 3S37H 3O6FB 3VFPA 2VDQH 4DVBB 3M17A 4DKEH 2YBRB 5K9OB 2R1XB 5DR5H 3ARBD 3HCVB 4R7NB 4DEPB 1QBAA 1AJ7H 1UZ8B 4ZD3H 2WWKO 4WVRA 1XF5A 4H8WH 4JZJB 2WBJC 5JPMA 2AJYL 3KPPA 4PLJC 5AWNL 2YPKB 5EU6A 1BOYA 3BKJH 3QHZH 3V52H 4XZUA 3T1FB 4KK8D 5FCUL 1CN4A 4N9OB 5DJCB 5T1MA 5DD5L 4LCIH 4Z78A 4UOW0 3RFZC 5AZEH 2VLJD 3HI6H 2DLIA 4S2SA 2FIKA 3BWUC 1YEDB 3OF6D 2CLZB 3O11A 4XVSH 4M5YL 3KDMB 4ZDHB 1LP9F 2N1KA 4JDZA 1JNLH 3I6KB 3MO1A 5D7JC 5HGHB 4HC1L 1DQTA 4HUMB 1KEML 3CFBA 3Q5YA 2HWZL 1B0RB 3WFDH 3PWNA 4QY8B 4BUHA 2BY2A 3U7YH 4ZXBD 3WNNA 1X6NA 5FUOL 3BW9B 5C0IB 3NTCH 3BE1L 3LIZL 4PBXA 4RMQA 4L8BB 2EEDA 3FQNB 4MD0B 5DSCA 1S5IH 2NZ9D 1DL7H 5C09B 2W38A 2A77H 1I4FB 4L9LB 5E5UB 1G9NC 4N90E 4EBQL 4OCRH 4JRXB 4PJGB 2AABL 4EUPH 3S4SA 2F5BH 3M45A 3LRGA 3V6FB 4D9QE 2Z93A 4HXAH 4HV8B 4IS6B 3HI5H 4QRPB 4ISVA 5B21A 2WIIB 5JHDE 3QWRD 4K23H 1P6FA 1IARB 1A7QL 4ONFL 1MAML 2ESVE 1E27B 3CXHK 4AJ0A 4LLDA 1P2CB 3R4DA 4B7IA 1WAAA 4LGPB 4KI5E 5FGRA 3FT2A 5DMYA 2MPAL 2BMKA 3DRTB 1A6UH 3IS0X 2EDFA 3Q48A 4MB5A 4S1SL 5GJTH 3UTTE 1JNJA 5C0EA 3KS0J 4IJ3C 1A4KA 4H0HB 2R0ZL 3AU1B 1ZK9A 4F7MA 3ELAT 3MUGA 4XGZA 3VA6A 3NIDF 1CGSL 4X5LA 5DRXA 4PJCB 3MMEA 1C1EL 3GBNL 5EA0L 3QCVH 3SOBL 4KRPD 3ULVD 4M1CC 5C0JA 2DIJA 5I2IB 3ESUF 1F3JA 3L3GB 4F2MA 2X4RB 1RZ8A 4JZNA 5FYJU 2IJ0C 4DGVH 1UJTA 1N8ZB 3ISWA 2QQNL 1ZS8A 4G6FB 1MCSA 1YN7A 2CK0H 1JF6A 2R0KH 2X4QA 1R5IA 3SE8L 3FZUC 4BQ9A 3H3PL 1KC5H 3AVEA 3GSRA 4Y8AA 4QXTB 4JAMB 2DD8L 4CGTA 4YUEL 4V2BA 2GUOB 3SGDI 4WV1C 2WBJD 4QYOB 3SO3C 4Y19E 1ZTXL 3CMOH 2NY1B 2CMRL 3D9AH 4QHKI 3TIDA 3MLWH 2RB8A 4PBVC 3K46A 1ED3B 1JV5B 2X89D 4JANB 5H2BB 4I3RH 3KPMA 4NQCE 2GYSA 4JG1H 3DXAA 3MLPA 2O5YL 3TNNB 3CZJA 4TSAH 2VC2L 1VERA 3PQYD 3D2UD 2C3VB 4UIKL 1N5AA 4TVPE 3CLEL 2MSPA 1IEBB 3VXPB 1RD6A 3VE0B 3D18A 3CFEB 4Y19D 4OV5B 4PJAA 3FO0H 1SBSL 1MQKL 1T7ZA 5EC1A 5GRVL 4RDQG 4J4PA 1I9RH 4G6MH 3MRCA 3TWCL 4YFDB 4YXKL 3MLXH 4OZGA 2AI0H 1HN1A 3MRHA 4LSSL 4OLUL 4L8CA 3ULSA 3GJFB 1G7MA 5IJKA 5EN2A 4HBQA 4NO3A 2JCCE 2XTJE 1F8TL 4LU5L 4GOSA 4P99A 4LLYA 2AJUH 2R0LL 3H3KA 3L95B 1Y6NR 3IF1A 2XRAH 1YQ2A 5C6WH 3RNKA 1FGNH 1T22A 2DI7A 3GO1L 1MRDH 2AERT 4KK5C 5L9DL 1TVHA 5IMOA 3F6LA 5LKNA 5E95B 2AJVH 1RJCA 5DYOB 2XTJD 5T3XD 3QXVA 1DP0A 1IGCL 1NANH 1EJ6A 1M1SA 1CDJA 2PN5A 5D7IB 2R2CA 2VLRD 2J88L 2NY6C 3WXVL 3X14B 5C70A 1P4BL 1MWAB 3BO8B 2ICWA 1JUFB 1RIVH 2E7MA 3K74B 3EOTL 2OJEB 1UM4L 3ME0A 1NPUA 1TZHB 1I9EA 4HFWB 2YKLH 1F2XK 4MCYB 5EBLB 1GIGH 3MV7E 4L8SA 4MMZC 2EDLA 3CSYB 2JJWA 3RVUC 4PJXF 1JL8A 3P9LB 5GGSA 2AXFB 1CR9L 4U6HA 3KG5A 1CL7L 3BD4A 4OKDA 1LEIB 2XKSA 4Z6AT 1J1XL 2EE6A 1S7VA 5C0BB 1FQ9C 2WMPA 5I15H 1FZMB 2R2BB 4QRSB 4FMKA 3QFJE 1KNOB 1VFMA 1J1PL 2NYYC 1BFOB 2B8OT 5DA0B 3C87A 3DIFA 3BRFA 1Y0LB 2CIIB 3UEZA 4S11A 4JO4L 1OD9A 4KV5E 3NZ8A 1SYSA 3BIKA 5E9DE 3TO2B 4LCCB 3V7MA 5A16A 4XCNB 4PRIE 2QSQA 1EO5A 4HMCA 2CLVB 4PREB 1CLZL 2GKIA 1YMMB 4I1NB 4WUUD 4JM4H 4OM1L 4UDUB 4O51B 2VLKB 3QFJD 4HX1A 4OQTL 5L7XL 5IKCB 4O2EB 2NY7H 4KROC 4LARH 4B41A 5KANG 3G04A 4UINH 1BHGA 3MNZB 3NAAL 1NSNH 3SJVB 5HPMB 3X3FL 3QWOA 1DLHB 1YNTA 4OCXH 4Z7OF 1S5HA 2GTWA 4HWBL 5DJDB 1C5BH 3BQUA 3P4NB 4XCYA 1FGVH 2QTEA 5CP3A 1GOHA 5E4EB 5HHMB 5I0ZA 3R8QA 2V2TA 3T4AB 4MJ4A 4XH2B 3AS0A 3P0VH 4ODWB 3WCYA 5JOFB 2BFVH 3IKCB 3FB7A 4RWYL 4CKVX 4FOMA 4BK5A 1G6RA 3JV5A 3RWEB 1EA9C 2SEBA 1KIQB 1K6QL 1YDPB 4L4VA 1ZLUH 1XH3B 3CSGA 4TYUA 3OKDA 1INDH 5GGTL 2KKQA 1ORSA 4BK4A 4ORGB 4MX7A 3BGFB 3L3DB 5EU6D 4I4WB 4PJIF 4NZUL 2GFBA 5C0RH 1QRKA 5BMFH 5KTEL 4ZPTB 1ZLSH 4JFYB 2HT2C 4YBLB 1S7XA 2J8UF 3HUJE 3ULVH 3GBLA 2QEJA 4U1NB 4RMRA 1CLYL 2WINB 2X4UB 1I7UA 4KY1L 3VH8A 3LQAH 4YK4C 2Z0BA 3QUML 4XNZC 4F7CB 3LS5H 1EEUA 1Z9SA 4PGDA 2X70B 4TTDC 4J4PC 3TV3L 4FTVB 3C6LA 3OR6A 3OKEB 2Y72A 3BKML 5I73B 4BH8A 3QIUA 1VEMA 4ZYKA 1RURL 4FQCL 3LKRA 4Y5YC 1YNKL 4XCEA 4JY6A 3HE6B 4G6JL 3HC0B 3RVUD 1UG9A 1OGTA 4OKVB 2C3GA 1EEYB 1S7RA 5DJXB 1IC4H 4EIGB 1P1ZB 3EFFA 5JXAL 4P2OC 5GGRA 1MLBB 5IIEB 43CAB 2VWEC 5DFWH 1UCTA 1ZXQA 4XCCL 5C07B 5CJBA 4FNLL 4HH8A 2XG4A 1OAYH 4KTYA 5BZWB 4X7SL 4LLQB 5I76A 3VD9A 2NYYD 5L88L 4G5ZH 2YPLB 3G6AA 1G0DA 3QO1A 2COQA 3LRSA 1B0WA 3C6SA 5BZDB 2D7NA 2DJ4A 1NCAL 1T21B 3SDDB 3EGSA 1I9JH 3UTQB 3HNVL 3SE4C 1EEZA 1FNSL 4JKLA 2GTZB 3HI1B 3LQMA 1MCKA 2CDGA 3R0MA 4Z7VE 1R24A 4L8SC 5A43C 3CK0H 1NGXA 3K2UH 4DQOL 4K55A 1DBAH 4YZFF 1OCWH 1NCNA 4KROD 4FA8A 5KS9B 1A64A 4NO0B 3Q6FA 5HYJA 4HZLA 2X05A 4Z7WA 2ICCA 2MTPA 5IB4B 3ULVF 1A6VL 1CG9A 1M05A 4HUNB 3GMLA 1TENA 2AK1L 1FNGA 4E41E 1NGYB 3WBDA 5GZNC 4BSVB 1DBKL 1YEIL 4LLMB 5FEBA 4YX2H 2X44D 3PWVB 3PL6B 25C8H 1FE8L 1TCRA 3KPRB 5AUMB 4LK4A 1X5JA 5T3XH 4RFOL 5ALCH 3MOBH 4LCUA 3MLRL 2E5EA 4HC1A 5K33A 3FONB 4HUVA 4J1UA 2CR6A 3E3QE 2LE9A 5EORL 4HCRH 5E6IB 5CMAB 4NCDA 4K94L 5CJQH 3O2DH 2FD6H 2R1YA 5I71C 5IWLA 1E4KA 4L8DB 3I6LE 4AIZA 4HIEA 4OZGE 5BQ7A 2EXYC 5KZCB 2OZ4A 3DXAD 4LSVL 4Q97A 2K3TA 2P7TA 2MCG1 1UB6B 1D5XB 1ZHLB 4NZTL 3OPZH 3GK8H 4G8GA 3BQUC 5I8OL 5CCKL 2DLHA 2ZUTA 4JREB 3QBTB 3O3DA 1WGOA 2O5XH 1BREA 3EYSL 4M9OA 4JHBA 4J4PD 1MRFH 3RWIB 5I1LB 4NKMB 5DJAB 1AHWB 4NBZB 3GBMH 4PJEB 5I75B 1UYWL 3LN5B 4LSQH 3VWKB 1FZKB 4N9GB 3IDYB 1HYRC 2OTPA 2YA1A 5E2JA 3WJJA 1A6ZA 2DLFH 1OARH 1HH9A 3BSZL 5HDOA 5KSBA 3RJDA 4M43H 3BVNB 3WUWA 1VACB 1U6AL 4X4ZA 2A6JA 4XAKD 1DBJL 4LQFH 4DGIL 1FV1B 1PSKL 4LSPL 1INEH 2B0SL 1LO3L 4HWEL 2YXMA 3WIIL 2ZUQC 5JUEH 2AP2A 1EMTH 1J86A 3VFNA 4Y2OA 5F96H 4XBEH 4DCQB 4P2QA 4QNPF 4YHMH 3V0AC 1XGYL 1OY3B 3C6LC 1RK1B 3RQ3A 5EO1A 3DOSA 1ZT4A 2FJFB 4IMLB 5B38G 3V4UL 1KGCE 1IZKA 4IDJL 1AO7E 2ARWA 2F53E 1AGEB 4S1QL 3VXRB 5DURD 2ZG1A 3MJ7B 1AC6A 1RZKL 3DURB 4HWZB 5FK9B 1KPUB 3JWNC 4X6DA 5D96B 2YD9A 1A6TB 2FBOJ 4TSBL 2APXA 4F15B 5CHNA 1DBML 3LQZB 4Y4HC 2YK1L 4JFPA 4NNPH 3W39B 1Q1JL 3VXNB 2ZJSL 2ARJQ 3SDXE 3T8XB 3DUHA 4Z5RA 5ANMB 2RBLA 5H35B 1X6LA 1XCTB 3C09C 4LLAA 5K93A 1UXWB 4F58L 1JGEA 3Q5TA 5GZND 1AGBB 4EZMA 5IHZB 1TZGH 2UY7A 3B5TA 4OM0H 4RFNC 3SKNB 1HQ4B 5I66A 1XF2A 2V2WA 3A6CH 2FCBA 1FZJB 2GK0A 3D3VA 3NACH 4PRHA 4RCAA 43C9A 4YO0A 3TFKC 1UQSA 4XMKH 1UCBL 5CBEA 5GIRA 2HG5B 3BEWA 4N1EA 3U9UB 1WZ1L 3MLUH 3PDOB 3FO1B 8FABB 3F7VA 1S8DB 3IU3B 3O3AB