2P4AB

X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with rnase a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
b'QVQLVESGGGLVQAGGSLRLSCAASGYPWTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGDALVATRYGRWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease pancreatic
publication title Exploring the capacity of minimalist protein interfaces: interface energetics and affinity maturation to picomolar KD of a single-domain antibody with a flat paratope.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 33
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p4aB00
5KSBB 4X6BB 3D69B 5E8DH 4XX1E 3RI5F 1FDLL 2DKUA 4X4XA 1UGNA 3VH8G 4G6KH 2IFFH 1IKFL 4N5UA 3GHEL 3PWPA 4OLZL 3FQTA 3S37X 4R2GD 2ARWA 4QF1B 3VH8B 2F58L 1OF2B 2I24N 1D9KB 1G9NC 3G5ZA 3I02A 2IBZX 3MJ8A 1S9WA 3B83A 4UT7L 5I73C 3PWVB 3D18A 4TTGA 2AKRA 4L3CB 5FV1L 1YMME 3GO1H 2RCSL 3BGMA 3PL6D 1Q9WA 3KDMB 3LZFL 4NO0B 1ZLWK 4KJPD 3SKNA 1MI5D 5CEXB 2HVJA 1BF2A 2OBGA 2IADA 3HKFA 1W72B 2IH3B 1NCUA 3IU4H 1ZT7A 4TPRL 1AC0A 4XT1C 1NMBL 2OM5A 5LQBH 3KWWB 4BH7B 3CK0H 5DEFB 5TQ0L 3KJ6L 2EDEA 1ULVA 4LMQI 4Y0GA 1Q38A 2LU7A 1CVSC 5FGCE 1P4LB 4ZAKC 1AI1L 1A02N 2YC1A 4Y1AD 4BH8B 1RZFH 4TYUA 1QVOA 2KZWA 2FO4A 1FNEA 2LVEA 4HWEL 4KFZC 1YQVH 2FEDC 1UVQA 3EAKA 1T2JA 4NCDA 3GDBA 2PYED 1JGDB 5B3JE 4PJHA 1ZT4A 3W82A 3QIWC 4H8WC 5D1QA 3VD7A 3KPRB 2A0LC 4HC1H 1IM9D 4WHYG 3BGFC 5CEZL 4WI9A 5KSAC 1KTRL 4G6FB 4K7PH 1KN4L 4LHUA 1ONQA 4I9WE 3ZKMD 5A2LH 1YA5A 1BOYA 2VLJE 3EJZD 5C6PB 5ITFA 3ET9F 4BZ2H 4YDVA 3EDFA 2VDRH 1N0XL 4YHNB 1XGYL 4R0LB 5E00B 5BVPH 4RFNC 3KLAB 3WFBL 3G5XA 3D9AH 3U6RA 4KUZH 1W2KT 2QHLA 3NMEA 5CKGA 4F58L 3EYUH 2QQQA 3V6OE 3CLFH 4O5LH 2F15A 5JPMB 5E2WH 1SBSL 1AJ7L 2Y25A 1CK0H 2AABH 2FH8A 3LEYL 3O4LA 4FG6D 3UTPD 5DZLA 4UB0H 5I1JL 1JBJA 3BZ4B 1AQKL 3WBDA 2K7PA 4EDXB 4K94L 1QNZL 5E94A 4PB0H 3EO1B 4ZO7A 3RY6A 3FQXA 2DQFA 3KYKH 4OBRA 4NP4H 5D2LE 1X5KA 2MKLC 1TJHH 1F4YH 5L2KB 2X4NA 5SX4H 4U1MA 1I9RH 4N0FA 1V3JA 1F11B 5T3ZH 3WYRA 1ODAA 2ZOLB 2WBKA 4YAQA 5DI8B 1RIUL 3B9VA 1ETZB 1YEFH 2A6JA 1KYOJ 2AJYH 3V95A 3QNYB 3BP7B 2FEEL 3O3AB 4DTGH 3UYRH 2VL5A 5D6DA 4MXWH 1SY6H 1LO0L 4KV5E 1RIHH 1KCVL 1DUZB 2EE2A 5I1HH 4JQVC 2C1PB 5ECJE 3PHOA 3VI3F 3RZCC 2ORBH 5DF0A 1BBDL 3PV6A 4ZS7L 1QEWA 5I1LB 2D9CA 4FXLA 1QFWL 1MWAH 3CFKB 3GHBH 1U3JA 1LE5B 4PRAA 4G8FA 1JUFB 2E3VA 4PS4H 4S2SA 4NPYB 4KDTA 4U33A 1Y0LA 1T5WB 1FYTB 2AGJH 4ONFH 5GISL 5KOMC 1Z9MA 4HS6B 5D70H 1KC5L 1DQML 4F7MB 2F54D 3GBLA 1WFOA 4PRDA 1UZ6F 4NQXB 2YZ8A 4PLNC 1OAXH 1C5CH 3BDXA 3B9DA 2AJSH 4JZNA 1C12B 3LQAL 5BO1H 5I73B 4C4KT 2CXGA 2Z35A 5AG9A 3EOYG 5DD6B 7FABH 2FATH 3L3OA 1U8MA 4NKIL 1FO0A 4UOW0 3VFPA 5HVFB 4YBLC 1P7QB 5IB1A 2W07A 1TENA 4WUUD 3GI8H 5BRZE 3PGDB 5ACZA 1NQBA 4PRHB 1MIML 1DLHA 4M7JH 1NCDL 1FNGB 5SWZD 5L8JB 4RRPG 5D93B 3HC0A 5D1ZB 3FRPA 4NQED 3VRLF 5JORB 3M17A 4KJPC 2NY7L 1B4JH 4QRRB 2VXUL 3B6SB 4QHMA 1OW0C 1EZVX 3G6AA 2FNBA 4QWWD 4RZCA 1NBYB 3I6GA 4WFFD 1F00I 4LLMA 1ZV5A 2J1KA 1AH1A 1UADC 1MF2H 1IMHC 4KVNH 1CLZL 3QIBD 3L7EA 4Z9KB 4LHQB 4D9RE 3MLYH 5D2NA 5I1DA 3WE6B 2Q8BH 3EDEA 1F4HA 1R5IA 1RUPL 4P46A 5GS2H 1DUYA 5HYIA 2FWOA 2VLKE 3DRTA 5M95B 4E41D 5DR5H 8FABA 3B9EA 1KB5A 4QHLB 4P3CH 4OKVA 5E8EB 3S88H 3ZT5A 3QIWB 3B3IA 3V7AE 1VCAA 4WVRA 1X5JA 2A6KA 4ZUSB 3O41B 4PTTB 5DWUH 4F9PA 3W5NA 5HI3D 1JRHH 5E9DA 4DN3L 5ILTL 2VXSH 5TE4H 4OLXL 4JHAL 1N3NA 3TA3D 3KR3L 4KTDH 3UJIL 1J12A 1BJ8A 3ILQC 1LGVA 4EN3B 2R0ZH 1AGCA 4RFNB 5DJ8A 4O2EB 2C7UA 1MLBA 4KVCH 1NAMB 4NNPH 5B8CC 2GFBA 2BNRE 4MNQA 4RDQG 4PP1C 1KJ2L 1BEYH 3REVB 3DV4A 5CJQH 1NKOA 1HINH 2A9ML 2LQRA 4V1DA 3QNZA 4NM4H 5DQDH 3AC0A 1T89C 4PJGB 4H5SA 3QDGA 1I8MB 5SWQA 1MEXH 1IGML 4P2RB 1JGEA 2XWBA 1UXWB 1PAMA 4FHBD 3WXVL 4F57H 5IKCB 2D7MA 5C7XL 1DE4B 4LPXA 4J2XA 4PLJD 2IH1B 1D5MB 2PW1A 4OI8A 3QH3A 3CDGA 4KQ4H 5GRVK 3MRIA 4RWYH 2IWGA 2ZP0T 4NZTL 1HYSD 3L3HB 3U36B 3OWEA 3UJTL 3PGFL 3QXWA 5JHLL 3PF2A 2QKIA 4XAWH 3GGWB 1A7PL 1UJ3A 3P0YL 1L6XA 5BJTA 4KKBC 1T03H 5IGXL 5CP3A 4DKDC 4LCWB 3C87A 1BHGA 5FA3B 3ARYA 4E0RB 3O0RL 4I48A 4UT6L 3QXVA 1JWSB 3FFCD 2A77H 3GJEA 3KXFB 4F7CB 1DN0B 4YHLL 3PQYB 5D1XA 3EJJX 1GCFA 3AFLA 2IGFL 1I3RB 4Y4HA 4NQVB 1CFSB 3UTSB 1D5ZB 5TQ2L 1UA6H 5EORL 1FZJB 1ZLUH 2Y5TA 4L9LC 4JFXB 1JHLL 1VHPA 1LP9A 4D0BA 4KI5E 2MFNA 1OGAA 1SQ2N 2EXYD 4IDJH 1AIFB 5EUOF 5HI5D 5IJKC 1J11A 3LQAC 3NCEB 4PGBA 5KVFH 3H0TA 3R4DA 3G6DH 3RRQA 3VFOB 1HI6A 1UACH 4QRPA 3ROOA 1N2RA 3BE1H 5MEPB 5FA4B 2PXYC 3W0WE 4HQQL 3TBTA 1NGWB 1KCSH 2B8OT 2RQ8A 5DDHB 4LKCB 3RNKA 4Z77B 3VGGA 3O6KL 3PXHA 3BRDA 2J6EH 2MMXA 4OBSA 3TJEL 4PPTA 3S4SG 3MUZ1 3AXLA 2W0KA 5FB8B 3PWJA 3SE9H 1VKXA 1ORQA 3GSOA 1KJ3H 2GSIA 3QUZC 5GGTH 5ALBH 5EBMA 3OTTA 4IOIA 4WY7L 5MERB 5FCUL 4I3SH 5F1IB 4HGWB 2FR4A 1GGCH 1FFQA 3PWLB 3O9WA 4HFUL 2G2RA 5ITBL 2XWJA 5KVGL 3MNVB 3H7LA 5A43C 1HHGB 1TCRA 4HUVB 1FNAA 4IRJB 4FQLH 4PTUA 5J12C 4GKNA 1U93B 5E5UB 4GG8B 5EBWA 5ISZE 3FTGA 1GGYA 4I18A 4UILL 4CMMB 3AGVA 3D0LB 2YPLD 2BNQE 3BSZH 4NC1E 3KPSD 1DL7L 3T4YB 1XGQB 5KSBE 3QIBC 1BBJB 1A1MA 1UWXK 4LPUA 4KXZI 4P5MA 2R4RH 3LKNA 3QAZC 1NFDF 2XWTB 4U0QB 3NH7H 1NUFA 1UB5B 1C16A 2CMRL 2H45A 43C9B 5J3HC 5CHNB 1OCWL 1YNLL 5MP6H 3I2CL 5EOCJ 2BXZA 2FL5B 4J23A 4ODXA 3DO7B 2NY4C 4OT1L 3U9PL 3FCTB 4L3AA 1B3JA 4N0CD 1E4XL 3BP4B 5JMOC 5JPNA 3JV6A 3ELAT 3STZB 1JZ4A 3OBAA 3QUXD 1P2CA 5HI3C 4PGEB 4FNLH 3RP1A 3OF6D 4BA8A 4L3EB 1Y6MR 3WMSA 4AT6A 4WJ5A 3ZL4L 4Z7OF 3K8KA 4ZFZA 3BESR 5C0EB 5IVXB 3FO2A 2NXYD 5JDJA 3C6LD 3RWCA 1RUMH 4WCYL 5IV2B 2F74B 3FQRB 1J0IA 4H0GA 2ZUYA 3MRDB 3RGVC 4FQCH 1F58L 5EO9B 2XZZA 4PR5A 1I75A 3WKMH 1QFWM 1UCBH 2APVA 1CXIA 5HHVL 4JZOB 4RQQA 4KUCF 2IQAB 3WFDL 3BPCA 3AS3A 5IM7B 1WZLA 4HWBL 3D2UD 4M7LL 2OJZL 4M7LT 4N90D 4M8VA 4E5XB 4YZFE 3ARQA 2SEBB 3VI4F 3MROB 4MDJA 4CRPA 1R3KB 5JXAL 3MYZA 2G9HB 5T3ZD 3VGAB 1MVFA 4PB9H 3KLHD 2OR7A 3MGTB 3U0WL 5FYKH 4R4ND 2ZUXA 3LV3A 1LEKB 2I60L 3QI9A 5C08B 3FQNB 5BS0A 4G80A 1RZKL 5E2TH 3TNNA 1AO7B 4X6CA 4AIXA 5GGRA 4Y2DA 3VGHA 5I0DA 3TYFB 3KPRE 5I0ZA 3P9LB 5CGMA 4JHWH 1U91A 2HWZH 1L7IL 4PG9B 1ZTXH 1KPUA 1YEEH 3MLSL 1ZVSA 2ITCB 4MAYB 4CU6A 1NGPH 1CDGA 1CS6A 4XRCB 4O2CA 2YBRA 2VR4A 1QBAA 1JIBA 1PZUB 4Z7VA 3JWNC 3E6FB 4M1CC 5AZEH 5A16A 4GXVL 2DLIA 5DUMH 1OTSD 5E1HB 3VD9A 3VXTA 4PRPD 2PKDA 3L9RB 2H3NB 3MODL 1EJOH 2R4SL 1MQKL 5E2UL 4G6JH 3BD3A 4WFHE 1CFNA 1WTLA 4NQDA 2NCMA 5GGQL 1NLBL 2BERA 3P3YA 4GKSA 4GH7B 5IEHA 1DQJB 1A4JA 2ZSVA 3MOAL 4TNWF 2PXYB 1RVFL 5E08L 2GUOB 5ESVB 5MENB 4JFQA 2Z31D 2NX5B 5L2KE 4PREA 3LS4L 5F9OL 4S1SL 2AJXL 3EZJB 5FYKU 4CAGA 5DD0L 5CUSL 3VE0B 4YWGL 3RU8L 1WZ1H 4WFGD 3RTQC 2PTTA 2NY5L 4IRSD 1NLDL 4U1NB 3CC5B 5C07D 3T1FA 4J3SA 3QUZB 5DRWB 3BYYA 3OHXA 3G6JF 5FXCH 4AY0A 3O2VH 3CPLB 2HMIC 1MCOL 2J8UA 3VMOA 4PJIB 4DW2H 4NKDB 2BX5A 4JDZB 5EG6C 4MA8L 1LE9A 4QXGL 1RK0B 3W11C 3OAYH 3SKUD 1RY7B 4JG0H 4NCC1 1KPVA 3V0VB 1YEDA 3TVMD 2H1PH 1P4IH 1IBGH 1I7ZB 3UAJD 3DX8B 4LVHC 3WN5B 1S7WB 3QUYD 3VXUD 3KYMB 3NZ8B 2P47B 5C0ND 2WWMD 4X4YB 4N0YH 4BK5A 4PJ9D 2HN7B 1FYTE 3MLXL 4F2MB 3S3JA 3DURB 5GS1A 1A6AB 5D7SL 4EI6B 1CTNA 4Y5XB 4NZDA 1NSNL 4PLKD 1Z3GL 2NY4B 4M00A 3C2SA 1UCTA 2DLFH 4GBXA 4P3WA 3QISA 3RWEB 1KJ2B 1MCCA 4JAMB 4I1NB 4UU9A 3RWDA 2OP4H 4PJFB 2NY6D 4JFED 4MX7B 4CVUA 4UTAL 4LSPH 3IJSB 4QXUH 4NGHH 3BKYL 5SX5H 2DBLH 3QUXC 4KMQA 4J12A 2R23A 5GGUB 4P2OA 2ZUVA 1MREL 4PRHE 5HDQH 4KKCD 1YEIL 3KHQA 2OTUB 3GMRA 3RGVB 4UUJA 4DKFH 3MNWA 2IQ9L 2AQ3A 2EEAA 4QRRE 4JO4H 2NMSA 2ZJSH 1XCQB 1LILA 2WWKO 5DVKA 5E6ZA 1MCDA 3A6BL 3VDCA 1RULL 1Q72L 5T1KA 1HDMA 4WGVB 1M6OA 1ND0B 4RMUA 4HEPG 1S9XB 4JM2F 2V5SA 2WBJD 5I17A 3HR5A 5DHVH 1DDHB 1RHHA 3BWUC 1A3RL 2RFXA 3CFJA 1DFBL 1IKNA 4WTZA 2NXZB 2HG5A 3ZDXF 4R96A 5EC1B 1T0NB 3S37L 2QEJA 2DMKA 1I85C 4XNUH 3IDMA 4JE4B 5T3XE 1NJ9B 4L4VB 3RVXC 4HGKC 1CXFA 3QUMH 5DJYA 4IMKA 4K8RC 3SY0A 2DI8A 4H20H 2Z93B 1H5BA 3U82B 2XYCA 5IUSA 4WHCA 5ALCH 3IDYC 4LCYB 3HE7A 4S1DD 1PLGH 2NR6D 2AK1H 5CINL 1RURL 3DNKA 2ED9A 1T83A 4PV9B 3RUGF 1NDGA 3ULUC 1U2CA 3QDJB 1OTSC 4PGCA 5ANMB 4PJAF 5E4EC 3CFBB 1FYHB 4PJGE 5EBLB 2ATKA 3EOTH 3MLVH 5GGVL 2NY5C 4Y5VA 2APWA 2NY2B 2ZCLH 5J6GA 2ADFL 1DQQA 4X99B 1QBBA 1F3DH 1X5FA 2D7TL 3HCVB 4P2RE 5F6HJ 4ODTH 4JKPL 5C0BB 2BSRA 2W0FA 1HHJB 3TN0D 2B4CL 3A0OA 3RPIA 2WP3T 3RX7A 1INDL 3S97C 4OLVH 3WS6A 1QR1A 4HUXA 2AEPH 3U4AA 4B7IA 2PCPA 3RTQB 2XN9A 2KBGA 3C60C 4NWTH 4W68A 2WLZA 4ZUWB 1FN4B 4HWZA 4LPWA 4WWKA 1CLYH 1G9MH 1U8PA 3DPBA 3IFPA 3WIIH 4MB3A 4OD1H 4L8CA 5LGJA 1PEWA 4LCWE 3HMWL 2EH7H 5J1AA 4TN9A 4PY8J 3KXFE 3W39B 2X4QB 3PQYE 5FKPB 2D7PA 4R8WL 3LPFA 1GOFA 1GZPA 1ZHKA 3UTSE 5FCSH 3SDCC 3FB7A 2VDPH 2BDNL 1B0RA 2OYPA 3WFHA 1DLFH 4Y4FA 1MH5B 3U30C 5IMLB 2R2EB 1KFAH 5K59E 3C6SB 2Y07L 1MWAA 1WFNA 5C0NC 4U6HB 1NFIA 1FVCB 3SGDH 4K7PY 1V3LA 5C2UB 1ZGLM 4OD3H 3SDAA 4DVRL 2C4XA 5EO1A 3QZWB 1UFUA 5GRJL 5A2JH 1YECH 3THMH 3F58L 4FS0A 4X9BA 1GC1L 4I0PA 5HYEA 3QRGH 2I5YH 2NY6C 4QNPE 4XMLH 5C6TH 3AAZA 5IFAH 3FT3B 3GSRB 3IF1B 3MRKA 1RJZB 2VERN 2VB5A 2CH8A 3RL1A 3TNMA 2IANA 4JHZA 4OCWL 1KBGH 4D3CL 4QXTB 3VWKD 2Q3AA 3ESVF 1ZGLB 4L8DA 4DGYL 3RWHB 1EHNA 1P6AB 4KUCD 4OIBA 4W6WB 1EPFA 3LKPB 2X41A 5HI4D 5BMFH 4WTXA 3O81A 3BVNA 1DBBL 4BYHA 2F19H 1GPOH 3QFJD 5CEZE 5FYKD 2XV6B 3LD8C 4JDTH 3ZDZF 1KPRB 3C5JA 4ZG1A 3QXAB 4DAGL 2QADC 4G6ML 1T2QL 4LSSH 4OZHF 4YDKH 3CLEH 4RNRB 5DSCA 2RHEA 3MR9A 4PJ5D 1NEZG 3VFNB 4CGTA 3DUHA 4CU7A 5F96L 2R1YA 5DJCA 4QTHA 2AXFA 1CGSL 3VFGH 3NACH 1BD2A 1X5IA 1NEZB 1AGEB 4X6FB 2OXGA 3TIDB 2EDLA 4ZD3H 4H25B 4L3EE 1AKJD 1OWRM 2H2SD 4ZOAA 1B4RA 4MZ2A 1J1OL 2FJHB 1IILE 2FX8L 4JFPB 3DLQR 4OV5B 3ARED 5E95B 2FCBA 4JG1L 3R8BB 3BFOA 5IVXE 4TUKH 2NR6C 3S34H 1HH9B 5DHXB 1W8NA 3D85A 1G0DA 4ZFOL 2ENSA 5B38A 3QO1A 3GFUA 4X6EA 3I3DA 5SV4A 2W91A 4XMKH 1F3RB 3N1QC 2X10A 4OZFG 5KS9F 4M62H 1DTUA 3HUJA 3TWCL 1JK8A 5F7EL 1ZLSH 1D5IL 5EZOL 4PJEF 3HMXH 4OZFB 1IT9L 3ARFC 3N1GC 4OB5L 1VERA 1CG9A 4OZIF 5CP7A 3QHFL 4UDTB 3CDFA 4NQCA 3ZE1E 2GAZB 5C08E 4H88H 1A3LH 2H2PC 4GAYA 1CE1H 1AO7E 3PGCA 4YC2C 4MNGB 1GIGH 1WCBA 1QRND 1SM3L 3ME0A 1A6ZA 4TQEH 1RJCA 1FFPB 5JQHC 4WV1A 4D0DA 1N5AA 3IS1X 4LHJB 4HK3J 3GIZL 5L8LB 3BZFA 4NUJA 1N59B 4XHJD 3TH2T 3GSQB 3IRPX 4JRXA 1A14H 3QA3B 3SDCB 1PSKL 5FO9A 3SOBL 3CFDA 4S11A 3PNWB 3IU3B 5CBAA 1V7ML 5FF6B 3MV7D 2P5EB 3L7FB 4GXUM 4M7ZB 3DIFA 2CKBA 1A64A 1T1WA 1GOGA 1H0DA 1FGNL 1BQSA 4QT5B 1HXYA 3U30B 5GRWA 1FO0L 4MDIB 1RFDH 4HIEB 7CGTA 1NGQH 2AEQH 5I71B 1N8ZB 1GC1C 1WBZA 2P49B 2Y72A 3MJ6A 3OJDB 4JFFD 1J1XH 1LWRA 1DBKH 2DICA 2WUBH 4KJYA 1MPAL 3WFEL 5JHDA 3VRJB 1KXTB 1HCVA 2XTLA 3MRMB 5HYJB 4PGJA 5MENE 4UINL 1JV5A 2NX5E 3RIFF 1QO3A 4JLRB 2HTLC 4QTIL 5C0AD 4ZDHA 2GYSA 3P4MA 4Y88A 2P7TA 2P8MA 4HJ0C 3MBXH 1MCJA 4YXKH 1FG2A 2D7NA 5FYLL 1YQ2A 4PGDA 3L5IA 1VFMA 2FRGP 3DO3A 2MPAH 2VXVH 2NLJB 3SDDB 1P1ZB 1LEIA 1CFBA 2W60A 2MWCA 1GGUA 3VXNB 2C9AA 1HWGB 1WC7A 4K9EL 3SGJA 3ARZA 3BH9A 3CH8A 3BKCL 1S7UA 3KPPA 4N8CH 2YMXH 1JI2A 4PJIE 1C5BH 5ACLA 1I8IA 1AXSB 2Y36H 3HC4L 5E1AA 1ZSDA 5SWSD 5GGTA 2WIIB 3A67H 1SJEB 4MD4B 3W2DL 2OCFD 2UWEB 4K2UL 4ODHH 4K3EH 2HLFD 2IBZY 2QL1A 4K3JH 4JM2D 1RJLB 3OPZH 4YXLL 2KQMA 2MOVA 3QEGL 1JF1A 3MRHB 3U7YH 5LWYH 4NO3B 3E3QE 2ITDB 2AI0L 4RGND 1YMMA 3VXQA 5D7LA 3SDYL 3RY6C 3D3VD 5F9WC 4EUPG 1JPGA 4KAQH 2ZPKH 3WNKA 1ZHBA 4IHOB 3SPVB 1IQDA 2GIYA 2R56H 4PJFE 4MVBD 1D6EB 5HGAA 1KTDA 1GSMA 5LVEA 5DURD 3U46B 3MOBH 4G7VH 3BDYH 5C2BL 4MQXC 5D4QA 5IQ9A 3DUUB 3O2DA 5KSVA 5FFLA 3L5JA 3LRGA 1UYWH 4JANB 4R26H 2H2SC 1HHIB 5J9PB 3NPZB 1JPFB 1H8NA 5IW6A 2DQJL 3AREC 3HE6A 3O8XB 3JTSB 4XWGL 1WFTA 4QKXB 3VCLB 4Q6IA 1MHEA 3PWUA 4P4RA 3QWQB 4YPGA 1IARB 4U1IA 1FVEB 4UAOC 3W9DA 4RAUA 2EDJA 3GBNH 1JFQH 2D4FA 1A7BA 4YLQT 5JA8B 1YY8A 1B2WL 4LL9A 1KELH 3CZFA 1NC2A 2AV1B 2YPKA 3ARFB 2Q76B 2VXTH 3FT2A 1RI8A 1P7HL 4X4XB 3MUY1 2MHAA 4KH2A 3PWPB 2UZXB 4YC2B 5GRUL 4Y5YA 3FQTB 5D71L 3U9UA 4R3SA 2JB6B 5DMGC 4L4VE 4EIZC 5C0CD 3V6OA 4XPTH 3L3JA 2V5RA 2Z4QA 3G5ZB 3I02B 4AQ1B 2EDKA 1S9WB 4FFWC 1EV2E 3FJTA 2XKNA 3K80A 4U0RC 5DJ6A 3Q1SL 3P30H 4I77L 2BCKB 2AKRB 1TTGA 2PO6A 1DVFA 5BZDB 4KDVA 1VADA 2CDFA 3G04A 4GQPH 3BGMB 2GJ6A 1Q9WB 4XHJC 5D2LA 2QQKH 3SKNB 1MHHA 4XVJL 2HVJB 1QOKA 3QDJE 2IADB 2YS4A 4XPHL 5ANME 2AK4A 1ZT7B 3C5ZD 1KIQA 2AJ3A 2IPTL 3DV6B 3QXTA 1GXEA 4PRNA 2QSCH 4EKXA 1QSEA 4MGXA 1GGBL 1BOGA 1ES0A 1TNMA 3S6CA 4P2QD 1MELA 4PRIA 4L5FH 5C0BE 1WLHA 5D2NC 3HTLX 4JJ5A 4D9QE 4K9EC 2FJFB 1QR4A 4P46C 4XPFL 4ODVH 2X2YA 3OZ9H 2FO4B 4LHUG 1FNEB 3RIAF 3B2VL 1UVQB 1AQDA 1U8JA 4WENB 1QLFB 2FECL 4PJHB 3D87B 1ZT4B 3PP4L 5D1QB 3T0EB 4RX4D 4LHUB 1ONQB 3OJ2C 5ITFB 5JOEA 3SHSA 3T3ME 4YDVB 2ARJQ 4OZGF 3BZDA 4K3DH 1BGXH 1XCTA 4KK9C 2H26A 2D7OA 1JTPA 5IB4A 2R0LL 4P99A 4JQXA 2KPNA 4XNXH 5TDPA 3G5XB 3W81A 5I1AA 4ZUUA 3U6RB 1H8OA 2BY3A 3MZTA 5GGSA 3QG7L 4IRZL 3G6JA 3HB3C 1FAIL 32C2A 4MHHI 2HLFC 4XCNA 2J88H 2GT9A 3O4LB 1ZLVH 4OAWA 4GMSL 4Z7NE 1CLOH 5EB9A 4LSUL 5TGBA 3UO1L 1ADQL 1MRCL 2YXMA 4F37F 3BT2H 4HCRA 5E94B 2JB5H 2YD8A 4NUGH 3FQXB 2DQFB 4IEFB 4PRBA 2JIXD 2X4NB 2EECA 5JR1H 3ZMRA 4U1MB 1KLGA 4DZBA 4N0FB 2OK0H 1QPPA 5CS7A 2QSTA 3HG1D 4ZFOB 1FE8H 3K2UH 43CAA 1H8SA 1JWMA 1I7UA 4GS7B 1MLCA 3SDXF 3V8OA 5BV7H 2F9BT 4G43A 1UJ3C 4XP6H 2A6JB 1FH5H 3EW3B 4JFZL 2VDNH 4RFOL 1MJ7L 2VL5B 4RISH 2H8PB 1X5HA 1RQ5A 3BIKA 3KLSA 4CMHB 1YEGL 1JCKA 1HHKA 5ESQA 4JB9L 4M4PA 4PJ7B 3TPUA 4Y4HC 2VC2L 3PHOB 3NFPA 4M3KB 5KZCD 3PV6B 4F33A 4FZ8H 1AD0A 1QFOA 1JL8A 2VRAA 4JPIA 1QEWB 2VDQH 4XI5D 1F90L 4UAOB 3HZYA 4W70A 2JTDA 4PRAB 1KXQE 4FQJL 4G8FB 2DQHL 3RA7L 1UM6L 2DYPD 4S2SB 2APTA 1J0KA 1RU9L 5SWSA 2EDOA 1P5UA 1X4YA 2QQNH 1NCCH 1Y0LB 1NL0H 1NGZA 4TSCL 4KMTL 5L2JB 3FFDA 2EYRA 5I1KL 3CUPA 5EU4A 1HYRC 4A2LA 4PRDB 4M1DL 2O5YH 4BSJA 1B6DA 2HLAA 2DJUA 2MNUA 5IQ7L 4KY1L 1LO3H 4KHTL 2F53D 4JZNB 4U0RB 2Z35B 4X0KA 4U6XA 3L3OB 1U8MB 1FO0B 2P8LA 3TZVB 3VFPB 2XI9A 4YHOH 5IB1B 3B5GA 4ZO8A 2CDGA 4OFPA 2VWEC 3QUMA 3V5DA 4APQD 5ACZB 1LO2H 1ZE3C 4LIQH 4OGYL 1DLHB 4FFZH 3TC9A 3HC0B 2XZAH 4WW1A 5J13B 3O9WC 4MA1C 2CLZA 5EU7C 3UTTA 2EYSA 2WUCH 4QHMB 4Z18A 3W5MA 3G6AB 1CF8L 1SMAA 4BQBA 3I6GB 4LLMB 4JM4H 1A5FL 1E4KA 1U58A 3RUGA 3KPOB 5IBTL 4YGVA 5C3LD 3UJJH 3K1KC 4U6VH 3L7EB 1I8KA 5DD1L 1OP9A 5I8OL 2XTJC 3NCFB 1XIWB 1XF5A 1NC4A 2VXQH 4IBLT 5I1DB 1IC4L 2HKFL 4PJAA 2H41A 1R5IB 1TVHA 4AG4H 4P46B 3VD5A 2NTFB 3MRJA 1DUYB 2FWOB 4GG6F 3DRTB 5FM4A 3MV9D 4F7TA 1YEJH 1HEZB 1Q94A 2Q8AL 8FABB 1T7WA 1EFXD 3FQUA 4OKVB 2GSGA 1C7SA 4TRPH 5I1CL 3GJFK 3B3IB 4OM1H 4MNGE 2VQTA 1A0QH 1CLCA 3VXMD 2OJEA 1CU4H 2A6KB 1F4AA 2ZUUA 2ICES 5T5FH 5E9DB 2HFGL 2A73A 5E6ID 2A2QT 1A6VH 3WV0A 3X3FL 4HUNB 1N3NB 2M26A 2NYYC 1J8HD 1SYSA 4NNXA 1P69B 5DQ9A 4E9LA 1AGCB 5DJ8B 2Z92A 2A83A 5E8DL 2C7UB 1IGCH 1MLBB 5L88H 3QWRA 2ZSWA 1MJJB 2GFBB 4MNQB 2P5EE 3HZMB 4G6KL 3O3UN 3DV4B 2IFFL 5F70A 3LPGA 4I0CC 4OM0L 4GT7A 4Z0XB 3FMGL 5T1LD 1G0YR 1J86A 3O3DA 4H5SB 5IMKA 2HT4C 5EZIL 4XAKD 5HYSA 3C08H 3QDGB 1OAQH 5SWQB 2FD6H 5EUKA 1RK1A 2FBOJ 1MI5B 1JGEB 2XWBB 5TF1H 5HYJE 3WUWG 1XMWA 3H8NA 3LIZH 4UBDC 2ZUTA 2PW1B 3GO1L 3OV6A 5D7JA 4MNHA 3QH3B 3CDGB 2EO1A 4FQXD 1UB6A 1S9VA 2GJJA 2ZCHH 1FGVH 4MAUH 2D31B 2QKIB 3H42H 1UJ3B 3MACH 4Y2DC 3IU4L 1RMFH 3CFCH 5BJTB 4LEXH 5ISZA 5LQBL 4ODWA 3C09B 4MMZC 3CK0L 5L7XH 4I48B 2BMKA 4G9FD 5H2BA 4LCIH 4R7NA 3U79A 5T5NG 5D1XB 2JELH 1MCKA 3RFZC 4Y4HB 4AM0A 3ES6B 2V7HA 4DQOH 4HUUA 3E2HC 3O6FA 4K23H 1URLA 4IOFD 2UWEE 1PYWA 3EYFA 3M8OH 1LP9B 4D0BB 3S7GA 2IPKA 3L5WA 1YQVL 1OGAB 4DKEH 3WIHH 4QGYA 3VH8A 5JW3H 1R3LA 3BQUD 4YHZH 4I8DA 2F5AH 4HC1L 4WUKH 2Q7NA 3ISWA 1JRHI 4PGBB 5ENWA 4S1QH 2BOBA 4BELD 4QRPB 4BZ2L 3MUJA 1TITA 3TO4D 2VDRL 3FO1A 3TBTB 4BFBD 3RNKB 3WD5H 5IB2A 5FHAH 3D9AL 5DT1H 4KUZL 3PWNA 3EYUL 3BUTA 5FECA 1EEZA 3QEQD 3TJHD 4LOUD 3AXLB 3CLFL 4O5LL 4MB4A 5E2WL 3PP3K 3PWJB 1CK0L 4YBQC 3SKJH 3BW9A 2AABL 3WLWD 1ORQB 3GSOB 5B22A 1VKXB 2AAVA 4UB0L 4MXVF 1PQZA 3PXJA 5EBMB 3BP5A 2GCYA 4IOIB 1W8OA 1PEZA 2FR4B 4APQC 2HJLA 4UTBH 3O9WB 4MA1B 1LDPH 4PB0L 2XRAH 2G2RB 4HIJA 3KYKL 4NP4L 2XWJB 1F4YL 4J3VA 3IDGA 5C0IB 2HFEA 1TCRB 1MFCH 1I9RL 1N64H 4PTUB 4PJ8A 4D0CA 4GKNB 5E2JA 1A8JH 5EBWB 4LDOB 4A6YA 2YKLH 3FTGB 1ZWIA 1G6RH 3H9SD 4I18B 1OB1A 4NBXB 2XTJB 2ATPA 4WO4A 3MXVH 1T7XA 1X5GA 2MQ3A 1BIHA 2AJYL 3L3KA 4DTGL 4PYHA 1SEBA 4P5MB 3LKNB 3QCVH 4OFDA 4MXWL 3TBSB 1C16B 2OI9C 1EO8H 5KS9A 1SY6L 3HMXA 1BWWA 1QSFD 1RIHL 1YN6A 4TTDD 3PWPE 5GS1C 3NBNA 1QKZL 5JZ7D 4PJEA 4ODXB 5L9DH 2ORBL 5K9QG 4NQUA 4ZFFA 4WI6A 3TLRA 3RKPA 4J4PD 4GBXC 2R15A 3Q48A 4BQCA 4UT9H 3I75B 3QNXA 3DXAA 1MWAL 3JV6B 5JPNB 1U3HD 1WBYA 3GHBL 1P2CB 3SCMD 3K81A 3LQMA 2ZNWA 4YHPA 4AT6B 1VGEH 4WJ5B 3SJVA 4U1KA 4W4NA 5HPOA 4L4TA 1Q1JL 3PV7A 4OCRH 3P2TA 2FX7H 4ZFZB 3FO2B 3IETB 1X4XA 3RWCB 3IB4A 4ODSH 4U3CA 2AGJL 4ONFL 1CL7I 3L5HA 1H3PH 4H1LH 5FHBL 5TH2A 4FQ2L 4S1RL 3EFDL 3OKEA 4HXBH 4PR5B 1I9JH 3AMKA 3CSGA 4RQQB 3BJLA 1OAXL 1C5CL 3BPCB 3FO9A 4Z7UF 5D96B 4PBXA 2ZUQB 5BO1L 2FATL 4GAFB 4OZ4A 1BWMA 5HGBA 4YQXH 1UH2A 3NIDE 2JF1A 1H3UA 2VITB 1NAKH 3FOMB 3GI8L 1X5XA 3LV3B 4UIKH 3QI9B 4M7JL 5H37G 5HHXH 4J3WA 4LAQL 4Q9RH 4OSUL 5DS8B 1MIEL 5BS0B 4G80B 3DROA 4X6CB 4PJHE 3TEUA 4H26A 4JKMA 1B4JL 4NNYA 5FYJH 3T0EE 1I8LA 4GQ9H 3P11H 3DHJA 2B20A 1FG9C 4IMKC 3QHZH 4WI8A 5FKAA 1H5BC 4AQOA 1A7QH 1MF2L 3JXAA 3V52L 4KVNL 3Q5OA 3HE7C 4O2CB 2YBRB 1FYTA 3MLYL 3MLWH 3E2HB 1ZGLP 4Z7VB 5GXBB 2DWDA 2Q8BL 5AZ2H 5A16B 1T83C 3ZO0A 1OM3H 4MJID 3VXSD 4HUWA 1MRDH 4X7SH 1O5DT 3VXTB 2ESVD 3G5YB 5E8NA 3QG6A 4KRPD 4OFYD 5DR5L 3H9ZA 5IWLA 4P3CL 3S88L 4XVTH 1Z9OA 4O02H 3NIFF 3O4LE 4LK4A 3KPQA 1C12A 3MTRA 4LAJH 1CFNB 3MMEA 4NQDB 3FHQA 5TFSL 1KACB 5DWUL 5C09D 3BQUC 4GKSB 2V5MA 1JRHL 3CGTA 4Y5VC 4BUGA 2VKXA 1YEKH 1P7QA 2R0WH 2ZSVB 5TE4L 2CRIA 3K8MA 4Y7MA 1C5DA 3PGDA 4KTDL 4JFQB 3D6GA 1YNKH 4HPOH 4PREB 2VMFA 5F1NA 3PABA 3ULVC 1LDSA 1L9NA 4D9LH 3WS6C 3MUHL 2JJSC 4NRYA 4KVCL 4NNPL 2PTTB 1BEYL 4WWKC 3RDTA 5CJQL 3TO2A 1EVTC 1HINL 4RRPA 3BRFA 3T1FB 1DBMH 1P9MA 4NM4L 5DQDL 5EH1A 5IT2H 1EVUA 3OHXB 2FYYA 2EIEA 4KGLA 4GUPB 2J8UB 1L4IA 4F3FA 1BZ7A 4P5TA 4O2FA 4HKJA 1MEXL 4PJXB 5D8JH 1P4BL 2VISA 5HHMD 3RVTD 4PJ7E 4PUBH 4I5BA 1EDQA 2DOCA 4XPGL 4F57L 3F65A 4MS8D 3VW3H 3TIEA 3F62A 1NUNB 1JZ5A 3S98A 1KPVB 4RWYL 4U1SA 1YEDB 1EEYA 5C0RH 2ZUSA 2BY2A 4ZUSA 3O41A 4I0KA 1V7NH 4XAWL 3Q5YA 5EPMA 3WJLA 2DDQH 4BFEA 1UH3A 1T03L 4NKMA 1EK3A 1XF2A 3KS0J 2GTWA 3KJ4C 2OI9B 2A77L 4M93C 4TSBH 3WHE1 5GS1B 5DMYA 4Z7WB 3SDAC 4HXAH 3WEXA 1CFTB 4GBXB 1MCPH 4XPAH 3RWDB 4UU9B 1NMAH 1HNGA 5KG9A 4J4PC 3LEXA 1MUJA 4J7RA 2FHBA 4IDJL 4KI5F 5F7KC 1ZHLA 3TH4T 2CLVB 1A9BA 2R23B 4P23A 3WNLA 4P2OB 2UY6A 4KJWD 1T1ZA 4HULB 4JPVH 5KVFL 3NN8A 2AJVH 3G6DL 1MHCA 4ZXBD 2FB4H 2OZ4H 3GMRB 5DJZA 4UUJB 5KVDL 3MNWB 1XT5A 3RVUC 1JYNA 3RIFK 1MFAH 4HFWA 5FGSA 3QCUH 3VWJA 4YFLF 1ZMYA 1W0WA 3QWOA 1KCSL 2CQVA 3L3HA 3U36A 5T1KB 1QA9A 5F8RC 1HDMB 2VSDA 1M6OB 2J6EL 3IJYA 4C54A 4HK3N 3NCYS 5CD5C 5FYLE 5I17B 4GFTB 4Y2OA 3T65A 3HR5B 3QQ4A 4LCWA 4UQ3A 3QRFM 1RHHB 2RFXB 5F3BA 1KJ3L 4LBEA 4WEUD 3CFJB 4A2MA 5GGTL 4HIXH 5ALBL 1F97A 3PQYA 4LLYA 1YC7A 3VGBA 2HG5B 2DF3A 1T3FA 4M9OA 4RIRA 1I3RA 5FDYA 4I3SL 4ODUA 1D5ZA 2BVEA 1GGCL 3L6FA 5D7IA 5IMOA 3H2WA 3OKMA 1WITA 2DQIH 5FO8B 3UPCA 2EDXA 3QDHA 3NPSC 5DJYB 5E9DE 4FQLL 1MOEA 3GSNH 5CLTA 3SY0B 2H32H 1H5BB 1M7DA 1F42A 1X6LA 1CXLA 1F4WH 4KI1A 4LPCA 4J8RA 3GMNA 1VACA 2UZYB 3CX5J 3HE7B 4MJ2A 2ARJA 3BSZL 1TXKA 3VFOA 4CU8A 2NQCA 5MEPA 2R4RL 1ZLWH 4MNQE 2A6IA 3N9GH 3NH7L 5DDHA 2DM7A 2QQLL 4PGCB 2BVOB 4BSWA 5MP6L 2W38A 4WW2F 2V5TA 3I84A 4KRPC 2V9TA 2ATKB 3O2DL 4Y5VB 3QDGE 5J6GB 1DQQB 3FONA 5I30H 2VLJD 3DYOA 1MJUH 3Q5TA 1MI5E 4XXDA 5EO0A 5KAQG 3S4SA 2W9EH 4FNLL 4R90L 1CE6A 2NZ9C 1H3GA 5MERA 1A3QA 2W0FB 2X4SA 5F1IA 3RPIB 1QR1B 4HUXB 5T1DH 3ARGD 2PCPB 1RUML 2XN9B 3VG0H 2VDKH 4HWZB 3K1DA 4WWKB 3D2UB 4FQCL 4HJGA 1NBQA 1U8PB 3LEVH 4IRJA 1D5XA 1OWWA 4JRWA 1LK2A 4L8CB 3WKML 5LGJB 1DSFH 1UCBL 4GG8A 4LSQH 1UQSA 4Q58C 3DVIA 3OB0K 4WV1C 4O00A 5J1AB 3OX8A 1CXEA 3Q3GA 2YSSA 4HX1B 4LSTH 1DANT 1XGRA 3FQWB 1GZPB 3OAUL 4RA0C 3FAWA 1ZHKB 4M03A 4U7MA 1GHFL 1S5HA 3EKCA 5C8JA 6FABH 1S78C 1UB5A 1NMCC 4PB9L 3FB7B 4HS8H 5F7FA 2BVQA 4EUPH 1I3UA 1LP9E 1B0RB 5FUOL 3WFHB 2FL5A 4Y16D 4Y4FB 4CDHA 4Z8FH 1OGAE 1OQXA 5E2TL 1RUKH 2ENYA 4G8GA 4WGWB 2E6QA 3L3IA 1MWAB 1CXHA 1ZT1A 4MQ7A 5I1EH 4TUJA 3WFCH 4KK5D 4NBZB 1Q9LA 1ZTXL 2VZUA 1YEEL 3KJ4B 5I66B 1CR9H 4QRPE 1NFIB 2F8OA 4FA8A 1KXVC 5E2VH 1NGPL 1MAMH 1FCCA 5EO1B 1I1FB 5AZEL 3WSQH 1JP5A 1FORH 2ZNXA 5DUML 4ZS6C 2AS5M 4I0PB 2XNAA 4U49A 3SE3A 2IQAA 4OUOA 5IM7A 1B0GB 3AAZB 3ARUA 4G6JL 2VWEE 4E5XA 3MRKB 1N4XH 2AXHA 3GB7A 4JRYA 3MBEA 4KPHH 2IANB 5ESAA 4R97B 4KJWC 2ICCA 4P4KA 1GYAA 4L8DB 2L0DA 2WK2A 5C07B 5F21B 4G8IB 3DMMD 2FLBT 1AO7A 1MCFA 4MLIA 3ZSSA 3BVNB 3RKDD 1WZ1L 2G5RA 3P9LA 3TFKD 1O7SA 1K8IA 1QFHA 2XTJE 3BEWA 4JPKH 1AGBA 4K07A 3C5JB 4HH8A 4CNIB 4Z0BL 5J4MA 2DWEA 5BRZD 3O2VL 1SJXA 5FYJD 2BVUA 1BVLA 3IGAA 1F6LL 4DW2L 5DSCB 2AEIT 1A6UH 2A74A 4JFHD 1REIA 1WISA 2FDBP 4MA7H 2YR3A 1T7VA 2R1YB 3VXUB 4OQTH 4QTHB 2AXFB 3VXRD 3X3GH 1ZLVK 2LU4A 1BD2B 5K9JL 2IEPA 4GG6A 1YUHA 4C83A 2H1PL 4HCRL 1P4IL 1IBGL 2Y7QA 5B39G 4YDLC 4P9HC 3UBXG 2BVPA 4N0YL 4D9RD 5JIPA 4Y4KD 5ESVA 5MENA 2PYFB 3D85B 2VLKD 4X4MA 1NEUA 5AD0A 3HE6C 4X5LA 2UVEA 5B38B 3QO1B 1WAAE 4Q74A 4X6EB 1XGPA 5B3NA 4Q6IC 3VE0A 3U4BH 2DLFL 2C26A 3HS0A 2OP4L 3HUJB 1JK8B 3EYVA 4FN0A 4ZXBA 3P73A 4LSPL 4U6YA 3MRNA 4QXUL 1G9NH 1YDPA 3GI9H 3RVWD 1RUQH 1AR1C 2DBLL 3ZHLA 1AY1L 3BPOB 4NKDA 5LBSH 1UEYA 5CP7B 5ICYA 5HDQL 2YUVA 1AP2A 1AHWA 4Q9QH 3E0GA 2BNRD 4GAYB 5BS0E 3SN6N 4X6CE 1A1OA 3PGCB 1MCBA 4DKFL 3ARGC 5C0JA 4Z6AT 1BX2A 4TOYH 1WCBB 2WBJB 4Y5YC 5I16A 5GS0L 4JO4L 2ZJSL 1NANH 3V0VA 2BC4A 3U7AA 2ID5A 3V6OC 4WV1B 2NNAA 4D0DB 4U1HA 4N8VG 3MA9H 1G7HA 2VLLA 1S7WA 2K3TA 3KYMA 1EAPB 3NZ8A 3BZFB 5CJOH 2RB8A 3RWIA 2PO6C 2HN7A 4EBQH 1DVFC 3REWA 4JRXB 1G6VK 2DKSA 1VEPA 4F2MA 5FO9B 2DIAA 4Z7VE 2ICWA 1NMCB 4FQIH 3CFDB 2WBWB 5CBAB 1MQ8A 3N85H 3QDAA 3DYMA 4Y5XA 4YR6A 1T1WB 1H0DB 4QRQA 5E5RB 1T0MA 3C5SB 1LNUB 1HXYB 1MFBH 1G7LA 3RWEA 3MXWH 4XNUL 4Y19A 1YEHH 4NQDE 1JGVH 3LOWA 1AFVH 1WBZB 1CD9B 1P84K 3FB6B 3QUML 2NW3A 2DMBA 3GK8H 4H8WH 4H20L 2D2OA 3WIHA 2C1OB 5T3XH 5ALCL 3QXDA 3H7BA 4KK5C 2B2XH 3Q2CA 1UEMA 1PLGL 4UMGA 1QO3B 3R06A 5EUOB 2AK1L 5GRZA 4ZDHB 3BO8A 3P4MB 2EO9A 2P7TB 2P8MB 1VFAA 5I75B 3UMTA 1QSVA 5JTWA 3QDMA 2W0LA 5IBLD 3PDGA 2K7QA 3BD4A 4NM8H 3RQ3A 4TVPL 1HHHA 5JW5A 1FG2B 3LS5H 4KI5D 2IAMA 4NIKB 1ND0A 1S9XA 2D9QB 1LEIB 2W60B 3F7VA 3QT2A 1BJ1J 3EOTL 3MLVL 1WC7B 5ID0A 3KPPB 1KOAA 3BH9B 1S7UB 3ZKND 3ZYZA 2J8UE 4PJXE 5E1AB 1ZSDB 4XGZA 3W0WD 4ODTL 3SO3C 3OKOB 4JQXC 5GZOD 2DQTH 1PY4A 3UTQA 2AEPL 4LSDA 1CICD 3U0TA 5I1IH 3WDHA 2HFFA 4NWTL 4N9GB 4UV7H 4Z7QF 3TCXA 2EXWC 1J0YA 4KRNA 1CLYL 1G9ML 2A1WL 3WIIL 4OD1L 3TFKC 2OMBA 1JF1B 1A7RH 2EH7L 3ARBD 4HIHA 1G6RA 2NY0D 3VXQB 5D7LB 2P45B 4JO2H 4J6RH 4Z7WE 3RY4A 1JPGB 1EX0A 4R7DA 5JLZA 1IC7H 2R9HD 2VOTA 2IG2L 2DD8H 4DWHA 1IQDB 2VDPL 2X9XA 5HGAB 4GJTB 1KTDB 2UVFA 4NZUH 3BMVA 1DLFL 4XBGA 4YDLB 5IQ9B 1OPGH 3BD5A 3N06B 2VN7A 4LVNB 5DQJA 2BNQD 3GHEH 5IESH 5DK2A 1MCLA 1N6UA 3DX7B 1HHJA 3HE6B 5DD3H 4Y4KC 1CQKA 3CFIC 3X12A 1GOHA 4Q6IB 1MHEB 3MV8A 5CIPA 4OD3L 3P0VL 3PWUB 3IAQA 4P4RB 4XCYA 5CILH 4EJ1C 4PY8I 4HBCL 4YPGB 4U1IB 1YECL 3LCYA 3THML 2EDNA 4RAUB 3MLRL 1D9KD 2VLRD 4H1LA 5GHWL 4ONOA 1YY8B 5GS0C 3CZFB 1XF4B 1NC2B 2YPKB 5EU6A 2E27H 4X7EC 1K3ZA 4XMLL 5C6TL 3W39A 5IFAL 1HNFA 3WHXA 1T1YA 4QNPF 4X9HA 5DGQA 3FT2B 3EYOA 5DUPL 1UWXH 4TPRH 4GRLA 2Z91A 4NO0D 5TPWH 2MHAB 1KBGL 3F7YA 4DUXA 3NCJH 4Z7UA 3O6LL 1R3HA 5LGHH 3NCYP 2Y4SA 2XA8L 5BZWA 4Y5YB 3U9UB 3AB0B 4R3SB 3HR6A 1G9EA 2VN4A 4M7KH 4N0RA 3L3JB 4AENB 5KVEH 2Z4QB 1MH5A 1ZOXA 4I3RL 1DN2A 1MVUA 1R3IL 1UJTA 1WUNT 5BMFL 5DJ6B 5CGYD 3CXDH 1DVFB 4C56A 3B9KA 4N0UA 2CDFB 1JPTH 3G04B 3KPMA 4JDTL 1TJIH 2GJ6B 1VFBA 1MHHB 4WU5A 3RY5A 4LSSL 1KN4H 4YDKL 3CLEL 3ZSTA 3TESA 1PVHA 3DGGA 3DYPA 2AK4B 5LCVH 1CTOA 1EUTA 4ZMAT 1OAUL 3KPRD 3QUKA 5F7WC 1XGYH 2AJ3B 4G6FD 4NHCL 3NACL 1RD6A 1KULA 5DFVC 1OAKH 3D0VA 4PRNB 3V8CA 4X80H 3FT3A 1QSEB 4KTEH 1BOGB 1ES0B 4HWBA 5T5NF 4F58H 3E1F1 4EOWH 4PRIB 2P8PA 4JJ5B 2FHFA 4N8PA 3ALWA 5L6YH 4QXTA 4M5ZH 5HVHC 1OTTC 4QYOA 5C9JA 4Q2ZA 2BY0A 4TUKL 3S34L 5I1JH 2XN9E 4CN1A 4ZO9A 1S7VA 2E5EA 5IVXF 4DUWA 1U8JB 2FO1A 3CAFA 4F15C 4A6YL 5E99H 3V4VH 2E9IA 4OLUH 4XMKL 2AVGA 4WFHD 4Q6YA 4M62L 3I50H 2YD6A 1FNHA 2IPUK 3LH2L 1ZLSL 1XCTB 2H26B 1XZ0B 3HMXL 3SO3B 5IB4B 1DZBA 5TDPB 1JNNH 4ZUUB 1QRNB 5L2KD 4Q7DA 4OGZA 4KK8C 4M6MH 5GGSB 3KYAA 3Q6FA 3G6JB 4H88L 1A3LL 1S5IH 1BVKA 32C2B 4FABH 3R1GH 1SHMA 3HNSH 5F71A 2GT9B 1WICA 1CT8A 4RAVB 4OAWB 1GIGL 1KCVH 2CUIA 3VI3E 4TQEL 1NEZA 3A6CH 4HLJA 4NOBA 4F7EA 3LN5A 3FT4B 1NGYB 1G7QA 1OSZA 2FJHA 3JWDH 3IDXH 3MV7B 5BOZG 1R24B 2NY0C 3AMLA 4YGAB 2CRYA 4ZOBA 1KLGB 4LSVH 5KW9H 2HJKB 4QY8B 5D7JC 5IR1A 2Y5EA 1FZMA 3DX6A 43CAB 1JWMB 4B0MM 1I7UB 1G0XA 2YK1H 5I19H 1YPZA 5GISH 2W9LA 4G43B 4HMCA 1KC5H 5F93C 1JWUA 4BSVA 2NY1D 1A47A 2YN3A 1NGQL 3MX0A 3R0MA 1FZOA 5JOFA 1RZJC 2VDMH 1U8IA 1YYLH 5IROA 2IANE 2GJZA 4HV8A 1J1XL 3BIKB 2WUBL 4XZUA 1B0WA 2X89D 1JHKL 1HHKB 5ESQB 4WFGE 2EDTA 3TPUB 3NFPB 3DVGB 3FL7A 2FGWH 1AD0B 3O6FC 5F9JA 5C07E 1PG7X 3V2AR 2WQRA 1EH9A 5DC9B 1QHOA 2BNUA 2LAAA 3HZYB 1ZA3B 3JWOL 4ZQKA 4UNVA 1E27A 3MBXL 2GKIA 4YXKL 5LJYH 2CK0H 5SWSB 1MAKA 2MPAL 2DQGH 5DZOA 1R5WA 5KBNC 1NGZB 4N8CL 2FHCA 1JZ2A 4CUCA 4PRHD 1C5BL 2EYRB 3FFDB 1GGIH 2Y36L 5EU4B 4O4YH 4PJIF 5D1ZD 5DJ2A 2EE9A 2DL2A 4DGIH 4G3YH 3A67L 1PKOA 3Q6GL 2HLAB 3VFMA 3QIUA 4QRRD 3VXUE 4KKAC 4ODHL 1K9TA 2E9JA 5DGRA 4K3EL 4YDJA 4RGMC 1BD2E 3LRHA 5GSVB 4U6XB 4GXUN 3OPZL 2P8LB 4RGNB 3D39A 3V6ZA 3D3VB 2CDGB 4ZAKD 3QUMB 5EOQH 3GUTA 12E8H 1Q9KA 1DEEA 4NKQB 4OKDA 4CADA 3MPCA 3U7YL 5LWYL 3PE9A 4NO2A 4TNVK 1MCQA 4DN3H 5ILTH 4HT1L 2FEDD 3UTTB 2EYSB 4KAQL 5TDNA 4MSWA 3QIWD 1S7QA 4RMTA 3KR3H 2A0LD 5T3XD 5KSAD 1QBMH 5JA9A 3TBVA 2OL3H 4KHXH 4RAHA 1U58B 2R56L 3MC0A 3RUGB 3HUJE 4YGVB 4ZO6A 3MOBL 1PKQA 3BDYL 2Y6SD 1NC4B 1KJ2H 2CO7B 2VZTA 1IGFL 4PJAB 4U1LA 3WNPA 4WU7A 1LO4L 5HVHB 4EN3D 1BAFH 1TTUA 1TVHB 1UYWL 4R26L 5ABDE 5DZNA 4F7TB 5FUCC 1Q94B 4R0LC 4JY5H 3FQUB 5F3HB 4F15B 5DMKA 5IG7B 3LN9A 2EC9T 3BIBX 1IGMH 2OJEB 1ITCA 3FZUC 1EIBA 4B5EA 2A73B 5C7XH 1MCSA 3GBNL 1JFQL 4XCCH 3TM6A 1SYSB 4HPYL 4C58B 1KELL 2P5WA 4P2RD 4CJ1A 4JRXE 2X4UA 2Z92B 3PGFH 2A83B 1IEAA 2VXTL 1QACA 1KNOA 1JZ3A 4EI5A 4QOKA 5FDWA 2ZSWB 4XHQA 4F7PA 4JFYA 4FOMA 4PBWD 5E8PB 1Y18A 4HWUA 2HRLA 4F8TA 3O3DB 2G75B 5MEOA 4GAJH 3DX9A 4ETQA 4EUPA 2HVKA 4XPTL 2P48B 5AWNH 3MGAA 5EUKB 4YXHL 1M71A 2FEEI 3IRZA 3WJJA 1RK1B 3EIFA 3KXFD 3C8HA 4N1EA 2XXCB 1OHQA 3ZKXC 3RZCD 5EUOE 2YA1A 3UTSD 2Y06H 5D7JB 2YZ1A 1C08A 1BFSA 5HGDA 2QQKL 1UB6B 1S9VB 4DVBA 1FNSH 1EGJH 4B41A 1IFHH 1FVEA 1I8LC 1EHLL 1IGTB 4QRTA 4ODWB 4KROC 3JWOC 4HKBB 2BMKB 1UG9A 5J0BA 1BIIA 1ZVHA 2EYTA 5H2BB 4R7NB 4FTVA 5JW4N 3ARDA 2QSCL 4AM0B 2X70A 4L5FL 2V7HB 4HUUB 3O6FB 4R6UA 1UZ8A 1Z9SA 3V4UH 1PYWB 1P7KA 3EYFB 3OZ9L 2IPKB 1KEMH 3L5WB 2JB6A 5IWLC 5FCUH 1ORSA 2VABB 1IM3A 1R3LB 2HJFA 4ZFGL 2LE9A 2E7MA 3RWFA 5ITBH 3EBAA 3TT1H 3ZYJA 2BCKA 3T0AA 4LARL 5T33H 5JXEA 4WWID 5BZDA 3U1SH 5ENWB 3IFLH 2BOBB 4HKZA 2PTVA 2AV7A 5D7LE 4Z78A 4PJCF 1U2HA 3T3MF 3FO1B 4JFDA 4K3DL 5HHOA 1BGXL 3L5XL 2AJZA 5IHUH 5IB2B 4XNXL 3FO0H 3HI1B 5D93C 3QJFB 4UILH 5D1ZC 3H6JA 4ONGH 4XCEB 3PWNB 4RGMB 5FECB 1EEZB 3RDTC 3BW9B 1ERNA 1U6AL 2J88L 4OQTA 3DV6A 5CEZD 3NA9L 3VMPA 1CLOL 1PQZB 1BQHA 4LQ1A 2BVTA 3BP5B 1Z2KA 4O9HH 1Y6NR 2GCYB 3OKKA 1TIUA 3BT2L 1I1YA 4P5TC 3H3PL 2JB5L 2HJLB 1E4WH 1QPXA 1S7XB 1XGTA 4HSQA 2FJFA 4NUGL 3SGEH 4HIJB 4PY7A 3IDGB 2HFEB 5JR1L 2ZG2A 4Z7OE 3ZE0E 1RPQA 2OK0L 4PJ8B 1QLFA 4XXCA 4D0CB 2OQJA 3ZL4H 1SEQH 3KAAA 3T0EA 2NY3C 5IK3A 4A6YB 1FE8L 3K2UL 5M7QA 1ZWIB 1OARH 2QTEA 1OB1B 1P84J 3OG6B 2ATPB 4WO4B 5BV7L 3EYSH 2Y23A 3WJLC 4L3ED 3ILQD 1FH5L 3L3KB 1SEBB 2DM2A 4RISL 2Y6SC 3KLDA 4EN3C 5KS9B 2DN7A 3WFDH 4PP1D 1YN6B 3BHBA 1T1XA 1S3KL 3S35H 1I1CA 4PJEB 1I9EA 4FZ8L 4ZFFB 2VDQL 3BI9X 3QNXB 3DXAB 4LLVA 4ZPVA 1WBYB 4XNQA 1CWVA 1CGYA 1I1AA 2JLLA 4OUUB 2PTUA 4YHPB 1S9KC 2FBJH 3EJYC 5KAQF 3SJVB 4U1KB 4IJ3B 3OJVC 4L4TB 4P23C 2A38A 2GJ6E 1ZAGA 4WTWA 5DA0B 3O45A 1NL0L 5IW3A 4X7CC 2QBWA 5C08D 5TH2B 4PJBF 2AK4E 3OKEB 4CN4A 3MLSH 4XBPA 5F7LB 2O5YL 4ZFOA 5INDA 4KKBD 3FO9B 1LO3L 4FQHA 1F6AA 5DMIH 1KIRA 2X6MA 2GK0A 4GXVH 4OZ4B 3I6LE 1QSEE 3S36H 3ZKXB 1XGUA 4PRIE 1D5BA 1X7QB 4MAYD 4YHOL 2H8PA 5HGBB 1T5XA 4K8RH 5JDSA 2YD3A 25C8H 2APBA 5DJXA 1LO2L 4Q9BA 4PJ7A 4LIQL 5F7MC 4FFZL 3H9HA 2XZAL 1XEDA 1H3TA 3ULUF 3DROB 3GSUA 4H26B 4NNYB 2WUCL 4KZEH 1X3DA 3ULUH 5IBUG 4W6YB 4OFVA 4L29A 4KROB 3PHSA 3LS4H 4JM4L 5F9OH 5FKAB 3MV9B 2EIZA 5JMRA 3UJJL 2K1MA 4U6VL 2PXYD 1EFXB 4UNUA 2NY5H 3I3EA 2DWDB 2NX5D 3ZKSD 1QRNE 5L2JA 1FBIL 4AG4L 3LY6A 4HUWB 2HRPH 1TVBB 3G6JE 5CFHA 3RJDA 1YEJL 5E8NB 3QG6B 4TRPL 1MCOH 4OM1L 1A4KA 1A0QL 3KPQB 1NCAL 1GAFH 3MMEB 1A6TA 4IIQA 3PG2A 1CU4L 3QUZD 2MCPH 4M6AA 2FZ3A 5T5FL 3TZVA 1FC1A 1A6VL 1JGUL 4C4KO 3MV7E 1C5DB 5F7NC 2XY1A 1DBAH 5EZLA 5F1NB 3PABB 3IDUA 3VG9C 3M45A 1CFVL 1IGCL 4NRYB 5CMAB 1I9IH 1Z5LB 5HDBF 2WINB 1FL5A 1FPTH 4BKLA 3RDTB 3TO2B 3WFZA 4KXZH 4M61A 4IRJC 3V5KA 1INQA 4P2YA 3KPOA 2FYYB 3C2AL 3DSFH 1F5WA 3MREA 1Z3GH 4MJ6A 1OAQL 3LMJH 4F3FB 1BZ7B 4P5TB 1XIWA 2R2BB 4O2FB 4HKJB 5CSZA 3OJMB 2E9BA 4X98A 3I9GL 2VISB 4YDIH 5J3HD 5TF1L 4I5BB 2NTFA 2I9TB 1G84A 4UTAH 4HUKB 1ZHNB 1HEZA 1UKQA 3LIZL 3EYQC 3TIEB 2NY4D 3ECBA 3VFSA 2MJWA 4U1SB 2NY3B 1EEYB 4X5WA 2IBBA 2ZCHL 4MAUL 1E4XI 1MREH 1ED3A 3ULSA 1YEIH 3H42L 4OLYL 1R0AH 5EPMB 1RMFL 3CFCL 4LEXL 1LK3H 1A2YA 5SWSE 1F8TH 4NKMB 1E28A 1XF2B 1MCRA 4JKLA 2GTWB 1TJGH 1VDGA 1N6QH 3CU1A 4LCIL 3DI2B 3MUGA 5E24E 4N9OB 5IB3A 4K94C 3VFRA 2X1QA 3RGVD 3KYOB 1MJJA 1AC6A 3WEXB 4DQOL 1N6VA 3HZMA 4YEFA 5C9KA 3ZHKA 4MXQC 4Z0XA 1A3RH 2UWEF 4HDIA 5GZNC 3ZDXE 1A1NA 1DFBH 2WQ8A 5KG9B 2I25N 3LEXB 1MUJB 4DKEL 3WIHL 3SE3C 4KRLB 4RGNE 1V05A 1ZHLB 4YHZL 1BPVA 3PL6A 3D3VE 1A9BB 4P23B 2F5AL 4L4JA 4WUKL 1KEGH 1MI5A 3MBEC 3H3BC 5GJSH 1T1ZB 3NN8B 1MHCB 2NXZD 4QHUB 4U6TA 4S1QL 5DJZB 3VGAC 3HRZA 2XKSA 4NCC2 3UTTE 4HFWB 1HILA 3VWJB 5D7KE 3QWOB 1W0WB 1U8KA 2AQ1A 3WUWA 3BN9C 5FHAL 1QA9B 2W0PA 2D31A 5DT1L 4L4VD 3TP4A 3IJYB 2VH5H 2XY2A 3RUGE 4TVPE 1H3VA 2B39A 3T65B 3QQ4B 4UQ3B 4Y1AA 1GH7A 3SKJL 4LRNH 4MWFA 4PJAE 5F3BB 4LBEB 4BFIA 4LLYB 4MAYC 4QHNB 4M1CD 1T3FB 1IAOA 5EZJA 4RIRB 3VMNA 4KTYA 3ES6A 2V2XA 2PYEA 4ODUB 3L6FB 5GGVH 4UTBL 5D7IB 5E70A 1LDPL 5KSUA 3QCTH 3QDJD 5IMOB 1IM9A 3OKMB 4OCLC 4NWUH 4ZNEA 1MY5A 1MFCL 2VE6A 4XVUC 1M7DB 1UWEH 2NY2D 3V79C 4J8RB 3GMNB 1VACB 2YKLL 2FJGA 5D5MF 1J8KA 1G6RL 2ARJB 2Y9RT 1QSFB 2ZOKA 3MXVL 3QULA 5CCKH 5C0BD 4D9QD 4DKAA 1BP3B 3X14A 1PD6A 4HIIA 3QCVL 3VRIA 1T89A 5C3TA 2A6IB 1EO8L 2OLDA 1HSAA 4OGXL 3RTQD 4LLQA 2DQUH 4BSWB 2COQA 2HT2C 4OZGB 1I4FA 5L9DL 5F97E 3DWTA 2OS7A 5K9KA 3DHMA 4UT9L 1OY3B 4UOJA 3FONB 4NSKA 2HMID 4XVSH 4XXDB 5EO0B 5AAWA 3S4SB 1II4E 2MKWA 1CE6B 2UY7A 3H9YA 3EFFA 2X4SB 1VGEL 4CKVX 3VG9B 4OCRL 2FX7L 3RZWA 3W11D 1QYGH 2X9YA 5GJTH 4YHIA 4ODSL 2CXKA 1AHWC 5C0IA 2X1OA 1H3PL 3HHRB 1OAZH 2Z0BA 4HJGB 2E7HA 3WL9A 4RMVA 4KZDH 1D5XB 1LK2B 1FFOA 1I9JL 2W9DH 1UQSB 1WSST 3CXHJ 4X6DF 5HD8D 3QQ3B 2WZPD 4D94A 4RA3A 3WN5C 3OX8B 1N26A 3Q3GB 2YSSB 5BV7B 3OSKA 4D8PB 1XGRB 4QGTA 4L9LA 3F58H 4KKNA 4YQXL 1S5HB 5C8JB 5CJBA 3TBSA 1P5VA 3E3QC 1NAKL 3NIDF 2BVQB 4GRWF 4Z5RA 4UIKL 4Y5XC 5HHXL 4Q9RL 4GRWH 1FJ1A 4OCSH 4D3CH 4G8GB 3S9DB 3I75A 5FYJL 1UM5H 1KCUH 1JGLH 4GQ9L 2V9QA 4LKXA 4PJHF 3LB6D 3L3IB 4DK6A 3IXAA 2JE8A 4ENEC 1ZT1B 5DRZA 1R3JA 5HHPB 2WM0A 4MQ7B 4TUJB 1K3IA 1Q9LB 3PDDA 3QHZL 3OL2A 3BP6A 4X9FA 1F4XH 2F54A 1ADQA 3IVKB 3IETA 1DBBH 5CZVH 3MLWL 3ZDZE 1ZEAL 3BYTA 3VA6A 5AZ2L 5GS3A 1RZ7L 4M5YH 4UQ2A 1OM3L 3DBXB 1CDYA 1WAAA 1MRDL 2CGRH 4ERSH 2MQ0A 5ID1A 4NJ9H 5J11C 2XNAB 3TBYA 3K8LA 4ELMA 4DAGH 4G6MH 1T2QH 4XVTL 1SVZA 4WUUA 1A6WH 2EKJA 1NFKA 1K5NA 4JRYB 3GB7B 3MBEB 5SWZA 1YN7A 4X5XB 2VZVA 5ESAB 1MFDH 1YEKL 2R0WL 4NQEA 3STBA 5CJXA 1KCLA 2JK5A 1PG7L 2VITA 5C6WH 4AK1A 3FOMA 4P4KB 5IB5A 2NXZC 2R1WB 1YNKL 2YRLA 35C8H 3EGSA 3Q0HA 4D9LL 5DS8A 4LNVA 3RVXD 1J1OH 1OGTA 3KPLA 1F3DJ 5DEZA 1VFOA 4K8RD 4YUEH 3ZLQC 3QIBA 3SO5A 2AEWA 3OR7A 1K8IB 5ICXA 3BEWB 3OXSB 3OKLB 2KQNA 5AYQA 1AGBB 2P43B 3N50A 2OL3A 4E41A 3CFEA 2DWEB 4YE4H 3J7HA 5FUCE 3VD4A 2N56A 1BVLB 5KS9E 3IGAB 3ULUD 2A74B 4M1GH 5D8JL 2YUWA 4XTRC 4MCYA 2B1HH 4PUBL 2W1NA 4GMTL 4M9PA 4PJEE 2CJUL 3T1WA 2EE6A 3G5YA 3VW3L 4POZC 2OR8A 3MJ9H 4HAFA 3MGOA 3DXAE 2EKSA 1U8LA 4GG6B 4WDIA 1YUHB 3MJ7A 3TA3A 3FRUA 3AM8A 2OX5A 4C83B 5C0RL 4JREC 1S7RA 4HLZG 2Y7QB 5I9QB 2P42B 4J3TA 1V7NL 4FP8H 2CUMA 1Q0YH 3SJVE 2NY2C 2BVPB 4DCQA 4L4TE 2DDQL 3MV11 4ORGA 3T0BA 3LKOA 1VGKA 5J57B 1SM3H 5I74C 2JCCA 5H94A 4XP9H 5KTEH 5AD0B 3ABZA 4KDWA 4OD2A 3C60D 4TSBL 4U2ZA 3GIZH 2LABA 1XGPB 5ICZA 3S5LG 1I7TB 5HHNA 4HXAL 2P4AB 4BM7A 5DTFA 3ZTNL 1MCPL 3HS0B 3MQIA 4FZEH 3T3PF 5T1MB 1CFQA 4TULL 1TTFA 1NMAL 2BFVL 1BZ9A 4XWOC 3EYVB 2NPLX 4ZXBB 3P73B 4U6YB 3MRNB 1YDPB 2KDGA 2Z8WC 2YD9A 4GUPA 4EXPX 5I2IA 5IMMA 1U8NA 3JUZA 5BXFA 4PJXA 3SDCD 3CSPA 1V5JA 5ICYB 5DRXB 4GRLC 4JPVL 1AP2B 1AHWB 2FB4L 2P5ED 3H3KA 1A1OB 5C0JB 1BX2B 1JF6A 1MFAL 3GJFH 3GMPA 5I16B 3QCUL 2ZUWA 2KH2B 2DQDL 2BC4B 4JY4B 2NNAB 2X4PA 4UINH 4U1HB 3FFCA 2HTKC 1G7HB 3A6OA 2VLLB 1EGJA 4XH2A 3MV9E 5HD8C 3RWIB 3REWB 3GMMA 1NCTA 5HYJD 2JJVA 2YD7A 2ICWB 3HPLA 4NFBA 5BVJB 3CDYA 1DQLH 4HIXL 1WK0A 4Z7WA 4M48H 3FOLA 4YR6B 2XIDA 4QRQB 4J3UA 1T0MB 1CFTA 4K9EH 5FM8A 1G7LB 2ZCKH 5CEYA 4Y19B 3X13A 2DQIL 3VU2A 5I15H 4FQ1H 1QFPA 1KB5H 3FKUS 4DEPC 4EVNA 4UNTA 3SDDD 2NW3B 4I2XA 5IHBA 1TQCC 3LB6C 2CLVA 4NZJA 1F4WL 1T21A 1HK6A 3QXDB 3H7BB 4NZRH 4XCFH 3CX2A 2DQEH 3R06B 3WS3A 3BH8A 4YXLH 2AJUH 2XZCL 3BO8B 3WCYA 4KK6C 5BQ7A 1VFAB 1UH4A 1U95A 4AEIL 3ROLB 3QDMB 1XR9B 2B1AH 1BLNA 3E6HA 5J11B 5F6IB 3MLUH 1HHHB 5JW5B 2IAMB 4PJCA 3CNKA 1JN6A 5DRNA 1T7YA 1FSKB 3L1OH 1RZKC 1F2XK 5DHYB 3F7VB 2X42A 3CCHA 4DGVL 1I1RA 2VQ1A 4RMWA 5ID0B 1F6FB 4HZLA 2QADD 1GZQB 3P4OB 1MJUL 2DI9A 4XGZB 1JZ6A 2W9EL 4FMKA 3TT3H 4MB5A 5IW1A 4QHKJ 3IFOA 4XNZC 4AMKH 1KLFA 3FN0H 3UTQB 5T1DL 3U0TB 2HFFB 4MD5A 3F7QA 5FO8A 2VDKL 2YPLA 1FNFA 3KPSA 3LKQA 3LEVL 2DQJH 3VFVA 1DSFL 4LSQL 2WANA 5IOPA 1BFOA 2IPUG 4HC1A 4HIHB 1G6RB 2BJMH 4ZUTB 4LSTL 5F9AC 3O6MH 1DP0A 1CDHA 3EO9H 4Y16B 3VGFA 3MV01 3O8XD 4R7DB 5JLZB 3V0WH 5DYOA 6FABL 1QFUL 2DTMH 4HS8L 3BRGC 2BVOA 1SBBA 3QUXA 1I7RA 1KB9K 1KGCD 3ZYOA 4JREB 3OF6A 3DRQA 1FL3A 3UZEA 4Z8FL 4OTXH 2Q86A 1LP9F 4XBGB 4XNYH 4OIIL 1SYVB 2C3WA 3PP3H 1MNUL 5DQJB 4JO3L 3RL2A 3K2MC 3ARFD 3C6LA 5DK2B 4WI3A 1A9EA 1IGIL 5I74B 5IROC 5I1EL 3WFCL 2J4WL 1TETH 5E8OA 5FM5O 2UYLA 2LU3A 1CR9L 5AUMA 1FZKA 4H1LG 2H2PD 3X12B 5E2VL 3PWPD 3MV8B 5CIPB 4JVPA 4I77H 1MAML 4XCYB 2WP3O 3D2UA 1YYMH 5HTSA 1FORL 4RMQA 1ACZA 4H1LB 3VJ6A 5EU6B 3QYCA 3WHXB 1T1YB 3TYGL 3VFWA 4HX1A 1N4XL 3EYOB 3FQWA 3GBMH 4KPHL 4GRLB 2Z91B 4QRSA 5E03A 3F7YB 3R0NA 4WFED 4Z7UB 1R3HB 4NN6C 1AXTH 5EU3A 5D7IE 3LDBC 5BZWB 1SY6A 3UZVB 5DK0A 3MLTA 4M7ZC 3EDJA 1MVUB 1PG7W 3IXTB 2HT3C 3F7PC 4FFYL 2ZKHL 5I71C 3MLPA 4L1HA 4YJZL 4C56B 3B9KB 1BJ1H 1QSFE 4N0UB 3KPMB 3WHE0 1S8DA 3UPRA 2MSPA 4QRUA 5I66A 4JPKL 5IHZA 4M43H 3PP4H 4M4RA 1VFBB 2HTLD 4K7PX 4PRPA 2OR9H 5I6XB 4U05A 2I27N 4WU5B 1FFNA 3VXRB 4ALAL 5JO5A 5JNYA 4HJ0D 4HBQA 1V8HA 2X4RA 1XR8B 1A6UL 3F6IA 3DGGB 4BFGA 1I1FA 4OZGE 4MA7L 5D1QD 1RZGA 3QUKB 4LNRA 4OQTL 4DEPB 3ZTJH 3RWGA 3X3GL 1EAJA 1E6OL 3E8UH 4LHUD 1EEUA 1TQCB 3S35X 1B0GA 1U9KA 3D0VB 2YPVH 3V7AG 2OSLA 2Z31A 3AS0A 3SDDC 3ZDYF 5KJRH 5EOTB 2P8PB 5CSGA 1CBVL 2VIRA 2BSTB 2YHGA 4LLWA 4RWHA 4QYOB 4AIOA 5C9JB 4Q2ZB 5B4MD 4IRSA 1S7VB 1QRKA 5C07A 1G7JA 4G8IA 4HH9A 3G9AB 5ADPH 5JIKA 1LQSR 1CGTA 3O4LD 3U4BL 3HZKA 2O5ZL 1HQ4A 4X7FC 5GQBA 4LLDB 2OXHA 1OD9A 5E5MA 4YX2H 4CNIA 1G9NL 3GI9L 3I85A 4XNZB 1U0QA 5D9SB 3U2SA 4EI5C 3Q6FB 3TVMA 5LBSL 3S36X 4RFOH 4Q9QL 1BVKB 1JMXA 3QUYA 3VXUA 2RIKA 3ARRA 1CT8B 2AQ2A 4G8GE 4TOYL 4MQXD 4PJ9A 1XF3A 3L95A 4EDWH 4F7EB 3LN5B 2FGZA 3MA9L 2ADGA 2DLEA 1G7QB 1OSZB 5L0QC 1OTUC 1EMTL 4NRXA 4AEFA 3WJJC 5CJOL 3CVIH 4KWUA 5EULV 2DLTA 4K55A 2R29L 5B39A 2PYFA 1NBZA 3UDWA 4FQIL 3UBXA 3RA7H 3BX7C 4JFEA 3O8XC 4JKWA 5IR1B 5CJ5A 2CIIB 3GIVB 1FZMB 2B4CC 4Z7VF 3DX6B 3N85L 1N7MH 3U4EB 1JHTA 2C4FT 1YPZB 4X7TB 2VAJA 1MFBL 4LGPB 1JWUB 1TZGH 3MXWL 4TSCH 4BSVB 1YEHL 1FZOB 5JOFB 4JRYE 1U8IB 4R4FH 1AFVL 2D0HA 2GJZB 4HV8B 1NCWH 5DEGA 4XZUB 3GK8L 3GSVA 3ARDC 1BFVL 4POYA 2OTWA 4HKXA 4XP4L 1VPOL 2B2XL 1WTGT 5TJWK 5TE7L 5F9JB 5A3IC 1PJ9A 4LIQE 4XP5H 5DMGD 1L9MA 2BNUB 1JVKA 4HUMB 2WBJA 2VLMD 4ZQKB 5GRVL 2BRRH 1E27B 4FFWD 4EIGB 1QZ1A 4JQIL 4NM8L 4MJ5A 3LS5L 3T08A 1EHXA 1JPSH 5JOPD 1EAPA 2CIKA 2XG5A 1QLEH 5J89A 3WNOA 5MEQA 1U92B 1R5WB 1CF8H 4YFEA 1X5AA 4NN6B 4N8VA 3EUUA 2J8UF 1KENL 3JV4A 3LDBB 4OFIA 5DJ2B 3MCKA 3VFMB 3QIUB 1WCQA 5EIVA 3OKDA 3K0WA 3O3EA 2DQTL 3ZE2F 3C5SA 4S10A 4YDJB 1UM4H 1IC4H 1LNUA 2GY5A 3B8YA 3C8KA 5FK9A 2YOCA 4GG6E 2BK8A 5I1IL 2GTZA 3ARBB 1A6PA 4UV7L 2VTFA 5C92A 2VDOL 3D39B 3FB6A 4JR9L 5F7DA 4LFHD 3V6ZB 4K71C 5I1CH 2C1OA 1Q9KB 3GUTB 2H32B 1DEEB 2R0KH 1A7RL 4CADB 1QD0A 4P46D 4NO2B 2DLHA 4X4ME 2C3GA 5EUOA 4WHDA 4JO2L 5D5MA 5HGGS 5TDNB 2IFGA 4MSWB 3RVVD 1IC7L 1S7QB 3NAAH 4YH6A 5J8OA 3NIGF 2DD8L 2FECI 3CSBA 2V7NA 3TBVB 4N5ED 5DLMH 2O61A 1AD9A 5D1QC 5E9DD 3T0EC 2YD4A 5HSFA 2J6EA 4NZUL 2AXGB 5C86A 2Z9TA 1PKQB 3TN0A 1JNHA 1T20A 1HSBA 3SGKA 1OPGL 4KK9D 4U1LB 4WU7B 4OM0H 4WW2B 3FMGH 5IESL 5CAYB 3CU7A 4HF5L 2QSQA 3OKOA 4XC3H 4NFCA 5EZIH 4MNQD 3HB3D 3ILPA 5B4MC 3OGCB 5DMKB 2VLRB 3JBG7 5DD3L 2G60H 1U8OA 1RUAH 3L3GA 4JY6A 4V1DD 1FHGA 3QO0A 4BZYA 5JIIA 5CILL 1ITBB 4N9GA 4OLWL 3M07A 3CJJA 3DECA 5K9QI 3G9VA 1RIVH 3UTZB 3QDGD 1T66C 5FM5M 1I1AC 2P5WB 4RMSA 1E4JA 1EO5A 1JNLH 2X4UB 3FN9A 2E27L 3RHWK 4EQ2A 1IEAB 3PJSA 5MI0C 3OG4B 1KNOB 2DBJA 4EI5B 4QOKB 5FDWB 4F7PB 4JFYB 4X6DA 5TPWL 3NCJL 1OVZA 2R1XA 5LGHL 1Y18B 3RBGA 1L6ZA 4GLRI 3IDNA 4NDMA 3CD4A 4Y19E 1KIUA 5MEOB 4AH2A 2ERJB 4EUPB 3DX9B 4ETQB 1NFDA 2HVKB 4M7KL 5GGVY 4GS7C 1EFQA 5KVEL 5ELIA 5EBGA 1DBJL 5L0QB 1M71B 1MCWW 4OF7A 3B9AA 2VYRE 4C57C 3IYLW 1RSFA 3CXDL 4G9DA 4QLRA 5D1XD 5D6DC 4Y4HD 3DX7A 1JPTL 1TJIL 4CMHC 5ADOH 2VZ1A 3AY4A 1C08B 1MCWM 5HGDB 1FRGH 5F88B 3QDME 4DVBB 4Q0XL 2C5DC 3QP3A 1OGAD 2ILLA 3EZ8A 5LCVL 4QRTB 2DM4A 2LV4A 1IQWH 3VXPA 3OB0H 3VWKA 4MD0A 1XF4A 1BIIB 2DIBA 2EYTB 3SE8H 1CZ8H 4FTVB 3ARDB 5IVZA 1OAKL 1OT1A 4X80L 4QRPD 4KDTC 4KTEL 2X70B 4EOWL 4K7FA 3OMZA 5L6YL 1T4KA 1BQLH 1UZ8B 4M5ZL 2JJWA 3B2UC 4MXVE 1P7KB 3EOBA 3ULVF 1EBAA 3OAZK 3QFJA 2N4IA 3ULVH 1ORSB 1IM3B 4AENA 1XH3A 2HJFB 3HAEH 5E99L 3V4VL 4GSDH 3RWFB 3V4PH 5D6CB 4IIQC 4OLUL 3TZVC 5J1SC 2DQCL 4HKZB 4PJ5A 2QR0B 1U8HA 2AV7B 2ED7A 3I50L 5EU5A 4Z78B 4TSAH 4JFDB 3IS0X 3GMLA 5HHOB 3O9WD 4HZAA 2AJZB 5DO2C 1JNNL 4GW1A 2R8SH 3NFSH 5J13C 2A9NL 4M6ML 4XMPL 1IAII 1BQHG 3MCLH 2EC8A 4U7SA 5HY9A 2XA3A 1AKJA 1S5IL 1OP5K 4FABL 3L3DA 1RZIA 3R1GL 3HNSL 4LSRL 4JO1H 3AREA 4AL8H 2XTJD 3N1MC 4G6AD 4K71B 1BQHB 3MJ9A 3A6CL 1T80A 3MRGA 1QKZH 3OKKB 2KKQA 5FEBA 1A21A 4XP1H 1I1YB 1XIWC 4PV8A 3GNMH 1XGTB 2HP4A 3JWDL 3IDXL 2FX9H 4PY7B 2J8HA 4OI9A 3MV8E 4MMXC 3K3QA 2NY1B 3T2NH 1JYXA 4LSVL 5KW9L 2OQJB 4UV4L 3RVVC 4I3GA 3HA0A 1F3JA 4Y8DC 3QPQC 5IK3B 1Q1JH 4J1UB 3EHBC 2YK1L 4N5EC 4F9PC 5I19L 3CVHH 5EU6E 1X44A 2YD2A 1BREA 2NYYD 2VZOA 1WFUA 2HKHH 1LO5A 1FIEA 5FHBH 3HNVL 3X11B 4FQ2H 4S1RH 2VDML 3EFDH 2QHRH 4HMEA 1YYLL 4QXWA 1XZ0A 2PR4H 2BSED 4Z7UE 4NQSA 1QRNA 1T1XB 3BHBB 4R2GC 5BW7A 2FGWL 2ICWJ 5EIIA 3ARVA 4ONHA 5HDLA 2HT4D 4UIMB 1KIPA 2Q20A 3ETBF 4LLVB 4NYLA 4ZPVB 5I18L 3P9MA 4RAVA 4C59B 4NKOA 4XNQB 3GSWA 2XQYK 3GJFA 5FYJE 1I1AB 4C56E 3FT4A 1NGYA 4P59L 4LAQH 4OSUH 4N0UE 1FLRH 2CK0L 3PL6C 4JFHE 1MIEH 4XPBL 3CDCA 1B88A 5MI0B 4UBDD 5IP4A 2DQGL 3MV7A 1R24A 5TDOB 4PJDF 1IAKA 3O45B 3VXRE 1VA9A 1EZVY 5CJ8A 3QI9D 2EH8H 1GGIL 2EDHA 1NCBH 1YJDH 4O4YL 2HJKA 4QY8A 5BS0D 4DGIL 4XBPB 4G3YL 4Y2DD 5INDB 3V52H 4JFFA 4FQQA 4ZAKB 4FQHB 1F6AB 1PZ5B 1KIRB 2GK0B 3NTCH 3C09C 1XGUB 2D7QA 1D5BB 1HKFA 3CX5K 1T5XB 5JDSB 5C0AA 3NIFE 3RAJH 1RAMA 1IZKA 5GPRA 5DJXB 3JVGA 5EOQL 12E8L 4TUOA 5D1XC 3AS2A 3EO0A 2R2HA 1A7OH 5KSAB 3BGFB 3DVGA 3H9HB 5TFSH 3SGEI 4M6NH 3GSUB 1CIUA 4ZOEA 4LCUA 1KB9J 3I3BA 5DD5H 1ZA3A 1CGUA 4L29B 3ZKMC 2P46B 3EJZC 4OCYH 4HEME 4NQDD 4OF8A 1QBML 4R9HA 3SE4A 2OL3L 3BKJH 4KHXL 3B8SA 3RBSA 1M05A 2APFA 2EIZB 3EOAB 3HUJF 4G7YH 3QXUA 5DFWH 1OSPH 5DHVA 1BAFL 1UWGL 4JM2A 1BMGA 2X40A 3STLA 3WIFA 1DQTA 4JY5L 2I07A 5A2IH 1B9ZA 4FG6C 5I8CA 2J5LC 2GW5A 1VENA 1A4KB 3QPXH 4HWNA 4YBQD 1P4BH 1A6TB 4IIQB 5GSVA 4S0TD 3QEHB 1KG0A 2FZ3B 4MA3A 4U4BA 1G7PA 4XPGH 3K4ZA 2X4OB 1I3GH 3BAEL 3D3VA 4XCCL 1TZIA 5EZLB 3P40A 5LXGH 2Z8SA 2L7UA 2BHZA 5DXWA 1T22A 3EDDA 4O51A 5IIEA 3LRSA 3JWDC 1IAIL 1FL5B 5SX4I 4BKLB 4F9LA 3VDBA 1YPZE 4FRWA 4M61B 1OP3K 3V5KB 4BQ6A 3VFUA 2B7DT 1INQB 5DVMA 4MZ3A 5IFHH 4GAJL 2CKBH 3RZCB 3MREB 4I18C 4MJ6B 4G6AC 5AWNL 3GSXA 5CSZB 1QBLH 4X98B 3UYPA 1UXSA 1IL1B 2PW2A 1C8PA 5I76A 3F12A 3ECBB 2Y06L 5F3HA 5IG7A 4GBXD 3VFSB 2VZSA 4X5WB 3OKYA 1KUMA 1EA9C 1ED3B 1FNSL 1EGJL 2YWZA 3K7UA 3ULSB 5H35A 1IFHL 1CL7H