2BDNH

Crystal structure of human mcp-1 bound to a blocking antibody, 11k2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
217
structure length
217
Chain Sequence
EVQLQQSGAELVKAGASVKLSCPASGLNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKFDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARGVFGFFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A2
publication title Structure activity relationships of monocyte chemoattractant proteins in complex with a blocking antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2005-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnH02
4UAOB 3O6ML 5JW4R 3H8NA 4OCNC 2CUIA 2C1OB 5CZXC 4PR5B 4W68A 3UTSA 1DFBH 2VTFA 5F7DB 1FIEA 5DJ0A 1RJYA 1AGEB 3STBA 1AR1C 3UBXB 1S7VB 5CD3A 3BGFB 2O61A 1VGEL 5EB9A 4FZEH 3BZFA 4YHIB 4RX4A 2AK1H 4QXUL 3ALWA 3VXOB 3ZLQC 4G8IB 5SWZA 1D5ZB 4G6JL 1I3GH 3SCMD 1DLHA 3UTTE 4JFXA 5HHXH 2H8PB 3WFHB 4PRAA 4JO1H 3S3PA 1HZHL 1XH3B 1DBBH 4Q74A 5F7MC 5JHLL 3RUGB 1ROWA 3VXUD 5GRVL 1KNOB 4X6CF 3MRBA 3NIFF 3L9RA 5DMGC 5CD5C 4RCAA 3MODH 2XWJA 3H6JA 4Q9RL 5I1AB 3C09B 4Z7WA 3T4YB 3UYOD 2N56A 3O2WL 5E94A 1FL5A 1KSRA 1CGUA 3O2DH 3VFUA 4ZMAT 5FHAL 5MEPA 1QR4A 4LSPL 4XVUC 4GMSL 4M6OH 1SEBA 4NT6B 1WZLA 5FM8A 5JR1L 4NWTH 1BBDL 3I50H 3VD5A 5MENE 3U0WH 4YGVB 5J6GA 1NGWA 3HNTH 3MLTA 4MZ3A 5F9JA 2FHBA 1D9KD 3O2DA 3UTTA 3OXRB 3ZL4H 1MF2L 5DYOB 1X4ZA 3DRQA 4C55A 4PS4H 2UZIL 3RL1A 3LV3A 1CL7I 5BV7L 1K4DA 5EIQA 2CDGA 2F19H 2NNAB 4L29A 4XMPH 3X14A 3K80A 5HBBA 1IGJB 2WW8A 3IF1B 1D5IH 1XF3A 1T3FA 1GOGA 3UJIH 2B1HH 1UXWA 5D93C 5DJZA 2XKSA 2OTWA 4H8WC 1A9EA 1IAMA 4NKMA 4DVRL 2NY2D 3TBSA 1BJ8A 5DJXB 4LARL 3Q3GB 5CEXA 1NFKA 1K4CB 2H2SC 5JIPA 5MENA 2VWEC 3MJ7A 2PETA 4JDZA 3SDAA 4AQOA 5CBAB 3AS2A 3H0TA 1B9ZA 1W2KT 3O3AA 5A3IC 1NMCB 4WDIA 4UDTA 4M7ZB 2AJSL 5E1HB 4YBHA 3G04B 4DN3H 1J86A 5I16A 1A1MB 3QXAB 4JFDD 5EC1B 4E0RB 3FOLB 5BS0D 2YD3A 3ECBB 1XR9B 1V3LA 3WNOA 3G5VB 3GMMA 1GCFA 4JGUA 4LCCA 4R96A 2J8UE 1YMHB 4YEFA 2Z8WC 3WHE1 2R1WA 3I85A 3AVEA 3S96B 4HJ0D 3VXSD 4OF5A 3RWCA 4JHAH 1HQRA 1I1AD 1F45A 2CRYA 2CXGA 2IGFH 4OLYH 2Q20A 3P0VH 2DJ4A 4KHTH 3VFVA 1WV7T 1JYWA 2CUMA 4NN7C 1WZKA 1N0LA 2E7BA 1YYML 1H3VA 5DFTA 5LQBH 1MQ8A 3SCMB 1KCVL 3QJFA 4PLJC 4HUXB 1KB5B 3ARDC 3W0WE 1BGXL 3MRNA 2D7PA 3DO7B 5C0BE 1NCNA 4ETYA 3VXRE 5DLMH 4OM1H 1AP2A 4ZUTA 4APQA 2L7JA 2F5AH 3SDYL 3PABA 3VXUB 4MXVF 1DQDH 3VRLF 2ENYA 2P8LA 4UILH 3BE1L 2VZ3A 3VH8G 3S4SA 4S10A 4HBQA 3E3QC 3BRDA 3RX5A 2CK0H 1GGIH 1C16A 2J8UA 4JY4A 3GSUA 3OF6D 3WIHA 2FCBA 1G6RH 1CE1L 4HC1H 2C3XA 3MXWH 1X5LA 5I1GH 1P7QD 2ADIB 1FIGL 1WFNA 2ARJA 4Q0XH 5CP3H 1EPFA 4L1HA 5JA8B 3MLPA 3QR2A 1OWWA 1CFBA 4XTRC 4GAYA 5KSUB 3WLWD 1EVTC 1U8IB 1D9KB 1E4WH 2HJKB 3QNZB 5ID0A 3HZMA 3W0WA 1N6QH 2F15A 5C0AD 2EEBA 4ZOAA 2DM3A 2VB5A 5C0BA 1G6RA 4HC1A 3VXRA 1UJTA 3SQBA 2W91A 2O5YH 1A7PH 1RZFH 1TZHA 5CP3A 3G5XA 1MAKA 1FZMA 4DOHB 3EO0B 5FB8A 3GI9L 5ESVA 5EIVA 4Y19D 3DTXA 2HTLC 2V7HB 3PG2A 4BSVB 3V8CA 2DLHA 2X4UB 4Y1AD 1Q9OB 4O5LH 2Z92B 4DZBB 5J13C 4J3OC 4EUPH 5BW7A 2EH8H 4XZUB 5E8EB 4DEPC 5GS0D 4R7DA 1ZA6A 4XVSH 3VWKA 1EHLH 2NY2B 3LRGA 4R97C 4F15C 5CSZB 3ZE1E 2Y25A 1G7PB 1ORSA 5EZOH 3S97C 3U30C 4UIKH 5EZIH 3B2UD 3FQXA 3PWUA 1XGTA 2FHFA 4U1HA 8FABB 3N1MC 4QYOA 3KPQA 4U3CA 4LDLB 4EUPA 3LHPL 4JFDB 5JXAL 4MNGB 3O45A 4K7FB 1N64H 5BS0B 3L3JA 5C70A 2DOCA 2ILLA 3TBVA 4E5XA 2VDKH 4Z7OE 4M5ZH 1UZ6F 4X6DE 3G6AB 1GHFL 3MUHL 2XWBA 5MEOA 3DOSA 4RA3A 3VXSB 3P9LB 4U3XA 2A6KB 3EGSB 4WFGE 5ENWA 2IALA 4M1CD 3ZKSD 4OUUA 1I1AB 3MOAL 3WD5L 4XWGH 4PG9A 3UDWA 4RIRB 1CD1B 2R0LH 2OMNA 5CKAA 1LO5A 1HQ4A 4Y8AA 1RZIB 1CLYL 5TPWH 4TVPD 1MCFA 4HAGA 2O5ZL 5EBLA 2QR0A 3DX9A 1TTFA 4YHPA 4JKWA 1FGVH 3D0VB 4JGMA 4UV7L 5MHSE 1ES0A 1UQSB 1DBKH 1HH9B 2AJZB 3T2NH 2CGRH 1BIIB 1A5FL 1Y18A 3O4OB 4RAVB 3LKQB 4U6XB 4BKLA 7CGTA 3ZTNL 5F6IB 4M3KB 4MJ2A 3BW9A 1QLFA 3HB3C 2VDNH 3ISWA 4HFWB 1DEEB 4K8RD 2JELL 1KCRL 5HGHA 3B43A 3EJZD 4NNYA 1JGUL 1MCOH 3GGWA 4X6DA 2R69H 4JRWA 5HDQL 3T0BA 3FN3A 1SYVB 4X6BB 1XF1A 1IEAB 2UWEB 3X3GL 1KLFA 4G5ZL 3E8UL 1P7QB 3MREB 2W0PA 4QHUA 1FGNH 4HQQH 2CK2A 5I8EA 1X3DA 4BUHA 2CKBH 5HHQB 1IGYA 4DKFL 4F2MA 1X4YA 4I77L 4PJEA 3OKOB 3UPRA 5C0AB 1NGQL 2EKSB 3RNKA 4V1DD 4I5BB 2J2ZA 1A1NB 5FO7B 1W0WA 4XP4L 3VXNA 4MHHI 3W2DL 2GT9B 1F4XL 2YMXL 2ZPKL 3GIZH 2VDOL 4KGLA 4RAUB 2H41A 2WIMA 5GGVH 3HAEH 5ITBL 2CKBA 4Y19B 2Y4SA 1EZVX 1T2QL 3EYVB 2KQNA 4WVRA 4ESKA 5CBEA 5I1DA 4WW2B 4I18C 1CCZA 4Y1AB 1G9MH 2RAMA 4ERSH 5HHNB 2CR3A 3RWIB 1BQUA 4X6FA 5EIIB 3W11C 4U1KB 4RGNE 3TBWB 2GJJA 5K9QI 3TPKA 4BYHA 2F53D 3BQUC 3TT1H 3VXTB 1E0OB 4BZ1H 5HYSB 1YDPA 4BSWB 1RMFH 1NCWH 5DJ8A 3QCTL 3V7MA 3HAEA 4O9HL 3WCYA 3FMGL 4GKNA 4X4XB 4YDJA 2PF6A 4P2RD 3LEYL 1IJ9A 3PJSB 3PDGA 1K2DA 3A6CL 1S9YA 5F7NC 1IZKA 1KPUB 3ARFD 3LIZL 2Q76A 5K9JL 3TJHC 4JJHA 1KJMA 3NIDF 4KMTH 1FSKC 2C4XA 1JYXA 2WMPA 5GZOC 3KPRD 1ZHKB 1FG9C 1KGCE 3JWOC 1NAKH 1WQVT 1JGEA 3CX5J 5EU4B 1MREL 3SE9L 5A16B 4ZFFA 5IV2A 3LKRB 4M1DH 5EOCJ 3ZDXF 3F62A 4FQQA 3MRHB 4MNQD 1EAPA 1YUHB 3I2CL 5DHVA 5J12C 5ERWA 5E2VL 2Z4QB 4WHDA 2EDJA 1G7IB 1RUPH 2VJXA 4MXQD 5FYJU 5HYQB 3QQ3B 2YD7A 2I5YL 2IPTH 1HH6A 5CSGA 1XIWD 2G2RA 4ZPTB 1JZ5A 3GSVB 5ICZB 4GXUN 5IB2B 1U93A 1U8MA 3ULVD 5IFHL 4TUOA 4Z7WF 3BKCL 4MMXC 4YPGB 5JOEA 3OXSB 3HC3L 4ZFZB 3VFOB 5A1AA 2IG2L 2ZSWB 1YNKH 2IBZX 2KZWA 3OAUH 4JCMA 4LLWA 4AEIL 1HXYB 2HRPH 3MSPA 4LAQH 1KULA 1UEMA 4LCUB 5E8PA 3VU2A 2ZOKB 4WFFD 5LGHL 4P5TB 1MPAH 4MD5B 2VNCA 3NGBB 2MNUA 2OTUA 5SWQB 1OTSD 2H26B 3VG0L 4WI4A 1C12B 3NZHH 3VGAC 4G9DB 1NC4A 2W9LA 4O58L 5D6CA 4DWHA 1OL0A 4V1DB 4AH2A 5D7IE 1WWCA 4OLWL 1I9RL 4KZDH 4WU5A 1AFVH 4KFZC 5C2BH 3ILQD 4L8DB 1HCFX 1WEJL 2BOCB 2OR9H 2AXGB 3TJEH 4AIZA 3O8XA 3B9EA 4JCLA 1AE6H 4R3SB 3ARRA 4NNPH 1Q0YH 1UWGL 3BSZL 5T5FH 4MXWH 2FJFA 3CUPB 3ROOA 5EORH 5F44A 2A9NH 1V8HA 2YN3A 5FYJD 5GRVK 2FEEL 4MCYB 4NP4H 1P4BL 5ILTL 5J06A 4QTIL 3WIIL 1BOYA 4JPWH 2F53B 5DQ9A 1B2WL 3SDAC 1J1OL 2F54D 4R4NC 1TNMA 3PWNB 5E03A 1N5AB 3MRGB 1WFUA 3GJFH 4JRYD 3IDIA 3DX6B 2CO7B 3KYKL 1E4KA 5EOQH 4P2RB 3RHWK 4LCCC 5JHDD 3MV01 1CD0A 1TJHL 3NA4A 3ARFB 1H3PH 3CFKB 3L5HA 1ORQA 5D7IA 4CW1B 4DQOL 5KJRH 1U3ZA 4HH9A 3V5DA 1E6JL 3TEUA 4XBGA 5D71H 3BP6B 1CWVA 3D85A 3KJ6L 3NFNB 1Q9WB 3KPRB 3GJFA 4K3JL 4WGVB 5IM7B 2BY2A 3ARPA 3HE6D 3T4AA 3ILPA 3RIFK 1BJ1H 4EDWL 2VC2H 4M7LH 3NA9L 1FYHB 4UV4H 5JDSA 1EIBA 1A7OH 1DQJB 2G5BA 5C09E 4ORGB 4N8CH 4APQC 4MNQB 2O5XH 3PWPE 3KPSE 5T1DH 4HGMA 1FG2B 4Y5VA 4U1GC 2XA8L 2DQEH 4PV9B 2Q1EA 3PWVA 1FFOA 4QWWD 4XCYA 1NANI 4XNZB 1XIWB 4NRYB 3ZYJA 5J1AA 5E5MB 2QADC 2W9EL 5KSVB 3X17A 2P45B 3EOAA 3HUJE 4XC1L 1EFQA 1RU9L 4PRID 2BVOB 5F1KC 2J8UF 2X9XA 3FO1B 5GJTH 5AZEH 3HNVL 4UMGA 3K1KC 1BX2A 3FFDA 3JXAA 4NZUH 3MLVH 3JTSA 1ADQL 2D0FA 2M1KA 1FO0L 2DL2A 5C1MB 5GZNC 4M62L 2CDEB 3OHXA 2MSPA 2X4RA 1JI2A 1S9XA 1G7LB 1QP1A 4UU9B 2HVKB 2BFVH 3C08H 5CJOL 4PRNA 3P9MB 1IAKB 4LSSH 3S88L 1Q9KA 4X5XA 5GGTL 5HHMD 1JNJA 5C09A 2OJZH 2XI9A 1ZV5A 4LBEB 3EFDH 3PWPA 1U3HB 4FRWA 3KPSA 4OIAA 2CRIA 1RZJH 2VLJE 1L9MA 2VISA 5FA4A 2HLFC 4N5UA 4UBDD 3SPVB 1C5BH 4TYUA 4ZDHA 4LLVB 4X6EA 4M61A 1FFPA 5JPMA 1PX3A 1CI5A 4OGYH 1MWAL 5DDHB 4JFPB 4N90E 5BW7C 2R29L 1NMAL 1DBML 1MNUL 1INEH 3V52H 3HUJA 3VWKC 4S2SB 1R0AL 3TNMA 4ODUB 5F88B 4UTAL 3DWTA 3SKOA 2FYYB 3QXUA 2GHWB 3BGMA 5FDWB 4OLZH 1JV5A 1UC6A 4P4RB 2D7TL 1QFWM 2YSSA 1NGXB 4JFOB 4DGYH 2F54B 3D9AL 3ZMRA 3JV6A 1PBYA 3DURB 2M2DA 2IAMD 3CFCH 4KK6D 3FHQA 4Y89A 4PTUA 4JRYB 4FQ1L 3OKKA 1OHQA 4GSDH 3IGAB 4XCEB 3QHZH 3V9FA 5JHDB 1LVEA 4YX2H 2C7UA 5JZ7C 5F7WC 2VLJA 4EDXB 2DI9A 4YIQA 2YBRB 4GS7B 1BQHB 1RY7B 5IW1A 2LTQC 5BVPL 1VADB 2PTUA 4R2GC 5ETUB 3UDWC 1ZA3A 3LS4H 4FXKA 3CH1B 4OM0L 1F3DH 2BX5A 3HE6B 1ZEAL 1MJ8H 1DQQB 3QFDA 1GC1C 4C58B 1FN4A 4ISVB 5MP6L 4OBRA 3C6SB 5J11B 4BH7A 1MJ7L 1A14H 4X7SL 2AK4D 4AG4H 2DKMA 2QSQA 2QQKL 1Q0XL 4P5MB 9CGTA 4Y4FA 4N5EC 4UT9L 2ZUWA 1BF8A 3OBAA 5D72H 5FGCB 5FUOL 2ICEB 2BMKA 3RWGA 4LQFH 4S1DC 3UO1H 1MJJB 1CZ8L 3ARVA 5DRXB 3I6LE 4JY6A 1J0JA 3C5ZA 1YA5A 2CXKA 3OAZH 1IC5H 3U7WH 2EDHA 4FQJH 4OAWB 4PRIB 5DURD 1CD8A 5BMFH 1NH6A 4Z7OF 1DL7H 1DCLA 4X6DF 2FL5B 1LE5A 2EYTB 1IARB 5GS1B 3QUKB 4Y4KA 5MI0B 4N0YL 3DUSB 1AHWA 4D9RE 1IBGL 3AROA 4JANA 5D70L 3V4VH 4IRJD 3PE9A 5ICYB 2C3VA 3HZKA 5D8JH 4IEFB 4PB0H 4LEXL 5JW3L 2HLAB 5HHMB 1WBZB 2ZCHL 4X5WA 4PJEF 3D2UA 2X1XR 1CGSH 5I8KL 1JWMA 2A74B 3QB7C 5KS9E 1N5YL 4KJWD 1RK1B 2B2XH 3OKLB 1N2RA 5DI8A 3WUWG 1QNZH 4HUNB 1R5IA 2OLDA 1SEQH 4AMKH 2UUDH 4ZFOL 3BPLC 2YUZA 5FM5O 2BVYA 2MCPH 4KJPC 3IDJA 3E6FA 5IWLA 4L8BA 4KKLD 1T5XA 5HGBA 2IPKA 4EQ2A 5TDPA 1ZANH 4P46D 3JTTB 1JNHB 2I60L 3V6ZA 1X5ZA 3TH3T 1OAKL 5I73B 3I3BA 4KUZL 4RQQA 3VA2C 3U2SB 3SGDI 4YHNB 1QHPA 5T3XE 2D31A 2NXYD 3EOBA 2IAMB 3FB7B 3GBNH 4BFIB 5DEFA 2QJDA 4JG1L 4JKPL 1G9MC 4P9HH 1YQVH 2WWMD 4JM2A 2FH8A 2Q7NA 4HKXB 3IDYC 1WC7A 1K9TA 1JF1B 2VE6A 5KS9A 5IHUH 1W8OA 4L3CA 5DWUH 4XXCA 4ZFGH 2EIZB 4OF0A 2RB8A 2FX9L 2N1KA 2EDQA 1JGLH 3CX5K 1QRNE 5T3XH 2AJXH 1I85A 2R2HB 1TETH 4O2FB 4HS8L 4B41A 3PWLA 3O0RL 5C0JA 2AERT 5HGAB 4HGKC 4HDIB 3BYYA 4RGNC 5I19L 5FO9A 1L7TH 5I30L 4M7JH 3MGTA 4XXDB 3LSOA 2CSPA 1VFBA 4OCRH 2AK4B 5D1ZD 3HRZA 6FABL 2YC1A 4U31A 1INDL 2NY0D 5L88L 4NO3B 2LVCA 1J0KA 5B4MC 3V2AR 4NQSB 4F37F 1FC1A 3FCTB 1N59B 4LKXA 5EUKA 1YZZA 5D5ME 4G42A 3LPGA 5DRWB 2VDPL 2BDNL 4XMLL 4NQDE 2VKXA 4YHMH 4PGEA 1J7VR 3QUZA 2L4OA 1GOFA 5DURB 5TF1H 1T20B 1QRNA 4QRUB 4NZTH 4GG6E 2XA3A 5T1MA 3SJVE 3RX8A 3VGFA 5D1XD 4TQEH 1KBGH 2IBZY 1NFIA 1DN2A 3P4LA 4IRJB 5FOBA 5LKNA 4PLNC 1F4AA 1AXIB 4FG6C 3DX8A 5J4MA 5GHWH 1UWXK 2Z93A 5I8OL 1FAIH 5EBMA 3BDBA 3V4PH 1P7KB 1ZSDB 3O8XC 5ICXB 4F7TB 5DUPL 4G7VH 1U91B 5K9KA 1MFCL 2Q3ZA 5ISZD 4KKNA 4M9PA 5D5MA 1ITCA 1BWMA 4WCYL 5C0FA 3KLDA 3MFFB 2XV6B 4RMRA 3QEGL 4NQDA 2A0LC 1R3IL 3UC0H 5IIEA 3MODL 3VCLB 5LAXA 1E28A 4GG6A 2GITB 3SJVA 4JAMB 4MZ2A 4P46B 2WUCH 1OB1B 2DKUA 1EBPA 1K8IA 2DBJA 1E4KC 3UYRL 3U4EA 1MIMH 1MRDL 1IILE 2NXYB 4LPUA 5CLTA 4K23H 3VRJA 2Y7QB 3BRGC 1BD2D 2KL6A 1CS6A 4NWTL 5HHPB 3QUYA 3U0WL 3MJ8B 5SX5H 5D7SH 2BOBA 2FEDC 2WK2A 3AU1B 1M71B 5CIPH 1KLGA 2FWOB 2OS7A 3CU7A 2W60B 4DUWA 1ETZB 3EKCA 3I75A 4YEEA 1QA9A 1OGAD 2DF3A 3MRRB 4G6ML 1V7NL 1ZGLB 3MRMB 3THMH 1NKRA 5H94A 5K33A 4XPBH 2CLZA 1ZT1A 4LASH 4LVNC 4XCFH 5LGJB 1JPTH 3G5ZB 3VRIB 1HNGA 2K9UA 3DUUB 3G9AB 5F93C 1MCQA 4D8PB 2PTVA 5TE4H 1ZE3C 5CIPA 3CFBA 3LPWA 1GPOH 3PNWA 2Z31A 4ZYKA 5INDB 1HXMA 4Y5VC 4AEEA 2XRAH 3GIVA 5D1ZB 5CEYA 3CFDB 3GMQB 3GM8A 4WW2F 4X0KA 4JM4H 2NY0B 3RY4A 2ATKB 3GSNB 4HIIB 4HPOH 1M6OA 4NNXA 1J05A 4GKZB 4F57L 4XGZA 2P49B 2NYYC 1X5YA 4DN4L 3PP4L 3CDYA 4HZLB 4POYA 4JFYB 1D5XA 2R2EA 3HZVB 3DHJA 5F9WC 5HHOE 2N7BA 1EA9C 1E4JA 4PJIB 4XNYH 4YXHL 4O2CB 1ZTXH 2H2PC 3P11L 4LPTA 4OD2B 5CHNA 2HKFL 5D1XB 2L0DA 3OX8A 4OKVB 5L9DH 3FB6A 4TUJB 3IDGB 3I6GA 5DJYA 2K7PA 4EI5B 4ZPVB 2IANE 4F3FB 4KKCD 5I17A 1H3GA 1TLKA 5I1LB 5IF0B 5C3TA 3H42H 2OL3B 3DVIA 4KHTL 5IR1B 5KVGL 2EZ0D 1QSED 5AZ2H 4HPYL 5E9DE 2X1OA 1LK3L 4BQ8A 1XGRA 2VDLH 4WY7H 4F7MA 3U36B 2DLIA 5GGRB 1GGYA 1Y0LB 2G60L 3GSXB 1U36A 5ISZB 2F5AL 5DMYA 2FR4B 3S6CA 1U6AL 3BEWB 4RMSA 4NOBA 1RZJC 3BPNB 5HHOA 1T03H 4WI7A 3IS0X 2OZ4L 3WE6A 5KANI 5LXGL 1QLEH 3VFWA 1NEZA 1UACH 1ZLVK 4HKJA 1QFUH 2KQMA 4JN2A 4R26L 1WICA 1FNGA 1J5OH 1INQB 3KLAB 3KYMB 2R15A 2VZUA 3T0ED 1G6RL 5DMKA 4P5KA 4MD0B 5I1JL 1ZT7A 3QWRA 4GRMA 4GUPB 4DW2L 3FRPG 5EN2B 2GJZA 2IANA 1R24A 4XBPB 5LVEA 3CDCA 2MHAA 4BM7A 5I71B 3PGFH 1CDUA 3QZWG 1Z5LA 3GSRA 4RGOL 4YQXL 3CSYA 3QUXD 5E9DA 1K85A 1E4WL 4IRSD 4JVWA 1UCTA 1L6ZA 1S7WB 3IXAB 4FHBD 1UWEH 1OGAB 4DKAA 4P48A 1IKFH 1Z2KA 2YPLE 1CXLA 3BMWA 3KHOA 3BZEA 1YNLL 2O5YL 4NQUA 1QO3A 3R06A 4K71C 1A7PL 2GCYA 4MLIA 4PJ8D 5CAYB 2XZAH 1G7HB 4NYLB 3S34L 4K3EH 4MCZB 4R90H 4QRPD 3OV6A 5TJWK 1IC4H 4Y4FC 2EDFA 1A9BB 2BNUA 4WJ5B 2EH8L 3KDMA 4C59B 1IKNA 5D7JA 3H3BC 1EHLL 5ADPH 4O4YL 5I76A 5C0GB 3IU4L 2DWEA 1P7HL 3FQTB 4HWEH 4HUUB 3C5ZC 5GRWA 5E8NB 3GSOA 1QFHA 1F6FB 1IGMH 3NCFB 3K4ZA 4ZNCD 2V2TA 1FVDB 4GH7B 2GK0A 1MFNA 2AKRA 1UKSA 4Y4KC 1S7TB 5EU5A 5INCA 2ARWA 3FN0L 4OQTL 1JMZA 1AHWC 1IVLA 1HEZB 4ENED 2E9IA 1MCHA 4OZIB 2N7AA 5GRUH 4MS8D 4M5ZL 4OZHB 3PV6A 1HHIB 3ARGD 5DZLA 5I75C 2UV3A 4HMDA 2X05A 5E56A 4G6KH 4LHJB 4LEOB 1HNFA 1UH3A 32C2B 1MHEA 4NM8L 4YWGH 5T3ZD 4PGDB 3BWAB 1QSEB 3P4OB 5CMAA 4OZGE 5TPWL 5CS7A 3A67L 2BSSB 2WANA 3RGVC 1FGVL 3L5WA 3S36X 3MZTA 5DD1H 4BSJA 4ZTPH 1DBKL 1TVHA 3WMSA 2YA1A 5IWLC 3DROB 4LU5L 3HI5L 5B38A 2CGRL 4CRPA 4PJCE 1T1YB 2FO1A 3BWUC 4LRNL 3SQOH 3O2VH 4D94A 3C8KA 3BRFA 3WNMA 1F2QA 4P3WA 2MPAH 2R0WH 2IH1A 1UB5B 3MROB 1P4LB 5IP4A 1X5AA 3MUZ1 1RZ8A 4GFTB 4AT6A 5E1AA 1K8DB 1ZLWH 1RV6X 1CGWA 4G8FA 5FYKU 2UVFA 4Y2DD 3T0EB 4JM2C 1IQWL 1MFEL 4KK5D 3ULUL 4LCWD 3IU3A 2X4OA 3EUUA 4NZRH 4MDIA 1AGFA 2VAAA 4JM2F 5B8CA 1FGNL 4P9MH 1VEPA 5J8OA 2V5MA 4XXCC 1S7UA 4WRLA 3C6LA 1GYAA 4OZGA 3GSQB 1B0RA 5D7LD 1CXHA 2NY1C 5KS9F 3QUXB 2WWKT 1I85C 3ZHDA 1UGNA 5FIEA 4IRSB 3RWFA 3IFLH 3JV4A 4TNVF 4Q2ZA 4LCYB 3ZZ1A 2DLTA 4P9HC 3TBYA 3TFKD 2DBLH 3GDBA 2FH6A 1XF5A 3PUCA 1IM9D 4PV8A 5FYLD 4LF3B 5CZVH 2EO9A 5F7DA 3VE0B 3OPZH 3WFDL 1QZ1A 5FKPB 4PJCA 4B7LA 2FRGP 4HK3N 4FQLH 2DQHH 4P57A 2IADB 1SMOA 4PJ8B 1C5CL 2PNDA 4YHIA 5D2LB 5DO2C 5H35B 3KJ4B 3Q1SL 3KYNB 3QH3A 5I66A 1GZPB 4QRPB 4ZS7H 3H3PH 4H1LB 3QSKB 4QHKJ 4OGZA 2AAVA 3QUML 3QIUD 2D9QB 2BHZA 5EZLA 4X9FA 4HJGB 5HXMA 1XH3A 3GB7B 1HYSD 4G9FD 3ZTJG 5EU6E 5DJAA 4JQIL 5DEGB 1F8TL 4FP8H 1KV3A 4HT1H 2DL9A 3QO1B 4PRPB 5FHBH 3QUZC 4KJYA 4H88L 4ZD3L 5FYKD 4U0QB 3GK8H 3R8BB 3LRHA 2YXFA 4YFLI 1T1ZB 3T4YA 4UOW1 1EEZA 4LVEA 4EQ3A 3CLFH 5FK9A 3ZDZF 3HPJB 3QA3A 1DZBA 1TJIH 4M1GH 4X9IA 3UAJC 3DGGA 4RWYH 4UQ3B 5D7KE 3SGKA 4LLYA 2UYLB 3BP5B 4AL8H 1J18A 1JVKA 3D5OF 1UCBH 3ARGB 4KMTL 4NT6A 3WO3B 1RZGA 3DXAD 2VDMH 4MWFB 3BEVA 4HH8A 2AJUH 1BP3B 3VH8B 1RJCA 2IQAB 5CILH 4PJFE 3V5KB 3BKML 1YEHL 2VZOA 4JFEE 1PKQE 1ACZA 2GJ6D 1OAZL 3PHQA 1F90H 1S8DB 3LN4B 5EU6A 3TPUB 4KROD 1S5IL 5ALBL 1WCBA 3UJJH 1T66C 1RIUL 1RUPL 4J6RL 3OKNB 1GOHA 3EW3B 4EEEA 4J4PD 2ZCLH 2WM0A 5D5MF 1IGJA 2IPTL 4YR6B 1MQKL 3LS5L 1OLLA 3QEQE 3L6FA 5FCUL 5ACZB 3BJLA 3BAEL 4QHKI 4GG6F 1UVQB 3ZKND 4L9LB 4PJAB 4HIHA 3NMEA 5DVOA 2W0FB 2JB6A 3HE7D 4KY1L 5TDOA 4Y2DB 2FLRT 3QUYC 3DX7B 5DJXA 3Q3GA 4LCWB 4QRSB 4GJTB 1K4CA 1RJZB 5CP7A 3MACH 1XGUA 3G6JE 1E4XH 3K2UH 1BAFL 2UY6A 4M8QA 5GISH 4KKAC 1YEEH 4PJFA 3QCUL 1LO4H 3NZHL 4FQXD 5D7LB 4JFEA 1KJ2B 4NZJA 1PKQA 2V6HA 4FQCH 3P4MA 3SO3B 5DQJB 4E0RA 4HXBH 4M43L 1VKXA 3HI6H 1QBAA 1EFXA 2NX5B 4ODHH 3WSQH 1IM9B 1A3RL 3L3DA 4XX1G 4WV1A 4PRDA 1XGPA 3S96A 4KZDL 2QL1A 3WO4B 4IHOA 1H8OA 1TQBC 3MLWL 2Z31C 2X10A 1UM5L 5FXCH 3TJEL 3QEQA 1WAAE 4A6YB 4NNPL 5FM4A 4U7SA 2HYMA 4M8VA 2IJ0C 3QG6A 3MRFA 4ZSOE 4RFOL 2DYPA 4MXWL 3B8SA 2QKIB 3ZT5A 3H9SD 5EU3A 4HUXA 3QIUB 1K5NB 5TF0A 2XTJB 3QNXA 3BKJH 1TITA 4JPWL 4LDOB 2MKLC 4G9FB 4QTHB 3MBXH 5EA0H 5J9PB 1OAYL 3G6JA 4KUCF 3HR5A 3ARUA 5LBSL 5IVXE 3PXJA 1CLZL 1U8LB 5F1NB 2GI7A 5DMIL 5EOQL 3HPLB 4CMMA 2OXGA 5L2JB 4LIQE 1IFHL 4Y8DC 1IAIL 3UTPD 1U8HB 1H3PL 4L4TE 4GQ9H 4FZ8H 5KJRL 4NQVA 4PGCA 3LQAH 5TFSH 3U0PA 4LSTL 2OTPA 1MHHB 3BN9D 4IDJH 3VW3H 2FX7H 3FTGA 1CLOH 1OSPH 3ETBF 5C08D 3TC9A 3D25B 5ADOL 3DXAB 5D2NB 2ORBH 4NHCL 1WAAA 4BELD 4OZ4B 1A6ZB 4J3XA 4X83A 4ZSOA 3RGHA 1DVFA 1HDMA 3MFGB 1D9KA 1DANU 3F7PC 4LIQH 3SO5A 1JHLH 1LO2L 4Z0BL 4W70A 3FQUA 4WU7A 4QXGH 3CCHB 3N50A 2GJ6B 2H32B 3L7FB 3MMEB 4WHYH 5BS0E 2JTDA 4V2CB 4WEBH 1RAMA 3WEXA 4KROB 4MD4B 1IRAY 1DBAL 1IEBA 2VSDA 2R4SH 3BP7A 3V7AG 5TDNB 5IVXA 5BZDB 2BC4A 2YKLH 1H5BA 2EE3A 4WFHD 2AV7B 3VXSE 2JJTA 3CZFB 1VFMA 2EDYA 5MERA 3H9YA 1DBJH 4HHAA 4L4TA 1IGTA 2MWCA 2JJSA 3MV8B 4OV6F 4H20L 2NPLX 4LSUL 2DQFA 3MBED 5EBGA 3HE7B 3T0WA 5CLWA 1CFTA 3MLVL 4FQHB 4K2UH 1FV1A 1YEJL 2YOCA 3QNYA 4FQXB 5E2UL 2R0KH 1BZ9B 3EYUH 3SE4A 3ME0A 1H3WM 4K7FA 4KI5E 1HWHB 3GKWH 1RZJL 3GSWB 4WWKD 5B3NA 1T21A 3UBXG 3HG1D 3ZKQD 1JP5A 1AD9B 1C5BL 1WBYB 1N8ZB 2APTA 2YA0A 3VXSA 2AXHA 4LVHB 3FT3B 2VUOA 4QRTB 2J3SA 4P23D 1HINH 3AY4A 2A1WL 2W1NA 1G0XA 1CFQB 1IKNC 1BJ1J 2XPGA 5D7JC 1AI1L 4ELKB 4Q97A 5J0BA 5E4EB 3CVIH 4M93C 2DMBA 3MRIA 4ODSL 5FO8A 5IG7B 4HKZA 3U6RB 4JB9H 4NUJB 4EIZC 5J57B 2XKNB 2NY6D 2VXSH 5IEHB 3X3FL 5HI5C 1M7IA 1MH5B 4AEFA 3CXHJ 2WQRA 2XFXB 2I25N 4GSDL 1JWSA 2BVTA 3QHZL 4ALAH 3MRKB 4L3EB 1HKLH 3VWJD 1UZ8B 4KMQA 4Y1AE 3FB5B 3U79A 3IB4A 5D6DA 1FBIH 3PGDB 4NC2B 5TE6H 1MFAH 5BRZE 5H8DA 1CBVL 3ARED 5I0DA 5IW6B 4E42A 1UENA 5C08B 2YUXA 5DK2B 3T04D 4Y5XA 1P7QA 1L7IL 4HK0A 1YECL 3FQWA 2HT3D 4IMKA 3FKUS 4XBEL 1EO5A 5TE7H 4HCRA 3GNMH 2YS4A 3VXPB 3MOQA 4OCXL 5C0RL 4LCIH 3LMJL 1OF2B 3BH8A 3TNNB 3O9WD 2QQLH 3MYZA 5FO7A 5GS0H 3QXDB 2NY3D 2J7LA 3D69B 1Z6JT 4YDKL 4HBCH 1F58L 5D72L 4C83B 4NN6C 4YK4C 5M94B 3ZE0E 4UT6H 1QFWH 4J2XA 2YWZA 2YZ8A 3HNSH 1UH2A 2XZCH 3KS0H 4W4NA 3WDIA 3CLEH 4KI1A 1DR9A 2B1AH 4Y1AA 4RGMC 1IC5L 5MEQA 4MJ5B 5BRZA 4LVOC 3MBEB 1MCJA 3QCVH 1A4JB 3L95B 1YEDB 3MLYH 5B8CC 3HRPA 4PJIF 4YLQT 3FQRA 3LQZB 3C6LC 1BOGB 5CGMA 4Y4HA 3NACH 1FNAA 4BFGA 4XVTH 4EN3D 3T3PE 3FO0H 5D8JL 3ZE2E 4OZGF 1P1ZB 1UA6H 3QRFM 1JGVL 5IEKB 5L8JB 2VL5A 1T5WA 4M02A 5IQ7H 4PY7A 5E2WH 3QXVA 5F9DC 4PJ9D 4U7MA 4BH8A 3HG1B 4NUGL 4F7EB 1SBSH 2QHLA 3IDNA 3LKNA 5IB1B 3H2WA 4NN5B 4PJCF 4P2CG 4AMKL 5AWNH 1A6VH 2HT4C 3AS0A 3F12B 1F3DJ 4D0BA 4DKEH 5IESL 4P23B 5KG9B 2VRAA 1MCKA 3MGAA 1DQLL 4FXLA 1JNLH 3LKRA 3CXDH 5EWIH 4K8RH 3MJGX 4OIBA 1FYTD 5GIRA 1YUHA 1YEKL 4PGBA 2AEQL 4OD1H 4V1DE 3NFSL 2NY6B 4RFNC 5HYQA 3R4DA 1SHMA 4R4BB 5ESQB 1PQZA 2E7LA 3OG6B 3IFOB 4YC2B 3LKOA 1KYOJ 4OLUL 5EO0B 3QIWD 3SGKC 1ZS8A 4QRQA 4D0DA 1GIGL 2I9LB 4NDMA 2CLRB 3M8OL 3HAEG 1I7ZA 4UIMB 3VWJB 1RUAH 4ZFZA 4M6NL 4JDTL 1ZWIB 2BJML 3CVHH 4G7YH 4R7NA 3B3IB 1G7QB 2H6PB 1LEGB 1JGLL 4LCUA 5T3XL 5HVHC 2ZOKA 3AREB 4HIJA 3TO4D 2IBBA 1I9JH 4H25B 1FNEB 1A4KB 5HYJE 1KJ3L 4FS0A 1UM4H 4MD5A 4OGAC 4ODTH 5KTEH 2DQDH 5I1EL 3FT4B 4HKBB 3MPCA 5EO9B 1FZKA 1P9MA 5DD0L 5TQ0L 1T0PB 3CVHA 2FIKA 5JMRA 5SV3A 1GZQB 1ITBB 2BRRH 3DVGA 1ZHLB 4W81A 4XP1H 4V1DA 1YEGH 3O9WB 4OCRL 4NQED 4KWUA 1P4IH 4LP5A 2E7HA 4ELMB 2NY3B 1B4JH 4PLKC 5HI4D 5F7EH 5BOPA 5T1LD 1JZ6A 3D3VE 4PRHD 5F7FA 5KVFH 3WN5A 1OAQH 2Y07H 1MHPH 4Z7NF 5HPMA 3AXLB 4I4WB 4WO4D 3O6MH 1TMCB 3RPIA 4MCYA 1WIPA 2K1MA 2EC9T 2NZ9D 4XI5D 3GZKA 1WF5A 4OBSA 5HYJA 2AQ2A 3VJ6A 3H9HB 2Y72A 1J0ZA 4G6JH 1KBGL 3P30H 2J8HA 3MRGA 4M7ZC 1RPQA 4Z7VE 4PJDE 4J3TA 4OZHF 4EN3B 3PHOA 4PJFF 4OD3H 1W72L 4QHNA 4XNQB 3STLA 1V5JA 5H37H 3CFJB 4WV1C 4Z18A 5JHLH 2F9BT 3LDBC 3CFKA 2CRMA 3I84A 3WIFA 3UROR 3SKNB 3TVMD 3V4PL 2LVEA 5DRZA 1BEYL 1QVOB 2EE2A 4WNQA 3D3VA 2PYED 2ZUSA 4Z95H 5GSRB 5DD5L 4Q9RH 1CVSC 2X4SA 4G7VL 4YBLB 3O2WH 2D4DA 1EBAA 1LGVA 5F97E 3TA3D 3D1MC 4UQ2B 3RRQA 4IRZL 4MJID 2KZ1B 5FHAH 4LSPH 2DQGL 2PXYA 3OJMB 2H1PL 4GMSH 3IYLW 3N1PC 5EOTB 1FYTB 5JR1H 4KQ3H 1BBDH 1I3RB 4OF6A 1H3XA 3DYOA 1JPSL 4ZUVB 2XNAA 4FXGB 3RDTA 3L3OB 4Z7VA 4PJDA 3G6JF 3C87A 3F5WA 5DT1H 3EOTL 4KK9C 1XIWA 2C26A 3HKFA 3BIKA 1MF2H 5E5MA 1KPRA 3BHBA 2UZIH 3QIWB 2ADJA 4UT7L 2I07A 5J3HD 2EIBA 1BFOA 4A2LA 5BV7H 3EYSL 1CTOA 2WUBH 3FFCD 5IMKB 1T80A 1BVKB 1R3LA 4H26B 5AD0A 5BQ7B 1BBJB 5EO1A 3TO4B 2GSIA 3OR7A 1TCRB 3LB6D 2Y23A 1DVFC 4QHMB 1QBML 2F54E 2WBJD 4LLQB 4XCFL 1WAAF 1D9KC 2VLMD 2QV2A 2CIIA 3DETD 3LKSB 3QIBA 4DVRH 3LQAC 2BZDA 4OLEA 4LARH 4LBEA 4G43A 4BZ2L 5JHDE 1GH7A 1Z9SA 4ONFL 5JDJA 1G84A 4L8SA 3O3BB 2B8OT 4NQEB 1C08B 3SGEH 1H5BC 5AUMA 3SPVA 4WW1B 1SYSA 4JM4L 1LO3L 2JJTC 2AJSH 2XT1B 4LLVA 2KUTA 3B6SB 2NTFB 4JFFD 1A47A 5E8OA 4NPYA 1JHKL 4PRHB 5IVXF 5T1LB 3DVFA 4HFUL 1I8LA 1JZ4A 4PTTA 2HWZL 3RJDA 2ERJB 4FFYL 3DIFA 2JJSC 5IHZB 3FO2A 2D7OA 3QULA 4WO4B 3LD8C 1U2HA 2XQYK 3H7BB 4MDJA 2X4QB 5I1IL 1KELL 5CZXD 4K7PX 3GJFK 1AGBA 3KPMA 1AR1D 3WUWB 1QQDA 3ZKMC 5BZWB 2EECA 5KSBB 1QHOA 1YNTA 1YYMH 4YFEA 1S7RB 2NMSA 3C5SA 4KQ4L 3WUZA 1KCVH 2IFFL 2M8XA 1BGXH 3SE4C 3N1FC 1WITA 5EBWA 3EJYC 3IXTA 5C0CE 1ZKAA 4Z77B 5JHDA 1L4IA 4M7KL 4W6XB 5JPNB 3CDGB 1BZQK 4WHCA 4Z5RB 4HUWB 4PJGB 4PRIE 1G6VK 1T6VN 2ZP0T 4HJ0C 3TVMB 2BVPA 2VDLL 2OQJA 1HILA 3SGJA 3FT2A 5DMGD 5CD5D 1SJEA 3BE1H 3D0LB 3AY4C 5DK3A 3WJLA 4X8JB 1RULL 3T09A 3V5HB 3TA3B 1J9CT 1II4E 4MJIB 3RBGA 4MB5A 1C5DA 3UTQB 2DQUH 3P73B 2DICA 4XVUD 7FABL 3TZVA 1QLEL 2ZNXA 5IOPB 4LHUD 3DSNA 2FB4H 1FIGH 3MC0A 1NUGA 4JFQB 2F8XC 3BI9X 1VPOL 3NCBB 1PDKA 4NHUB 1NFDB 3K8MA 4OCSL 4U1MB 3C9NA 5GSVB 2EDXA 3FJTA 2ICEA 4P4KA 4KI5C 1OP3K 5C0CA 3E6HB 1X5HA 3OKYA 1JBJA 5HGDB 5D6DC 1YJDH 2FJHA 2YRLA 4KI5F 4PRIA 1DUZB 3NCYP 3FFCB 4PBXA 3LVEA 4Y5XC 3GI9H 3NCJL 4IMKC 3S36H 1KT2A 1J1PL 4P49A 4OSUL 1NLBL 2P24A 2WBJB 3O3EA 1TTGA 3BD5A 4LLDA 4HWZB 1U8KA 2Z91A 4U1SA 2VITB 1A6WL 5EG6C 2BXYA 4R90L 4AY0A 1XAUA 4I3GA 4Y2OA 1WWBX 2RJMA 2H2SD 4YNYB 2GAZB 4Z7UB 2A38A 3DHMA 5A3ID 3F7VB 4JFFB 4I9WE 4N0FA 5JXAH 4PLOB 3PDOB 1JTPA 4IDLA 4NJ9H 4M9OA 3DVNA 3FONA 5GS0C 3HS0A 2EXYC 1GHFH 2NW2A 3L3IA 5A2IH 4QT5B 1VGKB 2X4NB 3DARA 4I2XB 4Y4HC 3ARZA 2MJWA 3MOAH 2AK4E 3WD5H 1FVEB 1OLZA 2FHCA 4ZQKA 1YY8A 3EYFB 4JREC 4WIQA 3BPCB 3FB7A 1NC2A 3OKMA 3GJEB 2XZZA 1CLYH 3X13A 4WUUD 4ZUUA 1JZ8A 1QSFE 1UB6B 3FO9A 4RRPA 4YWGL 3H3KA 5DGRA 5HY9A 4X6CB 4AENB 2FECI 1OTUD 1A5FH 2YA2A 4O51B 1U8NB 3ZTNH 3HZYA 4G8EB 2EDTA 2JJVA 5GGSA 4ODBD 1BECA 3IJSB 3ZE0F 4XNMA 4M03A 1KCRH 3MR9A 3PWJB 4U1JB 1U42A 3BXNA 3EO1A 3W5MA 4UOW0 2XG5A 5HDQH 3REVA 5ITFB 1D3CA 4JPIA 3X3GH 2X44D 4LHUB 5BXFA 5E08L 1S9WB 4G5ZH 3E8UH 1X44A 5C71A 3GMNB 1EDQA 2X70A 3VXQA 3TO2B 1P84K 4IOSD 2E7LC 1KYOK 1BWWA 1QPXA 4FFZH 4XTRD 3IT8D 1D5BB 1CK0L 4Z8FL 3CPLB 3T3PF 4K8RC 1QSFA 4MAUL 1NGQH 3EJZC 4XPTL 1OSZB 5DRWA 3DNKA 3RWEB 1N3NA 5C6WH 2F8OA 1F4XH 2YMXH 3IFLL 4QRUA 2ZPKH 2N4IA 4JKMA 4HLZH 5ITBH 3WNPA 1T2QH 3RNQA 2R8SL 2D0HA 3OPZL 3MLUH 4POUB 4ZUSB 2F74A 5IVNA 5B39B 1TNNA 5D93B 1P9MC 3MOBL 2AABL 4CJ0A 2WINA 4IOIA 3PV7A 3SDCA 4NQTA 4AIXA 3Q6FA 1RFDH 3QCTH 4M4RA 1LD9B 2IF7A 4O9HH 2OR8A 5GRZA 3HLAA 3IFNL 3WN5C 2W07A 1A7RH 3OQ3B 4L3AA 1X7QB 3LEYH 4JJ5B 1U91A 4LKCA 4OFPA 3A6CH 3OMZA 3O41B 4NRZA 2AP2A 2RIKA 5K59F 1KTKE 1GGCH 3LIZH 3FB8B 1WBXB 5K9JH 3NIGE 3SE3A 1JZ7A 1KC5L 1HHJB 4XAKE 3ES6B 3LEXB 1X5FA 3GRWL 4JAMA 1PYWB 1UWXH 4UB0L 4WI8A 4G80B 1Q72L 1OB1A 2NW3B 2A6DB 3T0DA 2BNRD 3X12A 3B9KA 1NANH 1YN6A 3U9UA 1MREH 3SE9H 3VXME 1Y6NR 1PEWA 4NN7B 1U3YA 4WUUB 1BFSA 3O11A 3BPOC 3UZEA 3KPOB 5F7UA 3V79C 1NEUA 1EUTA 3I2CH 3QEHB 4HGWB 4S1QL 1ZVHA 5E2VH 5T33L 1M71A 1DQML 4XHQA 2GSGA 2I5YH 3QDJD 4KDTA 5E00A 3M17A 2BSTB 5F96L 5JUEL 5IFHH 1NCDH 3HB3D 1NAMB 4MX7A 1MCDA 4NKDB 3GSNH 2UVEA 2PXYC 1NDGA 2W0KA 2IG2H 3IS1X 4U6YB 4HWNA 3QZWB 4AEIH 2RFXA 4JO3L 2GUOB 2FIRT 5FF6A 3BZ4B 3RDTC 4HLJA 3T65B 4AM0A 5F72S 3CFDA 2V2XB 5IB4B 1T0NB 2I24N 3VG0H 1XIWC 4GKSA 3VXMA 1JUFA 1FL3A 4HX1B 3SDXE 4Z7VF 1I1YB 3I9GL 4PJDF 5TQ2H 3MV7E 4HIIA 3PP3K 4O58H 4GKZA 4JHBA 1CIUA 4JY5H 3T3ME 2X4TB 4XH2B 1E4XL 3A6OA 3B4NA 4CGTA 5JQHC 1REIA 3RHWF 4B5EA 4F58H 4U2ZA 1BHGA 4OLWH 2JK5A 3WKML 1I8IB 1U8PB 5FV2A 2UZXB 1R3HB 4FQIL 4R9HA 5D9SA 2HKHL 1WEJH 2ZZUT 4YDVB 2Q8BH 2DM2A 2HAZA 1KB5L 3BDYL 2APBA 3BVNA 4ODHL 2W9DL 3JVGA 5F3BB 2VLRD 2IH3B 5BO1L 3MGOB 1R5VB 1UWGH 3KPNB 3BSZH 2RR3A 4KHXH 1MI5D 3QIBC 4YXKL 5BV7C 2ED8A 4Y16A 3REWA 1FRGL 2J6EL 5KVDL 4ZPVA 3QEUA 5J13B 5JIIA 3ZYZA 5ILTH 5IF0A 4QTIH 5HJ3B 1BD2E 2CDFA 3MRQB 4LGSB 4L8SC 5H2BA 3W11D 3WIIH 4L1DA 2H45A 3U82B 3BQUD 1B2WH 3RIFF 1J1OH 4R97B 4F15B 2ZUQC 1CE6A 4X7TB 3UP1A 4I3SH 4LLUB 3I02B 3U30B 2VQ1B 1EVUA 1XF4A 3KYKH 3SDXA 5KN5A 1I8LC 3U36A 3MV7A 2DWDB 5C0DB 3SE8H 3J7HA 4PP2B 4Z78A 1IM3B 1B3JA 2R4RL 3GSXA 4JHWL 4OFYA 4ONHA 1D5MB 4P2OA 1TJHH 3ZDYE 2FR4A 2BSRA 2G75B 4DQOH 3CSPA 3UTSD 2NY4C 3TJHD 1S7XB 2V2WA 3KJ6H 4NWUL 4P2YA 2AGJL 4WHTB 1MOEA 4XNUL 4K3JH 1S7QA 4YO0A 2Y5TA 1EO7A 5SWZD 1TCMA 4GQ9L 2BNRB 1GVIA 1FVCB 1BF2A 2P7TB 4WI9A 5TFSL 4R8WH 1N7MH 2FX7L 3VFGL 4EDWH 5L2KE 3W9EA 3NA9H 2Q3AA 1BD2A 2ITDB 3U0TB 1QEWB 4YGAB 3N06B 3RVUC 1NBZB 1J87A 1RUKL 4D0CB 1T7YA 3MRLB 2HMIC 1FORL 3SGJC 5IBLC 1JHLL 5JLZA 3F6LA 5AYQA 3OJDA 1OGTA 3WJLC 1ZLVH 5ID1A 3QDJB 2W9EH 1KJVB 1LEKA 4XC1H 3OR6A 4GAJL 3ALPA 5J11C 4ETQA 1R3JA 2YKLL 4XNXL 3TZVC 3HNVH 1LNUB 1AIFB 3KYOB 3VFNB 1ADQH 4TN9A 5TH2B 1MCPL 3QFJE 1FO0H 1DBJL 4M62H 1FL6B 1KG0A 1S7SA 2Q6WA 3R0NA 2CIKB 4YAQB 2HJFA 5JOFA 1FPTL 3TYFB 2ZUVA 4YHZL 4U1NA 3OKDA 4QWWC 3CFEB 3UTTD 5CJOH 4P4KC 2XWTA 5L2KA 1NDMA 1S5HB 1I3UA 4Y7MA 1NEZG 4TULL 5ANMB 1S9VA 4Z76A 5FA3B 5GGTH 2V17L 1HN1A 2DLFL 4K2UL 5EPMB 3GMOB 5SWSA 4GW1B 3MNWA 3RWJB 4L4VE 2OX5A 4GRWH 1ADQA 3G5YA 1FVDA 4NO5A 1FO0A 5MI0C 1U8JB 3MX0A 2R0KL 5IVZA 3EYUL 1MWAH 2VDRH 3BMVA 4U3HA 3F7QA 2R29H 2VLRB 3WKNA 1DBMH 1MNUH 5GGTA 2X7LB 1D6VL 2QHRL 3NPZB 2WP3T 3T0EE 1YJDC 2DTML 4Q7DA 1E4XI 4UTAH 2ITCB 2HVJB 3RWHB 1KIUA 1I7TA 5L0QC 32C2A 3BP4A 4NKOB 3QFJA 2D7TH 5MEND 5DJ2B 3BQUB 4FTVA 4JRXE 25C8L 5CZKA 3SDAD 4ONGL 1MWAA 4I3RL 5AAMA 1LDSA 4LOUC 4PGZA 2HRLA 3R1GL 4FQ1H 3VDBA 2Y5EA 2VDQH 4U1IB 2BP3A 4QXWA 2VXSL 1A7QL 4NSKA 1EXUA 4L4VA 3KHQA 3KPLA 3NPSC 3UTSB 5DJ0B 1RJYB 1H15B 1MCEA 1QKZH 5E95B 5CD3B 4TSCH 2O61B 1FSKB 2PCPA 4G3YL 3B8YA 1RUMH 1NMBL 4PJBE 4KTEH 5SWZB 1FBIL 3BO8A 4PG2A 1ZEAH 3T0EA 5FECA 5MP6H 4JFXB 4PRAB 5C3LD 3V0VA 5FGBA 5HTSA 1MJ7H 4X7SH 3C60A 4JRXA 4APQD 5TE7L 5F6HJ 2BK8A 5J12B 2QQKH 3U4AA 2H3NA 5HI3C 2P42B 3MRBB 3L9RB 3TBTA 5IMMA 3GNML 2XWJB 5DS8A 2HFGH 5HSFA 2C4FU 5FUOH 4Z7WB 2FSEB 2BRQA 5E94B 5E2JA 1AJ7H 4CVZA 1FL5B 5GS0L 2QADD 3VFUB 1XCQA 1U8QB 1L6XA 1PSKL 3MA7A 5MEPB 4HBCL 3HCVA 1PY4A 3BIBX 4KC3B 1SEBB 4OTXL 3O6LL 3KYNA 1C8PA 4N0YH 4XP9H 3IAGC 5LCVL 4PJBA 4LHQB 1AXSA 5J6GB 1NGWB 1HCVA 3MLTB 1IBGH 5GZND 5D70H 1CG9A 5F9JB 4KRMB 1JK8A 3NOIA 2WP3O 3UTTB 3QCVL 3W0WD 1W0VA 3NCMA 5JW3H 1HYRC 3VGAB 2ZCHH 5C0BD 3DRQB 4FFVC 5GJSL 2D0GA 3VXRD 1F42A 3RL1B 2WSKA 3NACL 1K4DB 2P8PA 2CDGB 4L29B 3E2HC 5FFLA 3X14B 3FO0L 1I1RA 3DRTB 1PG7X 2HLFD 3S35X 1UA6L 4RDQF 4IMLB 1XF3B 1T3FB 1NL0H 4TVPL 1UXWB 4YHLL 4MA7H 5IQ7L 4PYHA 5E2WL 5DJZB 5JIKA 1X5IA 5CGTA 2OTWB 5KAQF 2I9TA 1FJ1A 5C8JA 3VWKD 1HHGA 4NKMB 1ZMYA 3HHRB 3TBSB 4LCWE 4ODWA 3SDCC 2I60H 5F6HI 1OAKH 5CEXB 4DKEL 4KUZH 1CTNA 4GRLA 5MENB 3MJ7B 4JLRB 1KTDA 2DIBA 4JDZB 4ZO9A 3SDAB 4QRRA 1T4KA 4ZFOA 3H0TB 3I6KA 3O3AB 4WDIB 4JG1H 2YEZA 4JKPH 4UDTB 4XC3L 1JJUA 3RIAK 5DHYA 3RL2A 4YE4L 5AYUL 2Z8RA 4M7LT 5I16B 2JLLA 1CN4A 3SE3C 4ZTOH 3GMMB 4LCCB 4R96B 15C8L 4BUGA 3Q5TA 5JZ7D 4XCCL 4HS6B 2R1WB 3PQYE 1U95A 2HJLA 1EJ6A 1IGCL 4JR9L 2W65A 3FAXA 3RWCB 3LCYA 3O0RH 3B9KC 4ODVL 4L9LA 1HQRB 3BH9A 4QEGA 3VFVB 4R2GD 1A2YA 5I1CL 4XRCA 3F65A 4G7YL 4ODXA 3KYAA 2D3VA 2WWMC 4PUBL 1VHPA 3QJFB 1A7NL 4F7CA 1M05A 3O4LA 5I19H 4LCWA 3MRNB 4M6AA 5I30H 2HFEB 3SOBL 1ZT4A 1H8SA 1AP2B 3QDME 4ZUTB 3NVQA 4APQB 2DQDL 2OMBA 6FABH 1RZKL 3PABB 1INDH 3SDDA 4TSAL 4KDTC 4HUVA 2OJEA 2P8LB 4U1GB 2VZVA 1KEML 3LQMA 3KXFE 3UTZA 3NFPA 3S4SB 1AXTL 4J1UA 4S1DD 2QADB 5L7XH 4CN6A 1B4JL 1C16B 2J8UB 4JY4B 2VDPH 3GSUB 1C7TA 4XMLH 3F7YA 3TP4A 3NIGF 1EGJH 1GL4B 3PQYA 4RA0C 2GEEA 1OAQL 1GGBL 4WFGD 2Y07L 1MHPL 2AEIT 2X42A 4S1RL 5HVGB 2ARJB 1JGDA 4MQXC 5DD3L 4X98A 4GAYB 3QHFL 4JO4L 3QIUA 1K5NA 1F6AA 5ID0B 3HZMB 3LPFA 3W0WB 1N6VA 2HT2C 1P6AB 2VH5L 5MHSD 5E6IA 5C0BB 4KAQL 1EGJA 3C2AL 3VXRB 5I6XC 3P30L 1JCKA 3QDMA 1QFWI 1QOKA 5I8OH 5J6HA 5I15L 5F1NA 4QXTA 1VFUA 1TZHB 4OD3L 3G5XB 2DI7A 2OK0L 2Q8AL 1FZMB 5DUPH 3JVGC 3KXFA 4RNRB 1MFCH 5FB8B 5ESVB 4J3VA 3DTXB 4YDLC 5CWSB 1AQDA 12E8L 4NO0A 4WCYH 4KJPD 4Y16C 5JTWA 2XTLA 3QEGH 3ROLA 1R3IH 4QOKE 4Z95L 1X6NA 4R7DB 1HI6A 1ZA6B 3VWKB 3VFRA 4K3GA 1R5WA 5IK3A 3TWCL 2A73A 1ORSB 1P2CA 3M1BA 4HUKB 3S37L 1BVLA 1HSBA 3UYRH 1MRDH 3ULVL 1T22B 2I27N 3FQXB 3U9PH 3DPBA 1JIBA 2GY5A 3PWUB 1XGTB 4U1HB 1JWUA 3KPQB 4QYOB 3GM0A 3L7FA 4P2OC 4KQ3L 4EUPB 4AQ1B 4CDHA 5F9OL 4OFIA 3T0XA 3T3MF 3L3JB 4OZFG 3QDGE 3TBVB 4E41D 4KRNA 5E7FA 4C57C 5DT1L 3W9DA 5L8KB 1T83A 2XWBB 5MEOB 2AJ3A 3TIEA 4U6VL 4G6MH 1OM3L 1Q38A 1V7NH 5ENWB 2IALB 1AGCA 4OUUB 2LTQB 4PG9B 4R2GB 4JGJA 2GW5A 1LO5B 2WUBL 3UZVB 3H9SE 1HQ4B 4Q6IA 4QOKA 5EBLB 2QR0B 4RGND 3DX9B 4FMKA 3P40A 1NCCL 1WGOA 1ES0B 2CQVA 3VFTB 1Y18B 4XPHL 1K6QH 1J8HE 4BKLB 4KJQC 4J3UA 5F8QC 3QWQB 3BW9B 1QLFB 3HMWL 3V0WL 4F57H 5FYJL 3D18B 4DN4H 3PP4H 3L5XL 5HGHB 3QDGA 5LWYL 4NNYB 3ARBA 2MTPA 3GGWB 4X6DB 3X11A 1I1FA 4OCYL 1CQKA 4YXHH 4H1LG 1KGCD 1MFDL 4PJ5E 1YN7A 1LK2A 2FJGA 3P11H 3O3UN 1DJSA 2MFNA 4URTB 2HKFH 4JG0L 2VL4A 4QHUB 1EO8L 5JNYA 5GRYA 5I8EB 1AKJA 3H9SA 2MQ3A 1QTYT 1NC4D 2DQJL 4F2MB 4PJEB 1A1OA 1CU4L 3TIDA 2XY2A 3EYOA 3UPRB 3L3HA 4FG6D 1FAKT 3RNKB 5KVGH 2A9MH 4WHYG 1W0WB 1G1CA 2X41A 5FKAA 3MLSL 4HPYH 1EEUA 3DSFL 5HGGS 1LK3H 3V0AC 1T6WA 5E7BA 1J8HA 3CH8A 3V8OA 4U6HA 1GGTA 3O8XD 1CQYA 2BVUA 2Q7YA 3PHSA 2G60H 5LJYH 1A64A 2DQCL 2CKBB 3BPLB 5CBEB 2I26N 5I1DB 1U6AH 3U7YL 4CVUA 1FC2D 2A0LD 4X6FB 2OZ4H 5EUOE 5LXGH 4M6ML 4FMFA 4PJ5A 3VGDA 1YDPB 4GRWF 4NBZB 4R26H 2JIXA 1YYLH 5DJ8B 1OD7A 2HN7A 5KSAA 3HAEB 5DUML 2DQUL 5I1JH 4OFDA 4GKNB 4QCIA 4YDJB 4DW2H 4ZOCA 2FB4L 1K2DB 1S9YB 1NJ9B 2X4PA 1XGQA 1OT1A 4IJ3C 1CYGA 2OZ4A 1DN0A 3IDYB 3Q0HA 5GGUB 2YPKA 1RI8A 2Q76B 4RGOH 1MHCA 1T1WA 4YQXH 2FEDD 4E41B 3MRPA 5JW4M 4YDIL 1KJMB 3D85D 3IVKA 2BVEA 1MIEL 4F7PA 1WCQA 5CJXA 4DZ8A 3MV11 3FRUA 1U0QA 5HYIA 1YJDL 1JGEB 4PG2C 1YNLH 2DB8A 4S11A 3T0EC 5IB3A 3OWEA 5GS2H 5DJ6A 4PBVC 3QAZC 3GO1H 2EO1A 3KR3L 4PJXE 5EUOA 5FGBC 5SV4A 4RGNB 4FQQB 3C60C 3S34H 3MQIA 1ZLSL 1EAPB 3S36L 5DHVB 5ERWB 4XCNA 5FCSH 4XPFH 4PREA 2V5RA 1V3MA 1EMTL 1P69B 4N0UE 5F1IA 1F02I 4LFHD 5C7XH 4N9GB 1UJ3A 1T1XA 4O4YH 1HH6B 2KKQA 2G2RB 3IU4H 5JOPE 5KW9L 4FNLL 4C54A 1T7WA 1U8MB 1U93B 4WWKA 2COQA 2NYYD 1AC6A 4U6TA 1SY6H 3KNBA 3ULSA 4F7EA 3MJ9L 4LLWB 3HI1A 3BOVA 5FUCE 1QFOA 3FN0H 4OQTH 4TTDC 5E8PB 4GXUM 4U0RC 4NJ9L 4D9LL 4PJBF 4YJZL 2OTUB 1JHTA 2VLLA 1XR8A 4CUCA 4K94L 1U58A 2ZJSL 3CSGA 2GTZB 4PJXA 4EJ1C 3OZ9L 1NC4B 3SGEI 5C09D 1SY6A 3DV4A 5D6CB 4IOFC 1NCAH 3PWPD 1HIML 5T5NG 4NM8H 4AH2B 2W59A 4OQTA 4N0UA 1VSCA 4MVBC 3A67H 1WFOA 4WU5B 2P5EE 3UJTH 4HG4J 4AIZB 3O8XB 2Q87A 2I9LA 4JQXA 1CFVL 3ULUE 4LU5H 3HI5H 3G08A 2PR4L 4I1NB 2FJFB 3ROOB 4MQ7A 5I2IA 4LRNH 2E6PA 1JPGA 5BOZG 2X9WA 4OLVL 4GRLC 4IIQA 1A4KA 2R1XA 5CGYC 5DQ9B 1UFUA 4FN0A 4KKBC 2FD6L 2FGWL 3M07A 5AEAA 3AAZA 3IDIB 2K3TA 1IQWH 2ADGA 1MFEH 3ULUH 2PW1A 2O26U 4P5TD 1A6TA 3GMLB 2Q86A 3I3EA 2VLJD 4DGVL 1ORQB 4FFZL 5D7IB 3HC0A 4QNPE 3V5DB 3MNZB 3C8HA 3OL2A 4XBGB 3D85B 2P5EA 4L9LC 5GRXG 2L7UA 1NUDA 3GJFB 2D03L 1IQDA 2P5WE 4N90D 2IQ9L 4UDUA 5HD8C 4XAWL 3WFDH 3B83A 3T4AB 3PIQA 1B0GA 3ILPB 3WV0A 1L0XA 2NXZC 1B90A 1C5CH 1JI1A 5JDSB 1HSAA 2BNQE 2G5BB 2CLVA 1MCWM 2X89A 3Q1SH 3CFIC 3SDDC 2JCCE 4LSDA 5F89A 3MLUL 4Y4FD 3QUMH 5C0EA 1CR9L 4Y5VB 3EDFA 4CKVX 1JN6A 3PWVB 4MJ6A 5I1HH 1FFOB 4XCYB 3MNVA 2D7MA 1LDPL 3JZ7A 1BZ7A 2GKIA 4JQIH 1WWWX 1F8TH 1CXEA 1NGYA 1RFDL 2HFFA 3C5ZD 4PJ9A 2GTWA 1RD6A 5JW4N 2ZSVB 4OB5H 1T89A 3EOAB 3TN0A 3QBTB 4H88H 3ESUF 1IAOA 4MAYA 1A7RL 4ZD3H 2C9AA 1ONQA 4PP1C 5F9WB 3FFDB 3QUMA 1AY1H 3JTSB 4Y4KD 1XCTB 3TYGL 1DE4A 1GGCL 2P5WA 1O5DT 1UKQA 1J10A 1U8OA 3QIUC 3VD9A 2VZSA 2EDWA 2D2OA 3OHXB 4MNHA 1S9XB 4IS6A 1KCUH 3IDMA 4NCC1 4PRNB 1B88A 2R56L 5EOTA 5E6IC 3FOMA 1Q9KB 4X5XB 2BNQA 5IB5A 5C09B 3D2UD 4B53A 3PWPB 3KPSB 1WTLA 2JCCA 2VISB 4Y0GA 5FA4B 1R3KA 4N1HB 3RTQA 3BKMH 1YEHH 5F7KC 1VB9A 4ZDHB 1OAZH 3NZ8A 4X6EB 4M61B 1FFPB 5JPMB 1S5IH 2XZQL 5ALBH 1RIUH 4J6RH 1GRWA 5LG1A 1NSNL 1I9IL 4UTBL 1MQKH 3LS5H 3TNMB 3UPAA 3SKOB 5DK0A 3TO4A 3BGMB 1TCRA 5FCUH 1JV5B 1NCDL 3BAEH 3PL6A 2A83B 3EOYG 3GSNL 3IJYA 4KVNL 2YSSB 4D9RD 4OJFL 1ZLUK 2Y9RT 4H5SA 4KY1H 1LQSR 4PTUB 2FZ3A 4JM2D 3OKKB 2P46B 5T1KA 5IBUB 1ZHNA 3BISA 1JPFA 3ZO0A 1BAFH 5ESAA 2C7UB 3IRZA 2EC8A 2VLJB 2VXUL 3QCUH 4MA8L 1T83C 5TQ2L 4YIQB 2PYEE 3VGGA 3O3DA 2NY1D 4C56E 4Z0XA 4JY5L 1KIQA 1NGZB 4M43H 5F3HA 3ZKNC 1U3HD 5IW1B 1NGPH 5IQ9A 4ZOEA 3RVWC 1ZA3B 3LN5A 1A3RH 4F58L 1FCGA 4FXKB 4Q6IC 2NLJA 2OL3L 1MVUA 1EH9A 4I8DA 3QFDB 1FN4B 4K71B 3MLWH 3P0GB 5DRNA 3WUWA 1UM5H 2Q8BL 4LRIA 5DUBA 4BH7B 2E9WA 4Y5YA 1S78D 4RFOH 4DJMA 4KHXL 3U48A 4P59L 1MY5A 4Y4FB 5JO5A 3DBXA 5GRJL 2Z8SA 5IMOA 4GBXA 5E8DL 3MJ6A 4UINL 4XP5L 2BMKB 3RWGB 1F11A 1OAYH 3L7EA 1H9VA 3ARBC 4JY6B 3V95A 4I3SL 3MRCA 1AO7E 3C5ZB 5LBSH 2QEJA 1CLZH 3QUZD 1MCCA 5DMIH 2PYEA 1QRND 1DEDA 3D0LA 1XF2A 3UYPA 4C56A 3SE8L 3BUYA 1LE5B 5BVJA 1G1YA 1IFHH 4Y4KB 1IAIH 1AHWB 3UAJD 3QRGL 4JANB 4LSTH 2ATPA 2WV3A 2C3VB 3HZKB 4PJ7E 5I75B 5ADOH 4DCQA 4NHCH 4X5WB 4U33A 4EBQH 3D2UB 3WL9A 1MAJA 4WEUD 1Q9LA 1JWMB 1SMAA 1GAFL 4R8WL 1N7ML 1N2RB 5DI8B 1LO2H 4Z0BH 1R5IB 3UXFA 3JV5A 2ICWA 5I8CA 1KEGL 3SY0A 2SEBA 4ZODA 1H3UA 2OI9C 3T1FA 1DBAH 3IDJB 1AO7A 1T66D 4NQDD 4L8BB 1DLFH 1T5XB 5KOMC 5HGBB 2IPKB 4JZOA 5TDPB 3QI9A 4K3DL 3SJVD 3FHAA 3V6ZB 4L5FL 1G9EA 4RQQB 1Y6KR 5KSAC 3HR6A 3BN3B 3LRSA 4GQPH 1VESA 4H20H 3EOBB 4LSUH 4CL7A 5J7CC 1HOCA 1OP3H 1Q1JL 2F5BL 4PJ7A 5DTFA 2WLYA 4JM2B 5IKCA 2KPNA 1WC7B 1Q94A 3NIFE 3EFFA 4DAGL 4HWBL 3QO0A 1YEJH 2VE6B 5KS9B 4PRBA 2PW2A 4L3CB 4KKAD 5CJXC 2MQ0A 5D1QD 5E2UH 5CINL 4CNIB 2A2QT 3FL7A 2NY1B 4HIXL 1BJMA 1RHFA 3PWLB 5C0JB 1I7UA 5DD6A 5I74C 5A2FA 2FATL 3W39A 1IC1A 5FO9B 2VAJA 2EDDA 2VDRL 1CDBA 3BUTA 3GEWB 2VR4A 1FVEA 3MGTB 2A1WH 3PXHA 4MHHG 2VXQL 3RWDA 3LSOB 1VFBB 2WBKA 1LHZA 3GBMH 1UJ3C 3HRZB 3WFEH 1AI1H 2YC1B 2AJYH 4D9QE 1U9KA 2OSLA 4ODSH 4NCDA 4KUCD 4OF8A 4WWKC 1FZJA 1NQBA 4D2NA 4LNRB 3X3FH 4LKXB 5E99L 4G42B 2YD6A 4TPRH 3L3GB 3MRJB 5K9QG 3QUZB 1QRNB 2VDQL 1VFAA 3WFCL 2OP4L 5T1MB 4YFLF 3JWNC 4JN1L 2FEEI 2YD5A 1KFAH 1YY9D 5DJDA 3RU8L 4QF1B 4LPWA 1UM6L 2XICA 4ZAKA 1DP0A 1QR1A 1KXQE 1NFIB 5FOBB 2VYRE 1CBVH 1QKZL 4TSCL 3S35H 3DX8B 1RUML 2XKUA 1L7IH 3INUL 5IROA 3GMNA 4NFBA 4KTEL 1YECH 5BJTA 1JF5A 1FZOA 2Z93B 4XBEH 3TO2A 1HHKA 5JORA 4MB4A 4HG4K 5EBMB 3AS1A 3IKKA 4OCXH 5C0RH 1UKTA 3QWOA 4JQXC 3LMJH 5K9KB 1M4KA 4NKQB 4PFEA 3N9GL 4J8RA 3N85L 3ZE1F 3QJHA 5D5MB 3O6FA 5C0FB 4YDKH 2ZWLT 4NQDB 5HHOD 1F58H 4V2BA 5IIEB 35C8H 4IIQC 2HFGL 1GSMA 4RRPG 1E28B 4GG6B 3SJVB 1AJ7L 2V7NA 5DVMA 4YFDB 3CGTA 1K8IB 3T77B 3MTRA 3U4EB 2V5YA 5BCAA 3QWRD 4WUUE 2DIAA 3VRJB 5JQ6L 1L0QA 3U4BH 3RAJL 1N4XL 3FQNA 2FBJL 4XP9L 2V5SA 1AGDA 3FN9A 4EI6A 2BOBB 1P5UA 2QTEA 3VRLE 4WGWB 4D3CL 1KLGB 5E9DD 2WIIA 4M4PA 1X7QA 4OIIL 3I75B 1KIPA 1QA9B 4C4KT 5D1QB 3O41A 1JGVH 3G6DL 4U2YA 3DI3B 3B9AA 4KDWA 3ULUC 5J56B 5H94B 3S9DB 3DLQR 5ALCL 2CLZB 2BSED 1EV2E 3I3DA 2A6JA 3ULUF 4NUGH 3UZQA 2QBWA 3VGHA 5T3ZL 2X2YA 5CEZD 1X5GA 3CFBB 2A6DA 3RGVA 1NL0L 1TQBB 3PNWB 5F1OB 3NCYS 4ZYKB 1HXMB 1SM3L 4MA7L 5IESH 1QSVA 4O2EB 3SKUD 3D48R 3MO1B 4RDQG 1DQLH 3GIVB 5CEYB 5D7JD 5IMLA 4X0KB 3LOWA 1CDIA 1F4YL 1X4XA 3AC0A 4GXVL 1YEKH 1SJHB 1EZVY 5KAQG 2AEQH 4KTDL 2AXJA 1M6OB 4NNXB 1BFVL 4PJ9C 4XGZB 1I8MA 3NFSH 1T89C 3CMGA 3TN0C 1I4FA 4MAYC 5HI5D 5CCKH 1D5XB 1CFSA 2R2EB 4JO2L 2BVQA 4JZNA 1E6OH 2BSTA 2HTKC 4B50A 4OLUH 2ZOLA 1GIGH 4HLZG 4NKDA 3BZDA 4ZTOL 3M8OH 5CHNB 2JB5L 1N0XL 3QPXL 1E27A 2E6QA 4JDTH 3FB6B 4M6NH 3I6GB 2BJMH 5DJYB 2PO6A 1WSST 4X4YA 4NJAL 5I17B 1CDCA 1KJ2L 1M7DA 2XIDA 2ZG3A 1KJ3H 1NBVL 1RJLA 4P0DA 2YR3A 3MUGA 1ZK9A 3RTQC 2JCCF 3L3KB 4S0TD 5I1EH 3QPQD 5FYLL 1MEXL 4F7MB 5DD0H 4N9OB 5TQ0H 5IGXL 3T8XA 2X4TA 3VI3E 3KLHD 1UZ6E 3WFBL 2JJUA 4A6YL 5E5RB 4QKXB 2A77H 4QO1A 3TO4C 2EH7L 4RMVA 5HHOB 4YDVA 3QISA 3WE6B 1TJGL 3CMOL 3PL6C 1F4WH 2GQHA 4C4KO 1JFQH 3VFWB 1NEZB 3MGOA 4HKJB 4JN2B 5L7XL 1FNGB 2XY1A 3GFUA 1OCWL 4Q58C 4CADA 3MRDA 3NN8B 1EGJL 1TVBA 3PP3H 4E9LA 5DMKB 3MUY1 1ZT7B 4GRMB 4MQTB 1CLCA 2VKWA 2GJZB 2IANB 2EYSA 2OR7A 5FYKL 5F7HA 2MHAB 3W81A 3C6LD 4QHLA 2X1QA 4G6AC 3B2VL 1Z5LB 3GSRB 1R6VA 3CSYB 2NR6D 5E9DB 4EI5D 2RQ8A 1BQSA 3F7RA 1W72H 5DSCB 2G9HA 2XN9E 1RURL 3BZEB 1WIOA 4XWOC 3EO9L 2VXTL 1QO3B 1S7XA 3R06B 1BEYH 5DZNA 2EDBA 3HC4L 3T08A 2GCYB 1XGYL 2NZ9C 4LRIC 4RZCA 5DD5H 4Y5YC 4WFEE 4CVXA 1G7JA 4RMTA 2HT4D 4DEPB 4IRZH 5SX4I 1CICA 1W72A 2BNUB 1OQXA 1A02N 4GBXC 4P2QE 2DQGH 4FFWC 3KDMB 3PF2A 1OTTC 2H1PH 5DC4B 5ANME 5D7JB 3U46A 2E27H 3F58H 1ZHBA 5I76B 4N0CC 3FZUC 4O02L 4GAGH 1JPSH 2EXWC 3TVMC 3GSOB 2IPUK 4OCWH 3EOTH 3U9PL 4ZXBA 3QYCA 3B5GA 4K7PL 2GK0B 3TESA 2AKRB 3RVVC 5INCB 5EU5B 4RFEA 1BPVA 4NC0B 4UT7H 4KH2A 2XN9A 1AD0A 2Y06L 3C5JA 1V05A 2NY5H 3EYSH 4U1LA 4NQXA 1MI5E 3PV6B 5D7IF 4LHUG 1CL7L 5IJVA 1AIFA 1RHHA 4X7EC 5CSBA 3D39E 5DC9B 3VG9C 1QBMH 4HJJL 1PFCA 1MHEB 3PGCA 4H0IA 4P2QA 4WUKL 43C9A 5CMAB 1F3JA 1CFNA 3ZTJH 5ANMA 3UTOA 5EU6D 3L5WB 3MLZH 4BZ2H 3GMOA 3BKYL 4ONFH 4GW1A 3B9DA 1TVHB 1ZXQA 3NIDE 2ZKHL 3QQ4B 5B38B 4W4OA 3QI9C 1K6QL 4PLKD 3VMPA 1LO3H 3ZHLA 1JHKH 2AI0L 3LB6C 4HFUH 5DR5L 3C8KB 3VD4A 2WBJC 2HWZH 1T0MA 4NN6B 4YK4B 4FFYH 5B39G 3S37X 5D7KD 1L0YA 4JPKL 2IH1B 3N1GC 1MI5A 1RZ8B 1BVZA 5I1IH 4AT6B 1KELH 3VFSA 4PJHE 4G8FB 4XPAH 3MCKA 4RGMB 3MCG1 1OARH 1X9QA 1JYNA 4UOJA 3IU3B 3D39A 2X4OB 1UXSB 4MDIB 4PJ7F 1AGFB 2VAAB 4LPXA 2EYRB 1EEYA 5B8CB 4NRXA 4NO2A 3EDDA 1S7UB 5ACMA 3C6LB 4LSQL 3GUTA 3WS6A 4TNWK 3FAWA 3IDXL 3KVQA 4OZGB 2C1PA 2ICES 4KQ4H 5GGVY 4JFED 2IFFH 4BK4A 3RWFB 3JV4B 1RIVL 4Q2ZB 3SHSA 1EFXD 4M7KH 3EYQC 3TBYB 2A9ML 1XF5B 3P77A 4PV8B 1S3KL 5DJCA 3JWDH 1H0DA 4PJCB 1H15A 2AXFA 4P57B 2AVGA 3QEQD 1RULH 3QH3B 1LP9E 3LKPA 1G0YR 5I66B 2DYPD 1FE8H 5FDYA 4XX1E 4PJHA 4ZUWA 3HUJF 5EZLB 3T2PA 7FABH 1QBLL 2R9HC 1EX0A 2BY3A 1BM3L 5DJAB 5IT2H 4OCSH 1VPOH 3OKEB 2R2CA 1YYLL 1HHHA 1DDHA 3ZHKA 4KJYB 4BQBA 1FFNA 4M5YL 4RFNB 1TVDA 5KZCD 4KK9D 2A6IA 1KENL 4NQCE 2ESVE 2FSEA 3VFPA 4X80H 4DTGL 1EEZB 4GW4A 4EVNA 2VXVH 5FK9B 3WDHA 3QA3B 1U8QA 2J4WL 4ZAKC 4BFEA 1KIRA 3DGGB 4NCC2 1MUJA 3IJHA 4LLYB 2OBGA 4F9PA 1FCCA 3K4AA 2WZPD 4HS3A 3QG7L 1J0YA 4R4FH 3K7UA 4DVBA 5CUSL 5IROC 1RZGB 5KBNC 3MYJA 3NCJH 1NBQA 3HFMH 5HVHB 1YEFL 1J1PH 1TZIA 1LP9A 3BEVB 1I7RA 1WISA 2Z35A 2RGSA 4OSUH 1NLBH 1DVFD 3IFPA 4DGIH 4XVJL 4HIEA 2GK2A 2ZG1A 2FBOJ 3GO1L 1YPZE 1A6WH 3PHQB 1JF6A 5EU6B 1D6EA 3O6FC 1CT8A 1WCBB 4UUJB 4XPFL 3DRTA 5C7XL 2R23A 1QLRA 2R0ZH 1A22B 4IMLA 4NQCA 2ESVA 1SVCP 1A21A 4FABL 1OAXH 3L6FB 4I48A 3ZKXC 1PJ9A 4PRPD 3R0MA 3IKCA 4L4TD 1TPXC 3TT3L 1NBYA 1VACA 1A6UL 4IM8A 4HIHB 1SY6L 3SKMA 3WLBA 2JB6B 3V7AE 4JEGB 3CNKA 5TDOB 2B5IC 2YPLA 3CDFA 3GMRA 1QRKA 2FO4A 5CP7B 4JLRA 1SQ2N 3RFZC 1XGUB 3ZKMD 4M8QB 4F33A 3BJ91 1ZVSA 2UZYB 4PJFB 3VD7A 5EFIA 4HXAH 1YPZA 4GMTL 4JFEB 3DMMA 1A6AA 1PKQB 3OGCA 5C6TH 3P4MB 4N8VA 2IBGA 1NCAL 2VLKE 1VKXB 3EJYD 1Y6MR 3KWWA 1EFXB 3WFZA 1PLGH 1KTLA 5E6YA 1ACYL 3L3DB 4WV1B 4PRDB 3LDBB 2R1YB 2ZNWA 4HS6A 1XGPB 4J12A 1ND0A 4IHOB 3UJTL 5L6YL 4OGXH 1RK0A 5K9OA 2R2BB 3QEQB 3GMPA 4HV8A 1MRFL 4G6FD 3QG6B 3MRFB 3V6FA 4X99A 2DYPB 4CVWA 4JDVA 1MLCA 1MVFA 2AEWA 1IL1A 3VMOA 4OZFB 5EU3B 3DV6A 3WNLA 3IETA 4X8XA 3QNXB 3RJQB 4P3DA 2HFEA 5CKGA 3WIHH 3CC5A 2CMRL 4JZJA 5E08H 4JVPA 4GW5A 1G7MA 3G6JB 1D7FA 3HR5B 1OTUC 4LSVL 1T04B 4MSWA 2DJUA 1TFHA 1CK0H 4Z8FH 5KZCB 4MAUH 4NFDA 4NC1E 4CMMB 2VLKA 2BHYA 5C0IA 4KI5D 3RUGE 1JRHL 5JXEA 1U92A 2DRUA 4XPTH 1Z0MA 5D96C 3RVXD 4YBQC 2E9JA 2PO6C 3OB0K 4NQVB 4PGCB 3U0PB 1ZGLM 1H3TA 3FTGB 5JW5B 1F3RB 4XHJD 2NX5D 3OJ2C 3S5LG 2C1OA 2R8SH 4PR5A 4ZSOB 5DFVC 1DVFB 1AGEA 1HDMB 4X5LA 3UBXA 3MOBH 1S7VA 2AABH 4OUOA 3FQUB 4TSBL 4MA1C 4WU7B 1OW0A 4OI9A 3NTCL 5KVEL 3VXOA 4G8IA 1D5ZA 5F70A 5KVMC 3WEXB 2ZUUA 1IEBB 4H0HB 4EXPX 4PD4J 3BP7B 5IVXB 2H8PA 2XTJD 3IFNH 3WFHA 5IFAL 3E0GA 2BC4B 4QY8B 5I1HL 4BZYA 1H5BB 4HULB 4RNRA 4CU6A 3MLXL 5CWSA 5MERB 4J3SA 3RUGA 5M95B 3EHBC 4HHAB 4L4TB 1KNOA 1IGTB 4OB5L 3QXTA 2W38A 1KC5H 3EIFA 5BRZD 3LD8B 2DQFB 5I1AA 1TQCC 3GRWH 2EXYD 4UB0H 1CFTB 1AY1L 1Q72H 4ZS6D 4M48L 1RIHH 2YZ1A 1FV1B 3LZFH 3NCCB 4Y4HD 5C0NC 1T22A 1KCUL 3QNYB 3ALXA 5HYFA 5JW4Q 4NGHL 1KB9K 4YGVA 4S1QH 1C7SA 3N0PB 4EXKA 5T33H 1GC1H 3GRWA 3VI3F 1DQMH 1T21B 3OXRA 3RI5K 5DYOA 5F96H 5JUEH 1CICC 2NNAA 2FX8L 1OT2A 4G6FB 2GFBB 1T7XA 5F7YC 1MFBH 2XPGB 5C86A 2WLZA 3IF1A 1DSFL 4JO3H 1P5VA 4PJEE 3MRIB 5FO8B 2BHUA 4HKZB 2J5LC 3ARWA 4YXLL 5I9QC 3MV8D 1M7IB 3VFTA 4ZXBC 3RKDC 3T0VA 5KANG 3I9GH 2APFA 1JWSB 1XZ0B 5DFWH 3D18A 1IEHA 1T7ZA 2ARJQ 1CDGA 3AB0B 3VXUE 4KRPC 5CBAA 3DECA 3A6BL 2B0SL 2ENSA 3WKMH 3G04A 1SJVA 4FQIH 5FUZL 1A1MA 2HKHH 3QXAA 4OLXH 5EC1A 4E42B 4Q9QL 3FOLA 1NGPL 3MCLH 1FLRH 3ECBA 4YHYC 1XR9A 4Y5XB 1KB5H 3BDYH 2ZCKL 3G5VA 4HF5L 4N68A 5E2TL 5IHLB 2W9DH 4HK0B 1YMHA 4WTZA 3FQWB 5BO1H 1IT9L 1QD0A 2NY7L 4YXKH 4N1EA 2NY5C 1JRHI 1FRGH 1M7XA 2J6EH 5KVDH 4F8TA 1FFQA 6CGTA 5EOCL 3BH8B 3OAYH 4FQ2L 4W4OC 3AS3A 3NH7H 4E41E 5E4IA 3SCMA 3UCRA 3QQNA 5I18L 3MLRH 1KB5A 3Q5OA 4F8QA 1FDLH 5FM5M 5HDOA 3DO7A 3W82A 2QSCH 1J11A 2R4RH 4JHWH 1NUFA 2J6EA 3VXUA 3QXWA 4NM4L 2ID5A 4DOHE 5MEQB 5BRZB 4NWUH 2AGJH 3QDAA 3STZB 1FHGA 5DMJB 1FNSL 4XNUH 3MA9L 4L3ED 5HYJD 3FQRB 2YK1L 1UH4A 3WS6C 3WXWH 2CO6B 2DDQL 4POZC 4Y4HB 3VFGH 4JREB 1EUUA 4WI5A 3JUYA 2ADIA 1NJ9A 4J3WA 4DKDC 4EBQL 2VL5B 1T5WB 5GGUA 5KSUA 1RUKH 2VIRB 4PY7B 1U8IA 4E41A 1FORH 2HJKA 3QNZA 5DHVH 4OT1L 4BH8B 4L9DA 3D3VD 3IDNB 3LKNB 2DM7A 4K9EL 3K8LA 1IE5A 2EEDA 4EOWL 4JFDE 4MNGE 5KOVC 4D0BB 1MAML 3WHXB 3SKJL 1AQKH 1MCNA 4GAJH 1DLFL 2PXYD 1G9NH 4XNXH 1PG7W 3EO0A 3JWDC 4PJHF 3VDAA 5GIRB 2V7HA 1J12A 2XQBH 4PGBB 3HMXL 4BSVA 1MCPH 3RA7L 2X4UA 2AQ3A 1Q9OA 3CJJA 2Z92A 3RDTD 1OWRM 4DZBA 4XZUA 1FPTH 4YHZH 5E8EA 1UADC 4N9GA 4BQCA 3S4SG 1PQZB 4TRPH 5B21A 3WJJA 4TULH 5CSZA 2V17H 1G7PA 3LKOB 2DLFH