2P4AB

X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with rnase a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGYPWTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGDALVATRYGRWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease pancreatic
publication title Exploring the capacity of minimalist protein interfaces: interface energetics and affinity maturation to picomolar KD of a single-domain antibody with a flat paratope.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 33
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p4aB00
2CKBL 5IMMB 3WIFA 4OB5L 4N9GA 2LAAA 1NGYB 1OB1B 2ED7A 3EYQD 1CL7I 4QOKA 2APVA 4OF8A 1IGTA 2H1PH 5C08A 2LV4A 1IQWL 1HYSC 2NY6D 2Q8AH 3STZB 5FF6A 2CDGA 2MNUA 3RTQB 4N5UA 4ZO6A 3MBEA 4BELD 4XZUB 3O6LL 4IIQA 3I50H 5I74C 2H45A 3CVHL 4U1NA 1IQDA 1CGTA 4UILH 2PNDA 3BPCA 1DQJB 2HVKA 4HUKB 4PJ9A 2XG4A 4B5EA 5DJ0A 1KTDA 4D3CH 1OWWA 4U6XA 4GUPB 1NCWL 1UB6B 2E3VA 4PJFA 5JORA 2W07A 1CDGA 3IDXL 1MJ7L 4HZLB 5EZOH 5ALBH 1HCFX 4QRRB 4M62H 1QBLL 1CGWA 4Y16D 4MCZB 4FQXD 2QQNH 3WBDA 2YC1B 4HSQA 4M48H 2OM5A 5IM7B 3V6FA 1ETZB 1WFOA 5IBUB 1DBAH 2Z93A 4WV1C 1T83C 2X9YA 4PB0L 2VKXA 2BOCA 4Y5VB 1KCRH 32C2B 3I6LD 1WV7T 1SEQH 1R3LB 2I60L 5DMJB 3UTQA 4QXGH 4ELMB 1K5NA 4WFGD 4WIQA 3VJ6B 2DM4A 5HDQH 3B9AA 4MD0A 4JKPH 1ZHKA 1C16B 5GSRB 3NIDE 2H26A 1MFCL 2E7LA 4M7ZC 4PJXF 3JWNC 5A16A 2VZ1A 4FQ2L 4C58B 5HHXH 4HKJB 4MLIA 3I85A 3RGVC 3TPUA 1EO7A 2BRRL 4QNPE 4KI5F 2VOTA 3MV7E 2ZUUA 4NC0B 2QQLL 1JF6A 4I48A 3HB3C 3N1GC 3WSQH 3OB0K 4YXKH 1SY6A 5J13B 1NAMB 5D2LB 5FYJU 1KJ2B 3BKJH 4XI5D 5T3XH 3E6FA 3PWPB 3RL1B 1UM6L 6FABL 5AYQA 3A6BH 4J3VA 3K4ZA 3EKCA 5DI8B 4MDJB 1E4XH 2Q20A 3LKSB 1F4YH 4OD2B 5HYJB 2ICWA 1BAFH 4H25B 5T3ZE 5DEZA 2R0LL 4Z5RA 3U30C 3VGHA 4JFDE 1U3JA 5ISZB 3HLAA 3P9MA 3IRZA 1R6VA 1GZPA 1SM3L 4HBQA 2HKFH 5GJTH 1E27A 1HHHA 1CIDA 2DM3A 3CH8A 5K9KA 1QA9A 2FBJH 3W39B 1FE8L 2E27H 3DLQR 5D7IF 4O02H 4GO6B 2WBJD 4UIMA 5FOBA 1S9YB 1UM4H 1FP5A 1PAMA 2FLRT 1GGCL 1JCKA 3QIBA 4B50A 1N8ZA 5H8DA 1REIA 1JPGB 5MEND 1JF1B 3HMXH 4K3HA 4M6ML 2EIBA 4XP6L 3LDBB 5SWZD 1GOHA 1ZHLA 2Y5EA 1QSFE 4L5FH 1N7MH 5JOFA 2J8UA 5DEFB 4EKXA 2H8PA 1CD9B 5CEZL 2X4PA 3EOBB 3U0PA 2UWEF 2R1WA 1U8NA 3TVMC 3LHPH 3MA7A 1QR1B 3GB7A 1CZ8H 4HEPG 3KGRA 1AHWA 1HZHH 3RA7H 3KYOB 3TJHD 4M9PA 3LQAH 1KJMB 1T2JA 3L3OB 3HZYA 2DL2A 3NFPA 4P9HH 4DZ8B 1SJVA 4MX7B 1FNEA 1YN6B 4KZEL 3WNPA 3MJ9H 4ZS6C 2AJSL 3C5JB 4ZSOB 2NNAA 1IAOB 2P24A 3ULUE 2VLRE 4MNGB 1ZVSB 4LSTH 2GT9A 4WHTA 1XT5A 2F53D 4KKCD 1IGML 2X1OA 4ZPTA 1Z3GL 5BV7L 3IU3A 5KVGL 1J18A 2EXWD 2X70A 3FRUA 3TBSA 1FZOA 3IFPA 4NQEB 3L3JA 1YJDL 3HZMB 4X6DF 2VWEE 3KWWA 2F74B 1H0DB 1JPST 5E6ID 4D0BA 4EOWL 1BFOA 1GIGL 4HWUA 2PTVA 1A7NH 5CIPH 4XB7A 4XWGL 5ICZA 4ZUWA 1DZBA 4NN7C 5BQ7A 1MPAH 3VW3H 3AB0B 4YEFA 2VL5A 3MYJA 5EA0H 5CMAB 2W9EH 4XNUL 4KUZL 4WWKA 3C8DA 4RAUB 4NCC1 4H20L 1ZLVK 3VMNA 1L6ZA 5C0CE 3ME0A 4K9EH 1I9JH 1UWGL 4OLVL 3SY0B 1PSKL 3LV3B 3I6KB 3L1OL 5E1HB 1NFDA 3MJGX 3TV3L 5D7JC 5FGCE 4JREB 2F8OA 4XNZC 4OCXL 1D5MA 1UZ8A 1G9MC 4N0CD 2B7DT 4RIRA 1X9QA 4JRXB 2PO6B 5EU3A 3PL6C 3TCLA 4ZD3L 1YEIH 1NCTA 3H7BA 4QO1A 1GPOL 2HTKC 4LLQA 5KS9A 1QOKA 5F9WB 3IDNA 5BZDA 4PP2B 2X05A 2A6KA 3T2QA 4FMKA 3ZKXC 3QQ9D 4X8JA 5D1ZB 1MAKA 4S0SD 3BSZL 4ONGL 5DJDB 3VFPB 4ELME 5DMGD 4ZOCA 3C09B 2VXTL 4K94L 1C5CL 4NWUH 3VH8A 3NPZB 4JY4A 3VXPB 3BWAB 3FT2B 2XOTA 2QQQA 1OARL 2E7MA 4GRWE 5IMKB 4HC1H 4JFHE 5ETUB 4ZFZB 1WC7B 1A6WH 5D1XA 4LQFH 4DK3A 4F2MB 3SHSA 1S9VA 3AXLB 5C0NC 5IVXF 4ZTPL 5HXMA 1OAUH 2VC2H 4H26B 5BS0A 4N5ED 2BNRD 5FM4A 5DK0B 5B38A 3ZDYE 4D0CB 3MOAL 1KELL 4W4NA 2PYFA 5MHSD 5F9JB 4Z7QF 3RL2A 1AP2B 2N4IA 4UINL 4KGLA 1GGIL 3O9WA 2AJ3A 1FV1B 1MHHB 4Z7UB 2FZ3A 4JHWL 5HYJE 3OKMB 1AGFA 3ULUC 5GZNC 5ISZE 5HI3D 4R4FH 4OGYH 5C9JB 4G8IB 3RU8H 3WO3B 1SJHA 4TTGA 3LD8C 4ODSH 1YMMA 4I5BA 5BO1L 3U7YL 3HE6B 2G60H 3IFNL 3TT1H 3BP4B 3O45A 2YBRB 4JN2A 5KBNC 3HPLA 4YEEA 1FG2A 2XXMB 2LU7A 2DYPA 1VSCA 1OM3L 4KJYA 3CDGB 2IPKB 1I7TA 3NBNA 4XPTL 4KQ4H 3RKDD 3U0WL 5DMIL 3Q5TA 4OD3H 3CLEH 4KY1H 3VXMA 1MHCA 4WO4B 1EVUA 4RDQG 3V4UH 1J87A 2ZCLL 4JVPA 1D5BA 3DO3A 3QUYA 5E1AA 3MRFB 4CKVX 4JPWH 4WENB 4Z0XB 2NY3C 3MA9H 1CE6B 1HILB 1YEDA 1JRHL 5I0DA 1B0GB 2DD8L 2O61A 4ZSOE 1TCRB 2R2HA 4K3EL 4LF3A 1CXEA 4LCIL 3QHZL 2XN9D 4MNGE 4WNQB 3KLDA 2EKJA 3DVGB 3ES6B 2P5EE 4NFCA 2Z35A 3GMRA 3SCMD 4S1QL 1IQWH 3W81A 5E70A 4Q7DA 5F1NB 5TF0A 4NQEE 4Y5VC 4V2CB 1ZXQA 5FV2A 5JMRA 3QNZB 3BUYA 1T0MB 4K7PL 3O6LH 4YDKH 5I1EH 1TZIB 3HE7D 4ODWB 3Q6FB 3QQ3B 5FV1L 3NTCL 4XCYB 3VXRB 1KIPB 1PY4A 3D87B 5J6HA 5CJQL 4Q9QH 4HFWB 3MGTA 1HKLL 1J86A 3FOMA 4UU9A 4M4RA 5HYSB 2DQIH 1LE9A 1U8KB 3N9GH 4N1HB 3IDXH 1T7ZA 1T80A 3VFWB 2IAMD 1QBLH 4M1CC 4F80A 4P5TA 4CUCA 1UM5L 4BKLA 1MWAA 1H5BA 4PJ8A 1YNTA 3HI1A 3I2CL 1QSED 5B39A 2EIDA 1ZLWH 1A6TA 1QLEL 4YDIL 3RY4A 1WZLA 4Y19D 4XT1C 1HK6A 3ARGB 1Z9OA 5GRVL 2QKIB 1FCGA 4BFIB 4LPWA 2I60H 2NXZD 4R96B 4NO2B 4AIZA 4WEUD 5C0CA 3VXUD 4JFFA 1RIUL 4GG8B 4UDTA 5TDNA 1CIUA 1P7QD 2CMRL 3HS0B 5CZVL 4ZO7A 1MFCH 4XHJC 1NC2B 4Y2DD 3LN4B 1ZT4B 4FQ2H 3TH2T 4NZUH 2EDRA 3PNWB 1N4XL 2BRRH 2J88L 4PJEE 4K8RD 4J23A 4HZAA 1MI5B 1AD9A 4I77L 5HYQB 1UH4A 4MS8C 1CFSA 3LDBC 3A6OA 4MJ4A 1YUHA 5ESQA 4KK6C 1A47A 3ALWA 4K71B 1KCSL 1BGXL 4DGIL 3HG1E 1HWHB 5IMLB 2VR9A 4KROC 6FABH 1JL8A 5E8EB 3G5VA 5DVMA 2J5LC 3PHSA 3KHQA 5CCKL 1F4HA 2R0LH 2DLTA 4N68A 5I8EA 3TIEB 5F72S 1SM3H 2A6IA 4P2RB 4NNPL 5C0JA 1TJGH 1PG7X 3NIFE 4QHUB 3MRKB 4KWUA 4WFEE 4Z7UE 3GRWL 3D25B 4HIEB 2VXUL 3VXOB 1DANU 1KGCD 3QDAA 5TE4H 3ARDC 4N90E 3RJDA 5SWSD 1W0YT 3I3DA 3A67H 1CICC 1MCFA 3FB5B 5T1KB 1HHGA 4M6MH 4WHYG 2KUTA 4XP6H 4OIAA 4MCYA 4U49A 4JJ5A 5MEQB 1S78D 4CVXB 1YZZA 3MXVL 2PUQT 3DV4B 3NFNA 1M6OB 4ZPVA 5DHXB 4P99A 2ATKA 2KQNA 4G6FD 3NCEB 4HS8L 4NKMB 1AGEB 4N1EA 4F37F 3UPRB 3P73B 5BOZG 2EE2A 1T5WA 1MFBL 3AB0C 2R2EB 5GGSB 3OSKA 1EMTH 4OQTH 3ZYZA 4QTIL 3PQYD 3DX8A 1U8IB 2DRUA 4G8GB 5DTFB 1EUUA 3RNKB 2AEQL 3CK0L 3CD4A 1WBYA 2ATPA 4NJ9L 2AXFB 1RZFL 3A6CL 2A0LC 1R5IA 2BOBB 4M02A 1CLOL 1A9BA 3VXQA 1Z3GH 1CVRA 3ZE2E 3HNTH 3EOTL 3AROA 4XMKL 2NY2D 4JPIB 2PO6C 1TVHA 1JNHB 2L7JA 3EJYD 1MREL 5J3HC 4JO4L 2C1PA 5BVJA 1GIGH 2RQ8A 1QFOA 3HMXA 3RWDB 3NZHL 1W0WA 4LSRL 4Z7WB 4F7CB 1TQCC 1K4CA 4C83A 2V5MA 3P11L 5D1ZC 3HMWL 4HJ0D 4XNUH 3NCFB 4KUZH 5TH2B 4KC3B 3V5DA 4GQPH 1YNLL 4R3SB 2JIXB 2OTWA 1BREA 1QD0A 1LO2H 3C09C 4H20H 5D5MB 3DUUB 2BCKA 2HFTA 3PV6A 4JQVA 4N0YL 4JQIL 5E4IA 2FR4B 3BRFA 3L5HA 1URLA 1QRNB 2P5EA 3QT2A 4MJ2A 3SKNA 3L1OH 2O5XH 3TV3H 1P7KB 3VWJD 3MJ9A 1MCDA 3IVKB 3TBWA 3V4VL 1M05B 4FA8A 3GUTA 1B0RA 2YN5A 7FABH 4ZD3H 2XY2A 3O2WL 1GPOH 4YBHA 1QACA 12E8L 1D9KB 1FYTD 3CFEB 2NW3B 4JZJA 5CUSL 1A3QA 5EOCJ 1ZSDA 4G7VL 2UZIL 3EAKA 3MNVB 3BDXA 3SDAA 2X44D 3BSZH 4ONGH 4Y4FD 3FOLB 4QRTA 2WP3O 5CIPA 2VXTH 5JXAL 1C5CH 3D2UD 5J6GB 3OAUH 5ERWA 3E2HB 4D8PA 3WKNA 3SDCA 5IF0A 1OARH 3U7WH 5FF6B 5F9OL 5IESL 4JCLA 4YBLB 2WIIB 5F1KC 3TZVD 1S7WB 3RWFA 3SDXB 3HE6C 2IQAB 2CQVA 4U1NB 2CUMA 5IJVB 1NEUA 3BDBA 1LK2B 2DM2A 4ZTPH 5FYLE 1KB5B 5GS2D 5GGUB 1MI5E 1NMAL 5C07A 5GHWL 5L9DL 5FYKE 2DWEB 2KZ1B 1MHPH 4OF6A 4XRCA 1KTDB 1KELH 4JB9H 1QFHA 3QIUA 4F7TA 4FFZH 4UINH 4LVOB 1GGIH 5HI5D 1KPUA 3OG6B 3FQTB 1KIRA 1PX4A 1U8MB 1B3JA 1WAAA 3V8CA 3NFSL 2HT3C 4WO4C 4RAVA 3C6SA 2E8ZA 4WU7B 1K6QL 5JLZA 1BD2D 3QCUL 3CDYA 5HPMA 4NZJA 4OLUH 5D6DA 2DN7A 5T1MA 5IB5B 3U7YH 1F02I 3IFNH 4L3ED 5K9OB 1YNKL 4F7EA 3DARA 3D0VA 1JFQL 2YKLL 4ZXBA 2OK0L 1SBSL 3EFDL 3MV8D 3CJJA 4HC1A 4IJ3C 2P8MA 2IH1B 1R3HB 4JN1L 5EU5B 3O6FB 5FECA 1EHAA 4M7JL 1ULVA 4WVRA 3I6GA 2PXYB 4PGCA 1Q1JL 1X3DA 1MFAL 4Y4KD 4YHLL 3U0WH 4X4YB 5IG7A 3SE9H 4LCCA 3F62A 5IEHA 3EDDA 2ED9A 4YUEH 1F42A 4D2NA 4HUVA 2ZCLH 4X7EC 2QBWA 4RX4A 4CN6A 1R5WB 3QNXB 5MP6H 1S7UB 1I3RB 3D85A 1AJ7L 2XTJE 4F9LC 4G8GE 1JRHH 5DA4A 1P4BL 2DD8H 4QHLA 5DJ2B 1EAJA 4JO3H 4K3EH 4X4XB 5HHQA 3QHZH 5J1AA 5DJ6A 1CR9H 1YQVL 1HHHB 3Q3GA 4PGBB 4QEGA 3ARBB 2VLMD 3RWHA 1HDMA 3MFFB 3MV9A 4P5KA 5CINL 3VXSB 2YHGA 1R24A 4NO0D 3ARGC 3BZ4A 4DUVA 2V5TA 2D7NA 2VDNL 3TM6A 1P2CA 1TXKA 2VXVH 3D39D 4UT6L 3UYPA 4QCIA 1T1YB 4K7PH 2JJTA 3L95A 1JPTL 3MRPA 3QIWB 4Z7WE 2F54D 1XF5B 2X7LA 2BXYA 5CJQH 4FQ1L 2OQJA 3H6JA 3JSSA 1Z9MA 1HKLH 3VRJA 3PP3K 4ESKA 3BN9D 2LVCA 5LWYL 5BXFA 2DKSA 4V1DA 5SX5K 5D5ME 1JTPA 1U8NB 3EYFB 3GO1L 4IRSD 5L8KB 2NLJA 4U1JB 3IDMB 3LS5H 4OLXL 4X5XB 3F6IA 3L3IA 4JFPA 4YHIB 2EH8L 2E9BA 1CTOA 1QRNE 3GIZH 4Q6IB 3L6FA 1Q9LB 2FIKA 4YDIH 4K71C 4ZUUB 3TYFB 4AEHH 1QBBA 1K8DA 4ODVL 1IAIM 4GRMA 4OIBA 4KTEL 3DXAB 4U1GB 2AGJL 5M95B 2RR3A 5IT2H 5JXEC 2ADJA 3IU3B 1RIUH 2VLKB 1FVEA 5CZVH 3FRUB 2OTPA 4WW1A 1ORQA 1G84A 2OJZL 1UENA 4HH8A 1KJVA 2A38A 2DL9A 2Y36L 4X6BB 4CVZB 4D0BB 1HIML 3RNQA 1N4XH 1BFOB 1F90L 4OZHA 5IB1A 3LKRA 3X11B 2AJYH 5BQ7B 3SDDD 3R06B 3DSFL 4I77H 4NOBA 2Z91B 1NGZB 4LSDA 5AZEL 2CKNA 1SEBB 2VH5L 5ACMA 4WWKB 1KCSH 3HR5A 1BGXH 3OKOB 4DGIH 3H9SB 4L8DB 1T4KB 1S7QB 4HK3N 3D5OF 3AU1B 2FYYA 2I27N 4H8WC 3T04D 2A2QT 5DD6B 5CCKH 3JWDC 4PRBB 3F7PC 1EH9A 2FX9L 3D18B 1OP3K 4NNPH 3BEVB 1IL1B 2X1XR 3PDOB 3UBXA 1RK1A 2W0PA 3TCLB 3GRWH 1G7LA 5DJCA 4K23L 1S7RA 3V6OE 5GS1B 1T03L 4RDQF 4I3SH 4P46B 4LLQB 5KSBA 4QKXB 5I1IL 4POZC 4BQCA 4RGNB 4HULB 3WYRA 4BSJA 1F3DJ 5F6HI 1KCVL 1T0NB 1MNUH 5KZCB 4L3CA 3NAAH 3OX8B 3HZVB 2YA0A 4U1MA 1F97A 4YH6A 2J6EL 1A7QL 5KJRH 4NO5A 3MXVH 3BH9B 1BLNA 2WP3T 4O2EA 1H3XA 4Y4HA 4GG6B 3VH8B 4Z7VA 4OGAD 4HWBL 4NP4H 1FL5A 4OAWB 1MFBH 5I19L 2R8SL 3GSXB 3T3PF 5C0GB 4LU5L 3ULVC 4AG4H 1PG7W 3FQUA 1S9VB 4QTIH 5IOPB 3HAEB 4L29A 2GJ6D 2WW8A 2AEQH 3CK0H 1XEDA 3BJLA 4NJ9H 1RZFH 3TN0B 4YAQB 4U0RB 4PP1D 3A6CH 5B38B 3IF1B 1EV2E 3O2DL 5KVFL 1FNGA 3O6KL 3QDMB 2PYFB 3O11A 3INUL 3IKCA 2NYYC 1CLOH 1FFNA 2AJ3B 3U1SH 1U92A 1MF2L 3KPSE 3N1QC 3KLHC 1N5AA 2V7NA 3D69B 4NCDA 3CFDB 4JO4H 4CJ1A 3V95A 1D9KC 1ZGLB 3NZHH 1KTLA 3BIKA 3RGVD 1YMMB 3HC0A 3VXSE 5HGDA 4OFYD 4X6FB 2CIKA 5SV4A 3DETC 1IGCL 4YZFE 5KVDL 4IRZH 1ZT1B 1DQQB 1YNLH 2D0FA 4JN2B 3KNBB 1I8LA 2D31B 1E28B 4JQIH 3E2HC 4PGDB 1AXSB 4OQTA 4YBLC 4QRSA 5DEGA 3UJTH 5T1DH 1BIIB 3UYRH 5JUEH 3C08L 4IIQC 2FD6L 4QWWD 1IGYA 3V4VH 3B5HA 1INQB 1EEUA 4PJ9C 1XGUA 2Z8WC 1MHCB 3BN3B 3S4SG 4U6HA 5DDHB 4UT9L 1H8NA 12E8H 2R4SH 4BK5A 4OZIF 2UYLB 3QUYB 2JCCB 1VA9A 4UBDC 3L3HB 3ZE1F 5CUSH 1QSVA 2F15A 3QXDA 1A4KB 4G7VH 5KSAB 2UZIH 2ID5A 5CD5C 1JHLL 3OAZH 3QG7L 4HX1A 5DRXA 3X3FL 1A3LH 3VMPA 2CJUH 1NBYB 3WDIA 2YPLB 2ZPKH 1EFXB 4ZTOL 2XIDA 1G6RH 1U8JB 1X5JA 4NQVA 3H7LA 5JXAH 2Z35B 1T20A 2VLKE 1FVCA 4LOUC 3UXFA 1V5JA 2LU4A 2F9BT 5F9OH 3MUGB 4HGWA 1X5FA 3QDGB 4NJAH 3EIFA 2JB5L 1QVOB 5IMOA 4KK5C 1NDMB 5IVZB 1AO7A 1FSKB 4GSDL 5E6YA 3RY5A 2B5IB 5A2LH 3X12B 4FTVA 3WV0A 2A77L 3VWKD 2BSTB 2X1PA 5GHWH 2R1YA 4PTTB 4QXTA 5T1LD 2E7LC 1A1MA 1CXKA 3O6FC 2ICES 4RNRB 4PRPB 4XP5L 1TCMA 1CF8H 2PXYC 3H9SE 4MA7L 3W0WE 1G9NC 5F7UA 2VL4A 1MRCL 2KH2B 4F7PA 1PD6A 3NFSH 2WNGA 4R7NA 1DBJL 1T22B 2DQGH 5L2KB 3GJFB 5EH1A 1L9MA 1K6QH 1DBMH 4E5XA 3K8KA 3N1PC 2GHWB 1SYVA 1X6NA 3LRGA 3QCUH 4GFTB 1PQZB 4OGZA 3MRMB 4QRUB 4JZOB 5F6HJ 5HJ3B 4PRIE 3IFOB 4TUOB 3O9WD 3BKML 3SJVB 1QHPA 4KDVA 1JFQH 1SBSH 4JVWA 4H1LG 1TIUA 5EUOF 5GGSY 5F1IB 4BZ1L 1OAYH 5EC2B 1JZ4A 2VDPL 3VD5A 4HKXB 3MV7D 2KDGA 1Y18A 3V8OA 5IW6A 1JP5A 4HIHA 4OT1H 1I7ZB 1S9KC 4U3HA 3L5IA 3QIBC 1MFAH 4YHLH 3EYSH 2HJKA 1DVFD 4OIIL 5GRUL 4GG6E 3OKKB 3QEQE 3DX7B 2A6JB 1IEAA 2VXSL 5E2UH 2NZIA 3EFFA 5JA9A 1CDBA 1WT5C 4HV8B 1CFSB 1XR8B 3FQXA 5ESQB 1JIBA 3P4NA 4U1HB 2NY0C 3BZFA 3NA9H 5JIIA 1MRDH 3JWOL 5T3ZD 1KT2A 3DHMA 4JRYB 5FKAA 4JFDD 2J4WL 1AJ7H 1P4BH 1YEJL 5EWIH 2VR4A 1NGPL 2VDOL 1AHWC 1PG7L 3ARZA 1QO3A 1ZE3C 4P2OA 3QDME 1YQVH 4LDEB 1ZWIB 3EYUH 4ZFOB 4EI5A 2P42B 3MLPA 1BJ1J 3HNSL 4FZ8L 1KCUL 3TO2A 2X6MA 4RFEB 3MLZL 2VDNH 1DTUA 1EFQA 1HOCB 3P4LA 4U1GC 3MZGB 2VIRA 1JPTH 3RWGB 1QSFD 1I85C 4HK0A 1P4IL 2YD1A 1JUFB 5HYEA 5JO5B 4EIZC 4JPKL 1JK8B 4ZAKB 4AK1A 5E8PA 3KPSA 2XWJA 3RVTD 6CGTA 3OXRB 4DKEL 1Q9WA 1RZIA 4WUUE 3C5ZA 3QISA 4OLXH 5GGTL 4IDLA 4YHPA 5C3TA 3LRSA 2EH8H 1XF1A 1LD9A 2Z0BA 3BP5B 2HFEA 5LBSL 5C1MB 3GNML 3OKEA 4JHZA 4WWKC 3ULUD 1IGFH 2VLRD 4PRDB 2DDQH 3TBTA 4IRJA 4ODVH 1M7XA 5EBMA 4KTEH 3KPRB 4KUCD 3MRBA 1MFEL 5D7KE 1PYWA 5MERA 4C59B 5MEPB 1DLFL 4IHOA 4M6NL 4YDJB 2VJXA 2UVEA 4A6YH 4P5TD 4D9QE 4MWFA 2YK1L 2ZUSA 5EU7C 3Q0HA 1TVHB 2YPLE 1OHQA 4PJIB 2NTSP 3GSVB 4LBEA 1HIMH 4KVNL 5ANME 5BVJB 5F7DB 4BUGA 4HWZB 5IHZA 1F90H 2EYSA 4Q58C 4Y7MA 4LIQL 1YN7B 3RTQD 4RGNC 4WJ5B 3RPKA 1BECA 3P4OB 2XFXB 4NQUA 5I1KL 5EZJA 1K4CB 1NCUA 2LFGA 5JQHC 5F93C 5C0CD 3LSOB 1ODAA 2VH5H 3QDGE 4DVRL 4UUJB 5IJKA 3RWCA 2EEBA 4J4PA 3B5TA 1HNGA 2X4NA 3MNWB 5JW4Q 4LCWA 3LKOB 1X5YA 5CJOL 2HA1A 4MAYB 4NCC2 3QFJE 4RQQA 3O2VL 2G9HA 4KV5F 3U2SB 4R4ND 2FX9H 3VFMB 1Q9KB 2EZ0C 4PRPE 5D1XC 1TVDA 2NY7H 3U4BL 3L9RA 5EZLA 5I66A 2X89A 1NKRA 4ODUB 3TN0C 1EDQA 3G08B 1B6UA 2EIZB 4RFNB 1NBZA 1QFWL 3GEWB 5FCUH 3VXNB 2YA1A 5GRYA 5L2KE 4QHMA 2BVTA 3ZL4L 2VDQH 4EIGB 1KCVH 2DQJL 1FVDB 3R8QA 5IVNA 4WI3A 2EDHA 4L4JA 2J6EH 1A7QH 1ZEAL 2CDFA 1SHMA 4PJCA 5CIPB 3W0WA 1KLGA 4JFHD 3SJVE 1PGRB 1FYHB 3HZKB 3D6GA 5E8OB 4FQJL 4LPVA 2HT2C 35C8L 1LE5B 3ZTNL 1HHIB 1F58L 2Y7QB 5DQ9B 5IF0B 5E5MA 4URTB 2GY5A 3ARWA 4EN3B 4KK9C 2DLGA 5I19H 3O6ML 4EJ1C 1N59A 5FYKU 1QEWA 1LO0L 3U6RA 4RFOL 2XPGA 3G6DH 4XCEA 4FNLL 5CS7A 1IGJA 1X7QA 2YZ1A 3IFLL 4LSVL 2B39A 3KYNA 4DTGL 4PRIA 1KEML 2YPVH 3PWPD 3FB6A 3DYPA 1I1AB 3PUCA 4X7TA 4JFQA 5HYJD 3WNOA 1Y0LB 4O2FB 2FB4H 2P8PA 3P9LB 3UMTA 4JRYE 2I9TA 3GRWA 5ISZD 4YHOH 5D2LF 1MF2H 4JM2A 3K4DA 4AEIH 4NRYB 5KTEL 1LP9E 5GQBA 1ADQL 1M7IA 4O5LH 4G5ZH 3KYMA 1RK0A 5GSVB 1NBVH 5HVGB 4KAQH 3QEQA 1YDPA 1A9EA 4DKAA 1VFAA 3QUYC 3T8XA 1D5XA 2BNQB 5A43C 1IGCH 4MS8D 3FKUS 2FSEB 1OAQL 5KVDH 4L8CB 1OGAE 1U91A 5I1DB 4ZXBB 2OTUA 3U46B 1T89A 1NMBH 3P3YA 4NQCB 4J7RA 4PD4K 1KIQA 3EZJB 5FECB 1BFVL 1DJSA 3IJHA 4PGCB 4IOFD 2YMXH 5HHOB 3VFTA 2FD6H 5K33A 5E08L 1FSKC 4DQOH 2B5IC 3IT8D 3NCJL 3GSQA 4F9PA 3L3GA 5JOPE 2RFXA 3U0TA 5A1AA 4PJGA 3MLRL 1FGVL 2C7UA 5J12B 3L5WA 2AXGA 3D85B 1IKNA 5LJYH 3VCLA 3BXNB 1JHLH 3QG7H 3X3FH 3ZSSA 2FHCA 1IM9A 5A2FA 4RCAA 3JV0A 3OR6A 4L8SB 3GMPA 3MOBL 5DJ6B 2FL5A 1RVFH 3Q3GB 1EPFA 4EUPH 4NQED 3P0VL 4WUUA 3UTSB 4OV5B 1CFNA 2ZOLB 2QADB 3C60A 2Q7NA 1IC1A 4OUUB 5IR1A 1MFDL 4PJIE 3TYGL 2VSDA 3WUZA 2RHEA 3L95B 2X5PA 5IBLD 3MLUL 3LS4H 1AH1A 4P4KB 4HFUL 4JHAL 4Y1AA 5INDA 4DGYL 3MCKA 3QEUA 3QAZB 4UIKL 3P30L 1JWSA 5IV2B 4ETQA 2HLAA 4XP5H 2A0LD 2R2BA 4TRPH 3B9EA 4V1DB 1KLUB 4MA7H 1OLLA 5GZOC 1RY7B 1U58A 2OJEA 3KPQA 1U6AH 4PD4J 3J7HA 5ANMA 2X4RA 3VDAA 3K7UA 2BDNL 1S8DB 1IJ9A 3L6FB 5EN2B 1UXSB 4L8BA 4M6OL 3NIGE 3VD3A 1XGQB 2ARJQ 5J3HD 3BO8B 4I9WE 5DD3L 1K8DB 1K2DA 2CKBB 3MLXL 1E6OL 4GRMB 1G6RA 4AT6B 2D0HA 2VDRH 4NSKB 1OSZB 2QSCH 3WN5A 3WS3B 4WGWB 2R1XA 5D1ZD 3TA3A 1T1WA 3EBAA 3IJSB 3VA6A 2F5AH 3GJFK 5JPMA 4BZ1H 3QYCA 3N85H 4DVBA 4DUWA 5F7EL 3KYKL 3DPBA 3CVHB 1I7RB 4S1RH 2BK8A 2FJFA 3ZZ1A 4GLRH 3OQ3B 3P0GB 3OHXA 4DAGL 2VXSH 3FAWA 4XMPH 3HG1D 1NJ9A 5I73C 1CE1H 4L4VA 4ACPA 2JKXA 1BZQK 4XVSL 2VQ1B 4LPTA 5IQ9A 3I02B 1JYNA 1GGTA 2W60A 5GGRA 5JZ7C 1YEJH 3MLSH 3UJJL 1NGPH 4N0RA 1MVUA 1XGPA 1G7QA 2D7OA 3HRZB 2V9RA 3DGCR 3BEWB 3VD4A 1JZ6A 2BSRB 2GSIA 2GJZB 4YO0A 4JO2L 1FJ1B 3HNSH 4FZ8H 1KCUH 1OP5H 2CLRB 5E00A 3FFCB 4N90D 5DJCB 3X3GH 5DWUL 4R0LB 5D6CA 4WTXA 4YXHL 4MVBC 3RAJL 2OX5A 2H41A 4RBPH 1P5VA 3CMGA 4X4MA 2DQHL 1A7RH 3F5WA 4GAYB 3OKNA 4H0GA 5IHBA 1IVLA 4GKZB 3RWJA 1BZ7B 4MZ3A 2E6PA 3BH8A 2BNQE 4OFDA 2Y6SC 4OZGF 3OKLA 4U1MB 4HWEH 1XF2A 3WL9A 3G04B 3D0LA 5E94A 3VD9A 2BHUA 2V2WA 4PRAA 5D1QB 3VFGL 4BQBA 1ZMYA 3C6LA 2OSLA 1HNFA 2ADGA 4J3UA 4GAFB 1RJYA 3MO1B 1FL5B 4NQCE 4XNQA 5GGTH 5CBAB 2D4DA 5CEXA 4FABL 3EO1A 3OGOE 4WO4D 5HHOE 1K4DB 4MSWB 4P2YA 4GKSA 3ZE0E 2HVJA 5FA3B 5TDOB 3S34L 2YEZB 2IADA 3ELAT 4JQVC 4PJHA 4MAYC 1RD6A 1OGAA 4NYLB 5H2BA 3LQAC 5AYUH 3U9UA 1F6AA 1LNUA 1MFEH 3O11B 4XXDA 5BMFL 4P9HC 1DLFH 4LLAA 4M6NH 5B3NA 5HGBA 1HH9B 1NFIA 1ZAGA 3H3KA 5D8JL 4G3YH 1JGUH 1AC6A 2DQEL 3BGFB 4MJIB 4OBSA 2QV2A 3OV6A 1BVKA 1OTTD 2COQA 1N2RB 3LEYH 5DZLA 4RFNC 4QLRA 4LLUB 5ICYA 4LIQH 3BIKB 3UTSE 2WWMD 3PWUA 2NX5B 3CXHK 4JZJC 5D7IB 4WCYL 5HGDB 5I1KH 3WFCL 4NQDA 2IGFL 2Y4SA 3BDYL 3I84A 5I8CA 1DUZA 3GMQA 4LSSL 2XWTB 4O2CA 2HFFA 3SDAC 4DVRH 4CU8A 1AIFA 4ZNCD 2OMNA 3QG6B 2P5WA 4R90H 3RBGA 5FXCH 5J06A 3RUGE 1WBXA 3QUXB 5HI4D 5CJOH 3KG5A 3SDCC 3O2VH 1QHOA 1IEBA 1DLHB 1RV6X 2UWEB 1KNOB 5B38G 1OPGH 1A14L 2ORBL 4I0CC 5KG9A 4K9EC 1J10A 3R4DA 5C0IB 4GW5A 5I1GL 1QFWH 2BJMH 1WBZA 4O4YL 4A6YA 5BV7B 1CLZL 3C2SA 3OXSA 2AEWA 4U1KA 3ZL4H 1G9EA 4PJBA 4I13B 2Y72A 5D9SA 2DQJH 4LDOB 1G7IA 1VPOL 1NCBL 5IKCB 2W1NA 1WEJL 4AZ8A 4LL9A 1ZEAH 3NCBB 1AXTH 5MEOA 1PY9A 1NC2D 4QTHA 3D9AH 2V5RA 4PJAA 4HJGB 5GS0D 4FQJH 5AEAA 3ZTNH 1JZ8A 4HIJB 4DCQA 2Y1VA 5B8CB 3CUPA 4X6DB 3H9ZA 5FYLD 5KVMC 4AM0B 1MI5D 5C0FB 2QTEA 5IMOB 5FYKD 3CXHJ 1LO0H 3CSYB 4RFOH 5CILL 1XGTB 3S97C 1NSNH 5DD5H 4FNLH 4ZXBC 3MRHA 2ITDA 2ZUWA 4DTGH 5CEYB 3T0EB 4XVUD 4JFZH 5E8DH 4TSCL 4Z9KB 5CP7A 1P1ZA 1CK0L 2XZAL 2BC4B 1GZQA 3SPVA 1WTLA 4GKNA 2PETA 3RZCD 2VLJA 4LCCC 3WFEL 4I3GA 4PRHA 4W4OC 1T6VN 5EBLB 2EYTB 4R7NB 3R1GH 2VB5A 1PKQA 3VU2A 3JBG7 3REWB 4BQ9A 1QPPA 1TZHA 3VGFA 1IAIH 2DLFL 5HDLA 4TULL 5H37H 5IGXL 3MX0A 2OL3L 3FFCE 2J6EA 4BH8B 4K3DL 2V17H 5T1KD 4AQOA 4ENEC 1A2YA 1XGYL 4TUKH 5DK2A 3O41A 4NN5B 3VMOA 2YUVA 3GSRB 4RA3A 5DJ8A 1VERA 2XWBB 1FFPA 4XGZB 5E0QA 2QADC 3EDKA 2NXYB 1VKXA 1L9NA 1KPRA 4HIHB 4MA1B 1DCLA 4ZFFB 3EYOA 3NGBB 2JJTC 2HJKB 4UV7L 5E08H 4YR6B 5E99L 4P4KC 1IEAB 2VMFA 3CX2A 4PJXE 1BF2A 3F8UB 3NCJH 5E9DA 2MCPH 2XTJD 4G8GD 4KDTC 4XMLL 4KI5E 3B6SA 5CJ5A 3MLRH 5IVXB 5B39G 3UZQA 4ERSH 1A6ZB 3O3EB 1UA6L 4M61B 4EVNA 2NW2A 1BZ9A 2NY4B 3PHQB 1NFKA 3WIHA 4X6EB 3MOBH 5DUMH 1JTOA 1UQSB 3ECBB 2DMCA 5BRZA 1HSAB 3H9YA 5C6TL 3RWEB 4Y89A 1W72H 2K7QA 5DQDL 4R8WH 1UB5A 5FHAL 3P4MB 2BFVH 2WZPD 5ILTL 3UTTA 4HKBA 1PLGL 3HPJA 4MJIE 1B88A 2WINA 1GC1L 1KENL 3C87A 4HBCL 1C7TA 4JHAH 1A4JA 2ZJSL 1I3VA 3QI9A 5D7IE 5HHVH 4DGYH 4PJ5E 4WFHD 4UIKH 1YYMH 1T1ZA 5CEZE 4RMRA 4X99A 2B1HL 4X9HA 5E8PB 3ARFB 5C0BB 1QRND 1J0ZA 5FM5O 3FL7A 5FUOL 5CGYC 3ULVF 3CZFA 4YIQA 1R3JA 2VAJA 3KLHD 2HFEB 1J7VR 3UTZB 4YHYB 4EDWL 4M6OH 1F6LL 1KG0A 2UWEE 4QXUL 2X9WA 3ULVL 4LHQB 3MLXH 5EBMB 1JWUA 2ITCA 1DEEB 1F6FB 5F9AC 4OLYL 4EUPA 1FLRL 3RUGA 1F8TH 2AV7B 5GXBB 4QT5B 5LKNA 2EKSA 4ORGB 3O8XA 2PF6A 2ARJA 5E2WH 1NC4A 5CHNA 1XH3A 4G7YL 1YMHA 5I76A 5I71B 1A7OL 3KYKH 2XICA 3F7VB 1OT1A 4HS3B 4LVNC 4WEBL 3AVEA 2PW1A 4NUGL 4MNHA 2H32H 3T4YB 4K7FA 1DN2A 5DZOA 4JDZA 2GK0B 4X6DE 4I2XA 3E8UL 3CDCA 3P77B 1L0XA 3KPOA 3JV4B 5EU6B 1NCAL 1I8IB 3T3MF 2C5DC 5LQBH 5D1QC 3QWOA 1W8OA 5AZ2H 5BOPA 4Y4HC 5GRJL 3SDXF 4UBDD 2XRAL 25C8H 4RQQB 3UJJH 4UQ3A 2V6HA 1I75A 4YGVA 3RIAF 4J8RB 4KI5C 3ARPA 1UVQA 1HHJA 1AE6L 3ZHDA 2AK4B 1V7ML 3QUZA 1HE7A 3ZDZF 4HH9B 4JO2H 1BHGA 4PJFF 3L9RB 4YHML 1GJIA 4JANA 1LMKA 3UAJC 3BT2L 5DRZB 3EOYG 4PJDA 2VNCA 4YXHH 5AUMB 2YSSB 2A73A 1J0YA 1WF5A 1Q9OB 4L9LB 1ZLWK 1BM3L 1OD9A 2ADIB 1R5VB 2DQHH 4NZRH 4TPRL 2VDML 5JR1L 1GH7A 5EORL 3PXHA 4G9FE 4QHNA 3BGFC 2ZSVA 4EI5D 2IANB 1JF5A 2RAMA 4XP4L 3VFGH 5LGJA 3O6FD 3WEXB 5E8NA 4PPTA 2PXYD 3O81A 3B9DA 4RGOL 4OCRH 3DO7B 4D9LL 4FABH 3DV6B 5CGTA 4XCCL 1ZLUH 3SE8L 4K8RH 3SBWA 1U8OB 3IKKA 4OCLC 5ID1A 4F3FB 5L6YL 2PTTA 1NEZA 3S34H 3QUXC 4BH7B 3FB6B 1U8LA 4BQ8A 3KPSD 1FAIL 3DRTA 2OBGA 3PWLB 3O4OB 1NGXB 3NZ8A 4NNXA 2APWA 2CLVB 4Y16A 2P8PB 4FQXA 4UDUB 5IVXE 3CC5A 5DGQA 2I9TB 1SMOA 3MLYL 5CD3A 4WWID 3BMWA 3ARBD 5ENWA 2A6DA 3LKNA 3KYMB 4DW2L 1AQDA 3VXSD 4Z7QE 1PDKA 3BIAX 5CFHA 2WLYA 1A9EB 5IW3A 3JTTA 4WCYH 1JVKA 4ZUTA 4PTUA 1JYWA 3WFCH 4ELKA 3BDYH 3EHBD 1BVLB 3QIWD 4FQLL 5SX4H 2AXHA 3BZEB 1ZA6B 3CAFA 5F88B 1RURL 5E7BA 5FO8B 3V6ZA 5EIIA 3ZKMC 3KLSA 4RWYL 3EO0A 3O3AA 3V4PL 3T77B 1AR1C 1DQML 5B8CC 5H94A 5KSUA 4HQQL 2D9CA 1G7JB 1AGCB 5JA8B 2RGSA 5EUKB 2AJUL 5JHLL 3VFTB 1AKJA 1HQRA 5HGHA 5AG8A 3QWQB 1A14H 4ZQKA 3V9FA 2J8UF 1J1OL 3H0TA 3T0EC 2VXQL 3G9AB 3WIIL 1CL7L 1PW3A 4O4YH 5D7LB 1NGWA 1FN4A 1NGQL 2C7UB 4PJ5A 1M7DB 5HVWA 4NKQB 3VFVA 2XNAB 1NCBH 2JK5B 4NQTA 4JFYA 1R3KB 2QR0A 1WEJH 4LKCA 3HHRB 2VLKD 4XNXH 4LVHB 2FL5B 5EU4B 2FO4A 3QZWA 4NPYB 3O3DB 1GGUA 1K9TA 2YD9A 1S9XB 3B9KB 3MR9B 3DYMA 3IU4L 2WBJA 3KLAB 1I7UB 5DT1L 3QH3A 4HXBH 3PABA 1L0YA 2CDEA 3ALPA 1M1SA 5TF1L 1BJMA 5I1LA 4P23B 5MENA 3SDYH 4V2BA 4FQQA 8FABB 1IGIH 4UTAL 4K94C 4LVEA 4X9GA 5SWZA 3IXAA 5EOTA 4XP9H 3IDIB 5HVFB 3DURA 1P4LA 3DUSB 5CKAA 1YY9C 4X0KB 3H9SD 4MMXC 3L3KB 1AGDA 4TSCH 3W0WD 9CGTA 4MXQD 2E7CA 5ID0B 1T66C 1CK0H 3IXTB 2HP4A 3H3PL 5ICXA 4M3JA 4ETYA 5EU6E 1B0WA 4MA1C 3QXAB 4ZUVB 2NY1B 1I9EA 1EX0A 1AQKL 5EC1B 1FBIH 3PWVB 1JNJA 3VFNA 3WFEH 4AIXA 4PLJC 4QRPB 4PREA 1II4E 4ZS7L 1RQ5A 3GJEA 4W6YB 2FRGP 4KXZH 5CBEB 3MRRA 3L5XL 5L88H 3KPMA 3WHXA 2AK4E 3DVNB 4IMLA 4TULH 4XPAH 4P46D 4G8FB 4DFHA 4AL8L 3T0AA 2YWYA 4ISVA 1NFDF 4LLVA 4P4RA 4WI8A 3QO1A 5L2JB 3TIDB 4P2QE 3RDTB 4PG2A 5I17A 2ENSA 2BSSB 5BW7A 3GSNH 3LRHA 3MJ7B 4HS6A 3MRCA 4HHAB 1GHFH 4JFOA 4P2OC 4JM2D 4MB3A 5TFSL 4GAGL 2DTML 5KS9F 1DE4B 3M8OH 5E6IA 4UT7L 1QLRB 5INCB 1RMFL 2IANE 3JV6A 3NABH 3ROLA 2SEBB 3TFKC 3KPNB 4UV7H 1TQBC 2YPKB 1U8HB 2A74B 1TJHH 2GSGB 3AY4A 3MREB 3BP7A 1W0VA 1U3HB 3B2UC 3C9NB 1ZHBA 1MCBA 1DBBH 2DQTL 2OP4L 4I18B 2X10A 3MGAA 4XMLH 3V6BR 5IQ9B 2Y9RT 4GMTL 1NH6A 3TN0D 1EAPB 1J05A 4P49A 3GMOA 5GS2H 4G9FA 3QDMD 4GQ9H 4H5SA 1XGPB 1G7QB 2QSTA 3U4EA 4KKAD 4JAMB 4NM4L 1HHKB 1RZKL 5K59F 2W0FA 5C6TH 2ICEA 3ZT7A 1JYVA 1A6VL 4NC1E 5DRNA 3B9VA 3P9WB 3BD5A 5EO1B 5ILTH 3Q1SL 3QP3A 3Q2CA 1PLGH 5GIRB 2X4UB 2W65B 2V2TB 5T33L 5FYJE 4PLKD 5L0QB 4F8QA 2JJVA 1GC1H 4G80B 2MFNA 1KENH 1WCQA 4KK9D 1CS6A 1U93B 2FH6A 3OKNB 2ZJSH 1IM9D 4CADB 1OOAA 4JRWA 4LMQE 5JDSB 5B3JF 1UH3A 5FK9B 3PGCA 4LAQH 1YEFL 4CDGC 4BSWB 3WL9B 3AMKA 3S96A 2DM7A 5CZXC 1HSBB 4WUUD 43CAA 2B1HH 4A2MA 5I71C 3C60D 1FGNH 5HHNB 3ESVF 2P7TA 1KC5L 1CU4L 2I9LA 1FFOB 1RZ8A 1ITBB 1O5DT 2WUCL 1QLFA 4EDWH 5IJKC 4ZUSB 4QXUH 4J4PC 2P44B 1VGKB 2BNRA 3UTOA 5D7KD 1MCCA 5DS8B 2CIIA 3BKCH 4N9OB 4D9QD 3UBXG 1RPQA 1FNSH 2ZNWA 1FLRH 5KSAD 1QNZL 1W72A 1S5IL 2R0WH 1NUFA 2YPLD 3CH1B 1EFXD 1EHNA 4HDIB 3FT4A 3WE6B 5EOQL 4I1NB 3SQOL 4KKLC 2JCCF 1FORL 4QF1B 4QY8B 4UOW0 4APQB 5C0EA 2GKIA 1QBML 4P3DA 3E6HB 4YLQT 5J56B 1YQ2A 4WEBH 3WMSA 4C4KO 4O51B 3ARUA 3WD5L 5ICYB 1JGEB 3ROOB 5I6XB 3QDGD 4NUGH 5ABDE 2CRYA 2EDLA 4QHKI 2PW2B 5I8CB 3HRPA 1U42A 3O3BB 4JKLA 3AMLA 1WSST 2G5BB 3LN9A 2R9HC 3TO4B 5E2TL 3MUHL 4W68A 3QFJD 1HN1A 1NCAH 3F58L 3Q6GL 1EZVY 4UI2A 5DO2D 3RFZC 5GRJH 1QKZL 2YA2A 4PRPD 3X14A 5HYFA 1CGUA 4ZOEA 5I2IB 3L7FA 5IFJA 5DURB 3WLBB 4LMQI 3SN6N 5I16A 3SGDH 1D6VL 1HI6A 3GI8L 3SO3B 2YD3A 1AE6H 1ZT7A 3IDGA 2FGWL 1V7MH 3K46A 4E42A 2F5BH 1T6WA 4YHMH 5HHME 3MODL 3QCTH 5L2KD 3TJEL 2XTLA 3BT2H 5FDWB 4QRPE 3OJDA 4QGYA 1WLHA 2FIRT 4XBPB 1JJUA 2DMKA 1KN4L 4UV4L 1BM3H 3OXSB 3O4OC 5A2IH 4U1KB 1Z5LA 5D9SB 2FATH 1IKFL 5JR1H 2XN9A 4U1SB 2H9GB 5EORH 3ARQA 5GRVK 4FP8L 3SJVD 2F8VA 4DZBA 5LCVL 2W91A 4DGVL 3S6CA 1MEXL 3SCMA 1INEL 2DBLL 3UCRA 4XP4H 3O4LB 1OGTB 4FXLA 4G6KH 5I18L 2VISA 2H32A 1JI1A 3IDJB 3ALXA 3FRPA 3GSOB 1FZMB 5JW5A 4DCQB 4KGJA 4RGOH 4YHKL 5J9PA 3HE7A 3W5MA 4FMFA 4XCCH 3PGDB 2AJZB 3F7YA 5L6YH 1FL6A 1T89C 2FJGA 1UKTA 4JRYD 5DHVH 4PG9B 2W38A 1P1ZB 2G5RA 5DHYB 4GS7C 4KI1A 2IAMA 3M17B 2Z31B 1LO5A 1BBJB 3GBLA 1KPVB 3QJHB 2Y5TB 1QSEA 3I50L 4FFWD 3DGGB 4MLSA 2D2OA 1PZ5A 4DW2H 1A5FH 3GBML 1OY3B 4MQXC 4C56E 4F9PC 1ED3B 4Y19A 2IMNA 4CW1B 2PCPB 4D3CL 1LEGA 2AKRB 3BD4A 1IKNC 3HI5L 5ALBL 4R4BA 2W9LA 4FQLH 4OCMC 5TDPA 3VXUA 1S7XA 1XIWB 3T0BA 2QQNL 1P7QA 3MLTB 1GSMA 1HH6B 2X4QB 4M48L 4Y2DA 3B9KC 4KZDH 4D94A 3KXFB 4ZAKD 4NIKB 5DJXA 3OB0H 4NHCL 3ULSA 1JN6B 4I0PB 4YX2L 2FECL 1DQMH 2RJMA 4X98A 1WWAX 2CK0L 4P23C 2BVPB 4LEOB 5JHLH 5FKPB 5JOPD 4QXGL 5C92A 5I74B 1J1OH 4X5LA 5HDQL 1KTKE 4ODXB 2YN3A 3V2AR 5D2NB 3EOAB 4JKPL 4G42B 4PJ7A 4DKDC 4XBGA 1CL7H 4L3EE 1J8HB 1DP0A 2AW2A 1OF2B 1PVHA 4K7PY 1U36A 3OR7B 2NY1C 1VADB 4JPVH 2UUDH 4LPXA 4YBQD 2Q8BH 3U36B 3VG9B 3I75A 3WHE1 1CFTB 5C0DB 4UQ2B 3WSQL 1YEKL 4YXKL 2P43B 4M8VA 5GJSL 1B2WH 2YUWA 4WV1B 4YHNA 3A6BL 3UTTB 2Z92A 4XNMA 3ZKSD 5TF1H 1ONQA 5SWSA 5HGAA 3SE4A 4QHKJ 2K1MA 3M1BA 4XNYH 3WN5C 2L4OA 3RPIB 3NN8B 3TA3C 2PTUA 1LK3H 2E5EA 3GBNH 3QXTA 3K1KC 2GI7A 5JHDE 1FRGH 2FBJL 3IGAB 2E27L 3JTSB 4M7ZB 1GAFH 4O02L 3H3PH 3M07A 4MAYD 1CDHA 1XF4A 5ITFA 2GITB 2QSQA 1UM4L 3G6JA 2BY3A 5F89A 1C8PA 1HXMB 4XBEL 3DYOA 5HHPB 5JPNA 1YPZA 3CFJA 4I9WD 4K7PX 3QFDB 4MGXA 4GBXD 4ZS7H 1R3JB 1V3JA 3HMXL 3PQYA 2B0SH 1U3HC 5GGQH 3L5XH 1OWRM 4MD5A 4L5FL 3QXUA 2H2SC 1N7ML 4E41B 3I9GL 1EHLH 4AL8H 4C57C 1TFHA 1CDUA 1T1XB 5F7NC 1JWUB 3MNZA 2LAGB 3HCVB 2BMKA 4U2ZA 4HF5L 1AD0A 1FZKA 1HZHL 4N0UA 5TFSH 1T5XA 4GAGH 5ADPH 2Z8RA 4GMSH 1SYSA 2DTMH 2ARJB 3QUMH 4BZ2L 1DN0A 3OAZK 4KJQD 3GZKA 5DJZB 2IBZX 3FO1A 3B3IA 1S9WB 4HD9A 4N0FB 4OF3A 5BZWA 1I9IL 2JB6B 3DRQA 4GRLD 3VG0L 2VABA 3O4LE 5FDYA 3IRPX 4C4KT 4EN3D 1F11B 1ZLVH 2XQBL 3DX6B 1H8OA 1HKFA 3GSUB 3LQZA 4JDZB 4OD1H 3UPCA 2V7HA 2EDEA 3WXWH 2OP4H 1CT8B 2DQTH 3EGSA 4OCYH 5IK3A 1AGBA 3T4AA 1OQXA 1O7VA 3OZ9H 1CFQB 1A21A 4XCNA 4MXWL 1I1AD 1HQ4A 4PR5A 1TENA 3CFKA 1K3ZA 2OR9H 1A7NL 2EYRB 3TVMB 2V2XB 4LCYB 3BPNC 3VWJA 1NCCH 1MPAL 3VW3L 4HMDA 4NM4H 1PBYA 2CO7B 3DI2B 1UVQB 1C5DA 5EA0L 1RZKH 3LEXA 4JANB 3FB8A 3WLWC 1FYTA 3Q1SH 4KFZC 3GSNA 2FJHA 5T33H 3FMGL 2BNQD 3NCYS 1I9JL 2G2RA 5M94B 1L6XA 3AUVA 2R23A 4Z76B 4U6TA 2GUOB 1WAAF 1X6LA 4NUJA 4Y4FA 3TBYA 5KN5A 2X4TB 4QYOB 4KK8D 3BMVA 1O7SA 2ZSVB 1I4FB 1K8IA 4APQC 3GIVB 4NQCD 1YEIL 3VXTA 1UC6A 1UXWA 3VDCA 5HYIA 5AD0B 5IB4B 5EUOB 3QEGH 4UNTA 1C1EH 1R0AH 5E8NB 3KXFE 4OJFL 4RWHA 3TZVA 4F7MB 1CCZA 3GGWB 4NKDA 1KC5H 7CGTA 4NT6A 5HHOD 3MJ8A 1N3NB 4NN7B 2I25N 1IM3B 5AAMA 2R2CA 1UEMA 3QXWA 1I1RA 2K7PA 3VFSA 3ZDXF 1MCPH 1MCOH 5D2NE 3T3PE 4WI5A 1IC4H 2NZ9C 3ARSA 4I0KA 3CU7A 4WW2B 1ES0B 1ACYH 1G7PA 1QNZH 3CC5B 5DRWB 2VUYA 3SO3C 3S37L 4KRPD 2VE6B 5EOQH 3RIFF 1MCWW 2RBLA 4XNZB 1OSPL 3SE3A 1FORH 4Y5YA 3UTSD 1G7MA 3PL6B 1JV5B 3DIFA 1KTRL 1OAUL 2VC2L 5HY9A 1CBVL 5F7KC 1BD2A 5HPOA 4JFEB 1OAXL 4X5WA 4Y8DC 3WD5H 2VAAA 1NUDA 5K9QG 3C5SA 1U8QB 1FC2D 3VFRA 4FG6C 1I8KA 4P4KD 2B1AL 4L3EA 4FXGA 1JHTA 4P57A 3MV8A 5E2TH 3V0WH 5EPMA 4J1UB 4LKXB 4GKOA 2C26A 3WO4B 5AWNL 2NCMA 1MY7A 4XB8A 1QKZH 4OGYL 4ZDHB 4PV8A 3FQWB 4GW1A 4ODSL 3UPAA 5JIKA 4Y4KA 4G9DB 4HGMA 5F3HA 3CFBB 3QA3B 4KJPD 1D6VH 3GI8H 5KANG 1UYWL 2W9DH 2FGWH 4M00A 3FQRB 1ZLSH 2G60L 3CGTA 3CPLB 3QQ4A 3MODH 4MD4B 1HYRC 4KPHH 2P4AB 4PV9A 2Q7YA 3S88H 3TJEH 1INDL 5F3BA 2MHAA 5DMKB 4WU5B 3DBXA 5E03A 1P53A 3BIBX 1MJJA 3BVNA 3LY6A 3DROA 2HJFB 3ULUH 1KN4H 3V5KA 4XPFH 1VACA 4NFBA 3BWUC 3E3QC 4D0DB 2BNUB 1MAMH 5GPRA 4E41E 1IKFH 5LAXB 2DI9A 1SJEA 4HUUA 4KQ4L 4FP8H 5EO0B 1YC7A 2H6PA 4DGVH 4G8EA 3FO2B 4OZIE 2QHRH 1MEXH 3MBXH 2I5YH 2DBLH 2BVOB 1WZ1L 5I18H 3RKPA 3ZE1E 4NO0A 3FB7A 3MYZA 5J7CC 2ZUXA 1D5ZB 3D39A 1I1YA 2Z4QB 3LD8B 4F33A 4JPWL 5F71A 3GMMB 4YHKH 2EE9A 4B7IA 4RRPA 1XIWC 4P5MA 4GH7B 1IEHA 1D5IL 3WNLA 4S2SB 4Q9BA 5BCAA 4G6AC 4LSUH 1S3KL 4EDXB 5IB3A 4OZHF 4ZYKA 5LG1A 3V79C 1F13A 4I0PC 4NNYB 4IRSA 3GK8L 2FHBA 3G5ZA 3TLRA 2C3GA 4XAWL 1NLBH 4FFVD 4KJWD 4YDKL 4B7LA 1ITCA 5I1EL 1UCBL 3FTGA 2H2PD 4U1LA 4PRNB 1EXUB 1D6EB 5D2NC 4M6AA 4NRZB 3GBMH 5H35B 4Q9QL 3FFCD 3BQUB 4NO3A 4YXLL 3MLWH 1JGVH 1I9RH 2UZXB 3WJJA 4IMLB 1YC8A 2DQIL 3N9GL 4KMTH 1FPTL 3QO0A 5DQJB 3HI5H 2NY3B 4X6CA 1S5HA 2F53B 1ZGLM 5IB2A 4S1SH 3VG9C 4JDVA 5I17B 4M8QA 4HS6B 4QRQA 3ARXA 5F21B 4MMZC 1L7IH 3UO1L 5KSBF 1NCDH 1E4KA 2Q76A 5D1QD 3V52L 3C8HA 4NHCH 2VLLB 3QSKB 4YX2H 1RJLA 4GRWH 1XGRB 2ED8A 2CK0H 2BHZA 4PUBH 2C1OA 3OG4B 1J0IA 5GS0L 2WANA 3SDDA 5ACZA 4LSQL 1MLCA 2GTZB 5EUOE 5F1OB 4KI5D 1CFVL 2HG5B 5DHVA 4MZ2A 3MV11 2IH3A 3IDYC 2HTLC 3S5LA 2NTFA 4Z7VF 2BVUA 1J9CT 3MRQB 3EYVB 1KJ2H 5FUCC 4FS0A 4NZUL 2DJSA 2H3NB 4RZCA 2QJDA 3GM8A 2YD6A 1CTNA 43C9A 4LLYB 4NHUA 1IARB 1UWEL 1YEKH 3T0VA 1AKJD 2FWOA 1BX2B 4MJID 5GISH 5TGBB 5GJSH 2I24N 3RX5A 3IAQA 1EO8H 4FQHB 2DQFB 4XCFL 2BY0A 5I1AA 4LLDA 2X40A 4PJ5D 3W9EB 4NQSB 4U3CA 4Q0XL 4QGTA 4DN3L 5CEZD 3O8XC 4LPCA 3VFOA 1TJGL 3FN0H 1ZS8B 2ZUQB 3OGCB 1U95B 1Q94A 2GFBA 3WUWA 2Q6WB 3FZUD 3V7AG 4Z77A 3GDBA 4XBEH 4OZ4A 5TE4L 5CWSB 3A67L 4Q2ZA 1BOGB 4IS6A 1WWCA 1LDPH 5DUBB 1JI2A 1P9MC 1QQDA 5CSGA 2GJ6A 3SKMB 4KTYA 4E9LA 1T83A 3I9GH 4KROB 4NQXA 4PBVC 5L7XH 1QFUL 5ESVA 4R2GC 3B2VH 2J5LB 2AQ2A 1HXYB 3BX7C 4HF5H 4IOIA 1RHHA 2GTWA 2IMMA 2VRAA 3VFUB 1EMTL 4LASL 4OQTL 3QUZC 2AABL 2GAZB 2AV1B 4BZ2H 2M2DA 1IFHL 1Z6JT 3MMEB 3RGVA 2O26U 1I9IH 4HKZB 2CGRL 4OZFG 3VG0H 4OFYA 3ILQC 3ARDB 3RY6A 3KJ4C 2XQBH 3ZKND 1UJ3B 1CICB 4JEGB 4LP4A 2CLZB 3CCHA 3HNTL 1XCTB 1FL3B 1RUML 1BQHA 3EYQC 3MGOB 5ADOL 3DTXA 1S7TA 3T0ED 2P8LB 4W81A 2IPUK 4R7DB 2JF1A 1W2KT 4MXWH 2NY6C 3ARYA 5DFVD 2VITB 1KEGH 1AI1H 4OZIA 1C12B 4N8VA 1SVCP 2J2ZA 4EI6A 4DOHB 1CD1A 1HI6B 2VO5A 3JWOC 2DKMA 3JVGA 3IDGB 4PGEA 4E42B 1FO0A 3SBWC 3WFHB 4CMHB 1B9ZA 4KV5E 3QEHA 5DFTA 1LO2L 2DWDB 5J1SC 2C3HA 1G6VK 3KDMB 5EO9B 5IEKA 3FMGH 5D72L 3W9DA 1JNLH 4LPUA 4U1IA 1B4RA 1LEKA 1MHEA 4G9FD 4WW2C 3QUMA 1DUYA 4Y16C 2O5XL 4FQXC 2APTA 1M71B 4GXVL 2EDKA 5C3LD 1PX3A 4QRRE 1MELA 1I8MB 3R0MA 3MRNA 1YY9D 4GOSA 1WTGT 7FABL 1MCRA 1MJ8L 2AP2A 1JGDA 4Z18A 2NXYD 3AAZA 4YHZH 1IE5A 4OJFH 1JYXA 4L4TB 1TQCB 1GOFA 5C8JB 2LQRA 1EEZB 3BESR 5EIVA 3F12A 3TF7C 4PY7B 3PJSA 3STLA 1XZ0B 2OZ4A 3VWKA 4KVCH 3NH7L 4YDLC 4JZNB 5T1LA 1RAMA 1KFAL 3REVB 3WO4C 5IFHH 3IJYB 5CSZB 1MVFA 3OAUL 3OKDA 1KB5L 4L9DA 1C08B 3MRGB 3U7WL 4F15C 3D3VB 2NY4D 3S37H 2CPCA 3B83A 3RVUD 1RIHL 1BBDL 1OSPH 4XI5C 4JHBA 5A3ID 3L3DA 1ND0B 1CBVH 1A1NB 3RWIA 2G75B 3FCTB 3L7EA 3W11D 1MHPL 1OAXH 2PYEB 4I4WA 4Y88A 1YY8A 4JB9L 4PY8J 5D2LE 4LCUB 5KVEL 1QBAA 5IHUL 3TFKD 1OP5K 3S4SB 4M7LH 4FFZL 3PWPE 2B1AH 4R9HA 5TDPB 3VXUB 4U2YA 4CMMA 3BW9A 4RBPK 1IT9H 2EE3A 4LFHG 4KMLB 5C7XL 4Y2DB 1QFWI 2EXYD 3MV7A 5AWNH 4OZGB 1A6AB 3ARFD 5C0BD 3RVWC 1DVFA 1P5UA 4KHXH 3BZDA 4OLUL 2DIAA 5D7JA 1IAKB 1UYWH 3T08A 2I07A 4WUKL 2BVQA 2CXGA 4NGHL 5HDBF 3CIQA 3OKYA 1INDH 2BP3A 4MAUH 4UTBH 4JFDA 4MA3A 3DX9A 4S1DD 1JPFA 2X4OA 2ZOKA 4K2UH 4ODHL 3BHBB 5DFWH 3BFOA 3TJHC 1JMXA 1JGLH 3NPSB 3HN3A 3SE9L 2ZUVA 2L7UA 1G0XA 5IFAH 1CI5A 3R8BB 4YUEL 1WZ1H 1UADC 1UFUA 3PWNB 3BQUC 4U05A 5CZXD 1S7VB 2IALA 4JFXB 4ZO8A 5MP6L 2F58H 3FFDA 2JJSC 1QSFA 3BP6B 4OGXH 1Q8MA 1UCTA 3GMNA 3H42H 4JO3L 3M1BB 4KTDL 1D5IH 2EXWC 2XKNB 1CR9L 3ILPB 2W0KA 3V5HA 3P40A 1FLTX 2NR6D 5EU6D 1S3KH 5C0AB 4HUXA 5FGBA 3S3JA 1X5AA 2YXFA 4IJ3B 1RZGB 4OTXL 5E6IC 4HUWB 2XQYK 2A83B 3PHOA 5FUZL 2C3VA 3GK8H 4MNQB 1I1FB 2VXVL 5ITFB 5E7FA 5SV3A 4TUJB 4H1LB 4LHUA 1LO3L 2WLZA 4XAWH 4Z7NF 4GW4A 2VYRE 4PBXA 3G5YB 3DOSA 2IQ9L 1UCBH 3AY4C 2AK4D 5K9JH 3PQYB 2J7LA 2VLRA 3T1FA 4AEEA 4DOHE 3T65B 4YXLH 1MUJA 1PKOA 4TNVF 3LKQA 3IB4A 4G43A 4P2QD 4NKOB 1GL4B 2ZSWA 1RJCA 5FO7A 1FPTH 3B8YA 1A1OA 2BVYA 3DMMD 3TBVA 4R26L 3TNNB 5IMMA 3LS5L 4XC3L 1AFVH 1KJ3H 1NGYA 3K0WA 3V0VB 4CGTA 3GIZL 2R9HD 3RX7A 3UO1H 2IAND 5C09B 5JMOC 4LSPH 3FT3B 1NDGB 2BY1A 3U9PL 1NLDL 3V52H 4AEHL 3STZA 3FO1B 4M7KL 4JRXE 3RTQA 3DRQB 1V8HA 4XZUA 5GS0H 3HUJB 4LSQH 4M03A 3PG2A 5IT2L 3QQ9C 5FA4B 4PJCF 4X7DC 1DQJA 1CFVH 1FFQA 1PJ9A 3LQZB 3FONB 5FYLH 5DMGC 5FYKH 2ZUQC 3QRGH 4GUPA 1AGBB 1UB6A 4ONHB 3T4AB 3Q48A 4E0RB 3G6AB 4HZLA 3K3QA 4JR9H 3T0DA 1KSRA 4TVPE 1X5XA 4MCZA 4Z78B 1N26A 3VWJB 2YC1A 3GKWH 4HXAL 2AJYL 1UWEH 5FO9B 4IOSD 5IM7A 1LEIB 3D3VE 1T04B 1C5DB 1ETZA 3OF6D 5AG9A 2GCYA 2OL3B 5FYJD 3CX5K 4EUPG 4N5EC 3DWTA 1Y6NR 2AJVH 3LN5B 3QJFB 1CD8A 4XCFH 4XPHL 1EGJH 3QRFM 3FO9B 4Y5VA 2FLBT 32C2A 4JGUA 1R3LA 4ELMA 2PYEE 2BXZA 3FQNA 4Q0XH 3TGXA 4DN3H 3VJ6A 1MIEL 2IPUG 1MLBB 1QUNA 1ZHNB 1C16A 2YZ8A 4HCRH 5CSBA 3D2UB 4HKJA 2E8YA 3MRLB 5F7HA 4I3SL 8CGTA 4NZTH 4OZGE 1UJ3C 2DI7A 1MNUL 3NAAL 1XR9B 1NAMA 1BOYA 1KJ2A 3AREB 3PWPA 4R97B 3RL1A 5KJRL 1RI8A 4AMKH 4YPGB 5DI8A 1QFUH 4MDJA 3LKSA 4OD2A 5HYJA 1F3JB 4H25A 4OV6F 5TQ2L 3RKDC 4NP4L 5SWQB 5ISZA 3PP4L 4NBYB 3MRIB 4LASH 1YEEL 3EJJX 1F00I 1XF3B 3O0RH 4HIIB 4AG4L 2AABH 1V3MA 3MRJB 4YNYB 5CAYB 1RUAH 2IEPA 3B9KD 4CMHC 4PJGF 2ERJB 4WTZA 1IFHH 2IC2A 2FO1A 3TH4T 3JXAA 1S9YA 4AH2B 5KW9L 4MQ7A 3CX5J 2CGRH 1TJIL 5CJXA 4P23D 1JPGA 3T0XA 4POYA 1JF1A 4U6VL 3U1SL 2VDKH 4KQ3H 5IVOA 1RUMH 5ADOH 2YD8A 1J0JA 4XAKE 3SCMC 5DEFA 3IYLW 3EOBA 3NMEA 1WCBB 1EEQA 4PV8B 1CWVA 2WQRA 1QR1A 5C0AE 1N0XH 3RX8A 4MJ5B 2NY1D 4Y4KB 5HHMD 3KYOA 1NEZG 3HE7C 2XZCL 3H9HB 3WXVL 4MNQE 3DI3B 1KJMA 4OFKA 4QRPD 3L3OA 4P59L 5ALCH 4HMCA 4DZ8A 4DUXA 4IRZL 2MMXA 4MX7A 1T7VA 1YN6A 4WDIB 3A0OA 3TNMB 3PIQB 1U8PB 2MHAB 3C5JA 4ZSOA 1IAOA 1RULH 3VXRE 4J3WA 1MJJB 4MNGA 5D72H 1ZVSA 5IBTH 2A9ML 1VACB 4HPYL 1RFDL 4LK4A 1CG9A 5DYOB 2CH8A 3EDEA 5HTSA 3RDTD 3QDJB 3UJTL 5T1DL 5BJTB 1SJEB 3UYRL 4GXVH 3GM0A 5JUEL 3RHWF 3QULB 4NQEA 2FBOJ 4HT1H 1CXIA 3HZMA 1MJ8H 2ZUYA 2F74A 1H0DA 3KR3H 2E6JA 2R4SL 4JVUA 3LB6C 5C09E 5IIEB 2VR5A 1VEPA 2ESVB 2NXZC 4WRLA 3AS1A 2ZUTA 2F54B 1A7BA 1A3LL 5CMAA 2CJUL 5IW1B 2ZPKL 3WIFB 4N9GB 2MQCA 3NH7H 1G6RL 2DQUH 3RQ3A 2DLHA 4RAUA 4Y2DC 1KFAH 2H2SD 3T2PA 3C8KA 4QOKB 2VSCA 4LEXL 2A1WL 3OB8A 1IGTB 4ZYKB 5C08B 2WBKA 1KB5H 3SY0A 3LV3A 5GS3A 2CDGB 3I6KA 2CRIA 1JZ3A 3S35L 4K8RC 3CZJA 4NJAL 4Q74A 1KCLA 3MBEB 3ZSTA 4C56D 4IIQB 1RIHH 1CN4A 2MJWA 5DSCA 1BBDH 1IQDB 3U48A 4PJ9B 3BPCB 2HVKB 1WICA 3VGBA 1R3IL 2XV6B 5DJ0B 4U7SA 4U6XB 5JORB 4PJFB 5DGRA 5KVEH 4XXCA 5IHUH 3QZWG 2R0ZH 1V05A 2OXHA 1S5HB 1CF8L 2VERN 3CXDL 5D1ZA 3NPSC 3TEUA 2KZWA 4JDVB 5DJDA 3VFPA 2XQYG 5C7XH 1OTUC 3V6FB 5T5FL 4WHCA 4P2RE 3NCMA 4PJEA 2MKWA 2DQGL 3VXPA 3BWAA 3FT2A 2Z93B 1DBML 5IMKA 3VI3F 4J2XA 4ONFH 1MFNA 4U4BA 2BOCB 5ETUA 4ZFZA 4NWTH 3SE4C 3I3BA 5ACZB 4F2MA 5EZIH 3HG1A 3UTQB 1T21A 4WUKH 3AXLA 4NM8L 4NGHH 1K5NB 1S78C 4H26A 4MD0B 3LQMA 4CN1A 1ZHKB 1YEGL 2Q87A 1YEHH 1OCWL 2H26B 5DK0A 1OAYL 4D0CA 2QLVB 1T3FA 2ZG2A 5A16B 3JUYA 4OCSL 1ZLUK 5I1CH 1AP2A 4ODHH 4BJLA 4OT1L 3TPUB 1YYLL 1IRAY 1FV1A 1MHHA 4Z7UA 3EYSL 3RVVD 43C9B 4JY5L 4NHUB 3N1FC 1KLFA 5EBWA 3VA2C 1P7HL 4I48B 5A2KH 4ZOAA 3KAAA 1VCAA 5E2UL 1EK3A 5TE6H 3RP1A 4PJHF 4APQD 5C9JA 3MUZ1 4G8IA 3NA9L 3MROA 3E6FB 1MRDL 4UOJA 1MCJA 3KPLA 1JHKL 5E5UB 2FCBA 5EDXA 2UY7A 3HE6A 5JHDD 2ICWB 4KTDH 5EWIL 1OW0C 1T2QL 4Z5RB 1FDLH 3BP4A 4XVTH 3HLAB 3P9MB 5HD8D 2D7TL 2HT4D 2NY2C 1GZPB 5C0RH 2YBRA 1E27B 5MI0C 3EYUL 3TO4D 3EJYC 5K9KB 4KKBD 1QA9B 3MRDA 4OTXH 3QNYA 1N6VA 4G6MH 5I8KH 2NPLX 3CDGA 3BAEH 2B4CL 2IPKA 5FUZH 4UIMB 5FOBB 2EC9T 2R69L 1JPSL 5DZNA 4Z77B 1LO3H 5FIEA 5DURD 3QIBB 4OZ4B 4DEPB 1N8ZB 2IQ9H 5FOJA 3RI5K 4HJ0C 4KRLB 1OT2A 4WO4A 4IBLT 4LQ1A 1ZHLB 1TLKA 3DJ9A 2NY0B 5JOFB 3MRFA 3E1F1 3ULVE 2J8UB 2H8PB 4Z0XA 1HILA 4WFHE 2X4PB 5ESVB 3U0PB 1B0GA 2OI9B 5H37G 2R1WB 3BRGC 1TCRA 4KDWA 3MA7B 3GB7B 4R26H 4IOIB 3VWJC 1UKSA 1AHWB 4XC3H 4WNQA 1H3VA 3DVGA 3UROR 3QDJE 2Q3ZA 3ZHLA 3HZYB 3NFPB 1IGFL 2AXJA 3O4LD 3U9PH 1NLDH 1FNEB 2QEJA 2DDQL 4M7KH 4PJBF 5F1NA 3SKJL 2D4FA 2NNAB 1BP3B 2P24B 1MQ8A 2LTQB 1T0MA 4YDVA 2WV3A 4ODWA 2GT9B 4WHTB 1L4IA 3Q6FA 3QQ3A 1KIPA 4ZPTB 3S36H 1BMGA 2ESVE 4Y4FC 4A6YL 4PJAF 1H3GA 2X70B 4HFWA 5J57B 3TBSB 1FZOB 3IFPB 3PGFH 5HYSA 3L3JB 1U8KA 4JCMA 5J11C 3KWWB 5DF0A 3VFWA 4YFLF 2Z31D 4Y2OA 4F58L 4CRPA 4ZUWB 1CGSH 5C08E 5ICZB 4HXAH 4GT7A 5F1SA 3T3ME 2VL5B 3MYJB 1KN2L 4ZG1A 3AREC 3SDXE 4R97C 4OLEA 4ZFGL 4XPHH 3QEHB 4JM4L 5DVNA 2QKIA 5IEKB 1S7SA 4NO2A 5HI5C 3ZDZE 5DC4B 3OJ2C 4RMSA 4PJFE 1XIWD 1NFDB 1MIEH 2CR6A 5JIHA 4GG8A 2IFFH 3HS0A 1T0PB 2WMPA 2NY7L 4DN4H 3SE3C 1NC2A 1D5MB 1UZ8B 3EDJA 3LN4A 1UH2A 1ZT4A 4RIRB 3KXFD 3LEVL 2ERJC 2JJWA 1GC1C 4Y5YC 5EU3B 4F8TA 3BOVA 3H7BB 1HYSD 3PNWA 1P6FA 5KS9B 4OI7A 5FCUL 3IDNB 5BZDB 4FZEL 3TC9A 1MI5A 5I1JH 2VDQL 2APFA 5HYQA 2A6KB 4HLZH 4X8JB 1J1XH 1WZKA 5IMLA 3EJZC 3N1MC 1X44A 2OR8A 5E8EA 1DSFL 3HAEH 4L1HA 5GGVY 4JY4B 5TQ2H 4Y4KC 3RZCA 5DMYA 3PP4H 4CDHA 1YEEH 4QHUA 1EGJA 3MRKA 5D1XB 1HINH 3QPXL 3AC0A 3G6DL 5F7MC 1NBQA 3D25A 5BS0B 3VXOA 4C55A 2YPVL 3EDFA 1F4WH 5KW9H 1TJIH 4UAOC 4BFEA 1YY8B 3RL2B 3FB5A 4HCRA 5T1KA 2X9XA 2FB4L 4U6VH 3O9WB 4YHOL 4AEIL 4CN4A 2FZ3B 5MEQA 3FRPG 4CVXA 4O5LL 1KACB 2C4XA 1AGFB 3OAYH 4G5ZL 3DV4A 1FFRA 1M6OA 1NBVL 3WIHL 1NL0H 4KAQL 2IBGA 1SJHB 3MLVL 1AGEA 5DJYA 3UPRA 2DIBA 1IC5H 4I5BB 5FB8A 5GGSA 5F6IB 2XZCH 3WXVH 2Y06L 4P59H 3HB3D 1TZGL 4J3OC 4TSBL 3RJQB 2OS7A 2O5ZL 4EZMA 1U8IA 3O45B 4G8GA 5DTFA 2APXA 3RNKA 4HMEA 3BN9C 3HPLB 2AXFA 4YWGL 4E41D 5CLWA 1FG2B 1NMBL 1JPFB 1OAZH 2DYPB 2A9MH 4KJYB 4HPYH 1RFDH 2BOBA 4IRSC 3T2OA 5F7FA 1I7TB 2J8UE 3MBEC 3BPOC 2YMXL 2YD7A 2MWCA 4JPIA 4DQOL 1JNHA 3VXMB 3RWDA 4B41A 4Z7WA 1D5BB 3WJJC 4AY0A 5E1AB 4F7CA 2Y07L 2FDBP 5DXWA 3WNNA 1YEDB 1N6UA 1GVIA 2O61B 2R2HB 4TNWK 2IFGA 3DXAE 4LF3B 1D3CA 2HJLA 4Z0BH 5TH2A 4FFYL 4R3SA 1RVFL 1TMCB 5D5MA 1NKOA 3DUUA 3GMRB 4LEXH 5E4EC 2A1WH 2FR4A 3F7QA 2AVGA 1QRNA 4M93B 5JQ6H 3GHEH 3TVMD 3S35H 2EDWA 1P7KA 3SDDC 3BUYB 2DBJA 3VRLF 3LS4L 3GMLA 1M05A 3BGMA 2ICWI 5J6HB 4HLJA 2ZG3A 4MHHG 1R3IH 3MGTB 4ZS6D 3VRIA 3FOMB 2E6QA 4UU9B 2NW3A 2QL1A 1LE9B 5GRZA 5JNYA 2GYSA 4TRPL 3DECA 5C2BL 3CXDH 3MNVA 1U6AL 4OSUL 4P5TB 3ZT5A 3FOLA 4BKLB 1F5WA 1MWAB 1H5BB 4PJ8B 3RIAK 1YNTB 3HI1B 3ETBF 5B39B 1MCKA 4PJDF 5T5FH 2P46B 1A6TB 1NFDE 5J6GA 5EFIA 2IPTH 5EU7E 2WIIA 1XCQA 3G5XA 1S7WA 3SDXA 2IQAA 2VDRL 4A2LA 4AIZB 2QSCL 5KS9E 1IILE 4NM8H 5IJVA 1LK2A 5C0CB 1TDQA 4JFFB 1IC7L 4RGNE 1KB5A 5GGUA 5IHLB 2F5AL 4UDTB 5TDNB 1YEGH 2DWEA 1OCWH 3OPZH 3N85L 4OCSH 4OGAC 5FGCB 4OZFH 3HNVL 1SVZA 1YYLH 3GFUA 4P2CG 4S1RL 4O00A 4DEPC 4JY5H 3FQTA 5D7JD 3V6OA 1U8MA 4XMPL 1AD9B 1CE1L 1EA9C 1YUHB 3PL6D 2GCYB 4WU7A 4PP1C 4WW2F 4JFED 2HTKD 2L0DA 5F7YC 1JHKH 1OD7A 3DVFA 3G5VB 3VGAC 2M1KA 4MA8L 2OI9C 5IB5A 4N8CL 5BS0E 5I30L 3MLSL 3RVXC 5K59E 1T2QH 3SKUD 3FQNB 5K9OA 5I8EB 3GSWA 1A02N 2D7TH 2A6IB 5C0JB 1KF9B 3NCYP 4GRWB 2IH1A 1R3HA 5EU5A 4D9RE 3O6FA 2X09A 2B4CH 3QPQC 4LAJH 3X3GL 1FNHA 4WI2A 2R69H 3ABZA 1T7YA 1JPSH 2PXYA 2LTQC 3S3SA 5B3JE 4X4YA 3RY6C 1X4ZA 1A7RL 1YMME 1HHGB 2DJUA 4JKWA 4TSAH 5C0ND 5I73B 4MCYB 1IAMA 1KBGH 4JJ5B 4HWEL 1P84K 1R5WA 3QNXA 1PEWA 1S7UA 4GAJL 1I3RA 2DIJA 3NFNB 4KKNA 4ZPVB 4OFPA 2ATKB 5DJ2A 2W59A 4X4XA 2WQ8A 4LHUD 1K85A 4QWWC 1SMAA 1T5WB 4PGBA 3ARBA 3JVGC 4JDTL 3MFFA 2C9AA 3VXSA 5L8LB 2UUDK 3DX8B 5GZND 1TVBA 2FH8A 5D71L 3SKJH 1WBYB 3VXME 2ATPB 4YE4L 3I3EA 4MQ7B 1T1YA 3RVWD 1N64H 1R5IB 5AYUL 3QIWA 1XF5A 5D7SL 2JCCE 3VXQB 1A9BB 3ARRA 1RZJH 1WT5A 5F96L 5D93C 1MQKH 4G3YL 1JGUL 5D70H 2Z8VC 5JDJA 4XC1L 1CDJA 3LEYL 2C1PB 1QP1A 3T2NH 3EYFA 4JG0H 1EERB 1W0WB 4U1JA 4F58H 3IDMA 4X5XA 2EO9A 4YHIA 3STBA 4XPGL 3PF2A 4Q6IA 3HTLX 2ICWJ 4BA8A 3WJLA 4C83B 1KN2H 3ARTA 5CLTA 2M8XA 1Q9LA 3VWKC 2EDQA 4ZUUA 3TYFA 3BQUD 3V5DB 4ZFGH 4R90L 4JM4H 2OTWB 4R6UA 3DXAA 2V5SA 2BCKB 3PV6B 3THML 1P84J 4Z95L 1LGVA 2NY3D 2PN5A 1RZKC 5AAWA 2P5EB 4QRRD 1CG9B 3SKNB 3JUZA 1I85A 2DLEA 2VLKA 4LRNH 3TBWB 1X4XA 5JIPA 1OPGL 4YQXH 2EO1A 3GUTB 3LEVH 1B0RB 1JZ7A 4CVZA 4X6BA 2XZZA 4OKVA 2BJML 1RUPH 5I75C 4FZEH 4HK3J 4JZJB 3X11A 5LVEA 3R06A 1L7TH 1ZSDB 2Z91A 3O9WC 4YFDB 1NGZA 3QUKA 3WDHA 3PE9A 1SEBA 3SDAB 4QRTB 3OKOA 3H9SA 1AXTL 2CXKA 4L8DA 1T4KA 1S7QA 3BYTA 1DSFH 3D9AL 3C8KB 4JFFE 3RZWA 3AU1A 5ERWB 5DD6A 4D8PB 4PRBA 3SDCB 1DVFC 3UX9B 3D18A 4M1CD 4TQEL 5F6IC 1DFBL 3BEVA 1IL1A 3RWFB 3PDOA 3HC3H 5K93A 1DQDH 1J11A 3QPXH 5DSCB 2YD4A 1NSNL 4IEFB 4ODTH 5DD5L 2KL6A 1TETH 5GS1A 5C07B 4P46A 2PR4L 5E8DL 4JFZL 4XRCB 4M43L 5DLMH 3QIUB 4F7TB 1T0NA 3OX8A 3HZVA 1KPUB 2F19H 2HN7A 1UACL 5C86A 1KIRB 3N06B 3BH9A 4XHJD 4RAVB 2X41A 3C6SB 3WIHH 4PJEB 3R1GL 4GG6A 4RRPG 1P69B 1E4WL 5JLZB 1IAIL 3MLVH 2CK2A 4OAWA 3UC0H 2ICCA 5HPMB 2MOVA 3GSXA 5T1MB 5C0GA 2YXMA 2Y06H 4X9BA 3HG1B 4J6RL 2V17L 1T21B 1TZGH 5IOPA 4TSBH 4TUKL 3HAEA 2O5ZH 4F7EB 3D0VB 4KK6D 1UZ6F 4P3CL 5FGBC 4YWGH 3TN0A 4YAQA 3IF1A 1CXFA 2P8MB 4KROD 2FX7L 3RVTC 1HCVA 1T3FB 5JW4M 3QDMA 2X2YA 1QSZA 4M93C 1MIMH 3LH2H 5EBGA 3ZYJA 1AR2A 3W2DH 5KSVA 3I6GB 3C2AL 2D03H 5IG7B 3QHTC 1WQVT 4LCCB 5EBWB 3D69A 5IEHB 3CVIH 2J3SA 2YOCA 3CFDA 3MZTA 5T3XE 4CBPA 4HUVB 2MCPL 1ZGLA 3MROB 3KPLB 2Y07H 3ARDD 4X6FA 3UYOD 4ERSL 3IAPA 1DQLL 4AENA 4QHLB 1CICD 2CRMA 4P5TC 5HHQB 5J1AB 1JWMA 1ZT1A 2VWEC 5DUML 3KPRE 1H5BC 1DQQA 4FFYH 4PJ8C 3KNBA 2FGZA 3RWHB 1HDMB 3MV9B 2D31A 4P5KB 3MRDB 5ACLA 1E28A 1W72L 3QNYB 1AXIB 4R8WL 2R15A 4PGDA 1AXSA 1R24B 2BFVL 3BZ4B 3MACL 3RTQC 1P2CB 1BIIA 4XPBH 3S5LG 4QCIB 1A7PH 3MRPB 1GGBH 1INQA 2JELL 3VGEA 2XA8H 2X7LB 5DDHA 2FEEI 5HHVL 2OQJB 2EC8A 1CDCA 1H3UA 2FECI 1YYML 2UYLA 3VRJB 2JCCA 1RUKL 3L3HA 5BXFB 1A4KA 5TE7L 5KSAA 4R4NC 5C2BH 2R56H 5IUSA 1NBYA 2YPLA 2CKBH 2NLJB 4OB5H 4OSUH 1EFXA 3L3IB 4JFPB 1U8JA 3QB7C 2D7MA 4JRXD 2PO6D 3VE0A 4EEEA 2FIKB 2VZVA 3SKOA 3CDFA 2R39A 3MUGA 3QDGA 2D7QA 4L4TD 4YDVB 2NY5L 1QVOA 3CVHH 1NDMA 3VI4F 5IVZA 1F8TL 3X12A 1IC7H 3WUWG 2ADJB 2BSTA 1G1CA 3QFJA 4PTTA 1FVEB 5E2WL 4M5YL 4WW1B 5L8JB 1ORQB 1NCWH 4TVPD 4RNRA 4PRPA 1E4XI 1KJVB 1LDSA 3U7AA 1MJ7H 3QWRD 3HNVH 3RNQB 3D3VD 4OZHB 4AJ0A 3DUHA 5IB1B 3LKRB 5J13C 3MXWL 5IQ7L 4TTDC 5M7QA 2FEDC 1T22A 5L2KA 3GJFA 4NBXB 3HR5B 4PB0H 3N50A 5LQBL 1PQZA 2PYED 3MRMA