1HWGB

1:2 complex of human growth hormone with its soluble binding protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
203
structure length
194
Chain Sequence
b'EPKFTKCRSPERETFSCHWTDEPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH HORMONE
publication title Crystal structure of an antagonist mutant of human growth hormone, G120R, in complex with its receptor at 2.9 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (hormone/receptor)
total genus 31
structure length 194
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1996-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwgB01
3SKMA 1HI6A 4GW4A 1HHJA 2VABA 2VLJA 3ZYJA 3PDOB 4KI5D 1VPOH 4JDVA 3TZVC 1MLBA 3KPLB 5H35A 2VAAB 3BHBA 3BSZH 5C0BB 5F7FA 5E8PB 4YHML 1J87A 3ZDZE 4Y4FC 2FNBA 5TF1L 1QQDB 4PJEF 3EKCA 3W2DH 5BS0D 4UOJA 5IFAL 1ADQL 4K3JL 1DVFB 1QBLH 1Z0MA 3SKUD 3UJJH 5FECB 1E4WL 4OCMC 4Z7OF 3B9DA 2UV3A 2X7LA 2EDEA 4R9HA 2YMXH 2OL3B 5EORL 4Z0XB 5JIPA 1F58H 3C6SB 2DM7A 4F2MA 5DD3H 1BX2A 1RZIA 4LMQI 4NHUA 1RULH 4KU1A 5CGYC 5BOZG 2E8YA 5AZ2H 1BOGB 4ZAKD 4L4JA 1UT9A 3G6JA 3K4ZA 2CKBH 4HGKC 4JRXB 1EIBA 1KXTB 2NW2B 3G5YB 4ZFOB 1CGSL 4EVNB 1JZ3A 4DW2L 1BQUA 1G7IA 2AJYH 5KSUB 3BRFA 4POUB 3UTQB 5KANI 1ITCA 5HHMD 1C5CH 4Q9RH 5DK3A 4HMEA 4WDIB 2YR3A 2HVJB 5LBSH 3PXJA 1ZGLM 2YS4A 5ACLA 4WTWA 3MC0A 5HPOA 4S0TD 1KLUB 4F9PC 4J6RH 3QUZC 2C7UA 1KJVB 1ZT1B 3QCUH 4ZFZB 3QXAA 3OAYK 3HFMH 4M6NL 3WLBA 4MQ7B 4E0RA 5KTEH 4S1SH 3QRFM 4MB3A 2GTZA 5F70A 4C56D 1T0NB 2B8OT 2V17H 4M6OL 4R3SA 5IBLC 1R24A 1NBVH 3BW9A 1I3GH 3GSVB 3RWEB 5JPMA 1TJIH 1T2JA 2FLBT 5BV7C 4OZFA 5CD3A 3FTGB 1T5XB 3N1MC 1KTLB 1DQQA 5HHNB 2DF3A 4QYOA 4LVOC 4Q97A 2R23B 1BQHB 3ZE2E 5FF6B 2AQ2A 1ZS8A 3JUZA 3MA7B 3UJTL 4XTRC 4ZUUB 3FO1B 4PP1D 1WFUA 3L5XL 2J3SA 5DRNB 2WNGA 1ADQA 4GQ9H 4JFEB 3C5SB 2BSRB 4LASL 3TN0D 1ONQB 4X80L 4NWTL 4N8CH 2ZUUA 1FGVL 1IE5A 3UTOA 3MRLB 1P5UA 1NGZB 3CZFB 3RWJB 4FQ1H 2F19L 1RFDH 5D7KD 1B9ZA 1F90H 1T1ZA 4FQQB 1AR1C 3WNNA 1ULVA 2FEDD 4PTTB 3UZVB 3KS0J 4GMSH 1KJ2H 3O81A 1MHCB 3KNBA 3KPOB 3QWQB 3V7AG 2R1WA 5BS0A 3W0WD 4RDQF 1T3FA 3QUKB 4U05A 3TIDB 3WXVL 2A9NL 2Q76B 5GJTL 1MRCL 4M5YL 5TFSH 3ARRA 1F8TL 2PW2B 3WNLA 4QRPB 4JN1H 3F6LA 4G8IA 4YHPA 2ADGB 5INDB 5FCSH 3RP1A 3VFSB 4XX1G 4ZAKA 5BOPA 2F5BH 4X7EC 1HEZA 2DQGH 4LCYB 2KPNA 3MXVL 3RWDB 4FABL 4WUUD 3MRNB 1FIEA 4GT7A 3SE4C 5FM5O 5SWZD 5DJCB 4QEGA 4KRPB 2Q86A 4LRNH 1DDHB 3CXDL 3D1MC 5FB8A 4QF1A 5J0BA 1FORL 2VXUL 3L3OA 5ESAB 1K4CB 1J1XH 5KVGL 2BNQE 1J8HE 4LLAA 3ESVF 5DEGB 4ZSOB 3S3JA 2E27L 1Y6NR 1ZVYA 4Z7VF 4D94A 4HUUA 5B39A 4KQ4L 3IB4A 2FJFB 4Q9QL 4XCNA 1R5VB 4JM2B 4P48A 3BYYA 4JFPB 1KELL 1H5BA 3C6LC 1Y18B 5HI5D 3RUGA 5LGKA 1BP3B 1MPAH 2H3NA 2AXFB 5E4IA 4C56A 3D48R 1JWUB 1YMME 1N8ZA 2Y6SD 5E2WH 4YHOH 5GHWH 4EBQL 1TETL 5TQ2H 1ZMYA 1AGEA 4NHCH 4ODHL 5F7DA 4G6JH 4L3EB 1MCBA 3EOBB 5I1HH 1CD8A 5CZXC 1N6UA 4I5BA 4DFHA 5IWLC 4YNYB 3C8KB 3VD3A 2APBA 3MOAL 4Z7VE 4JG1H 4MAUH 2XKUA 3QDGB 2DQFB 1N64L 2NX5E 3TN0A 2BCKB 3RHWK 2LAAA 1RUKL 4JR9H 3ZHKA 4D0CB 4PJFB 1JGDB 3AS1A 5TDNA 4OBRA 4WI6A 1SBBA 3I6GA 1A4JB 3U0PB 1PEZA 1TVBA 1SBSL 3ARED 4BSWB 2AJZA 1JPST 5TDOB 4YPGB 2JCCB 1A7QH 4PLKD 1N0XH 3MFFA 2QTEA 3C08H 5H8DA 3F65A 3RWHB 1RHFA 2VLMD 4F7EB 3W0WA 1S7VA 4DWHA 4DZBA 3O3BB 1AC6A 3OJVC 3LIZH 1F6AB 4WHTA 3T4YB 2H45A 1ZTXH 2D9CA 3UBXB 4OD1H 5DC9B 2H2PD 1U8KB 2W60A 4HJ0D 4XP6H 3WKML 4DKEH 1XGPB 1YJDC 5F3HB 1RZFH 2K7PA 4I3RL 3TF7C 3MYJA 2X4TA 5HGHA 1EBPA 4G42A 4TUKL 1HCVA 1U9KA 1YMHA 5C0BE 4C83B 4WUUA 1UC6A 1S9WB 5D93B 1F4YL 1ZHBA 4DGIL 5A3ID 5SWZA 1TNMA 1YQVL 5C2BL 3U1SL 1OL0A 2WINB 3T0VA 3B6SB 3LS5H 1OAQL 4XPHL 3MXWH 5IESL 1T83A 4IOFC 5ANMB 3K4DA 2O61A 4L3AA 5L2JA 4YDLB 1JRHH 3FO0L 2ADFL 2AV1B 3U0WL 3ELAT 4PYGA 1DTUA 1YNKH 5F96L 5IB1A 1CTOA 5FUCC 5I18L 1FZOB 2JTDA 1T04A 2NXYC 3VG9C 4I1NB 4X6DF 4I77H 2I5YH 4KGJA 3IDXH 2H8PB 4QXGL 5M95B 5HXMA 1YN6B 3GO1H 3SKNA 4NUGH 5E7BA 2X1WL 3Q6FA 4LSSL 4I4WA 4NZUH 1IEAB 2IBGA 4JRXE 4NWUL 4FQLH 1MFNA 2A1WL 3NFNA 4U1LA 2GFBB 3L5WA 4EUPB 5JHDB 1WFTA 4Y2OA 2NY3B 2FZ3A 3HZMA 2IBBA 1RV6X 1W0VB 1CLZH 3FB6A 4X7FC 3THML 5FDWB 2ARJQ 2R56L 3VH8G 1NSNL 4PRPD 5ITBH 2OJEB 2A6JA 3DHJA 3IDYB 5E95B 2AQ1A 1WEJL 1J7VR 4O2EA 1BIHA 1PD6A 2GAZA 2HMIC 3UPRA 3S35X 4JPWH 4TOYH 4HXBH 4OCXL 3QXDA 4J3VA 2ZUSA 4LARH 3HE6B 5I1CL 2Z4QA 4HQQL 3ZLQC 4GXUN 3QUMB 5T3ZD 5ALCL 1PQZB 1DBAH 1W72B 1JF5A 1CWVA 1U8IA 4UTAH 3E6HB 4FQXC 5EG6C 4N1EA 3FRPG 2X5PA 2ZCLL 2HVKA 3TO4D 3WYRA 1LO5A 3EO9H 3MCLH 4TYUA 4NZTL 3Q6GL 1P2CB 2C5DC 4AEIH 4JFEE 4JANA 1MI5D 5JORA 1IFHL 3RKDD 5HPMB 4G8FB 5I30H 5CHNA 3MYZA 3UC0H 4UZGA 5EO0A 2VXVL 2M1KA 1YC7A 1N5YL 2NXZB 4FFWD 4DEPB 3IVKA 5T3ZL 3HMWH 5B3NA 1OGAD 4MQTB 2SEBB 3AM8C 4Y5XB 5F7EL 3OZ9H 1EAJA 4WO4A 4HS3A 5MERA 1KC5L 3QZWB 5AUMB 1QSED 4YDJB 1KENL 1H3UA 2UWEE 1FO0B 5IV2B 5ILTH 4FQJH 4HKXB 3BH8B 4YFLF 2APTA 3PWVB 5E6ZA 1HSAB 1XGUB 3TPUA 2VIRB 4CVUA 1ZHKA 1FYTD 3PNWB 2DLFH 2J8UF 1L7TL 1UM5L 3GSOB 4KPHH 4G6MH 1CFBA 3LQAL 4XP1H 5T5NG 4R8WL 1KN4L 3VGAC 4O2FB 5BVPH 4M6MH 3IFNH 4QRPE 3OAUL 2DQDH 2N4IA 4F3FA 5JLZA 2DBJA 5EO9B 5TH2A 4JM2F 2XN9B 3V4PH 4WI4A 3HAEA 3BAEL 4U6HA 2O5XH 1YN7A 3BIKB 3SGJA 5LKNA 4V1DB 4IS6A 3CFKA 2Y72A 2WWKO 1S9XB 5GS3A 4RAUB 5CZKA 1EBAA 1FSKB 2QSQA 2IMNA 4P2QD 4X6CA 5INCA 3HG1B 3QPQD 4DQOL 4KQ3H 1CT8A 4ZSOE 4PRPA 2VJXA 2J4WL 1UEYA 2WP3O 3MNWA 3RVUC 4RMQA 3SDDC 3MJ6A 1REIA 3DI2B 3LQZB 4Y8DC 5DXWA 4LLDB 1ES0B 2WLYA 2NR6D 5D5MA 3MREA 3BP5A 1HKLH 1UCBH 2OQJB 4OGAD 1BAFH 5EUKA 4U7SA 4XBGB 3OKDB 1XGRB 3ES6A 3GB7A 3MRBB 3VD9A 2VKWA 1NMAH 3LOWA 1MIML 4L3EE 3ARSA 3QIWD 4AENA 1Q0YL 1DN2A 1YEDB 4L29A 4JFXA 1CU4H 5FKAA 4ZOCA 2EDRA 1GGBL 4CMMA 4AEHH 4RAVA 3QDGE 2G75B 1YUHB 2VE6A 1NLDH 4KKCC 5EB9A 2APFA 1R3LA 5J9PB 4ONGH 4HK3N 4PJFE 1IKFH 2OYPA 3DUHA 5EBGA 5A40E 1QPXA 4QHKI 3RI5F 1EGJH 4YLQT 1G7QA 2R1XA 3QIBD 4B50A 3SDAD 2NY0C 3MRQB 4J1UA 3F12B 4WEMB 4AJ0A 4FFYL 2JCCE 4DVRH 3PP4H 2AERT 5CLTA 5CGTA 3TH4T 1QSEA 5CCKL 4X4YA 2YEZB 4GW5A 1CE6B 4OGYL 5JPNB 3MLSH 1DLHA 1FYTA 1G0DA 3MLTA 2GT9A 5FA4A 3CSYB 2Q6WB 5CP3H 4YE4L 4EIGB 1H3PH 2HLAA 4R96A 1MY5A 3BIBX 1NAKH 3MRFA 2NY4D 2PTVA 3RFZC 5DJ6A 1BVKB 1IEBB 3LS4H 4JZNB 5CWSA 1ZGLA 2ZNWA 5F9JA 3BT2L 4PGDA 4YQXL 2GJZB 3DV6A 2GSGA 3BPLB 5KW9L 2WUBH 4UDTB 4ZD3L 3M45A 1KLGB 3MX0A 1PLGH 2OR9H 2NLJB 3B5HA 5KSAC 4OLVH 3VGHA 4UI2A 1EPFA 1GHFH 2VDKH 4U0RC 1DEEA 3WMSA 3CSPA 4KKLD 2R4SH 4PRBB 3UDWC 2X10A 3V5HA 2WIMA 5ISZA 3U0TA 4OV5A 2BJML 4IIQC 3LSOA 4DKFH 5ANME 1CQKA 5EOTA 4A2LA 3EDFA 4PP2A 4I48B 4P2QA 5CSZA 3CVHL 3KPMB 3KPNA 4LLQB 5T1LD 5A1AA 2YN3A 3TBWA 3FQXA 4H0GA 1WCBB 1FPTL 1QFWI 1R0AL 4IRSC 4NZRH 4PD4K 1AC0A 1R6VA 4XCEA 3X11A 2C3XA 1EEQA 1RIUH 2VXQL 5GSRB 1C16B 1HYSC 1BHGA 4N5ED 4FZ8H 4MAYD 4MDJB 1INEL 1U8LA 4OI7A 4PG9B 4KMTL 1JE6A 3HE7C 1MHHA 1A4KB 1JI1A 5DI8A 3FONA 4YHZH 4P59H 2AJ3B 2P8LB 2PYEB 1FFPA 3T09A 2D9QB 3NN8B 4HT1H 5FYKU 5JHDE 2E7MA 3BWAB 1W0WB 3ARBB 2EYRA 4M00A 5C0CA 5B3JF 3JVGC 3T0WA 1T0MB 4WV1B 5T3XH 1FV1A 4MDIA 3ECBA 5CJXC 1EO8L 3HI6H 5DJDB 1HIML 3NGBC 4ZOBA 4BYHA 3VXSB 2V5TA 2X70B 1ZANH 4IEFB 3M8OH 4J7RA 1NUNB 3GUTB 1OTSD 5GGVL 1A1NB 3DX8B 3H3KA 4Z0BH 2DWDB 1RVFL 4L4TB 4RGMC 3QIBA 5F88A 5BJTA 1PSKH 2EDOA 1MIEH 1C12B 5IFJA 2P45B 3QXVA 4KUCF 5C8JA 2OJZH 3MRDB 1JHTB 3U46B 4JVPA 2CDEB 2V2XB 1KFAL 1JUFB 4ISVA 2MHAA 3ZHDA 3K8KA 3KJ4B 1AH1A 4CN1A 4PJCA 1A5FL 4FNLH 3TBSB 2OCFD 1Q9LA 1I1AA 1LK3H 4JO4H 1FBIH 4HIXL 5D7JD 4X9IA 1FVCB 3X13B 1QLFB 2OX5A 3TC9A 4BZ2L 3K1KC 4BK5A 2FEEL 4D8PB 3LKOA 2HT3D 3NCCB 1SM3H 3VWKA 4X5XA 5IT2H 4ZTPL 2VR9A 2WWKT 3TZVB 5I76B 1IAIH 1UM6H 2L0DA 4WHYH 1RK0A 4OCWL 5AAMA 1WICA 2QKIB 5IVXA 5HBBA 2YD6A 5JOFA 3W5NA 4OZHE 1T7ZA 5T1LA 4D0BA 5DD6A 4MA1B 3GJEB 1J11A 5H37H 5DMYA 2V6HA 2CKBB 4TVPD 4YXLL 1NCBH 3Q48A 5IB4B 4JO3L 3D2UD 3X14B 4MAYA 2BSSA 2QADB 4M48L 4YK4B 1EHXA 1NDGB 2VDML 2XN9E 1BWMA 5DHVH 3CSGA 5C0DA 2I07A 3OV6A 2NTFA 4NC1E 1KIPB 1XF5B 2CSPA 3HUJA 3G5ZB 1CXHA 4XC3L 1WT5A 1GGTA 1JGEA 1SVZA 4KC3B 3VFNB 4V1DE 1M7DB 2CUIA 4MXVF 4K7FA 2YD4A 4XT1C 3S36L 4LHUD 3C60D 4LOUC 3Q5YA 2R0WH 3ZT6A 4TVPL 4I0PD 3SCMC 3S96B 3WIIL 3HG1E 1WLHA 4PJIA 1DUYA 4M03A 2N56A 4TULL 1WZ1H 2HRLA 4YO0B 2JJTC 2P5WB 1KG0A 1YA5A 2AK1H 3GMOA 4HMCA 1MJJA 2MNUA 4YEEA 2Z31D 5FGSA 4XVSL 1GZPA 4KDWA 4WFEE 1S7TB 2EYTA 4HFWB 1F6LL 2R0LL 5EZLB 2A0LC 4MNHA 2F58H 4O2CA 4BFBD 3QUZB 2YPKA 1HZHH 1LDSA 1CDYA 1A7OH 4FXGB 3WS3A 2X4NB 4QOKD 5C3LD 2YD9A 2YRPA 1NEUA 5C7XL 3PGDB 4DOHB 3BKYH 1F00I 4Y2DD 2B4CL 2B5IB 4LSPH 5EDXA 2XNAB 2H2SC 5GGRA 1NANI 2BP3A 2AV7A 7FABH 2F74B 3FT4B 1Q0XL 3ULVE 5D7JA 1OP9A 3OJDA 5DUBA 1MJ8L 5ERWA 3RX8A 4PUBL 3MRIA 3WFHB 2YKLH 5DF0A 1KJ2B 4EI6A 1U3HD 5IR1A 5ITFB 4EZMA 1FNGA 5JW4M 1WWAX 4LCWD 2WV3A 3PWUA 4LL9A 1VEPA 3RA7L 4IMLA 5D96C 1BLNA 4XWGL 2G60L 4DGYH 4A2MA 3SDXA 5AG8A 4R97C 3QR2A 2DQUL 5IJKA 5DJ2B 4CADB 1FC1A 3M17B 5KSVA 3CD4A 1AY1L 3MCKA 4KI5C 3CCHB 4E41D 3I02A 4G80A 2W59A 4QLRA 5GGSA 4JLRA 4OZFH 3DI3B 4KAQL 2ARWA 4XXDB 4D0DB 4UV4L 4R2GB 3D2UA 1NGXB 4Q6IA 4WTXA 4N0FA 4YHMH 1AD9B 3BN3B 2R9HC 1FE8L 5TF1H 3FT3B 1M71B 3ZKSD 1I7RA 5IFAH 1ADQH 1ROWA 4K3JH 5IJVB 4PS4L 2ZUTA 3MRJB 4MWFA 1U8QA 1F3DJ 4LHJB 1E4WH 2OSLB 2EDTA 3QI9B 1AXSA 4NRZB 1SMAA 1M7IB 2MSPA 1ZLSL 3BDXA 2ED7A 4LHUA 1D5BB 2A6KB 3C60A 4BSVA 5EORH 4EN3D 1MUJB 5DFWH 4ZO7A 1ZHLA 3L3HB 1EAPA 1HHKA 3IFPB 3MBED 1U8JB 4ZAKC 5IF0B 4X6EA 3BP4A 2WWMD 5I75B 1XF3A 5FYKE 3EOAA 1CGSH 3PWJA 3QXWA 4DW2H 2Z31A 1FYHB 1WITA 3TNNA 1N5AA 2EIBA 5IG7B 2AEWA 3B2VL 1KCVL 3AU1A 1OCWL 5KVDL 1WBZB 4OGXL 2Y36L 2PYEE 2X44D 5CP7B 3OGCB 5HHXL 4P0DA 4QOKA 4P23D 3KPPB 3V6ZA 4J8RB 3QRGL 4G6FB 5IM7B 1E28A 2Y7QB 1AFVL 1P4LB 4P5TD 4Y2DA 2X9WA 3ZE1F 3RTQB 3BH9A 3O8XB 4M6NH 4HIEA 3NIDF 4OFDA 1Y6KR 2GYSA 1WBYB 3A6CL 4KK5D 1R5WB 4ESKA 2QBWA 4HWZA 2PXYA 4LQ1A 2FX8L 2ZKHL 3FMGH 1G84A 3O9WD 1U3HA 1P1ZA 4AH2B 5EU6A 2OR8A 4LCWA 3AUVA 3RWCB 4EI5D 2FGWL 4F7CB 1MCDA 3N9GL 2RIKA 3IGAA 3UJTH 2OS7A 4PP1C 1PDKA 3L5XH 2Z9TA 4PJEA 3ZE1E 1PKQB 3DUUA 2PO6B 4LASH 3B9KD 3F5WA 3VRJB 3TN0C 4XGZA 1NCUA 4IHOA 5FYLE 2CUMA 3NIDE 4X80H 4NWTH 3HCVA 5GS0D 3N50A 3W39A 1FGVH 4OD2A 4W4OC 1AKJB 4E41A 2F19H 3INUL 4IMKA 1GVIA 2XRAL 2FIRT 3KYMA 4XVJL 5EULV 4CNIA 3PJSA 1U41A 2FEDC 5MI0C 3R0NA 4NO3B 1QRNB 5MHSD 2IQAB 4OFYD 1CE1L 4NFDA 3P73B 2E7LC 1UGNA 2MOVA 2BSED 4G7YL 3D39B 1LNUB 3QP3A 3PL6C 3PGFL 2ENSA 3WXVH 4PTUA 2D4FA 1RZGA 1YMMD 1BZ9B 2A9NH 4NO2A 3QNXB 5DSCB 5GJTH 1MRCH 5T1KD 3RHWF 4EN3A 3P0YL 1M6OB 5TE4L 3QPXL 1F8TH 5C07B 3F6IA 4HAFA 4PB9L 2VN4A 3U4EA 1LP9A 3MBEA 1T1YA 1LQSR 3CFEA 2A2QT 2Q8BL 5DJ8B 3QQ3A 5GGUA 4MJ5A 3MXVH 3VJ6B 4FABH 5AAWA 2BVYA 3WDJA 4YZFF 5ID1A 3UTZA 1QUNA 2YK1L 4NGHL 3REWB 3CXDH 1A6WL 5EN2B 1FORH 2VXUH 2NXYB 2QLVB 5EZJA 4OIBA 4EQ3A 5KVGH 4P23A 4APQB 2E27H 1CDHA 4RMWA 1IGCL 5HVFB 2HAZA 3OKLB 2CJUL 1ZT7A 1ED3B 4Q9QH 4KKNA 2LTQC 4PJGB 4HW6A 1KELH 5C9JA 1KPUA 4WHCA 3C8HA 3BMWA 4X8JA 3S5LB 2P5WE 3P2TA 3NMEA 4K07A 4R90L 3L3IA 3DGCR 4WJ5A 4Z76A 3B2UD 5J3HD 3CUPA 5IHZA 3GSWB 4PLNC 3SY0B 3UJIL 5HVHC 4EBQH 1TETH 3E0GA 1FNEA 4ODHH 4N8PA 1CL7H 1T1XA 1MCRA 3D85D 1EEYA 4XMLL 3SEPA 4U2ZA 3VWJD 2CXKA 4EI5A 1TVHA 5CBAB 5C0BD 5GGTL 4GRLB 3MOAH 4LSVL 2ADIB 2P24A 1INQA 1BEYL 1N64H 4HJGA 3WFZA 3OKYA 4QHNA 3JV6B 3QNYB 4DOHE 1RUKH 3DTXA 4HK0A 4PGEB 3IKKA 3U9UB 1Q9KB 3OR7B 4ORGA 3RU8L 3GMQB 2X09A 2XWBA 2PW1B 2P4AB 2C26A 3NA9L 4FMFA 3AAZA 1SBSH 3AREC 3RVTD 1JL8A 2XKNB 2P8MA 3L3GB 4YEFA 4X4XA 3P4NB 3CDGA 5HYQA 3X3GL 4FQXB 1U8NA 3MMEA 3BKJL 2ATPA 3I75A 1X5AA 4PLKC 4IRJB 4ZUSA 3H9SD 4UQ3A 5I1LB 3STZA 4NN7C 1CDBA 1WK0A 1JF1A 2ZUWA 1KPVB 1IC7L 4L3CB 3KYNB 2Y5EA 1VENA 4Q2ZA 1UKTA 1I3RA 5J8OA 2CRZA 3KPTA 2H2PC 4HJ0C 1XF2A 5T1KA 4YBHA 3WKMH 4FXKA 5AWNL 4B0MM 4I3RH 5IIEA 3JV4A 1TQBC 3DX6A 3MJ8A 4CGTA 4TUKH 2FECI 4HIIB 3STBA 3TBVB 2CD0A 1H15B 4OFIA 4XHJD 4DGIH 1F4YH 1T89A 4X6FA 4CJ0A 5A3IC 4KROD 1YQVH 3CFBA 5C2BH 3U1SH 2ITCA 4X0KB 1OAQH 4XPHH 2GK0B 3BISA 4PJDB 5E8EB 3S8WA 1A8JH 2IANB 1HXMB 4JHAL 1TPXC 2IADB 1CVSC 1YY9D 2LVCA 3FO0H 3FB7A 2ADFH 5LJYH 3U0WH 2HJLA 3G6AA 5F96H 5DMJB 1GL4B 3DETD 5GGTA 4NC0B 5I18H 2H1PH 2VLLA 1J05B 5GRYA 3VXME 1J10A 4ZS6D 4LSSH 3C8DA 1I9RL 3OR6A 4JQXA 3ARVA 1TCMA 4JFED 4NWUH 3BP7B 4KKBD 4PR5A 2A1WH 5DVKA 1WIUA 1KIRA 3MRGB 4F33B 2W9DL 3SGJC 3D85A 3UBXG 3ALWA 3OKNA 3VWJA 5E99L 4PGCB 5H2BA 5AZEL 1I8KB 2XZAL 3MNZA 5DYOB 4Q58C 3V6OC 4UMGA 3THMH 3MJ7B 2R56H 4MA8L 5JMRA 1NSNH 4LEXL 4TUJB 3T3PE 4FMKA 3GMPB 5ICZB 4UU9B 1WEJH 1WCQA 3QEQB 4NDMA 4Y19E 2F54A 1E0OB 1AD0B 3HAEH 2VWEC 8CGTA 4WTZA 5IB2B 4OCXH 3OAZH 3T3MF 5FO9B 5I1CH 1B0RB 1I85C 4HQQH 4UNUA 5C0RH 1M7XA 1CXLA 2Y5TB 1MY7A 1FVDB 1XIWD 2HFEA 3PQYB 1ETZB 5ALCH 3L6FA 2YXMA 3H9SA 3MACL 3PABA 1KJMB 4QRPD 1B90A 4HLJA 3K8LA 2V2TB 3O6KH 1A1OB 1C5BL 4NBZB 2ZCLH 3GIVB 1XEDA 3TO4C 3NPSB 4NZTH 2I26N 3Q6GH 5J1SC 3NCJL 3UZQA 1PKQE 4LSRL 5KSUA 1DN0B 3RKDC 4RGOL 2Z92A 5LWYL 1CG9A 1IQDB 4KRPD 2NY0B 2P7TB 2VXVH 3GSUA 1N5YH 4XNZB 5CIPH 5T3ZH 3HC0B 1JNHA 4L9LA 5IP4A 1FLTX 1JZ7A 1KEGL 4OLWL 2NY2D 4P49A 5F7EH 1A7RL 4X6DA 5LGJA 4HC1A 3TO2A 1KC5H 2ZUQC 1J0IA 1QRNE 5AD0B 1KENH 2B0SL 5DTFB 4JM2D 3GMRB 4WRLA 1FQ9C 1QSFB 4X4MA 5DS8A 5HY9A 3D39E 1RHHA 4CW1B 3TCLB 2D03L 1T0NA 4NKOB 5I8CA 5ENWB 3BEWB 3HPJB 1UM5H 1G9ML 1WAAF 1MJUL 3LQAH 1VADB 2IG2H 5JZ7D 1FNSL 4R8WH 4OZIF 1KN4H 3NA4A 1T5XA 3UO1L 1KTLA 3DMMA 5C07E 3QT2A 5LGHL 1MFCH 3OAUH 3LEXA 4WWKD 2XZCL 4LGPB 4P5MA 4JN2B 4L8BA 4U0RB 5DQDL 1NKRA 5BW7A 4J3XA 3E3QE 3QCVL 1FRGL 1E27B 3TCXA 1IT9L 2DQHL 1ONQA 4BH8B 3VXUD 4GUPB 2J5LC 4MNQA 4GXUM 5GQBA 3MV7D 3U36B 5EC2A 1T5WA 4LLMB 2ZP0T 1T22B 5CMAB 3U7YL 4ODXA 4Y89A 4Y5VA 1MFDL 2VAJA 5FUCE 4OSUL 4MD4B 3OG6B 5CEYA 5DHXB 3QPQC 3WNOA 4DQOH 4UUJB 3VCLB 3WO4B 1E4JA 2VLRB 3HE7B 4ALAL 3T2NH 2J4WH 2VDRL 2H32A 1GOHA 3BOVA 4PJGE 4LAJH 3ALXA 1Y6MR 2WQRA 4QRSB 3KYOA 2NR6C 1JGLL 3BIAX 3GJFK 1JN6B 4HH9B 1EZVX 1PBYA 5IEKA 1XR8A 2BDNL 4OGAC 5D1QD 5IW1A 3L5IA 2Q76A 3RWFA 1BVLA 3WIHL 2E9WA 1I75A 4N5UA 2EIZA 1XIWA 5FDYA 5CUSL 1V7NL 3L5HA 1XMWA 1AQKL 1JPGA 4GKZA 1MIMH 5LG1A 2BFVL 3QIWC 1Q0YH 4U1JB 4MS8D 2I9LA 1H0DB 1GGBH 1HHHB 3S88L 2COQA 4H1LB 1FFOB 4P4RB 3MV8A 4ZFGL 5SX4I 2A74B 4JAMA 3BMVA 2J8UA 5EA0L 5D6CA 4L4VB 3H3PL 4J4PD 3BZFA 3Q1SH 3NFPB 4BH7B 2W0PA 4FP8L 3VFRB 5FGBA 4P4KD 1GXEA 5ESAA 3GFUA 3UXFA 1RI8A 1EERB 3SDAC 1CDUA 3UTSA 3VFWA 4FFYH 4PJ8A 4UV7L 2W38A 4H5SA 5CCKH 1DQLL 4KJWD 15C8L 3DECA 1GPOL 4U6YA 4OGYH 3TNMB 4N90E 1Y18A 3BN9D 4KJYA 2X41A 1L0QA 3ILPA 4S1QH 3LV3B 4PJDF 4YE4H 3WD5L 3HPLB 4TN9A 1PYWB 2NY4C 1EEZB 5K93A 4WWKA 3BT2H 4YNYA 2P1YA 2FHFA 4HKJA 4YQXH 5KW9H 1P7KA 4NIKB 4ZD3H 4IBLT 2NY5C 3QG7L 4XCCL 3EYFB 4ZODA 4GLRI 5DHVB 1IL1A 1PY9A 3G6AB 2Q1EA 3P4MA 3VXRB 3VXUA 3SKMB 1HI6B 3MV7A 1Q72L 3G9VA 4GW4B 1MHPL 1S5HA 5CJBA 4RNRA 1HHJB 2VABB 4D9RE 1WVZA 4JDVB 2BJMH 4HBQA 1YNTA 4OF5A 4X98A 2IANE 1ZVSA 3BHBB 5H35B 3REVA 1CXEA 5C0FA 3MGOA 5C0AE 3CVHH 4LAQL 2VQ1A 2UZYB 1FPTH 1YNLL 1R0AH 5MEPB 3B83A 5L7XL 1NUFA 4F80A 1B2WL 1CD1A 2VXQH 3VRIA 3EJYD 4N5EC 1INEH 1VGEL 4M93B 3S36X 4KMTH 2R2BA 5D1QA 2X7LB 5DJAA 3MUJA 2EXYD 3O6FC 5AEAA 2KZ1B 3ALPA 1WT5C 2HTKD 4F2MB 4NHUB 5JUEL 3U6RA 4RMVA 3TVMC 4XI5C 1EUTA 4KZDL 1W72L 3KLHD 3G6JB 3MLVL 4KUCD 3QDMD 4G7VL 2VZ3A 2E6JA 2EIDA 1G7IB 1HIMH 2RFXA 4K55A 1SYSA 4YR6A 3QEQE 4ZO6A 5BZDA 3GMMA 5HHOD 2BVEA 3F7QA 4M8QA 5GGVH 4CMHC 4P4KA 5DGRA 4YDIL 1ZSDA 4Z5RA 1RJCA 1RVFH 1I4FA 4Q74A 5F9WB 3DVGA 1EXUA 2JK5A 2C7UB 5EOQL 3PQYE 4JDTH 5I2IA 1MCLA 3QXAB 4WFHE 4XBPA 3LD8C 4TSBL 4PY8J 3WLBB 2VH5L 3BPOB 4E0RB 5I1IL 2GTZB 3MLZL 3JBG7 5C0IA 4FZEL 1KFAH 2XN9D 4XH2A 4MJIA 4M7ZB 1C08A 1R24B 3MPCA 3BW9B 3CVIL 5JPMB 1A5FH 1JPFA 4NN5C 4OZFB 4JY5L 5CD3B 1MLCA 1JWSA 5E6IA 1KYOJ 4HIXH 3UPAA 5D7JC 4NM8L 3BI9X 5I8KL 2Y1VA 4QYOB 4OBSA 5DQ9B 4BZ2H 4NOBA 1I8MA 1KXVC 2EH7L 3BEVB 3LEYL 5D96B 1ZS8B 2HT3C 2OTPA 2FBOJ 2ICWI 4ODWA 4Y7MA 3BPCA 4ZTPH 3PGCA 1FL3A 1KXQE 1QSFE 1LDPL 3EDDA 4OCWH 1GOFA 4HF5L 1TQCC 4RBPH 2ZSWA 1T1ZB 3ULSA 3VXPA 4OCNC 5I0DA 4NNXA 1W72A 5F7YC 3OSKA 1H8NA 2VUYA 3QJFA 4TTDD 4YXLH 2XTJD 3KNBB 2R1WB 5BS0B 4JO3H 4P3CL 2GUOA 1T3FB 4M48H 4PJXA 2XFXA 4XWOD 2VDMH 5CBEA 1KB5A 1V3KA 2HJFA 2Q8AL 4Q9CA 4S1RL 3HKFA 4XC3H 5I6XC 3D25A 4G8IB 1II4E 4YHPB 4Z7QF 1IC5L 4FTVD 3S36H 2YUZA 3W11D 2D7QA 4XB7A 1UM4L 1N4XL 1J0HA 4JJ5B 3QDMA 4TVPH 5T3XE 4I0PC 1A22B 1HEZB 1CI5A 3WIIH 2D31B 3TESA 2KDGA 1FZMB 4TULH 3QEGL 2B4CC 4Y5YA 2VLRE 5ALBL 4RA0C 1HSAA 5I71C 1MAJA 2Q86B 5HHOA 4X9FA 5FB8B 3GSNL 2Z31C 4XVSH 4QF1B 4CU6A 4JREB 3L3OB 3FFCA 3SGDI 2R0LH 2HT4C 3SPVA 2NQCA 1YEHL 4JKKA 4Z7QE 1OWRM 4O2FA 1CQYA 4HUUB 4QXTA 3QXTA 5B39B 3KXFD 3FAWA 4XCNB 3ARYA 2BY1A 2XY2A 3T0EA 1H5BB 1UKQA 5C7XH 3QUXD 3RUGB 1R3IL 2B4CH 2H3NB 4C56B 4GJTB 1BJ8A 2CIIA 3IAPA 3C5JB 2O5ZL 5ADOL 3BPNB 3KYAA 1AHWC 1N8ZB 3SJVA 4U6VL 1AGEB 1Q0XH 4L4VE 5F7DB 5EIQA 1MJ8H 4PUBH 1U3JA 4HJJL 4JG0H 4I5BB 1I8IA 2ICWJ 1U3HC 4NKIL 1D5ZA 4RA3A 2Z8SA 4UAOC 3OB0H 2EEBA 1J86A 2P44B 4KDVA 4P99A 4OAWB 1GGIL 3EOYG 3RA7H 5IK3A 4DN3L 4XWGH 5TDNB 2G60H 5F9AC 3I6GB 1ES0A 4NN6B 5DD1L 2DQUH 1TVBB 1KT2A 4U2YA 3LPFA 1AY1H 2AJZB 2VERN 4V2CB 5MI0B 4S10A 1DANT 1WWBX 1XGRA 5T1MA 1YEJL 3UTPE 4KAQH 4XNYL 3W0WB 1S7VB 4XXCC 4C57C 4OJFL 5F93C 4WHTB 1FE8H 3G5VA 4AEEA 2IFFL 3DYPA 2W60B 4PS4H 3VXRE 3GSNA 3VXSD 3PDDA 1JIBA 3JWDL 4DK3A 2VLJE 4RMRA 3MYJB 2X4TB 4FTVA 5HGHB 4CDGC 4G42B 3P4LA 4EN3C 1QFOA 1YMHB 4L4TD 2E9IA 5I73B 3V4VL 1FLRL 4OGZA 5JQ6L 5E2VL 2I24N 4WUUB 2D7NA 3MBEC 1ZHBB 3QHFL 4F7PA 1U2CA 5D1XA 3FOMA 2C3VA 3GHBH 1MH5A 2WWMC 4K9EL 3QHZL 5FYLD 3LCYA 2O61B 5L2JB 5F1IA 3UTTD 1H8SA 4PBXA 1WBXB 3T0XA 3E1F1 1Q9OA 1X4YA 3B2VH 1KCVH 5KVDH 1OCWH 3BESR 5IB1B 4OGXH 2Y36H 3OQ3B 3V5DA 4HG4K 1NLBL 1CVRA 1T04B 5HHXH 3KXFA 5KOMC 1K4DA 4MXQD 3QRGH 4F9LA 3HRZA 1AFVH 3SKNB 4P5TC 3Q6FB 3QUXA 4I4WB 3G6JE 4S1DD 3CMGA 5FYLL 3PP3H 3NFNB 4U1LB 1I7ZA 1MCPL 3L5WB 5D6DA 1RIHL 2FX8H 2CDGA 2FZ3B 3HZMB 1G6RL 2ZKHH 1ZLUK 3RIAK 2CKNA 1BIIA 3BSZL 1LEIA 3O9WC 5CINL 4BZ1L 3RKPA 3FB6B 4UDUA 4ZDHA 1VCAA 5K59F 4LLQA 2VC2L 1WCBA 2FX9L 2DQEL 2A6JB 2VLKD 1UJ3A 1RZ8A 2FGWH 4R4NC 3N9GH 4WW2F 3DXAA 3J8F7 4O2EB 2EDBA 4KK9D 2GAZB 5BQ7A 3UPRB 3B9KC 4U33A 4OCLC 3QXDB 5GS0C 2Z4QB 5EUOF 1CXKA 4Z6AT 2AJ3A 1JHKL 3C87A 5D9SA 4P2OB 2V7NA 4OCSL 3INUH 1UB6A 1QOKA 3ROLA 2XRAH 4XVJH 5FYJD 3I6LD 1U8IB 3ARDC 2HG5A 1NCAL 1PKOA 4UB0H 4WV1A 2E7HA 1CE1H 3T2OA 2HVKB 4LNRA 5DUML 1LO5B 1V5JA 1PJ9A 2JIXD 4G7YH 4JANB 5FM8A 5JORB 2BK8A 4U6XA 1E6OL 1YYML 5CHNB 4K3DL 3WE6A 2E9BA 3NZ8A 4GW1A 5SX5H 2ATKA 5EO0B 4KI5E 4D9QD 4X5LA 1CCZA 3IVKB 3SQOL 5LXGL 3P0YH 3HI1A 5DHYA 1GGUA 3GKWL 5FHAL 4L4TA 5TE4H 5FYJL 2AKRA 3QPXH 4LLUA 4PB9H 1I9JH 2EDFA 2PNDA 4WO4B 1GJIA 2DN7A 1P9MC 4HS3B 5MERB 1NBYA 2Z91A 1CXIA 4KXZH 3WDIA 2E8ZA 5EH1A 2Q8BH 4WI3A 5KS9A 3KHQA 2HTLC 5BS0E 5B8CA 3TPUB 4LFHD 1ZHKB 1T89C 4C54A 4KTYA 2V7HA 1YQ2A 3UTTA 1TPXB 1FL5A 5C09B 3MRMA 2YK1H 4NGHH 2VZ1A 1G6RA 1A6WH 4KJPC 1S7WA 5JOPD 4K2UL 1FVCA 1P7QD 2YOCA 4F3FB 2ZUVA 5JLZB 1IGCH 4TPRH 1HWGB 4KKAC 1YEIL 2CJUH 3EYSH 2BC4A 2M8XA 3FJTA 3HAEB 5EO1A 2WLZA 3BKCL 5F6IB 2GIYA 4U6HB 4JQXC 5HHME 4MQSB 1EUUA 3ULUD 1DP0A 1FCGA 2R4RL 4MSWA 4R90H 3CFKB 4LP5A 5J3HC 2CUHA 3ARFD 3UJIH 3DRTA 2HKHH 1F90L 3E6FA 4LLYB 1LMKA 1YEEL 5INCB 4L8SA 1BGXH 4XMLH 1BWWA 4XCFL 1CT8B 4JVUA 1IAOA 4PRPB 2DS4A 2VLKA 1GCFA 5GGTH 4LSVH 5D70L 4R2GD 5IKCA 3MRKA 1AXTL 3MNWB 1A6UL 5IB4A 1BEYH 2DLTA 2GJ6D 2P8PB 5E5MA 1NDGA 2XYCA 4HFUL 3RUGE 5D5MB 3MREB 3RU8H 3BP5B 4C56E 1RIVL 3N85L 3NOIA 3ULUL 5EUKB 3DO3A 4JPVL 2VOTA 3NA9H 3ES6B 3GB7B 1CGWA 3VD4A 4QRTA 1NCNA 3QI9D 3X3GH 4IOIA 4AENB 3BKJH 1FDLL 3MRRA 4L29B 4JFXB 5FKAB 2UUDK 4CMMB 1LD9A 3M07A 3FHAA 4RAVB 4PRIA 1T1WA 2JIXA 3EYVA 1IC7H 2VE6B 1R3LB 5J7CC 1QVOA 3WN5A 2BRRL 1NKOA 2R29L 1NMCB 3EW3B 3LDBB 4Q0XL 4NRYA 1J9CT 3S5LG 2V5MA 5D7KE 1G7QB 2R1XB 5AWNH 3PWPA 4J1UB 1I1YA 2AGJL 2CXGA 5C1MB 4TQEL 5L8LB 2ZUQB 1QSEB 1QR1A 4GW5B 3N1GC 3RAJL 1PW3A 3QDJB 4ODUA 4G6FD 5IMOA 4XHJC 3W0WE 4ZYKA 1DLHB 2Q7YA 1FYTB 4WHDA 3MLTB 2GT9B 5FA4B 4KROC 1BJ1H 4LSTL 3RTQD 1A6TA 2W9EL 4U1MA 5HYFA 2HLAB 3F58L 4BJLA 4R96B 5C0EA 3MRFB 4JHAH 4P9HC 4FHBD 2F74A 2DQJL 3B9AA 5DJ6B 4RCAA 1I7UB 1P7QA 5CWSB 1ZGLB 2WK2A 5BRZD 4X7TA 3T08A 5F9JB 5ELIA 1CYGA 4PGDB 4J12A 1WJ3A 1NL0L 3DV6B 2GSGB 3DETC 3RNQA 1V7ML 1T4KA 3IJSA 2CR6A 3LPWA 4PB0L 4I2XA 5K33A 1IARB 2GW5A 4NCDA 4WUUE 4K3EL 5SWZE 2EO1A 1I9RH 3V5HB 4GRWH 3U0TB 4WENB 5IB5A 5ISZB 4OV5B 2PO6D 4KKBC 2DMKA 3LSOB 5E6YA 2K7QA 5FOBA 5EOTB 3RY4A 3ARFA 4PP2B 4RGND 2CLVA 4P2QB 2W9DH 1AKJD 4M8VA 4YGAB 3KPNB 3CX5K 5E99H 1BFSA 3FQXB 3TBWB 5AZEH 2XZAH 4FFVD 1UA6L 1AO7B 3ARUA 3X11B 5T33L 3Q3GA 4MA8H 3STLA 1IGFL 4LEXH 5BMFL 2GJ6A 1K2DA 4OUUA 4P3WA 1F45A 1U8LB 3HTLX 4HPYL 3U4BL 4KRMB 3FT3A 1MHHB 4NCC2 5DI8B 3D39D 3FONB 1DSFL 5E2TL 1U91A 4PG2A 1FFPB 5CJOL 1C5DA 1K9TA 4Y16D 1HN1A 4BFIA 2WBKA 3GKZA 4UT6L 2EYRB 5C0CB 1XIWC 2P5ED 3W5MA 3MACH 5HGGS 1HQ4A 4W6XB 4MDIB 3ECBB 1C5BH 2IF7A 1CR9L 2VQTA 4PJAA 5E94A 4WUKL 2ESVA 3MXWL 2H32H 4AIXA 2XT1B 3DYOA 3NCJH 4LSRH 4MLSA 4RGOH 4KUZL 4PLJD 2Y23A 5LWYH 1G0XA 3QIBB 4KRPC 5F88B 5BJTB 1KNOA 1G9MC 4O58L 1B3JA 1YNKL 1MVFA 5IFJB 4KGLA 4KJQD 3O3DA 5C8JB 3PE9A 4OLWH 2NY2C 4APQD 4JFDD 1A7RH 2VLME 3MQIA 2N7AA 2B0SH 4ISVB 3X12A 3V0WL 2MHAB 4JM2C 4PJCB 4BQBA 1N2RA 1OSZA 3RDTA 2D03H 4ZUWA 3QNZA 1S3KL 1Q9LB 1I1AB 1LO3L 1UH3A 5K9QI 1G9MH 1W8OA 5BRZA 5JW4Q 1MJUH 5DFVD 5DT1L 1FNSH 5JZ7C 3UO1H 3LKOB 5LGHH 4YUEL 5I1EL 2XZCH 4UBDC 4WWKC 3VWKB 5HYEA 4X5XB 3SGEH 1QO3A 1B4RA 2GCYA 3QCVH 1ZA3B 1HH9A 4ONFL 1JZ6A 1FRGH 1IT9H 2DQHH 4QHMA 4TOYL 1RK0B 3BUYA 3BGFC 5CKGA 5IVXB 2NCMA 4QHLA 4HUKB 5GISL 3U7YH 4E42B 5JOFB 5T1LB 4D0BB 1VESA 3NCMA 2J7LA 5DD6B 1MFDH 3LKPA 4JZOA 5FUOH 4OSUH 5TQ0L 4WEBL 1VACA 4I18B 5DRXA 4HUWA 4N8VB 3L7FA 5J13B 3UYRL 4IRJD 4MAYB 2BSSB 4N0UA 3CGTA 2NX5A 3EO9L 3MCLL 4KDTA 4Z77A 3EJZC 3HN3A 2VDRH 4ACPA 4OCRL 2MQ0A 4OF6A 5CILL 4XP5L 5C0DB 2NTFB 3K3QA 3RWIA 1F3JA 1FAKT 2ZCKL 4O51A 1I9IH 3HUJB 4BM7A 1JGEB 1JGLH 2IAMA 1BZ9A 2BDNH 5D1QC 4Y16A 5DSCA 4NO0B 3VFTA 2J6EA 4K7FB 5HI4D 2P5EA 3RZCD 5CUSH 1V7NH 3B4NA 1CFNA 4X6CE 1AQKH 1F3RB 3CC5A 3OZ9L 4PJIB 5HYSB 4NKDA 4HX1B 1DUYB 2BFVH 4PRPE 3NIFF 4MS8C 3S88H 3U7AA 1KG0B 1QPPA 3VJ6A 3BUTA 3GMOB 2CDFA 1UCTA 2XPGA 4JEGB 5D93C 1MJJB 2VWEE 3X3FL 4ZFGH 1EFXD 4RRPG 4ZFFA 5D5ME 2EYTB 4D9RD 4J4PC 1I1FA 4ELMF 1WAAA 2IAND 3GM8A 4MNHB 3SKOB 4O2CB 4FP8H 4JFOA 2YPKB 4OZIA 4M6ML 4YDLC 3WS3B 3CIQA 4JFDA 4R0LA 3DVIA 3NH7L 4UV7H 3EAKA 1NPUA 1A3RL 1DQLH 15C8H 4KJWC 3NIFE 4HKZB 2PETA 4O9HH 4LKCA 2YD2A 3QSKB 5GGRB 4NN5B 2AV7B 2K3TA 5JW3L 5DUBB 3OJDB 3VMPA 5I8OL 3WD5H 3MRIB 2DWEA 1X7QA 1DANU 5DO2D 4NYLA 3P30L 5IR1B 1JTPA 4M3JA 2R8SL 1MCFA 1FNGB 2PN5A 3RWGA 3PWUB 3D69A 3FKUS 1QSEE 3MLYL 3QG7H 4XCCH 5TGBA 1BLNB 5JOEA 3K0WA 1NQBA 4PPTA 2AEQL 5DEFA 3R8QA 3SDXB 3IDYC 1FYTE 4NUJA 4WFGE 1Q72H 1Q9KA 3QEQD 5KSVB 1MHPH 1UCBL 3CH8A 3MCKB 3I02B 1DZBA 4JZJA 4G80B 3U79A 5GGSB 4JLRB 2YC1A 1H3TA 5I17A 2E6PA 1A47A 4LAQH 1QNZL 3SOBL 3D2UB 3PQYD 1CU4L 4Q6IB 4N0FB 3UX9B 1YNLH 4YC2B 3EZ8A 4LDOB 2VQUA 3T0AA 5L7XH 5TE6L 3V4UL 1B2WH 2AXJA 3VGGA 2DBLL 3EJYC 3MRPA 2Y9RT 1VGEH 1UKSA 2ZZUT 4MWFB 1OT1A 1U8QB 1FNAA 1AXSB 5ISZE 3R1GL 2IH3A 2EXYC 4WHYG 1UWXH 1A14L 4LHUB 3C60B 4POYA 3RZCA 2FATL 2APVA 5T1DL 2HTKC 5IHLB 1QLRA 4P2QE 3VA6A 1ZHLB 2NXZC 1UG9A 5JUEH 1EAPB 1HHKB 4Z18A 3ZDXE 1CICA 1W72H 3KLHC 5D2LA 5D1ZD 3MLVH 2B39A 4X6EB 3BP4B 4OT1L 4G7VH 4G8GD 1P4BL 2GQHA 4Y5XC 1XF3B 4JCLA 1U8OA 2CQVA 4X83A 5I71B 2R69L 3EOAB 2FGZA 3OKMA 3PWJB 4KWUA 5KVFL 4GRMA 5I1JL 2Z31B 1EFXA 4RQQA 3WUWA 2RBLA 4LVEA 5J6HA 4MVBD 2EYSA 3TNNB 1N5AB 4M61A 1A6AA 4PJDA 1KB5H 3BXNA 1EVTC 4MA3A 4K71B 3QQNA 1URLA 2IADA 1MRDL 4YDIH 3RRQA 2PTUA 3LS4L 4ZO9A 1I9EA 3VGBA 1B0GA 4QOKB 1W2KT 3V6ZB 1KF9B 4LP4A 3HC4L 1E28B 3ARTA 4QWWD 5C0CE 2Q7NA 4JRWA 1J05A 4Y2DB 5I8EA 4TSBH 3BH9B 2AJUL 2VH5H 4HIEB 3K80A 5I1IH 3MLZH 4GS7C 1IMHC 4FZEH 3UPCA 2JF1A 4HWZB 2PXYB 2EE2A 4NC1C 1GC1C 3CVIH 2IQ9L 1OM3L 3QFDA 3D0VA 4JY5H 1U3HB 4F33A 1P1ZB 5BCAA 3ARZA 5EU6B 4U49A 4NM8H 5I8KH 1AJ7L 2LU7A 4LCWB 4BUHA 2QJDA 4PGCA 1FSKC 1I8KA 4HIJA 2EH7H 4UIMA 3IGAB 4C4KO 1DQTA 4GKSA 2YD1A 4TUJA 3D5OF 2OP4L 5JA8B 3DUUB 3F5WB 4XGZB 4IHOB 2VLRD 4UU9A 3HCVB 3W39B 4K7PX 2OMBA 1LDPH 4PJCE 4E41B 2UYLA 4X4ZA 4YWGL 5TDPA 4HF5H 5FKPA 1F4AA 3RNKA 3KYMB 1T66D 4CNIB 3PJSB 4CUCA 2YPLD 1R3KA 3V6BR 3QO1A 1NUGA 2EE3A 4TTDC 2J1KA 5L9DL 1CDIA 3MO1A 2MCPL 1G9EA 4P3CH 4JKMA 3GBML 3SGKA 1EEUA 2OTUA 4XWOC 1MCIA 3TYFA 4PTUB 4U0QB 1RZGB 5E8OA 2X4UA 2Q8AH 4NO2B 3HUJF 4S1RH 4EN3B 1Z9LA 2FRGP 3U4EB 5IVXE 2CO6B 1YC8A 1LP9B 4Q9BA 3IJYA 1IC5H 3MBEB 1T1YB 5FV1L 3W11C 3LN4A 4OZFG 1UM4H 1N4XH 5D1ZA 3CFEB 3OX8A 3SHSA 5CJ5A 4G8GA 3QQ3B 5GGUB 4MJ5B 3KLAA 2EDJA 5GIRA 1TCRA 3P9MA 2EC9U 4HUNB 1S7XA 4KHTL 5ID1B 3UTZB 3QEGH 2C3GA 5ALBH 4Y1AB 2C4FU 1RJZA 2ID5A 4YAQA 3GSNH 4HUXA 1A02N 4GBXA 2AEPL 3HPJA 3HUJE 3QCTL 2ORBL 5EZJB 4ZPTA 2DM3A 1EZVY 4P23B 4NSKA 3QAZB 2EZ0D 5EU7C 5EU4A 1YEHH 1UWGL 4F15C 1ZT7B 2WBJA 1NFDF 1L9MA 4PJIE 1HDMA 2BOCA 4XCYA 4F9LC 2K1MA 5C9JB 3BPLC 4XAKD 1R3IH 5GGVY 4X8JB 5FIEA 5KG9A 5I74C 5E03A 3I85A 2O5ZH 3SBWA 5ADOH 4J23A 3L3IB 4ZMAT 4WJ5B 4Z76B 3CUPB 5IHZB 1ZLVK 1D7FA 5F44A 1U36A 4U6VH 1JMXA 1T1XB 4M1CC 3ZKXC 1EEYB 4HJJH 4EI5B 1NEZA 1TVHB 4MD4A 4NKIH 3TBTA 2P24B 1INQB 1BD2A 3CJJA 4HJGB 5HDLA 1GGIH 4MLIA 2A9MH 3DTXB 4HK0B 4JDZA 4ORGB 2FH8A 2XWBB 3HLAA 1L6ZA 3N1FC 2KKQA 5DD1H 4RIRA 3AAZB 5E8DL 1CS6A 3JWDC 4N9GA 3OAYH 2P8MB 4X4XB 3CDGB 5HSFA 1U8NB 2YPLA 3MMEB 3ZDYF 4RFEA 2ATPB 3I75B 3C2AL 3BKML 4ZUSB 1YEJH 3O3EA 3STZB 1DFBL 1ZGLP 1JF1B 1RZKL 3ARBC 4ZO8A 3RIAF 4OJFH 5MEOA 3MNVA 4JCMA 4Q2ZB 1GAFL 4WV1C 4DTGL 4P2CG 1I3RB 4H1LA 1FC2D 3UAJD 3QYCA 5B39G 2AK1L 1AQDA 2IFFH 3WSQL 1FFOA 4K9EC 3UBXI 3SDXE 1XF2B 5T1KB 2PUQT 3L3DA 3QEHA 3JWDH 4XC1L 5IIEB 5EU3A 2BZDA 3JV4B 4KRNA 4U3CA 1A1MA 1YECL 2RR3A 2W91A 1FL6A 3DX6B 3MJ8B 3ZDYE 3PWLA 1MRFL 5FGRA 1FLRH 3V4VH 4TVPE 3TFKC 1S7QA 5JQ6H 4FG6D 1VGKA 3AS3A 3IDIA 1CLYL 1OD7A 1ND0A 3GK8L 3QHFH 4X6FB 1ZXQA 5J1AA 4XNXL 3DOSA 2ITCB 2VN7A 5CD5D 3ZT5A 3GZKA 4K9EH 3S4SA 4LQFL 4X5WA 3WFDL 3QHZH 1DEDA 1G1YA 43C9A 2O5YL 1WZMA 1QP1A 4M9OA 2DMCA 4FA8A 1OSPL 3RPIA 3NPZB 3KJ4C 5GGSY 3SE8L 3FB7B 1NFIA 2HJLB 4EDXA 4ZUTA 2CMRL 1CLCA 1MWAB 1NLBH 2VLLB 3MLRL 4MB5A 1UXSA 1TTGA 2OLDA 5ACZA 3OR6B 4OIAA 4S1DC 5F7NC 4G8EB 1JPTL 4HH8A 5FYLH 4PR5B 5F21B 1KIRB 1MCPH 3D3VA 5MEQA 2A73A 3VI4E 3D85B 1DQJA 1RIHH 3BRGC 3AS0A 1G6RH 3OKNB 3VWJB 4C4KT 5J57B 3S9DB 5H2BB 3MNZB 5CINH 4BZ1H 3O41A 4LCCA 2VC2H 4QOKE 5DDHA 4MA1C 2FX9H 2DQEH 5MEPA 3F7RA 3MROA 1QYGL 3LHPL 4NDMB 3S3SA 3VXQA 2F54B 2HH0L 4S0SD 2QADC 5IGXL 4CBPA 4YK4C 4HEPG 4Y8AA 4UT9L 3VE0A 1WTLA 2DQIL 4HS6A 1JHKH 4NBYB 5K9KB 4CVXA 2HFEB 3VRLF 4OCSH 1RY7B 1QFWM 3L6FB 4Y4HA 3H9SB 3PABB 5EU6E 4JM4L 1NCAH 4LCWE 4FFZL 3U30C 2IPTH 2E9JA 4RWHA 5DUMH 1S8DA 3DVFA 1GRWA 1TZHA 2FHBA 3T2PA 4PJEE 1K8DA 5LAXA 2BSTA 2LFGA 1E6OH 1YYMH 4GKNA 4K3DH 5A2JH 2Z92B 5BVJA 4RFOH 2KUTA 1CG9B 4Z7OE 1D5IL 3WN5C 3GSUB 4E41E 3SQOH 5LXGH 4L9LB 1JNHB 5FHAH 3GKWH 5HDQL 1PG7W 5FYJH 1X44A 1LP9F 5A2KH 2FYYA 4X6DB 5DURB 3TA3A 5LGJB 5JNYA 3TO2B 1PY4A 1WSST 3QA3A 4KROB 3QB7C 4CVWA 4GRWB 4P3DA 2GY5A 3SO3C 5JDSA 1PZ5A 2IALA 5HY9B 5DS8B 3WCYA 1EO5A 1RHHB 3TEUA 4YH6A 5I8CB 2B5IC 2XTLA 4NKQB 2DRUA 3RX5A 3RVVC 1U8MA 3FMGL 2GSIB 2XIDA 3RZWA 3LKSA 4K2UH 3DMMB 2VZUA 1LP9E 2P47B 3LEXB 5DQ9A 4P5MB 3RY5A 5E70A 4K8RD 3CFDA 4L8BB 3BEVA 5AYUL 1YEIH 3ARGD 4WW2A 5DZLA 1MCWW 3K8MA 3HNSL 3M1BB 3S34L 4Z8FL 3WHXA 2V9QA 1V3MA 2R2EA 4MNQB 2PTTA 3BKCH 5EC2B 1T5WB 2JKXA 2GTWA 5EUOA 2R4RH 4ODXB 4XZUB 3IAQA 4NQUA 4Y5VB 2B1AL 4LPVA 1ACYL 1OTUD 3O2WL 4WI5A 1GYAA 5CEYB 1KCRL 1YEEH 3NFSH 4Y4KD 5HD8C 4U1KA 3KR3L 4XCFH 3ILQD 3H7BA 1OAUL 4K8RL 2HT2C 5D70H 3DBXA 4R2GC 3VFVA 1AXTH 1A6UH 2H32B 4FQPA 1WIOA 2EDQA 2JELL 4GSDL 3KYOB 4KFZC 4HFUH 2YPVL 5FHBL 1RIVH 3N85H 5IEKB 1XR8B 5IW1B 3ULUH 4JPVH 3RWFB 1BVLB 2EIZB 1XIWB 3C09B 3JV5A 5FGCB 2DQTL 4PG2C 1AGDA 2A6DA 3QI9C 1Q1JH 3AMKA 1JPGB 4GKZB 4NBXB 2P42B 3SE9L 2OXHA 1I8LA 1FDLH 4EDWL 4AMKL 2I9LB 3FQUA 4G3YL 4JJ5A 5GRWA 4O02L 3QULA 3EYQD 2D31A 43CAA 4I3SL 3SDCD 1K5NA 1FZMA 1A9BB 3MV8B 3JSSA 3OGOE 4GG8A 3PG2A 1MEXL 4JAMB 1DBBL 2J8UB 3TT3L 5I75C 5D6CB 3BZFB 2BRRH 5IQ9A 2V9RA 5FO7A 2R29H 3V8OA 3BZEB 4Q0XH 2DJ4A 4JO1L 4HWNA 3VXNA 3RVWD 2FJHB 2NY2B 3UTSB 3VFWB 4MA7L 2AGJH 4PJ8B 4TQEH 5F7UA 4H5SB 5MHSE 1E4XI 2C9AA 3V52L 5EPMA 4U6YB 3PIQA 3RAJH 2Y06L 5JIIA 4KJYB 2BNRD 1EHAA 4MD0A 4LSTH 3D18B 3ILPB 3RTQC 1B88A 3O8XC 1JCKA 4FQ2L 3C5JA 3SQBA 2W9EH 5IROA 1T7VA 3F58H 3FN3A 4KHXL 4R7DA 3BWUC 2DQJH 1CL7L 5L88H 4I0CC 1RUQL 1D5MA 4WWKB 4F58L 1EH9A 4HKJB 1NL0H 1OAYL 3D6GA 1P7KB 1CGUA 2M2DA 3FO2B 3ARGA 1KCUL 1V7MH 4OAWA 4PB0H 1X5GA 5KOVC 1IL1B 1E4KA 3P4MB 1CK0L 4K3EH 3VXUB 3BGFB 3MV7B 4GFTB 3R4DA 1S5HB 4RNRB 1JVKA 1IC4L 2AEIT 2PO6C 5KSBB 1YNTB 4JFFA 4X98B 2YBRA 1ZVSB 3REVB 3UP1A 4RGNC 1S7SA 1QD0A 3WUZA 5C0FB 3MGOB 3E2HB 4Y4KA 4P2OD 2VQ1B 1YZZA 5D4QA 1IJ9A 4PRAA 1QLEL 4FFVC 1RK1A 1UA6H 3L95A 2BVOA 1JYVA 3T0BA 1CD1B 3GSQA 5T33H 2BHZA 3BGAA 1IGFH 3VMNA 5BMFH 3VRIB 1F42A 4HPYH 3U4BH 2R2BB 3G08A 5D1QB 5DJAB 4JPKL 3HR6A 5IBLD 1DSFH 3IFLL 5E2TH 2BY3A 1NGQL 1O7VA 4W4NA 4DUXA 5CJOH 5GRZA 3U6RB 4UT6H 4IDLA 5GRJL 2KBGA 3ETBF 4WO4D 3SDCA 5C6TL 4IM8A 4XTRD 3HI5L 1JPSL 1CR9H 2RFXB 2F8XC 3E3QC 3MUGA 2BOBA 1Q94A 1SYSB 4WUKH 5L8KB 4YR6B 5BZDB 5CZVL 5EIIA 3GMMB 2F54E 5I9QB 4M8QB 5IVZB 1FGNL 4KUZH 2HN7A 4P4KB 5C09D 3KDMB 1ZSDB 4Z5RB 3OF6A 3QFJB 1WBXA 1I4FB 5BV7L 2W0FA 3QO0A 5HVGB 4AYFA 3DVGB 4O58H 4PIRF 1EXUB 2J6EH 2JK5B 5EOCL 5I0ZA 1AR1D 1JGVL 5KZCD 5I2IB 2H1PL 4KJQC 4LVNB 3H9SE 4XBPB 1YEKH 5F3BA 2R1YA 4APQC 4Y4FA 3AGVA 3BVNA 5HGDA 1X5IA 5DQJA 5ETUA 3WS6A 5J11B 2F5AL 2YD7A 3FZUC 2BNRA 4R26L 5C0IB 1JZ2A 4GRWF 4PRNA 4CU7A 4LEOA 1OP5K 1M1SA 1L0XA 4XH2B 3V0WH 4MJIB 1C08B 3TWCL 4UTBL 1MCHA 2C3HA 1JPFB 1G7PA 3IFOB 5E8NA 1S3KH 1MLCB 1JWSB 5E6IB 1LO3H 3B5GA 1B4JL 3I3BA 5DJXA 3RL2A 4JGMA 4OLUL 3RIFK 4OLXL 3S37L 5DFVC 5DT1H 1I8MB 4E9LA 4OF7A 1FAIL 4P5KA 4YUEH 5I1EH 4TUOA 4X6DE 2G9HA 5EBLA 4PJ7F 4GG6A 4ODWB 3BPCB 4GRLC 3PGCB 1CDGA 1FL3B 1NC2D 4GRWE 4ONFH 3BFOA 1IAKB 4X4ME 4O00A 1INDL 4RX4D 1ZLWK 3OPZL 4LU5L 3VMOA 3TH2T 4OF0A 2ZSWB 3QG6A 5C0RL 3VDBA 1HILA 5GISH 5C9KA 3ULSB 2AJXL 3VXPB 3CDCA 4P2OA 4NNXB 2EH8L 4QTHA 3EHBD 5D7LB 3QJFB 4F9PA 5TQ0H 3EO0A 1WV7T 2H9GA 3LKNA 4WEBH 3BGMA 3BD5A 3O6KL 1IKNA 3T2QA 3WLWD 2WW8A 3UYRH 2GUOB 2VZOA 4IRJC 2BY0A 3DVNA 1UXWA 4PJXB 1T7WA 3JWOL 1L9NA 2EECA 2XFXB 3C6LD 5CBEB 3VGEA 3A6OA 1KB5B 4OCRH 2HJFB 5CILH 4XP5H 3HNVL 4OUOA 2ZCKH 2HJKA 2VDNL 2XWTA 3D25B 1DBKL 3ZSTA 1MCOL 3QDHA 4WW1A 1VA9A 1ORSA 3V8CA 3RZCC 1F97A 3PWNA 4U1NA 1T7XA 2IPUG 3QDMB 3GJFA 2BVQA 3AMLA 2FCBA 3ZKQD 1DBJL 5DFTA 4Y5YB 3QDJD 3VGDA 5HHOB 5I1AA 3SE3A 4WFGD 1XZ0A 3X3FH 5IMLB 1N7ML 5C09A 4KTEL 4OTXH 3W9EB 3FFCB 2YRLA 4BKLA 4FQHA 4U3XA 2Q3AA 4J3OC 2IG2L 3SPVB 3FB5A 2AXGA 4QXTB 5FGCE 1RU9L 3MA9L 1MFCL 2O93L 3FQWA 3T0EB 3NH7H 2A38A 3N1QC 1IGJA 1QFWL 4GS7B 1RUML 1A3RH 2ZOLA 4OLZL 3VDAA 1OAZL 4PJBA 2CIIB 4GO6B 1KGCD 4XHQA 2Q3ZA 3MV8E 3SJVB 3T65B 2J8UE 5JW3H 4OD3L 5ISZD 4NP4L 4XMKL 4XP4L 5CFHA 5I8OH 1I8IB 5DO2C 5KJRL 3QH3A 2L7UA 3P30H 4LLYA 4W68A 1B6UA 1D9KD 1D5ZB 2R8SH 4MHHG 1XAUA 4RWYH 1AO7D 3MLYH 5IK3B 2XXCB 3T2NL 2NW3A 2OM5A 1NC2A 2NY7L 2RJMA 2ZSVA 2AEQH 2P8PA 2J2ZA 4RX4A 5DEZA 1KT2B 5D72L 1U92A 4IOFD 5C0JB 2D2OA 2EE9A 5KSBF 1E6JL 1P84J 3O6LL 1EV2E 5T1MB 1OF2A 1RURL 3DGGA 4QXUL 1A21A 1BFOA 5DZOA 1XF1A 2XTJB 3OKOA 1QNZH 3SOBH 5C0CD 5EWIL 2FIKA 3RX7A 5EFIA 1HQRA 1S9VB 2N7BA 3C6LA 4H8WL 2HWZL 3G5VB 2YSSA 1TLKA 5E1AA 5TE6H 3V4UH 2DBLH 1NMBL 3GSNB 3VXUE 2VITA 3MV7E 3NPSC 4LIQL 1H9VA 2DM2A 3Q1SL 4GMTL 5FFLA 4ELMA 3R1GH 4FTVB 3KJ6L 1A14H 2DKMA 2FATH 5T1DH 5FV2A 5E9DA 1GGYA 4XNZC 1V3JA 2X2YA 1LWRA 4F7PB 2DDQL 2HLFC 5D1XB 4LLWA 3FOMB 2C3VB 4OT1H 4HK3J 3QDJA 1P4BH 1MH5B 1NBZB 2R69H 4JRYD 5KVFH 5C08B 5I1JH 4S1QL 5F1IB 1TZGL 4XPBL 2CGRL 3IDGA 5F7LB 2ZPKL 5GRUL 3JV0A 5GZND 1YPZA 3WDHA 1Q9OB 5L0QB 1I1CA 1I3UA 3S3PA 3WV0A 5FK9A 4A6YL 5HDOA 1I1AD 1MRDH 3V5DB 4F15B 1I7UA 1SJEA 2FR4A 3KXFB 4OQ1A 4M7LL 1A2YA 1K4DB 1EA9C 5E5RB 4URTB 3HC4H 4HGMA 4QWWC 3HRZB 1KLFA 1U8PA 2Z35A 3QUXB 4NNYA 5F8RC 4CKVX 4DZ8A 1RUPL 4F7TA 4IOSD 4PV8A 5I74B 2AJUH 2AK4A 3VWKD 3ROOA 2F53D 1WF5A 2YXFA 3NVQA 1AIFA 5D7IF 3B8YA 3RBGA 1I7ZB 5K9JL 1MREL 3ZKXB 1OW0C 3SBWC 2CDGB 5FCUL 2ARJA 2OBGA 3WXWL 2IQ9H 3V79C 1BIIB 1OM3H 1LEIB 4X7SH 2W1NA 1D9KA 4UDUB 4ZDHB 3HS0A 1AJ7H 5EC1A 2VDPL 4NQDA 4LHUG 1NCTA 1UJ3B 1RZ8B 3H9HA 2FLRT 4MD5A 1AO7A 3DXAB 3PHSA 3VFUB 4LSDA 2OP4H 3WO4C 5BQ7B 1N59A 3FAXA 1CGXA 1QACA 2EXWD 2ED8A 1ZV5A 2GEEA 1MELA 4MJIE 2BNUA 1FZJA 4P2RB 3JZ7A 4G6AD 2PKDA 4JGJA 5D9SB 2V7NB 3KHOA 4YWGH 1UB6B 3ROLB 2BXYA 1T66C 5F8QC 4NO0D 2HG5B 1FN4A 4KVNL 1BFVH 2QEJA 4LDLB 1WISA 3EYUL 1QFPA 1ZEAL 4LNRB 5L9DH 2MCPH 3F62A 3PV6A 3EOTL 4PJXF 1AP2B 2W92A 3GBMH 4U6XB 3CU1A 3WE6B 3NZ8B 4HEME 1MNUL 4GW1B 5J56B 2ATKB 5J1TC 2MQCA 1JRHI 4A6YA 3CK0L 2KZWA 3HI1B 3IF1A 5DHYB 2AKRB 4LLUB 1S78D 1CFQA 1RPQA 1IBGL 1NBYB 1EO7A 2Z91B 4JDTL 1AGCA 3U48A 3HR5A 5ICXA 2CRYA 3WJJC 3VG0L 2MPAL 5B3JE 4LPYA 3WFBL 5KS9B 3QXUA 4JRYA 5B8CB 1QA9A 5DD5L 4KHTH 3RVUD 1DQML 3KPSA 4PJXE 3SDDD 2V7HB 3UTTB 1FL5B 4H1LH 2BY2A 3MRMB 3PDGA 1A9EB 1G6RB 5TPWL 1ORQA 3LPGA 1OAXL 1S7UA 3LY6A 2AEPH 3QCTH 1S7WB 2JJWA 3VW3L 2R2HA 5IMMA 2KH2B 4MNGA 2ORBH 5A16A 1TZIA 2EZ0C 1UWGH 3S35L 4PLOB 2QQLL 1U8HA 3QDME 2BC4B 4MCYA 2F53A 5EO1B 3EBAA 3OKKA 1NGWA 2VDLH 1YYLL 1ZA3A 3WFCL 3KS0H 1UJTA 4MSWB 5HHOE 2EDNA 2L7JA 3ARXA 3DRTB 5J12C 3EZJB 3FFCE 3E6FB 4E42A 2V9TA 5C0ND 2Q20A 2HRPL 1F13A 4L8SB 3TYGL 3AM8A 1IAOB 3ZYZA 3KPRD 2VLKB 1U58A 3CLFL 4I18A 5IKCB 3MRKB 3E8UL 2VXTH 4LCCC 4N8VA 4EQ2A 5DVMA 4OF3A 4FQIL 4PREB 4QNPF 3T0EE 5F7HA 5E5MB 3FN0L 4M62L 5DRZA 4YHYB 3QWOB 1DLFL 3CNKA 2YUVA 1RZ7L 4M93C 5E8DH 1KIUA 4QRTB 5I15L 5GSVA 5I1GL 2N1KA 4NO0A 4IOIB 1QSVA 3MRRB 3V5KA 3QWRD 3U30B 3C2AH 3BKMH 5K9QG 2I27N 1I7TA 1LD9B 5HYSA 1DFBH 4HX1A 4PRIB 1T1WB 2JIXB 5CJQL 1RZKH 3EYVB 2DQCL 2YZ1A 4QNPE 1GAFH 4DTGH 2VNCA 1QVOB 1Y0LA 5FYJU 3UAJC 4GAGL 3ZT7A 1A6ZA 3WN5B 3WSQH 4NQTA 1WFNA 4NC2B 1JNLL 2MJWA 4NRYB 2MWCA 3PWPB 3GI9L 2EIEA 4M5ZH 4XC1H 1I1YB 3SKOA 4DCQA 1G7JA 1YECH 1XH3B 3QIUB 2WBWB 4MXVE 4I9WE 5F71A 5IBUB 4RZCA 3P4OA 2CIKA 1MRFH 1QR1B 5F9WC 3P0VL 3H42L 4XVTL 1NFDA 2XTJE 3SO3B 4FG6C 4ODUB 4ZNCD 5IUSA 5IMOB 3P40A 1CLYH 4ZYKB 2X4RA 3GK8H 4JB9L 2Q7YB 2OZ4A 4XNXH 4PRHD 3SDDA 4HKZA 1NGYA 3O4LD 1IM9D 1A6TB 1NAMB 5CD5C 5TE7L 3BPOC 4NQSA 4U1MB 4LQFH 3WFDH 2X4OA 4YDVA 5D7SL 4RDQG 5C0EB 5T5NF 2O5YH 3VA2C 1G7LA 1OSPH 2DD8L 2EDHA 2PXYD 4M7ZC 3F8UB 1P7QB 3SE8H 4ERSL 1A64A 4X7TB 4JG0L 3C9NA 3DWTA 4FTVE 1LEGA 1IAMA 1A7BA 2CMRH 4C58B 5E00B 2VZVA 5EU6D 2NYYD 3RNQB 3MLRH 4WCYL 4WFFD 4Y88A 1T4KB 3IJSB 1I1RA 4I2XB 3B43A 2X89D 3F7PC 4LPWA 3TBYA 3TJHD 5HJ3A 1CXFA 4WW2C 3RGHA 1ZK9A 5IB5B 2VKXA 1BBDL 1JPTH 1AXIB 5FOBB 3ARFB 2CLVB 3IKCA 1Z2KA 1AGBA 5C0GA 5JTWA 4HUVA 5EU7E 3KPRA 2NY1D 2CH8A 4X9GA 4F37K 3KXFE 3Q3GB 3STLB 3AVEA 2GJ6B 3DX9A 1K2DB 4OUUB 4N0RA 2X4QA 3OJ2C 3Q0HA 3I50L 1QYGH 3LHPH 4KV5F 2HH0H 4H88L 5IGXH 4UT9H 1U91B 3VFMA 2DQIH 3ISWA 1C5DB 5ICYA 2BX5A 3FO9A 4BFIB 4WIQA 3QWRA 2HFGH 2XZZA 4IJ3B 3UMTA 1XGQA 4XPAL 3G9AB 1HQ4B 4JM4H 4YHKL 4B53A 5EBWA 4ETQA 5KSAA 4FFZH 2JB5L 4GOSA 4PJAB 5E94B 4PD4J 3BO8A 2YA2A 3GHBL 2PR4L 1DE4A 3DXAE 2ESVB 2ENYA 2CR3A 4RRPA 3ZYIA 3UDWA 2CPCA 3F7VA 4XBEL 4H25A 4RMTA 3FB8A 4XVUD 4GXVL 4Y1AD 1D5IH 1KNOB 4K7PY 1ZA6A 3O0RL 4AIOA 4JREC 5C92A 1DCLA 5HDQH 3O3DB 1NJ9A 1LO4L 4GAJL 5J6GA 4IRSA 3O3UN 3V7MA 1HSBA 2BMKA 5C71A 4PRHA 3WHE0 3O4LA 1IM9A 3AXLA 5KS9F 4F7MA 3CDFA 3X12B 3ORJA 3O11A 2ADJA 1T20A 4YJZL 1H5BC 3LKRB 4TTGA 2OTWA 1RMFL 1N2RB 1OSZB 3RDTB 3VXSE 4ZUWB 3QNZB 4JFZL 5IMKA 5I1DA 3WHE1 1JYXA 1J0ZA 2D7MA 3BPNC 5IROC 5DRWA 1T2XA 1CTNA 5BRZB 5B38A 1Q8MA 4WTZG 4HHAB 1FH5L 4L4TE 3JVGA 3L5JA 1KEML 4K8RC 3O4OB 2X89A 5AYUH 1QO3B 3ARGC 3LRSA 5C6PB 2GCYB 4HDIA 1HH9B 1OGTA 3HNSH 2ERJB 5KS9E 3S34H 4Z8FH 1D6VL 4QHMB 2XACC 3BUYB 3I3DA 4RGNB 3UTTE 4I0KA 4D2NA 5A2LH 4QHLB 4UILL 4NN6C 3OMZA 4HGWA 4MXWL 1EJOL 3BJLA 2B1AH 1UWEL 3CPLA 3LKPB 4JZOB 1ACYH 1OTUC 1ZKAA 3O2WH 1TTFA 1KCRH 1VACB 4Y4KC 4Z78A 1KB9J 2JB6A 3U82B 5DRXB 5F7MC 3KR3H 4HUWB 4UB0L 4XPGL 3L7FB 3ILQC 4K8RH 1OAUH 3MV9D 2FECL 4N0UB 3DIFA 2NX5B 3BZDA 4Z77B 1DUZA 4HS8L 1TVDA 2Z8RA 1A7PL 2JELH 4GSDH 3RWIB 1F3JB 4O51B 1MCEA 2YPVH 5FHBH 1U2HA 2IAMB 3B3IA 3RBSA 5KAQF 4MZ2A 4Y16B 3VFTB 3OHXA 2P5EB 3BJ91 3HA0A 2B1HL 2DQTH 4QCIA 2GHWB 1I9JL 1CFNB 1SJHA 4DJMA 3CC5B 3SE9H 4NKDB 1XR9A 4R4FL 2R0KL 2E7CA 4EOWL 4EDWH 1JF6A 2RAMA 1CFVL 4AMKH 5DLML 2VLKE 4G3YH 5I73C 1L7IL 3GNML 4O02H 3BDBA 3EYQC 4I3SH 4TRPH 2AW2A 3SDCC 1G7HA 2CDFB 2FH6A 2XPGB 3OXRA 3NCEB 1FIGL 1BQHG 3DX7A 1MEXH 1DBBH 3O3AA 1Z0NA 4ZFFB 3TT3H 4QO1A 4Y1AA 4YHIA 1OQOA 1I1FB 1T83C 2DLHA 4JFOB 1CGVA 5B21A 1JYWA 4OZIB 4JO1H 5FYJE 1YY8A 4LBEA 5F72S 3RVWC 3I6LE 1VFAA 4JFDB 4MA7H 4R0LB 5GPRA 4TPRL 2V5YA 3B8SA 5DVOA 3V52H 5JHLL 1U93A 3G6DL 4G43A 3EYSL 4WY7L 4LKCB 5CGMA 3LMJL 4PRIE 2R9HD 2Y06H 4K3GA 3WS6C 7CGTA 1AGFA 5HI5C 1IAII 3S37X 4YZFE 1GH7A 2D7OA 1CDCA 2NY6B 4FQ2H 3T0DA 3PXHA 5FO8B 3IXTA 4D9QE 1S5IL 2DWEB 4KHXH 1OAKL 1HOCA 1V05A 1X7QB 2Y6SC 1K85A 1GSMA 2HKHL 1SYVA 4NYLB 1RUQH 5F7WC 4TNWK 3PWPE 1BGXL 1JV5A 4HZAA 4F58H 3SCMA 3EFFA 4KY1L 3QJHA 5L2KD 4C59B 1OAYH 1MWAL 3RWGB 3D69B 2J12B 4L1DA 4W6WB 5E4EB 1KCUH 4O4YL 2K9UA 4NQED 2JJTA 5TGBB 1ZWIA 5DEFB 1CK0H 2DIBA 4FQCL 4NUJB 2ZJSL 3JTTA 4ZQKA 3ULUF 2F54D 1IC4H 1P53A 4H0HB 5DJYA 4JZJB 32C2A 4X8XA 4QRRD 2YC1B 5JOPE 5I17B 4HV8A 1WC7A 1IGIL 5I1KH 2C1OA 4YHNA 4P2OC 3MV9A 4RFNB 1QLEH 2QR0A 3ZE2F 4UT7L 2Y07L 1IKNC 3RIFF 3VXTB 1BZ7B 4I2XE 3R8BB 4MCZA 2LQRA 3MRPB 2CLRA 4JVWA 4Q6YA 4JPKH 3ULUE 1BBJB 2IH3B 3B9EA 3IFLH 1BOYA 1VEOA 1LVEA 1S7RA 1NGQH 1EJ6A 3MOQA 3MRHA 3RZCB 3GIZH 1F4HA 1QLRB 4CL7A 3MR9A 2DKUA 1EHNA 4U1GC 1CICB 4PJHA 5GRJH 5D2LB 3DV4A 3GEWB 5DURD 4YDKL 3KVQA 4WO4C 1U8OB 3RPKA 5C6TH 3OKMB 1J5OL 2GJ6E 4GRMB 3HI5H 1JPSH 4PJAF 1EFXB 1KTRL 4RQQB 3WUWB 5J6HB 1CDJA 3MTRA 2EYSB 4KVCL 4M61B 1A6AB 5CZVH 4OKDA 3BXNB 5JIHA 3SE3C 4MA3B 1FGNH 1J0YA 4G9FD 5IHUL 5BV7H 1B0GB 2EDKA 1WQVT 4L5FL 5EOCH 1JGVH 1MWAA 1MSPA 1XCTA 3DMMD 3CH1A 2FHCA 5I8EB 5TJWK 3GJFH 2UWEB 4HC1L 4XPTL 2F5AH 1J1PL 1S9KC 4NQXA 4R26H 3LEVL 4JFYB 4PJAE 1OP3K 2Q87A 2DICA 2ESVE 3PL6D 4G8EA 1ZT4A 4UTBH 3TWCH 4MNQD 4X6BA 3D0LA 3QFDB 5F6IC 2FJGA 3D0VB 5HYJD 1B4JH 1FCCA 4OLUH 4OLXH 3S37H 5L2KA 3WIFA 4HIJB 5HHQA 2X1OA 2AI0L 1BJMA 3P9LB 4UIMB 1FAIH 5HGBA 2GJJA 3ZL4L 4GKSB 4NQEA 3O6ML 3ZTJH 3WEXA 1EMTL 3LZFL 4EEEA 1N6QL 1IGTA 1DR9A 3JWOC 1AE6L 4U1HA 3RL1B 3AS2A 3RJQB 2APXA 1INDH 2UYLB 1ODAA 3MV11 4BSJA 2WMPA 3HZKA 4QRRA 3OPZH 2MTPA 5TDPB 4LU5H 2BVUA 5FKPB 3EYOB 3RNKB 1J1OL 4WI2A 2AJXH 1JMZA 1KTDA 5BRZE 5K9KA 1R3KB 2EH8H 3QO1B 1UEMA 4WI9A 2YHGA 3EHBC 4DKDC 3MOBH 4HKBB 3MO1B 1VHPA 5DMKA 1CD9B 3WLWC 4J3WA 5DWUL 4JHWL 4PGZA 3JWOH 2OTUB 4PBWD 4BELD 1GIGL 3TYFB 5E8OB 2X4UB 3MV8D 2ZWLT 3HNVH 3EFDL 4RGNE 2WM0A 1P84K 2VDNH 3T3ME 5AG9A 4MX7A 5MEND 4FFWC 1DBKH 3LQAC 3IJYB 1MCOH 1NMCC 3LN5A 2QSVA 3LDBC 3LN4B 1XF4A 2EKSA 1G6VK 5D1ZB 3OX8B 4UIKL 4EUPG 4G8GB 1N0LA 4WEUD 3UTSD 3KLAB 4PJ8D 5GIRB 3WNMA 1KBGL 1TCRB 3P9MB 2I9TA 1S7XB 2QHLA 1DBJH 4PBVC 4N0UE 3K81A 3H9YA 1J18A 1IZKA 1RJZB 4YAQB 4HUXB 4W4OA 1N7MH 4GBXB 4KTEH 1JFQL 4G9FA 2AS5M 4ZPTB 1F4WL 1A7NL 4NSKB 3T77A 3V95A 2GSIA 3U9PL 4JFHD 5EU4B 2D3VA 2P5EE 3H7LA 1RU9H 4JQIL 3A67L 2WBJB 3MA9H 1HH6A 4RISL 1G0YR 1OY3B 1HDMB 4U3HA 4OM0L 2BOCB 3BDYL 3I84A 4XCYB 2E7LA 4MMZC 1QFWH 4OLZH 1RUMH 4PJ7A 4HIHA 1KCKA 2ICCA 3DRQA 1OAZH 3M1BA 2NZIA 5KG9B 1F6FB 3PL6A 4UINL 1QKZH 1NCWL 4S2SA 4LKXA 3T1FA 4KK6D 5HYJA 4OD3H 3OTTA 4NP4H 5DK0A 4AZ8A 4XZUA 4XMKH 4XP4H 3A6BL 1WAAE 1D6EA 1NEZB 2XQBL 5FUOL 2XY1A 5KJRH 3U2SA 5LQBL 4OZIE 2NTSP 3TBTB 1D9KC 4ENED 5JMOC 1BD2B 4JFDE 4OI9A 1GOGA 2XG4A 1FNLA 4H8WC 2D7PA 4JDZB 1FNFA 2NY7H 4JGUA 3HLAB 4KH2A 3QZWG 4ZNEA 1W0YT 1I9IL 4RIRB 1CBVH 5D72H 1HINL 1X5LA 1QTYT 4N9GB 1O5DT 2NNAA 2CLZA 2YPLB 1YJDH 1E6JH 4RFEB 3O6LH 1RURH 4QXUH 3AB0B 1S9YA 2ED9A 1TFHA 2HKFL 3O3EB 4CVZA 2IPKA 5EWIH 4YPJA 2WSKA 5MEOB 3MNVB 4H8WH 2HWZH 1R5IA 3EIFA 1AQDB 5CEXA 4MYWB 2XZQL 1A9BA 3K2MC 1NMBH 1G9NL 2VZSA 2PYFA 3L3DB 4AM0A 3QEHB 4NQVA 5F9OL 4LIQH 4GMTH 1JGUL 5MENA 1KIQA 5EU3B 3VDCA 1HXYA 1MCSA 5D8JL 1A1MB 3BZEA 3KJ6H 3L7EB 1FL6B 3CFJA 1HE7A 3QFJD 3F7YA 2FJHA 3PWLB 3QIBC 5E7FA 1S7QB 1VGKB 3IDIB 1KCSL 1ND0B 3HB3D 4N1HB 5D2LF 5J1AB 2DDQH 3WL9A 4O9HL 1JYNA 5JXED 3U83A 4WI7A 1PZUB 3S4SB 2DI7A 4X5WB 3HZYB 3AY4A 2OMNA 3D18A 2MKWA 3V6FA 4PY8I 43C9B 1TZGH 4XPBH 2CGRH 1JWMA 4MJID 2ZPKH 5GRUH 2A83A 3RPIB 1Q9WA 3ZZ1A 4LF3A 3AREA 1WZLA 5GZNC 1NFIB 4Z7WA 5CEZD 1CL7I 3EGSA 4EDXB 4A6YH 1CD0A 4ZUTB 5E6ID 1I1AC 1NUDA 4MZ3A 1SEQL 4M7LH 3V0VA 1XCQA 3HC3L 1OT2A 1RJYA 3FFDA 1O7SA 4B41A 1UVQA 3MLPA 1UXSB 3D9AL 4OZGA 3FO2A 4P9ML 1ITBB 5D2LE 5ACZB 1RUPH 2UWEF 5C6WH 3TPKA 3VWKC 3L3KA 1JI2A 2DOCA 4KKLC 5J12B 1U42A 5K9JH 3D3VB 2NZ9D 1MREH 2D0GA 5MEQB 2A73B 2FL5A 4PJ5D 1DQJB 4PJDE