3RY4A

1.5 angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
170
structure length
170
Chain Sequence
APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLFEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low affinity immunoglobulin gamma Fc region receptor II-a
publication title Structural Basis for Fc{gamma}RIIa Recognition of Human IgG and Formation of Inflammatory Signaling Complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ry4A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ry4A02
4KJPC 1A3RL 5I1IL 12E8L 3VFOB 5IK3B 1LHZA 3MYJB 3O41B 2KUTA 4C83B 2ITCA 2W0KA 5DWUH 1J5OL 3U9PL 2R0KL 4HC1A 4HS8H 1AH1A 1FDLL 1ACYL 1MCLA 3QB7C 4QLRA 3ELAT 1C12A 4HWZA 2WP3O 4PY7B 5EUOA 2VLKB 3BISA 4JFHE 1UENA 3WFCH 1IMHC 2A74B 2PYFB 3TT3L 1UXWA 4HZAA 4KZEL 4RAUB 4JFXA 4NRZA 4HH9B 2LAGB 2AXJA 3MRIB 5EUKB 5I16B 1JF5A 3SN6N 3VD9A 4P23A 1EMTH 3X3GH 2NYYC 5D6DA 5IVOA 1NFDA 5KVGL 2DMKA 4FZ8H 3DO3A 5D6DC 5FYKD 1G6RB 3KPLB 2VIRB 3VG0H 5I1AA 5IIEB 1N5YH 1CFTA 1HOCB 2OI9B 5EIIB 4OCXL 1LWRA 1P7KA 5TDOB 1HHKB 3NIDE 4WWID 4ONHB 5DD3L 1FFPA 2AEIT 2DDQL 1H0DB 1FL6A 1GOHA 4FQIL 4EDWH 1I7TB 1CF8H 2VITB 3HUJE 5IESL 2CRZA 1DLFL 3D3VB 4U2ZA 4OLEA 4Z5RA 4AEIH 1F4YH 5T5NF 4XNQB 5D1QB 4PP2A 2YPLE 3FB8A 4J1UB 1JMXA 3WN5A 4NKDB 4JZJA 3IFOA 5FKAB 4JZJC 3MO1B 3OAZK 3ULVH 3HE6B 4OLXL 2P49B 2NR6C 2P48B 4PRIA 3SDYH 1KN2L 3FO9A 1IKFH 5CILH 5D8JH 4Y2DC 4MS8C 4DQOL 5CINL 3GSUA 5DHXB 1RZKC 3WL9B 3X14B 5CMAB 2GT9A 5KBNC 5L7XL 2CLRB 1ZA6B 1ZK9A 3SKJH 3UTTD 2RFXB 3LSOB 4WJ5A 4JRWA 2J3SA 2ZG2A 1ORQB 1EEYB 1Q9LA 4AL8L 3HZYB 3MACL 5HVFB 3T8XB 3GBNL 4FQHB 3HPLA 3LKPB 2DL2A 5F6IB 1FL3A 4ZFOA 1CD1A 1PZ5A 3FN3A 3KLAA 2BSSA 5EU4B 1A5FL 1JZ4A 4BSVB 4JM4H 1JPST 2A9NL 5IFAH 1OAKH 4GAYB 3GMLB 4LFHG 1YJDC 3WFBH 4ZS7H 1W0YT 1LD9B 1X5GA 3B2VH 5BCAA 1BFTA 4CW1B 1NGWA 1HHGA 1CICB 4NQXA 4X4MA 3BP4A 2IH3B 2QKIA 2Z8WC 2Z31B 1MCWW 4JG1L 2HWZL 5DLMH 1P4IH 4L8CA 2VB5A 3ME0A 4Y4KA 4UU9B 5C0CA 4WFGE 4Y4KC 2ADIB 3Q6FA 2ORBH 1HNGA 3U36A 2Q86A 1HHJA 4XZUA 5KSAA 1I1YA 4V2CB 5DD1L 3GSQA 5FYLL 4IOIB 1NCDL 1MCNA 2X4NA 4MAYC 1BVZA 1CE1H 1KGCD 1IM9D 4ODWA 5C0DB 2P8PA 3KAAA 2I5YL 3TBWB 5JHDA 2PW1B 3VGAB 4R26H 2F8OA 2QSTA 2J1KA 5KOVC 1K2DB 1GGIL 3UZEA 4NZRL 5DGRA 3SDCB 1U9KA 4FXGB 4BUGA 3SDDB 5ISZE 2DQTL 1VFAB 5I8CA 3U0PB 4PRHE 4GKNA 5FGSA 4J6RL 4OD3L 5DUPL 4RDQF 5KG9A 3RU8L 4X7DC 1FV1A 3NA9H 4BSWB 5CD5D 1SVCP 3M1BA 2W65B 5L8JB 4QRUB 3CSYA 5HY9B 4OCWL 1MAKA 1AE6H 1ZVSA 3BGAA 1BVLA 5LAXB 2FNBA 1MQKH 3MLTB 2GCYB 1YEGH 4G42A 4GKZA 2FX7L 4XNMA 3MZGB 3ISWA 1NDGB 4TUOB 2I07A 4X4XA 4HUUB 2DI7A 5D7SH 3O45A 4GRLA 1LEKB 3VMPA 1IC1A 2FHFA 3B3IB 2E5EA 1P2CA 3SY0B 2Z9TA 1MJUH 3QXAA 4K9EL 1U0QA 3FFCE 4LNRB 3D85A 5IW6A 5EZOH 5T1DH 5CLWA 2FSEB 5E8NB 1J87A 3C6SA 5C6TH 1IAOB 2QHLA 3BKCL 4JR9H 2GK0A 5E6IC 5I75B 1QHOA 1QUNA 2EDJA 4ODUB 3U7YH 3HI6L 1IM3B 1KG0A 3RKPA 5E4IA 1ULVA 3MGOA 3DOSA 2P8LA 1NBYA 2RIKA 4QXTA 1IGJB 4Y1AE 1I1RA 4APQA 4GJTB 2CMRH 5DURB 3DGGB 4H0HB 5I15H 3IFNH 2GSGA 3P2TA 1NMCC 4EJ1C 1YEJH 3V0WH 5DJZA 4IJ3B 3E6FB 4WVRA 3DVNA 5E5MB 3QUYC 4FQXA 2LU7A 4HIIA 3TF7C 3L3JB 3B83A 5FFLA 4J4PA 4M1CD 4PJ5E 1TZIB 1ADQA 1SVZA 4C4KT 1FYTD 3DXAB 5SWSD 2XY1A 3C2SA 4J3XA 1HYRC 1PLGL 4ZYKB 1OGAD 2OTWA 3LEVH 1FJ1B 4JE4B 4ODSL 3VDAA 3DX8A 3ZE1E 5F3HA 1WBZA 3MA9H 3ULUH 1UJTA 3N06B 2DLHA 4P2QE 1S7XB 2V2XB 1KTLA 1T3FB 3EYOB 2G2RB 3EUUA 3O3DB 5ELIA 2IAMB 1DQLL 1QR1B 1UCBL 1XR9A 1KPVA 3SKOA 2YZ1A 2EECA 3FFDB 3F65A 2Z35B 4OFIA 4XGZA 3BAEH 4Q97A 1JZ5A 2W9DL 2JKXA 3PG2A 1AO7B 3TPKA 1N3NA 2ZUQC 3CFEA 1XH3A 3RHWF 1J1XL 3SHSA 1G7PB 3RWEB 4LLDB 1PKQB 3S35X 5DMKA 3UTSD 3WNNA 5IB3A 2BX5A 1M6OB 2YR3A 5CJXA 3RWFA 1RI8A 1JWUB 3CDYA 3MRHB 2XYCA 3PDGA 4TPRL 3OJMB 1IKNA 3DV6B 2ZUSA 5JW4R 1GZPA 5ACZB 1RJZA 3HUJA 3P9MB 1FNHA 4PJEE 5T33L 3ARZA 1JNNH 2P8MA 3VXME 1TJGL 3AB0C 2AXFA 3O2DH 4ACPA 2C3VB 4PJAE 5KOMC 1OD7A 4JO4L 1P84K 1IGCH 1VERA 5FV2A 5BZWB 4IRJD 1MVUA 1KTDB 5T1KA 5I1LA 5K9JH 3EFDL 4YPGB 4LLWB 3JVGC 4I8DA 4RGOH 4YQXL 4HKZB 4YAQB 3BRFA 3BSZH 1T7VA 3IU3A 2FX9L 1EZVY 1CL7I 3E8UH 2X7LA 4I3RL 5F88B 5EU5A 2MCG1 4HKBA 4OGAD 4HIJB 4ZUTB 5IP4A 4G8EB 2VZVA 5FDWA 3D0VB 1MHEA 1JFQH 2D7PA 4JCMA 4X99A 5C07E 4PUBL 3CVHB 2M8XA 4M1DH 1MOEA 3DECA 2VH5L 1LO3L 5IJVA 1PG7H 1RUPL 1GOFA 3PXHA 4O58H 1S7SB 2XV6B 4XCNA 3CH8A 2ICEA 5HTSA 2XFXB 4L1HA 5E1AA 3GSNL 4PS4L 2DKUA 4K94H 5ENWB 1LO2H 1ITBB 2NY3C 3S88H 4I18C 3BUTA 3NIDF 4UUJB 5DHVB 5IBTL 1L7TL 1TVHB 4DZBA 3EHBD 1KBGH 4OFPA 3VXUE 5I76A 3HUJF 5FB8A 5C6WH 4S2SA 4CNIB 1TJHL 1DE4B 1IL1B 4NBZB 5TDNA 3G9VA 3U46B 1D6EA 4MWFB 4OSUH 2QR0A 4KVCH 2FJHB 1FO0H 3VFTA 1YEKH 4H20H 3RL1A 1KIPB 3QDGD 1U92B 1H9VA 4I2XE 1PBYA 5IVXA 4GS7C 4HCRA 4PLKD 2RGSA 3CFJA 4FP8H 2VLRE 1U42A 4RMWA 4R7DB 3W39B 3O9WB 1HEZB 1A7PH 3ZT7A 1A7NL 1TZGH 3NABL 4OM1L 4O2CA 1SBSL 1I7RB 4KC3B 1A7BA 1RZ8B 3AS0A 2NXZB 1S9VA 2CIKB 2A83B 5LG1A 2DIBA 2XA3A 4HZLB 3MLYH 3ZKQD 3NTCH 3ARRA 2VE6A 4HUVA 1S7UB 4RFOH 3PNWA 3NAAL 4DAGL 3HRZA 5ISZA 4MVBD 4NC2B 3T77B 4GRWH 1IE5A 3E1F1 1K8DA 4R4FH 2F53B 4H1LH 3CLFL 3GRWA 2APVA 3LKRB 1PSKH 1XCTA 3SGKC 3OWEA 4Q6YA 1A1OB 4LP4A 5DEFA 4PJBE 3BT2L 5E5RB 4KJWD 4G6JH 3NCCB 5HVHB 5E99L 1A7RL 4NQUA 4ZS6C 4UDUB 4NNPH 3DBXA 2NQCA 4NYLB 4GXVL 1TJIL 4RRPG 2R8SH 1CFBA 1G7JA 1YNKH 1YEFL 4OZHB 1N4XL 3FFCA 4P2OB 4HIHB 1EO7A 4XRCB 5CJQH 2Q8BL 4O5LL 4FXKB 4NP4L 3KNBB 1U8MB 2EC9T 1RZJH 3LZFH 3RTQA 1ZANH 2R0WH 2FJFA 43C9B 1GZQB 4RFEA 3I75B 2LVCA 4YIQB 1PJ9A 1AHWB 4EVNB 2AVGA 2AEWA 4HWUA 1I1AD 4OGYH 1AXTH 4NQDB 2FECI 4Y8DC 1RZFH 2VLJB 4OCLC 1RULH 4JFFB 4Y1AA 3LN5B 5K9QG 5JTWA 4HIEA 3HAEG 3P40A 4G6AC 1LDPH 4GG8B 3BH8B 4H88H 3ZT5A 5ALBL 4JLRA 2P7TA 4DW2L 1EAJA 1QSEB 5GSRA 1RUAH 5EO9A 3RIFF 4JFQA 2IFFL 1FZKA 2AJVL 4U6XA 3FCTB 4JDZA 2AXHA 4KJQD 2BSTB 1UACH 5IV2B 4WI8A 3OX8B 2VDKL 4LLYB 4XPAL 4PJ5A 5FKPB 3ZKMC 3KPNA 5C0IB 1G84A 3IKCB 3P4NB 1OL0A 3DHJA 2P1YA 1HSAB 4P2QA 3FHQA 4M62L 4F9LA 1IC5L 2NY4B 4FTVE 1DANU 5GJSH 1UM6L 1ORSA 1IGIL 3VXSB 3DI3B 5IVZA 2APFA 2VABB 2ESVB 4ZNEA 3U6RB 3LV3B 4LCYA 1T2QH 3QDME 4P3CH 5IKCA 4LKXA 1T04A 1QQDB 3BRDA 2D31B 4ZUSB 1J12A 1WAAE 5HHOB 1NC4B 4UIKL 5IB5A 1KJ2H 3G6JE 2AJUL 4PLJD 5GGVY 4NUGL 2NY7L 1IAKB 4YHYC 3OBAA 3OHXA 3SKMA 4WGWB 3VD3A 3VFRA 5DF0A 2YMXL 4FQLH 4PJEA 5JPNA 4U1HA 3VXMA 5MEQB 4A6YL 5F96L 1WF5A 1MCBA 4PJAA 1PKOA 1A7QH 4LSUL 3LKOB 3BN9D 3T3PE 5AEAA 1E27B 3PL6B 4LQ1A 3OF6A 1CCZA 1PW3A 3X17A 1L0YA 1C08A 2ZNWA 4F7PB 5CCKL 1YMHA 4CJ0A 3MLZH 3ZE1F 3MGTB 1JTOA 4X7FC 2H3NB 2VDNL 3WUWA 3BQUA 2JB5H 4JPKL 4W4NA 3MJ8A 4K7PY 3S35L 3BQUC 4I4WB 4L3EB 1XF1A 1DBML 1RY7B 5C07A 1K4DA 2P47B 1P5VA 5GS0C 1U8LA 3UROR 2OQJA 3UTQA 1T1WA 5DRWA 1F90L 1T6WA 1IQWL 4YHNB 1ZWIB 3EFFB 3QIBA 1JHLH 3WE6A 4XP4L 2F5BH 5HDBE 3RWCA 4NN5C 1LE5A 4HGMA 1JHKL 3IRZA 3B9KD 2E8YA 4QHKI 3RIAF 2YXFA 2Q1EA 3BXNA 3ZL4H 3CNKA 3DUHA 3BPNC 2IBZX 1JK8B 2NY6B 5JHLH 3MRLA 3RQ3A 4NZTL 4P57A 3G5YB 1S8DA 3L5JA 4PJEF 1V7NL 3SO3B 3QDJB 2NZ9C 3QO0A 3ARBC 2NY5L 5C09D 1BECA 1FYHB 3VMOA 3V5KA 3WYRA 5I1GH 1UJ3A 1I7UA 1XGPB 4O51B 5I1EL 3CFCL 4I2XA 1SHMA 2AJYL 3AREA 3D1MC 4XVUD 4OIIL 3RDTD 2VLRA 4JKWA 2RQ8A 5KSUB 4KTDL 1V8HA 1RU9L 1Q72H 3DHMA 4F58H 4Z7VA 3GFUA 2A38A 2H41A 5E56A 3F5WB 4I77L 4F15B 3EAKA 4PRNA 5A2FA 1JF1B 2DIAA 3MSPA 2FATL 1R0AH 1A6AA 3T65B 4R90L 2PXYB 4DZ8B 5C0BD 1UGNA 4M5YH 5IQ9B 4U7SA 1CVSC 3SE8L 1CXLA 2YBRA 1I1AC 1QKZL 5HYFA 5J3HD 3B8YA 2L0DA 2R0LL 4WI5A 5I74C 4GSDL 1B4JH 4P5TB 3DUUA 2K3TA 2VDOL 5C9KA 4IOFD 5DQDL 1KPRB 5JA9A 2HT4C 2ZJSL 1HN1A 5DJYA 1MQ8A 1U8HA 3MRPB 1N64H 2DQJH 2P5WB 4KK6D 4PJBA 4QXGL 2NMSA 5GPRA 5J8OA 4MGXA 2J8UE 5DC9B 1UKTA 2XWJB 1RV6X 3AM8C 3WUZA 2K7PA 5IMMA 3U0TA 2HJFB 4PTUA 4U1KA 2W1NA 4JFZL 5F1OB 5I1HL 1YQVH 1NANI 3FQTA 2YKLH 4CMHB 1TQBC 4CU7A 4WFHE 1N6QH 2F5AH 4LSVL 1JYNA 3RWJA 3V6BR 2WP3T 1MNUL 3QWRA 4WUUB 5EBLA 2WIMA 4E5XA 4M5ZH 4HWEL 3KPMA 2Q76A 1IAII 2DWEB 4LRNH 4H5SA 4OZGE 2AEPL 2IGFL 4E0RB 2ZUTA 5FA3A 2XNAA 3TZVA 4LCWA 3F6IA 3G6AA 2IH1B 4XPTL 4L8SA 4JN1H 5D2LE 1FSKC 1L7IH 1DVFD 2JLLA 5D2NE 3QNXB 1BQLH 5E2JA 3G5VA 5FGCB 4LGRB 2H45A 5JQ6L 3VXQA 2WAHA 4Q9QL 1I75A 2QBWA 3MLWH 3D6GA 1ZA3A 4NT6A 2BVQB 1W0WB 4IMLA 1MJ8L 1HXYA 2JCCF 4PR5B 2D0FA 3GEWB 4H25A 4PJBF 3OKNA 3DLQR 1LEIB 5TFSH 3PWVB 5DS8A 3IJYB 3BHBB 2VR9A 4BH8B 3BPOB 1BIHA 2ZCKL 3CFBB 5DA4A 3SJVE 4Y4FA 3UZQA 4L3CA 5IVNA 1WT5A 2P43B 4X6CA 3BN9C 4D9RD 3GMRB 2QHRL 4ZAKD 1U3HD 1P9MA 1KC5H 1SJEB 5D7LD 3U4BH 1D5BA 3GMMA 3PWPE 4FTVA 3U0WH 5BV7B 3TNMB 5HVWA 5IFJB 4QT5A 1NC2A 1RFDH 3RUGB 4QGTA 1IGMH 4IS6B 4WWKD 4IHOB 4V2BA 1A6WH 2X4UA 1RUQL 4LEXL 3R0NA 1IC7H 1IEBA 1AGBB 1U8PB 2AK1H 3NFNB 3EO9L 3MUY1 3TC9A 1WAAA 2J5LB 4CU8A 4N0YL 4U1LA 3VXTB 5C8JA 5I66B 2KBGA 4Z77A 3LOWA 5JMOC 2J88L 2Y36L 4QHLA 1G9NL 1GC1C 3G6JA 5BZDB 5E4EB 1FO0B 4ZTPH 2QSVA 1YY9D 1GGTA 3QRGL 3STLB 5HXMA 1FG9C 3UJJH 1RZGA 3WJLC 4BQ9A 3H7BA 3O2WH 5ITFB 4R3SA 3DUSB 1BJ1H 2EH7L 3RKDD 5AWNH 5GGUA 2CIIB 4R2GD 1HCFX 5HGDA 5A2KH 4I48B 1KPUA 3RWIB 3W9EB 5ILTH 5H94A 3BKML 4FABH 1QOKA 4YLQT 3C09C 4EI5B 4TUJA 4KROD 1CDJA 2GSIB 5B39A 1A3RH 5I1IH 12E8H 4XVUC 5MEPB 3RDTC 3HG1D 4MB3A 4DVRL 2JB6A 2VXUL 3GHEL 4JRXB 4K3GA 3H9HB 1A21A 4JPVL 1CT8A 3O4OB 2VZ3A 4H1LB 4DTGH 3QCTL 4G9DA 3TA3B 1X5XA 1R5VB 1ZT4B 1KIQB 4Y19B 5B8CC 1PVHA 5HI3C 4V1DB 2FGWL 1HQRA 3SDAB 1KB5L 1BOYA 3TT3H 1HZHL 3GMOB 1WAAF 4KZEH 4CADA 5J3HC 3AUVA 1QFOA 1TPXB 2YRLA 4ODTL 3X11B 3G6JF 4KTEH 1S7WB 5F9WC 2ATKB 3HZKB 3HB3D 4BK5A 1H8SA 2H32A 3PHOA 3HNSL 4X8JA 5LGJB 1S78D 3QWOA 3RZCD 5GQBA 4OCXH 3VW3L 5CD3A 4PBWD 4UAOB 2YK1L 4XMPH 3E6HB 5DD3H 1UT9A 4HKXA 5D9SA 4P4KA 3T3PF 2Y1VA 1A6ZA 3GIVB 4P4KC 2V17L 4N90D 5IESH 4CMMB 5LGKA 4ZOCA 4LFHD 4P4RB 3QFJD 3HLAA 1L9MA 4I0CC 2AKRB 4M61A 5GGRA 1E0OB 1IILE 1NKOA 1P4BL 4NM8L 1MI5D 4ZXBA 2CLZA 2FR4B 5I1JL 1U8NA 3F7VB 5F1IB 1GSMA 3D5OF 5DFVC 5BMFH 3MRKB 4ZOBA 4PD4K 1IGTB 1DQQB 4ZUVB 1KN2H 3W2DL 5FK9A 2DLFL 4PP1C 4X5LA 4DQOH 5F6HI 4WHCA 4H8WL 1KELL 2AJZA 2Q6WA 1CN4A 3NCJH 4I9WE 2OR9L 3K3QA 1B0GA 3RVXD 3MV8A 4P9ML 2PN5A 5K33A 1EO8H 3MBXH 3LQZB 4AL8H 3O2VH 3P11L 3MACH 2YWYA 3HI1B 3GBNH 3GJEA 3DROB 1T5WB 3MBEA 5SX4I 4DGVL 1Z9OA 5F89A 4WHYH 2BNQB 5F8QC 3SGEH 1GIGL 4KZDH 2AV1A 4EUPG 3EJZC 1Q94B 1JRHL 2OL3L 5DRZA 2A9NH 3MRJB 3EJJX 1CI5A 1Y18B 4N0RA 1FIGL 2YA0A 1BZ7B 5L9DL 1AFVH 4QNPE 4ZAKC 1U3HC 2VR5A 5HHQA 1KJ2B 1U8KA 3GSWA 1CIUA 3L7FA 4JANB 2JJTA 4TTDC 2HWZH 4OZGA 4LNVA 1YUHA 2JJTC 1ZLWH 5CEZD 3T0EB 3WD5L 2BFVH 5HDQL 2O93L 5JMRA 3TNNA 5EU6B 2QTEA 4KUCD 5DJ2B 1YNTA 2BVEA 2PW2B 3C6LB 1GHFL 4UZGA 3EYSL 4K71C 2CDGB 4WUKH 5D72H 2UYLB 4P46D 1CL7L 1XF2B 5DD1H 2VAAA 5FYLH 5IR1A 2HT3C 1NCDH 3MV01 4NQVA 1QLEH 4P2RD 5A16B 1YY9C 5FYKE 1A4JB 3OAYH 4ZO6A 2OTUA 4IDLA 5JDSA 4F2MA 2D4FA 3JTTA 2GJ6D 1TDQA 4XH2B 3QQ9D 4WI6A 1BBJB 2EH8H 1RJLB 4JGMA 3VXRB 1FFNB 2DQTH 3PP3K 2J8UF 3RKDC 4NC1C 3SGDI 4OD3H 5DUPH 3DX9B 3IFLH 4QWWC 2P5ED 3VFOA 5DC4B 1OP9A 4X7SL 4D2NA 2GIYA 4PV8B 2EO1A 4C83A 2E9WA 3DIFA 3QHFH 4WI4A 3DXAE 4KROC 1XGUB 1CLZL 1D6VH 3IAGC 4LVHC 3QDHA 2IMNA 1CFVH 1AI1L 5TQ0H 4PY7A 1XIWA 2VLKA 4YDLC 3S5LG 1BX2B 3ETBF 3HAEH 1OQXA 2A74A 2VDLL 4OZGF 4B7LA 1JZ2A 4K9EH 5IW1B 2PETA 4RAUA 2X09A 1T4KB 1RUML 1KULA 4HH9A 3L1OL 3T1WA 4KI5E 3UTTE 5EUKA 2BK8A 2JTDA 5D2LF 4U1MB 5D7KD 4ZOEA 2EDEA 1J1OL 1AQDB 3W9DA 3CDGB 2VIRA 3WLWD 2F74B 1HQ4A 5IIEA 1HOCA 4NO0D 5EIIA 4YFDB 2ZG1A 4X4YB 4UDTB 2OI9C 1HHKA 4QRPD 2NY2B 3A6CL 4ONHA 3QNZB 4FZEL 1H0DA 3RZCB 3PXJA 2VZOA 3KYAA 3OPZL 1K5NB 2VITA 4BM7A 1T0NA 3HE7C 5GIRB 3D3VA 2KPNA 4XNQA 4L8BB 4Y16B 3F7RA 1CWVA 4Y89A 4XNUL 5D1QC 1CFQA 5C2BH 3ARFD 2E7BA 3MO1A 4NQED 3HE6A 4PJIE 2VQUA 3V4UH 3D69B 4HG4J 4GBXD 4X6DB 3KWWB 1C5CH 5IWLA 4ODSH 4HKJB 5KANI 5IJKA 5CMAA 4GW5B 3VFUA 2CLRA 1ZA6A 2RFXA 5GGRY 5GGSB 5DRXB 4LPWA 1C7TA 3SBWA 3BE1L 3K46A 1EEYA 1UCBH 3PQYB 4PGDA 3HRPA 4EQ2A 4FQHA 5C0JB 3LKPA 3EW3B 2J6EA 2W9DH 4ZFFA 3FQXB 2FIKB 5J12B 5KVFL 1X5JA 1WWWX 1NUDA 3OAUL 1G7QB 1J1XH 4LDEB 5DSCB 1UB5B 1G0XA 5EU4A 4BSVA 5JIPA 3QUML 4ERSH 1MCFA 2FECL 4U1JB 5HGHB 4GAYA 1DBKL 4JG0H 4XNYL 1CXKA 1KB9K 3NZ8B 4TPRH 1LD9A 2UZXB 4MLSA 4F37F 4QXUL 4CW1A 5L6YH 1CICA 3OKKB 1TCRB 2ICES 1TJGH 2Z31A 1F8TL 3VI4F 5DJ8B 5T3ZL 1SMOA 5GRJH 2BY2A 3GSRB 4UU9A 1MAML 5DVMA 3ARGB 2ADIA 3MJ9L 4NZUL 3BD4A 2WUBL 1CU4L 5GISL 4YQXH 3PHQB 4MNHB 5TDPB 5DD0L 1GCFA 1KCLA 2FX9H 3OAYK 3K2UL 5J11C 4ODVL 1NGYB 3NCYS 1HILA 4YHOL 1NMAH 2HYMA 3TBWA 2PW1A 3D87B 2ZNXA 4EN3A 4MX7B 3ZYZA 2IF7A 4LPUA 1K2DA 4YBLB 3SDCA 3WLBB 2VH5H 4BELD 3SDDA 3C5ZB 1LO3H 5BQ7B 2P44B 1RUPH 1VFAA 3SDDC 3U0PA 1ZV5A 1XGYL 2GJ6B 2DQUH 3RNQB 3TCLA 1ZEAL 4JHAL 3OJVC 5DZOA 4PS4H 3QQ9C 3SCMB 4BSWA 4JCLA 4QRUA 2EDXA 5HY9A 2FHCA 1T22B 3NPZB 4NQTA 5LAXA 1LO4L 3ZDXE 5IBTH 1N6UA 3MLTA 2GCYA 2P5EB 1OARH 1U6AH 4R4ND 1MAJA 1NDGA 4TUOA 3JWDC 1FZMA 4IIQB 4HUUA 1KCUH 1KENL 2DQFA 4LKCA 2I24N 1FYTE 3VFSA 5SWSE 1A6UL 5FYLD 1TJHH 1LEKA 2MCPL 3CC5B 1OGAE 3B3IA 3SY0A 3OB0K 3OKOB 4OZHE 4XX1G 2CUMA 3M07A 4LNRA 5ADOL 4X5WB 4MDIB 1IQDB 4OFDA 3V6ZB 1DTUA 3KJ6L 4YBQC 2FSEA 2GUOB 3JTSA 5E8NA 2X2YA 2HRPH 1G7LB 1I85A 4F7EB 1VFOA 3KXFD 1IAOA 2EDBA 1A2YB 1A7NH 4QRRB 1BQHG 1YQ2A 2E6PA 2KZWA 3NABH 4JRYD 4ODUA 5E8EA 1SBSH 5F7MC 1IM3A 2YD6A 4PJ8D 3ROOB 4PJHF 4XAKD 3WIHH 4XAWL 1P7QB 1IGJA 3ARTA 3QG7L 3TO4D 4NNYB 3WLWC 3DGGA 3UTSE 4HF5L 3ZLQC 3QEGL 2JJSC 1DBAL 2UV3A 3NAAH 4J3TA 2EYTB 1QSEE 5MP6L 4UT7L 3ULVE 3CAFA 4NPYB 3E6FA 3VXOB 1DEEA 3MUGA 4RGNB 5E5MA 5E8PB 3QH3B 5E8OB 3CLFH 1R5IA 3L3JA 3BP6A 1NJ9B 3MZTA 3GGWB 4G7VL 3VGHA 3BT2H 3DXAA 3BUYB 2NW2B 4ZYKA 1A7RH 1FJ1A 3P4MB 4QEGA 5EU7E 2VL5B 3RRQA 3MLRL 3WDJA 4WEMB 1IFHL 2OXGA 2MPAL 4M7JH 1TJIH 1S7XA 1T3FA 3V6OA 4MXQD 1YEFH 2G2RA 5FM8A 5FECB 3NGBB 1N4XH 2BCKB 3U2SB 2IAMA 3ET9F 4M02A 3V6OC 2IAMC 4KK9D 3WO3B 3UTTA 2Q8BH 4DEPC 4L5FH 2XZAH 2J8HA 2JIXB 3HI5H 1AO7A 3KG5A 1N8ZA 1TVBB 5EU3B 3RI5F 3LS4L 3CU7A 1G7PA 3RWEA 4LLDA 4WRLA 1PKQA 1ZT7B 2IFGA 5E7BA 4JDVB 1MFNA 2W59A 4FMFA 3IDYB 1EFXB 1JWUA 1FAIL 3MRHA 2B5IB 4ELKA 4JFOA 3DV6A 3ROLB 2V5RA 1AGCB 5ACZA 5AG9A 1E4XI 1FHGA 3P9MA 5ALBH 5D7IE 1DQDL 3VFWA 2X4OB 5FCSH 3I2CH 2ED9A 1DLHB 3N1QC 3QXUA 5F9JB 2AJVH 2EO9A 2C3VA 2VDML 2FYYB 2GJZB 4LDLB 4HC1L 4M9OA 1BZQK 2VDKH 2Y06L 3BZ4A 3C2AL 4XPAH 5KJRH 5BZWA 4HJJH 1KTDA 4ZD3H 4NN6C 5FV1L 1LO5B 2CPCA 2ZSWA 3EJYD 4NZDA 2WUCH 5AZEL 4AM0B 5JIIA 3QDGE 3HS0B 4IMKA 3P4OB 3VWKB 4IMKC 1NGZB 5F88A 3GM0A 1JNLL 1E4KA 3OKLA 3X12B 4L3EE 4HIJA 4ZUTA 4G8EA 1X6NA 4M62H 2BERA 1WTGT 3D0VA 5EBWB 1C16B 4LQFL 4M6NL 5FO7B 3QCUH 3CVHA 4FQCL 4LGPB 4Z76B 4P59H 1IM9A 2X6MA 5EA0L 1UWGL 5JNYB 1QRNB 5IQ7H 1RZIB 1S7SA 1F6AA 2XFXA 3FT4B 1VCAA 5F93C 5ENWA 2BNUB 1DBJL 5LGHL 1UZ6E 3BOVA 1UEMA 4FFYL 4UUJA 5DHVA 2AJUH 3EDDA 1A14L 1D3CA 3WFEL 2NY7H 4LSSH 5B4MD 3I50H 3VCLB 1MWAL 4G5ZL 4LOUD 1HI6B 5JW4M 2N4IA 5E2UH 3DGCR 4CNIA 5DZNA 4YXHL 3HMXA 1U3YA 1E4WH 5ANMB 1DE4A 1CE6B 1IL1A 3S4SB 1YN7B 3KLDA 3MODL 3LRSA 1NEZG 5DEGB 3V6FB 2FJHA 4WI9A 4RMVA 4R4NC 2IPUG 3RY4A 1KIPA 1U92A 2GITA 1RZKL 1WISA 3O6FB 4BZYA 5IF0A 4PJIF 3W39A 3O9WA 3W5MA 1FZOB 2DL9A 4HBQA 3O9WC 5H2BB 4AIOA 3MC0A 1VESA 1NAML 5ERWB 2VZUA 1FGVH 1H8NA 4WTXA 3V2AR 1F4HA 1RZ8A 2CIKA 3S35H 2A83A 4NFDA 4HZLA 1EH9A 2XQYG 1BFVL 2XQBH 2F19L 3DX6A 4ZFOL 1NSNH 1S7UA 3UYOD 4MLIA 5I8EB 2F54B 2WBKA 4JQVA 4OFYA 4UTAL 2HKFH 4KHXH 2DTML 4MAUH 3TFKD 4JEGB 3BFOA 3T77A 4KRLB 3QIWD 1IQWH 4G43B 3T4AB 2DN7A 3TO4C 4XP4H 1T5XB 3LKRA 5TE6L 1JHKH 3ULUE 1J7VR 4OI9A 4TSBL 4YUEH 1A1OA 3U83A 4BUHA 2YPKB 2VL4A 5EOQL 4PBXA 3SQOL 3UAJD 2UVEA 3MR9A 1A4KA 4U05A 4NZTH 1T6VN 4NN7C 4UDUA 4X98B 1JPTL 4NYLA 5DT1L 1FYTA 4DKFL 3O6LL 2ZCHL 2X41A 3O6KL 4D3CH 1Z9LA 4HUNB 5GRXG 4FHBD 2P4AB 1OB1B 4JN2B 4OZHA 3ULSB 4P2OA 2EKSB 4HIHA 4XRCA 4P2OC 3CFCH 5I1EH 5HHVL 2NW3B 5DUMH 3NPSB 4OIIH 4FXKA 1RVFH 3VFGH 3KNBA 4FS0A 5FYJU 1U8MA 3KPRD 4ZUUA 3RY6A 3IAQA 3QXWA 1RU9H 43C9A 1FORH 1GZQA 3I75A 4UILL 4KK9C 1AHWA 4ORGB 5D1ZD 4EVNA 4I77H 1V7MH 3ARQA 1S5HB 1KIRB 2DS4A 2VLJA 2FATH 5ESVB 4R90H 2VRAA 1A6VL 2N7AA 3SKUD 1ZT1B 2GTWA 3LN5A 1INEH 4K7FA 4F3FB 3RNKB 4EUPH 4UQ2B 3BH8A 2EXYD 3OZ9L 4EDXB 1QSEA 1KTKE 1ZHNB 5C0ND 4GSDH 5E03A 3FCTA 4JPIB 1GOGA 2BSTA 4PYHA 5IV2A 3HZMB 1OGTB 4LLYA 1DUYB 3B8SA 4FNLH 2QQNL 3BP7A 3ZDXF 5ID0B 2FEDD 4QXGH 5JLZB 2ADFH 5D7JD 3ILQC 4LSRL 1CGXA 3O6ML 4IRJA 1VKXB 4N0UE 5C0IA 2YC1B 4D9QD 3P4NA 3FO0L 2Z93B 4W6WB 4DGIH 2NLJA 3JV5A 3UYRL 1LK2B 1MFCH 4OZHF 5CLTA 3HZVA 2G9HA 4C56B 5F9OL 2BNRD 2CD0A 4JJ5B 5CGYD 5KN5B 2VABA 2ESVA 4LSVH 3RUGE 2R1YB 3U6RA 3LV3A 8FABA 1KXTB 1BIIB 5DJAB 4HWEH 2APTA 3KPSB 3FAXA 3Q1SL 4NQCB 1QQDA 2IGFH 4RAHA 1YPZB 4ZUSA 3WXVH 3TIEA 4UOW0 5F3BB 1NC4A 2BC4B 3FOLB 3W82A 3FB6B 1XF5A 4OM0H 5T1LD 3FRPG 1IAMA 1QBAA 5A2JH 5L2KD 5I19L 3CD4A 1IAKA 1SJXA 3CXDL 4Y4HD 1T0MB 2CUHA 4L4TB 3MOQA 4XWOD 1RIUH 3E2HC 2Z8RA 2ZUVA 2MJWA 3KYNA 1LO0L 5MEQA 4X0KB 1C12B 1OVZA 1J11A 4Q9QH 2WLYA 1ADQL 5IEHB 1QSZA 5E5UB 4LOUC 2DTSA 3GK8L 1UXWB 1MJ8H 3LKOA 2LTQB 5C09E 2X89D 1E27A 2XG4A 4NRZB 4PRPB 3GIZL 5HYSG 3IDMB 1UH4A 3PL6C 5J6HA 3QDGA 4F7PA 3MGTA 4PJFB 5KSBE 1FP5A 4RIRB 2H3NA 5D1XB 4L3EA 1MLBB 1XCQA 5CUSL 3GSXA 1Q38A 4W6YB 4GRWE 1YYML 1AQKH 1A8JH 4JRXE 3BJLA 3IYLW 5DDHA 3IT8D 2ED7A 4Y19E 4V1DE 4QOKD 4NHCL 2WWKT 4YHNA 3O3AB 3MLSL 3EFFA 4NOBA 5CJOL 3QA3A 4LSDA 3S7GA 1J1PL 2AJSL 3QUZD 3ZTNH 3QIWB 1J0ZA 2FEEI 4CN4A 2J88H 2Y36H 1G9NH 4U0RB 1JK8A 2D7TL 1AXSB 2JELH 3BDYL 4WW2C 4RFNB 2NY6C 3QRGH 1KOAA 3G5YA 5B38A 5D7IF 2V2TB 3QDJA 3Q48A 2HKHH 2GT9B 3FZUD 5IHZA 2XZQL 3UAJC 2L7UA 1XGPA 4O51A 4WFED 3GUTA 4JM2D 3MXVL 4WJ5B 3KVQA 4AT6B 1FC2D 1Q9LB 3W5NA 1EX0A 3UJIL 2D03H 2L4OA 5KSUA 2CRYA 3OV6A 7FABL 1HHIB 2Q7NA 2V2WB 3EYFA 1M71B 2Z0BA 3MRQB 2DM7A 1FL3B 1CD1B 3F5WA 3KLAB 3S8WA 1LK3H 3H9SB 4F15C 5ICXB 1JF1A 3T65A 5GGVL 2BSSB 1I8LC 4DVRH 2VXUH 5DD5H 2PXYC 1DFBL 4YDIH 5IQ9A 3JWOL 1EBAA 3QCTH 1GPOL 3ZHLA 3NVQA 1KTRL 2FGWH 1NGWB 5IM7B 1KB5H 4IRSB 4NQXB 4P5TC 5TPWL 2MNUA 4JY4A 3ZDZE 3ARDD 3S97C 3GZKA 2X1XR 1KPRA 2UWEB 3MOAL 1UZ6F 1IC4H 4KMTL 5C0NC 4ODTH 3TJEL 1F6FB 2A73A 1MCHA 2OTPA 3S37X 1S7RA 1NCCH 1FAKT 2XWJA 2YN3A 4K7PL 2HH0L 2DQEL 4XZUB 2BNQE 3HNSH 2YRZA 5CJ5A 2FEDC 4XBGA 5GSVA 3B5TA 5BXFB 3VW3H 3W11D 4ODWB 2P8PB 3O3EB 2DYPD 2EE2A 1WSST 4CMHC 2R2HB 3K7UA 2O5XL 3A6OA 2V17H 3QULA 3TBTB 4OZFG 1DQJB 3QIUD 5F7HA 4XTRD 1QSFD 1MCSA 2DWEA 5CGYC 4E0RA 5E6YA 4G9FD 2LU3A 3RIFK 2IH1A 4F7MB 5TQ2H 1P4BH 5HD8C 5I1KL 3HPJB 4JHWH 1KJ3L 3M1BB 5EU6E 4OB5L 3O2DA 2XTJD 2KQMA 4XBEH 3MA7B 3QNXA 5MEND 3W2DH 1CFNB 3PABB 1WC7B 3GRWL 3PGCB 3TVMB 1XGTA 3IXTB 3EBAA 2DB8A 5HJ3B 4DWHA 4K07A 4P9MH 1CDBA 2W9EH 2BVQA 1G7MB 1W0WA 3OXSB 5E7FA 4ZUWB 3QXAB 4XWOC 5GGTH 3MMEB 3D85B 4ZTOH 1LEIA 4HK0A 3IJYA 4BH8A 4RISL 3C6SB 4K23H 1NLBL 5CSGA 3CFBA 1CGUA 4RA0C 3W0WD 1NGPH 4N0UA 4DGVH 2GK0B 1WEJH 3GMRA 3U7WL 3RL2A 1JRHH 3IDXL 3MGOB 1SJEA 2HTKD 5GZOD 2DLEA 1CR9L 2P8LB 3HTLX 5BV7C 3Q3GB 4HQQL 1S7VB 3RUGA 4APQB 1UXSA 5L9DH 3MUHL 4IS6A 4IHOA 3N1PC 2GSGB 3LQAH 1NUNB 1C5DB 1U8PA 3NFNA 5E6ZA 2Y4SA 1I1FA 2WBWB 1MCKA 3DVNB 4FXLA 3TYFB 5I66A 3WD5H 4HIIB 1R3KB 4I0PB 3OGCA 5BZDA 1FO0A 3EYSH 1IGYB 2D4DA 3B9KA 3STLA 4CL7A 4JFDD 3BMWA 2CRIA 5F3HB 1WBZB 4M48L 5ITFA 2VNCA 3ZKXB 4XCYB 4XHJC 4Z8FL 4WIQA 3KYMB 3DETD 2CIIA 3V7AG 1U3JA 5D71L 5C09A 3NACL 4I48A 2F58L 1BD2B 4CVWA 1P7HL 1XT5A 3FZUC 2B2XL 1EUTA 4XGZB 3LS5H 5HHMB 1F11A 1Y6NR 4RQQB 2GSIA 4JM2C 43CAB 4EI5C 1B3JA 1I1CA 1V3KA 1N3NB 4N90E 5GGQH 4R9HA 3CFEB 1XH3B 5IT2L 3NCBB 3VWJD 3QFJE 5GJTH 5E9DD 3DRQB 4JRXA 3H9HA 3MCKB 4UV7H 5FUCC 4G6MH 4X6DE 4EXPX 2FHBA 4H1LA 1MI5E 1X5AA 2GQHA 5IB4B 3BZDA 1L6XA 3TA3C 2JE8A 1KIQA 3F62A 4Y19A 4NDMB 2EIZA 4V1DA 5FYJL 3HUJB 3WXWL 3SDAA 1W72H 1T7XA 2P8MB 3GMOA 1AD9A 5KZCB 1RUMH 2EYRB 3L1OH 3VE0A 3ZKND 4EI6B 2YPLB 3PQYE 3X11A 5J13B 1TPXC 5JW4N 3GI8L 1FZJB 1Q9WB 2OP4L 3ARDB 4OV5B 3LD8B 3WIIL 1S7WA 5EZIH 2ATKA 4D8PA 1J1OH 4LEOB 3DO7B 3OMZA 1NFKA 3IU3B 4G8GD 3HFML 5LGJA 2X7LB 4X4ZA 3D9AL 5C0AD 4UI2A 4EBQL 3E6HA 4X6EB 2R9HC 4XPGL 1D5IL 1MHEB 4LCCB 5LWYL 2NX5D 3OPZH 3C08H 3GIVA 5DVOA 4JKLA 5I17A 4CMMA 3W11C 4WCYL 3EIFA 4P4RA 4LMQE 2APWA 5KSBF 2AKRA 1SM3H 4IRZL 5GS0L 3ESVF 1KN4L 1JGUH 2FR4A 5BOZG 4GRWF 3MGAA 4CGTA 1QFPA 3F7VA 5F1IA 1MFDL 4HUXB 3MRKA 5CEZE 3RVWD 15C8L 3VRJA 1IGTA 4M7KH 4MNQD 4ZUVA 4DZBB 3DWTA 2MKLC 4TVPL 5FIEA 1FVDA 1DVFA 1DBBH 4NOFA 3C8DA 2XTJC 3QPQC 4LARL 4S2SB 3DPBA 2EDKA 1I3VA 1HYSD 4MCZB 1D6EB 1T89A 5JPMB 2QR0B 3LQZA 4OD2B 1C5BL 1HH9A 1HWGB 4LBEB 3RL1B 3HI1A 3I9GH 4XXDA 4OUUB 1U8JA 3DROA 1OAUL 1T5WA 1AP2B 2GJ6E 5KVFH 3OG6B 5L88L 1Q0YH 2MQCA 4X9GA 2BNQA 3CXHK 4L9DA 1EO5A 4XC3L 3STZB 1VFMA 2D9QB 1JZ3A 3MRJA 5BVPH 2VN4A 1S9VB 2CO6B 1YECL 4XNYH 1EXUA 1Y18A 2R0ZL 5TF1H 2P5EE 2A6KB 4OLYL 3T0VA 1INDH 4PTTB 1BZ7A 4BZ2H 1MFAH 4KY1H 5L0QC 1KJ2A 1I7ZB 2X4QB 4OLUL 1J05B 1HCVA 3HRZB 5ISZB 1MUJB 5GZOC 4JANA 4PRHB 3ARYA 1A6PA 4UT9H 1F8TH 5T3ZH 4MJIB 5C0RH 3T0EA 2R1XA 4HPOL 1K8DB 4DKEH 1BJ1J 5ITBL 4NZUH 5EU6A 2VKXA 2PW2A 4F9PA 2VXTL 1MIEL 4F9PC 3C6LC 4QRRE 3BYYA 2AQ3A 2UYLA 2G75B 5I9QB 1FFOB 4NKIH 5D7KE 1XF2A 4C58B 2HJKB 3GHBL 1LE9A 1EGJL 3P9LA 1C8PA 1GGBL 2XN9B 4I13B 3RWDA 3BP5A 1QD0A 5A16A 3SE9L 5E08L 1A4JA 3QYCA 1G7JB 1OSPL 1S7QB 4WI2A 4Y5XC 3FFCB 4XH2A 4U1NB 4O2FA 4FFWD 4QHMB 2E27L 2PO6D 4LASH 1RJLA 2I27N 3VXRA 1FFNA 1XGYH 1Y6KR 3DETC 3DX9A 1ZEAH 2FJFB 3T08A 4EIGB 4KDTA 4H0IA 5EWIH 5ALCL 4PV8A 4WGVB 5CWSB 1JGLH 1U91B 1HH6B 2BHYA 4WENB 3DYMA 4G8FB 1XGUA 4HBCH 4GQ9L 4Y1AB 2B1AL 2G60H 2H1PL 2VWEC 3QHZL 1KENH 1H5BA 3DMMD 1G9MC 1U8QB 1YY8A 4JLRB 1BX2A 5GSRB 4OLWH 3IFPB 1FZKB 5IW1A 4YHMH 4PB9L 1NBVL 4LHUB 1VSCA 2IQAB 3KJ6H 3OXRB 4U1MA 4O4YL 3L3GB 4JJHA 2EDWA 3P4LA 3NFPB 2Y6SD 5BRZB 4CN1A 2AEQL 2CJUL 4NBXB 1TTFA 1AQDA 1EVUA 3K4AA 1F5WA 3ZKNC 2F74A 2FLRT 2AXGB 4UDTA 4KKLD 1D5MA 4N0FB 4XAWH 1T83C 4G8GB 2NY2C 3RZCA 3WEXA 4P2YA 4JFEB 3QEGH 5MP6H 3P0YH 5GIRA 3MV7D 3WFDL 1CLYL 4LCYB 5IHUH 1JE6A 1OTTD 5IKCB 4OV6F 3LH2L 3MRBA 1MCCA 3Q6GL 4Y16A 4AY0A 3QUXB 3H2WA 4LKXB 1T04B 2X70A 5FAAA 5I8KL 4G6KL 3VDCA 4F7TB 1KB5B 1MLCB 1I8KA 3K8MA 3D69A 1EJOL 4X6DA 1NCAL 1CG9B 1N7MH 1K3IA 4LIQH 1SEBB 4HKJA 3HNVL 1JTPA 3MLRH 3OHXB 3D2UD 3VFRB 3NFSH 1IFHH 5GGSA 4PJEB 5JPNB 2IPUK 2DLGA 2ZWLT 5DRXA 3VXMB 4O02L 4PGJA 3PQYA 3WMSA 1Q9KA 5CP3H 5C0JA 1MRDL 1Z6JT 1QRNE 4DCQB 3FQXA 2FIKA 2NY1D 3K81A 1AKJD 5T5FL 4G8IB 3LS4H 1G7QA 5DSCA 4S1DC 1UB5A 1YMHB 2A0LD 1KB9J 3OTTA 2XQYK 1MCPL 1U8OA 4U1JA 5HGHA 3MJ8B 2B4CL 2ADJB 4YE4L 2AK4B 3C5SA 3ARXA 3ZE0E 1FAIH 3L95A 2CKBL 1EVTC 1K4DB 5C07B 4DJMA 1CTNA 1T03L 5EORL 3OKKA 5HI4C 5JORB 4Y5YB 5DRWB 2OMBA 3OKEA 1JI2A 5BO1H 1ETZB 3L5IA 4Q74A 3QIBB 5FYLE 3GSRA 4OGZA 3HNTL 3N85H 4JO1L 3ARGC 3GNML 5F7YC 5D96B 1N0XL 4H8WC 5AZEH 2VR4A 3N1FC 3PHQA 4PGBB 1D9KD 5JZ7C 4WTZG 4ETQA 2W07A 4HS3A 1CDGA 3MRLB 4OCNC 2IQ9H 1NGYA 3VXUB 1JNLH 2A6DB 3DRTB 3KXFE 3IETA 5JXED 3CFDB 2CSPA 4P46A 1YC8A 1MFBH 2D9CA 3V5KB 3WUWG 4LQFH 2NTSP 4M6NH 1UJ3B 4MX7A 1TIUA 5SV4A 1OTUC 4XAKE 5EA0H 4I2XB 3WLBA 5HHNB 4P9HH 3C5ZA 5BQ7A 3C5ZC 2VLRB 2BXZA 4U31A 2GJ6A 3RNQA 2PO6B 2HFFB 5T3ZD 1HKLL 2JJWA 3SCMC 1DBJH 5LGHH 3DTXB 1T22A 4PRNB 1OTSC 3RGHA 4L8DB 4FFYH 2Y9RT 3WKML 4KDWA 1A14H 2P5EA 3OQ3B 1MWAH 1QFWH 1MF2H 1YEHL 3O4LD 3ZYJA 5I71B 2CR3A 1G7IA 4IIQC 2WBJD 3CC5A 3IS0X 3U1SL 3O8XB 3OKOA 1CBVL 3V6ZA 2XRAH 3K80A 3DMMC 1RZKH 1G7LA 2GKIA 5ICZB 1U8HB 2JCCB 2X9WA 4JDTL 3FN0L 3S3SA 4PJBB 4NSKB 4KRPB 2FJGB 4QRRA 1NAMH 3CMOL 1X9QA 5F8RC 5LXGL 5JOPD 3L5WB 4B7IA 3ROOA 5K9KB 4KKNA 2HTLD 3QPXH 1HWHB 4PTUB 5JO5B 4JB9L 1ONQB 4RBPH 1UA6L 3VFMA 4NNYA 4ODXA 1YC7A 2WV3A 4KKBD 3RWHB 4S0TD 4W6XB 4M43L 4UTAH 3GMNB 1EHLL 4NPYA 2BJML 3TN0D 1DEDA 3RGVD 1CXIA 3EYQD 3VXOA 2FL5B 4M1GL 1YJDH 5E00A 2LAAA 4M03A 5E8PA 4OZFH 3QH3A 4RGNC 4H5SB 5E8OA 3NH7L 5DYOB 5TE6H 5FA3B 3GGWA 4MA7L 4TOYL 3V52H 2FEEL 1W72B 3Q0HA 4PG2C 3BUYA 4L4VD 2QSCL 3TBVB 2QEJA 3P4MA 3ARFA 1OF2A 5DT1H 2VL5A 4DKFH 1A22B 4PBVC 4RMUA 4GBXA 3O6KH 4N5ED 4HFUL 4OGXH 5DD6A 3WNKA 1YMMD 2NY0B 3QI9B 5FECA 1RIHH 2BCKA 3ES6B 3U2SA 3VXQB 4L3AA 3LN9A 3AY4A 4NT6B 5HHPB 5F1SA 3KPOA 5HHVH 3E3QC 4CRPA 4IMLB 1HXYB 4P48A 4TYUA 3OKNB 1VEOA 2JIXA 2YOCA 5F7DB 4NRYB 4HJGA 1TVBA 3KPSE 3F12A 4NQCE 1I3RB 4UB0L 1OAQL 4Y4FB 1YPZE 1PQZA 1ZT7A 5GGSY 5BJTB 2HT2C 3AC0A 1F58H 4JDVA 3RAJL 3QT2A 1BQUA 1FPTL 2Y7QB 5D4QA 1JZ8A 5AUMB 3WJJC 1FVCA 4BQ6A 5DQ9B 3SQBA 32C2B 1D5BB 3H6JA 3B6SA 4L4TE 2A0LC 3JV6B 3MTRA 1AGCA 5F44A 3UJTH 1VADB 2H6PA 2AERT 1PYWB 5DMIL 4F7CA 1ZGLP 2X4OA 1QFUL 2OZ4H 3C60D 5F9JA 3QDMB 4GAJL 4NWTH 2FYYA 2GJZA 4TULL 1RIVL 5KAQG 5KTEL 1KFAL 4P0DA 4PRPE 4U1LB 1LO5A 1VGKB 5BS0D 1NCWH 4QHLB 4WO4B 1NUGA 5GS2D 3HS0A 3G6JB 2FH6A 1RHHB 4LSRH 3O6MH 1JNHB 3P4OA 3VWKA 3EOAB 4PJFE 2ZKHH 3FO0H 2J4WL 3L3KA 4R97B 2OS7A 3X12A 2AJXL 1KXQE 5DRNB 5KVDL 5HPOA 1RZGB 3UYRH 3H7BB 4U6TA 4GFTB 5EBWA 1D9KC 4UTBL 1C16A 1MHHB 2AAVA 5F9OH 5FO7A 1S7TB 4KJPD 1MCRA 4KH2A 5JNYA 2AI0L 5MERB 1G6RL 5JXEC 1QRNA 1RZIA 4GG6E 1CXHA 3Q1SH 2X4SA 3FT4A 4PIRF 5H94B 3T3ME 2BOCB 5IHBA 3TJHC 5GRUH 4I3SL 1PGRB 4JY6B 1AR2A 1SY6L 1ZTXL 4LLAA 5AZ2H 2P46B 3HC3H 4HXAL 3VCLA 1XR8B 3CXDH 1HI6A 3WS6C 3MUZ1 1CE6A 3S4SA 4FFZH 1YN7A 3SEPA 2E7LC 5DEGA 1WBXB 3V6FA 3OKYA 3CVIH 1VENA 3CSPA 4YDKL 3GK8H 4BZ1L 4P23D 2NYYD 1W0VB 3ALPA 4HWNA 3O6FA 4U6YA 3GIZH 1Z2KA 3FRUB 2VUYA 4HLZH 5H2BA 3K0WA 1IT9L 5ERWA 5GRWA 5CBAB 4X5XB 4GAGH 3T0BA 2YA1A 3MCLL 2VDPL 3NZHL 4RRPA 1T1YB 3QEUB 5SWZD 4NWUL 3KPRE 3GO1L 4X8JB 2OK0L 5B39G 4CU6A 2N1KA 4PFEA 2FZ3A 1YYMH 4RWYL 4EOWH 5ABDE 4LDOB 3DV4B 4HKXB 5D9SB 1AC0A 4LVOB 2F54A 2HTLC 1UVQB 1TQCB 2O5YL 4KU1A 5C0FB 4WU7B 2K1MA 4G43A 3INUL 4NHCH 4XVJH 1GAFL 5DZLA 4U1GC 3PE9A 5M7QA 1T5XA 2UWEE 4LRIA 1J1PH 2AJSH 4M61B 3UPCA 4PRID 5GGRB 4Y2DD 4UNVA 4MS8D 3TN0C 4HK3N 1FFRA 4ZXBB 2YPKA 3EYQC 3F58L 3HAEA 1B88A 3ZE0F 4PJCE 2D7TH 4YHZH 1A3LH 3BDYH 5M94B 5HI5D 2X4TB 1T1ZA 3TGXA 3UDWC 2XXCB 5C1MB 1X44A 3PGFH 1OB1A 3A67L 4JN2A 4D9QE 2EKSA 4AIZA 3OR7A 3RA7L 1XF3B 5EN2B 2G5BA 4LAQL 3NPSC 4MNGB 3PHSA 2BNRE 5DK0B 3GJEB 3FO1B 4ZQKA 2J8UB 4KJYA 1N6VA 4ORGA 1FNAA 3UP1A 2ARJB 4N9GB 4LLVA 1UCTA 5F89B 1S5HA 5MI0B 3V0VB 2YUXA 4GLRH 4K8RC 3VG9B 1ZT1A 1VACB 4DOHE 1DFBH 3HC4H 1FVEA 4F3FA 3RNKA 1L0QA 5GS1B 4EDXA 3RJQB 4ALAH 1DSFH 1ZHNA 5L2KE 5HHQB 3EO0A 5DI8A 2D7QA 4H26B 4NCDA 4Y4KD 4JPIA 5C0CD 3HZMA 1A1MB 1OGTA 2DLTA 4OZGB 1DUYA 2Q87A 4Z9KB 1BOGA 3I6LD 3C60B 2Y5EA 1A7OL 5KSAD 3TJEH 4WEBL 4QTIL 1I9RL 5JLZA 1X5ZA 1MRFL 5DJ0B 3LKSB 4YWGL 4WNQB 5D2LB 4KK8C 4O9HL 4PJ9B 3IU4H 6CGTA 1VKXA 4NRXA 2V9QA 5D2NB 2DJ4A 2DQEH 5LQBH 2A9ML 5JHDD 2VLMD 2Z93A 3L6FA 2VDQH 4N0CC 2V5SA 3K4DA 4NQVB 1LK2A 3IDGB 4HMDA 3RBSA 4OTXH 5B22A 4Y5VB 4C56A 2GY5A 3HR6A 4M6OH 1KV3A 1BEYL 2R1YA 5I73B 5TGBB 3TH3T 5DJAA 3GMPB 5D6CB 3SGJC 3KPSA 4NQCA 2VZSA 3UYPA 3SJVB 1YPZA 5F3BA 2BC4A 3FOLA 2ADGB 2J7LA 4QOKE 1SEQL 3FB6A 2DWDA 5ICYB 4OB5H 4FQJL 1A64A 2ZCLL 2RB8A 3DIFB 3EDJA 3PWPB 4XC1L 4GRLD 1T0MA 4L4TA 4JO3H 4M7ZC 5JOFB 4X0KA 4FG6C 1JPFB 1XIWB 4K3JH 5IEHA 1DJSA 5KS9E 1CQYA 1U8IB 5E6ID 3MRMA 4JFYA 3O0RL 1BD2E 1TFHA 4MJ5B 4PRPA 3IDMA 5DHYA 4DKAA 4WFEE 3LHPL 5FGBA 1ITCA 5IFHL 2NXYD 5HHME 5KW9L 2EDOA 3JSSA 4J8RA 2I60H 4P23C 4PJFA 3FONB 4RIRA 2XZCL 5D1XA 4G6FD 4KQ3H 3W9DB 3NCMA 3KYKL 1MLBA 1T20B 4XP1H 1HQ4B 5GHWL 3IDXH 1RURL 2HG5B 3N9GL 4QHNA 5CZKA 1CR9H 4NJAH 1RQ5A 1QBLH 4Z7WE 1F2XK 4CJ1A 5HYJD 3QUYD 1XFPA 2VMFA 4GG6A 5IG7B 3FJTA 4MA8H 1T0NB 4X8XA 3O3AA 1QLFA 4J4PD 1YPZF 5E2VL 1MWAB 2R15A 4JPWL 3OJ2C 1TENA 3IVKB 5CBEA 3QIWA 2XKUA 3P0VL 1QPXA 2FD6L 3WN5C 1CFQB 3UZVB 4K3EL 1Q9OB 1IZKA 2QV2A 4U0RC 1AXSA 4OFKA 2VXVL 3BIAX 5I1CH 2V2TA 4CAGA 4M48H 4HG4K 1HHHB 3VFUB 1WZLA 2R23B 5I18L 4Z8FH 4J23A 2BP3A 4I3GA 5HI5C 4FQ2L 1K8IA 4ISVB 4AT6A 3QEHB 3R4DA 2F58H 3K2MC 3WIHA 4PGDB 2K7QA 1HHIA 5C0GA 2V2WA 4XMLH 1M71A 4ZFFB 3MRQA 4PJFF 4XXCA 1M7XA 5ADPL 5IT2H 3BIBX 3H9SA 1UM5L 3CVHL 5ICXA 4JO2L 1IBGL 1QSFE 3DYPA 3A6BL 1Q1JL 2C4FU 3UBXB 1JV5A 4PJDE 1Z3GL 3WNLA 3C87A 2DQDL 4G9FE 3DSFL 1YNLL 2DI9A 4LPXA 1X5IA 2FLBT 1DDHB 2LU4A 1CD9B 4L1DA 3R1GL 4GG6F 1MEXH 2E8ZA 2YEZA 5FYJH 3WXWH 2H9GB 2NNAB 5IM7A 3T3MF 4IRSA 5T1KD 4OKDA 2FCBA 2FBJH 1DN2A 2UWEA 5LCVL 4PJXE 4U3CA 5C2UB 2DBLL 1FCCA 4WW2F 5JUEH 2OP4H 3HMXL 3LKQB 3WIIH 4PJCA 5H35B 2M1KA 2QADC 3FT2A 3HFMH 5KSAC 5D7JA 4M3KB 4MAYB 4S1QL 5BXFA 3W0WE 2XTLA 3D9AH 3KPPB 1HILB 4EBQH 2FX8L 3G6DH 3O3EA 4PJHB 2Z91A 4XCCL 2IC2A 4XPGH 4FQQB 1SYVB 2Q8AH 2R2HA 4EN3B 1X5LA 3TBTA 4PY8I 1DQJA 2XPGB 2XWTB 1K6QH 3VGDA 4UBDD 4WCYH 2NY3D 4MXWL 4MJIE 3TCLB 4MYWB 4PJGF 4S1RH 1I8MB 1BFSA 1KN4H 4F7MA 5CEXA 3HPJA 3TO2B 2P42B 5D70L 4NNXB 1MFDH 3PDOB 4WY7H 5DWUL 5FO9B 3MA7A 1CFNA 3PABA 1WC7A 4AG4H 1K4CB 1FZMB 2LE9A 3FAWA 4LKCB 2DQFB 3PGCA 3TVMA 2XN9E 3VFSB 3IXTA 3HCVA 5HJ3A 4S10A 4WFGD 4GRLC 2UWEF 1G7MA 4JFDE 1CXFA 3UMTA 3OXSA 4ZUWA 1C5BH 3QZWG 3MMEA 5EOCL 1HINL 5IBLC 1I3UA 5GZNC 3JTSB 2UUDK 4CVZB 1JBJA 3C9NA 4PJCF 1R3JB 1U41A 2J8OA 4QGYA 4AQ1B 1T2XA 1YZZA 1S9YB 4XP9L 5KVEH 1EMTL 3DX7A 3X3GL 5L88H 3FB5A 3LEYH 1B90A 2EDRA 1LP9E 4NCC1 4YDVB 4XC3H 5E8EB 4ODBD 4B50A 4LL9A 1WWCA 2NXYC 5CKAA 1YECH 3CK0H 3G04B 3Q3GA 1A9BA 1S7VA 5C0EA 3BPCB 3VH8B 1R24B 4EDWL 4AZ8A 1NMCB 4P2CG 1CF8L 5E9DE 4APQC 4OLUH 1KLGA 4MB4A 5JW3H 2AABH 2X10A 3VI3E 1RAMA 1C5DA 1F4YL 2QQKH 2PCPB 4AMKH 1DEEB 1WFUA 3MUGB 4HPOH 3TYFA 1R3KA 1X6LA 4I0PA 4ZS6D 4FQXC 1R5IB 3BP6B 4XWGL 3ULVL 3L5XL 3S37H 5BRZE 2VXTH 1MIEH 3QUZA 4J4PC 2EDTA 4LMQI 1IGYA 1JP5A 1RK1A 3SDYL 1IKFL 4BFEA 2YD5A 3GHBH 4BH7B 1EGJH 1GGBH 2ERJC 1E6OL 4XCYA 4URTB 3ZKXC 1O7SA 1E6JH 4JREB 1MIML 3KYMA 4G8GE 5KS9A 1QBMH 4OJFL 2OCFD 1OSPH 1OD9A 4ELME 3BEVB 4JFEE 3RTQD 1BD2A 3FQNB 1OOAA 3UTTB 5FHBH 5IROA 2UZIL 4R8WL 2IWGA 4RQQA 2NX5E 43CAA 1A0QH 1N8ZB 1Y0LB 2D3VA 3EYUH 3VRLE 4G6AD 4JM4L 3TWCL 4NFCA 1OPGH 3DRQA 1OAKL 3MCKA 4MD4B 1M7IA 4PREA 5CJXC 2EYSB 4GQ9H 4U33A 5IB4A 4ELKB 4JFOB 3UTZB 3QHZH 3WHE0 1IKNC 4NDMA 1TZHB 5CZVH 4JY5H 3VFWB 3MREA 5ETUA 3V8OA 3ZKMD 3MNWB 4N8VG 4PJ5D 1XMWA 5DLML 4POZC 4XNZB 2EKJA 2EYRA 3FB7A 4EI6A 2YPLA 3BZ4B 5SV3A 3JBG7 3ZTJG 4O4YH 5FHAL 4IM8A 1FZJA 1Q9WA 3ARDA 5J13C 4JGUA 2ORBL 2FIRT 4OV5A 3BGMB 2ZSWB 2P45B 1WCBB 1KCKA 2AEQH 4PJIB 5DFWH 4LEOA 3DO7A 1S9KC 4KTYA 2HRLA 4GMTH 1QYGH 3EYVB 4P2QD 3DSNA 4U1SB 3AFLA 1LEGA 2WIIB 4PRDB 3F7PC 3OKLB 5F7LB 2FRGP 2H2SC 3KR3H 4MMXC 4XP6L 4X6EA 5KS9F 2AK4E 2XI9A 3OKDA 1X4YA 3WNOA 1OAYH 4LCCA 3LKNA 4R26L 1AGFB 3RPIB 1CLOH 1IM9B 2GAZA 4P5KB 4JM2F 4PJ7E 5FYJD 3QQ4B 5FXCH 4EUPA 1F6AB 1JL8A 2VDRH 2KKQA 3JWOC 1QSFA 5I8KH 4I18B 3V4PH 1KUMA 4UBDC 4BFGA 1CDHA 2R29H 4PJDA 4HUXA 4P3DB 5EZJA 4G9FA 4D94A 1EJOH 4X7TB 1MQKL 4J2XA 2YUZA 4Z7WF 1WIPA 4MA1C 4XX1E 2YZ8A 1DR9A 1GC1H 3M45A 1KCVH 4MCZA 4X6FB 1J86A 3MOBH 3LRSB 4O02H 5JPMA 1MJUL 4OD2A 3WIFA 1IARB 2DMBA 4PJXA 5T1DL 4LBEA 4RX4D 2QL1A 4OUUA 3H0TB 1MRDH 2GITB 3X3FL 3CXHJ 5IF0B 2ATPA 5C6TL 3BQUD 2C1OB 5T5FH 1AP2A 4JR9L 5IB1B 2R2EA 2OX5A 1UM4L 2OR7A 3STZA 2EEAA 4GW4A 5GS0D 4HH8A 4OUOA 1MCPH 1WV7T 3C8HA 3L3IB 3M8OL 4YE4H 1EDQA 1IRAY 1JWSB 3SE3A 2A6KA 4YHLH 1LQSR 3NBNA 4PTTA 3OGOE 5DVLA 2CKBH 3DX6B 5I15L 3IFNL 2X4QA 1I7ZA 5D93B 1CDIA 2ICWJ 1J05A 5EORH 4TVPD 1YEJL 1KLUA 1MUJA 2IEPA 3V0WL 4PRHA 1OCWL 4MJIA 3BH9B 1WIOA 2Y72A 4TNWK 4XCEB 3HNTH 1PAMA 4OBRA 5I2IB 3RPKA 3VD4A 4PJDF 2BSED 3GNMH 2JCCE 4YGVB 5DFTA 1N0XH 3P73B 2NZ9D 3ARBD 2Y5TB 1F3DH 2G75A 1FFOA 3MR9B 1A4KB 2HJKA 3MA9L 4OLVH 4X80H 2XN9A 1FYTB 3ULUL 5SWSB 3F6LA 3ARED 1CIDA 1OGAB 2E9BA 1S7QA 5IMLB 4PJXF 2DLIA 4U1NA 1J8HD 4QHMA 4PLOB 1UEYA 3S36X 3RVUD 4OZIE 1WWAX 4MHHI 5A43C 5ID1B 4Q7DA 4M7LT 4ZUUB 3RTQC 1LP9A 1HKLH 1IAIM 3SGEI 5CWSA 1U91A 4OIAA 1HH6A 3QBTB 4G8FA 1J0YA 3LB6C 2GTWB 3VWJA 4K7FB 3UTSB 5E9DA 4LLQB 2HT4D 1U8QA 5TH2A 1FNSL 4NIKB 2KQNA 3O2DL 3IFPA 1CBVH 4LHUA 2EE6A 3OR6B 2IQAA 5FCUH 4ONGH 1IGCL 5IMKA 3OXRA 5DA0B 3VD7A 1QA9B 3L3GA 3BP7B 5DVNA 4JQXA 3NFPA 4JDTH 5IBUB 4KVNH 5BRZA 4F57L 5MHSE 2MQ0A 3QP3A 3CMOH 4YC2B 4IRJB 4GOSA 3E8UL 1JHTB 1BPVA 1FH5H 3CH1B 2AXGA 2V9RA 2VSCA 1BFOB 2EIEA 4N0FA 3B43A 4G8GA 2NLJB 4M93C 2R2CA 3QWRD 1UA6H 4JFPA 2YRPA 3L7EA 1MSPA 3HZVB 4F9LC 2G9HB 1JF6A 4ELMA 3BN3B 2PTTB 4JFEA 3D39D 4M43H 4KQ4L 1EHLH 3TZVD 8FABB 4LCWD 2GHWB 4LVNC 2NX5A 5HGAB 4DGYH 1ZGLB 5IUSA 1BF8A 2BXYA 1LP9F 3IS1X 3QUXA 5BV7L 4OI8A 1LO2L 1A1NB 1JPSH 1R3HA 4ZOAA 4F7TA 4MA7H 3TIEB 1OSZB 2EDFA 5CFHA 4TOYH 3LMJH 3T04D 1R3IH 1KB5A 1MLCA 3J7HA 1CG9A 1XF5B 3UTPD 1KBGL 1SEBA 4QYOB 4YHYB 2JK5B 3BO8B 2OMNA 3MV9D 4DN4H 1DQML 4D0DA 2B0SH 5E95B 5K9QI 3VI3F 3KYNB 1SYSB 4UOW1 5D7IB 3PWJA 2FO4A 4KXZH 4OSUL 1FO0L 1YEKL 1YEIL 2AW2A 4H20L 2YD2A 35C8H 4U6VL 4DCQA 4NGHL 4G8IA 3MYZA 1A7PL 1G1YA 5J6HB 3QDGB 1GH7A 4UB0H 1NPUA 4FTVD 3QO1B 2VXQH 3LCYA 1NC2D 3RAJH 3TBYA 1FPTH 2VN7A 1XCQB 2ADJA 1NBQA 5C9JA 2AK4A 3GSXB 2VYRE 5T3ZE 3ECBB 5FOBB 4ELMF 3WHXA 5DMYA 5DDHB 5T3XL 4RFOL 4PJ7A 1QFUH 5JORA 4Y5YA 4GAJH 4R4BB 1LDSA 4Y5YC 2R39A 2YD7A 1AIFB 1ETZA 2O61B 3VRLF 3BW9B 3QA3B 3QIBC 2YPVH 5KTEH 2I9TB 1KFAH 5A1AA 4C57C 1U36A 1BF2A 2A1WL 3ZE2E 3BPNB 2OYPA 4G6JL 4PGBA 3V4VH 4P5MB 4A2LA 5CP7A 5GGTA 4YXLH 1JN6B 4NNPL 5CS7A 3VXUA 4KKCD 2A6DA 3DRTA 2DM3A 4AEHH 3ARBB 5B38B 5EIQA 5KVDH 1MRCH 3CFDA 3B9DA 5JOPE 1YNKL 2OJZL 4UTBH 5IHZB 3C5JB 1XGRB 5CJQL 3BRGC 3GUTB 5HYQB 1UJ3C 4YHKL 5HHNA 2C1PB 1QG3A 2AI0H 2M2DA 1BQHA 1G6RH 1H3PH 1HSBB 3AREC 4WHDA 4XB8A 4NZJA 1YA5A 1RZJL 3LZFL 1CVRA 2PO6A 3QUKB 3EYFB 3QDAA 2HFFA 3LY6A 4I3SH 4OCRH 1T21A 3DTXA 1SY6H 3BMVA 1AXTL 3RVUC 2X1WL 2R69H 3H7LA 4L8DA 1DP0A 3UPRB 3LQAC 1RULL 2UY7A 5HI3D 4RAVB 4HXAH 3PF2A 4HAFA 1I1AB 2X4RB 1FBIL 4PJ7F 5I74B 4Z0BL 4L4VE 3RZWA 3TV3H 1N26A 3O8XA 2ICWA 1ZE3C 4LAJH 3O8XC 2QSQA 2CGRH 4YDKH 4JY4B 3QR2A 1CFSB 2ITDB 2VZ1A 1BAFH 5ICZA 2JCCA 4YDJB 1ZHLB 4MNGE 4NSKA 2A73B 2FJGA 1S7RB 1IT9H 3L5WA 1YEEH 3NZHH 4CDGC 4NWUH 5K9KA 1FRGL 3GO1H 4ZPTB 4P4KD 1ZOXA 4M6MH 5HPMA 3G5ZB 4XBGB 5JO5A 5GSVB 1ONQA 3IKKA 1L9NA 3S34H 5DEZA 4HIXH 4K2UL 5A3ID 5JIHA 3RWHA 3CGTA 3GMNA 3QULB 2O5YH 4OZIA 4P3CL 2FL5A 2XKNA 1GAFH 3IJSB 3IJHB 5DFVD 3CDFA 4LIQE 2X1PA 5DYOA 5I8OL 3T0WA 4PP1D 3TZVC 1FSKB 1W72A 4XCFL 3F58H 3RX7A 4L8SC 3TBVA 1P6AB 3UO1H 4NKMB 3ZSTA 1MPAH 3MV8D 3NIFE 4NJ9H 3TYGH 4Z18A 1F6LL 2EDDA 4YX2H 1W8OA 3QI9A 1XGTB 3ES6A 2NY0C 4BQCA 5IHLB 5CEZH 3RA7H 4XI5C 2DM4A 5HHPA 1A7QL 3MBED 3WSQL 4LAQH 1L0XA 4HK0B 3S36L 1UWXH 1MCJA 2OR8A 4WTWA 5F7DA 4NRYA 3H3KA 3KHQA 3EJZD 3EOTH 3B9AA 1QEWB 1I3RA 1JI1A 1RHFA 4PRAA 4N0UB 1JGEB 2UVFA 2YN5A 4Y4FC 1PFCA 5BJTA 2GK2A 1WT5C 4EIZC 4JVWA 4HJ0C 3RL2B 2Y7QA 5AUMA 5CKGA 4LSQL 1P6FA 5DQ9A 1P9MC 2B1HH 3RBGA 32C2A 3GJFH 3JV6A 1OW0A 5C08D 4TTDD 1VADA 3V9FA 1PYWA 4OZIF 1UXSB 1SJHB 2E7MA 3QDMA 4Q9RH 1F45A 4JKPH 1OAZL 4KI1A 4LCUB 3JWDH 3GSVB 5HYEA 1I1FB 1A7OH 1G9ML 1HK6A 4DK6A 1VGKA 4WEBH 3QEQD 2HT3D 1MRFH 4YWGH 4WO4A 1RHHA 2I26N 5JHLL 2YD1A 3OGCB 1JNHA 5FF6B 3EOAA 5KSVB 1A9EA 1NEZA 3HHRB 3I02A 3U82B 3B9KB 2IBZY 1R5WB 5JOEA 5DRNA 1MHPH 4HPYL 5FGRA 3NCFB 2EC8A 4HS6B 3DVGB 3U4AA 1MHHA 1QFHA 5SWZE 1FNGB 1DZBA 2PR4H 4L4JA 1H3UA 1S7TA 4KKCC 2IAND 3LQMA 3O11A 3BKYH 1L6ZA 5E70A 5MEOB 5MERA 5C09B 4QWWD 2X9XA 5BW7A 2B4CC 4QCIA 2BOCA 1Q72L 2Q3ZA 1V3LA 4F58L 1JPGB 2CKBB 1F11B 3RDTB 1RPQA 4JY6A 3VI4E 5KSBB 4L9LA 1KIUA 3PP3H 1CGTA 1VFBB 4FQJH 1BLNB 4GRWB 3LN4B 1VFUA 1XR8A 3L3OB 4PRIE 4RCAA 2R0KH 4XC1H 3U4EB 2VLKD 3U9PH 1J5OH 1FDLH 1ACYH 3F7YB 5B8CB 3BD5A 4RMSA 1FC1A 5C0BB 2EIZB 3GKWL 1B4JL 1WBXA 5J9PA 3JUYA 4LK4A 4YZFE 4GRMB 2B39A 4MZ2A 1W0VA 1AD9B 1F3JB 1II4E 2VZTA 3VE0B 2DQJL 3GBLA 3FRUA 2R56L 5F9WB 1JGVL 5IFHH 5F71A 5CBAA 4X5XA 1F02I 3CPLA 5KW9H 3AS2A 3ZTJH 3U48A 3WKNA 1FNLA 4M8QA 4D8PB 1T1YA 3QEUA 3FTGA 4FOMA 5KVGH 3KYKH 4F33A 2WNGA 4ESKA 4OD1L 3MPCA 3N9GH 3HE7D 2WK2A 3V5HB 1NGXA 3DV4A 1J8KA 3D3VD 2DDQH 2YKLL 2CK0L 4NHUB 1ZHKB 2F5AL 5D1QD 4FQIH 1UVQA 4LVOC 4KK5C 2YS4A 3ZYIA 4H1LG 1TQCC 4M5ZL 1WZ1L 4WU7A 5C0FA 5I17B 1DLFH 5J06A 4LRNL 3HE6D 5A3IC 3OKMB 4JPWH 3WNPA 1AC6A 1AGEA 3IB4A 3P0VH 3K1DA 1K85A 3ARPA 2F8VA 1L7IL 4ZXBC 2C4FT 3U9UA 4OLXH 2MWCA 2VXVH 3VRJB 1ZVHA 3FT3A 2X4TA 3D0LB 1I8IA 5DJ6B 4L4VA 5CINH 1FVDB 2FB4L 1DVFB 3TESA 3MNVB 5L7XH 1UWXK 1ND0B 4XPFL 4ZODA 4PJHE 5JHDE 5I18H 3MLWL 2VLME 1XF3A 5EN2A 4G7YL 5F97E 1KCRL 2WWMC 1F42A 2WWKO 3MRDB 1HH9B 1I9EA 3ZE2F 4MNGA 5TFSL 4XXDB 5DK0A 2FH8A 1U8JB 3FO1A 3ABZA 3N1MC 2J8UA 1J0KA 1QNZL 2B20A 2ARJA 3MBEC 4N9GA 3GJFK 1ZSDB 1IBGH 1A5FH 4UV4L 2VAJA 3A6BH 3V0VA 2OSLB 1Q1JH 1VACA 1KC5L 5A2LH 2IADB 3BWAB 3DSFH 1CICD 1EXUB 5GS1A 2Z31D 4ZAKB 1U3HB 4YNYB 3R1GH 4XBPB 5D7LB 4H26A 4M3JA 1A1MA 4JG1H 3UTOA 2AK1L 2YSSA 3X13B 4CBPA 2CXKA 4WWKB 3C60A 3FRPA 2R1XB 5JIKA 4QKXB 3B9VA 3LKSA 1GGCL 3HMXH 4U49A 5DJ0A 4WNQA 5D2LA 5EFIB 4PJ9A 4XMKL 5T1MA 2BVTA 1AD0B 4K71B 4ZTPL 1GL4B 2HLFD 4I9WD 5D2NA 3TH2T 5D2NC 3QEQB 5CP3A 2YHGA 3UJJL 3G08B 3O2WL 3V7AE 1LE9B 3P9LB 3IDGA 3VRIB 4Z7UE 4Y5VA 3SDCD 2I5YH 3SDDD 3RWDB 3BP5B 2VJXA 1B0WA 1FLRL 1YYLL 2BVUA 5DR5L 5TGBA 2EEBA 4O2FB 3MRFB 1GGIH 4CVXA 4NZRH 5I73C 3GMPA 5D6CA 1I4FB 1YDPA 2DRUA 1QVOB 3TM6A 1CGVA 4B5EA 4MXWH 4R2GB 5E8DL 1GYAA 2WANA 2HFEB 5F6HJ 4J6RH 3SJVA 5HYJE 2MQ3A 2WLZA 5F7WC 2V7HB 3K8KA 2ADGA 3RU8H 1BMGA 1ZS8B 3TIDB 4X6BB 5ICYA 5D70H 4OCWH 4OQTL 1ES0B 2ENYA 2GI7A 1NGQL 4KROB 3PWPA 1MHCB 2W0PA 4DTGL 2FX7H 4LVHB 3HG1B 3CJJA 5JOFA 4YBQD 4PGEB 1H5BB 2H8PB 4YDLB 1JPFA 3MCG1 4ENEC 1YY8B 4IEFB 1WFTA 3CX2A 1B2WL 1XIWC 4TRPL 3EDEA 1WZKA 1U8IA 5EOCH 1HINH 5F21B 4MJ5A 4HWBL 5KVMC 4KTEL 2SEBB 3BVNB 1QSVA 3OB0H 2E7HA 4XP9H 3BKCH 2YUWA 3NIFF 3FONA 4MMZC 3QQNA 1QLRB 1X4ZA 1D5XB 1B4RA 3HI6H 1T20A 4P9HC 3ZT6A 1EIBA 5DURD 3QXVA 3VGFA 2HG5A 2VTFA 3U7AA 4XMPL 5SWZA 4XPHL 1D5MB 1MY5A 3TEUA 1NCUA 5DC0A 3WEXB 4IOSD 3HE7B 2VQ1A 3FQUB 1IEHA 5IG7A 5JQHC 3GMQB 2JJVA 2CK2A 3SKNA 1MWAA 3AS1A 2N7BA 3DXAD 3MRBB 3H8NA 2DKMA 3IVKA 4KGJA 4XT1C 2X70B 1U93B 4LPTA 5C7XL 4XWGH 3QFJB 1Q9OA 5BMFL 3L5XH 2W0FA 4N8CL 1I8KB 4DN3L 3HE6C 3UC0L 4Y2DA 4R0LB 1PLGH 1MI5B 2KDGA 5IWLC 2NCMA 4HW6A 2IAMD 5EUOF 5IJKC 1EV2E 1E6OH 1HHHA 3NCJL 1NAMA 4KI5D 2R23A 1MIMH 4X7EC 5CGTA 4OJFH 3WV0A 4R7NA 1EO8L 4ISVA 3RVTC 3MBXL 3QEHA 1KYOK 1AO7D 3O2VL 1DQLH 2IBBA 2JJUA 3SBWC 1L4IA 1KGCE 3QXDA 1Q9KB 4MD5A 3ARUA 2UZIH 3JV0A 4R8WH 3WFHB 5AG8A 1NFDF 5F6IC 4KZDL 3TWCH 1MCQA 4UNUA 3UBXA 1U8OB 3CLEL 2XA8L 1ZXQA 1ERNA 4OZFA 3C5SB 1JZ7A 3L95B 1T2JA 3CFKA 1DDHA 1LNUB 4Z0XA 4U6HB 2CDFA 1AFVL 1KEGL 2H9GA 2NNAA 3WCYA 3REWB 5T33H 2CLVB 1CICC 1EBPA 4NM4L 3FL7A 2Z31C 1U2CA 3OKEB 4JO4H 2BFVL 5IVXE 1Z0NA 5DJXB 5FHAH 1JWMB 4Q2ZB 3EFDH 3LKQA 4W70A 1EZVX 4YXKL 5H35A 2PTVA 4YO0B 4JKKA 4WUKL 5D72L 5J11B 4ETQB 4HS3B 4MAYA 3KS0J 4I3RH 4HHAB 1B0RB 1JMZA 3KPPA 3L9RB 1QLEL 3IETB 3QZWB 4YZFF 4XP6H 4GUPA 4PJHA 2HLFC 3HA0A 4P46B 4FQQA 1SYVA 2V9TA 3VGAC 1DN0B 1NKRA 4U1IB 2DD8L 4PUBH 2HVKA 3MRRA 3QWQB 4EN3C 4IDJL 2XPGA 2XWTA 2EH8L 4XVTL 4P2RB 5DUBA 3SDCC 5C70A 4NC0B 1N59B 2CQVA 5J7CC 2XT1B 3GJFB 3P77B 3IFLL 1I8MA 3GSNH 5DK2B 1WUNT 4ONFL 5JW5A 3TO2A 2OZ4A 3H42L 5I1DB 4NNXA 4MJ4A 3PDOA 1RZ7L 3QHFL 3HMWL 4HAGA 5FO9A 1L7TH 3KPTA 4LGSB 1REIA 1ZHBA 3R0MA 1D6VL 1K4CA 1CFVL 1G7IB 3DNKA 5TQ0L 3WDHA 3C8KB 1CD0A 3KDMA 3O9WD 4GO6B 5J1AB 3MLXL 1RUKL 2IPTL 1OY3B 3OL2A 5IMOB 4CVZA 3IF1A 3X3FH 1R3JA 3BX7C 3RP1A 5E6IA 2NXZD 1W2KT 1S9YA 1I85C 4OF0A 3PIQB 5HHXL 1UM4H 4HUMB 4YDVA 5I75C 4OM1H 1BJMA 1OP5H 2XY2A 2EIBA 3HC0B 4RNRB 4S11A 4Z7UA 2XKSA 3M8OH 4YEFA 3G04A 4OFYD 5CJBA 3BPCA 3VH8A 4ODHL 1R24A 3PJSB 3VFMB 4NO0B 4ODXB 1NUFA 1MH5B 1JYWA 4QRPB 4DAGH 2F53D 4K8RL 3D25A 4Z78B 2RHEA 5EBMA 1OCWH 1H3GA 4TVSa 4JVPA 5EH1A 2PCPA 4IJ3C 3QUYA 5HYJA 2PYED 1T7YA 5E00B 1NFIA 1JUFA 5FUOL 5ACLA 5C2BL 5IGXL 2XICA 3V4UL 1EA9C 1C5CL 5E99H 1FNFA 3VA2C 3ARFB 4NQEB 4WDIA 1OF2B 3QQ3B 4P2OD 4BH7A 4N8VB 5EZLB 4GXVH 4RMRA 4GBXB 1I9JL 2DF3A 2MSPA 5DD6B 4JREC 1FN4B 3BEVA 4X83A 4DEPB 5DQJB 3FQNA 3KPOB 4ZNEE 2GFBB 5AD0A 1OT2A 4KI5C 2VOTA 4O5LH 1EAPB 4NP4H 2ARWA 4NQDD 2VLJD 4HJGB 1Y0LA 1MFEL 3F12B 5LVEA 1Z5LB 4JFFD 2V7NB 4ZDHB 2ZPKL 1PQZB 5FYJE 4Z7UF 4ERSL 3NA4A 1JRHI 3R06A 5DGQA 5H8DA 4JG0L 4MD4A 1QSED 2ICCA 3SE4A 3ULVD 2EYSA 1FVCB 3SE4C 3VD5A 3UTZA 3B6SB 2IALB 1TZHA 1FNSH 2H6PB 5L6YL 4DW2H 4ETYA 4F7CB 2IFFH 3D18A 3MNWA 5SX5H 2VKWA 5FM4A 3ILQD 2HFGL 5GRJL 4XNZC 4G80B 2OJEB 1VGEL 3JVGA 4NN6B 3GKZA 3BPLB 3BGMA 4F57H 1WCBA 4JQIL 4PJIA 2ICWI 4U1SA 3EYVA 1PY4A 1UKSA 4AH2B 2WIIA 4PRDA 2NY4D 1PX3A 3L3KB 4QF1A 3VXSD 3ZO0A 4ONOA 1E4KC 2Q7YA 1NMAL 2ESVD 3VFNB 4YHIA 1IC5H 5SWQB 2KZ1B 3AVEA 1AGFA 1F4XL 3B5GA 4LF3B 3RPIA 3BWUC 1UM6H 1IGIH 1KEML 4P5KA 4KQ4H 2FGZA 1UQSA 2B7DT 3I3DA 5HHOD 1NDMB 1NC4D 3QQ4A 2DQUL 4X9BA 2X4SB 3QNYA 5BV7H 1IAIL 3MRGA 4TVPE 4YR6B 4HGWA 4I18A 3T0AA 2IPKA 4UIKH 4NO3B 4P3DA 3JZ7A 3MV11 1LILA 1T1XB 4X7TA 3QHTC 1OARL 4DUWA 1U6AL 3GM8A 3O3BB 4NUGH 4L29A 5H37G 4CUCA 4ZO7A 2CDEB 5CD5C 5HGBA 1KCUL 2X1QA 4XVSL 1DQMH 4HUKB 2MHAB 4BQ8A 1UG9A 2YMXH 1NAKL 1D5ZB 4X6FA 3CDCA 3PL6D 1CDYA 4A6YH 5F96H 2DIJA 3PWNB 1V3JA 3T2OA 4MHHG 1TXKA 1YEIH 4LSPL 4LSUH 4H0GA 4YK4B 1OP5K 2HRPL 3H0TA 4U6VH 4U6YB 4WHYG 2WQRA 2W92A 4NGHH 2C1OA 1J8HE 4L3ED 5IB1A 4EXKA 2C3XA 5CCKH 3LEXB 4Z7VE 4K7PX 1VHPA 4TNVK 4TSCL 3JWNC 4OIBA 5J57B 4PG9B 3PWUA 4M00A 3RJDA 2VDNH 4JPKH