1HWGB

1:2 complex of human growth hormone with its soluble binding protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
203
structure length
194
Chain Sequence
EPKFTKCRSPERETFSCHWTDEPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (hormone/receptor)
molecule keywords GROWTH HORMONE
publication title Crystal structure of an antagonist mutant of human growth hormone, G120R, in complex with its receptor at 2.9 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 194
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1996-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwgB01
4BQ8A 1AGCA 3UXFA 5LAXA 1MI5E 3O4LB 2DWEA 4QTIH 5I8OH 5CKGA 1MCCA 1IKNC 4Y88A 3GSWB 2ICWJ 3ULUH 4TSBH 3H9HA 4JFOB 2R29L 5F72S 3PQYE 1X5YA 4OZFB 4O2EB 5GSRA 2APWA 3QQ4B 3U79A 2GW5A 3HG1B 3T65B 3VXSA 4NFCA 4G8GA 1JWSA 1FO0B 4A6YL 3RA7H 3DROB 1I85C 5E8EB 3SDAC 5JA8B 4MA3B 2EDKA 1HHGA 2LFGA 4J8RB 4HD9A 4LPYA 5CBEA 1X7QB 4YWGH 5BVPL 4R7NA 2HJKB 1CR9L 1YY9D 3V8OA 1XIWA 2NX5A 2XN9A 3UEZA 3VFSA 4MDIA 5D71H 2ITDB 4RGMC 4TTDD 5HYSB 4FTVE 3RFZC 1LQSR 4FN0A 1T66D 4JFDA 1EFQA 1ZAGA 4M93B 5D5MF 3WS6A 2CMRH 2XA8L 1T2JA 3I3EA 5TQ0H 1CD1A 4P3DB 5EBGA 5C86A 4FP8H 5KG9B 1Q9LA 4P4RB 4N9OB 1BQSA 5MHSE 1IGTB 1MLCA 4WEUD 5IESL 5C08E 1CT8A 1RPQA 1N0XH 1XT5A 1LNUB 1QFWH 1BM3L 3I6GA 5CD3A 1Y18B 3IFPB 4U1KB 3RQ3A 4MA7L 1BMGA 1FZJB 2C3VA 3MRFB 3TA3B 4Z7WB 4PY8J 3VFTB 4ZFGL 3PNWB 4HHAA 1DDHB 2VLJA 1HDMB 3VGHA 1K4CA 4ZO6A 3S98A 3ULVF 5LKNA 1MNUL 3VGAC 2RQ8A 2R0LH 2MPAH 1T7XA 5GS0D 2YEZA 1SY6H 1CICD 3RX8A 4J2XA 1OOAA 3G5ZB 4U31A 5D1QD 1NMAL 3F58L 1K8DB 3IDGA 1HQ4A 3UAJC 5EOCL 3VU2A 4JFZL 4GAFB 3SE8L 2AJUL 4ODWB 3JTSA 5DD3L 1WV7T 1UVQB 4PJFE 3AMKA 5HVHC 2CJUH 1G9MH 1BJ8A 3ZHLA 3FB5B 8FABA 3RBSA 1QP1A 1FGVH 2IANB 4OZHA 3PWUA 2D9CA 2OK0L 4S1DD 2BSRA 4IDLA 1I7RA 2EYSB 1NJ9A 2ZOKB 1RJYA 1TJHL 2QADC 3PGCA 3GSXA 4WDIB 3CK0H 1GGTA 2YD3A 5F96L 1M7IB 1IM9D 5FDWB 5F44A 1MREH 3PE9A 5IT2L 4G6KL 2EE6A 2IGFH 3DBXA 5E2TH 5C0AE 3WLBA 1ES0B 2YUVA 3NABL 5FYJL 1EGJH 3LKNB 1OSZA 3DVGA 2D0HA 2JELL 2VC2H 2Y7QB 4LCWA 4U0RB 3SDXB 3BD4A 4CN1A 3CLEL 4XPTL 4LCCB 4LPWA 3MCLL 2GTZA 1IEBA 2MQ0A 1JZ6A 1GZPA 3VFWB 4GAGH 3W9EA 2RBLA 4H8WC 5GSVB 4HMDA 1CL7L 1AC6A 3IXTA 3AY4A 4YDKH 3FRPA 3AGVA 2IH3B 2BRRL 3CFDA 5DURD 5DRWA 4M5ZL 4RBPK 4UB0L 1ACYL 2BY1A 2VDNH 1A3QA 4M7KL 1CFQA 3MA7A 1PX4A 1PQZB 4LLVA 4D0DB 2CLRB 3F62A 1G9NC 3DNKA 1LK2A 4KDWA 5CJOL 3JWDC 4HIEA 5BS0B 4NN7B 1MJJA 1IKFH 1S7UA 2FH8A 1SJEA 1J86A 1YDPB 1RUKH 2JIXD 4DN3L 1FH5L 2GCYA 4PJHE 3KPNA 3L1OH 5EUOA 4ZD3L 1OCWL 3DXAD 4BA8A 4RGNE 3BX7C 4N0YL 1GGCH 1QRNA 4LSPH 3RTQC 4Y4FB 2X4UA 1J8HB 1P4LA 4OD3L 32C2B 5JMOC 5EIIA 3QT2A 3MRQB 3IDNB 3L9RA 3QNZA 3MRDB 35C8H 1X6LA 1CI5A 5D72H 1IM3B 1V7NH 3HHRB 1MQKH 5JOEA 3ILQC 5GJSH 3OZ9H 1AO7D 1L7IH 1E4XL 1B4RA 1KUMA 1WTLA 5FAAA 3GMQA 4XPGH 4G5ZH 3BW9B 5ICYA 1A3LL 15C8H 4HK0A 4H20H 3T3PF 5MEND 2UWEE 3INUH 4PJCB 1P6FA 1Q0YL 1UYWH 3QCTL 3L7FA 3DV6B 2BOCA 1KACB 1AIFA 2Z93A 3U4EA 1TVHB 1WWAX 4YIQA 3CXDH 1YJDL 1I1RA 5F7WC 1EPFA 1RIUL 3C5JA 4F9PA 3REVB 1N6UA 4JB9L 3IDYB 4GRLD 6FABL 2IQ9H 3TH2T 2NW3A 4G6AD 4Q0XH 1K9TA 1ZHKA 2ICEA 4PRIB 4XP5H 4DOHE 4AEFA 4IOFC 2WBJA 1OTTC 2QKIB 4QYOA 2G2RB 4CVXB 3AU1A 1JV5B 4OLVH 2FZ3B 3HZVA 4MVBC 1ZHBB 2HN7A 5FM8A 1HNFA 1X5JA 3WSQL 1C08B 2W0FB 4RFOH 1IGFL 1DVFC 5D7JB 3KPSB 2HTLD 3MGTB 1R5VA 1EFXA 4J4PD 5I1KL 1U8KA 5TFSH 3M1BB 1FL6B 4URTB 1IILE 1GGIH 5KW9H 2XXCB 1OPGL 1WQVT 4UOW0 2APBA 2Q7NA 4O9HL 3HLAB 3A6CH 3ARSA 1QSEE 2Y5EA 3L5WB 4YUEH 4GQPH 1DBAH 5D5ME 3U46B 3H42L 1X5LA 3BZ4A 4DGYL 4PY7A 2P5WD 2R0ZH 2VL4A 4R90H 4XT1C 4ERSH 3NCJH 5DQJB 1P4IH 4IS6A 4HQQH 3GSVB 5SWZB 5HHPB 2W0KA 3MGAA 4GKSB 3F6LA 4KKCD 4JFYB 3T0ED 4N0UB 1SHMA 4U1LA 3RU8H 3CD4A 1TCRA 3QO0B 4Q97A 3QXDB 4MB5A 3FN9A 4LCYB 4YBLB 5HHXL 2JJTC 3VFMA 1QPXA 3VXMD 2P7TB 3SEPA 1J1XH 4X7SH 3SKJL 3FT3B 3O6KL 2JCCF 5GJTL 1QNZH 1Z9LA 3VFRA 4WU7B 3ULVE 3B5HA 4PJ7B 5B21A 2EC9U 5HGGS 4GLRH 1XCTB 2LU3A 4K3JH 3QIUC 2BXZA 5ACLA 2CK2A 4YH6A 1J0YA 2Q3AA 1QLEL 4V1DB 3D69B 2HT2D 1WBYB 5GQBA 5I30H 3MJ9H 2PW2B 4I48A 2X4PA 25C8L 4GBXA 1VKXB 3A6BL 4Y5XA 2NNAB 3VGBA 1UA6L 4NOFA 5D7LD 2P5EE 2X09A 5CMAA 4WFFD 5MEPB 2EZ0C 1WIPA 3PV6A 1JGUH 4TPRH 3MLXH 1WZLA 3RDTC 1JYXA 3CZFB 5MERB 1OLLA 3RWFB 1NCDH 4M1CC 3MRKB 3IFLH 1HNGA 2MKWA 3H0TB 5B22A 4WI7A 1MH5B 4D0CB 2IPTL 5EO1B 4IRZH 4J7RA 5F8RC 1R3JA 3WFDH 4CMMA 1FLRL 3EZJB 1F3RB 2IBZY 4JKPH 1DQQB 3DIFA 2OX5A 5D7IA 4Y16C 3PP4H 4AQ1B 3V6OA 3EO9L 5EWIH 3CFBB 4A6YB 1MRCL 4XP4H 1WVZA 2DIAA 5ISZB 5CD5C 4FFVD 5I1EL 1XZ0B 5EOQL 5ALBL 1V8HA 3MX0A 5HYFA 1XGRA 1MFBL 4LPTA 2I25N 5C9JA 5TGBA 1N7ML 4PJGE 3C5ZB 3PDOB 3QCVL 4OJFL 5E6ZA 3N85L 3P4LA 5E6ID 4LPUA 1KJ2L 2J6EH 3QI9D 3ESVF 4KTDL 3F8UB 1OGAE 2Z31B 4JRXE 1L0YA 3O3DA 1F4WL 1AI1L 1RZGA 4P2QA 2ICWB 1G7QA 1YC7A 2J8UF 2GAZA 5D8JL 3EIFA 1UZ6F 3TJEL 3VXRB 4ZUTB 2BSSB 1ORQB 4LLUB 4GRMB 3E0GA 3SHSA 5FGSA 4JFPB 4QXTB 2NY5H 5J3HD 3Q0HA 3CVHH 2N1KA 5D93B 3GMRB 5C09B 4NM4H 2DQDL 2CLZA 1T80A 4QHMB 3G08B 3VDCA 3SY0B 3D39E 3E6FB 2XFXB 1YN7A 3MCKA 4XMKH 3TESA 1NPUA 4KDTC 4NO5A 3VGDA 5ADPH 3U36A 3HUJB 4N1EA 4IMLB 4XPFH 3JWNC 5C6TH 3U0TA 2R56H 3P4NA 4NNYB 3T3PE 4H1LA 1B3JA 1N64H 4HGWB 4XNQA 4F7CB 2BNRE 3PG2A 4PJ9C 4MJ6A 1KLUB 3WNPA 3T3ME 4PJ5E 4PYGA 3LEVL 5IMKB 4IHOA 4MX7A 2W9EL 4FQPA 2WINA 2FHCA 3O9WD 3MREA 5EULV 3S37H 5C0IB 4ONHB 3RZCA 2FEEI 5E5RB 1T89C 1FL5B 2RHEA 2X1WL 4NQSA 4U6HB 2Q7YB 4K2UL 1JMZA 3MUY1 3B2UD 5EU3A 5JW4N 43CAA 2C4XA 2QBWA 4LHUG 4MSWA 1G7MA 1IL1B 2UYLA 5HI5C 3HE6B 4L4JA 4F57H 2BNQD 1E4KA 2AXJA 1IQWL 4P2OB 4GW4A 4L9LA 4POZD 2MFNA 4E42B 1MFDL 2X2YA 2HMIC 4PJAA 1YEFH 4OCXH 4XPAH 4MB3A 4P4KD 3R1GH 4HWUA 4FFWD 3IFOA 2C3XA 1UKQA 1AFVH 5I73B 3JV4B 1LD9B 1EHNA 3V7AG 5E5UB 3QDGA 4KU1A 2H3NA 4LOUD 2YPKA 3MBEB 3O8XA 4OV5A 4MD0A 5HVFB 3QUMA 3S5LB 1XF4B 3VWKC 2FD6H 3FB8B 2B39A 3QP3A 5DMGC 1FNSH 2VISA 2MQCA 1CDIA 4PGBA 1D5ZB 1F42A 1TIUA 5IEHB 3U4AA 2ZUWA 4OGAD 3RBGA 5TE4L 2P8PB 4BSWA 2VDLL 5DK0B 1MCHA 5HI4C 5GS2D 4M1GL 1TETH 5JDSB 5D1ZB 5DDHB 4P0DA 3L7EA 4M02A 4HS8L 3MV7E 1SVZA 4K23L 4EN3B 3IKCB 3GMPB 4S2SA 1I8MB 2APXA 4KVNL 3VW3L 1CIDA 4M6NL 3VFOB 4QRPE 5DFWH 1L4IA 3MRBB 4KHTH 3DURA 1BZ7A 4HLZG 4YHPB 1NC4A 3RGVB 4KRPC 3SKOB 3LRGA 4R0LC 4HJJL 4HUWB 4RMRA 1BFOB 4RGNB 5J11C 3V7AE 3O2VH 5KS9E 4U6XB 4MCYA 1SQ2N 1EO8H 1BBJB 4K94L 4MDJB 3JUZA 3MGOB 4DUXA 4MJ5A 3ALWA 3EOBB 2XWBA 1A5FH 4E5XA 3DETD 5ICZA 4KK9D 4XCFL 4XCEA 4WW2C 2VLME 1NLBH 5JQHC 5B8CA 1Y0LB 4RFNB 1S5IH 3UDWC 1MFCH 4M7LL 2Q76A 5DT1L 5JPNB 1BZQK 1I9JH 1UM4H 4R2GD 1AJ7H 3D3VE 2GITA 4JGMA 3WDIA 5E9DD 5BMFL 2VLRE 4YC2B 4QRRE 1MAML 4KQ3H 2FLBT 1MFAH 2JB5L 4PG2A 5ICXB 3SPVA 4XAWH 5KSAC 4MA1C 2DIJA 4TQEL 3ARTA 1TZIA 4AK1A 2FLRT 3OR7B 3UYRH 5D7KD 1KXTB 1D9KD 4P5KB 1KSRA 2VZTA 4YHOH 4LIQH 3BKJL 5D4QA 1FIEA 3LS5L 2GTWB 4GQ9L 3MYJB 3LPWA 4OB5L 4L4VA 2IQAA 4LLAA 4AIOA 3V4VH 1KGCE 4JJ5B 4V2CB 5IHLB 3MJ8A 1NMCB 3LIZH 4ZNEE 4HCRH 4GMSH 5GZOD 1MUJB 3WJLC 3O4LA 3GBNL 3GSWA 2B7DT 4JFOA 2A9ML 1XF3B 1CK0H 1TJGL 1ZXQA 4O2EA 4OZFA 3MLWL 1U8NB 3QQ4A 3HG1A 4OLYL 4AMKH 3T65A 2FWOB 4N0FB 4XVJH 1YEIH 4TSCH 4R26L 1FO0A 4M4RA 3UTTB 3U6RB 3K80A 3DROA 1VACB 5E8EA 3U7WH 4MA3A 1CFBA 3Q1SH 4J8RA 4APQB 3PL6D 3JSSA 2ED7A 1X7QA 5D6DA 3VDBA 2J8UE 2NY3B 2H26B 1DLFH 2IAMC 2EICA 2NY2B 2HJKA 3CFKB 4B5EA 4MJ2A 5DMYA 1R3KB 2XA8H 4NUGH 3OG6B 2YR3A 2KQMA 2ITDA 5HYSA 3TFKD 5CHNB 5IESH 2YD8A 4JRYD 5FYKE 2ESVE 3RWDB 1AH1A 4P3DA 4O02H 5F7MC 5KG9A 4NZJA 4P4RA 2Q8BH 4YJZL 1IGTA 4U6VL 3ZO0A 4F2MB 3P30H 1FGNL 1NCCH 4F37F 5DJYB 1IFHL 1Q38A 1LNUA 4KI5C 4ZFGH 5I1CL 4M7JH 1EAPB 2XZQH 3RJQB 3NPSC 1WK0A 1Y18A 3IFPA 4U1KA 2ZCHH 1FZJA 3MRFA 3TA3A 5IVNA 4MMZC 4Z7WA 1S9YB 5JUEL 2PXYB 3MLYH 3DMMC 3VFTA 1NBQA 4HK3J 3HZYB 1N6VA 1OHQA 3SDAD 3PNWA 1DDHA 5A2FA 3BGAA 4MGXA 5D2LF 1HDMA 4XAKE 1JWUB 4WENB 3IDIB 4MNGB 3TF7C 5LGJB 1PKOA 2F53E 5BO1L 2I27N 5L7XL 4KZEH 4M6ML 2VDQL 2PYEE 4P49A 4JPIB 2FHFA 4C56D 2XQYK 2YD5A 4OFIA 3G5ZA 3MLVL 1K8DA 2ZG3A 3IU4L 2VXVL 4DFHA 4YHYC 3UPRB 1ZGLM 5C0DB 1YNTB 4JHWL 3PGFH 2AJYL 4MQXC 4ODWA 1YNLH 3MUHL 2SEBB 1EUTA 3D9AL 1UVQA 1OWWA 4FQ1L 5SWQB 5L88L 2E6QA 3HC4H 3L3HB 4HMCA 3Q6GL 5I1GL 4IRJB 3FB5A 4GXVL 2F54D 1G6RL 3EO0B 2EYSA 3BEWB 3EDFA 2P8LB 2ZOKA 3P4OB 4NO0B 4WDIA 3IS0X 4LLMB 1M7IA 2X41A 4GAJL 5FDWA 2AERT 1EDQA 5E2JA 1DEEB 3D2UD 1LO0L 4LCUB 1ES0A 4HIXH 1YEJL 2XIDA 3LKNA 2XQBL 2Y7QA 5GRJH 3SDXA 1HINL 3UAJD 3ETBF 3UZQA 4LCCA 1CL7H 3VFWA 1KJ2B 5KOMC 5JOPD 1EMTL 4ODVH 2BRRH 5HVWA 3KYKH 5GSVA 1I7TB 2PNDA 3JWOH 4JCLA 2PR4L 4HUXB 4PV8B 5DMJB 2IH3A 1CGSH 5T5NF 4GRWF 4XCNB 1PQZA 5I17B 2QADD 1D5MB 1EEUA 4G7YL 2PTTB 4D0DA 5J6GB 3MJ7B 3WNLA 2VR9A 2CLRA 2EE9A 4W68A 3LN4B 2OR8A 3OJDB 3ARPA 4KK8C 4JQIH 5BS0A 4DN3H 2HJLB 3FKUS 4Z7VB 3K2MC 4ZUVB 2QHRH 4D9QD 4P2YA 1YDPA 1UCBH 1F6AB 1IAOB 2C1PB 4POYA 2NXZC 4OD3H 3ILPB 1H8SA 2R1XB 1F58H 4IMKA 4P9HH 3DGCR 4BM7A 1P9MA 5JHDB 1FG9C 1XEDA 1DUZB 4Y4FA 4GMTL 1J8HA 32C2A 3QPXH 4U1SB 3MRQA 5GGRB 3IDNA 1VFBB 3I2CL 1S7RB 3ARGB 3LZFL 3FB7B 1E4XH 1ZLSL 1KT2B 3MRDA 4PRHB 5CIPH 4OCRH 1IM3A 4I3RH 2DQEH 3MLTB 3O6FB 4ODTH 5AYQA 3B43A 1QTYT 3P0GB 5CILH 2QQKH 5C0RH 4NQED 5IMOB 1C5BH 3BW9A 3IVKB 3K2UL 4N5EC 3L5IA 1KEMH 1I3GL 4MQ7B 3FQTB 5T3XL 3Q6FB 1YJDH 4PJCA 1X5HA 3MXVH 3GIVB 3JVGA 2BFVL 2CSPA 3DV6A 4HBCL 4JB9H 3RNKB 3BIKB 3QUZC 4MYWB 4Y5VA 2AJZB 2GT9B 1INDL 3TT1H 4CU8A 1TVHA 1JPSH 4POUB 3RL1B 3T0BA 5EOTB 3REVA 2E5EA 5DRXB 2X4NB 5I74C 3RTQD 2C4FU 1NLDL 4JKMA 4BUHA 5C0JB 1XMWA 1CGTA 3ZE1F 4PRIA 2BRQA 2ZWLT 4R6UA 4D9LH 4WUKL 5FGBC 2NY7H 1TPXC 4XNZB 2LTQB 2QKIA 2G2RA 4J3TA 4CVXA 2AI0L 4GSDH 1JV5A 2KQNA 3FB6B 4M62H 2FZ3A 5F3BB 3ILQD 5TF1L 3C6SB 4M5YL 2ZZUT 5DJZB 3WFCL 1C08A 2W0FA 3WO3B 4JDZB 5D7JA 4OLXL 3KPSA 3HCVB 1OPGH 3SOBH 1YEHL 3MGTA 4UDTA 5I71B 4EQ3A 4Y2DC 3MRHB 4PD4J 3V6ZB 2QQNH 1FL6A 1JPST 3M1BA 4JDVB 3PWNB 5AZEH 3WUWB 1GAFL 3SDCC 4PRPD 4QHKJ 5EB9A 3HLAA 3EDJA 2EYTB 3L5WA 1HE7A 1ZANL 1XFPA 5E99L 1T2QH 4I77L 3QFJD 4IOFD 4DUWA 5DLMH 5DQJA 1OTTD 1Q1JH 3GSVA 4LVHC 5SWZA 2FEEL 5HHPA 2I07B 4GKSA 1U93B 2OTWB 4JFYA 5L2KB 1U3YA 4MVBD 4N0UA 3MV9B 2R1WB 2JCCB 3VWJB 3QO0A 1YEKH 2A83B 4HJ0C 4I9WD 5DA4A 2CPCA 3QXDA 1DVFD 4HX1B 5FO9B 4KHXH 5FEBA 4LCYA 5F1KC 4OAWB 2VH5L 3AFLA 3SGDH 3KXFB 5F1NB 2P7TA 1PG7X 3FT3A 1OSPL 4WU7A 1JTPA 1RZKL 3UBXB 3RY5A 4PJ7A 4XI5C 3D1MC 3ULVH 2D7QA 3EYUH 5EH1A 3DHMA 1XCTA 5FUOL 1T6WA 3F7YB 3CGTA 2X6MA 2NXYB 3VFUB 2NCMA 4RNRB 4V1DA 5L0QB 3D69A 1WBYA 3T04D 3BZDA 5KAQG 4LMQI 1NAMH 1OAZH 3FN0H 4U33A 2PW2A 4JM2C 4AY0A 3HMWL 3D3VB 2ED8A 3ZDXF 1VKXA 3K3QA 2NNAA 4L3ED 1IGMH 5T5NG 1MF2L 2VLRB 1UT9A 2M1KA 1TDQA 5MEPA 1G84A 1RHHB 5ITBH 3QDJD 3B5TA 3LPFA 3CZFA 5MERA 1MJ8H 3RWFA 3MRKA 2CIIB 3DPBA 3QIWB 3ARZA 5GS0L 1AY1L 3H0TA 2MOVA 4EZMA 1MH5A 1WZKA 1T5WB 2WUBH 1CU4L 3EBAA 4D0CA 5EO1A 2A73B 4O2FB 4Z7UB 3QIUD 1R6VA 1QSVA 3B5GA 1KTRL 4OLZL 4NN5C 1DQQA 1MRCH 4UT6L 2AEPL 2YZ8A 5ELIA 1JRHI 4U7SA 5C0FB 3EKCA 3RJDA 3CFBA 4A6YA 2HLFC 4PGEB 4JLRB 5ISZA 5LCVH 3MZGB 2CRMA 3QZWB 1ZS8B 1XZ0A 4S1RL 1IE5A 4BZ1L 1N26A 2EZ0D 1CQKA 1XIWC 3RDTD 4OJFH 1E6OL 5DHVH 4ORZC 3BOVA 5E8DH 5DHXB 3B8YA 2KBGA 3LMJH 4KTDH 4M1CD 2ZUQB 3C5ZA 3PDOA 3WS6C 5CZVL 5IV2B 1RQ5A 3BN3B 4HDIB 1E4JA 2Z31A 4NC0B 4YHLL 5SWSB 4KGJA 3N0PB 5D8JH 3BPOB 5C0BD 3GSRB 2M26A 4HW6A 4JG0H 4ELME 2ICWA 2WP3T 3KPRD 1TENA 3EDEA 3B2VH 4LHJB 4JFEB 4Z7QF 4Y16D 3BPNB 4L29B 5IJKA 4FQCL 2CXGA 2ZCLL 1I1AB 2XKUA 4ZUTA 2BSSA 4LLUA 3GJFH 4GRMA 2DQDH 5CD5D 4U2YA 2O26U 3DTXB 3PWLB 2DQIL 4JFPA 4QXTA 3KS0J 3GMRA 2CGRL 5C09A 1LP9F 5IG7B 2X4QB 4QHMA 4YDJB 3BP6B 3QB7C 4MA8H 3VXNB 3SCMB 3MLRH 3RIFK 2N7AA 2DMBA 3QG7H 3SY0A 3E6FA 1IVLA 1RULL 5C92A 2XFXA 5JTWA 2QQQA 3FONB 3DXAE 5C3LD 4QNPF 3ZKQD 1KB9J 3HUJA 4IMLA 4DCQB 4F9LC 3BT2H 1Z5LA 5H94B 4NNYA 2DBJA 5EZOL 4HGWA 4F7CA 4WV1C 1N3NB 4DUVA 1KLUA 2AGJH 5IB2B 2W9EH 4TOYH 4C4KT 3DUUB 1MFNA 1IAIM 4HZAA 3SGEI 1JI1A 4DW2H 2DKUA 1AO7E 5IMKA 1YEGL 5LWYL 1G6RB 1O5DT 5DQ9B 3ZE1E 5C0IA 4ONHA 1UQSB 4P3CH 4U6HA 2Q7YA 3LD8C 2BVTA 1I3RB 5MENE 3EYFB 1EJOL 1LGVA 1AGEB 4M43H 1IL1A 3HE6A 1CDYA 1K4DB 1D7FA 3ROOB 1CFNB 3NACH 4P2OA 4E42A 3GDBA 3TVMB 4BJLA 4PJ9D 2BVQB 3NFSH 4K8RH 1S5HB 3LKPA 4AEHL 2I9TB 3JV4A 3N50A 1LD9A 3RWIB 2J4WL 1W8NA 1ADQH 4PJIF 5TDNB 1LO4L 3ISWA 3UO1L 1Q9WB 2YD9A 3MBEA 4AIZB 3P11H 2R4RH 3FOLB 3THMH 2B4CH 3G6DL 5C71A 4YXKH 1CXLA 1A7RL 3S5LA 1XF4A 4UUJB 3U1SL 3FB8A 2WLYA 3A0OA 1VGEH 1WZMA 3IDUA 1YQVH 1D5ZA 5IEHA 4K7PL 4TSAH 4HS8H 5KZCD 3NIGE 2P8PA 5HDOA 3VD4A 1J7VR 1QR4A 5DK0A 3DX6B 5JDSA 5D1ZA 5DDHA 5HI5D 3SO3B 4X6EB 3U48A 4EN3A 3IKCA 3GMPA 1I8MA 4H0GA 1PDKA 2HMID 2P5WE 4UOJA 4OSUH 3VFOA 3DRTB 3QDMD 3MRBA 4X9HA 4YHPA 1QKZL 2DQUL 3OKEB 4NWTL 1UKTA 3RGVA 2WW8A 3SKOA 4UIKL 1LVEA 3T0EE 3BHBB 4HUWA 4Z8FL 1BFOA 3DHJA 3VDAA 3LHPH 1HCVA 3MROB 4MXQC 3U30C 3LRSB 4U6XA 5LBSH 3VWKD 4NBZB 1BBJA 4R7DB 4MDJA 2H6PB 5DMGD 3VXME 3DX7B 1V3MA 3HZKB 3MGOA 5DUML 4WUUB 4NKOB 4WWKB 1NCWL 4R97C 5C8JB 1PEZA 3MNWB 1I1YB 2P48B 5HI4D 3ZDXE 3LDBB 4JN2B 1Y0LA 2VAJA 2EC9T 4YDIL 1IT9L 5I1IH 5DQDH 5JPNA 1I3UA 1C7SA 3S34H 1PD6A 2R69L 3OAUH 5SX4I 4OIAA 2C3GA 1MCSA 1T21B 3DI2B 4KRPD 4NPYB 5E8PB 2WBJC 2WP3O 5ICXA 1BWWA 4HLZH 2V2XB 1L9MA 4OZIF 3OR7A 5D7LE 4MLSA 1Z0MA 4ORGB 4P5KA 1SEQL 2ARJQ 4X7TB 3E8UL 5DD0H 2GTWA 5EG6C 3MYJA 4PJDE 4NHCH 2WZPD 2CDEB 4PPTA 4FXLA 3GBNH 4JJ5A 5T3ZH 1J88A 3BXNB 2A9MH 1TVDA 1MUJA 3M17B 1TJGH 2FGWH 1IQDB 3GBML 5ENWB 5FUCE 1XF3A 1IJ9A 1YY8B 1U8NA 2KH2B 1KJMB 5AUMB 5DMIL 2WBKA 1AD0B 1L6XA 5F9OH 5HBBA 1E4WH 1LO2H 2FWOA 4N0FA 3WNNA 5KVEL 3UTTA 3U6RA 4KTYA 5KSAD 3T4YB 2PCPB 5FOBB 1VACA 4YDLC 4C4KO 2DRUA 2W1NA 2A9NH 1DP0A 2FATL 3CLFL 4APQA 5I0DA 3DUSB 4OKDA 2ZUXA 1PLGH 2H26A 4Z7QE 3CFKA 4CMHB 1R3KA 4I3GA 1J05B 1GC1H 5FV2A 1JIBA 3RKPA 3VD3A 3MO1B 1RVFH 4XMPL 4K9EL 3O3UN 1T1XB 1UKSA 3FT4B 5CHNA 1HHIB 2PETA 1ZE3C 3RWDA 4PB0H 5KVDH 4JVPA 1FSKB 4NQCD 1A02N 5FYKH 1A4KB 4F2MA 2FX9H 2DD8L 5DJYA 5D2LB 1OQXA 1EAPA 4LCIH 4XRCB 3ZT7A 3PJSB 3SBWA 4QNPE 2PXYA 1FIGL 1HZHL 3GMOB 1TJIL 1T5XB 3HZYA 3LS4H 3VG0H 3GJFK 3ZKXB 4DJMA 3U2SB 4AENB 4C58B 2X42A 4GBXC 1JWUA 3IDIA 4MNGA 4Y5XC 1A8JH 5LGJA 2FNBA 2IC2A 2IAMD 1U8OB 3UJJH 4D2NA 2G60L 1S9VB 2WWMC 2DLFL 4EUPB 2VXVH 1Q72L 4JPIA 4JHWH 4JDTL 4KZDH 4Q7DA 3UPRA 3VGEA 2O5YH 5C0DA 1YNTA 5GISL 2F15A 2RCSH 3WIHH 2EECA 3Q6GH 1RFDL 2IADB 1QFUL 2SEBA 1U95B 1A0QL 3IRPX 3BD5A 4KI5D 3P0VH 3WEXB 5SWQA 3BKMH 4LSUH 3L3HA 4H5SB 2I60H 2NY4B 4P23A 4IRJA 5DR5L 3DMMD 4ZPVB 3OHXB 3V6OC 4NWUL 4RSVA 4XCYB 3EO0A 4TNVF 2XTJC 3BEWA 3W11C 6CGTA 2BHZA 2P8LA 3BGFC 4F7PB 3P4OA 4NO0A 3SE9H 2A1WH 3IGAA 1BEYH 4LLMA 5BRZB 3FT2A 5ANMB 2NY1C 2A6KB 1EH9A 3HR5B 3GRWL 1DEEA 2VQ1B 2D7MA 2F5AH 4LCUA 2PUQT 4LMQE 1C5CH 3PWPD 3I6LD 2BNQE 3ZE2E 1MEXH 3VXOB 2QSCH 1KCUH 4Y19D 4OZGF 4RA0C 4Y4HB 4MQXD 1XGUA 1KJ2A 4GRWB 2CUIA 1UH2A 3VXTB 1IC7H 5EU5B 1I7TA 4FA8A 4HUXA 4PV8A 1BVLB 3C08H 2B1AH 3O2DH 1DCLA 4KROC 5IF0B 2HFGL 4W81A 1JN6B 1XR9B 3T2NL 4XCNA 5I17A 1D5MA 3LQAH 2EDTA 2DKSA 5J6GA 2PTTA 3MJ7A 5FCUH 2D7NA 1OWRM 1KEGH 3LN4A 3OJDA 2VJXA 5I2IB 5FIEA 5GGTL 3WXWL 2OYPA 5EU6D 3PDDA 2HJLA 4Z7VA 4OCYH 4WEBL 4ZUVA 1X44A 4XB7A 3U7YH 2DB8A 4RDQF 4J6RH 4TTGA 1FJ1B 1F6AA 1IAOA 3QA3B 2C1PA 2VB5A 3VGGA 4OCSH 4XP9L 5DJDB 3ILPA 2R1XA 5KSUB 2BSED 2WSKA 5L8JB 4AEIL 4L8SB 5JHDA 4HWBL 1JRHL 1RURL 3T0VA 1ZLSH 3RY4A 1DUZA 5J0BA 3ZKNC 5JA9A 5IB3B 1Y6NR 3WD5L 4U1SA 4Z77B 1EHXA 1HIMH 5GGRA 4YHZH 1VFBA 4LRIA 1S7RA 3ARGA 3FB7A 4WTZA 1KT2A 2EKJA 3BSZL 3G6JE 1GHFH 4PRHA 3U9PL 1H3TA 4LDOB 4XNYH 4RFEB 2YOCA 5F9AC 3MLTA 3O6FA 3AS0A 2IPKB 3QFDB 1LEKB 2J88L 1M1SA 4KK8D 2FDBP 4LSQH 5IMOA 3IVKA 5JW4R 9CGTA 3KPPB 1TZHB 4MQ7A 1INDH 5D96C 4OZIE 4MWFB 3FQTA 3Q6FA 1YECL 1FFNB 4ALAH 3GIVA 3DO3A 3RNKA 3BIKA 3VG9B 2AJZA 1NLDH 2GT9A 2NXZD 4MJIB 3PHSA 3K7UA 3RL1A 4JG1H 4L9LC 2J5LC 5C1MB 3F65A 5EOTA 3MOAH 5E9DE 5DRXA 4ONFH 2ARJB 2X4NA 5C0JA 3CFCL 4NZRL 4MZ2A 5I18H 3KG5A 3TWCH 4BELD 4HC1L 2GHWB 2H1PL 3SDYL 5CLTA 4FFYH 5D7KE 3QXAB 3O8XC 4UAOC 5FHAL 5F3BA 1CXKA 1N6QH 3C6SA 3KLSA 5DJZA 3X3GL 1UB6B 2MSPA 4R8WH 5IR1B 3NTCH 3C9NB 4JDZA 4P5TB 2OCFD 3HCVA 3QEQD 4YHML 1LO5B 4N5ED 1G0XA 4YGAB 4FABL 3MRHA 3V6ZA 2JE8A 5E2VL 1QRKA 5F21B 4JDVA 1ZEAH 3PWNA 4G9FB 3WUWA 2FB4H 3QUZD 1BAFH 4DKAA 1T0PB 4OCNC 4F8TA 1WF5A 3GIZL 4GXUM 2EYTA 2DAVA 3U83A 1RIVL 4IDJH 4E41B 3T0XA 2KL6A 2X1PA 3CX5K 4RX4A 2AJSH 1J0IA 1H8NA 1P1ZB 4RWYH 4YQXL 5C2BL 4X8JB 1AGDB 3NMEA 2I07A 1U93A 2MCG1 2OTWA 2AK1L 1QFWI 4MNQB 1A21A 5L2KA 3NAAH 2AEQL 3MV9A 1ZVYA 2JCCA 2R1WA 3VWJA 4X6DF 2A83A 1FAIH 2DQHL 1GJIA 2AJ3B 4HX1A 5FO9A 3O81A 4PJEF 4HEPG 3TN0C 2GJJA 4OAWA 4AG4H 4DN4L 2CKBH 3KXFA 3U9UB 4Y2DD 4JRYE 5DVKA 5F1NA 4P9ML 5EA0H 1UACL 5JXEA 3EOTL 4JO3H 2VXUH 3UBXA 5B8CC 1HYSD 1XAUA 3B8SA 1J1PL 3SDCD 5B38G 1VFMA 4DGIL 3MRPB 2OZ4H 3TBVB 4Y5YB 5DXWA 1DE4B 1UM5H 3CFJB 3F7YA 4XPHH 2DQFB 4YFLI 1NQBA 3AXLB 4PBXA 5JZ7C 3AM8C 3VFUA 1OAXL 4RNRA 5JW3L 4FQIL 5HDQL 1HYRC 3HI5L 4PG2C 4KY1H 4NRYB 3C2AL 1T04B 3RI5K 1NCBH 3BQUC 5KJRL 1KYOK 5TE6H 1VCAA 3D3VA 1NBYB 2EDQA 1WWBX 2XKNB 5KSBF 1KG0B 1O0VA 4HJ0D 5EORL 2VLRA 1P7HL 3NGBB 2HWZH 1NSNH 4YE4L 5IW6B 4QRRA 3W0WB 1RHHA 4HPOL 3K1DA 3SJVD 3DWTA 5GS0H 5TF0A 1U36A 3MFFB 4I0KA 4PB9L 2H2SC 1T03H 1MIML 2CIIA 3FFCD 2WIIA 2BMKB 3QIWA 3KJ4B 4WIQA 2W65B 2MWCA 4RGOL 1NGQH 4UV4L 4XI5D 1JJUA 1T5WA 1F90L 1YMMD 5T1KD 1I7UB 2A73A 3DLQR 5HGHB 4O2FA 4Z7UA 1W0VB 2COQA 2YK1L 3GK8L 1AQKH 1FZMB 3BE1H 1JGVH 5ILTL 5KN5B 5E4EB 5JHLL 5DD5L 5HHMD 1CZ8L 3UJTH 2F54E 4YR6B 5FHBH 4OD2B 5I8EB 3U82B 5FK9B 3DV4B 3BDYL 5C0FA 3ALXA 2BY2A 3WXVH 4JM2D 3ARRA 3MA9L 4PGEA 1BOYA 4JLRA 4XGZB 3F7VB 4ZTOH 3CX2A 3NZHL 4OI8A 5D6DC 4DTGH 1ZS8A 3S88H 3Q2CA 2E9JA 4XHQA 1N5YH 4CKVX 1TTGA 1BQHB 4QY8B 1J5OL 4M93C 4IIQB 2PYFB 1F8TH 4G43B 3R8QA 3SO5A 4XNXH 4YHLH 2W9DL 5IV2A 1R0AL 1KPUB 2VAAB 4IJ3B 5JOPE 4HDIA 4XXDB 5F1OB 3VA2C 2F8VA 3OPZL 3FZUC 5SWSA 1KB5B 3BDBA 5EIVA 1WZ1L 3TIEB 1KBGH 1YMHB 3GSRA 5ADOH 3GO1H 3VXSD 1QSFB 2ORBL 3NZ8B 4G8GD 3SKMA 3TA3C 1SM3L 3HE7B 4U7MA 4LBEB 3IJHB 4L29A 4PJBF 1RZJH 1TLKA 2C7UB 1LP9B 3FO0L 1I1AA 4Z7OE 2HLFD 1P4BH 1LK3H 1MCPL 2YBRB 4KV5F 3ULUF 5DEFB 4JFQB 5C7XL 2D9QB 3DTXA 3PWLA 4JN1L 1JK8B 3WFHB 4RMSA 1QFPA 1W2KT 5GGRY 4Y4KB 4NCDA 3BEVB 1P7KB 1OP3K 1S8DB 3HFML 2HH0H 1XIWD 2NX5D 2XN9D 1U3JA 4PFEA 5H37H 5IG7A 3I9GL 1O7VA 2X4QA 4YDJA 3BP6A 4OUOA 3UTOA 3VXNA 1FRGH 3SCMA 4D9QE 4JFDD 4QXGL 5DI8B 3FONA 5TQ2H 1FNGB 4OT1H 3GHBH 2JJUA 5JW4Q 1OF2B 2BVPB 4DCQA 4NQDB 2K7QA 1D5XB 3I85A 5H94A 3K4ZA 3GSNH 4FFZL 3OXSB 3UTSB 1FORH 5D70H 4DVBB 4OIIL 1N3NA 5MP6H 2OTPA 5I1DB 2AEIT 4JHZA 4Z7NF 1HXYB 5IB2A 5LWYH 1KJVB 3DUUA 2E9WA 3OG4B 2VLJD 3V4PL 4OQTH 1G6RA 2Q8AH 5DQ9A 3KS0H 4NQEE 3QDHA 1I8LC 3D25B 3P77A 3S97C 1UQSA 3TYGL 2EDOA 1MCFA 3FAXA 3NCFB 4F3FB 4KKAC 2O5XH 2VWEC 4MAYB 1IBGL 1I3RA 5K33A 3QWQB 2Q1EA 3EYFA 1CBVL 1I9RH 1UJ3C 5I15L 5B3JF 1AGEA 4U0RC 4LCCC 4W4NA 1K4DA 2DI9A 3ROOA 1BQUA 1CFNA 3T1FB 1A7NL 4M1DL 4PJIB 4ONGL 1PAMA 3TVMA 1KCLA 1JP5A 3H7LA 1HYSC 4KJYB 2BVQA 4UBDC 3WYRA 5CINH 1A6UL 1S5HA 4DVRL 3L6FB 4YFLF 4H0HB 3BRDA 1YYLH 2I9TA 2JLLA 3BDXA 3RWIA 1FLTX 1C7TA 1S7VB 5TDNA 3SN6N 1Q9WA 4HEME 1CFVH 4FNLL 4AIZA 3FOLA 1S9KC 3B4NA 4UUJA 1PBYA 3ARDB 3RP1A 3VD5A 1BGXL 1NCNA 3KR3L 4NN7C 1N8ZB 2V17L 5GPRA 4X6DE 3DX6A 4PRPE 3S36X 4LCWD 2E7BA 5CP3H 4X6EA 3WIIH 3CU1A 2A38A 4IMKC 3RZWA 3QPQC 1P9MC 1YPZE 1HN1A 2ZOLB 3HA0A 2VZUA 3DRTA 1AC0A 3ARVA 4Y4FC 4CVZB 3QFJE 4OFKA 2HVJB 3OKEA 4HWEL 1WEJL 3LH2H 1AE6H 1DBKL 5E8NB 3BHBA 4OCWL 4RISH 2OL3L 1A6TB 4I9WE 1FPTL 3MROA 3T4AB 3LRSA 3CDGB 4J3SA 5D2NB 4R7DA 4XP6L 2H6PA 3DX7A 3HZKA 1JVKA 4TUJB 4YO0B 3VA6A 4QGTA 3KYOB 1S7XB 2MCPL 4WUUA 4NKOA 5IHBA 4LSTL 4WWKA 5C8JA 4UIMB 3MNWA 1I1YA 5L6YL 1T22B 3JVGC 4X4YB 2FX8L 3AREB 4JN2A 2P24B 4M3KB 4XB8A 3HI6L 1KC5L 3O3BB 3CDYA 2I9LB 3WBDA 1QRND 3IDYC 4O4YL 4QXUH 1OD9A 1G7JB 3GGWB 1T21A 4N1CA 4QWWC 2IPUK 3NA9L 4S0TD 1JPTH 5DJ8B 4NPYA 2AQ3A 5E8PA 4WI9A 1SEQH 4KJWC 3QEGH 3E8UH 1OGTB 5FGCE 2V2XA 4L3EE 4I4WB 1EJ6A 5GGVH 5JPMB 4MXQD 4ORGA 2YC1B 2KPNA 3GSQB 4LVEA 4ISVB 3E2HB 4X7TA 3QDJE 4GFTB 2YD1A 3PP3H 5D7JC 3DRQB 4XBEL 1XGYL 3S3SA 2CDEA 4OFYA 3KJ6L 5GS1B 5AEAA 4Z0BH 4NT6B 4OLUL 2R0KH 3BXNA 3EFFB 3CUPB 3M17A 3GI9H 4K3DL 1IQDA 5ENWA 3OB0H 1D3CA 4D3CH 4Y7MA 4J3UA 1G1CA 1YY8A 4XVTL 4DK6A 5AUMA 1KJMA 2DDQH 4OM1H 4ZMAT 1AD0A 1D5BB 3M8OL 2WBJD 5H35B 1MY7A 3T4YA 2PCPA 5FOBA 3DSFL 2A77L 5IFAL 43C9A 3X11B 5LQBH 3DUSA 4QOKB 3UP1A 2Y5TB 3P9LB 2Y36H 1X3DA 1KELL 5C0CB 1J05A 2DOCA 4YBLC 3MO1A 3WN5B 1Z3GL 1T1XA 4JZOB 3D85D 1EFXD 4YFEA 3FT4A 2QLVB 5EU7C 5BQ7B 5IWLA 4LHQB 2VRAA 1IC1A 5EDXA 3MLUH 4DFIA 3MLZH 1A4KA 1F3DH 2B0SL 4FS0A 4L4TB 4QTIL 3ZHDA 5I8OL 3EYSH 5C0BE 3LVEA 3ULUL 4U3CA 1M7DB 2H32B 1L9NA 3KPRE 5D2LA 5DRZB 4XRCA 3CSPA 5IKCB 3PJSA 1CLOH 1FYHB 3GMOA 1T5XA 2Y9RT 2ERJB 3U2SA 1JPFB 4AENA 3RA7L 5JO5B 4WFGD 2W60B 5DJ0B 4RWHA 1H9VA 1S9VA 4YWGL 4EUPA 1ZWIB 2YMXH 2D7PA 3VGFA 1CD1B 4I3SH 4ZXBB 2EEBA 5D71L 2NY0B 4HWZB 1AR2A 1F45A 3BN9C 1I3VA 1BFSA 2CMRL 5TQ0L 2AXHA 4FP8L 2EKSB 3K81A 1INQA 1HXMB 4C56B 1G7IB 2IADA 2BY0A 4CN6A 1U95A 3RL2B 1E0OB 1N0XL 2IBZX 2NYYC 3QUYB 3WEXA 2UUDH 5DK2B 3EDDA 4H5SA 1QFWL 2V9TA 3IAPA 1VEMA 1PSKH 4LFHG 4WFED 2R0WH 4ZPVA 3OHXA 5GGUB 4XCYA 4GBXD 4F7PA 3EOYG 3B3IB 3FHAA 4ZQKB 5BRZA 3U0PB 5ANMA 2WWMD 2A6KA 1DBJH 4H25B 2YUZA 4OZGB 3HR5A 3VI3F 1RIHH 2VQ1A 3RHWK 5CP7B 2MPAL 1YYMH 1SY6L 2LVEA 5DC4B 4N0CC 3C5ZC 1QSZA 2ZUYA 4BQCA 1W0WB 4Y4HA 1II4E 2Z31C 3L3OB 3FOMB 3VXTA 2VDKH 4JHAH 2HFGH 1IAII 1RSFA 5EU5A 3CFEB 3LOWA 3MFGB 2Y23A 3C09B 1RZJC 2VN4A 1BVLA 1AQDB 2CJUL 1MWAH 1G9ML 5IF0A 3O41B 5IJKC 4WCYH 4NRXA 1JN6A 1XR9A 1FGVL 2XTJD 3W11D 3OAZH 1Q0XL 4CBPA 5J6HB 2NY1D 5I2IA 2D4FA 4WNQB 3FN3A 4N8VB 4XP9H 1FYTB 5E2TL 2KZWA 1ZHNB 5GS2H 3MSPA 4M61B 1EGJL 2IFFH 3RX5A 5LG1A 1FJ1A 3GMLB 3ZE0F 2VC2L 3QA3A 3NN8B 2ADJB 5D7SH 5DD6B 4C59B 5DJDA 2O61B 5KSUA 3QDME 3V5HB 2GQHA 3MUGB 1HKLH 4GAGL 4L5FH 4L8SA 4P2QD 1Y6MR 4X7CC 4GG8B 3GHEH 1S7TB 3OJ2C 3BSZH 4ZO8A 5IB3A 1NCTA 4WO4C 4Z77A 4KROD 3V0VB 4YDKL 4XX1G 4LVNB 4LLVB 2N7BA 5GRUH 2G75B 5CJ5A 2ZUTA 3DJ9A 2J88H 3G5YB 4R96B 4RFEA 5JW5A 2VDNL 2IPKA 3QFDA 1LEKA 3QCUH 3UCRA 5INDB 4ENEC 3L5JA 2E7CA 4ZFZB 3KPPA 1NDMB 1TZHA 3MRRB 2GK0B 4S1QH 4MWFA 1FFNA 1BVKB 1IKFL 1EBPA 4JE4B 3HE6C 3N1MC 3QSKB 4WFHD 1S9WB 3QJHB 1RUKL 2L7JA 2Z9TA 4P59H 4MJIA 4P2OC 2X4UB 3L1OL 3IT8D 2YPLB 4TULH 4XVUC 2ARJA 4C83B 2VSCA 1GGCL 4XH2B 3ZKND 1BD2B 4LSPL 1U0QA 3SE4A 1FV1B 4JPKH 4I18B 5I73C 1E27B 2OBGA 3O45B 4UDUB 1JFQH 4XX1E 3QXAA 3MBEC 35C8L 4WTWA 5D72L 3OKDB 2R2BB 3PP3K 3MQIA 3OZ9L 3MCG1 1L7IL 2AJVH 1UB6A 4WI6A 5IR1A 5JMRA 3C9NA 1FVCB 4P5TA 2Y06H 4XPGL 1LO5A 2GJ6B 2WUCH 4G5ZL 15C8L 4KRMB 2Y07L 4K71B 5SX5H 4H20L 2ADFH 3HNSH 2VKWA 5D1ZC 5J1SC 3INUL 4G9FA 3G9AB 1UYWL 3SGEH 3OB0K 4FQXB 3X17A 4EDXB 3MODH 4MAUH 4EN3C 1AXTH 2AVGA 4D9RD 3KLHC 3CXDL 3ZYOA 4E41A 5ESAB 2J7LA 1P1ZA 2IQ9L 2K3TA 4QYOB 4Q0XL 3RGVC 4XP5L 4X8JA 1KCKA 1AGDA 3BZEB 3ARBB 4PJEB 3VJ6B 1PYWB 3FTGB 4MNQA 3O8XD 1HILB 5FXCH 4OLVL 2VDRH 4DN4H 3S4SG 4YX2H 2VLKB 2DYPB 2I5YH 2AJ3A 4RFOL 1SJHB 1MPAH 5DZOA 3U9UA 2IEPA 4XHJC 1SJVA 4K7FB 4NQCE 5BW7A 3NH7H 5TFSL 1KENH 1DVFB 4RFNC 5E1HB 1GGIL 1KN4L 4ZPTB 5KW9L 3HRZB 3MRPA 2ZNXA 4I0PB 4G3YH 4G9DB 1RZ7L 4Y5YA 1IC5H 3TBVA 1DE4A 3CFJA 2DQFA 3A6CL 3AXLA 2V7HB 1U3HD 5IVXF 4YUEL 2HLAB 1DBAL 1NGXB 1RZ8B 5KSBB 3E1F1 4YC2C 1FBIH 5ETUB 5KJRH 3W5MA 3NIFE 4R90L 3WHXB 4ERSL 4JVWA 2AK4B 4M9OA 3WFEL 3NCJL 2C26A 4NRYA 1T04A 1YZZA 4HQQL 5DEGB 4E9LA 5C07B 1NBYA 4EI5B 2XKNA 1KG0A 2NR6C 4FQJH 4ZSOE 2EXYC 4P2CG 4PB9H 2M8XA 5IW6A 3W0WA 3TN0D 2N4IA 1A7OH 2DLTA 3MFFA 1NMCC 3TT3H 1J1XL 3WCYA 4X7SL 1DQJB 5E08H 1QNZL 2E27H 2W65A 4N90D 3X12B 1CZ8H 4PJXE 1I7UA 4KI5E 5HGHA 2HRPH 1W0VA 1ODAA 5JZ7D 1FZMA 2XXMB 3IAQA 5F6IB 5KN5A 2R8SH 4K3JL 4NQXB 2VZOA 1UG9A 1I7ZB 4YR6A 1G7LB 4OD2A 5I8EA 5FK9A 3NZHH 3TLRA 4HXAH 3DV4A 2GKIA 3BQUD 1ZMYA 4EOWH 5I30L 3MJ9L 4DQOH 4XGZA 4APQC 4KVCH 3F7VA 4DGVH 1PG7H 2NY3C 4H26B 5AD0B 2NY2C 1U8QB 1UXSB 3MV01 1C16B 4DKDC 4L4VD 1BQHA 5SX4H 5T3ZD 3PWPE 3I6LE 4QY8A 4RMTA 4TPRL 1JGUL 3MLXL 2VUOA 1U6AL 2H2SD 1OQOA 2EDDA 5BJTA 4IIQA 5IP4A 2PYFA 4G43A 3W2DH 4Y19E 3OPZH 3IFLL 4NKDB 3O4LD 1KPUA 2VAAA 5I1HL 4XXDA 2ZCKH 4JM2F 3Q48A 4PJBB 5F93C 4IRZL 1KB5A 4YBQC 3TIEA 2IF7A 1YMHA 3HG1D 1Y6KR 3WFDL 1ACZA 1QSFA 3NZ8A 4NP4H 3SBWC 5I76B 3WNMA 1QG3A 2HFFB 4JKPL 2PXYC 3HE7A 5HHVH 4LBEA 1KJ3H 3IJHA 5ERWB 2C7UA 3OAZK 1LP9A 5C3TA 5EU4B 3PP4L 5HTSA 5I75C 5EWIL 2YBRA 5DEFA 4JFQA 4XP4L 2WAHA 3QEHB 3WFHA 1JK8A 4Y4KA 3V6FB 3BEVA 1P7KA 1S8DA 5EU6E 3VXUB 5I1LB 1NBZB 5FA3B 4ODUB 3ZSTA 5K59E 5FYKD 1HI6B 2DJ4A 5DI8A 5IFHH 3AB0B 4WI8A 1FNGA 1OF2A 2J6EL 2BVPA 4ODSH 4P3WA 4NQDA 4H8WH 3ZTNH 3FZUD 1D5XA 1G7QB 3ES6B 3OXSA 3UTSA 4DVBA 1YNKH 1B0RB 1CGWA 4FMKA 4RZCB 3TA3D 5I1DA 4IRJC 5CUSH 4K3EH 1HXYA 2L4OA 4F58H 1NFDB 1KJVA 3H6JA 1CWVA 2BHYA 4LSSH 4X6CE 2EEDA 1EHLH 4TRPH 1B9ZA 3D25A 1FZKB 3Q3GB 1G9NH 2FYYB 3KYAA 1FFOB 4YK4B 4MAYA 4PV9B 3JWDH 4QRUB 4HUVB 4NM4L 5EZJB 3GRWA 3RVVC 1A7PH 1RZFH 2YHGA 1UWEH 1KCVH 1CGXA 1BF8A 1BVZA 4XMKL 5KVGH 5IBUG 5ADPL 1SBSL 3T1FA 2CDFB 2XG5A 2LAAA 4PJIA 4XPFL 4OI7A 5C6TL 2BP3A 2R56L 2X9YA 3HAEH 4K7PY 3NIDE 1MVUB 4KJYA 1N64L 4Z78B 3P9MB 3L6FA 4ODHH 3U4BH 1IZJA 2IAND 4JR9L 2BC4B 2FH6A 1S7VA 4QLRA 5CJXA 3KHOA 2OR9L 3QEQE 3ARDA 3S37L 4KKAD 3DI3B 4PJFF 2EDEA 5JOFB 1LMKA 1N8ZA 5GGTA 5SX5K 3MJGX 3GUTB 5FECB 4Y89A 3MRNB 2CUMA 4I2XB 5T1LB 5L9DL 2LAGB 3DECA 1RU9H 4F57L 2Z8RA 4NHUB 3GKWH 3CAFA 2ZOLA 3ARYA 4NCC2 1JGDB 4UBDD 4XNUH 4CVZA 1DN0B 1HWGB 4OCWH 4TUKH 3IDXH 2HVJA 2OL3H 4HWBA 4OCXL 1S78C 3TEUA 4XPAL 1Z6JT 1X5XA 2PW1A 1J1OH 1JUFB 3BAEH 2R4SH 3R1GL 4LRIC 3HMXH 3ARGC 1NANH 5E8NA 1AFVL 2DM2A 1A6TA 2P4AB 4XP6H 3V0WH 3O6FC 5IVXE 1QHOA 4X4XB 3T4AA 3CDGA 1OAYH 4TNWK 2BDNH 5CKAA 5D2NA 1MRFH 3WMSA 5GS3A 1KTDB 4TVPD 1EEZB 2FD6L 4TUJA 4YO0A 5BS0D 3KYOA 1S7XA 1FNSL 4G7VH 4UIMA 1CGVA 4OTXH 5IW1B 5FO8B 1T22A 3L5HA 1KTKE 4YEEA 5K93A 3BFOA 4Z95H 4X4YA 3AREA 1RUMH 2P24A 3VFGL 2QSVA 4S1SH 1TETL 4B50A 1NCUA 1FNFA 3O3BA 2I9LA 3QPQD 3V4UH 5EUKB 4Y4FD 3SGJC 1J8HD 1G7JA 2F74B 3GGWA 2YPVH 5HYQB 5CGMA 1FG2B 1VESA 4KHTL 1O7SA 4N8CH 3C6LB 5DJ8A 3RIFF 5J1TC 4LAQH 4XNZC 2LTQC 1CF8H 1JZ8A 4HXBH 4HC1A 3CH1B 1OGTA 4I4WA 4X9FA 5JPMA 2VDMH 3PXHA 1MCOH 2YC1A 3GSQA 1BOGB 3O2VL 4PJHF 1M4KA 4ISVA 3SJVE 1NMBH 5IGXL 1AXIB 5M7QA 2BNUB 4JPVH 1EO8L 1ZK9A 5GGQH 3DRQA 5I71C 2B5IB 3FFCE 5GS1A 1B4JH 4Y1AB 4NT6A 3GSOB 4Q2ZB 3EFFA 1A5FL 3CUPA 1YMME 3G04B 1NLBL 2DBLH 1S5IL 3BUYB 1MFCL 5HHME 1NUDA 4RQQB 3K1KC 2VDPH 3AMLA 1I9JL 1UM4L 5AG9A 1AJ7L 5F70A 4QWWD 3SPVB 1D5BA 3PHOB 4O2CB 5H35A 1JZ2A 4KJWD 3MXWH 4KQ3L 4JREB 1MFAL 1CYGA 3D48R 5SV3A 4XAWL 3WHE1 3M45A 3X11A 4F15B 4QOKA 5DJ2B 2QEJA 2Y5TA 3P9LA 3UYRL 4YHOL 5D7JD 4KKNA 4LIQL 5C0CA 1X9QA 3C87A 3WN5A 4K94C 1Z9MA 4JZOA 2OQJB 2B0SH 2F58H 5JXEC 3V4VL 5EBWB 5BQ7A 2VL5B 2VO5A 4FXKB 3LIZL 4HCRL 4GMSL 2A74B 4C57C 3LKSB 4L4TA 3BYTA 3D5OF 5GZNC 1NGWB 3VXSE 4E0RB 2ZUSA 1M7DA 2H32A 2NXYC 5DJAB 3TO2B 4G8GE 4QCIB 1CS6A 1CK0L 2DQJH 3CU7A 5L0QC 4Q58C 1F02I 5DRZA 3S3JA 1IKNA 5IKCA 4OLEA 4AMKL 2YKLH 4XVJL 1YEIL 4TSCL 5SWZD 4LPVA 2FL5B 1JPFA 5M95B 5JO5A 1EXUB 3QJFB 3NOIA 4P2RB 3U7WL 4EDWH 3Q1SL 4LL9A 2W60A 4FQQB 5DJ0A 3IKKA 2NX5E 2XN9E 4HAGA 3QWRA 4JFFB 1GOGA 2AABH 3HRPA 1PVHA 1DLFL 1X4ZA 1ZWIA 4JFDE 5FYLD 2Z4QB 5HPOA 4QO1A 4ZXBA 4NUGL 3IS1X 4HIHB 3QIWC 4HWZA 1U8HB 1UZ8B 4O02L 1VEPA 2EKSA 4PREB 1N4XH 1VADB 1MCQA 4KTEH 3S4SB 1HXMA 4HT1H 4C56A 2Q8BL 1G7IA 1S7SB 3DSNA 4J3OC 3BVNB 3RL2A 3P30L 1NCCL 3QUYA 1QVOB 1QFHA 5DK2A 2DS4A 3PWJB 4M7JL 4PJ8B 2XZQL 4KWUA 1V3JA 1CXHA 4C55A 2ZCHL 3O0RH 2VLJE 2ICCA 3MLYL 5GGUA 1JYWA 5C2UB 5KANI 2Q20A 5F71A 1DR9A 3CDCA 3O4OB 4HMEA 3B3IA 4ZQKA 5HYJB 4M48H 1MJ7H 3DMMB 2QR0B 3U0PA 3WKNA 3D0LB 4H25A 4OZGA 5I6XB 4FXGB 5JIHA 4KZEL 3H9SB 5CP7A 1IGIH 3ARFB 4G8FB 2ZUQC 5EC2B 3T09A 2JTDA 3BN9D 2VTFA 2ZKHH 4B0MM 1W0WA 5ABDE 3UC0H 3TYFB 2F9BT 3FRPG 3S35X 3PGFL 4IM8A 3L3OA 2QQLH 3FOMA 3STLB 3FO1B 2NYYD 3ZYIA 1YNLL 3OQ3B 3BPOC 1BJ1H 3CFEA 3WO4B 4OZHE 4JM4H 3HC4L 1Q0XH 1AQDA 1MHPH 3BPNC 3O41A 5HGAB 2ZSWB 1IARB 2FCBA 4OZ4B 1I1AC 2V5RA 4GAYA 3WLWC 3W39B 5ISZD 1UADC 3BGMB 1B6DA 1CXFA 4AJ0A 3FJTA 4XZUB 1RUPH 3H3PH 5J6HA 2I24N 3TH4T 3C60B 3ET9F 3S3PA 4WNQA 2Y6SC 2XWTB 3SCMC 1GSMA 4LCWE 2D7TH 4N8VA 4N0CD 3C5ZD 1FYTA 3QIBB 1ZHNA 3BP7B 5H8DA 4HIXL 4M61A 4P46B 2B2XH 5F9JB 3GMLA 3NBNA 1PKQB 5DD6A 3NN8A 2ADJA 5GRJL 3O2WL 3MUZ1 2Z31D 2O61A 3V5HA 3MUGA 1BREA 4M7ZB 2ADIB 4GG8A 4ODVL 1S7TA 3KYKL 1SBBA 3JWOL 1V3LA 3V0VA 2G75A 3VXRD 4PJGF 3BZFB 5GGSY 1DQMH 1CGSL 3G5YA 4R96A 5HHOD 4W70A 5EO9B 2XZAH 1WAAA 3D18B 3TZVB 3UROR 1KOAA 3HKFA 5INDA 1YA5A 5C09D 1JWMB 5J89A 1CE1H 4ZFZA 1NDMA 1F4YH 3R06B 3MRRA 3ZT5A 4JQIL 2GK0A 3CVHB 3DGGB 3MV8B 1BVKA 5EUOE 3T0AA 2QHRL 2X4OB 3PWVA 5IOPB 2DN7A 1S9WA 3QJHA 1UCBL 1IRAY 1QRNE 1M6OB 2DQTH 2YPLA 4OLWH 3TVMC 1F58L 4P9HL 4C83A 1I8IB 4XH2A 1BD2A 3QHFH 1X5KA 4UINH 4WO4D 1FV1A 4LEXH 2XYCA 4I18A 4JANB 1E27A 3O45A 3QPXL 1R24B 4UDUA 2DM7A 3QNYB 4OCRL 1L7TH 3OKDA 4I3RL 2DQEL 2R2BA 4DKEH 1BX2B 3KYMA 5CZKA 4ODTL 2Y07H 4ENED 2HT3C 2EDYA 1FVCA 5CILL 2QQKL 4G6FD 4JRWA 1NUNB 1C5BL 2PN5A 2GJ6A 5C0RL 4WWID 4OF5A 4Y5VB 1KEML 4HUUB 3MNVB 5FYJD 3T3MF 2EH8H 3HE6D 5JXAH 2FIRT 2MKLC 3SO3C 3MXVL 4EDXA 4FQXA 3IXAB 4I5BB 3LAFA 4P2OD 1XF5B 3ME0A 3TT1L 3RRQA 1JPSL 4ZUWB 4XWOC 4XVUD 1PEWA 5ESAA 4NKMB 2WK2A 3MYZA 2AV1B 3VMNA 4I13B 2AW2A 4G6JH 1LILA 4D9LL 3RUGB 2NY7L 3BZEA 3ARBA 4PJEA 3K74B 3RAJH 3VJ6A 1PYWA 3FTGA 1JHKH 3MBED 1KN2H 1NC2B 1HILA 4GSDL 4M62L 2VLKA 2DYPA 5ITFB 1X5IA 4UDTB 2WWKO 5JORB 4CL7A 5E2WH 2J2ZA 1SJHA 2BXYA 2F8XC 3VRJB 1KN4H 1N2RB 4WWKC 3SOBL 1ONQB 4K7FA 1RZ7H 5D1ZD 2FBJH 3LDBC 2QQNL 1DVFA 1BF2A 4EN3D 4ZPTA 5AZEL 3HRZA 5CSZB 4I0PA 3FMGH 4G9DA 1XGQB 2VERN 2R39A 3KLHD 2CXKA 3SDDB 1F97A 2V7HA 3SQOH 1T83C 3WFEH 2HLAA 1NGXA 1RZ8A 5KSBA 5ETUA 1FFPB 4RAHA 3RGVD 1Q9KB 2EYRB 3WHXA 1T2QL 4NUJB 3BMWA 4WFGE 2AK4A 5JR1H 5DLML 3T8XB 1Q1JL 4JFHD 5DEGA 1FFRA 2QL1A 1CDJA 5C07A 4OFVA 2Z35B 3OF6A 4RIRB 4X7DC 4EI5A 1NL0H 1KLGB 1YEKL 3DX9B 3PV7A 5CS7A 5A3IC 4KHXL 1UB5B 4XHJD 2ILLA 4HLJA 1T0NB 2X7LB 4M3JA 1MVFA 4CADB 1DQJA 3SKUD 1NCAH 3BO8B 1OAKH 4NC1C 2X89A 3X12A 1BIHA 4YPGB 3ULVL 5KS9F 5K9KB 2HRLA 3EYUL 3AVEA 3EJZC 4NQXA 4WFEE 2DLHA 1I7ZA 1G7LA 3GKZA 2NY6B 1MCNA 5BV7B 2APVA 4LP5A 1NGZB 1QUNA 1NAML 4O58H 1OAZL 3FN0L 2HFEB 1HHJB 2NR6D 4X6BB 2EXYD 3VI4E 4H26A 5AD0A 1U6AH 5F97E 1U8QA 1IGML 1UXSA 4CMHC 1JGEB 1QYGL 4JM2B 1C16A 5EPMB 5I1HH 5ITBL 5FKAB 3FQWB 1VENA 4Z18A 4DZBB 1FVDB 5IB4B 5IWLC 4P5MB 1MJ8L 1CDUA 3WDHA 5EBLB 4U1HB 4NKDA 1FSKC 2Y1VA 1RZKC 1NEZB 1E28B 1FCGA 2WUBL 4PJBA 2HT4C 1FC1A 3IYLW 5F7KC 2V7NB 5TPWH 5DS8B 2DF3A 5I19H 1MI5B 1W0YT 3LB6C 3V6OE 5I76A 2HFFA 3UTTD 1H3UA 2J12B 1AGFB 2XTJE 5F3HB 2GSIB 3PQYB 2RB8A 5ERWA 4RMWA 4HF5H 1ETZA 3ZKXC 5EU4A 3MJ6A 5K9JH 1T0MB 4APQD 4BZ2L 4PRNB 4CJ1A 1X6NA 3QEHA 5LCVL 2NY3D 1CDGA 2NY2D 3V6FA 3GM0A 3VXUA 2Q86B 5I1LA 5ACZB 4NO3B 1NBZA 5FA3A 4ODUA 1LDPH 2BCKB 4ZOBA 5E8DL 3JZ7A 5T5FH 3LMJL 1HI6A 4H1LG 2YWZA 3WUZA 3CMOH 2VMFA 4P2QE 3ZKMC 4FTVB 3ES6A 4YBQD 4JPWH 3H9YA 4LF3B 1B0RA 4RZCA 2NY4C 3VRIB 4JG0L 2PXYD 5C08B 4PBVC 1NFDA 3B2VL 1H3PH 4F7TB 5IK3B 4XBPB 1C5DB 3FRUB 3TM6A 1CG9B 1XF1A 5FF6B 1RMFH 2EDLA 4OBSA 1FZKA 4RMUA 3Q3GA 2FYYA 3PGDB 1FFOA 1EX0A 5D6CB 2DTMH 4PV9A 5FYKU 4QRUA 4HUVA 5EZJA 4HUMB 1QA9B 4MA8L 1SBSH 5KANG 3MLRL 1PZ5B 2E6PA 2ATPB 4WFHE 1SY6A 3QG7L 4PG9B 2FO1A 4NJ9H 3RI5F 1Z5LB 4Y4HC 4ZOEA 2CDFA 2ZUUA 2ENSA 3BT2L 4JR9H 2P45B 1MVUA 4KDTA 4Z78A 3P9MA 5DA0B 2CRIA 4IRJD 2Q87A 2UY6A 2OR9H 1CLYH 2AGJL 2DKMA 4IRSB 4WI3A 4UILH 4ZS6C 3UJIH 2CKNA 2BC4A 4TOYL 5B39G 4PJFB 5DUPH 2VXSH 3EYQC 4DW2L 1H3XA 3EYVB 4X8XA 3R0MA 4P3CL 3QXUA 5JOFA 5L9DH 2HVKB 3L3JB 3RVVD 3GUTA 5FECA 3PABB 4UT7L 3MRNA 4I2XA 5T1LA 4D9RE 4M6OH 4M43L 1EGJA 3GSUB 4PJAE 5C0AB 2HA1A 4TUOB 4X6FB 4NHUA 1ZLWH 3G9VA 3NACL 4L8SC 3LKPB 1EHAA 1JGDA 1DN0A 5I8KH 4AEEA 3NFSL 1A6VH 4K8RL 5DVMA 1JUFA 4NGHH 5F9WB 1QQDB 1NGPL 3W5NA 2KDGA 4JZJB 4D0BB 1ADQL 2EO1A 1OARH 4ONOA 1I8KB 1V7MH 1A6AB 4X4XA 3P11L 2R4RL 3THML 2B4CL 1KTDA 4YXKL 1EEZA 3VFGH 3MV11 1IAIH 1VGEL 5J56B 1YQVL 4PTTB 4TSAL 5IW1A 5FO8A 4HBQA 1RY7B 5ESQB 2CQVA 1MHHB 3HB3D 3V6BR 3VG9C 3Q5YA 5IMLB 5JHDD 3MZTA 5EUKA 5DZNA 3RX7A 2BVUA 1WTGT 4RMVA 2F74A 5HYQA 5ESVB 4OSUL 1I4FB 1S78D 4R9HA 1I9IH 1FG2A 3SE4C 4W4OC 5JIPA 3MMEB 4PJHB 3C6LA 5T1DH 3ARGD 1TQBB 4PRHD 4YDVB 3CH1A 5IGXH 1DN2A 3O6FD 4KQ4H 2IG2H 3QEUB 5CIPB 1BOGA 3LHPL 4XP1H 2PTUA 1W72H 5LBSL 2BNUA 3S36H 5J1AB 4P5TC 4LKCA 3HNTH 2BVOB 2MQ3A 4UTAH 4LSRH 4PRAB 3ZDYE 3U30B 3V7MA 5J13B 4Y1AA 4N90E 3GSOA 4Q2ZA 3RWJB 1D6VH 1MCDA 2W9LA 4OZFG 3G04A 5DC0A 2QV2A 3LCYA 3VFVB 1EO5A 2HTLC 5I1IL 3BUYA 4MZ3A 5DQDL 4RQQA 2UWEB 4KPHH 3TNMB 4W6YB 1UWGH 3S34L 3OAUL 3ZSSA 3BISA 3CX5J 4ETYA 5AG8A 3PHOA 4HSQA 4O2CA 2BOBB 4PJCF 3EJYC 5GRWA 1SJXA 4DOHB 2IALB 4JHBA 5I9QC 4BH7B 5DJ2A 5HYSG 5T3ZE 2ICWI 4L4VE 4AT6B 3C8DA 4CRPA 3EFDL 4U0QB 3L3IB 4PGDB 5IJVB 5DD0L 5CCKL 1JNHB 4KMQA 4NHCL 1VSCA 2OQJA 4WI2A 5EBWA 3O4LE 2EO9A 5BW7C 3UTPD 1QLFB 1LO3H 2VL5A 4FXKA 2OM5A 5T3ZL 4J3XA 3CIQA 2A74A 2FGWL 3LKSA 4Y5YC 3D85B 2NTSP 3HG1E 3BRGC 1NGWA 4E0RA 1IAMA 2ZSVB 5DJAA 3TO2A 4RX4D 3K4AA 4QCIA 1OM3H 1RJCA 3WJLA 3U0WH 3GM8A 1QSEB 5F9OL 1E4WL 1LO2L 3BKYH 5DVOA 2JK5B 5D5MB 2FL5A 5L2KD 1X4XA 1LE9B 1KYOJ 1EXUA 3QJFA 4P2RA 3MV9D 1J8KA 4FQQA 2A9NL 1J0KA 4O5LH 4JEGB 4JFFA 3NGBC 4QHUB 4CW1B 4KKLC 1PLGL 2UZIH 3B6SB 4HS3B 1K8IB 2NPLX 2Z4QA 3KXFD 2RAMA 1GC1L 1VFOA 1MCIA 1RVFL 3QXWA 1DL7H 1H3GA 2XRAH 5JXED 3EZ8A 4HIHA 3KJ4C 4HFUH 4YZFE 4PY8I 3QH3B 5I1JH 1KIQB 5F7FA 1JHTB 1U8HA 1UZ8A 1ZKAA 1MHCB 4PB0L 5KVDL 4F8QA 4PREA 3OKKB 1VADA 5INCA 5FYKL 3S4SA 4Q9QH 1S7SA 5GZND 3N1PC 1VPOL 2D0GA 5HSFA 3BVNA 2NXYD 2FX9L 5E4EC 1QVOA 4Z7WE 4KI1A 3B9VA 3PWJA 3T08A 2D4DA 4PJ8A 1M71B 4EEEA 4LCIL 1A9EB 5TJWK 5JDJA 3VG0L 3LS4L 1A14H 2QSTA 5E7BA 4PJ7F 1NAMB 5DMKB 2ZP0T 3MJ9A 3I50L 5HYJA 3PXJA 3DMMA 2QR0A 4PLOB 5IHUH 3D0LA 3UJJL 4ZG1A 1ZSDB 1JBJA 4FXGA 3H9SA 2J1KA 3ARFA 2EC8A 4G8FA 4IIQC 3QIWD 5EC2A 1RD6A 2P5EB 3QBTB 4BH8B 5J7CC 4KZDL 1QBML 4IJ3C 2O5YL 3TYFA 2RCSL 4X4MA 1PW3A 4P23B 3WIHL 3STLA 1KCRH 3FO1A 3PWPA 4XCCL 1QBAA 2KUTA 2P44B 2MTPA 3P0VL 5F89B 2IANE 5FA4B 3BKML 4LSUL 4N9GB 2OI9B 2I60L 3HE7C 3IETB 5HGAA 4NBYB 4UQ2B 2ZSWA 3BUTA 4HV8B 4OZ4A 1QR1B 4PGJA 3IGAB 3W39A 4XVSH 3BGMA 3FT2B 2GI7A 4KK5C 1HK6A 1UEYA 2VWEE 4BFIB 4XZUA 1PFCA 4Y4KC 3SE9L 1MLBB 2A1WL 3C60A 1FAKT 1BEYL 5HDLA 2XWTA 1RHFA 3SDXE 2ZPKH 2F5AL 3O2WH 3QIBA 1Z2KA 3BP7A 5DHVB 1JNLH 3HNVH 1C5CL 1XGUB 2NY1B 4P46A 5F9JA 5KAQF 1PKQA 1A7QH 1CDHA 1MEXL 1ZLWK 2QSCL 1KCUL 3QR2A 4OF3A 5SWSD 1HWHB 4PJGB 2B1HH 2J6EA 5C0GA 2ADIA 1BPVA 1IC7L 1NAKH 3FFDB 3HC3H 4JFED 4X5LA 4DAGH 1OGAB 4JRXB 1BECA 2B1AL 3C08L 4U1GB 3O2DL 3RVTC 1I1AD 1V5JA 2AJXH 3BZFA 4XXCA 3WLWD 5A2JH 2CRYA 3I6KB 1REIA 5EO9A 4GKZB 3N9GH 4TVPE 3D18A 3TZVA 3VRLF 3LQAL 5BS0E 4B53A 3GJFB 5FCUL 5E5MB 4ZODA 1JWMA 1KEGL 4MAYC 2Y6SD 3IFNH 4H88H 3SCMD 4ELMF 3R06A 4NN6B 3CVHA 3DGGA 1TMCB 3MV8A 4KUZH 1TZGH 4OCYL 1E6JH 2FX7L 4TYUA 2X4OA 3U7YL 5IOPA 5ACMA 1WFUA 4J6RL 3BP4B 1CTNA 4GS7B 1QO3B 4KK6C 5F6HI 1M6OA 3V9FA 1J8HE 3D39B 4OCSL 4OV6F 3L3GB 2YN3A 4OF0A 4OGXH 1I8IA 3ESUF 4IOSD 1HOCB 3QQ9C 4PS4H 4JANA 1HIML 1R24A 2I26N 4YHZL 4MJ4A 2FJFB 5CJXC 4LARH 2BNRB 3QNYA 1GHFL 2GFBB 4XNYL 1BX2A 2BY3A 5DJCB 3D0VB 5IHZB 3ARDC 2PF6A 5F1IB 1G9EA 4PJ5B 1B6UA 3LEYL 4MNHB 4LSQL 4PJCE 1PX3A 1JPGB 4JY4B 1FVEB 4OD1H 4LDEB 1P2CB 2Z0BA 4HUUA 3MNVA 4JO4H 4NJAH 1ZV5A 4ALAL 1Z9OA 5KBNC 3IXAA 4I5BA 2OTUB 1M05B 5KVFH 1XF5A 1KF9B 2P49B 4U7KA 2VXTH 3TVMD 2A6DB 2EDNA 2Z91B 4FZ8H 4PRIE 4ZUWA 4JG1L 5FB8B 5F7EH 3MOAL 4NKMA 2FECI 4ONFL 2AV1A 3RHWF 2XT1B 1J12A 4XTRC 3RUGA 5I18L 4EI6B 3TWCL 1GOFA 4YBHA 1CQYA 3D6GA 1NC2A 1UCTA 4FFYL 3SE3A 4LLQB 2X40A 5DEZA 3BMVA 3WKMH 5ECJE 5GHWH 4XNMB 1N6QL 5D2NC 5ITFA 5IVZB 2HT3D 5JORA 4R8WL 2RIKA 5J12B 3NTCL 2DLEA 3IB4A 3VRJA 1N2RA 1ONQA 1P53A 1BFTA 3LV3B 5B39B 3AREC 3WIFB 1OP9A 1U9KA 4ZUUB 1ZEAL 2IPUG 2FB4L 1T7ZA 5CSZA 1BAFL 1BFVH 2YUXA 1XGQA 3SDDA 4XWOD 2GJZB 4IDJL 4Q6IB 4LHUB 4JZNB 3LSOB 1T1WB 1FFPA 2GY7B 2X4RB 3MV7B 4HGMA 5SWZE 2AJSL 1MJUH 1Q9KA 2FO4B 2EYRA 4RWYL 2AXGB 4NUJA 3NIGF 4N0UE 5IBLC 4QRPB 3T8XA 1N59B 1U3HB 1F13A 1T2XA 5TE7H 2RGSA 2Z35A 4RIRA 2ADGB 3NAAL 3E2HC 5FYLE 1X5ZA 2X1XR 1KLGA 3DX9A 2E9IA 4M00A 1FAIL 4R4BB 2DM3A 5EU7E 4WUUD 1UB5A 5KS9B 4WWKD 5GS1C 4AG4L 1T0NA 4NC2B 2CKBL 2X7LA 4PJ7E 4Z5RB 3MOBH 1SEBB 5EA0L 4CADA 5T3XD 1HHHB 1MFEH 3BO8A 4JO3L 2VXUL 4LNRB 3TN0B 2OLDA 4HFWB 4YPGA 1BZ9B 4X7FC 4NRZB 5K9KA 1MCBA 4HS6B 2OZ4L 1FE8H 2MJWA 1UM5L 4XPHL 4LSVL 1KTLB 1U42A 4N5UA 2OXGA 4Q74A 5D1XB 1CN4A 1NGZA 4WVRA 3QWOB 4KY1L 1QYGH 1NCBL 2HFEA 1HHJA 4QRRB 1UXWB 1FDLH 4X6BA 5CGTA 5TE6L 5KTEH 5CAYB 1SMAA 4OGYH 5HVGB 2EIEA 2YZ1A 1JGEA 5F7DB 3ALPA 3BQUB 2YSSB 4JM2A 2HWZL 1NSNL 3WN5C 2WIIB 3BPCB 5A3ID 5EPMA 3V5DB 4OFYD 4MHHI 5FKAA 3FQWA 5HY9B 1ZA6B 4DZBA 1FVDA 5IB4A 5J57B 4P5MA 5J4MA 1T03L 5KVMC 5EBLA 4U1HA 3ZL4H 2R2HB 1NEZA 1RJZB 1E28A 1NGQL 4HCRA 2HG5B 3EJZD 1IC4H 5AWNH 4NQUA 3MC0A 2V7NA 3B9KB 1XF2B 5DS8A 1AQKL 3BE1L 5HYIA 1JGVL 1MI5A 3V5KB 4PJDF 4M4PA 4Y8AA 4BZ2H 3UJTL 1AGFA 5F3HA 2GSIA 3PQYA 5FHBL 5H37G 5ISZE 2ERJC 4LK4A 3V2AR 1T0MA 3WXVL 2HKHH 4PRNA 3OX8B 2IWGA 4ZTOL 4OUUB 2HKFH 2Q86A 4DTGL 3S88L 5ACZA 4NO3A 4LP4A 1N5YL 3N1FC 3R4DA 5JNYB 4ZXBC 2BCKA 1KCSH 2NY0C 2J8UB 1HCFX 3VRLE 2DM4A 2Q3ZA 2AS5M 1F8TL 4XNXL 4JKKA 5E56A 5CJQH 4PRDB 4HPYH 2HT4D 2KKQA 4FTVA 4QT5B 3SKMB 5EOCJ 3QUYC 2ESVB 4LF3A 4UNUA 3LEXB 3V52H 3LB6D 1U8MB 1CD9B 3VRIA 3ZYZA 5DSCB 1KBGL 5ADOL 3VXRE 3GO1L 5C08A 3TO4B 5FFLA 2O5ZL 4X9BA 5HHOE 4F7TA 5IK3A 4XBPA 1C5DA 1RZJL 3FRUA 3QUXB 3CVIH 1P4BL 1CG9A 1LK3L 5FF6A 1EAJA 3T0DA 5C09E 4DEPB 1DBMH 3P0YH 2LV4A 3PGDA 4NYLB 5D6CA 2HH0L 1U2CA 1T1YB 1A6WH 4ZAKB 1QA9A 2PO6B 1J87A 4X5WA 1FRGL 4MXWH 1PZ5A 2F53B 2ATPA 3HUJE 4PG9A 1UH4A 1JGLH 2PYEB 5TQ2L 4ODXB 4OT1L 3ZKMD 3GHBL 1U8JB 2VQTA 1NUFA 3LQMA 4H1LH 2OXHA 4PLNC 3LN9A 1QFOA 3GSNL 2NY4D 3FQXB 1FORL 3C09C 4YFDB 5D70L 5MP6L 1H3VA 1QACA 3QRGH 2W92A 5HDBE 4F9LA 3WNOA 4IRSA 2IFGA 4JY5H 3S5LG 2YRLA 4PJFA 4G8EB 3P77B 3GJEB 4WV1A 1CD0A 2YWYA 4JKLA 3DVNB 4OQTL 5BRZD 2LABA 3RWEB 2Q8AL 2L7UA 3EYVA 1WBXB 2V5SA 4UT7H 2X44D 4QRSB 1T3FB 2O5XL 2HVKA 5FYJE 3L3JA 4HG4K 1ZLUH 1TQCB 1JE6A 2ICES 4PTUB 2AAVA 3PABA 1I9RL 2W59A 4KJPC 2E9BA 3DARA 1KFAH 1AKJB 4LVOB 5EBMB 4DK3A 4Y4HD 3GSUA 5C0AA 4UTBH 3DYPA 4TUOA 4X6FA 3AY4C 1UJ3B 3WV0A 1A1OB 5F7UA 4XC3H 3FO9B 4LRNL 2F5BH 1NGPH 2V2WB 5IM7B 3CPLA 5HYEA 5CINL 3UBXI 4LVNC 4ZS6D 1QQDA 2DL9A 3WHE0 1YYLL 4EIZC 4JZJA 4D0BA 3EYQD 5DFTA 3ZE2F 2EH7H 4JQVA 3KPTA 1I8KA 4X5XB 1A6AA 2DICA 3QUMH 1CFVL 1NKRA 1DLHB 1OW0A 3JV6B 3L5XH 4EKXA 4A2LA 4WGWB 4JAMB 4PTTA 5IIEB 1F11B 1MIEH 4FQ2H 5ESQA 1R3LB 3TCLB 1DFBL 1MHHA 3RVUC 1J0HA 1WFOA 4WHCA 3WIIL 5IMLA 4XC1H 3UZEA 2VDOL 1A64A 4JY6B 4M8QB 1N0LA 4TN9A 5ESVA 1I4FA 1F5WA 3WFBH 3LRHA 4CN4A 3MMEA 4PJHA 4I18C 2BVEA 1G1YA 4Z7VF 4JFHE 4MQTB 2PTVA 3LH2L 4YDVA 1AE6L 2D31B 3H2WA 3LY6A 4RISL 3QEUA 5CIPA 1C1EH 4OFDA 2YA0A 2EIBA 3ARWA 1NBVH 5J1AA 4QRQB 3BWUC 4RRPG 2BVOA 4PGCB 5F6HJ 3MBXH 4PRAA 5E70A 4K71C 1DBBH 3CSYB 3RWJA 4LASH 1G0DA 5LXGH 1TNMA 3MLSH 4KJQC 5GRXG 4F9PC 2R2EB 3G6JF 4FQXC 3ZTJG 4LGSB 4MJID 3VFVA 2ID5A 4OF8A 3GI8H 2UWEA 3TNMA 4UQ3B 1EERB 1XH3B 4NO2B 4BK4A 5JW4M 4QXUL 4V2BA 4XWGH 4UNVA 1JPTL 3V8CA 1XR8B 2DTSA 4NZUH 2BOBA 3ARBC 1RUQH 4OCMC 1PY9A 3EFDH 5ALCH 3OB8A 3QEGL 2GIYA 2IALA 5CCKH 4BH7A 5GGVL 1W8OA 2OP4L 4JO1H 3X13B 2A6JB 4AT6A 5BOPA 3L3IA 5FM5M 4P5TD 1N5AB 4NSKB 4PGDA 5AYUL 5IJVA 2HFTA 1TXKA 1JNHA 4EBQH 3OJVC 1YEEH 3S9DB 1QLFA 4Z0BL 3KAAA 4G9FD 2R0KL 12E8L 2P43B 1S3KH 1F3DJ 2DL2A 3GI9L 1WISA 4I0PC 1INEH 3C2SA 4A2MA 3D85A 1BQLH 4E41D 4OZFH 2ZSVA 4KUCD 4ZTPH 3FAWA 3BKCH 4D3CL 1J11A 3UTTE 5K9QI 3BI9X 1D5IH 2DDQL 2D2OA 1EK3A 4OM1L 4MB4A 1FO0H 1QSEA 4KAQH 2DI8A 4AH2B 5FUZH 4CAGA 2XV6B 43C9B 2JK5A 5D5MA 3EJYD 1G0YR 2ITCB 4MNQD 4WRLA 1HH9B 1LE9A 1WIUA 3DVIA 4EI5C 4EQ2A 3UTZB 3ARQA 3LPGA 5LQBL 1F4AA 4NNPH 4QHUA 2Y36L 4CW1A 3QULB 3B6SA 4HS3A 1K8IA 3KVQA 5MI0B 3WJJA 1U2HA 1JI2A 1GIGH 3VCLB 1VPOH 2CKBB 3QH3A 1ITBB 1KIQA 1JHTA 1MHCA 5CEZH 1OLZA 2FECL 3GB7B 4P57B 3OKKA 3MLUL 3MLZL 4G80B 4TNWF 2YD7A 5F6IC 3EYSL 3SKNB 3BIBX 4FZEH 4PLKC 4UV7H 4KDVA 1M71A 3KLAA 2OMNA 1A9EA 1CLOL 2MHAB 3I50H 1OAUH 1A9BB 4MNGE 1PZUB 5I8CB 2DQGH 1EO7A 1NAMA 5DMKA 1FZOB 2DI7A 4NKIH 3W0WD 5KOVC 4KKLD 1ZSDA 1AD9B 1TNNA 1TITA 4AQOA 1QBMH 2YMXL 3TV3H 5JQ6H 4GW1B 4I3SL 2F19H 2LU7A 2P5EA 4BH8A 1CICB 3RGHA 1INQB 4XCCH 1EUUA 2P8MB 3K4DA 5T33H 3EYOB 5BXFB 5D1QB 4B7LA 4ZS7H 1OB1B 1QLRB 4MHHG 3ULUC 4X80H 5F89A 3VMOA 5FA4A 4JKWA 4N9GA 1TTFA 3BPLB 3IETA 4M8VA 1ZTXH 4UQ2A 1MRDH 1PSKL 4HV8A 2R0WL 1QR1A 3OMZA 3VD9A 2A2QT 1T7WA 2J3SA 4WY7H 4BFIA 3HPJB 4JCMA 4Z7UF 4C54A 1MLBA 1NANI 3RIAK 5DHYB 2E7LA 4DKFH 1DBJL 1S7QB 1ZLUK 4UT9H 4CVWA 2V6HA 1RIHL 3O3EB 1IM9B 4WHYH 3OSKA 1YYML 4L8CB 5DHVA 2VIRB 3AB0C 2MMXA 2H8PB 1WT5A 4J23A 2E8ZA 4KMTH 5F8QC 4LLWB 7FABL