2P4AB

X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with rnase a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGYPWTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGDALVATRYGRWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Ribonuclease pancreatic
publication title Exploring the capacity of minimalist protein interfaces: interface energetics and affinity maturation to picomolar KD of a single-domain antibody with a flat paratope.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 33
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p4aB00
4QTHA 3DV4B 2F8VA 5DSCB 3GB7A 5F9OL 1FV1A 4ZD3L 3RNKB 4JFFD 3HAEA 1OSPH 2SEBB 3BE1L 5E0QA 2E5EA 1CF8H 4JM2A 2QQKL 2Q8BL 5TDOA 1IL1A 1N3NB 4ONFH 4KK6C 4U1NA 1KYOJ 4HT1L 4UDTA 2GSIB 1NAMA 1Z0MA 4PV8A 3FN9A 3RGVB 1GC1L 1H5BB 1UEYA 5F7UA 3QEQB 4OZFG 4RISL 4EVNB 5AZEL 3G5YB 2IC2A 2R69H 3SDXF 4ZXBB 4U2YA 1CK0L 1NBYA 1RZ7H 1FZOA 2UV3A 3LKRA 3S96B 1YEFH 4U0RC 2FO4A 5HI3D 3KPMA 1D7FA 3C60A 4HDIA 2EYRB 1ND0A 1F4AA 3I6LD 2ITCA 4ISVA 1U8JB 3REWA 1E4WL 1N8ZB 1F58L 2A2QT 2OK0L 4Y2DD 3VDCA 2EC9U 4Y89A 2R8SH 4UBDD 3HUJF 4RWYH 4YAQB 3FHQA 2R2EB 5FV2A 3SDXB 3NABL 1DCLA 1T4KA 4AQOA 3G5ZA 2AERT 3SE4A 2EDLA 2PCPA 4G80A 5CILL 1OM3L 2BMKB 5F3HA 4LMQI 2NY1D 4X7EC 5FHBH 4XNUL 1RUKH 2FJFA 1OAXH 4DZ8A 4OSUH 3FT3A 5DR5L 5C3LD 3KPSD 1QLRB 3PHOA 1OAYH 1RJYA 5K9KA 3SDAD 2D2OA 4N0RA 5DT1L 3QISA 2YPLB 2XTLA 3ZTJG 1HH6B 2BK8A 3GSUB 1HXYA 4XWOD 3UBXB 4FTVA 4D3CH 4P23A 3VFWB 3VG0L 1BZ7B 1YMMD 2BSRA 5ESQB 1EHLH 3QXUA 1FG9C 1XCQA 2PTUA 1EMTL 1INDH 5C0BB 1FZJA 5D2NA 3G6JF 4XNZC 3QI9C 5CEXB 3JTTA 3TGXA 1IGTB 2R0KL 4LQFH 5DD6B 2HN7B 2NY4B 2W65B 2F58L 5FCUL 4MAYB 3P73B 1AGCA 1A02N 5EIIB 4EDWH 2N7BA 5A1AA 3I3DA 2EDBA 3N85L 5E1HB 5L6YL 2DIJA 2CJUL 4G5ZL 2YPKA 3MUHL 3CX5K 4FQ2L 5B4MC 3AROA 1U8PB 4QRUB 3FL7A 2D7QA 3GO1L 4P4KD 5B8CC 3B6SA 2X41A 3E6FB 5EZOH 2D03H 3ARBD 5IWLA 4GBXB 2X89D 1TVHA 3QUZD 5ICYA 3F58L 1NGZB 3D0VA 2HJFA 5C0IA 1IM9A 1K6QL 3L3OB 2G5BA 2RJMA 1OCWL 5F88A 4M61B 3MNWA 4PJXE 2EKSA 1ZKAA 4KVCH 4LSVL 2CK0L 3U4BH 4QXGL 4WHCA 2DM7A 3B2VH 1YEKH 5CFHA 5CJ5A 3CDYA 3FOLB 5JW3H 4NWTH 3DLQR 1K8DA 1TENA 3N1GC 1A7QH 5J56B 1ROWA 5KJRL 3DROA 4LHUB 5E5UB 2WUCH 5CBEB 4HUXA 1G9NL 3VJ6A 2W9LA 2X4NB 5T5NG 3UC0L 3WLWC 4QLRA 2ATPA 2ZNXA 4Q9BA 1F90L 5A2LH 5C0FB 4K23H 2FD6L 1D5XA 1T3FB 2XKSA 5KG9A 3MRHA 2VWEC 4JRXE 4UDUB 4AENB 4XPAL 1NMAH 4AJ0A 4QRPE 1N5AB 3QEUA 1IC4L 1WFOA 3UDWC 5E1AB 5L88L 1BFTA 4TNWF 4QWWC 1SMAA 1I9IH 4YNYB 1R24A 3BW9B 1XGRA 1U58B 5TPWH 1JWUB 3I2CH 5IFAH 4CNIA 4MHHG 3RAJH 4OFDA 1IFHL 1U8OA 2Z9TA 4HUNB 4J8RA 1MCEA 4OIAA 4Y1AD 3AREB 3MRJB 1AO7B 2IPKB 3CVHH 2R4SL 5I76B 3VE0B 1ODAA 1YNLL 1E28A 5AUMA 5KS9B 4TVPD 4S2SA 2AJ3A 2NTFA 3EUUA 3WKML 1AP2B 4X6EA 1IQWH 1A7OL 3UPCA 1BQLL 1FZKB 3KYOB 3KJ4C 5EU6A 4BSJA 3IDYC 1DN2A 2B1HL 1EEZA 2XN9A 2UUDH 1P4BH 2HLFC 1MJ7L 4OQTA 43CAA 1IT9L 1WFTA 2AEPH 2EEAA 2UYLB 4JRYB 4I9WD 2F19L 3CFKA 4WFFE 3R4DA 5ETUA 1MQKH 2AEWA 5K9JH 4IBLT 3FO9A 1FNLA 4U1HB 3ULSA 4NJ9H 2ILLA 3BXNA 12E8L 3MRCA 3BDYH 4M00A 1EVTC 4BFIB 5INDB 3LKQA 3TIEA 1NMBH 5T33H 2BNQD 3T4YB 4PJXA 4C4KO 1H5BC 1FLRH 5JW5A 1NC2B 1M05A 2NW2A 3MPCA 4ZXBC 4MMXC 3UTSE 1A6AB 3HE6A 1VFUA 1X5IA 1U92B 2PUQT 3MLSL 1ITCA 3UBXI 4R7DB 4OKVA 4QTHB 1DQML 2IF7A 1W0WA 3AB0B 3GB7B 1FV1B 3B9VA 2DMBA 3HAEB 25C8H 1FIEA 2DQUL 4JPWL 4J3WA 3EDJA 3VXTA 4JM2B 5TDOB 1IL1B 5BOPA 5CZKA 4U1NB 3P0GB 4TULH 4UDTB 1VADA 1NAMB 2FNBA 4PV8B 3HC3H 4JRXA 4ZSOB 1NCBL 3FZUC 2VDQL 5HGHA 4JFQA 4JN2A 2UZYB 2Z8SA 2C1OB 4ONGH 4D0CA 1NBYB 1AI1L 3QCTL 3LPFA 2FO4B 4HJJH 3KPMB 3C60B 4HKJA 4HDIB 2VL4A 5T1MA 3MCG1 2ITCB 3ARDA 4ACPA 2DJ4A 4X80L 3REWB 4XP9L 2DOCA 3WHE0 3O2WH 1YY8B 4FZEL 1MFCL 4NC1E 4P3DA 2V5SA 3QO0A 4WWKB 5DWUH 5TE6H 4X9GA 1PQZB 2X4PA 4ZTOL 3S5LG 2QKIA 1KCSL 4O2EA 6FABL 3OAUL 1T4KB 3RWEA 3G5ZB 4EI6A 4Y16A 2PCPB 4G80B 4KGLA 2AEQH 3P2TA 2KPNA 3AM8A 4RMRA 2GIYA 2RB8A 1PVHA 4K71B 2FJFB 4DZ8B 1XMWA 3FT3B 4YC2C 4JR9L 1YQ2A 2NY4C 3PHOB 1LO4H 1RJYB 3QR2A 3DJ9A 5K9KB 4A6YA 4N1EA 4MXQD 2GKIA 1RUQH 1YECL 1JRHH 1HXYB 3MLXL 4FTVB 3OBAA 1AY1H 4P23B 2BSRB 4LLYA 5SV4A 2BDNH 3RVVC 1XCQB 4F58H 4Z8FH 1LE9A 5D2NB 1AKJA 4E5XA 4HFWB 3PWUA 3UTSA 3JTTB 2F5AH 4GBXC 1S5HA 4OLZH 3ZDXF 1TNMA 1AGCB 4YQXH 2EIZA 4HWNA 2PYFA 3P3YA 2VLRE 2HJKA 3C08H 4F7EA 2P5WD 3RU8H 4PB0H 4NZTH 1CLOH 1YEGH 5IFHL 3U0WL 1V05A 3RI5K 1U9KA 3MROA 1YEDA 1NAKL 1KXTB 3D18A 4NO0D 3DUHA 4DFIA 2YPKB 1NLDH 2LABA 4S1QH 3T2NL 4R4FL 4GW5A 2ENSA 3TF7C 2AQ2A 3B6SB 3GK8L 2DN7A 1X5YA 4XHQA 2B1AL 1KN2L 4JANA 1XIWD 1KFAL 1D6VH 1TVHB 5TDPA 3HB3C 4UB0L 4IEFB 2AGJH 3D0VB 2IH1A 3W2DH 1IM9B 2G5BB 3WS6A 2V2XA 2C4FU 5F88B 1UWGL 1QR4A 3DGGB 3MNWB 1IE5A 1OHQA 4KK9C 2EKSB 2FRGP 3HMXL 4LP5A 4P46D 3AAZA 3QJHB 4KRNA 2ZWLT 1R3JA 4K9EH 4X5XA 1JP5A 3CX5J 1K8DB 2ZKHL 2IFFH 3DX9A 3DROB 3P4NA 3NVQA 4XC1L 2Q7NA 1Q9KA 3F7QA 3AREC 4PB9H 3VJ6B 3IETA 5FHAH 2ATPB 2K1MA 2Q8AL 1C5BH 1D5XB 2PTVA 5KG9B 3VWKD 3MRHB 4CBPA 3BP6A 5B22A 2ESVD 3RKDC 4NO5A 2DDQH 3QEUB 3U1SH 4G6JL 4Z95L 2UY6A 1BOGA 1Q1JH 5KW9L 1R24B 4PY7B 5DHVH 3O81A 3QG7H 4CNIB 3RWHB 4N1CA 1U8OB 5CZVH 4J8RB 5KVGL 4JY5H 4KI5F 3T8XA 2FX9L 3BUYA 3TO2A 1E28B 2YD6A 2AJ3B 2HMID 2J6EA 4X6EB 4TVPL 4FNLH 2BC4A 4KKCD 4OD3L 5CCKH 1U3HA 3VFNB 1YMHB 2GK2A 3MA7A 2IGFL 5EU6B 1FIGL 4OBSA 1EEZB 1QP1A 2XN9B 3ZTNH 1S7UA 3DMMA 4X6BA 3U7AA 43CAB 5CJXA 5EO9B 1BEYH 1BFVL 1CLCA 3T2QA 3ULUL 3IJHA 4V2BA 1P2CA 3CFKB 4XZUA 5ETUB 1OP3H 2YS4A 3AB0C 4JPVL 3BIAX 4PRHA 2G75A 1XCTB 3ULSB 1ACYL 4FRWA 4JM2C 3MRCB 1E4XL 3ARFD 5GGVH 3LKQB 3TIEB 1MAJA 4YXKH 4M3JA 4WV1A 5JW5B 2APTA 3E2HB 2NW2B 3HE6B 1TXKA 2IBZX 3C5JA 3T09A 3C60C 4OKVB 4OV5B 3S4SG 4AZ8A 1W0WB 4D9QD 3O4LE 5DD5L 1OF2B 1KF9B 3SJVB 3UROR 5GZOC 2AI0L 5LQBL 1CXHA 1CVRA 3HNTL 4KU1A 3VXTB 1XEDA 1MWAH 2GFBB 1VADB 1GAFL 5GISL 1MRCH 3C5ZD 3GSNL 1N6QH 3NIFE 4DEPB 3RGHA 4JFQB 1PX3A 1UT9A 1XGQB 4JN2B 2AXGA 3SE4C 4XP1L 3ZHKA 4C55A 4D0CB 3B2UD 1BLNB 1WK0A 3ARVA 4P5MA 2M1KA 4HKJB 1VEOA 4K71C 3VU2A 3C5SB 4KTEL 3UPRA 1KG0A 1YYML 2A6KB 5F7KC 1HI6A 5B21A 5C0CD 4P3DB 3QO0B 4Z7VE 2ZCLL 4FQXA 2X4PB 4JFDA 1DBJL 1MCOL 2QKIB 5IB2A 1TITA 5J3HC 1FNSH 3ZDYE 4P23C 4P2QA 4Y8DC 1VGKA 1CL7I 3NFSL 4EI6B 5I18L 1YUHA 4Y16B 3P30L 1AJ7L 1KIUA 1L0QA 5D2NC 4NO3A 4URTB 5HHPA 2IBGA 5IP4A 2OX5A 2VQTA 2HP4A 4U7KA 3ZT5A 1PG7L 4GAJL 2VZTA 4YHOH 3T0DA 3C87A 5FECA 4QHUA 4WUKL 3LMJH 1A3RL 4BQ6A 4JKWA 4A6YB 4HWEH 1T21B 5ID0A 2VLJD 3HCVA 3UJJL 3QDJA 3TBTB 3RY5A 2CDGA 4LLYB 4KRPB 4XNQA 3RWIA 4FABL 1M7IA 4XPBL 1IZKA 4FN0A 1LE9B 1AKJB 1KJMA 4E5XB 1ZTXL 3PWUB 3UTSB 4M1CD 4KFZC 3RVTD 5D1QA 5J13B 5IWLC 1S5HB 3UAJD 1Z3GH 4M1GL 2YPVH 5K59E 3O4LA 4UT6H 4OZFB 5E8DH 1RIVL 4P9HH 2EIZB 2PYFB 2HJKB 2XACC 1WC7A 1HIMH 2A9NH 3QQ4B 3FN0L 3WKNA 1NCAL 4MD4A 1YEDB 4Q6YA 5C9KA 5DQ9A 3D18B 4MVBD 5EU5A 3CFDA 5HD8D 3TIDA 4GW5B 1J8HD 4LFHD 4YBLB 4LCCA 1I9EA 1A5FL 1OAUH 3ULVC 4JANB 5TDPB 3S5LA 1WITA 4U1SA 3INUL 4F37F 1UZ8A 4PJ9A 1G6VK 2E9WA 2IH1B 1NKRA 2EEBA 1YEHH 3GRWL 5FYJU 1CD9B 2V2XB 3T0WA 4L5FL 5D8JL 4UTBH 2Z31B 4Z7VA 4Z7OF 3CLEH 3K8LA 1WCBA 2BXYA 4H88L 5SWZB 3AAZB 3AU1A 1R3JB 1J12A 4KHXL 3V52H 3CK0H 5JW4R 4R96A 1CDUA 3L7EA 1F8TL 2EZ0C 5EFIB 3QFJE 3P4NB 4OIIH 1BZQK 1BWMA 1Q9KB 5FUZL 1KEMH 3VXPA 3IETB 4D9RE 1R5WB 3ZL4H 2P45B 5EOQL 2AABL 4APQA 4M43H 1S5IH 2PO6D 2B2XL 3VD7A 2F15A 5T3ZD 1HYSC 3BP6B 2AJYH 4NO5B 2OR8A 4EI5D 5MEPB 4Z78A 1A4JA 3KPPA 1UZ6E 1BOGB 3WNNA 4KZDH 2VDML 1R3HA 1NGPL 3RUGE 1RZKC 3AC0A 4GS7B 3VI3F 1RSFA 4GW1B 4OZ4B 3BDXA 5GRJL 3ARRA 2B4CL 5DRXA 4D0DA 1MIMH 1OP5K 1B9ZA 3T8XB 3TO2B 2Y9RT 3TNNA 1AH1A 3ZE0F 4FZ8H 3JVGA 5C86A 2BC4B 4JCLA 3K4DA 1U3HB 1XF2B 3MA7B 1FYTD 2HTKC 5F9OH 5HHOA 4KXZH 4G9FA 1T04A 1S7UB 3DMMB 4X6BB 3E2HC 2ENYA 2QQKH 3HE6C 1I9JL 3P40A 1PZUB 3MJ9A 1L0XA 4HCRH 2R56L 4XZUB 3UMTA 1ERNA 2BVQB 4RISH 3P9MA 4PRHB 1EX0A 3HPLA 4XHJD 1WWBX 4P2OD 1J5OL 3AVEA 1WIPA 4N0UB 4E9LA 1N5YL 4XXDA 4LSQH 5GS1A 1KIRA 2YC1A 3CAFA 4DEPC 1NUDA 1F58H 2OK0H 5BCAA 4K8RD 5IHZA 5TQ2H 2NNAA 1KTDA 3TT1L 4WI4A 4MWFA 3RY4A 4JREB 4LPCA 4U6HA 2MSPA 5D6DA 1G7HB 3NABH 3ARDC 4JJHA 3QFJA 3GSOA 4U6TA 2I07B 4OF0A 5CILH 2GJZA 2C5DC 1S78D 4C54A 3T3MF 3VXRE 2KH2B 4R26H 4QNPE 4PS4L 4QTIH 3EFDL 4JRWA 3OXSA 5LXGL 1U8IA 2JCCE 3F62A 2AXGB 3LQMA 1U8MA 4Y16C 5C07A 4XPTL 3AM8C 4G6KL 4BH7A 4PIRF 2X4TA 5F6HJ 4P5MB 3RUGA 4EZMA 4NRXA 4GRWF 1SM3L 2L7JA 3MACH 2P5EE 3UPRB 2XTJB 1KCRL 1KG0B 2RCSL 3UXFA 4JO2H 1Q9OA 1HCVA 4F8TA 1CE6A 4J3UA 4EIGB 4FQXB 4JFDB 1MCRA 4U1KA 2R0KH 3NIGF 4RFOL 1WIUA 5IB2B 1ZLUK 2WBWB 3T1WA 4P2QB 3EOTL 1VGKB 2F58H 5FCUH 1P7QA 4EUPH 3S3PA 4KRPC 3C6LA 1YUHB 2EDEA 4E0RA 1JGVH 3HS0A 1W0VA 1DDHA 1UKSA 1YNKL 3RVWC 5HGBA 2D9QB 3D9AL 3GMQA 4NO3B 3TNMA 5HHPB 2NY0B 3MGTA 4LCYA 3KPRD 3PWLA 3SDCB 4K94C 4NKIH 2ORBH 4G5ZH 1G9MH 5FECB 4QHUB 1LP9E 2XWBA 4FQ2H 3UTPE 3GO1H 2VDKL 5ID0B 2P44B 5SWSD 5TE7H 1TPXB 3QDJB 4OGYL 4JFEB 3FT2A 3OJDA 5L0QB 4NJAL 5F7DA 4POUB 3S4SA 4GUPA 4XNQB 2AK4E 1M7IB 4JE4B 4GKSB 2LU7A 1OCWH 1KJMB 3ARYA 4HULB 4YBLC 5D1QB 2H2SC 1J0ZA 1LGVA 3KLHD 1KTRL 3N9GH 2W38A 5C7XH 3GEWB 1S8DA 3D2UA 4POZC 5KTEL 1Y6MR 2CDFA 3WS6C 1WC7B 1KBGH 3VXRA 4PP1C 1F4WH 3WO3B 3QDMD 1FNFA 5D1ZA 2FH6A 4MD4B 2P48B 2MQCA 2A74A 5DQ9B 3UZVB 1F90H 2JCCA 3QJFA 3EYUL 3VFOA 3TIDB 2FHBA 4KUCF 3IAGC 4XPAH 2FJHA 1Q9WA 2L0DA 1IC4H 2FZ3A 3S5LB 1N59A 4NKQB 4U1SB 5CZXC 3PDDA 1UZ8B 2P5EA 2UZXB 3IDMA 4PJ9B 5JHDD 1R5VA 4S10A 5DEZA 2NXZC 2VDOH 3WL9A 3KAAA 5CD3A 3T0VA 5J6GA 3GM0A 1C5CL 1IFHH 2ZG3A 3OAYK 4Z7VB 3TCXA 1CE1L 2NY6B 3W9DB 4Y8AA 1TVDA 3IU3A 1IC1A 2R4SH 5CSZA 1L9NA 1WCBB 3WDJA 5BJTA 4JO4H 2WBJA 3BT2H 4KKAC 5IBTL 3WKMH 1NGWA 4P49A 1QFPA 2DWDA 4R96B 1QBLL 3BYYA 4GS7C 1ULVA 3L7EB 1Z9SA 4CGTA 3B8SA 2IANA 4HWBL 5JXEA 3VXPB 5FKPA 1EAJA 4KH2A 5IT2L 5IBLC 1MJ7H 1JGUL 1IT9H 3LN5A 4APQB 5TF1L 3NGBB 2WINA 2Q76A 3RBSA 5IJVB 3PL6D 1U3HC 5DMJB 2F19H 4JG1L 2EXWD 5T3ZL 1IGIL 1UADC 2NY3C 1JWMA 1LO3L 4Z78B 1A4JB 3KPPB 2E6PA 4IS6A 3DMMC 4WNQB 4Q9CA 1R3HB 2P8PA 1N6UA 5CJXC 12E8H 3HNSL 5I8OL 2F54E 3BPNB 1T2QL 1WAAA 4LPUA 4XBPA 4DKAA 5DRXB 1FFQA 3JTSA 4JFFE 3TNNB 1FPTL 4W4NA 1GHFL 4JHAL 3MLSH 4K9EC 4LIQE 3QUML 1UA6L 2ITDB 1WZLA 2VH5H 1DQMH 3RZCB 4GRLD 4CDHA 3FOMA 3IDNA 5I9QB 5HHOB 1KXQE 5ID1A 1DFBL 4L3CA 4WV1C 4G9FB 2KZWA 3SE8H 1MJUL 1T04B 4JPWH 5EA0L 3F7PC 1MRDL 1UYWH 2DJSA 4KI1A 3U48A 3LD8B 3S36L 4JREC 4LIQH 2CIKA 2DI9A 1NC4A 5DVKA 2X42A 3CPLA 2C1PA 1CIDA 3I6LE 3BP4A 3EYQC 5L7XL 1N2RA 2Y07H 2YN3A 2WUBH 3HPLB 4PJHF 1U36A 1WEJL 3MBXL 1AI1H 4V1DA 3L3DB 3QCUL 4XXDB 2YOCA 5GS1B 1KIRB 2ZSWA 4X80H 4XP9H 4LU5H 2BNUA 1MCKA 2GCYA 4XB8A 2ZPKL 5IHZB 1KTDB 1DANU 1KSRA 2CGRH 1KPUB 1H9VA 5DFWH 2Z4QA 3WUWG 4MWFB 4K8RL 2EICA 4PJHB 4U6HB 5EOCL 5HVFB 3UTOA 1KCSH 6FABH 3OAUH 3QFJB 3OHXA 3GSOB 4PRDA 5E2TL 2UWEA 4O5LL 5SV3A 3FB5B 3KPSE 2GJZB 4XPFL 2FHCA 4FQXC 4OCRH 2WNGA 1T5WA 2P46B 1H0DA 1M7DB 4KMTH 4MQXC 4XVSL 2J8UE 4WWID 4HUUA 4YJZL 5J8OA 1DQDL 3CGTA 1QSZA 3OXSB 5E2WH 3VFMA 3WO4B 1KTKE 1U8IB 3GI8L 1D3CA 1U8MB 1YMME 5C07B 2YD4A 3B5HA 4I3SL 3MV7D 4BH7B 2X4TB 3RUGB 1VHPA 1YECH 2NY0C 3TO4D 1BFOA 2F54A 1NMCB 4XMPH 4L29B 2V5MA 2HVKA 3JUYA 5AAMA 2KBGA 4JFPA 1RIUL 1T5XA 1Q9OB 4PJDE 3S8WA 1CE6B 3P0VL 5IM7A 5F1SA 4OLYL 4U1KB 3S37H 2CXKA 1TPXC 5FXCH 3O8XD 5L0QC 2VC2H 1P7QB 1GPOH 4RBPH 5EBLA 3C6LB 3BH9B 4E0RB 2NX5D 3HS0B 1DDHB 3MFFB 5HGBB 3GMQB 3G5XA 4LEOA 2BRQA 3TNMB 3MGTB 4LCYB 1ACZA 1Z0NA 4K7PH 3PWLB 2BHZA 3N06B 3TBYA 1NAKH 5HDLA 2B8OT 3PP4L 3H7LA 3T2NH 4FQHA 5GJTL 4R4FH 4G9DA 1A6WL 2A0LC 3GK8H 4KJYA 1UM4L 2VTFA 2HLAA 4Y2DA 1CFTB 1KN2H 1KFAH 1BBJA 1LO5B 3FT2B 3U83A 3OJDB 4UB0H 5F7DB 1HCFX 4GUPB 5E94A 4MJ2A 4RGND 1GOGA 1UWGH 3U9PH 1NFIA 4LCCC 2EDJA 4Z7WE 1UACL 3PWJA 4YDKL 3V8CA 3FFCD 3HMXH 4QGYA 1B0GA 1S8DB 5ESVA 5J1SC 3D2UB 1GGUA 4PG9A 5DQJB 3W0WD 2CDFB 1FGVH 5IG7A 2UZIL 1JF6A 2ZKHH 3KPSA 1A47A 1PDKA 3VXRB 1H3TA 2NY6C 4RAUA 5I1HL 1FLTX 4LVNB 5D1ZB 5ECJE 3MXVL 3I9GL 3E6HA 5EU4B 4R8WH 2XZAL 2A74B 3IFPA 3BIKB 4KWUA 2Q8AH 2JCCB 5MERA 3QJFB 2VLMD 1A6UL 4RX4D 3QXDA 2CXGA 2DWEA 2FJHB 1Q9WB 3W11D 1MCWM 1G6RL 1YNTA 2WMPA 2FZ3B 3KR3H 1N59B 5EU3A 1NBQA 4Y1AE 3OQ3B 2O93L 2P5EB 2Z35A 3IDMB 4LDEB 5KW9H 1R5VB 2VZUA 1JK8A 3TV3L 4APQC 3WL9B 3NGBC 5CD3B 4PJDA 1CICD 4TVPE 1MVUA 3EO1A 3EDEA 3O6LH 3QI9D 1WBZA 5I8KH 5GRVK 5KVGH 3IU3B 4JDZA 3KGRA 1UQSA 5CSZB 2FX9H 1YZZA 5BJTB 3K46A 1NGWB 3GMRA 1F3DJ 2DWDB 4OD3H 3B4NA 4QRTA 1XGTA 4Z77A 5D6CA 2IGFH 1BF8A 2IANB 4I9WE 4P4KA 1ZT1A 3DIFA 3Q0HA 5FKPB 5K9QI 4H1LH 1C12B 3ARBA 1WAAF 1W72L 2X89A 1BFVH 3JVGC 3QUZA 5B4MD 3WDIA 2Q76B 4OCSH 3TCLA 3WFDH 2XRAL 3MLZL 5F3BA 4XH2A 5I9QC 1JWMB 1WBYB 4JPVH 5J7CC 2BNQE 3DOSA 5D5MF 2QSTA 4IS6B 5I1EH 4MYWB 5FYJH 1ACYH 3V4VH 3TVMB 2P8PB 3MV11 3LD8C 5BZWA 5DURB 3HI6H 4JB9H 2NY5C 1Y18A 3WCYA 5I74B 2C4XA 4XBPB 1ZK9A 3MRBA 3O41A 5IEHA 1BIIA 1ORSA 3Q3GA 4I18A 3MYZA 4X83A 4HKZA 1J9CT 3RIFF 2A77L 4S1SL 3FQUA 1EEYA 4YGVA 1HDMA 1YEJH 5SX5H 4YHIB 5DLML 2OS7A 1TDQA 5GS1C 3NH7L 3FFDA 5E9DA 3IDNB 1JN6A 1U95A 3CLFL 1XR9A 5DD5H 5ID1B 2FGWH 2AI0H 1WVZA 5LQBH 2W0LA 7FABL 1CFQA 4OZGE 2AV7A 2H1PL 2R2HB 2CIKB 1GAFH 2HFTA 1EHAA 5GISH 5D6DC 3SPVA 4J12A 5F1OB 4W68A 4YX2L 3GSNH 3CPLB 2C1PB 3P11H 3I84A 3BP4B 5CEZD 1V8HA 1N2RB 4XP1H 4Y1AA 4V1DB 5LVEA 4TN9A 1A7NL 2UWEF 2YRZA 1CDGA 4LCWD 4NO2B 4OAWA 3QG6B 1IAIH 1J11A 1SJHA 1UC6A 2ZSWB 4KTEH 4OCNC 3E3QE 2BNUB 3BN9D 2GCYB 3CDGA 3LQAH 2EDOA 3AS0A 4N5UA 4P59L 3OJ2C 4ZNCD 2ZNWA 2Z4QB 2D0HA 1G7MA 3U36A 4G8FA 1DBJH 1F6LL 1MCOH 2D7MA 2GTZA 5D1XD 1NMCC 1CD1A 2H2PD 3OHXB 4U0QB 4PRDB 3T0ED 2UWEB 1WLHA 3P30H 2BVYA 1AJ7H 3GMMB 4GMTL 4W81A 1RD6A 1T5WB 3K4AA 4PJ5D 1H0DB 5TH2A 3V6BR 4YDJA 4WVRA 2FECL 4HUUB 1B4RA 4LSUL 1IZJA 1HINL 3MJ6A 1PG7H 1GC1C 4WUKH 3C6LC 3MOQA 3DX7B 3S34H 5AD0A 3UJJH 1BFOB 1JZ8A 2HVKB 3B9KC 1W0YT 4JFPB 3RGVD 1JPGB 1MFDL 1T5XB 3WMSA 3QEQD 1IGYB 4FABH 1BJ1J 4XPBH 4FG6C 5IM7B 1CT8A 5HHNA 4B50A 5GRZA 4DK3A 3BKYH 2P5WE 1JHKL 4PGEA 3GSNA 5EBLB 2VDPH 4PJCE 2ED9A 1RIVH 2DTMH 5C92A 2FH8A 3G5XB 3HA0A 4LEOB 5C0AE 2OL3L 3L3HA 1DR9A 3EOBA 5CD5C 3FN0H 2FBJL 4UOJA 2OR9L 4G6AC 3EYOA 5HVGB 4MXVF 1NCAH 4RMTA 3TBYB 1EFQA 1GGCL 3HC4L 4R90H 2J5LB 3H2WA 1QPXA 4FQHB 4Y5YA 1OPGH 2K3TA 3QWQB 4RCAA 5AWNL 4KJYB 2PR4L 2HLAB 1A5FH 3OGOE 4Y2DB 1O7VA 4LFHG 3WUWA 2Y36H 1BBJB 4QHLA 4LVNC 5D1ZC 1AXTL 3INUH 5CGTA 3UTZA 4S1RH 5F7WC 3V4PL 4HQQL 3GRWH 3U30B 5E94B 4LASL 5DUBA 5L2JA 2APWA 1F6FB 2YPLD 4CUCA 2PN5A 5JDJA 2JJWA 5DS8A 1B0GB 4Y4KA 5ESVB 4NZUH 4I77L 4PG9B 2HRLA 1YA5A 5IG7B 2IALA 3KPSB 3RTQA 5C0BD 3U2SA 1F8TH 4KTYA 5IJKA 5FGCE 2DQJH 2N7AA 4RAUB 3V0WH 1HKLH 1JZ6A 2ESVE 1GZQA 4H5SA 3E6HB 5I15H 5FF6A 3TPKA 4WFED 2AABH 3IFPB 2BOBB 2WBJC 3CFBA 4MAYD 5MERB 3NCJL 2B2XH 1Y6KR 3QXDB 1F5WA 1B6DA 3VXSA 2EIDA 5C0JA 2R0ZH 1YNTB 3LIZH 1RJCA 1N0XH 5JXEC 2A1WL 5D72L 5EU3B 5CINH 5IMKB 4TRPH 5MI0B 1FQ9C 2X7LB 5CUSL 1JK8B 1FL5A 4PJDB 1MVUB 1UJTA 3EO1B 3KLAA 3IXAA 1KLUB 1S9XA 5DK3A 4AYFA 1WBZB 1VB9A 1TNNA 2B4CH 4XNXL 3MUJA 3BMWA 4GBXD 2A73A 4JDZB 2P5WA 32C2A 2X1QA 2VLKB 3GMRB 4XRCA 4YHZL 1NDGA 4QRTB 1P6FA 2AKRB 3VFGH 4NO0A 1XGTB 4Z77B 3WE6A 2GY7B 5D6CB 1RY7B 2DLFH 3SGDI 5I74C 5C0AA 3X13A 1ZT1B 3DIFB 1CD8A 3ECBA 1G9NC 3ARBB 4M7ZC 3VD9A 3HPJA 5INCA 4PLNC 3QUZB 2HFGH 4BKLA 1BGXL 4NIKB 3GRWA 3TCLB 3OXRA 5HBBA 2R56H 3K2UH 2IAMA 4AK1A 1UKTA 4LHUD 5IB3A 4JO1H 2XZQH 3WFZA 2XXCB 2DQDL 5CJOL 1G0DA 3RL2B 5KBNC 2AVGA 5BZWB 1EBPA 1Y18B 1JIBA 2DM4A 5ALBH 3MRBB 5IEHB 1BIIB 1F02I 1ORSB 3Q3GB 4I18B 3K1DA 4N8PA 3T3PE 4D9QE 5I2IA 1S7WA 1GCFA 3FQUB 1EEYB 4RGMB 1UM5H 5T1DL 3TT1H 3PGDA 3U0PA 4OLVH 5I19H 2EH8L 3R1GL 3FFDB 5E9DB 5EH1A 1ZVYA 1JN6B 1U95B 4AEHL 1XR9B 1X5JA 3L6FA 3VWKA 1AO7D 5HPOA 3J7HA 2ESVA 1J1XL 1T20A 2AV7B 3CZJA 4PPTA 2HTLD 4OJFL 5IOPA 4I8DA 3KG5A 4NQCA 3EFDH 1P6AB 3KHOA 3EZ8A 5ITFA 5DJXA 3AGVA 1A6ZB 5C0CE 2GHWB 2X9XA 4HFUL 5E4EB 4ALAL 2WAHA 1ED3A 1GGTA 2ZOLB 4JRYD 4PJ7F 1SJHB 1EH9A 5E2VH 3BEVA 1J7VR 1KCRH 5E8PA 1RULL 3CDGB 3TZVD 1JNLL 5DC0A 4OGAD 1MFBL 1CVSC 1G7MB 3U36B 1SJEA 4G8FB 4UV4L 5ILTL 1C5DA 3EYSL 4RFOH 5D9SA 2GTZB 5JXAH 2QLVB 5KZCB 1CD1B 2OJZH 1K5NB 3FO1A 5LBSH 4CVZA 4NHUA 1AR1D 2F5BL 3BZDA 2V2WA 1NC2D 3D9AH 4KGJA 5BRZD 3MTRA 4M02A 4YH6A 5TH2B 1HN1A 2G2RA 4YDJB 5D2LF 5HTSA 2VLJE 3DI2B 1KB9J 1EFXA 1T1WA 3THML 3ARFA 4LAJH 4QXUH 2QQNH 2EYTA 4J3TA 3VW3L 2DRUA 2VDKH 4UZGA 4JM2D 1H3PL 4NBZB 1A7PL 3H3KA 4BZ1L 5AD0B 3SKJL 4OGYH 4JAMA 1TTUA 4HKBA 4NP4L 3O4OB 4LLMA 4NJAH 5B3NA 5HI3C 3GJEA 4M03A 3UPAA 4LCIH 3UO1L 2DQCH 2J5LC 3P9WB 1OWWA 4LEXL 5IHUL 4DQOL 4GQPH 1CT8B 4K7PY 5HHNB 1RHHA 3OAZK 5DF0A 4Y2DC 3RA7L 1YJDL 3C60D 3BDBA 3KYNA 3C8DA 4PGEB 4UBDC 2VDNL 4HJGB 5LWYH 1T0NA 4K55A 4M1DL 3ZHLA 5GZOD 5KTEH 3U30C 3EHBD 1U3ZA 4GLRH 3RWJA 3D87B 1WZKA 5IESL 4WWKD 4HC1L 3L3HB 3EOBB 1J8HE 3LEYH 3G9AB 3KS0H 2HKFL 1RIHL 1GYAA 3EYOB 2NY1C 1WFNA 4GW4A 4MCYA 5DK0A 3O2VL 1SEQH 1T2JA 5DJDA 4Y5YB 5IMMB 3IDJB 5HYEA 4FFWD 5GRXG 3RX7A 4PYHA 2IQ9L 5E99L 3WUWB 4N0FB 2BJML 4QHLB 4RDQF 4M8VA 3PGCA 3UTZB 1K8IA 1Z2KA 1MCWW 3MMEA 5EPMB 4XWOC 2UY7A 2Y25A 5DUBB 2FR4A 4PGZA 3O45B 4P5TB 1U6AH 1CE1H 4FQCL 4QXTA 4I1NB 1TTGA 5J3HD 4FTVD 4P23D 5DS8B 1UWEH 4Y4KB 5MI0C 4NDMA 5IBTH 3DVNA 4WHTA 1JGDA 3IS1X 2IALB 1QBLH 4OUOA 2I5YL 3RTQB 3U2SB 5KSAD 1JZ5A 5J12B 5T3ZE 3OX8A 4TSAL 4HWBH 2NPLX 1WWWX 4H5SB 2VLJA 5IT2H 4JVPA 5FF6B 1DUYA 1JGUH 2QQLL 1FL3A 3SDDB 4M48L 5J89A 4UT7H 1Z9MA 4UIKH 3VXSB 4XP4H 5C0JB 4JG1H 4OLUL 4LRNH 1LO3H 2ICEA 4S1DD 2CPCA 1ONQA 4P4KC 1CYGA 5HHVL 2DBLL 1REIA 4JZOA 1IBGL 4PUBH 3WLBA 3ARBC 4YPGA 3SGEH 5I8OH 1FL5B 3MA9L 3QUZC 3BGFC 3SDYL 1NCWH 4EEEA 2A73B 3VD5A 1FYTE 2JIXA 4LF3A 4LGPB 32C2B 2AJSL 1FPTH 3U6RA 1D9KD 3FMGL 5F89A 1FZMA 1J8KA 1IM9D 1GHFH 3HZYA 3JV0A 4XRCB 1NDGB 4NGHL 3OKYA 1UA6H 2DMCA 4NO0B 1AC6A 5JIHA 3WE6B 4L1HA 4J6RL 5C0AB 5DD3L 5GRVL 4F37K 3X13B 1S7QB 3FO0L 1JZ3A 1MJUH 4I18C 4DKEL 3ECBB 3GDBA 3VMPA 5IVOA 3HPJB 3JWOL 4RGMC 1MCCA 5INCB 4QYOA 5FO7A 5C71A 3AS2A 1ZV5A 3S36H 5JIIA 4TNVK 3OXRB 1K2DA 1G7IA 4NUJA 2IAMB 4G3YL 5DD0L 3ULVD 5IB3B 5EWIL 4HUWB 5L7XH 2WK2A 2AV1A 1OTUC 2FLBT 1J05A 1WEJH 5F8QC 4BSVA 3MBXH 3QCUH 1ZE3C 4PGDA 5A16A 3WFCH 2W0FA 4HH8A 2QV2A 3WDHA 5HXMA 3QA3A 5FGRA 3T0AA 2X44D 5D7LB 3JUZA 4HWBA 5I2IB 4OF6A 1S7WB 2ZPKH 3I75A 3PWPD 4OIBA 3BFOA 3PGDB 3WNPA 3U0PB 2XY1A 1KT2A 3CZFA 5E4EC 5FA3A 1S7TA 5I1KH 5EOCH 3QEHB 3MLWH 2Y06L 5GHWL 2R1XA 1J1OH 2PO6A 2APXA 2P8LA 5CBAA 3L6FB 4MAUL 4O5LH 3VWKB 3QDHA 1QEWA 1ADQL 1BM3L 4MA3A 2ICCA 4XPFH 5H8DA 1T20B 2C3VA 1FH5L 2ZUVA 5E2JA 3MRKA 4DAGL 3EBAA 1IGML 3V7MA 4JZNA 5GXBB 2VXSL 1FAIL 5IOPB 3ULUC 1HYSD 4NQCB 4LARL 1CGXA 4HZAA 2FIRT 5EU6D 3GI8H 5ITFB 5IQ7H 2XN9D 3OB0H 5C0RL 4GXVL 4YO0A 4KI5D 4D0BA 3QUMA 5FYLH 3ZYZA 4RGOL 5E8PB 2ADFH 1ZA3A 4G6FB 1VPOL 3GI9L 5CGYD 4I5BA 3TJHD 4J4PA 4X6DF 4XCCL 1SJEB 3O6MH 4YLQT 1A3LL 1C5DB 5D9SB 2A9ML 1PJ9A 5J11B 5FOJA 4ZFOL 1IEHA 3O4OC 4Y88A 1EGJL 1L6ZA 2HTKD 3KPRE 3QFDA 3FO1B 1GRWA 2X4UA 3OAZH 1MFAL 4UNVA 1YN6A 3LKOA 2V2WB 3IYLW 1SJXA 4FQIH 5HY9A 4P2OA 2G2RB 3R0MA 4NUGH 4LLWA 5IK3A 1EFXB 1I4FB 1T1WB 3SJVD 5BV7L 2I27N 2EYTB 3Q2CA 1A6WH 5J9PA 3D69A 2VRAA 4NRYA 4JAMB 2OTUA 2YWZA 3B9AA 4HKBB 4LLMB 4PR5A 4XVUC 2EDYA 3CUPA 2BX5A 1NAML 4KKBC 1P4IL 3CNKA 1IGCH 4YHLL 4Y5YC 3BP5B 2EDXA 1RHHB 2OR7A 4N0CC 4N8VA 1EJOH 1UACH 4HIXH 3UJIL 4YDKH 3KYNB 2KL6A 1OGAD 1T0NB 3QDME 3KPOA 4EJ1C 5GRUL 4YEFA 2C7UB 3HTLX 3VXUA 3E3QC 4Z7UF 1CXEA 3I85A 4OF7A 3RWJB 2UZIH 1AGFA 2BVEA 5JORA 5K33A 4OZHF 3MXVH 4FXKA 1SYSB 3I9GH 5HHXL 1JTOA 4GW4B 4Y4KC 1IKFL 5DK0B 5HYSG 4NKDA 4AIXA 3ZSSA 3B83A 5DJDB 3PIQA 5JHDE 2VLLB 1A6UH 4Y16D 5DZOA 3RTQC 3U46A 5IJKC 3O0RH 4HPYL 4UQ3A 4XP5L 5EN2A 1HHJA 1ZHNA 3PGCB 5FGSA 1C1EH 4R2GB 1JRHI 2JJTA 4WFFD 1I9RL 3TV3H 4LLQA 2CLVA 2FR4B 3EGSA 1FNGA 3OR6A 1CLYL 1CS6A 4DW2L 2DM3A 5AG9A 2VL5A 4QXTB 1IC7L 2PKDA 1U2CA 4NDMB 3SOBL 4JGMA 3KPRA 4KRPD 1FO0L 3DVNB 4WHTB 3WIFA 5IR1A 1JGDB 3RVWD 2W9EL 3DO3A 1AKJD 1F6AB 3UTSD 3OX8B 2D31A 3DNKA 1IRAY 4LPYA 3RPIA 2VLJB 2X9YA 1DUYB 2QJDA 2MNUA 1W72H 1FL3B 1KIPA 2CIIB 3WXWL 4S11A 3FONB 4JM4L 1SVZA 1X5KA 2IBBA 2CKBA 1NEUA 1Q0YL 2XRAH 4YDIL 3MLZH 3GMLA 1IEBA 1KLFA 2ADJB 2AJUL 2ICEB 3G6AA 1V5JA 1ONQB 2BERA 3GBML 4JZOB 3WLBB 4YPGB 5C2BH 3NA4A 4TVSa 2VSCA 4N90D 2IAMC 1ES0A 2MPAL 3VI4E 3NIDE 2JIXB 3TH4T 3PXHA 4LF3B 2A77H 1RK0B 3U6RB 4U31A 5F89B 4POZD 1FZMB 3HZYB 2X1XR 5DLMH 1CL7L 4F15B 2Z31D 4PP1D 1WBXA 1G6RA 1MSPA 2I24N 5BQ7A 5AZ2L 4TUOA 3ZDZE 5SWZD 1BQUA 2NLJB 1UCBH 2H1PH 4QYOB 1J87A 5TF0A 1GGBL 4PV9A 1K2DB 3QSKB 5JHDA 1G7IB 2DF3A 2VABA 3GHEH 3V6OE 3SKUD 4NUJB 3IRZA 5BVJA 3VWKC 1SEBA 1U2HA 2AV1B 4IOIA 5TFSH 1HYRC 4MD0B 1PKQB 2D9CA 1MEXH 3C2AH 5CZXD 1J05B 5DUML 4BSVB 2CR3A 4G8EA 1X3DA 2WWKO 4KPHL 1A7NH 4PGDB 2W0FB 3SCMA 5JOEA 3QA3B 4P5KA 4YE4H 2B4CC 4WY7H 5EORL 4BQCA 2WWMC 3I75B 4XB7A 4P59H 3DXAD 4ZQKA 2DD8H 3CZFB 4YHML 1A6VL 5FA3B 5B3JE 4ZUVA 3CXHK 5HJ3A 2R1XB 2PO6B 2P8LB 4KKCC 3PL6A 1QEWB 4KV5E 3LAFA 4MA3B 5HYFA 4I2XE 5IBLD 2C3VB 4GMTH 1KC5L 1I1FA 4YHKL 5FO9B 5IVNA 1SY6L 1HSAA 3MV7E 1U3HD 4YFLF 5J11C 3PF2A 3JWDH 1X5FA 4L3EB 4JKMA 4HIHA 4LSTL 3MODL 2FO1A 2XXMB 4F7MA 4ERSH 3ZZ1A 1QO3A 4ZFGL 3A6BL 4YO0B 5BVPH 1HHKA 3Q5OA 5I1JH 4D0BB 35C8H 1HH9A 1RZKL 1TJIH 2IG2L 3QUMB 3WIIL 4FQLL 5AG8A 4FFYL 1MFDH 3ARFC 3T77A 4GRLA 4PRHD 2BFVH 4I5BB 4ZO6A 3VWJD 2NX5E 1MFEH 1LEGA 3R06A 5FDWA 1ITBB 5FKAA 4WTWA 1JHKH 3HMWL 4G7YL 1ZT7B 3QFDB 4YK4B 2IMMA 3X14A 2X4UB 3TT3L 1JYWA 3LSOA 2C3GA 1E6JL 3SGJA 4M62L 1YN6B 3LKOB 3DHMA 4NWUL 1OY3B 1R0AL 4WGVB 2FSEA 5HY9B 2IADB 4DCQA 4LLWB 5C3TA 4ETQA 3GHBL 4V2CB 5IK3B 4AMKL 1V3LA 5JUEL 3HC4H 4NM4H 3EYQD 3BI9X 1IQDA 1CR9L 3ROLA 5J9PB 4FA8A 2F9BT 3D69B 3H3BC 2PR4H 4RGNE 4NRYB 4KK5D 5I8EA 3DUSA 2OTUB 1P7KA 2B7DT 3B2UC 5C0GB 1U3JA 4NFCA 5I16A 1GIGL 1CGYA 3CUPB 4TQEH 4OFPA 3V4PH 4HQQH 4EBQL 4PJAF 2B5IC 4TUJA 3BPLB 4LASH 1P4LA 3W0WE 4C4KT 4BK4A 4GAGL 4FS0A 4HJ0C 2MMXA 1X5XA 3UYOD 5IKCA 3KPOB 1FSKB 2XTJD 4R2GC 3VXUB 4JDVA 3TWCL 5MHSD 1RZIB 1AGFB 2VLME 2R29L 1JNHA 4JFDD 3HG1D 3GKWL 4MQXD 5HYIA 5JORB 1A7RH 1K4CA 1XH3A 2OP4L 1U42A 3MV7A 4FXKB 4DN4L 3OF6D 4P2QD 5DGRA 3TO4A 2EE9A 1Q0XL 3QIUA 4F57L 3NCJH 3PIQB 1RAMA 2XOTA 3EDFA 2F74A 4C57C 3U46B 5EUOE 1T7YA 1VSCA 3Q1SH 3BZ4B 2NY0D 2A1WH 4UQ3B 4DTGL 3NA9H 2V6HA 5D72H 1MJJA 3PGFH 5EN2B 1HHJB 3SDCD 1UCTA 1ZHNB 3CD4A 5ESAA 2J1KA 4E42A 1P5UA 2BSTA 3PJSA 4LLQB 3O8XA 2CLVB 2R1YA 3EGSB 3OR6B 2OL3A 2VL5B 3QDJD 4XNXH 4JFED 4LMQE 1AC0A 5IV2A 1FHGA 4M1CC 1LEKA 4P9ML 1WWCA 1J0HA 2Q86A 3B5GA 2FEEI 1DQLL 1SJVA 3WIFB 5DRWA 3UAJC 5IR1B 1QLEH 1F11A 2XQBL 1MJ8L 1ZVSA 2Y5EA 1KPRA 2D31B 5D1QD 5DJ8A 5CKGA 1RI8A 3IRPX 3TH3T 2OMNA 3MLUH 1KIPB 3IDIA 4NKMA 4K94L 1VACA 2AAVA 3VRLE 4XAWL 1BGXH 4DVBA 1YY9C 5FM5O 2CKBB 2E9BA 5T3XD 3DWTA 4MVBC 1IEBB 4X9IA 4F15C 2Z0BA 5DMIH 2P42B 1CZ8L 2H32A 1QSFD 4WW1A 1Q8MA 2Q1EA 2VZVA 3MCLH 1XAUA 1HILA 3CMOL 3UTTA 3STLA 3RX8A 5F7NC 1ES0B 1E6OH 4U1MA 3ES6A 2YD7A 2CDEA 2VKWA 2XQYK 4PJ9D 3RIAK 5T1DH 2X4OA 4X6FA 2VQ1B 5HYSA 4Q9RL 3R1GH 3PWVA 1KB5L 4JG0L 5C0EA 4MX7A 4HWZA 1WBXB 2D0FA 1G6RB 4RX4A 1N4XL 4YFLI 5IHLB 4KUCD 4TUOB 1CQYA 1FP5A 2IQAA 3REVA 5DEFB 4OJFH 5JHDB 4PV9B 3DHJA 5EUOA 4N8CH 1CICA 2QR0A 2PO6C 4LCWE 1L9MA 1RU9H 3WFEH 5BVJB 1SEBB 2XI9A 2PNDA 3KJ6L 5CEZH 1JHTA 4APQD 4G8EB 2XICA 1KEGH 4ALAH 3SCMB 3QEGL 5FO8A 2XIDA 4P5KB 3QQ9C 3RQ3A 4Q2ZA 1FJ1A 2E27L 3T0EE 3QHFL 1MAML 1QBBA 1DBBL 3EYSH 3ELAT 1IEAA 3B8YA 4ZUVB 1FE8L 1SHMA 5HJ3B 2G5RA 5JR1H 1XF4B 2V2TA 3PL6B 3STZA 2F5BH 3GUTA 4RQQA 2IPUK 5AYQA 4KXZI 4J4PC 1I1FB 1JZ7A 1HSAB 5IGXH 4CMHB 3RZCD 5MEQA 4HIHB 2APFA 5HHOD 1BJ1H 4YK4C 4G9FD 3L5XL 4F7MB 3QPXL 3VW3H 3QEQE 4RNRA 1QO3B 5CJQL 5HHMB 1KENL 5SWQB 4XHJC 1HHKB 4P2OC 1LMKA 3BD3A 4JKKA 3T65A 2ADIA 4CADA 1RZJL 4XI5D 3H3PH 4HMEA 3EJYD 4GRLB 4OBRA 4KJQD 4LEXH 1P84K 4XMKL 4DQOH 2Y5TA 3GMNB 5I1CL 3EZJB 1NUFA 1LEGB 3R06B 3RA7H 5FDWB 4K8RC 1QNZL 5FKAB 2C3HA 2VDNH 4QHNA 3TPUA 2X09A 4OCWL 4M1DH 4RMWA 3SDXE 3X14B 4LVOB 4WCYL 3H9SD 4NNPL 3JV4A 3BPLC 4Q0XH 4HC1H 2A38A 2FEDD 2FSEB 5ALCL 4DCQB 1HK6A 1RIHH 3SO5A 4ETQB 4OCYL 3QFJD 3O2VH 3KYKL 4QO1A 1VFAA 1MNUL 4LCWA 4XC3L 1J88A 1IQDB 3ROLB 3MUY1 4EOWL 2NY2B 2BJMH 3DUSB 2YPLE 1P7KB 4NQDB 2BRRH 4HIIA 3U4AA 5I16B 3BKML 4JHBA 4TUJB 4M8QA 3L3IB 3WFBH 5C07D 4D94A 1ZHLA 1P4LB 3T0EA 4FQCH 4K3DL 5C0BE 4PGJA 4UUJB 4UTAH 1A8JH 5IKCB 2YBRA 4LBEA 4OI7A 4M7JH 2JJTC 5KAQF 1QOKA 3SQOL 3FQXA 1IAIM 5JTWA 4WFEE 5GGSA 3RNKA 5D71L 1I7ZA 1JNHB 2X4SB 1K4CB 4ZNEA 1XH3B 5FOBA 2E7BA 3MV7B 4FP8L 43C9A 3TO4B 2O61A 3QIUB 1P7QD 3G6JE 5E5MA 2VXUL 4ODHH 4M48H 1R5IA 2F74B 4NZRH 2XZCL 4RIRA 4O4YL 5HHVH 2DBLH 1MJJB 1IBGH 1TZGH 5ESAB 4FXGA 3BH8A 1GOHA 2VKXA 4BELD 3DPBA 1ZLVH 3B9DA 4E42B 2BSTB 3PJSB 3O8XB 3SDYH 2R1YB 4IRJD 5ADOL 2BY0A 4HC1A 2Y6SC 3X17A 4GSDH 1A6TB 2OL3B 1PEWA 1QSED 5IV2B 1X5LA 1LEKB 4TTDD 5EZLB 2Q86B 1U0QA 4X7FC 4GH7B 2AJSH 3FMGH 4CW1A 3KLHC 5DRWB 3SDXA 1F11B 1VFMA 1FFRA 4NGHH 3X3FL 1I3RA 4L9DA 1ZANL 4N9GB 1KPRB 4KRLB 1XGUA 3O2DL 5DJ8B 3FO0H 4DKEH 5FM8A 4C83A 1UGNA 2ATKA 3IDIB 3JWOH 3D2UD 4NKMB 1VACB 5DK2A 4DVBB 3HUJA 2A6IA 5J4MA 2H26A 1QLRA 1D5IL 5T3XL 2H32B 5EWIH 5D1ZD 4PJIF 3WXVL 4L8BA 3GJFA 2W59A 1WGOA 1FG2A 1H15A 3JWNC 1HILB 2AQ3A 1BPVA 6CGTA 4R9HA 1II4E 3UTTB 2R0LH 5ESQA 1YEIL 1X4YA 4U1MB 3ES6B 4R0LB 5CEXA 2CDEB 4J2XA 1AO7E 1IGTA 4HSQA 2X4OB 4X6FB 1JPTL 2W65A 1VENA 2PXYD 3F6LA 4NQSA 4MAYA 2Y06H 4C59B 5C0EB 4MX7B 4HWZB 1MF2H 3WSQL 5EIIA 3GSWB 4P2RD 1MCLA 5FUCE 1BM3H 3DYMA 3S35H 4ZUSA 4KAQH 4P2YA 4U7MA 4BUGA 1MCPL 3G6JA 3REVB 1FAIH 4U6VH 4LKCB 3LDBB 4G6MH 5EUOB 1T1ZA 2QR0B 3ALWA 1JNNL 4Z7WF 1N6VA 4JRYE 2IAND 1BHGA 5J0BA 5D70H 5JXED 5E08H 4ZTPL 3PL6C 1V7NL 2W07A 3E6FA 1GGYA 1JHTB 4KUZL 1VEPA 4CMMA 5JA8B 5C0RH 1G7LA 5FO8B 4CMHC 1AFVH 1IC5L 3I6GA 4XAKD 4ELKA 4Q2ZB 1FJ1B 1JMZA 1TZIA 2EDQA 4XCCH 3TVMD 4NC2B 3AS3A 1U8HA 1NGXA 4IRSB 4JPKH 4WI2A 1XF1A 5BRZE 2A9MH 4I4WA 1U8KA 1L7TL 1ZLSH 2MKWA 1NLBH 4BYHA 4HUMB 4X5WA 1FNHA 3MR9A 1MFAH 3STZB 4GRLC 3GUTB 4RQQB 4J1UA 2WP3O 1MUJA 1OAZH 2WQRA 4QHKI 2X4NA 3ARWA 5J06A 4RA0C 5MEQB 2V9TA 2YKLH 4O02L 1T3FA 4M7LT 4LVOC 4ZSOE 1U8NA 3SGJC 4RNRB 4JY6A 1N5AA 3HAEH 5E1AA 3RVXD 2ADIB 4CADB 5CIPA 4CL7A 3TJEL 4M7LL 2YSSA 3MJ9L 1NAMH 1P4IH 4Y2OA 1ADQA 2Y5TB 2FHFA 1KELL 2BY1A 4OM0H 5TQ0L 4V1DD 5GQBA 4NKOA 2NY2C 4YEEA 4HPOL 4M9PA 4OM1H 1VEMA 4WHYH 5IFJA 2AEIT 2QSQA 4HEPG 4QHNB 5EZIL 1ZEAH 2EXYD 3JV4B 5GGTL 4NCDA 2D0GA 3VDBA 7CGTA 1JGEA 4GXUN 2VE6A 1VFOA 3TYGL 1CFVH 3BESR 3VA2C 2C3XA 4E41A 3MRFA 4OLXL 5ANMA 5HHXH 5IMOA 1IKFH 5MEOA 4LCWB 2UYLA 3FB7A 4JRYA 5CAYB 1ZHKA 3IT8D 4NPYA 4UINL 4XPGH 2FBOJ 3DO7A 3BRDA 3QHTC 3TZVA 4HPYH 3N0PB 4GFTB 3KLSA 2GQHA 5CMAA 4HIIB 4PJ8B 1T03L 4ZFOA 5C09D 3OB8A 1EGJA 4BM7A 3TO4C 4FTVE 3QIUC 1I9RH 4M8QB 4L8CA 1X5AA 2VDLL 1ZHLB 3T0EB 4OFIA 4HS6B 3RWGA 3S37X 4DW2H 4DGIL 3G08A 4KK8D 4UU9A 5D2NE 5M94B 5BRZA 4H8WC 4B53A 4HH9B 4JGJA 4RMUA 2YBRB 2UUDK 4LBEB 3SOBH 1U92A 4NM8H 5I71C 2L7UA 4R7DA 1NH6A 3FQXB 5GGRY 4P4RA 3O8XC 5GGSB 2W9EH 1I7ZB 1OAQH 4K7PX 4LSRL 3LEVL 5FOBB 1I8IA 2BY2A 5BMFH 43C9B 2D7PA 2V7NA 4J3SA 5KSBF 3DRQA 3VXOA 3D48R 2O61B 3WXWH 5E5MB 4LDLB 4JM4H 3VFRA 3NACL 1R5IB 1K3IA 1B2WL 4ZSOA 1KCVL 1NFKA 1Q0YH 4RIRB 3ROOA 3ZDXE 3RJQB 2C1OA 2HRPL 1Q94A 4FXGB 3BH8B 3I50L 3CC5B 1KJ3L 5ITBL 2HG5A 3MV8B 1R3KA 5JZ7D 5KSBB 5C9JA 1YY8A 4RGNC 1WSST 3GSXA 4WWKA 1NBVL 1PQZA 3U7YH 4ELMA 4NZJA 4CW1B 2YA1A 4R7NA 3OKOA 3VXMD 1I3RB 3LHPL 4TOYL 1CL7H 4EXPX 5D7IA 1XGUB 3MLVL 2CK2A 3ULVE 1BZ9A 4HIJA 3ARXA 4Z0BL 1EZVY 4C83B 2ATKB 1KN4L 4MJIB 5DK2B 4G43A 3HUJB 2A6IB 4KHTH 1GGBH 2H26B 1JUFA 4RZCA 4IM8A 3GNML 4L8BB 2ED7A 3GJFB 3ULVH 4G8IA 3W11C 4UT9L 4F7TB 1FG2B 5F93C 1H15B 3PWPE 1FO0A 4YWGL 4O00A 3VFSB 4U33A 1M71A 1QVOB 1J18A 3LDBC 4W6XB 1WZ1H 4MJ5B 1CICC 4GO6B 3MNVA 5KSAA 1LO2L 2VXTL 4ODUB 2QTEA 4HFWA 3FN3A 3VGDA 3BZFB 4YHMH 1D5BB 4NHCL 2D7OA 1MHPL 4NQSB 3J8F7 2VZ3A 4GRMA 2ICES 3B43A 2V5YA 3QAZC 3CDCA 1QKZL 5EU6E 3A6CL 3O6FA 4ZUSB 2XWJB 2XN9E 1S9WA 1K9TA 4N68A 3G6JB 2EH7H 1QFWM 2VLKD 3HLAB 1LD9A 4Z7QF 3RWFB 4AM0A 3WN5A 1T1ZB 4KI5E 2OZ4A 4GG6F 2DQGL 1QD0A 4LSTH 2FCBA 3JSSA 2JELL 1I7UA 4KZEL 4CMMB 4ZFGH 2O26U 4LSPL 2FWOA 3A6BH 4IRZH 3DX6A 4HBQA 4JJ5A 4U1LA 4N1HB 4OQTH 4WFGD 4X6CA 8FABA 1RZKH 1G7LB 2IG2H 1D9KA 2Q20A 4FQLH 1Q72L 3I6GB 1A1OA 4FFYH 4ELKB 1RURL 1VGEL 5MP6L 4JHWL 3DGGA 1TZIB 1HHGA 4MNGA 2I25N 5IBUG 1CDYA 2I9LA 1U8HB 1NGXB 1L7IL 4KMLB 4I4WB 1I8MA 1U8KB 1NCNA 3KPLA 4JFXA 3C2SA 3QJHA 2W9DH 1BD2A 4LRIA 5FAAA 4G7YH 4X5WB 4XBGB 2DQTH 1Q38A 1TQCB 1YC7A 1YEEL 2J12B 4NC0B 3MR9B 4X7SL 2HKHL 4J1UB 3SJVE 2DKSA 2CMRL 4NWUH 1MUJB 5D93B 4XCFL 1B3JA 5E9DD 3VGAB 4AMKH 2H9GB 3GM8A 4HLZG 1OTUD 1KJ2L 1U8NB 3CSPA 4LVHB 3ZKNC 4OZIF 4B0MM 4JY4B 4JY6B 5KVDL 4X8XA 3QUYB 4L3AA 4OF8A 3PWPA 1MELA 4KDTA 3FHAA 3BJLA 3BEWA 4L4VB 1K3ZA 5CIPB 4YZFF 4PY7A 4HX1A 1GIGH 2YSSB 4KVNL 5I17B 1O7SA 1OGAE 3RWHA 3TP4A 2B39A 4XNYL 1IAII 5KANI 3BN9C 5JHLH 4NKOB 4NN5C 3SKNA 1SY6A 4OZIB 5IFJB 4I3RH 1WQVT 3TWCH 4DGYL 5D1XC 3VFNA 1YMHA 2X1OA 3ME0A 3L9RA 2H2PC 3NPSC 1JGEB 4OLEA 3T0EC 2VE6B 4NFDA 3IFLL 5FFLA 3GKWH 5T1LD 1NGQL 4MNQD 4IDLA 4E41B 3GMOB 3ULUD 3MRFB 5ANMB 2IWGA 2X1WL 5EO9A 4DUVA 1FVEA 4DN4H 5IMOB 5KZCD 5MEOB 3LKSB 1Q0XH 4F57H 3FB7B 1RFDL 3H9HA 4QF1B 2OLDA 1ZHKB 1FN4A 2DQHL 4NPYB 3DO7B 3TZVB 2R4RL 1WIOA 3HFML 1XCTA 4JKPL 3WNLA 4DTGH 5CMAB 1IGFL 4HXAH 1GZPA 4ZOEA 4ZFOB 5JMRA 3IB4A 3HI5H 2Z91A 2X2YA 3RGVC 4ZOAA 1JFQL 4L8CB 2BP3A 4U49A 3RWGB 3CFJA 4ZS7L 3G08B 4A6YH 3PQYD 4UU9B 1U91A 1YJDC 5BRZB 4GMSH 4PREA 4P9MH 2ZUSA 1P53A 4ODTL 3L1OH 2E8ZA 4MS8C 5ADPL 1DQLH 4X0KB 4K3GA 4U1GB 2JTDA 1W8OA 4P4RB 5BV7B 4OV5A 5DDHA 2XQBH 3LRSA 3MV9B 5BW7A 3SJVA 1OF2A 4NN7B 5IIEA 4YXLL 2E7MA 3BHBB 4XVTL 1T7VA 1OP3K 4Z7NF 1I8IB 1CDIA 4OT1L 3HNVH 1EUTA 4H25A 4TUKL 3OSKA 2JB5H 3VFVA 2V7NB 3DRQB 3VXOB 2GFBA 4K94H 3LB6C 2EDHA 4XAWH 5DJYA 2KQNA 5EUKA 3VFRB 2ZZUT 4OZFH 1XGQA 3ROOB 4ELMF 1WZMA 2D7TH 4WI5A 1CZ8H 5C0DA 4WO4D 4N90E 1BLNA 1Q94B 4XVUD 5IW3A 1S7SA 2R15A 5D7IF 4KKBD 1OGAA 3MLRL 3C5SA 4P0DA 5GGUA 1DBMH 2HG5B 4OFKA 3CMOH 2A6KA 1SBSL 3VGFA 3D85A 1R3KB 1CBVH 1Z9OA 3IF1A 4N0CD 4UILL 5C9JB 1FBIL 2HH0H 4LLDA 3GSXB 1GGIL 2QQQA 3FRUB 1JHLL 3PV7A 4U2ZA 3HR5A 4QRQA 4ELMB 5DFTA 4R7NB 4DKDC 3OKOB 2ZCKH 1MI5D 2O5XL 5SWZE 4Q9RH 4JG0H 5D7IB 4P5TD 2HFFA 5DVNA 1BVKB 4ODVL 1BZ9B 1OSPL 4HIJB 4Y4KD 5E00A 2Q87A 4LPVA 4G43B 2IPTH 3QULA 4Z7OE 2LFGA 3RTQD 3R8QA 3Q48A 1JUFB 3EAKA 4MAYC 4RZCB 2FX8H 5E8EA 2P7TA 1T21A 4LGSB 5ELIA 1LDPL 3ZTJH 4G8IB 1IARB 2G9HB 1M6OA 2R69L 3GBLA 3TBTA 1FO0B 2V7HA 3SDDD 4CAGA 1ZXQA 4G7VL 3DXAE 1M71B 3VXSD 1NL0L 3VRJA 3BUTA 3MNVB 4TPRL 5KSAB 4ZPTA 3QPQD 2E27H 4ZO7A 5C8JA 1H3WM 2R8SL 5A2IH 1MAMH 1DBBH 5JO5B 4RWYL 4IOSD 3ZKXB 2VERN 4OZFA 2WSKA 3ZE2F 4GRMB 3ESVF 3DUUB 5E2UH 1M7XA 4X6CF 1J86A 3O6FB 3VI3E 3QQ4A 3RWDB 1S9WB 4PLJD 2JKXA 3JWOC 5HPMA 1NFDF 4BSWA 1LD9B 3DVFA 4AM0B 2EDTA 2J6EH 3WN5B 2JB6B 1RUKL 4OSUL 4PJEA 5C0AD 4X9BA 1TQCC 4KDVA 5LGKA 3ZE0E 1OAYL 2APBA 3QPXH 4WI8A 4OTXL 3VGEA 1FC2D 1I7UB 4PRHE 2EYSB 15C8H 3CIQA 2FWOB 4JJ5B 3DX6B 3QIBA 4U1LB 2DLTA 2FDBP 4X6CB 4N0UE 8FABB 2ZUUA 1D9KB 1KB5A 3VGAC 2IAMD 1A1OB 3LEXA 4ODWB 5I8CA 1MHCA 5I1LA 1EHLL 2Z31A 1HHGB 4XMKH 4MNGB 4LVHC 4ZS6C 2I9LB 5JA9A 1DJSA 5E24E 2X4RA 1I8MB 3KPLB 4JFXB 5SWZA 1XT5A 5I73B 1BD2B 3KWWA 4OCWH 5CKAA 4X98A 5D7LD 1NSNL 1A14L 4WCYH 5EFIA 4NNPH 4WI6A 2LV4A 4PBXA 5TDNA 4OD1H 4EDWL 5K9QG 1PW3A 1R5WA 3OPZH 4WUUA 4OCYH 1U41A 4MCZA 4MQ7B 2HTLC 3X12A 2H6PA 5F7EL 3NCEB 1AGEA 4HK3N 5FUCC 5I6XB 1I7RB 5MEPA 1CXIA 2B20A 4QGTA 2RBLA 3PWPB 4K2UL 1HKFA 1DE4A 2D03L 3DXAA 4MXWL 3BEWB 1GSMA 2B0SL 4NQCD 2CH8A 4Q6IA 4HX1B 5I1AA 3DSFH 4GW1A 3GFUA 3BKMH 3VFPB 1K85A 3T3ME 4OZ4A 2XTJE 2WWMD 5MHSE 3ZMRA 4YFDB 3TZVC 4K3DH 3SKNB 1W2KT 3F65A 5H37G 4JFDE 1FVCA 3HG1E 4OGAC 4PLOB 3QIWB 3U4BL 3QQ3B 3B2VL 2GAZB 5F1IA 3MZGB 4P2QE 1XF2A 1JGLL 4G6FD 3L9RB 5JW3L 1FYHB 4GRWE 1QHOA 1AR1C 4LHJB 4LKXA 1JE6A 2WUCL 5EOTB 1WJ3A 2Q7YA 3ZYOA 3CX2A 1FVEB 2OMBA 5C70A 3IJSA 4M5ZL 3H9HB 1FN4B 5BV7C 4NFBA 3NIGE 3VFTA 2BVQA 4NN7C 2XZCH 1OSZA 2OJEA 1NMAL 1GZPB 4N0UA 4ZUUA 3VWJA 1EFXD 3QDJE 3X3GL 4JFEE 2Z91B 1BP3B 2NTSP 4Y4FB 1IILE 2KZ1B 2AXFA 3I2CL 5IFAL 3I02B 1JZ2A 3CFJB 3DV6A 3VGHA 1CU4H 1U91B 1NCTA 4PREB 3CVHL 3ILQC 4JDTH 3UJTH 3NTCL 1G7HA 1Q9LA 5DDHB 2VR9A 3LRSB 4H20H 4QRRA 2I07A 5IIEB 1A6PA 2MHAA 3SBWA 5MENA 5T3XE 4GLRI 3EHBC 5DMKA 4WWKC 4H25B 3OKDA 4H0IA 3WEXA 3VFVB 1P4BL 1QSFE 1V3KA 5JQHC 5DJYB 5EUKB 2DYPB 3ZE1E 3GSRA 2OTPA 4KQ4H 1D5IH 1QBML 1JYVA 5DMYA 5IB1A 5T3XH 5C0DB 5JQ6L 5K9JL 4FFWC 3WXVH 3QHZL 4XCNA 1A0QL 1S7SB 5IF0A 1OGAB 5GGUB 3HZVA 1PBYA 3D85B 5FA4A 5C1MB 3IF1B 4LLDB 5LGJA 1SVCP 1WISA 4HJ0D 4HZLA 1FLRL 4OGZA 1TZHA 1UJ3A 3HG1A 3HR5B 4X4YA 4QRQB 4R2GD 3CXDH 4RMQA 1QFWI 1JPTH 3LRGA 3OF6A 3BAEH 5FYKD 3QCVL 4PRPD 2HFFB 4LSSL 1LQSR 5J1AA 2F53D 3W9EA 4AEIH 5KSAC 2IFGA 25C8L 2XQYG 5E00B 3P4MB 1ZSDA 1MCPH 4U4BA 3SDCA 3QULB 3PABA 3EOAB 4TULL 3ZKXC 4CVXA 3MX0A 1T1YA 1JNNH 1KOAA 3HC3L 5E8EB 2P7TB 1Z9LA 4M5YH 1ZOXA 4ZTPH 2VO5A 3JBG7 2JJVA 2FYYA 4LOUD 1JCKA 4RSVA 1M6OB 3O6FC 4S1DC 4M7KL 5IHBA 4JFEA 4ONGL 2V7HB 4PJFA 1M4KA 3NZHL 5J1TC 4S0TD 1A2YA 4O2CA 3SGEI 1NBZA 1T6WA 4BA8A 3WN5C 1IC5H 3VRJB 4GKSA 1K4DA 4HIEB 1BWWA 2R9HD 4QHMA 3O2DA 4ZPTB 4F7PB 2E7LA 1N7MH 1VA9A 5EC2A 5A3IC 3O2WL 3RHWK 5C8JB 4FQ1L 1JYXA 2QADD 4PJEF 5TE6L 1JV5A 1RK1A 5KVFH 1L7TH 5AYUL 1D9KC 4OLWH 5HSFA 3BRGC 2BNRD 4R97B 1QBAA 5L2KA 2JIXD 5HHOE 1CGVA 5GGRA 4G9FE 2AW2A 5DMGD 1QSFA 5GRYA 5HPMB 5C0ND 4BSWB 1YY9D 3K3QA 5CLWA 4IOFC 4LRIC 4YXHL 5I73C 5DTFA 4PJEB 3WS3B 4O02H 1LO4L 3VXNA 3QIBB 1B4JH 1AHWA 5A2JH 1EA9C 4TSCH 1JRHL 1KB5B 3TJEH 1AY1L 4KJPD 3LEXB 3MJ9H 5I8CB 1MHCB 2NY5H 1S7RA 5I1LB 2BDNL 4F58L 4Z8FL 1KELH 4TNVF 5I6XC 3W9DA 4AEFA 2ZP0T 3H9SE 4LHQB 2FIKA 3JXAA 4JFYA 2X4RB 4KDTC 3QDAA 4HPOH 2P49B 4J7RA 1UXWA 4OLZL 3KWWB 3MLYL 4PJHE 4X98B 1RUAH 5EZIH 4X9HA 4P3WA 4BFEA 4YQXL 5TDNB 3K80A 3TYGH 1DSFH 2PYEA 3G9VA 4PB0L 1H8OA 4WUUB 1DTUA 4NZTL 4X4XA 1YEGL 2R2BA 4HS8H 4MCZB 5F7FA 3X12B 2H6PB 4BFBD 1N64L 2A6DA 5EU7E 4BQ8A 5IJVA 1CFSB 5ISZD 4JKLA 1AGEB 2BVOA 3C9NA 4UINH 1GH7A 1C16A 5C07E 1MPAL 1DE4B 3DXAB 4WNQA 3N1PC 1D6VL 1GVIA 1T03H 4Q6IB 3MXWL 5I1AB 3TEUA 4L3ED 4RA3A 4KI5C 2E7HA 1UWXK 3QQ9D 3W2DL 5F21B 3SN6N 4F80A 5D7JD 3QZWG 1S9KC 4DGIH 4HKXA 5CGYC 5IB4A 4WENB 2KUTA 3V2AR 3TJHC 1FORH 1FVCB 5GJSH 5F1KC 4ZPVA 2ITDA 3Q5TA 5TE4L 5F1IB 3RZCA 1G1CA 5IEKA 4ZD3H 1TFHA 4J4PD 1RV6X 4LSRH 3BE1H 4LKXB 1F4XL 2Q7YB 2Q8BH 4PB9L 5C08D 4HT1H 3T4AB 1FCCA 3EIFA 4DUWA 3IJSB 3NACH 3D39B 1GC1H 1B2WH 5BW7C 1KCVH 4JHZA 1C5BL 3VFTB 4CJ0A 5IBUB 1OSZB 2OJEB 5AZEH 4M6ML 1NQBA 4PD4K 2DDQL 1CK0H 4JCMA 3U1SL 5JMOC 4WW2A 4ZUUB 3VWJB 5CP3A 5ICZA 3L3DA 3L3GA 3I50H 5EB9A 3CFEB 1QSEE 1Q1JL 3ET9F 5GSVA 1UH3A 1I3VA 4KV5F 5ITBH 2AXFB 1E4WH 5GGTA 3H9SA 3DV6B 4KMQA 4P57A 5IW6A 4IJ3B 1KPUA 1JF1A 1PKOA 1DLHA 1YPZF 4PJHA 3I3EA 3QRGL 1Q9LB 3CSYA 4QRRB 1R3LB 2MHAB 2FJGA 4XVJL 5EBMA 3FB5A 5MENB 3T08A 3MSPA 3MLVH 5DMKB 1OM3H 4F9PA 1VESA 5FB8A 3OKDB 4D9LL 1KCUL 4HHAA 3WEXB 1M7DA 4XNUH 3VXUD 1S9VB 1BEYL 5DR5H 3GSRB 2RQ8A 5IB1B 4UNTA 3RRQA 5EC1B 3GNMH 5DT1H 1HQ4A 3S88L 4XCNB 4XT1C 5IF0B 4YWGH 4L29A 3VG0H 3HZVB 4AEEA 5FA4B 3L3JB 1CXLA 1QTYT 4NT6A 4YXKL 1EMTH 3V5KA 5LGJB 4HZLB 2MCG1 1LO2H 2VXTH 1TZHB 1UJ3B 3HG1B 4X4YB 4P2RE 1FGNL 4KDWA 1LNUA 1F97A 4J3VA 4NHCH 2GJJA 3F7VA 3U4EB 1NUNB 3LVEA 4GRWB 3WHXA 3BH9A 5FYKL 3LV3A 4PJFF 5H35A 3MFFA 5J1AB 3MZTA 5GGQL 3W9EB 2EEDA 3K0WA 1QKZH 2IANE 1ZSDB 5J13C 3K8KA 1G7PB 1TETL 4P3CL 3N85H 4U0RB 1G7QA 4ODXA 5KN5A 2VUYA 5L6YH 3PABB 2CJUH 4CVXB 4ENED 1T1YB 5IVZA 2XG4A 2DQGH 5F7HA 4IRJA 2FYYB 4R97C 4XAKE 3L3KA 3M1BB 2RGSA 4FQJL 1CFTA 4KZEH 1LO5A 4NQVB 4LSPH 1QSEA 4PJFB 1X5ZA 5CP7A 1A2YB 3F58H 4O2CB 4WU7A 1NBZB 1T0MB 1K6QH 5EDXA 2Y6SD 3DVGA 5HYJA 1K4DB 5DA0B 3O3UN 1RURH 4QHMB 4RBPK 1WAAE 1NEZG 3BQUA 4JHWH 5EC2B 5F97E 1PX4A 1JV5B 1MY5A 1RK1B 4LSVH 3QIBC 2F8OA 4NN6B 2CK0H 3WNMA 4QXGH 5DQJA 1FNSL 3LPWA 2GT9A 5D5ME 4GAYA 1YEEH 4EDXA 5KJRH 5L2KB 2HKHH 2Z31C 3QXTA 5DC9B 5GGRB 3ZYIA 1UEMA 1G9NH 1QSFB 2P43B 3RDTA 5EU4A 3UC0H 4XCFH 4GT7A 4PJBF 3BIKA 5DTFB 2FD6H 5DVMA 4YHOL 1BMGA 4X4MA 3VXNB 2EC9T 2LVEA 3G04A 4ZMAT 4L4TA 1AHWB 5L88H 5LKNA 4V1DE 1MOEA 2CSPA 3HC0A 5D7SL 2PXYA 1S7RB 4XNYH 5DJ6B 3D3VD 4P2RA 2FIKB 4JFYB 1YNLH 4Y5VA 3O11A 1UWXH 3SCMD 2FEEL 1NANI 5F7MC 1UXWB 3F12B 1Z3GL 4Q6IC 1A1MA 2YPVL 1A7OH 1NCCL 2OCFD 4DGYH 5T5FL 1BQLH 4ZOCA 5SX4I 4UT6L 5GS0D 2UWEE 1UENA 2Z93A 3O3AB 2B1HH 4PTUA 5E8OB 1QRND 3IFLH 5E56A 1J0KA 1C12A 2PYEB 2A9NL 1NGQH 2VQUA 3MRRB 4X4XB 4F33B 2R2BB 3UZEA 4ZO8A 2A6DB 2LVCA 4XTRC 1UB5A 5C09E 2BVOB 3C9NB 3W39A 1WBYA 3HFMH 1C16B 1I8LA 1VCAA 4JKPH 4PP2A 4K3HA 3TVMA 2NXYD 3FQRB 1RZJC 2HYMA 4KC3B 2YZ1A 1YEHL 1JFQH 3BWUC 4ZS7H 5HHMD 4UTBL 4HKXB 5IB4B 1E4KA 3IKCB 3VWJC 3BPCA 3WV0A 1CDBA 4YHIA 4ZPVB 1F2XK 5D5MA 1EXUA 5ADPH 3D25A 2LAAA 5IEKB 4TSBL 2YD2A 3V52L 1KJ2A 4WW2F 4YXLH 2DQUH 4XVTH 2D3VA 4IJ3C 3FQTA 4OT1H 5GGVY 3WIHL 4BH8B 1W8NA 3FQNA 2R2HA 3ZL4L 2OSLB 1EK3A 1NCBH 2VDQH 1HSBB 1F3RB 4M6NL 3SBWC 3MRDA 2AJYL 3MJ8A 3QCTH 4WW2B 5ICZB 5D4QA 1AGBA 3L3GB 1MVFA 4PJGF 3KLDA 4KK5C 5GSVB 4NO2A 4KZDL 3QG6A 1U8LA 5SX5K 2W1NA 3H9SB 4UILH 3VXME 1FBIH 5K93A 4MXVE 2NY2D 3KJ4B 1MFCH 4FZEH 4P57B 5IW6B 1GGIH 3X11B 4NQDD 1JHLH 2AK1L 1JF1B 4ZTOH 1DLHB 5GIRA 2O5XH 2XTJC 3CSYB 4PJGB 4MNHA 1FVDB 2FJGB 5GSRA 5EBMB 1O5DT 3GMMA 3U9UA 4ODVH 4PD4J 5FB8B 2VAAA 5ABDE 1UJ3C 1ZWIA 4HHAB 4WFHD 1I3GL 4HS3A 5C09A 4JR9H 4EN3A 1R3IL 1T22A 1AQDA 1H8SA 4RAVA 4RDQG 3QZWA 4HCRL 3U82B 1X9QA 4HV8A 2XWTA 1HQ4B 3DX7A 1LDPH 5IVXA 4Q9QL 1DUZA 1EUUA 4QHKJ 3QIUD 2IJ0C 2MTPA 3D1MC 3MLXH 2YK1L 4G7VH 4RRPG 3SDCC 3RVUD 1JPGA 4LSQL 5DD1L 3VRIA 1NL0H 1TTFA 3WNKA 1G0YR 1IGYA 3E0GA 4NT6B 3V5KB 1FAKT 4LAQL 5DJCA 4TPRH 4F9LA 1RZ8A 5HDBF 3ZLQC 4K3EL 1R6VA 4MDJB 3OGCA 1LNUB 5TQ2L 2UVEA 1C8PA 3F7VB 5JIKA 4BZYA 3DETD 5EO0A 5L9DL 2VLKE 3WHXB 2A6JA 1DBKL 3LV3B 5H35B 3V4UL 4F8QA 3L7FB 5AAWA 1FRGL 3EYVA 3V0VA 3KVQA 2E7LC 1AGDB 4O58L 5D1QC 2DS4A 5IFHH 2C3WA 3U0WH 4HD9A 1G7QB 3F8UB 4ODXB 5KN5B 4NN6C 3B3IA 4R26L 5KVMC 1LE5A 4ZYKA 4QTIL 4WFGE 5IVZB 4IRJB 4DWHA 2AXJA 3L3KB 3H6JA 1OTTD 2B1AH 4OTXH 2FGZA 2WQ8A 5H94A 1QSEB 1EZVX 5CP7B 4U1JA 5GPRA 3ZYJA 5D7KD 3PNWA 4WU7B 3MACL 3HZMA 3DVGB 4CVUA 5HYJB 3VXMA 2CKBL 4U1IA 3RPKA 1NPUA 3BQUB 4JO2L 2DQEL 4ZFZA 1EHXA 1AXIB 3BOVA 1HZHL 4MGXA 1AHWC 1MREL 2ADGA 4G8GD 4MJ4A 4PJ9C 2KQMA 2YUVA 3UTTD 4EKXA 2VN4A 2GT9B 4GAYB 1C7TA 4YC2B 1NSNH 1A14H 5E9DE 5ICXA 4EDXB 2NZ9D 2DJUA 4XC1H 1JGVL 1KULA 3RDTB 4QRSA 4IHOA 2BOBA 4I3GA 4NKIL 2DLEA 2ORBL 5F7EH 3RIAF 3RJDA 4ETYA 3EYFA 1G9ML 5JW4M 2GY5A 1DQJB 5HHQA 2O5YL 3G04B 4G6JH 4Z95H 4L4TB 4CRPA 2ZSVA 4K2UH 4LLUB 5IMKA 1RZFL 4MXWH 5TE7L 2X7LA 4MMZC 4UNUA 2B0SH 3HC0B 1Z5LA 2CUMA 4RFNB 4NQEE 2PXYB 4OFVA 1X44A 1KLUA 5DJ2B 1ZVHA 4P2RB 4WJ5A 3V0AC 1C08A 1J1PL 2YWYA 4Y5VB 2YD1A 3O11B 4MB4A 3N9GL 5C2UB 5C7XL 1A1MB 2VLKA 4MNQE 4TVPH 4DUXA 3ULUE 2OTWA 5FM4A 2AKRA 3BPNC 2P1YA 1JGLH 1MY7A 1A22B 4N5EC 2BVUA 2Z93B 1FIGH 3PHSA 4PTUB 5GS0L 4PJ7E 2EE3A 3UZQA 1KBGL 4IRSD 4ODSL 2H45A 1F4WL 4HBCL 2OBGA 4PY8I 1A9EA 3ETBF 1E27A 2X40A 3MV01 3ULUH 4XCEA 3O3EA 4HK0A 4M5ZH 5DGQA 4WEUD 3KXFD 1UB5B 3RZCC 1HXMA 1QFUL 4M6OL 1NEZA 2FATL 4Z18A 3W39B 3MRMA 3DSNA 3O9WA 2DI8A 1INQB 5KS9F 3RL2A 4PP2B 3C6SA 1CG9A 3PQYE 3X3GH 2WWKT 1E4XH 2OQJA 4QEGA 4XI5C 2VDOL 1IAOA 1XZ0A 2NYYC 4JPIA 5D2LE 4KY1L 2R2CA 2MQ0A 3EJYC 3FT4A 4KJQC 1GOFA 4KQ3L 4Y19B 3QRFM 2E9IA 2W60B 4WW2C 3BPCB 5EZJA 3OV6A 3NTCH 1UM6L 1EXUB 4N0YL 5D5MB 3D25B 4JO4L 3BT2L 3LN4B 1KJ2B 1QFHA 2X10A 4UOW0 4UQ2A 3HNTH 1MCBA 1EBAA 3FQTB 4YDVA 2FEDC 5IUSA 4MZ2A 5JW4Q 3FQNB 3S98A 1JI1A 2W0PA 4GXUM 3ZKND 2C4FT 1QG3A 1QBMH 4PGCA 2E9JA 3MRDB 3MJ8B 1A6ZA 5JDSA 4F9PC 5JQ6H 3BO8A 5FYJD 4IDJL 1AGBB 3QHZH 1A0QH 3GKZA 3NCYP 3P4LA 1T0PB 2ZOLA 4NQEA 4S0SD 1U8LB 5EU7C 2EDWA 4FQQA 1YYMH 1J0YA 3WO4C 1MI5E 2V17L 4JM2F 4LNVA 5DI8B 2ZCLH 3IVKB 4I0KA 4PJ8D 3EO9L 5T1LA 4MNQA 5GIRB 2Y7QB 4PRID 3CDFA 3QCVH 1K5NA 4MNHB 5IVXF 5GSRB 1I1RA 3NFSH 3P9LA 5I18H 2VH5L 5F71A 4PJ7A 4LSSH 3U9UB 2VAAB 2Y4SA 3SE8L 1ZWIB 2VISA 1UYWL 4HS3B 5C09B 4EN3B 2YHGA 2AXHA 5LJYH 4GAJH 1T22B 4YDLB 4LIQL 1AQDB 1DEEA 3OWEA 4RAVB 2VXQL 1A3RH 3QZWB 3VXSE 4HV8B 2XWTB 1NGYA 5IVXB 4QRPA 1DUZB 2Y07L 3CVHA 2WUBL 3NN8A 3PQYA 5E70A 3A67L 4M7KH 3LKRB 4X5LA 3TFKD 1FZOB 1CXKA 3NZHH 1U8QA 3F7YA 3VRIB 1ND0B 4ISVB 5D2LA 3QWOA 3NPZB 4IRJC 4LU5L 5DJCB 1RZ8B 2ZCHL 1ZTXH 2XG5A 1GXEA 2EO1A 3ZO0A 3OGCB 4FQ1H 4MS8D 4H8WL 1MIEL 2CGRL 2GTWA 4M1GH 3MRIA 5LG1A 4HJGA 4TTDC 4Z9KB 1FFPA 2M8XA 3UX9B 5AYUH 3MV8D 1MAKA 5EO0B 2A6JB 3QDGD 4LL9A 3EYVB 3V0VB 3P4OA 4ZODA 3BQUC 3QH3A 2V5RA 4WO4A 5F3HB 3LB6D 4OCRL 1X4ZA 3B3IB 4KMTL 1FL6A 2YA2A 3V8OA 1LE5B 2E7CA 4ZYKB 4YXHH 3MRPA 5IMMA 5E2WL 3IDJA 3V7AG 2VSDA 4X99A 4U3CA 4N0FA 5H94B 4MJID 4U1JB 3RDTC 1ZS8A 5E6ID 3RWCA 3PNWB 5EPMA 4UOW1 4XMPL 3HZMB 4ODBD 1KXVC 1MI5A 3VXMB 3ARPA 4L5FH 5D8JH 4U1IB 1YN7A 3O45A 4ZFZB 4P5TA 5D7LE 5I1IL 4UV7L 1FZJB 1DP0A 3OJVC 2ADGB 5M7QA 4H88H 3S37L 5BS0D 1BAFL 4U6YA 4KHXH 5GS2D 3MLYH 1DL7L 2HWZL 4PBVC 3ZKQD 5F9DC 2VC2L 4RFNC 5ICXB