1HWGB

1:2 complex of human growth hormone with its soluble binding protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
203
structure length
194
Chain Sequence
EPKFTKCRSPERETFSCHWTDEPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an antagonist mutant of human growth hormone, G120R, in complex with its receptor at 2.9 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (hormone/receptor)
molecule keywords GROWTH HORMONE
total genus 31
structure length 194
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1996-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwgB01
3HE6C 2EKJA 3ECBB 4U1HB 3RVVD 2D2OA 4HUXA 4MYWB 2VXVH 1I3RB 2V2XA 3QUKA 5GGSB 5K59F 4DZBB 1KLGA 2FIKB 4TVPL 1J87A 2GTWA 5ERWB 4K3EL 4PJBA 2AJUH 4PJHE 4NUGL 1A3LH 4PV8B 3VXRD 4GS7B 4ZO7A 5IVZA 5DFTA 1XH3A 3DUSB 2FX7H 2BP3A 2CDGB 3IS0X 4KK6C 4RDQF 1TDQA 4Y16D 5FYKD 1U6AH 5IBTH 1YY9D 1AR1D 5H2BA 4YAQB 1JTPA 1JHKH 3FFDB 1E6JH 4NQXA 4LU5L 1Y6MR 1H5BA 4HBQA 4OLEA 3E8UH 4LPCA 3VD9A 1QSED 1ZANL 2R2EB 1YUHB 4YHZH 3SQOL 3KPLA 4M48H 3RBSA 4OZGF 4P0DA 3L6FA 1KLFA 3PHSA 4M8QB 3H9HB 4N0FB 1KJ2H 1IAKA 4XZUB 2G2RA 1J1PL 3DX9A 3ULVC 2C1OA 4QLRA 1J0KA 2VDOL 2W65B 4WO4B 4NQEE 3T2OA 5CEZL 5ILTL 1PAMA 3DIFB 3SDCD 3HUJA 3KJ6L 3QUZA 1NGXB 4M00A 2WWMD 3NH7L 2ZJSH 4AG4L 2V2TB 3OZ9H 3OKYA 4XAWH 4HKJA 1UCTA 3GSNB 4GRLB 5HI3D 1WAAF 5D6DA 4OLUL 3SDDB 1A9EB 4H8WH 4P4RB 4FFWD 4XMLL 2P5EB 3QJHB 1BFTA 2C3XA 3FOLB 3G6AA 5JIIA 3GHEH 1EXUB 2IAMA 1GAFL 3VI4F 5DD5H 1T5XA 1VB9A 2MQ0A 1FFNA 1HI6B 4I9WE 4AL8H 1ZAGA 3QH3B 2V2WB 4C56B 1XZ0B 4NJAL 2Z93B 3BXNB 4P59H 1NCCL 4JN2B 4PLJD 2YMXH 5JHDA 1U93B 1EGJA 1HCVA 4YXHL 5IHBA 2NMSA 2D7QA 2AI0H 4XH2B 3VFGL 3VWKA 3W0WA 4F7EB 2X42A 3SKJL 4YHYC 1N26A 1ZHNA 4PJ8A 1GJIA 1BJ1J 4FFZH 1TMCB 2F54A 3X12B 4NKIL 2YK1L 1MJJA 2FHBA 2R0KL 1CDYA 3ALPA 1E27A 3CMOH 5EB9A 2X4RB 4FFZL 3V6FA 3QG6B 4QXGL 2AP2A 2OZ4L 1LO5B 1G1YA 5A3ID 4GMTH 4PRPD 1UWEL 3OGCB 2P8MA 2VE6B 2P45B 1A7QH 4HWEL 4OGXL 3PABA 5GGRA 2NY1C 1IZKA 1UENA 2ZUQB 3MYJB 5HYSB 3S98A 2FR4B 5JO5B 4PGDB 4ELKB 2BK8A 2PYEB 5B39A 2ITDB 1VADB 1QA9B 2R1XB 4JANA 5IGXL 5I8KH 2I25N 3OJMB 3UZVB 1WCQA 1F4WL 2J6EL 4FQQA 4MD4B 4YE4H 4R4NC 2WIMA 2WWMC 1YUHA 32C2A 4KU1A 2I07A 4OIAA 3MLRH 3HMWL 2VXQH 2X70A 3KWWA 1GGBH 1F6FB 1YZZA 3QG7L 4GLRI 3DTXA 4HK0B 1T21B 1JZ3A 1JN6B 4LVHB 3GKWL 1ZLVK 2Q8BL 5DEZA 3S88H 4ZDHA 3KPSA 4JFFD 4CAGA 2E7CA 4DGYH 3SHSA 4F37F 4G9DB 4LP4A 1K8IA 2R2EA 2VLRB 5E8OA 4LLVA 2XN9E 1CDUA 3G6DH 4G8EA 4AEFA 5KSBA 3HI5L 1RUAH 3TVMC 3E6HA 2FDBP 2D4DA 4W6XB 2DKMA 3CLFH 1E28B 5FO9A 2KH2B 5JIKA 2VLJE 4G7VL 1YEEL 1AY1H 1A1NA 2JK5B 2Y07L 4F7TA 2RFXB 3O8XB 5C07E 4KRMB 2BOCB 4X6CE 5DFWH 3AU1A 5I74B 3BE1L 5CP7B 1BBDH 4LFHD 5F89A 2ITCB 3QSKB 1CD1B 1A7NL 4BQBA 4X5LA 1WC7A 4XPAH 1G6RH 1VHPA 2BMKB 2YS4A 2NLJA 1XGPA 4KPHH 4PJ5A 3P11H 1EFXB 2H1PL 2VUYA 4NRYB 2OTWA 1EMTH 3FN9A 4PP1D 3EFDH 4S1SL 4BZ1L 3IDJB 1LO3H 2CKBH 3ARZA 3QP3A 4LHUD 3IF1A 1UJ3C 5CIPA 2IFFL 3K74B 4FTVE 3OAUL 4LCIL 3GNML 3BDYL 4NWUL 3VU2A 5KVGL 1J0YA 3L3HA 3VXUE 5EZJB 4YHPA 3L5XL 5M94B 2CO7B 2IJ0C 3G08A 2QHRL 4P46D 3O2WL 4HWBL 3WUWG 1SBSL 4NO2A 5FO7B 3QDGB 2UY6A 4LLDB 5K9OA 4OCYL 2NR6D 5E1AA 3MRCB 3LMJL 5B38G 3T3PE 5CZVL 1FNSL 3IXAA 4O9HH 5CWSB 5AAMA 1YN7B 3ZL4L 4YHKH 5LCVH 4D0BA 4PR5A 1P6AB 1ADQH 1JPFA 2G5BB 1NDMA 2WBJD 4XMPL 3FCTB 2LAAA 3V0VB 2VOTA 3TNMA 4FTVD 4NZUL 4R90H 2GQHA 1CICC 3RKDC 3T77A 3U30C 3I75B 2BOBB 1FLRH 1INDL 2AJSH 5ACMA 3T0EE 2VKWA 1F3DJ 4G43B 2QSQA 3HLAA 5F9WC 4XNQA 1PLGH 3TBWA 1U58B 5IFJA 2XWJB 4XCNB 1OHQA 2PW2A 4YQXL 4L8DA 1BD2B 1IL1A 4S1QL 2HA1A 4J4PC 4MXQD 1CL7L 4UDUB 1U58A 5EOTB 4GFTB 3ARPA 2F74A 5HYFA 3BT2H 5T1KD 1U8PB 1R5WA 4JFPB 2VQUA 1YPZB 1IT9L 3U36B 3GSNH 4MS8C 4HS6B 3HMXL 1ZSDB 1KTDB 2BNRD 3ROOB 3FRPA 5TF1L 3GMLB 5GS3A 4ZNEA 1KLUA 4WRLA 1R6VA 4WUUE 4HIXH 3SQBA 2HT4D 3DROA 2X41A 3VGAB 4GW1B 1UM4H 3N9GH 1CL7I 1HDMA 3BGMB 1OTUD 1FO0B 4WW2A 2XNAB 4FQHA 3B9DA 5AWNL 1H9VA 5C09B 3PXHA 3QPQD 5E6YA 5C6TL 3NFSH 4P2OB 1FL6A 1KC5L 1HYSC 1ZHBB 4FQIH 2JB6A 3HRPA 4Z0BL 4P3WA 5D7JC 1HE7A 4JY6A 1RIUL 5E2JA 1FYTD 5F1NA 2BMKA 2F5AH 3IU4L 2BVYA 5KJRL 3NAAL 4L4TA 3MFFB 3FTGB 1BQUA 1XF3A 1T1XB 3P9LA 1EJOH 1VFAB 5E2TL 1T7WA 4Q9RL 2H2PD 2P47B 4DWHA 2A9MH 3MRIB 2HKFL 3GRWH 4P4KD 1WLHA 4OZFA 1EEQA 1KJ3H 2V5RA 4AMKH 4HFUH 1NCTA 2XI9A 4I1NB 2XA3A 2NY0B 5I6XC 3DVNB 3ISWA 5DVNA 3FJTA 2VQTA 4QY8A 1FSKB 2H3NA 5JUEL 3BZFA 2ICWA 5LKNA 5EBWB 1GOGA 4NO0D 1B4RA 2YPVH 3HE6A 4O2FB 1CF8L 4FABH 1NUGA 4N68A 4HHAB 4KHTL 3IFOA 5CJQL 4I0PD 3IDYC 4YDLB 4XGZA 4MCZB 4HGKC 1MIMH 5DHVA 1YEHL 1BFOA 2F15A 1I9JL 2C1OB 2IMNA 2BRRL 1FE8H 3K8MA 4KI5F 3WHE1 3WKNA 4KROD 2HKHL 4KKBC 2CK0L 2R1YA 4XPHH 4ZG1A 5DJCA 1MCSA 3LS4L 4F7CA 3L3OB 1RPQA 5HHQA 3UJTL 3U48A 3RL1B 1NAML 2ZG2A 1OGAA 3ZE2E 3S37X 3QDJD 3GSQB 5TQ0L 3LB6D 1T5WB 4YHKL 5C0AA 4JVPA 3ZYZA 1TZIB 5F7MC 3CU7A 3RTQA 2F58L 5GZNC 2R56L 4Y1AA 2W0PA 1TJGH 1HWGB 3QJFA 5T3ZD 1OAQH 3NIFE 5FF6A 2IEPA 1CIUA 4PJEA 4HWBH 5EU6E 3U79A 1PW3A 5E9DD 4OKVA 4HIHA 4N9GB 4KUZH 4TSCL 1ADQA 4LRIC 1CQYA 1FG2B 3U7WH 5IW6A 4P9MH 1X44A 4P3DA 3Q1SL 4URTB 2Y06L 4LKXA 3IGAA 5H94B 3DTXB 4HK0A 1DJSA 5D7JD 4LASL 2XWJA 5F7YC 4Q0XL 4HJGB 5FKAA 5DRWA 1JWSA 3V6BR 2UZIH 2XA8H 2EE3A 3QCUL 2NY6B 4JPKH 1W72H 4JQXA 4IOIA 4ZYKA 1CFQA 2XT1B 3TZVB 1N4XL 5EFIA 4LPWA 3RTQD 1A6ZA 4QRPE 4EUPH 2YD3A 4O58H 3P30L 5E0QA 4TUOA 1FVEA 1DFBL 4TRPH 3TPKA 4PUBL 3KPRD 4L8CB 5E4EB 4FRWA 5IV2B 2EC9T 1V05A 3TN0D 3U9PH 4NM8H 1RUKH 5SWZE 3U1SL 2JJTA 1A7PL 3D9AH 3MYJA 5HYSA 4TVPE 4E41A 1TVHA 2Z35A 1QSEE 4I0PC 4L9LB 1CR9L 4OB5H 1PG7L 3WBDA 1NSNL 1AIFA 1RUML 4QCIB 3BISA 1UCBH 1ZT1A 4X6CB 4RZCB 5IF0A 4KROC 4K23H 3DETD 2ESVA 1I3VA 1EHNA 3GK8H 1RMFL 5FYJE 2Y5TB 2PN5A 5HGAB 5BZWB 5E8NB 3QCVL 3T2NL 1CLCA 2DQCH 1YEGH 4G9FD 2PXYD 2R1WB 4HCRA 4AJ0A 2VSDA 4YH6A 3VRLF 2ZCLH 4OM1L 2GT9A 1XGQB 4RAVA 4CDGC 2VN4A 4JB9L 3AY4C 5HTSA 1HOCB 1XGRA 2QQNL 4QHKI 1V3JA 2HT2C 3SPVB 4F7PB 3ZLQC 4LVNC 1ETZA 2CQVA 3DURB 1Z3GL 1A6PA 1AE6L 3U4BL 1KN4L 5TQ2H 5JDJA 1ZEAH 4MD4A 1IL1B 2H8PB 2ZWLT 3E1F1 3H7LA 1MNUL 3QDGE 3BP4A 4JB9H 4NFCA 2GUOA 4HIJB 4Y1AB 2XZQL 3G5ZA 2X4OB 5E6ID 1DQQA 1S9WA 4XP5L 1R5VA 2D31A 1I8IA 2DQCL 3VFUA 5HI5C 2NY4C 3UJIL 4QHLB 2Q1EA 4CN1A 1NGQH 4U3CA 5J1TC 4QXGH 5IWLC 4NYLB 1GGIH 4KAQH 5L6YH 3T4AB 1S8DB 3MLSL 3OTTA 5EH1A 3UTTE 2DWEA 1RFDL 1I8LC 4OZHE 1BAFH 1DP0A 2VKXA 3NFNB 3ZDZF 4PGZA 1AGFA 3MJ9L 4PB0L 5LAXB 5FEBA 3UROR 4G8FB 4J3VA 4XNXL 3MRKB 1FH5H 4HFWB 3B2UD 3TFKC 5E6ZA 4NDMA 4M6MH 4PGEB 5T1KA 1A7OL 1UACL 4NRZB 4PTUB 3RZCC 5CBAA 1IC7L 2R29H 4ZQKB 1CXFA 2F9BT 2FLBT 4BQCA 3NZ8A 4OV6F 5T1LD 3WFBH 4XTRC 1H8NA 1F11B 3SKNB 1GHFH 4FXKB 4XPFL 1IGJA 2KPNA 3T1WA 1MCRA 4OZIA 1S7QA 2F54B 3KJ4C 4CVWA 1BQLH 3BUYA 2HN7A 3OZ9L 4XAWL 2Y06H 4OCRL 3CSGA 1F4YL 3CX5K 5CIPB 2V5TA 2ZNWA 4ORGB 1WT5C 4XI5C 4JN1H 2GFBA 3LQZA 3T0DA 3IU3B 3D39D 4K7PL 5D1XA 2OP4H 3MRMB 3MRNB 5GS0C 3PG2A 5C7XL 1J10A 3F7RA 5CAYB 5IB5A 3NCBB 2NY7L 5FUCE 4LPYA 3WS6C 1HHIA 4IDJL 1DBKL 3LKPA 1UJTA 1ZWIA 3SGEI 2BSED 4L3ED 2VLJB 3ZDYF 5DRZB 4X9HA 4Z7UB 4X80L 3LKSB 1P4BH 1U8HB 2GJZA 5HYIA 4RMTA 3K0WA 1FFNB 5FGBC 4UOJA 2G60H 2L4OA 4OAWA 2WNGA 3EGSA 3K2UL 4HGMA 4KKCC 3O8XC 4XPTL 5T1DL 3WIIL 4G6AD 5DHYB 4JDVA 2VDQH 3HMXA 4RRPA 3ZKMC 4D9RD 4RSVA 1CG9A 4GW4A 2HJLB 4ZO8A 4HUWB 1CF8H 4FABL 3TBVA 5EO9B 1EVUA 4CW1A 1IEBA 1D5IH 4ODVL 1MCKA 1UXSB 3LIZH 4P2YA 3IDYB 2Q3AA 1U92A 1XF2A 1G9MC 5EIIB 3WNKA 1P4LB 3B5TA 3QHZH 3PIQB 4IRJD 2IC2A 1NGZB 1E0OB 5A2JH 3G5YA 2XFXA 1EEZA 5ETUB 1ZHLB 4MA8L 5KSVA 2HFGL 2VZSA 4J12A 1U42A 4HIHB 5E94A 1CYGA 4L4TD 3CC5A 5D7KD 5HGBA 1JNLH 1NMAH 5KOMC 2WM0A 1OSPL 3TJEH 2AJVL 3ARGB 2OBGA 4P5MA 5CFHA 5H35A 2NZ9D 5MEOA 4PREA 3HS0B 4GKZA 4IIQC 4U1KA 1AHWA 5E8EB 3WEXB 4XXDA 4EUPA 4LQFL 3MGTB 2DQUH 1NL0L 1E27B 2EEAA 5J3HD 3FQUB 1CGSL 1LNUA 5IBLD 4QKXB 4NM8L 1BVZA 4ZOEA 3HE6B 4O2FA 5D1QB 4NCC1 3UMTA 3MR9A 4Y19A 2DKSA 4UT7L 4OBRA 1I7ZA 5GQBA 4QXUL 5A16B 4KZEL 3B9AA 3EDJA 1JNHA 2HFEA 2CXKA 2C3VA 3QEGH 1N4XH 2H41A 5C6WH 1BD2E 1XCTA 3RWFB 3V6OC 4H25A 4ZFFA 3AXLB 4WI3A 3K81A 1S7UA 4FQ1L 4WEUD 5B3JF 5SX4I 4ZS7L 5BCAA 1Q9LB 1R3JA 3TO2B 3VCLA 1T04A 4QY8B 2DQDH 3HPLB 3L7FB 4FFWC 3QO0B 3L3GB 2EO9A 1N7MH 1FL3A 4UNTA 1C08A 1RUPL 1QFPA 3VMNA 1YNLH 3L3IB 3ZKMD 1TCRA 1P1ZA 3FZUC 4EDWH 2FJGB 1WSST 3NPZB 2A6KB 3ZZ1A 1IQWH 4M7LT 3DIFA 3S35X 2GEEA 4TTDD 4OZIF 2IALA 4S10A 3AUVA 3CX2A 4DAGL 1ZT4B 1MI5A 1XIWD 1ADQL 2ED7A 4IRJC 1ZTXH 5DK0B 4MAUH 4E42A 1CXKA 43CAA 4GW4B 1CG9B 3K7UA 2FATL 3WFEH 3MV7B 3BHBA 1R24B 3MA7B 3ULSA 3UBXB 3T4AA 1BMGA 2D7NA 4JHWL 3RP1A 2BVEA 3BP4B 4R7DA 3EFFA 5KTEH 3RUGE 4HAFA 8CGTA 3CNKA 1KTDA 4O02L 5DD0L 3S37H 1ZLWK 5C0CA 4Z5RB 4CGTA 3L9RB 5DQJB 4XVUC 4Y5VC 5EC2B 1S5HA 5CSGA 3OXRB 4FXLA 2WW8A 3VMPA 4M4PA 5DWUL 4WFFD 3RHWK 4APQA 2EEDA 3MGOA 3CFBA 4L4VE 4AEIL 1JK8B 3V4VH 2AK1L 1NCAH 2C1PA 4WUUB 5TPWL 1T1ZA 2DDQH 1MCCA 4X7FC 5DXWA 4OLWH 2FZ3B 4ONHB 1T66D 5KS9F 5K9QI 1CXLA 3JV6B 1AH1A 3OXSA 3BKCH 4TSBH 3V6OA 3NABL 3P0VH 1AI1L 3RJQB 2AJVH 3CXHK 5DZLA 4ZUTB 2YZ1A 3HE7B 4DGIH 2ZSWB 3WV0A 2VRAA 4XPBL 2XPGB 1A5FL 1FZMA 1LO4H 1T7VA 4PJ8C 3HNTH 4RRPG 4IS6A 4YFDB 3VXQA 3HKFA 4DQOL 3H42L 4LEOA 3NFSL 4Z7UE 3V7AG 1DUYA 1TVHB 2BNQD 1OCWL 1RVFH 3IU3A 2A0LD 4X8XA 1KIQA 3AXLA 4NQCA 1UH4A 4LCYB 3AREC 4CADB 2GITA 2VJXA 3QEUB 3P0YL 2ADGA 2QV2A 3FT4B 1WEJH 4EQ3A 2Z31B 5DURB 5EUOE 3PWJB 3MNVB 4DUVA 4EI6B 4MDIB 4OUUB 4XX1E 4G8EB 1QSEB 3BYYA 3OB0K 1RAMA 3FT4A 4RIRB 3HZVB 4P23B 3F65A 5DRNB 5BO1H 5HYQA 2YRZA 2G75B 4RNRA 2A73B 1LE9A 4ORGA 1DBAL 4I48B 3X13B 2EDWA 4DK6A 5ANME 5I0DA 4F7TB 4IJ3C 4NCC2 4ONOA 4NQDA 4WI8A 5BQ7A 5GJSL 4X80H 2GJ6A 4OZHF 2FGWH 2X4UB 1MCPL 3X3GL 3WFBL 1MJ7H 1YPZA 5FYJD 4GXUM 4EUPG 2R69L 1UG9A 4QXUH 5FYJU 1MY5A 3O4OC 4PJEB 5BS0E 1I7TA 1AC6A 1LDPL 1YEKH 5E8DL 4PRIE 1HXYA 2J5LC 1L7TL 2OI9C 5ECJE 2JIXD 3CVHL 1FZOA 4D0CA 5D5MA 4R26H 4UOW1 4P46C 1CDJA 4DGIL 5FM5M 1AI1H 4L3CA 2Y6SD 1ED3A 3CC5B 5HGBB 1NFDB 4HLZG 5L6YL 1QPPA 5DJYA 4YGVA 2X1QA 1T0MB 4LLQA 2VL5A 4Q9QL 1DBBH 4K8RD 4QHKJ 3CFBB 5LBSL 4WWKB 4YXHH 4I8DA 35C8H 3AM8A 4Z76B 2JJTC 4D8PA 1DE4A 3MRGA 4NRXB 3RBGA 4MVBD 2R29L 2ZOLA 5T1LA 4M5ZH 3U0TB 1TNMA 1JTTA 3A6CL 5JMOC 1MELA 4NOBA 4AL8L 4ZXBA 3Q2CA 1YMMB 3ZE1E 2FO4B 1AE6H 3VG0L 4X4ME 2AXFA 1EO7A 3P11L 5MEPA 3MJ9H 1HHGA 4TOYH 4UAOB 2LU7A 4L9LA 3L3KB 4I3SL 1SJEB 1OGTB 3QNZA 4JREB 3BGFC 5E00B 4QF1A 2NXZD 3BE1H 3GO1L 4GBXD 2YBRB 2Y25A 1QRNA 1DQDH 3VFMB 2G60L 1OAZH 4P5KA 5M7QA 2ED8A 5DUMH 1TQCC 2G75A 2VDMH 4N1CA 4MA3B 2QHLA 4F9LC 4KKLC 4LKCB 4PJ9B 4ZPTB 3MO1B 1T20A 3VRLE 4JG1L 5CEZH 1TJHH 5A16A 4AIOA 1L4IA 3E3QC 2NY4B 5DJ2B 2HT4C 1X5XA 3SCMA 5AZ2H 1OTUC 3QDJE 4UZGA 3PDDA 3P9MA 3C60A 2DLTA 2J4WL 2VXSH 1PG7H 1X6LA 4C54A 1YN6B 1U95B 2ZCKH 4AH2A 1G7QB 1A1MB 4QRPB 2GSGB 3RGVC 1RUPH 3DO3A 2VDLL 1YJDC 2BSRA 2EYRB 2AABH 3VFRA 4PS4L 3FL7A 1MIEH 1FL3B 3GUTA 2XQYG 5J1AB 2JB6B 5FCSH 2Y4SA 1XGTA 3QXWA 4HWNA 2APTA 3OR7A 4YXKL 4HC1L 3MBEA 4KJYA 4OKVB 1UQSB 5D6CA 1F97A 2FRGP 3O8XA 4HZAA 1VFAA 3BP7A 2D0GA 5FM8A 4L4VB 35C8L 2WZPD 5GGVH 4MNGB 4NC2B 1GHFL 2XQYK 1FP5A 1PKQA 3OKDB 5J56B 2R0WL 4ZSOA 3KNBB 4ONFH 5I2IA 1C12A 4OLVL 2EECA 3EO1B 4DGVL 43CAB 8FABA 1HQ4A 1N6UA 3H7BB 5GGUA 4X0KB 4LIQE 3OF6A 3A6BL 5ICXA 4PYGA 1IM9D 1ZVSB 5IHUL 2H32B 2O5YH 4NKMA 3SCMD 3T09A 3PNWA 2M26A 4JHZA 3SE8L 3MODL 4R7DB 1RD6A 3TA3A 1JJUA 1HILB 1KUMA 2YC1B 3U6RB 5HGDA 5MERB 4PJCB 1JNNH 2NY0C 5C0JB 4N8VA 1WWCA 3QQ9C 2R0WH 3EBAA 3D2UA 1IBGH 4CMHC 5F6IC 5FHBL 4GBXC 1T2JA 4JG0L 4JO2H 4OCNC 5E1AB 3V6ZA 1QFUL 5KSBE 4HT1H 4XWOD 3KVQA 2EDXA 4XP5H 3X3GH 5JIPA 3KPRE 3LB6C 3CH1B 2OM5A 1GPOH 3UTSE 2G5BA 5IP4A 1F4AA 3DUSA 25C8L 4OZ4A 5FK9B 5IG7B 1T80A 5BZWA 4X9BA 1Z9OA 3M45A 3MRCA 4QYOA 3C09B 2DD8H 5KSAD 3BVNB 1TCRB 1X5ZA 5D2NC 3HCVB 4MX7B 2DD8L 5EUKA 4UDTA 2L0DA 2FJHB 4JM2D 1IGFH 3QAZC 5I8OL 3O2VL 4ORZC 4WFGE 5I1AA 1SY6A 1GZQB 3MRMA 1RU9H 1WEJL 4JFDB 5CZXC 3HAEA 5IJKC 2DN7A 4H8WL 4HMCA 2I5YH 3VXPA 1MREL 2YD2A 4XHJD 3BSZH 4FN0A 4K3DL 1AHWC 4NC1C 4P4KA 5EU6D 3NH7H 4ODXA 3RWHA 4HFUL 3T65A 1TNNA 1QEWB 3KJ6H 4W4NA 1B6UA 5CEXA 5F6HJ 1I3GH 1QLRB 4WJ5B 4OUUA 1CS6A 4JQXC 3RDTD 1T4KB 1AXTL 5ENWB 2EDQA 3O9WA 2EDYA 4IOSD 4MJID 2B5IB 5HGHB 1XGUA 5F6HI 3NACL 1R5WB 4R4ND 3V0WH 1M7IA 4G6ML 5ABDE 3VG0H 4R4FH 4DW2H 3NCCB 3HI1B 1E4XI 5IBTL 1S9XB 5IESH 2VH5H 3SCMC 2DYPD 2J8HA 4F58H 1UXSA 4PRDB 4YK4C 1IGTA 1WWAX 1H3XA 4R97B 1S78D 3KLHD 2ITCA 2Z9TA 5SV4A 3NPSC 2D7OA 3FQWB 1D9KC 4FZEL 5C3LD 3TBTA 3W39A 1JGDB 2XG5A 4O02H 4XWOC 1IMHC 2LU3A 2R2HB 2YPKB 3ZKSD 2DI9A 5KZCB 5D7IA 4WU5B 5DUPH 1UJ3A 1JNJA 3TBTB 2X4NA 3QCTL 3W39B 3S4SG 5IMMA 1QA9A 2XTJC 3NAAH 4U1JA 1KTKE 1MIEL 2BVOA 3GMQB 1KCLA 3Q1SH 4ETQA 1AQDA 2D0HA 4ZNEE 4DJMA 1OAXH 5C0BA 4NT6B 4YPGA 3PV6A 1A4JA 3RWEA 2FX8H 3BN9D 1LO0L 3CU1A 1S3KL 3MCLH 4U4BA 4NZUH 5IB1B 3V9FA 1WBYA 5E70A 1MCPH 3V6FB 1DQML 4DKDC 2GFBB 3LQZB 5CWSA 1TJGL 3HLAB 3B3IA 5DS8B 3G6JE 3U0WL 1A22B 1SJHB 1YNLL 4Z7WE 5ESVA 4MD0A 2IPUK 4JDVB 3DX8B 3V0VA 5CD5C 1CBVL 3NABH 5IOPA 1ERNA 2HG5A 1D5BB 1FIGL 4KROB 1NBVH 3S97C 3OJDB 2VLRE 3Q5OA 2WBKA 3FQRA 3TP4A 2DLEA 2HH0L 4CNIB 5CD3B 1FVDA 2IQAA 4OKDA 4CN4A 4KDTC 5BRZB 5CJQH 1P2CB 3RZWA 1MIML 4LAJH 5HI4C 2OR8A 1P9MC 1ETZB 2IQAB 1J86A 4HQQL 3TBYB 4YNYB 1CFNA 1Z0NA 1QBLL 3NVQA 4X6EB 3X14B 4OZGA 4OD2A 3J8F7 3K80A 3RZCD 2YOCA 3LZFL 4OCLC 3M17B 3TBYA 5B8CB 4KJWD 1T7XA 4ZODA 5ISZA 3KLAA 3ARRA 2I24N 3T1FA 3B9KA 3C9NA 4KRPD 4WW2F 4Q9QH 4N5ED 4KJQC 2P7TB 3QZWG 4JAMB 1T22B 4ALAH 1EHLL 4GW1A 3C60D 2FATH 3ALWA 4MZ3A 2F5AL 3BGAA 3WJLA 5E2TH 4MAUL 4ZD3H 1EHLH 3IETB 5CEYB 3DRQB 4LBEB 4KV5E 3LN5B 3L3JB 2ZUWA 5E2UL 4YX2H 3SE4A 1I8LA 4N90D 3LEVL 2AERT 5F21B 3EOYG 1G7PA 4MS8D 5D5MB 2H2SD 3PWPE 5K9QG 2MCPH 1HILA 5I9QC 3QIBB 5GS0D 4QGTA 4MXVE 5K33A 4PGEA 1G7PB 2ICWI 2ENSA 5L2JB 1B88A 3LKOB 5ISZD 4JGUA 1W72L 4A2LA 3H9SA 1UWGL 1BLNB 4P48A 4FFVD 4LLYA 4LSTL 4JFQB 5D93C 4KKAC 3VWJB 1NC4B 4I9WD 3PDGA 2RHEA 5F1SA 1DUZA 1I85C 1LO2L 7FABH 1LEGA 3FRPG 2FEDC 5KSBF 1MHHA 2ZNXA 2NY5L 1MFDL 5JW4Q 4YBLC 4KH2A 3WLBB 4P5TA 5IFJB 2VL4A 4W6YB 2DMBA 1C5DB 4LL9A 5FV1L 3ZTJG 2IPKB 4BSJA 4KUZL 2PXYB 2DQIH 2AJSL 2QKIB 3C6LC 1TQBB 3BKMH 3D2UD 5I1EL 3RVXC 3BDBA 4U1LB 5JPNB 1GYAA 3MRNA 2KZWA 2DQUL 1RJZB 1VA9A 4P2RA 1JWMA 4P9HC 1R24A 4A6YB 4MXVF 4HWZA 4DQOH 4X5WB 3WO4C 5HYJE 1JTOA 1W0VB 2W9EH 4LSUH 5BRZA 5J4MA 3SOBL 5I17B 1CGVA 3LS4H 4N5EC 1P6FA 3O4LA 3BO8A 1XCQB 5CIPH 5IFAH 4HKZB 1S3KH 3LMJH 4NQDD 1URLA 1KEML 1KOAA 1MCOH 2AK4E 1ORQB 3V5DB 3VGGA 3HZYB 2EDKA 4M1DL 4KKBD 5JHDB 1SBBA 4WNQA 3OB0H 1RK1B 4HJ0D 4AH2B 3D3VA 1ES0A 3KDMB 2VUOA 2RFXA 2EYTA 3SJVA 3QFDB 3FQUA 1Z9LA 3V52L 3MFFA 1T1ZB 1YJDL 4KJPD 1RJYA 4ZAKB 2PR4H 5CBAB 2NLJB 4OFKA 5IIEB 3MRBA 4XP9H 4HLJA 4XPAL 3WDIA 4HS6A 1A7QL 4IOIB 3VGEA 2PYFA 4R3SA 3RWIA 3WIHL 5I19H 1TIUA 1T2QL 4JHWH 5E5UB 2C4XA 2P8LB 2Y36H 3P77A 4YUEL 2PYED 2HTKC 2CDFA 4Q58C 5D7IB 4EXKA 1HKLH 2GIYA 1S7VA 3SDAD 1PG7W 1I3GL 1NC2B 4KZDL 5DEGA 2NNAA 1KB5H 4AYFA 3CFIC 1BZ7A 1CICB 4X99B 3V5KA 3WS3B 4LSPH 4UILL 4P2OA 2EICA 3SKJH 1A7BA 1XFPA 1KB5A 4ETQB 5D70L 3ARGC 3JV6A 4DZ8A 3KPLB 3VA6A 1HYRC 4WW1A 3LN4B 2F53D 4C57C 4CJ1A 3BQUC 4ZUVB 1H8SA 5IVNA 1BP3B 5LGHL 3GSNL 1WF5A 2DBJA 3X17A 2JKXA 1WTLA 4WI5A 1E4WL 1K8DB 1EEYB 4ETYA 1A2YA 3DMMC 3LKOA 5FUOH 1JWUB 2FLRT 2R0ZH 4Q6YA 4FQPA 2DM4A 1A6TA 3CDGA 3G5ZB 4XPFH 3VDCA 2XXCB 3V4UH 3Q5YA 5BVPL 5I8KL 5FGRA 1C8PA 5BJTB 5FYLE 3D25B 4PJBE 5DEFB 4UUJA 2WUBL 1G0YR 2RBLA 3VXMD 1PLGL 1PQZA 1XF1A 3JUZA 4IDJH 2FIRT 4NO3A 3DGGB 2FYYA 4YR6A 4YWGL 5I1DA 3O6MH 5D2LF 1WWBX 2P5ED 5ICYB 4FNLH 3KDMA 4WY7L 3L3IA 4YJZL 2DAVA 1M7DB 3D69A 2PXYC 1YYLL 5DDHB 2Z4QB 5I1AB 2FO1A 3DECA 4H1LG 1OOAA 2OXGA 4H0GA 1RZGB 4YDIH 3GMNB 4XCCL 2DLFH 4Y5YB 1PYWB 2GJ6B 3HNSL 4LCCC 4UB0L 4YDVA 4F8TA 3A6BH 1KFAH 1M7DA 2EIZB 1LP9A 2O93L 1U91B 3FT3A 2BSSB 4R4BB 4KZDH 3V8CA 1B0GB 2BNUB 4HDIA 3ARBD 1CK0H 5C0IA 5JOFB 1G7LA 4L8CA 1BQLL 5ENWA 1MEXL 4NQEA 2Y23A 1NGQL 3MROB 4R6UA 4XRCA 3NZ8B 2ZUTA 1F3JB 5FO9B 3MXWL 4NN7C 4XB8A 3HUJE 4CMHB 5GZOD 2ZSWA 1B3JA 3BO8B 4OM0H 3TZVA 3QUYB 3DBXA 3JV4B 2JTDA 5AD0A 3MJ8B 3OAUH 3C08H 3QT2A 4ZMAT 3MRIA 1QVOB 5C8JA 3HNSH 4F15B 5E94B 2YA0A 1I1AA 3MLXL 3VH8B 2R4RL 3QYCA 1LWRA 3D3VB 5C07A 2CJUH 3OG6B 5FYKH 3TM6A 4J2XA 2VIRA 1NCCH 2DIBA 5DUBA 5D2LA 6FABH 4BZYA 3VFOB 1B90A 4O51B 5TDPB 1KCUL 4JRXE 4JRYB 4QOKB 1CFQB 4ZFZB 4Y4HC 4U1MA 3Q3GA 4QTHA 5T1DH 3GHEL 3I9GL 3U7AA 4Z7QE 1GIGL 1MCBA 5IFAL 3ZKXB 2NTFB 4LAQL 5C0JA 3B2UC 1OAQL 3KXFB 4WU5A 1XR8B 1DLFH 4FTVA 4M6OH 1BOYA 4JM2F 3WDHA 3MV9B 1SVCP 3NCYP 1MFCL 3WXWL 3HE7C 4YFLI 2OCFD 1J1PH 1CGUA 3RL2A 1S5IH 5F3HA 1OWRM 2ICEB 4UQ3A 4LU5H 4MA1C 4FNLL 4WY7H 2ARJB 4UV4H 2BSTB 5INCA 3QZWA 4YHZL 3H3BC 2GK0B 1GGBL 1HH6B 5TE7H 1U8IA 3VI4E 3QWOA 5TDNB 1YN6A 4MHHG 1DFBH 4TRPL 5MENB 4Y19E 3F5WB 2IAMC 4D2NA 1MFBH 3U0PA 1GH7A 3T0EA 4J3UA 1AKJB 2VISB 3VWKB 3W0WB 3BZ4B 1X7QB 2SEBB 4Y4KD 4NQEB 4C55A 5BMFH 5DJXB 3LEXA 3T04D 5J8OA 3QWRD 4NNYA 3MBEB 2Z93A 1TPXB 4K94H 1A7OH 3S34H 1AJ7H 1BX2B 2XZAH 2ATPA 5I30L 4P9ML 4HWEH 3AS0A 1OT2A 2JCCB 4R26L 3RJDA 3ULUC 2JJSC 1A6AB 4XP1H 2HRPH 4JDTL 3LVEA 2VZVA 4IMLB 2RCSL 1VFBB 5L2KB 4ENEC 4NDMB 2VWEC 4HLZH 3BEWA 5CBEA 4X5XB 2P7TA 2ENYA 4LHUB 1WFTA 2IPTL 2UV3A 2ZPKH 4HKXB 1MI5E 1B9ZA 5EG6C 4NRYA 4U1KB 2L7JA 1YEDA 1JZ7A 1VEPA 2ARJQ 5JXAL 1NGWB 5F1NB 4YBQD 3SDDC 3QDGD 4OQ1A 5HHNA 1BQSA 2W38A 4EN3D 4HULB 1RURH 3ZMRA 5F96H 4ZXBB 1I7RA 5H8DA 1OAYH 2OSLB 3H3PL 1LE5B 3GM0A 1NEUA 4MQXC 4RFNC 4N1HB 5E5RB 2B0SL 3QHFL 4NRXA 4YHNB 2CUIA 3TT3L 3U4BH 3TYGH 3FFDA 4NQXB 5HDQH 5C0NC 3OB8A 3FQRB 5F88A 2NZ9C 3UTZA 2EIBA 4NN6C 3KPOB 4FTVB 2BJML 3TIEA 1WVZA 2DF3A 1EBPA 1F3DH 2NX5E 3PWLB 3RVUC 1U8PA 1PY4A 3LKQA 5D1ZB 4XC1L 3C6SA 2A83A 4MNQB 5HXMA 4X8JA 3MLWH 2I9TB 3QWQB 3UJTH 5EDXA 4DKEL 4GKOA 4C58B 4DCQA 2E7BA 1ZVHA 3P4LA 5DR5H 5SWSE 3FO9B 3B9KB 3C9NB 3I6KB 4BQ9A 1ZLVH 5HYJD 1LO0H 3MUGB 3PHOB 2FX8L 2HLFC 3GBNH 1RVFL 4XNZC 1ZOXA 4PJ8B 3PP3H 3N06B 4G6KL 4X6DA 5J6GB 2CMRH 4XNZB 4HUVA 3D9AL 3V4VL 1Q0YL 3BD3A 5E2UH 1QQDB 1JPST 4G6FD 1BFSA 4WGWB 3TO4A 1CFNB 4Y16A 4LCIH 2ICWJ 4YUEH 2VWEE 4HIXL 3CK0H 3BKCL 4KKNA 4M6AA 5KW9L 4RDQG 2FH8A 4LHUA 4M93C 5EU7E 3MUZ1 3WUZA 2W0KA 1IKNC 3F58H 2FWOB 2VABB 4K7PY 3BRDA 1S9XA 4G8IA 1G84A 3ZT5A 3V52H 2F8XC 3FOMB 5DJ0A 3QUZD 1MRCL 4FXKA 4O5LL 1FNLA 3SJVD 2XXMB 1XCTB 2CMRL 3IDNB 2GJ6E 3F7YA 1RHHA 4WUUA 5C6TH 1NLDH 1AO7D 5JMRA 1UGNA 4WWKD 4G9FB 4QHUA 4TUOB 4NQSA 1P5UA 4KK8C 3TO4D 1RZIA 1PEWA 3ZDXF 1YY8B 1UVQB 3EOBA 2VZTA 4F9PA 1I1YA 5CZXD 2E9JA 2HH0H 4NQCB 4DGYL 2W9EL 4LSUL 4OGZA 2W9DL 5BS0A 1U8MB 5GRYA 1MUJA 2Z92B 4CVZB 1Z9SA 3WFZA 4XXDB 1Y18B 2PKDA 4MAYB 4E41E 2GSIB 4ELMB 1KPUA 5C6PB 3NN8A 3LKRA 3VFPB 4ZFOA 3WO4B 4NBYB 5HHOE 1QR1B 3I3BA 2G2RB 3DYOA 5HHPA 4Q2ZB 4F2MA 2PF6A 3MR9B 4Y19B 4ZS7H 4GMSH 1YEJL 4M61A 3FFCD 3T3ME 1EVTC 3LSOA 2P5WD 3DVIA 5C3TA 3MREB 3OKKB 5I15H 3AAZB 4NHCL 4JZNA 2PW2B 4J3XA 2WV3A 3MV7E 3P73A 4P2QA 5HVFB 2IALB 1KV3A 4I4WA 3BP6B 3HZKB 3MA7A 5D5MF 3EDKA 3R06B 1T5WA 3MCKB 5KVFL 5CJXC 2R4RH 2VLMD 5DJ8B 1X9QA 5GHWH 1CFSA 3B83A 3GSXB 1C1EH 3R06A 2F8VA 1X5IA 3OSKA 4OM0L 5KW9H 4D0CB 1NANH 3K3QA 4KZEH 1J8HB 3CK0L 3DXAA 1U8QB 4BSWA 3UZQA 1OT1A 4YEFA 2D7TL 1L9MA 1OGAE 1DSFL 4OIIL 5C08B 1UT9A 3NBNA 4GQ9H 2CLRA 3MODH 4JDTH 2LTQC 3O11A 4NQVB 4MA8H 5GS1A 4NO2B 1BQHB 3EYFB 4DW2L 4W4OC 2ZOKA 3QNXB 5MI0C 1JPGA 2C5DC 2OTWB 3C5SA 4BFIA 2VDPH 1PDKA 3KLSA 4WHYG 1YC7A 4K94L 2HRPL 1MRCH 5AWNH 4LPXA 1NEZB 1H0DA 5KG9B 4KK9D 5DYOA 5BXFA 3AROA 3EYFA 2C26A 5I8CA 3QFJD 5J12C 4BSVA 3S34L 2E9WA 3IFOB 4ZUSB 2H1PH 3UTTA 4NZDA 5D7LE 2WBWB 2MQ3A 3TCLB 4KPHL 3OKEB 4PY7B 3IAQA 4WWID 4RGOH 3MXVL 1P4IL 3F7QA 3RNKB 3EO9L 2W59A 2C3VB 3DMMB 4OF6A 1MCDA 4NNXB 3BIAX 1FDLL 4G9FA 4QHUB 4QHNB 3GIVB 4Y4KC 5F7UA 5TE7L 2QTEA 3H9SD 5DMKA 4Q7DA 2Y6SC 3VFMA 3VGAC 5E08L 1IGJB 3OKNA 5IB4B 3JWOC 2AAVA 4YPJA 4Y2DB 4I5BB 4L8SC 1I8MB 4OCSH 2PTVA 4JHAL 2DS4A 3G6DL 5DJZB 1TVBA 2UVFA 4M9OA 5IBUG 2ZG1A 4XBEL 2ESVD 1SHMA 4QRQB 4G6JH 2AKRA 5E5MB 1E6OH 3E2HC 1V7NL 3F62A 2DBLH 2G9HA 1JUFA 1RZ8A 1I7ZB 3EDDA 3ZO0A 5FA4A 3IFLH 1R0AH 3IDMB 4K7PH 2C3GA 5H37H 5SWZA 1XMWA 5HDOA 4L8BB 1R3HA 1HHJB 5C9KA 2KBGA 2V2TA 3FONA 3SO3C 3QIWC 1F8TH 3MLVL 4NM4L 1K6QL 3NA9H 3BIKA 5JPMB 1H3PL 5DK2A 2BFVH 4JM2B 4RMRA 5B38B 4U7MA 5HHXL 5DUML 5KN5B 1JHTB 4KI5D 1CGXA 3ZKQD 5DJ6A 5JORA 1XAUA 4U33A 3QI9B 1MQKL 1CGYA 4ACPA 1LMKA 2DIAA 4IRJB 4PJHF 4C56E 3QI9C 3RL2B 4EI5B 4JN1L 2AI0L 4K71B 1W72A 3W11D 3KPRA 1AGFB 1U2CA 5ALBL 4UIKH 1ND0B 4FZ8H 1UM5L 4XC3H 4PG9A 1WBZA 5GRUH 4J1UA 4PG2C 2I9TA 1MF2L 4F9LA 4TUJA 4U1SA 5GRXG 4FZ8L 4RQQA 2CJUL 5F96L 5FYKL 3PWUB 1G7IA 4I2XA 4GUPB 1T0NA 1QYGL 1FCGA 3LQAH 1FZJA 2PW1B 4QRTA 5JXAH 2FSEA 2RAMA 4E42B 3KLAB 4L9LC 2CR6A 4FFVC 2X4UA 4Z95L 3FQXB 1GGYA 1T03H 1TZHB 2XWBB 4Y4HB 3VFOA 5FHBH 1NGYB 3LY6A 1T7YA 4NKIH 1MEXH 4ZTPL 3QULB 1CDHA 3QIUD 2XN9D 1KPRA 2Y5TA 3VXRB 4UB0H 2RCSH 2E7HA 2FH6A 2W60B 2VDOH 3UC0H 3ZSTA 4XP1L 5JO5A 1HN1A 1FO0H 3RWFA 3TNNA 1KSRA 1A64A 5KVEH 5FB8A 4P49A 4XCFH 2E7MA 3C6LD 2HVKA 1WK0A 1MFCH 3KYAA 1IGMH 2ZOKB 3QNXA 2HFFA 5L8LB 1ZEAL 1MJ7L 2KQNA 2AV7B 3MV8D 1SM3H 1BM3H 3R0MA 1IC4L 5DD5L 2K7QA 3UDWC 4A2MA 1TJHL 1NMCB 1LVEA 2NX5D 4QRSA 3D87B 3A67H 1CFTA 4EKXA 4P5TB 4QF1B 1QLEH 4K8RH 4Z76A 2VXQL 2VDML 2OR9H 4M93B 4HG4J 2AXGA 1IGFL 1FDLH 3KS0J 3VGHA 4MDIA 4LGPB 1SEQH 4U1NA 4CRPA 4OM1H 1I8KB 4V1DD 2VDKL 5F9DC 12E8H 3HRZA 4E0RB 1SMOA 1KYOJ 1KN4H 4OZHB 3F5WA 3BW9A 1TITA 1MCLA 4MJ5A 1D6EB 4PJXA 2P42B 2J88H 2VDLH 3UBXI 4L5FL 1F58H 25C8H 5ELIA 5CGYC 4YDJA 4GRMB 2Y9RT 5F3BA 5H2BB 1U36A 4KJPC 4R9HA 5KN5A 2GTZA 2NW3A 4UQ3B 1AD0B 4OI8A 4RAUB 2VC2L 1C5CL 3ULSB 3QO1B 5C0AB 3CDFA 5EIQA 3LEVH 1E6JL 3SDDA 1QLFA 3QRGL 2C9AA 4L8BA 1K3IA 5JDSA 4Q97A 5JOPE 5EU5B 4X7TB 2EXWC 3LH2H 3O3AA 5DA0B 2CSPA 2YSSA 3BKYH 2EDEA 1RUMH 2V7NA 1DQDL 4PRNB 1U8NB 1KCSL 3PP3K 2AJUL 4Z7OF 2CDFB 4Z95H 1ZVYA 1FN4A 3JVGA 3O6LH 4QT5A 5IW6B 1IEBB 2DB8A 4TOYL 2JJSA 4W68A 4CMMB 5I1KL 1NFDA 4YDIL 1QYGH 3ARGD 1XR9B 1D6VL 2WIIB 4ZAKC 4B41A 4X6CA 1XGTB 4PJHB 5I1GL 3ZE0F 4PBXA 1ZLUK 4YWGH 2PR4L 4YHPB 1QBLH 2W9LA 5T3XD 1WFUA 2WBJB 4KK5D 3B43A 4Y5XA 4PJ7A 5C70A 3UTPE 5LBSH 3IB4A 1I9EA 5JW4N 5IROC 3ILQD 3T8XA 5FO8B 2ICWB 1U3YA 4OZGE 1MQKH 1QO3A 3CVIH 1MCOL 5TDPA 5DD3H 4F7EA 1HHIB 1MWAA 2X44D 5HYEA 3G08B 1YMHA 1ZT7B 2N7AA 3OX8A 5D1ZC 5D2LB 4LLMB 3VXUA 2BFVL 1PZUB 2W0FB 3NFPB 4TSCH 5KS9A 5TDOB 2AJYH 1KPRB 3BZDA 3KHQA 3HAEB 1HH6A 3IFLL 4X9IA 4U31A 5FDWB 4OT1L 5D1QC 2HJFB 1AO7A 5LJYH 4X6BA 2EZ0C 4H5SA 4Y5VA 2OLDA 2DQFB 1NAKL 1QFHA 2EH8H 1R3JB 4HBCL 4KHTH 1KIQB 1U6AL 3WLWC 3V4UL 5BV7C 5GRVL 4WHTB 3EZJB 3TVMD 1UKQA 4XHQA 5FM5O 2BVPA 2FD6H 4NIKB 4P46A 1LO2H 5C09D 4XPHL 3DVGB 1JN6A 4NQCE 5IQ9A 4LRNH 1CCZA 5A2LH 1CQKA 4CNIA 2AV1A 1MFDH 1B6DA 1NGZA 5E7FA 4NUGH 1BD2A 1KLUB 1YEFH 1ZA6A 3RY6C 4F57H 5ID0A 1TZIA 3O3AB 7FABL 4HUNB 3F58L 4F7MB 1P4IH 1G6RA 4K3JL 1M71B 3H9HA 1NQBA 2FEEI 3CFDB 2BCKA 5DSCB 4ODUA 3SDCA 2FHFA 4Z5RA 5DJDB 1M6OA 2AEQH 4Y5YC 4I0KA 1EFXD 4L8SB 3QIWB 3C8DA 5IVXF 3MGOB 4YX2L 4NQDE 3HG1D 2KZ1B 3BZEA 2BY2A 3UYRL 3PWNB 2VZOA 4KK5C 3JZ7A 2J12B 3GSXA 1DDHB 2YPLA 2ID5A 5CHNB 1R3IH 2XICA 4FQXA 1U3HC 3OR7B 1QLFB 2D7TH 5AD0B 4GAGL 1MRFH 4GH7B 1JNLL 2BC4A 5BW7A 2Y72A 4LCUB 5GSVA 3MCG1 3O9WD 3W2DH 1IGIL 1MJ8H 4PB9L 3BH8A 4RMWA 3N1QC 3GSVA 4L4TE 2X89A 3LDBC 4FFYL 5FGSA 5I1LA 3HE7D 3EO1A 4RZCA 1QVOA 4JRYA 4QOKA 4H20H 3TLRA 1CXIA 4HQQH 4XWGH 3RWDB 3VXMA 5GRZA 1CICD 3CX5J 4JZOA 2AKRB 4GAFB 4F15C 5T3XL 3D3VE 3S37L 4PRAB 5C0CE 4JLRB 3HMXH 5DD0H 4NGHL 1YN7A 1NBQA 3CGTA 4WV1B 2W60A 4P2CG 2A73A 1LE9B 3U82B 2CUMA 1Q9WA 4ZPVB 4BFBD 2GJJA 1RURL 5EO0B 4TNWK 1GPOL 1OSZA 3EJYD 3SEPA 3T0EC 1QFWH 2BHZA 3DX8A 2BVQB 3OKLA 4J23A 4JDZA 2VZUA 3QAZB 4UQ2B 2IFGA 3QPXL 3DHJA 4HEPG 5DQ9A 5GGVY 1B0RB 2OR7A 4PRIB 4GRLA 1YNTA 2NYYD 5IMLA 3HZMB 5TH2B 4MZ2A 4J3WA 4R0LA 4M1GL 3ILPA 4YC2B 4U7KA 3DGGA 3KPTA 4KKAD 1MHPL 3TV3L 2F19H 3WNNA 2ZUVA 4X98A 3AVEA 4EDWL 3U30B 1H8OA 5GS1C 1W0WA 3VXNA 4K94C 2X70B 3M8OH 5F1KC 1S9VA 4JJHA 5EO9A 5EC2A 1LO3L 2BVUA 2NY5H 1N7ML 2FL5B 3QDJA 4PBVC 2JCCF 5EU6A 5DD3L 3IKCA 5HGGS 3MCKA 5I2IB 3K1KC 3KPPB 2IPUG 3BGMA 4LDLB 1SBSH 5DJ6B 3RKPA 1N0XL 5B3JE 5C2BH 5J11C 2XRAH 3AM8C 1OLLA 2APWA 2H26B 2HFGH 4MLIA 3MBEC 1PVHA 3GNMH 4JGMA 1C5BH 2P8LA 4F58L 2WIIA 1UQSA 3QXTA 1CFVL 1NDGA 4YHLH 3VFNB 1KLGB 4N9OB 4LBEA 3PDOA 3EJZC 3JWOL 3MRBB 4JFHD 1INQA 1J1OL 5EUOB 1PKQB 4HS3A 1U8NA 2QJDA 1FQ9C 3V0WL 1OB1A 3SGDI 1BAFL 1EX0A 2C3WA 4ONGL 5DJYB 1OTTD 4NKOB 4DZ8B 4YGAB 4JFEB 3JV0A 4LHQB 1FRGH 4LSQL 4H1LH 4IHOB 1FYTA 3RVUD 4WI2A 2YEZA 5DEGB 4R2GD 3P3YA 3MZGB 1QSEA 4OFYA 4Q6IA 2APBA 4LLWB 4NQSB 3UJIH 1XIWA 2OJEB 4X9GA 3X11B 2MWCA 2X4SB 2VC2H 1N59A 3TN0A 5D7KE 1RU9L 3E0GA 3LZFH 2ADJB 3GIZH 1GGCH 5DMKB 5FO7A 1N59B 1KCUH 3H0TA 4JE4B 2HTKD 6FABL 3ZE1F 3ALXA 1FZKB 2BSRB 2EYRA 4LNVA 5F7DB 4KDVA 3RNQB 5HD8C 4HIEA 1T04B 2CLZB 3CFCH 5EPMA 3BEVA 1SEQL 2OQJB 3K2UH 2W92A 4XXCC 1BGXH 2X7LA 1G7HB 1MH5A 3FB5B 3ARED 3B3IB 5DS8A 4KXZH 4X4MA 1I1AD 3SY0A 5D2LE 5DQDH 1HKFA 5IT2L 4D0DA 1S7XA 4YDVB 2Q6WB 1NUNB 3CPLA 4GSDL 5BOPA 3CSPA 5IOPB 3O4LB 4NZTH 4QHMA 5MEND 1IFHL 4XVJL 1OP9A 2LFGA 1BQHA 1WAAE 1FG2A 5CP7A 1KN2L 2C3HA 3G6JB 4N90E 4QHLA 1WBXB 5EZOL 4NZRH 5IESL 3SGJA 3SE8H 2HYMA 4P2RD 4HS8H 4EOWH 5KVEL 2QLVB 3TA3D 2NY3D 2ZP0T 2F54D 5F7WC 3MRJA 2YUVA 2H32A 1J8HA 4NKMB 4XNUH 1INQB 2R23B 4HUVB 1EBAA 3G5XA 3ARQA 5JA8B 4ZUTA 1XGYL 2X4TB 3IJSB 4ZTPH 1NPUA 1E4XH 5CINH 5EZOH 4IBLT 1MLCA 1NMCC 3KNBA 4FS0A 1A14H 4M1CC 3HB3C 3D39B 3LPFA 4HK3N 3QHZL 3CVHA 4OGYL 3RX7A 1HHHB 5GGVL 3VD5A 2DQJH 1IAII 2JE8A 4JREC 4OFIA 1ZLWH 4PY8J 3PV6B 4ODVH 1DTUA 3ZTJH 1N2RB 2CRMA 5C07B 1QFWI 2XZQH 3T3MF 2VH5L 2ADIB 1LE5A 2GTWB 4JFDE 3VRIB 2DTSA 3HA0A 1UACH 4Y4KA 4Z8FL 4O51A 4R4FL 1RIHL 4H26B 3BH9B 4QHNA 2KQMA 3VFSB 2GY5A 1P7QA 4W81A 3UTSD 4NNXA 2HJFA 1CE1L 2CDGA 5FB8B 2DM7A 5IHZB 3L7FA 3WFDH 4K07A 2K3TA 5HSFA 4CADA 2FX9H 4RBPH 3CFJB 4MDJB 1FC1A 3CLEL 5C0DA 3DX6B 3OKNB 5DRZA 2IQ9L 4PJBB 1ZANH 4MJ4A 4HKBB 3BJLA 5TJWK 1KIPA 4C56D 4ZFFB 4M7LH 2H3NB 4GG6F 3JWDL 1VESA 3QCVH 2IQ9H 4Y88A 2LVEA 3FOLA 3L1OH 4Q74A 3RIAK 1KXVC 1V3MA 1FL5A 2H45A 5DZOA 4JKKA 4IRZH 3D69B 1UCBL 5E03A 4RMQA 5I8OH 1T2QH 1PGRB 2YN5A 4U05A 2DBLL 5IHUH 3I50L 4LCCA 5B8CA 3L3DB 1OAKH 1LP9B 4M8VA 4RIRA 1GZQA 4U1IA 3EZ8A 1HDMB 5TQ2L 4H88L 1FAIH 1UKTA 4KVNH 3IGAB 4WI4A 4OGAC 5H94A 1JZ2A 4P9HH 5DDHA 3B9KD 1WC7B 3KYKH 1J0ZA 2VLRA 5E8OB 3A6CH 3QXDB 3GI9H 2YR3A 3CXDL 2ZG3A 3PQYB 3T0EB 3MRHB 1BQHG 1KGCE 1MAML 2IBBA 5IFHL 1K85A 3EYQC 1MCWM 3BFOA 1DDHA 4ZUSA 1FFOB 2LVCA 5IR1A 1SYSB 1UXWB 3RGVD 4K3HA 1FV1B 1KEMH 2XRAL 5CINL 5F7EL 2YPKA 4HC1H 3GMLA 1N6QL 3UBXA 3EO0B 1EJOL 5EU5A 2IGFL 5GGTA 5GJTH 2XKUA 2LABA 4LLUB 4PS4H 1MSPA 3UYPA 3WKML 4KK6D 1LNUB 2DQGH 5I1CL 1I1CA 2RQ8A 4HJGA 3I3EA 2VERN 4PRDA 3VWJD 1UM6L 1D9KB 2NNAB 1EJ6A 3B6SB 2AW2A 2R69H 2VMFA 4OI7A 4FQXD 5I1EH 4XBPA 4QRUA 3BKML 1DUZB 4RGNC 5BW7C 3UEZA 3MV9E 3PABB 3S36X 1BZ9B 2UYLA 2PYFB 4U1MB 4D9QE 3CFEB 4N0UA 5CJXA 3TPUB 3L3GA 1EGJH 5GJSH 2OX5A 2A2QT 4JM2A 2UZIL 3RNKA 5I1HL 1HXMB 4HF5H 4L3EB 4AEHH 5K93A 1OD7A 2RGSA 4BM7A 1VDGA 4DEPC 5HPOA 1JMXA 3BYTA 4XNMB 5IMOB 2WINB 4KKCD 3O8XD 4NGHH 4O2CB 5BO1L 5DD6B 1H3GA 2AGJH 4IDLA 3FB8A 3SKMB 3MJ7A 3MV7D 2KL6A 4UDTB 4HV8A 4LRIA 4JZJA 4AIZB 3A6OA 1BWWA 5DD6A 4NQDB 4N0CC 4WO4C 2E7LC 2ADFL 3FFCB 1O7SA 4D9QD 1U95A 4PLJC 5ITFB 5KSUA 2R9HC 4NO3B 4YR6B 5C0BE 1N5AB 3B9EA 1S7UB 1JPSH 3T1FB 1MHEA 4RNRB 3MRHA 4XPBH 3CFJA 3EYQD 3R0NA 4MDJA 3VG9B 1UZ6F 5T3ZE 4GRLC 5HDLA 4NSKA 1D5MA 2QADB 1UC6A 4ALAL 1ZHBA 2QADC 3RWGA 4N8CH 3P0VL 1A1MA 3VDAA 5TGBA 4HKJB 1FE8L 3DYPA 1I9JH 1IAOB 4MMZC 1X4ZA 4P2RE 5DJ8A 1F42A 2BSSA 3IRPX 4R4BA 5LAXA 3RAJL 1Q9OB 5E6IA 1DEEB 4AQ1B 4ZDHB 1J12A 3VXRA 1OARL 4POUB 4RQQB 4G42B 1N0LA 4WW2B 4Z7NF 5HDBF 2VLKD 1HWHB 2VB5A 2V7NB 4PRNA 4BFIB 4HH8A 4FQXC 1T0MA 1X5GA 1XF5B 5F7LB 5GGTH 3WFCL 5JUEH 4EBQH 1TJIL 4YHYB 2BVOB 1RUQL 3HE6D 1J0IA 3K2MC 1RSFA 4KHXL 4PIRF 5B8CC 1DBBL 4Z7VE 1KGCD 1OL0A 3UPCA 2DMKA 5I1JL 4GKSB 3W9EB 1G7IB 4I2XB 5KSAA 2IAND 2FHCA 4M1DH 5F7FA 1A9BB 1AHWB 4UNUA 5E8EA 3WEXA 1FFRA 3BMVA 2HT3C 5MHSD 2B7DT 5DURD 4LLQB 4N0UB 1SYSA 2Y07H 3VD3A 3GSRB 4Y4FB 3FAWA 1MVFA 1N64H 4PJAF 1CL7H 3WFEL 4CL7A 1S78C 4Y16C 5E7BA 2EXYD 5C0RL 2IADA 5JR1H 2BNQE 2GI7A 4NQUA 3Q48A 3TVMA 4K55A 4PJAB 3QEHA 1WZ1L 2IH1A 2W07A 3TEUA 1NC2A 5EZJA 3FZUD 2E3VA 1CT8B 1OCWH 5DUBB 1JPFB 4EEEA 1IAIL 1MVUA 2XKNB 3NA4A 4XGZB 5EORH 4TSAL 5C0RH 5TQ0H 1QFWL 3QEQA 3V8OA 3QXVA 5AAWA 4HG4K 32C2B 4Z7UA 2ESVB 3QG7H 4KVCH 3S8WA 2DQDL 2C7UA 4U6TA 5CZVH 4H5SB 4Y5VB 4FQQB 3OF6D 5J12B 3NPSB 4D0DB 2B4CL 1B4JH 3QRFM 4TUKH 2XTJE 2R15A 4LSTH 3DX6A 3HPJA 4AEIH 4YQXH 4J4PA 1B2WH 5IJVB 3SDXF 3RUGB 1BF8A 3NCYS 4HZLA 4S11A 5L9DL 4IOFD 4LSSL 3I6GA 1BIIA 1CD8A 3ARBB 3U83A 3T4YB 3IAGC 4OD2B 2IG2L 1RJYB 4ZAKA 2NPLX 4HAGA 1DN2A 4NOFA 2ORBH 1T3FB 2BERA 2P5WE 3VD7A 5FOBB 4JY5H 5KTEL 5I1DB 4PB0H 1BOGA 2J5LB 4ZOCA 3ARXA 1J9CT 2X9YA 4JFEE 5ITFA 3V5DA 4BSWB 1ZHNB 4ZD3L 5K9JL 5L2KA 1H0DB 1XGPB 4QO1A 3BKYL 2WQ8A 2YK1H 1J88A 4Z0BH 1VGEL 1MI5D 1CN4A 5ACZB 2LAGB 4OLZL 4X6DB 3BAEL 4QNPF 1LP9E 1NCAL 1U3JA 3MLTA 1BHGA 3NTCL 1NUFA 2WBJC 3MRPA 1RUAL 3O4LE 5E1HB 4DN3L 3OHXA 1KB9J 3S9DB 3GMPB 3U6RA 4NQTA 2J2ZA 4PJ7B 3G5YB 3WNLA 3C60C 2NY1D 1UJ3B 4YLQT 3HR6A 2EKSA 1PX4A 3STLB 4QTIH 3LN4A 3QEHB 3JTSA 4NWTH 3BPNB 3CH1A 4BK5A 2X1XR 1J5OH 1Q94B 4HJJH 3SJVE 3MRDA 2D0FA 1BZ9A 4PLNC 1Z3GH 1LK3L 2RB8A 4MCYB 5C2UB 1G6RL 5EU3A 1BEYH 3QEQB 3ROLB 1T83C 2X4NB 5IMMB 3MQIA 4KY1H 1BD2D 2JJUA 2KDGA 3S3JA 3PWPB 3WIIH 3U9UA 1MJUL 3FCTA 3VGBA 3MACL 1YEDB 2XG4A 1Y18A 2B1AL 3DX9B 1JVKA 1G9NC 1U41A 1YEGL 1ZKAA 5C0BB 2YD5A 3LKSA 4WTZA 4I3GA 3FONB 3ARTA 4JRXA 4YIQB 4GLRH 5DC0A 3O6FA 3QFJA 5GSRB 3ZTNL 2OSLA 3HI5H 1DQQB 4KUCF 1W0WB 2A6IA 3QDMB 1IQWL 3IDIA 1H5BC 4O00A 1ZT4A 4XMKH 1OSZB 1UH2A 3S88L 3RTQB 3MJGX 1WIPA 5IQ9B 1EFQA 1T22A 5B39B 1FNSH 4O9HL 3ARVA 1WITA 5HPMA 1MHEB 4Y7MA 3HHRB 3K4ZA 5IVOA 3QXAB 4OLVH 2BY3A 1MLBB 3TJHC 2WAHA 5FXCH 3DOSA 3RPIA 2YD6A 5F71A 4PJ9A 4XMKL 4ZPTA 4LVNB 4K3EH 4BFGA 1E4KC 2AXHA 1MLBA 1RIVL 4PRHE 3PL6A 5AG8A 1LEKB 5F89B 3QQNA 3PF2A 1LP9F 4MQTB 4QEGA 4LCCB 3WCYA 4YE4L 2PW1A 3WNOA 5GIRB 1KT2B 3BUTA 4HK3J 3C87A 4TVSa 4GXVH 4D9RE 3QUMB 4S0TD 1BWMA 3ZHLA 4H0IA 3SDCC 2PTTB 4ODHL 4TUJB 2BXZA 4U1SB 5DVMA 1IGCH 3I6LD 3MLXH 3NGBC 5I16A 5D7SH 1F4HA 1P84K 4RGMB 5A40E 1AQKH 3BUYB 4PJXE 5D1QA 5JOFA 4HH9A 1JP5A 2XY1A 1YMME 4XPTH 4CMMA 3DYMA 5IW1A 3Q5TA 4L3EE 1AY1L 1NFIA 1RFDH 1QACA 2HRLA 2QBWA 1J5OL 1W2KT 1F90L 4QWWC 1AXTH 3G04A 1P69B 3IJHB 5JHLH 1DQLH 4F3FA 5E8PA 2NXZC 4R8WH 1FZMB 3S5LB 1PJ9A 4Z77B 1IM3A 1V8HA 3RX8A 4OCWL 2Q76A 1YECH 3D6GA 4H0HB 1XH3B 4M7LL 4Y1AD 5DC9B 4JFQA 1PFCA 4LARH 1VKXB 1JZ6A 3JUYA 3UYOD 43C9B 3IDXH 4U1JB 2I5YL 3TIEB 3X3FL 3IDGA 4I3SH 4PJCF 3RU8H 4YDLC 4WWKA 1CVRA 5I1IL 3BD5A 1S9KC 1V7NH 2BHYA 5K9JH 1RIHH 2ATKB 3E8UL 5BZDB 3C6SB 1AP2B 1JPTH 4MNQA 4XNQB 2E6QA 4KTDH 2AJ3A 5F8RC 5BVPH 4NPYB 1U8LB 1K8DA 3SE9H 2R0ZL 4XCEB 3VMOA 3WL9A 1I8KA 3ZKXC 4KMQA 4ODBD 1LQSR 3A67L 3QQ4A 4TN9A 3KPOA 4MXWH 4ZOBA 1PX3A 1E4WH 1KJVA 1EO8L 5CMAA 4OI9A 5JPMA 2GJZB 2NY6D 3LEYH 2N7BA 4HT1L 2YN3A 4WFEE 1VACB 3GJFK 2MKWA 1JGUH 3BQUA 4KTYA 3TZVD 3CFDA 2DQTH 2P48B 1AKJD 5IMLB 1RZ7H 3FO2B 2NX5A 2EDDA 3IU4H 4NQED 5DJ2A 1NFDF 5JW3H 1OVZA 1ZA6B 5TE4H 3HCVA 4MX7A 3CPLB 3NIDE 5EUKB 1LDPH 1YEKL 3Q6FB 2OZ4H 2BZDA 5KS9E 5L8JB 1HYSD 3MLSH 3K8KA 3BXNA 3EYSL 5EUOF 4MQ7A 1IQDB 1DLHA 1B0GA 5GIRA 2DJUA 3P4OA 3CUPB 4A6YL 3C5JB 4X4YB 4TSAH 1H3WM 1FO0A 1TZGH 3PWVB 3JBG7 5DRXB 4P57B 5I73C 4DKAA 4LVOC 1F3JA 2XTJB 3G6AB 2BC4B 3LRHA 3WIHH 5I19L 9CGTA 3BOVA 5BV7B 1RHHB 1FL6B 4D94A 1YYMH 1KNOA 3WHXA 3QCUH 3D85B 4ODSH 3TH3T 3CFCL 4H25B 5ITBH 1QKZH 3T08A 1WT5A 2HT2D 3V0AC 2EE6A 1A21A 4Q0XH 3VXTA 2VQ1A 1A7RH 2ERJC 5DTFB 3RI5F 3I6LE 3RWEB 1HHHA 4P3CH 3MC0A 2HN7B 4PJ5D 5L8KB 2UZYB 1JGLH 3FHQA 4Z7WF 1HQ4B 2QSVA 2QQNH 5EU3B 2H6PB 5D1XC 1CI5A 2Q3ZA 2XQBH 1RUQH 4NKOA 4JM2C 5AUMA 5HHPB 1QR4A 2QSTA 4X99A 3V5KB 3MOAH 5GGQL 3PP4H 1GGTA 2CLVB 4ZUVA 2E8YA 4L29B 4DK3A 4X8JB 5F97E 3MREA 1RJLA 3AMLA 1R0AL 3GSQA 1WZMA 4TVPD 1NSNH 2MKLC 3WN5A 1R3HB 2AJ3B 3GO1H 5E95B 3G6JA 4LLDA 3TZVC 3VFWB 1HHKA 4RAUA 2HKHH 4ZTOH 1QRND 1ZS8A 1JRHH 1JHKL 2I26N 4EDXA 5JORB 3TIDA 2LE9A 4ZFGH 4POZD 4TNVK 4QRQA 3UPRA 3OQ3B 4MJ6B 4N1EA 4PRPB 1RULL 2YA2A 5D1ZA 1ZGLM 3UJJH 4X6FA 3P30H 1A3LL 2DL2A 3EFDL 4S1SH 1HSAB 2JJWA 3VXME 1FCCA 5EPMB 5FYLD 5HHOB 3VXSD 4RGOL 4JPKL 3QNYA 3KLHC 3B5HA 4MNGA 2XA8L 5BQ7B 4NKQB 1XCQA 5JQHC 3MNWB 2OZ4A 1GL4B 2JELH 1A6WL 1MOEA 1N6VA 2APVA 2AEPH 3FQNA 3VXOB 3VW3L 3DI3B 1VGKA 5ISZE 3DHMA 2X9XA 1DBJL 4J4PD 4YXLH 2FJFA 3GB7A 1PBYA 5I8CB 5TGBB 1KC5H 2GKIA 4Y16B 1X5JA 3TN0C 3ESVF 3U1SH 5GRWA 4IM8A 1KB9K 2Q7NA 5LQBL 5EIVA 3SE3C 4XI5D 3S36L 4PJGB 5SWSA 1ZV5A 5J13B 3RY6A 4E41B 4ELME 4NBZB 4NP4L 5HVHB 1SJVA 1VPOL 3ARDD 4R96B 1KT2A 3RA7L 4FQCL 5C86A 4LPVA 1IGYA 3UTOA 3QIBC 3R4DA 4MD5B 5JQ6H 4DKEH 1C1EL 4H1LA 4DKFH 4GRWH 4W6WB 3PWPA 2QQKL 4M7KL 4JFED 3GM8A 1J8KA 2BRRH 4HW6A 1JGVL 2E6JA 1LGVA 4QYOB 2IH3B 1QG3A 5J11B 3HFML 3H9SE 1O7VA 4CU8A 1JF1B 3SBWC 5T3XH 15C8L 2BJMH 5EA0L 1OM3L 4LSVL 2DWDB 4K9EL 5D96C 2A6IB 4L29A 4GMSL 3O2DH 4PJAA 5HI4D 4R90L 3NCJL 3WFHB 2MPAL 3N50A 3U46A 3B9KC 4G9FE 1VERA 4MD0B 2DLGA 2IF7A 3QA3A 3D5OF 5ID1B 4I13B 1FIGH 3UJJL 4PB9H 3WJLC 1BJ1H 1Q1JL 3RZCB 5EOTA 2X4OA 2A9ML 1RZ8B 4Q9RH 2B8OT 3U0WH 4V2CB 1D5ZA 3MOBL 2CLVA 4M7ZB 4WUKH 4KRPC 5LCVL 3TJEL 5DFVC 3O3EA 1IAKB 3LDBB 4GRWE 3RQ3A 2OMNA 3WD5H 4I48A 1ONQB 1RIUH 3BPCA 4JPWL 5L88H 2FNBA 1G9NL 2FJGA 4G8GB 4F37K 3AMKA 1OGAD 1RZJH 3M17A 4NWUH 2CKBL 3BI9X 4HGWA 3L5XH 4PJXF 4XVTH 3GKZA 1OAUH 4GRMA 2YPVL 5FCUL 4XCYA 3KPQA 3PGCA 3GI8H 5IR1B 3MOAL 2AK4A 4I77L 5GZND 4RGND 4C56A 4HUUB 4OCMC 5F9JB 5JHLL 3PQYA 3QUML 3QIBD 1K5NB 5FOBA 1M05A 3FTGA 1TQCB 4P2QE 1ZMYA 2P8MB 5EBLB 3BT2L 3DMMA 5EFIB 4CU6A 1FORH 3L3HB 4RISL 2EDOA 4HX1B 1EAPB 1U93A 4UBDC 4OZIB 2FD6L 4IIQB 4PJBF 1YDPB 3B4NA 4MQ7B 4BQ8A 4QRRD 4R96A 2DM3A 2EH8L 5DRWB 4M6NH 4NKDA 5CS7A 3EUUA 5BXFB 3DWTA 2I60L 3DXAE 3LRGA 1U9KA 1FNHA 3GBNL 3PGFH 4JO3H 4L3AA 3MV8A 4G6MH 1NGYA 1YMHB 1ZT7A 3GMRB 1WAAA 3SKMA 3NACH 2XPGA 2VAAB 3HNVL 2CIIB 3VFVA 5JXEC 2C7UB 2CO6B 4OQTL 3O6FB 3ZE0E 3GMOA 3QUXA 3EYSH 4EQ2A 2VAJA 1DUYB 3D2UB 1XIWC 2D7PA 3MRLA 1KACB 4UMGA 4DCQB 1XIWB 4Z7QF 1A47A 4GJTB 4HIIB 1A6TB 1P7QB 3CDGB 2X2YA 1T1WB 3VXUD 3DUUB 1TETL 5D7LA 4DTGL 2GJ6D 5J6GA 2KUTA 1IKNA 4KXZI 2QHRH 2NW2B 3L6FB 3KYNB 5ESQB 4FQJH 1CLYH 1MCNA 3QA3B 2HJKA 4PLOB 5GPRA 3VXNB 3LEYL 3QEGL 4NO0A 3BPOC 1EHAA 5KAQG 3GZKA 5C71A 1FGVH 1KCRH 3L95B 1INDH 3WMSA 4P2QD 3KWWB 3KPPA 1M1SA 1MFNA 4RGMC 1MJUH 3RL1A 4QNPE 4F7PA 3BPLC 5FIEA 3O6LL 2EIEA 4M4RA 3BZEB 2R23A 1D5XB 1LK3H 1A6VL 4LFHG 1HXYB 3TWCH 5IEKB 3F7YB 3JSSA 1CK0L 4M7ZC 1Q0XL 2BDNL 1NCDL 4KDWA 4PY7A 3B9VA 3OAYK 4MAYC 4KWUA 3IDJA 3CZFA 3NZHH 4LLUA 3RGVB 2QSCH 1C5CH 1UVQA 4OFVA 1I1AC 2EH7L 3ME0A 1NC2D 3DV6A 1MRDH 5DHYA 2YUXA 1YQVL 2BY0A 2QQLH 4XH2A 5J3HC 1RZGA 5ALCL 2OMBA 2CGRH 5EBLA 1A1OA 4FOMA 2YMXL 5JNYA 3TWCL 5E2VL 3WXVH 4X4YA 5IB3A 1GAFH 2YA1A 1QSFA 5IKCA 5LWYL 1YDPA 2AK4B 4HH9B 1NFDE 4N0YH 2NXYB 5L7XL 2NY3C 4XVSL 5GS0L 4JY4B 3D0LB 4OTXH 5IIEA 5MHSE 5I76B 3MO1A 2V5MA 3TPUA 1ACZA 3MV8B 4YXKH 3TBSA 4I2XE 1IGCL 4XMLH 1YEEH 5T1KB 3VI3F 4K8RL 3IDNA 3TNNB 4FQ2H 2RR3A 4JKLA 1FYHB 4PJ7E 5J13C 4M9PA 2PXYA 2BNRB 4I0CC 4PJFB 1BM3L 2XIDA 5ICZB 3CZJA 4JM4L 3AC0A 4M03A 1WCBA 5BVJA 1FL5B 4LVEA 5E99H 4GG6E 4Y8DC 3VXMB 2B39A 3IDGB 4BUHA 1N0XH 5C2BL 5I66A 2OP4L 5F6IB 1TLKA 4LEXL 5I6XB 2B5IC 1JWUA 3KPRB 4PRBA 2UY7A 3FO0H 2ED9A 1FSKC 1W0VA 2BOBA 4P2OD 3RWJA 1DN0A 2YBRA 4X6FB 1QSVA 4PP2B 3LHPL 2R2BA 4I4WB 4UOW0 4R7NA 4V2BA 1GIGH 2CRIA 3FMGH 5GISH 1QD0A 2DWDA 5JXEA 5EU4A 2ICES 4M3JA 4EVNB 1AO7E 2R2BB 3F7VB 3WYRA 5EORL 2NY2B 4GO6B 3DPBA 3BKJH 4O4YL 3VFWA 3RI5K 2Y36L 4WHTA 5SX4H 2YD1A 1PZ5B 2V5YA 4M1GH 1WZ1H 4PJGE 3GDBA 2PO6B 3B8SA 4M43H 1AD0A 3QPXH 5FA3A 3O4OB 2PO6C 1PKOA 3GSWB 2W91A 4XP9L 4ZS6C 3QJFB 1UB5A 1L6ZA 3VRJA 2H26A 1QNZL 4JO4L 4NO0B 3DX7B 4JFYB 2NY5C 4UIKL 3SY0B 4XNXH 1H3UA 2NTSP 4ODUB 1I85A 3R8QA 5D72H 4GMTL 2CRZA 2X10A 2DYPA 4QHMB 2Q76B 3QUYA 3EO0A 3EYUL 3B2VH 4HWUA 5T1MB 3OAZH 3HTLX 1H3PH 1GGIL 2R1XA 4JANB 4KAQL 4WDIA 5MP6L 1TVBB 1KFAL 4HDIB 1IC5L 1LK2A 1S7SB 1S7WA 2IANB 4HHAA 5IB3B 3WIFB 5GGSY 1SY6L 5SWSD 5AYUH 4NN6B 1YYLH 1M7XA 2OJZH 4OLYH 5EZLB 2WBJA 5HJ3A 2PUQT 4P59L 2OJEA 4BFEA 2OXHA 1V7ML 2Y7QA 2YKLL 1DQJB 5EOCJ 2VDRL 3SQOH 3WD5L 1EPFA 5EZLA 1LO5A 2FECL 2N56A 1MRFL 2GITB 5EN2A 4OCSL 4OLXL 2ADJA 4MD5A 2ZOLB 3MNZA 2CIKA 3ZYIA 4MJIB 3VXRE 5A3IC 1I1FB 2OK0H 2PNDA 3MGTA 4ZUUA 1G7MA 5FYJH 5EN2B 3P4NA 3MLZH 1WBYB 1I4FA 1K2DB 4AIZA 3P9WB 4S1RH 5IBLC 3V2AR 1FZKA 4AG4H 1LEGB 1EAJA 2AEIT 1JL8A 5HDBE 2FECI 1L0YA 2ZZUT 1KJ3L 1BFVH 4Z7VA 5I17A 3R1GH 1AGDB 4JKPL 4UIMB 1OP5H 1KCVL 4Z7NE 2D31B 1C5DA 1ONQA 3VFUB 1X5KA 1HNFA 5D7IF 1DR9A 1FVCB 2YZ8A 3L95A 4NHUB 3P4MA 3U4EB 2VDPL 1X4YA 2UUDH 3GSWA 2MCPL 4FQIL 4MWFA 1KELH 4JPIA 4U0QB 4B50A 3H42H 3VA2C 5FUCC 2FEEL 1YY9C 2BNQA 1WBXA 4OIIH 4JQVA 2QQQA 2VR4A 5A1AA 4YHML 4F7MA 3ET9F 4PV9B 1YNKH 1DVFB 1T1YA 3PIQA 2H2PC 3S35L 3CSYA 1UB5B 2AXJA 1IZJA 4P4KC 2XWTA 2EDTA 4WO4D 3MSPA 3J7HA 1ZE3C 5GHWL 3BN3B 1FNGB 3N1PC 5C0CB 1VKXA 3RHWF 3SDXE 5MP6H 4WEBH 5DA4A 1BZ7B 2OL3B 1U3HB 3BP5B 1MWAH 2VR9A 1MCHA 1J1XL 4WCYH 1P9MA 3KPMB 4R2GB 3JTTB 4JFHE 2EYSA 1KPVA 4G7YH 3PV7A 3MRFA 5KSAB 4JKWA 4Y19D 2P44B 2D3VA 3UTTB 3MNZB 1TJIH 5D96B 5I71B 4G80A 4EJ1C 4Y2OA 2WLYA 5I71C 1VFBA 1QNZH 2HFEB 2VDNH 2XY2A 3MLYH 3O3DB 5MEQA 4FMKA 3MRRB 4LSDA 3H0TB 2YPLE 1ZTXL 1K4DB 2A74B 1Y0LA 1IEAA 4JFEA 2W9DH 1BPVA 4UV7H 5D4QA 4MJIA 1FAIL 1JFQH 1F00I 1JWMB 5L2KE 3NIGE 3RDTC 3IFNL 2MTPA 4PRAA 4MSWB 3AREB 4XBGA 3OKOB 4WO4A 5T5FL 1KCSH 4GG8A 4LLWA 4NFBA 3PWJA 4PRID 4H26A 5HJ3B 4M62H 4KTEH 5HHOA 4LMQE 5ICYA 4TULH 3O45B 1UYWL 4JRYE 4JRXB 4QOKE 4PJ8D 3WN5B 3FO0L 3K1DA 4CBPA 4LEOB 4KQ4H 5LVEA 1S7RA 3QCTH 4P2RB 3O81A 5D1QD 3L3KA 5D8JH 5JPNA 3P73B 3ULVF 4FQ1H 3IJYB 1U92B 4QXTA 3MV7A 1C7SA 4L5FH 2HKFH 5F70A 1NLBL 4U1GC 5FYKU 4G8FA 1PD6A 4PPTA 4M61B 1A7RL 4EI5A 3THMH 1VACA 1XF5A 2P4AB 5IQ7H 4UU9A 1FN4B 1NC4D 3NIGF 3DXAB 3AAZA 3I02A 5TFSL 1Y6NR 2VQ1B 5JLZA 5CUSL 3MZTA 1BJ8A 4PTTA 3ROOA 2XTLA 4LQFH 5JA9A 1A4KB 4AQOA 4X0KA 3L5WB 3MUY1 3TBVB 1MAKA 3MRPB 4M3KB 3RY4A 2DLHA 2Z8SA 3NCMA 3H9SB 2VYRE 3I2CL 5IVXE 2DI8A 3GKWH 3AS1A 4IOFC 3C5ZA 3HC0A 5C0GB 5C0FA 1PY9A 5DLML 5IW3A 3GMRA 3MLWL 3ZT6A 5ADOH 4U6YB 4JY4A 2J6EA 3ECBA 4U1HA 5TF1H 2CUHA 3D18A 2WUCH 2A38A 3MLUH 3QHTC 4Z9KB 3EIFA 4G42A 3P2TA 4FHBD 3GMOB 2PYEA 3WKMH 4OIBA 2I27N 1NMBH 4LVOB 1NCDH 1Y0LB 1RZKH 4IIQA 1QTYT 1INEH 1RZIB 5F9OH 2EO1A 4G3YH 2BVTA 3O2VH 4YDKL 5DVKA 1F4WH 1UZ6E 1T2XA 4LCWB 2H9GB 5SX5H 2B4CC 3ARFA 4WFFE 3TT3H 3VXTB 3DNKA 2WP3T 3CDCA 1QO3B 2B2XL 2WINA 1GZPB 2WWKT 1IEAB 3H3PH 2OQJA 2Q86A 4MA7H 3N85L 4MMXC 1P84J 4P23A 3RY5A 1BREA 1JGEB 4JFDA 3QB7C 1ZT1B 2DTMH 1WTGT 2LTQB 3L7EA 3OJDA 3PGDA 3LD8C 3WUWB 4NJ9L 1DQJA 4WI6A 2DQHL 4HV8B 5E4IA 4KVNL 5J6HB 1YMMA 1JPTL 4X83A 3T65B 4OF0A 3S7GA 4WGVB 4NPYA 1YEIH 3T0VA 5KAQF 5KSUB 3PHOA 1II4E 2IPKA 3C60B 3HI6H 3LN9A 3FQNB 1OGTA 3QNZB 1F13A 3HN3A 4NO5A 1J8HD 1IJ9A 1GGCL 5DEFA 3L5HA 3CCHB 2YD8A 4U1LA 4EI5C 4S2SA 4UU9B 3KR3L 3BDYH 1VENA 3KPNA 2P5EA 3QJHA 3BWAB 1QOKA 3D39E 4GG6B 3QXAA 4OCRH 2NYYC 1HEZA 3BESR 4X7SL 1A6UL 1IKFH 3AU1B 4JFXA 3ULUF 3S3SA 3ARDC 5DLMH 4JFPA 2XNAA 1FNFA 4FQHB 5MENA 3Q6GH 3AY4A 3IVKB 4ISVA 3I2CH 3S3PA 4GAJL 3CSYB 1S7VB 4MNQE 4HGWB 4UTBL 3H2WA 5T3ZL 1RZFH 1A7NH 5EZIL 2F53B 4FQXB 2PO6A 3KXFE 4PJCA 5E2WL 3RFZC 2F53A 1T6VN 2XTJD 1S7TB 2DICA 5T3ZH 5DK3A 2DQJL 3TJHD 5ILTH 1I3RA 2V2XB 4PLKC 2E27H 1J7VR 1JYXA 3GMMB 4E9LA 4YC2C 1KJ2L 1ZXQA 3UO1L 2LV4A 1NJ9A 1MLCB 2WUCL 3VGFA 1NFIB 5IWLA 3WHXB 3WXWH 5BS0B 2Q8BH 5AZ2L 3MRDB 4PJDA 4FA8A 1EEUA 1IGTB 5M95B 5F7DA 1OAUL 4PJ5B 4R97C 3WSQL 4JG1H 4GKNB 4J8RA 4GOSA 1I4FB 3BSZL 4L4JA 1MRDL 4Z7OE 5K9KA 1LEIB 1F2QA 2EDRA 4HCRL 5L0QC 1KULA 2QSCL 4N8VG 4TPRL 1O5DT 3CXHJ 1MFEH 7CGTA 1TXKA 1GZPA 5HYQB 3JVGC 2HWZH 3NFPA 5IF0B 2F19L 3D0VA 3UX9B 4PG2A 3K4AA 2P1YA 3NCEB 3QQ9D 2VXVL 4HJ0C 4HMEA 2AXFB 5F7HA 2HVKB 4N0UE 3SGEH 1PSKL 3FB6A 3AB0B 5DQDL 1G7QA 3KYOA 4ZUUB 4N5UA 2JCCE 4YO0A 3HR5B 1QRNB 2E5EA 1PQZB 5IHLB 5C92A 5CD3A 3T2NH 1EXUA 1R3KB 3MA9H 4NNPH 5EBMA 4JZJB 3VE0B 1T20B 2E7LA 4OZFG 3E6HB 1UYWH 4LKXB 2B2XH 4AY0A 5C09E 4G7YL 4YNYA 1RZKL 3I3DA 4UBDD 4JRYD 4QOKD 2CLRB 4LHJB 2FYYB 2HLAA 4TQEL 1S9WB 4WEMB 5ACLA 4DTGH 3SDAB 2A1WL 2DWEB 3OL2A 4RFOH 5E6IC 4MWFB 3RIFK 3QIUC 4EUPB 2R4SH 3I02B 1NMBL 1P4LA 4MGXA 1JK8A 1F45A 3B6SA 1FGNL 2ZUUA 3MBXH 2OL3A 5F3BB 4FQLL 2X4PA 2VL5B 5J9PA 2R2HA 4PJEF 4HFWA 5TE6H 4U0RC 2YEZB 5FOJA 4YFLF 8FABB 1FRGL 4LSQH 3DUHA 1N3NA 2L7UA 4M5YH 5GRJL 3U4AA 3BX7C 4RFEA 4RMSA 4LCWE 3BQUD 3O0RL 5F1OB 4WTZG 3ARSA 4QRPD 4U3XA 1CDBA 3IYLW 4ISVB 4J6RH 4OLUH 1NC4A 3BPNC 1N8ZA 4KQ3H 5TFSH 5D9SB 1CDGA 2AJZA 1NAMA 1V3KA 2NW2A 3ZT7A 1MFAL 4J3TA 5D7JA 4JHBA 4MNGE