3RY4A

1.5 angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
170
structure length
170
Chain Sequence
APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLFEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Low affinity immunoglobulin gamma Fc region receptor II-a
publication title Structural Basis for Fc{gamma}RIIa Recognition of Human IgG and Formation of Inflammatory Signaling Complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ry4A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ry4A02
1X5FA 4WW2F 5B38A 3I02A 5F7YC 5JZ7C 5I1LB 4X8XA 3OJ2C 1JWSA 3RPKA 3BQUD 4OCXH 2Z31D 1E0OB 5TE7L 3MV7A 4HMEA 3BWUC 3QH3A 3MRJB 3MRBA 3GIZL 3MA7A 4Z7VB 1VCAA 1QEWA 1T4KB 4C59B 5F3BA 5E99H 5GGSA 4F3FA 1S9WB 4HX1A 4YHNB 4HGKC 1PZUB 1HHIB 3QDGA 5EWIL 1A9EB 1QA9B 2P5WB 3WO4B 3BEWA 4NO2A 5EZOH 1CN4A 3K8MA 1QTYT 1LILA 3NFNA 3G6JF 5TQ2L 5KJRH 1H8NA 4J7RA 4FABL 3UC0H 4GAJL 4WUUD 2VLRD 2DM2A 1RHHA 2EE2A 4I0KA 2A9ML 3UPRB 3GMNA 4H1LA 1YA5A 1ZLUH 3O3UN 2HJLA 2R1WA 1NDMA 4MXQC 4Z7QF 4AEFA 2IANE 4OLZH 3IRPX 4U1JB 3Q1SH 1BFOB 4MD0A 1C5CL 2APXA 3PJSB 5B38G 2H2PC 3B3IA 1KTRL 4TUOA 4N0FA 4CVZA 3MLTB 5CSGA 5DEGB 1URLA 2H45A 1TFHA 3OZ9H 1IM3B 1R3IH 4G7YL 4L29A 1B6DA 1HKLL 4M1CC 4EIGB 5I73B 1NGQL 4Q9QH 1TCRB 3WNMA 4L3EA 4HUWB 2LV4A 5MEND 2J6EL 2VDPH 3P0YL 3QEHB 2NQCA 1BP3B 4KKAD 5TF0A 1UWGL 5GRJL 1T2QH 4P5TD 1UKTA 5I15H 4IHOB 5F6IC 3JV0A 3EDJA 3BZ4B 3U46B 4CU7A 2DQCH 3PQYB 3IDGB 3NFSH 1ZVSB 5B8CC 4WJ5A 3ULVC 2PXYC 3P3YA 2UUDH 5C0EB 2EKJA 4H8WH 2IBGA 2B1AL 5EIQA 3QO0A 5DHVH 5EC1A 1A6UH 2EC9T 4NUGH 5GJTH 1AKJB 4R3SA 2C1OA 3DX9A 5EO9B 3RI5F 1N6QL 1ZA3A 1MEXH 1NCAL 3ISWA 4ODVL 5L6YH 5I1AB 1JV5B 1XGUB 2WWKO 1MWAH 4RFEA 3EYSH 1REIA 1MNUL 2KUTA 1AGCA 4GKNB 5J6HB 3BYYA 1KPUA 1YZZA 4NYLA 1IAOB 4WY7H 1T22B 4HQQH 1CU4H 4IOFC 4XNYL 2X4TA 5DLML 3W11C 4YBLC 4K71B 1K8DA 3C5ZA 4X7SH 4PBVC 3UTTD 5DFWH 3W2DL 2X89A 5D1ZA 2WMPA 4PPTA 1ZHLA 4HT1H 1SEBB 5IKCA 2LU4A 4O9HL 1S9VB 4PP1C 1HH6B 5HDBF 1I8IA 1IGTB 3I3EA 5J89A 4DVRL 3QI9B 4QTHB 5JIPA 3VMNA 4ENEC 4EZMA 5CZVL 2AGJH 1T1WB 2FATL 3O8XD 5IQ7H 3GMLB 3MV9E 4ZUSB 3RVTC 1RZ7L 4Z7OF 5F7WC 5LG1A 3F58H 5DK0A 4F9PA 1OT2A 3WS3A 1DBKH 5TGBB 1WCBA 2NW3B 5D7LD 3HMWH 4G5ZH 4D9QD 3CU7A 5KSBB 4OV5B 4F7EB 1JTPA 2HWZL 4Z77B 3CDGB 1WV7T 5IFJB 4FQ1H 3LVEA 4JZNA 5MEOB 1N5YH 2XQBL 2F8XC 2ZG3A 1JYVA 4WNQB 1OVZA 5IB3A 4Z76B 4HIHA 3S37L 1IL1B 3V7AE 5J11B 4M7ZC 1MIML 1TPXB 1VFMA 3RUGB 3TH2T 4XVUD 2Y07H 3EOBB 3RAJH 3C6LA 3KPLA 4LP5A 3AREB 3OX8A 3F12A 2EE9A 5F6HJ 1EGJH 5C09E 5C07B 3A67H 4GLRH 4P9HC 3MYJB 4ISVA 1MELA 2DMKA 4ZDHA 2EO1A 2D7OA 4Q6IB 2PO6A 2R56H 5KS9E 2EDBA 5ICYA 1KIUA 1UH4A 4NCDA 5E94B 4LPYA 3BE1L 5EU6B 5GS1C 3DNKA 4M8VA 3QIBA 3BESR 5DTFA 1EZVY 5DRNA 5A2LH 4S1RL 1OY3B 3WUWA 1XF3B 3WN5C 1C1EL 4XCCH 5GSVA 4HULB 1J11A 1EJOH 4DAGH 5JHDA 4F33A 3QHFH 3BT2H 5HI4C 1OTTD 4EIZC 1UH2A 2IFGA 3MFGB 2YD7A 1L4IA 1DLHA 1ZLSL 1V8HA 3MOAL 4MB3A 3DHJA 4OSUL 2KPNA 5J56B 1XH3B 1R3KA 5CSZB 3BSZH 4X5WA 3BX7C 5FKAB 5T3XE 1HHHA 3FQNA 5ITBL 3KLAB 2PTTB 1NAML 3HS0B 3K1KC 5FHAH 3GJEA 4LVNB 1KNOA 3PABB 3G04B 1OD9A 1M7XA 4Y5YC 4K07A 1EFXD 2ATPB 4AM0A 3M17A 1KXVC 2AXFA 4PJIB 4QHKJ 1VHPA 3Q6GL 4RGMC 5HD8C 2FR4A 2F19H 1FV1B 1RZ8A 3CH1A 5E2UH 2W9DL 4X4YA 1HE7A 5GGQL 3EOTL 3K8LA 2R0WH 4Z7WF 1M7IA 2DQDH 4TN9A 1IVLA 5TE4L 5D2NB 3WFCL 5EOCJ 2V5RA 4XRCB 5DD5L 4QWWD 2H6PB 3BPCA 3ULUE 2QHRH 2E27H 3TNNB 1S9KC 4F8QA 4JJ5B 4PRHD 3IFNL 3PL6B 3KPRA 3JV6A 2F54E 2EYTA 1AD9A 1NMAL 5D96B 1NFIB 1ZWIB 2NX5D 2VKXA 1QBBA 3L3KA 4PJHA 1OARL 2P8LB 4LLYB 4P2RD 4O51A 4X9FA 2D0HA 4OTXL 1CQKA 1SYVA 3JBG7 2X6MA 3E2HC 3QIUD 4WEBL 5JA9A 3FONA 3VFWA 3RBSA 4NUJA 2ARJA 1GC1C 3P2TA 4KDTA 5A1AA 1EHLL 3ARFD 2BVYA 3OWEA 1GOHA 1XAUA 4B0MM 2HJFA 1E4KA 1O0VA 2DI8A 4JKMA 4PJDA 4PJ9C 4YGVA 4MQXD 4PRPA 1MFBH 5D7JA 3RKDC 5SWSA 1EO5A 3OF6D 3WFDL 1E6OH 2D31B 5C8JB 5EPMA 4AG4H 3MBEC 1BVKA 3VXRA 3I50L 4ETQB 2ZCHL 3VGBA 4FQ2L 4R90H 3GMPB 2BC4B 3NIFE 3ZL4L 2YKLH 3QQ4A 5GGVY 3U0WH 5IJVA 3INUH 4OZHA 3GSUA 4JFDA 5GRUH 5MI0B 3D85B 2BX5A 4LSUH 1SJHB 3CFDB 3S3PA 2R1YB 3IAGC 1NBVL 4JQIL 1G6RH 4GRWF 4YHPA 4EI6B 4KK5C 3DPBA 1YQ2A 4HAFA 4NHUB 3MPCA 3QQ9D 1S9XB 1YN6A 2GK0B 1A7NH 4HZLA 2QR0A 3NZHL 4W6YB 4JZJB 1B0RA 1A4JA 4JFFE 4BELD 5K59E 5IMOB 1MCKA 3CK0H 2YD4A 4UNUA 3T1FB 4N1EA 5C3LD 1W72L 3KPPA 3HUJE 4PRAB 1HN1A 3V52L 2VAAB 5C0AD 2F15A 4K8RD 1IGFL 3OKOA 5E8EA 3B2VL 1TNMA 4F9LC 4OD3L 4Y5VC 1ACYH 2XPGA 4R0LC 3KR3L 1CD1B 1JGDB 4K8RH 1S9YA 4JFEB 3BP4A 2GEEA 3DLQR 5DZOA 4WTZA 4NN7B 1IKNA 1VACA 1D9KA 1XR8B 1RK0A 3QDJB 1G1CA 4D9RD 1F00I 5FO7B 1JF6A 3RZCA 3WIFB 1ZGLB 1KELL 4YQXH 3S37X 4KI5F 3HTLX 4HWBL 5IWLC 3O4LA 1ZHNA 5DF0A 3CPLA 5LXGL 4MAYA 4GMSL 4FXGA 2BNRE 4MD5A 1K5NB 2JCCE 4XNMB 4YO0B 5C0DB 5INCA 3DMMC 5GGRB 5ACLA 4FQXB 1KYOJ 1NGWA 1MFDH 2XI9A 2B4CC 2AJSH 3CSYA 1CLCA 1R5WA 3LN5B 1SM3L 2PYEB 4S11A 4YNYB 1YMHB 4PJFA 1FN4A 3JV4B 3W9EA 4PR5A 3OAYH 4F15C 4PGEB 4ZOBA 5KANI 2CMRL 4XMPH 4RIRB 3TBTB 4YHOL 4WFED 5GZOC 5KSBE 1M1SA 3LDBC 3VWKC 4OGXH 3NIGE 5EUOA 4ZSOA 3D0VA 3RDTA 4WTZG 4FP8H 1FNEA 4KJYB 1OB1B 4J4PC 1P7QB 1W8NA 2XNAA 5DUPH 3OKEA 4UZGA 3TJEH 1D5IH 1JNLH 3NCJL 4GKSB 4ODUA 4PUBL 4XHQA 3H0TA 4AIZA 3MNZB 5FYLE 1BD2B 1DJSA 1VKXB 4PJXB 4QF1B 5C07E 4BH7A 2BVOA 2HKHH 4JPVH 3QEQD 4N0CD 4W4NA 4PJCB 4XVSH 1MJUH 1OW0A 1SEQH 4I9WE 4HHAA 5KVEL 1I7RA 4L4TD 3TBVB 4PG2A 1PD6A 1P9MA 3DUSB 3SDXF 1DANU 5TE7H 3X12B 4KFZC 1XIWC 2PW1A 4H20L 1LE5A 2AJZB 4NWTL 2NY0B 1OGAA 1Z3GL 4P2QE 5TE6L 4WRLA 3ZDYE 43C9B 3GIZH 5C6TL 2R8SL 5F89B 3SJVD 4UTAL 3KJ4B 2FJFA 3KXFE 1FYTD 4QOKB 2X4QB 1YUHA 2MQ3A 3O11A 4WI4A 4JY6A 4BSVB 5EWIH 3BIKB 5JQ6L 4KK8C 1HIML 4XAKD 3EJYC 1E6JL 4BZ2L 4PV9B 4ZS6C 4GAGH 3ORJA 4CGTA 5T3ZD 4P57A 3CUPB 3DV4B 3OBAA 5FA4B 5TQ2H 4LCYA 4MD4B 4FABH 2CDFB 3TF7C 1T1YB 2P7TA 2GJ6A 3BWAA 4EUPB 4GAJH 3LSOA 3RY5A 5INDA 2IAMC 5IV2A 1JPGB 1K3IA 1RIUL 2A9MH 1F6FB 1CG9B 4U1SA 1OSPL 3QG6A 3OB8A 3BKYL 4P23C 2AQ3A 3VRJB 1C5CH 5ACZB 3V6FA 2BCKA 4JFPB 4FG6D 4ZAKD 3MRIA 1MCHA 4GG8B 2A77L 2R15A 3K2UL 3EBAA 5DC9B 1CGVA 1QSFD 4G7YH 3VRLE 5D7IA 5D2NE 1HKLH 3DSFL 5J12C 3ZT6A 2R0ZL 5B39B 1U8OA 1N3NB 4XP5L 1NGQH 3CC5A 3EYFA 5C0BA 2JB5L 2ZWLT 1U58B 3HC0B 2ICWI 1M71B 3UAJC 2J6EH 3P0YH 2X1PA 3ALPA 1FVDA 1KB5A 3D3VA 4Q7DA 4YH6A 3DGGB 5GRJH 1A6VL 3UPCA 4HCRL 2X5PA 3TA3C 3UTSA 2I07A 3GRWA 2XA8L 2R2CA 4H8WC 1B88A 1TLKA 1JGVL 4Y19E 5T3XL 4JCLA 4PLJD 2G2RB 1MCBA 1IGJB 5DWUL 4B7LA 5JTWA 2IPUG 1HEZB 3IT8D 4FXKB 4BSWA 4PGDA 3EOYG 2B1AH 1MRCL 1UJ3C 2HFTA 1H5BB 2LVEA 2AV1B 1IRAY 2UYLB 4NN6C 3RIAF 4CDHA 3HG1A 1XGYL 3TLRA 1KJ2A 3VH8A 1N6QH 2R4SL 2ZUSA 1NCAH 4ODVH 5DD3L 5ID1B 2CH8A 3GMMB 4X6BB 1I8MA 1S7UB 4MJIA 5CIPH 4PTTB 2HG5B 3WS6A 1MNUH 5GRYA 1JI2A 1T03L 2XN9B 3Q3GA 2G75B 3ULUL 2CIKB 4IJ3C 4HPYH 4M61B 4XNYH 1OGTB 5DLMH 4ZUTA 5D5MA 4NQEB 1QZ1A 2VLLA 3X17A 3DX8A 5KAQF 2DQFA 4GRLC 5D70L 2BERA 4UINL 4ODXA 3W2DH 2CLVA 2VDNL 2DB8A 3MV7B 4KI5C 4Q2ZA 5IMKB 2VQ1A 4O9HH 4LASL 4PP2B 1FFRA 4LLDA 3ZE1F 3MRBB 4LPUA 4ZUUB 2H2PD 3MA7B 4DVRH 5F3BB 4U0RC 5CZVH 2RGSA 2FATH 5GGSB 4F3FB 4HX1B 2X9XA 4AYFA 4JVWA 4D3CL 1JVKA 2A83A 1RZ7H 4JFEE 1UCTA 1QHOA 5BCAA 2OJEA 3BEWB 2XTJC 3BZFB 1LP9F 3RJQB 2VNCA 2HWZH 5DFVC 3B9DA 3T0EC 4JM2C 2I9TA 5CEYA 3NFNB 1HSBB 2XQBH 5MP6L 5IJKC 2Y6SC 1MLBB 3SDYL 1IM9B 3S37H 1IZKA 3L5XL 3RP1A 2ZCLL 3JWDC 3U36A 3GMNB 4DUWA 1MIMH 3D2UD 2HJLB 2R1WB 1ZLVK 5BZDB 3TBWA 2V5MA 5E56A 3OHXA 2R9HD 2V6HA 2PXYD 2I5YL 3NA9L 4PJEB 1JUFA 4OJFL 4Z6AT 4CVZB 4XX1E 3OJVC 2X9YA 3V0VA 3HRZB 5ILTL 3N1QC 1UB5B 1CR9L 3MV8A 3BE1H 4M5ZL 4L29B 5F1IA 5HVHB 3DRTB 3SOBL 4WGVB 5L2JA 1SY6A 1BJ1J 4S1RH 1WISA 4RAUA 3GO1L 3OAZK 1N0XL 3IFPA 1C1EH 1QBLL 4ZFGL 3VXME 2B0SL 1LNUB 3QHTC 3QUYA 3VXTA 4ZOAA 4PJ5A 1E4WL 5C7XL 3ALXA 1UA6L 1ZLSH 3MOAH 1G7LA 4JRYB 4OSUH 2YZ8A 2AABL 3B2UC 1IBGL 1JNHB 1WTLA 5IVNA 1ZV5A 4NGHL 2WK2A 3HFML 3LKQB 1UEMA 4RGNE 2YN3A 5ITBH 5C08B 1NAMH 1TQCB 3QO0B 1YPZE 1VADA 4APQD 4ENED 3AM8C 3Q6GH 3KYOA 4UQ2A 5EC2A 2C1OB 3ESVF 4XB7A 1RPQA 1WZLA 3DX9B 1IQWL 1CDBA 4EQ2A 3RVTD 1MIEL 4OI7A 2W9DH 1N6UA 5E9DE 1DLFL 5GGQH 3BRDA 3EOTH 4RFEB 1QUNA 4QOKE 1AGCB 3K8KA 1WT5A 3W9DA 4Z18A 5TE4H 4WU7A 4PGBA 3WFCH 2BMKB 1KB9K 3EYQD 4MNGA 5DD5H 1CTOA 2X4TB 1OQXA 5ELIA 1CL7L 3NGBC 3GB7A 4Y4FB 5DHYB 3QIWD 3IFNH 4HKZA 5ISZA 1K8DB 3C5ZB 5HGBB 4KJWD 1NMAH 1F90L 3MNWA 5BOPA 3GKWL 5D1ZB 1OARH 2MCPL 1P84J 4IRJA 4U6HA 2PYFA 4OTXH 3T2QA 1JHKL 3MTRA 1KF9B 3FHQA 1I8IB 3QXUA 3OV6A 4P46A 4WEBH 3D5OF 2JJTA 1CFNB 1ZSDA 5FYLL 5JHLL 1EFQA 3MO1B 4PLKD 4LDLB 1EHLH 4MNQA 2ERJB 1I1AC 5DK0B 2JJUA 1J8KA 4HWZA 3B9EA 4LLQB 2ADGA 3WFHA 2J3SA 4N90D 5E6IA 3WFDH 4NQSA 2DI9A 2JELL 2XKUA 1WTGT 3I50H 3QXWA 2ZCHH 1CDGA 1T7XA 4FQ2H 4EN3C 2GSIA 4E41E 4QRUA 4HIHB 5AD0A 4UIMA 4OB5L 3ZL4H 2ZCKL 5BV7C 3S4SA 3H42L 5F7DB 3X11A 5DMIL 1NBVH 4JQIH 2BSRB 4NP4L 3F5WB 1JMZA 3VCLB 3BD5A 3BD3A 1B0GB 2J2ZA 4ISVB 4ZDHB 2PO6B 3NZHH 3O4OB 4HXAL 3D1MC 4JRWA 5ICYB 4FTVD 3NCBB 3V8OA 4Y4HD 1CICD 3HPJB 3QIBB 4HUVA 4LLUA 1W72H 1S7WA 2JIXD 2NLJA 3DXAB 4NQDA 3V52H 4J3TA 3GGWB 1K4DA 1T3FA 2KQMA 4I0PA 4LGSB 5HYQA 2C3GA 2XWTA 1EERB 2VOTA 3N1MC 1IGFH 5DD0L 1TXKA 3B2VH 3C60C 4OD3H 3KR3H 3MR9A 3JWOL 4LLWA 5E5RB 1LO3L 4F33B 4PRIB 3MLUL 4JHBA 3MGAA 2NPLX 3T0WA 1DLHB 4M7LL 4WWKB 1D6VL 4M6OL 5DK3A 3IDMB 1KELH 2C26A 2NY1B 4DTGL 3RWFB 4HWBH 5KG9A 5E08L 3GSXA 5HHME 4CVXA 1HHHB 1YDPA 3FQNB 5HGGS 5LXGH 4GMSH 4NQEE 3S4SG 4YDLC 5F21B 2AP2A 3KPQA 1A7QL 3M17B 2AXFB 4XPTL 2CQVA 3RBGA 1RZ8B 1S8DA 3CH1B 4OCNC 4U1MB 4CMHB 1IAIM 4PJ9D 4CVWA 3L5JA 1SM3H 2X4SB 1DBJL 3RKDD 1NUNB 1R5VA 3AS2A 3QDGE 3EYVB 5K9QG 2CMRH 4QO1A 3BPCB 4YHOH 4LP4A 3ARYA 3KPRB 1N0LA 3PHQA 5FO9A 2EYTB 1MQ8A 1AD9B 5L88L 4QXUL 3L3KB 5SV4A 1EAJA 4LPCA 2BP3A 5B3JF 3TZVD 1I4FA 3ROOB 2AJXL 1PY4A 3G9VA 3NCJH 4PUBH 2WUCL 4NUJB 4X8JA 4NC2B 1JWMA 2HJFB 1JHTB 5F88A 3MYZA 2H2SC 4PJDB 2XKSA 4YGVB 2ARWA 4PRPB 5D7JB 3EZJB 5SWSB 5KVEH 4UNTA 1QOKA 1HHJA 3NZ8B 1JN6A 5DI8A 2AJYL 1CFQB 5EPMB 1BAFL 1BVKB 3QDMB 3VXRB 3ZE0F 5FUOH 4H20H 4GW1A 4NWTH 4Y2DC 3DGCR 1RUQL 1Z3GH 4PJ7F 5TE6H 5EOTA 5C6TH 4L3EE 5DQJB 2AXGA 2R8SH 3QQ4B 4UTAH 5IJVB 1DQLL 4JFDB 4JFXB 3TN0A 3O3AA 3J8F7 5FDYA 4ZNCD 2MKWA 2M8XA 5L2KE 5JQ6H 4JFOA 1HIMH 2DDQL 1DSFL 4HZLB 1E6JH 4BZ2H 2QR0B 4TVSa 1R3JA 5CUSL 1A4JB 4ODBD 1K6QL 1QD0A 3UDWC 4WDIB 3LKNB 3BQUA 2BVUA 1IAIL 3IGAA 3KPPB 4RBPK 4UIKL 5JW3L 2GCYA 5C09D 1RIUH 4W6WB 1QSVA 3OKOB 5E8EB 1LQSR 1OSPH 5IBLC 1N8ZB 3ARGD 2X40A 2XPGB 3BKYH 1ZAGA 3MUY1 1GOGA 4X9HA 3BP4B 5EZJA 3OR6A 2R23A 2Y4SA 3G5VB 1VACB 1D9KB 1QFOA 3MJ9L 1U0QA 2A77H 3K2UH 3VWKD 2YUWA 3VFVA 2DS4A 2DLFL 3ARSA 1RJCA 3MJ6A 2UY6A 4UB0L 3NIDE 3DSFH 4K7PX 2DQUL 2R0ZH 4MAYB 5T1LB 4XP5H 2QADC 4FXGB 5B22A 5IHLB 4MD5B 2JB5H 2X4UA 4U6YB 5I2IB 1ADQA 4WUUA 5I6XC 2VLRA 4U6TA 3EKCA 4BH8A 4S2SA 2A6IA 1A6VH 4HCRH 2B8OT 3CSYB 4YIQB 1R5WB 3FQWA 2XA8H 5HHPA 3MRGA 4NKQB 1XGQB 3HE6B 2BNUA 1JGVH 5T3XH 1KIRA 1MJ7L 2WUBL 1FN4B 5C0FB 3P73A 5DWUH 1KFAL 1YY8A 2W07A 5CJ8A 4HC1L 1MRCH 5FGRA 4PV8A 2R2EB 5EUOB 4ZSOB 3D0VB 2YWYA 3TVMB 4OV6F 1XGYH 3RX5A 3EO1A 2XNAB 2R4SH 4IMLB 2JJSA 2ZUQC 3KHOA 3KVQA 4LAQL 4YX2L 1OPGL 4WO4C 5DD3H 4KK8D 3R0NA 3B9KD 3H0TB 1P1ZA 4JCMA 1CL7I 4P5TA 5A16B 5JW5A 5LJYH 1WAAA 2O5YL 2OL3A 3UJIL 1MFEL 3QXTA 4NOBA 1T03H 5I76B 3ULUH 3WDJA 4KROC 3CU1A 1CFSB 1JMXA 5EORL 1MHEB 3ULVF 3L7EA 5DHVA 3EO9L 5D70H 1RJYA 1C8PA 3T3PF 4H26A 1T0MB 4UINH 2CJUL 2VDNH 4LLAA 5DRWA 4P23D 2PW1B 1LE5B 4LASH 1A1OB 2FJFB 3HZKA 5C86A 5I66A 3OMZA 3BDXA 1FBIL 1YUHB 4Z0XB 3AGVA 4D3CH 4JY6B 4MZ2A 5JHDE 4JDVA 4U1IB 5AUMB 4FFVD 4YDVA 4LPXA 4I18C 1LHZA 1BBJA 5CJQL 2FIKA 1I8LC 5I8OL 3VFRA 4P57B 5F7LB 3ZE2F 5DVLA 1CBVL 5AWNL 5MP6H 3UTTA 1QFWM 5CZKA 2ZUYA 2XRAL 2P7TB 1VPOL 2GJ6B 3BWAB 5DQ9A 3RIFF 5EZLA 3SDYH 2BHUA 3L5XH 2ZCLH 3TA3D 1UM4L 2D9CA 1ES0B 1HKFA 4Y16D 4NO3A 2M2DA 2HN7A 3O8XA 4M93C 4MMXC 2I5YH 3NA9H 1CD9B 1F6LL 4V2CB 2BCKB 2EKSA 2Q3AA 3MRIB 4OJFH 4L4VD 2D7MA 3PHOB 4L8DA 4NZDA 5I0DA 2EEDA 3T08A 5D7LA 5ILTH 3S36X 1CR9H 3SBWA 5D7IB 4M5ZH 3FQUB 1ZT4A 4HJ0C 3P4LA 3EIFA 1ZT1A 3SOBH 3TO4C 3MRQA 3CC5B 3EYFB 1S7TA 2HFEA 4CAGA 1TZHA 4R96A 3WNPA 2AI0L 3GO1H 1N0XH 1NCNA 4PJHE 1QBLH 2ENYA 2GY5A 4JY4A 4ZFGH 2L7JA 2B0SH 3O45B 1NCUA 3H7LA 5CP3A 3RVUC 1E4WH 3G5ZB 5C7XH 1I85A 3MJ8A 1UA6H 3K2MC 5MEPA 4S0SD 4BUHA 2AABH 5DSCA 1IBGH 3QNZA 5JIKA 5HVWA 4NGHH 3AXLA 3HFMH 4U1GC 4OKVB 2VLKE 5EU3A 4PJDE 4RDQG 4PGDB 5F1OB 4G6JL 4PRPE 4P3DA 1LE9A 3CZFA 3L7FA 5C0NC 2VAJA 5EU4A 4AENB 3VXRE 3PXJA 4KQ4L 3A6BL 3WFZA 4KUCF 1PYWA 1MIEH 2FEDC 3I75A 1UZ6F 2NMSA 2XY2A 1MI5B 3UTZA 5TDPB 1DLFH 4MJIB 4RZCA 2XTJD 4OZHE 2DN7A 4JFDE 3T0ED 1XCTB 2P24A 4UOJA 5D4QA 3F65A 2SEBA 1QFWL 1QSED 5JMRA 2NTFB 5D5MB 3S5LG 1CL7H 5L9DL 4X5LA 5KS9F 5DC4B 3CVIL 4HLZH 4ZYKA 5C6PB 1G0XA 1F90H 4ODXB 2ZNXA 2EDYA 1F97A 4QRPD 4F7MA 1BIHA 3GKWH 2MCPH 5LKNA 1EFXA 4KV5E 4Q2ZB 2VQ1B 1JHKH 4LLDB 1HHGA 2C3WA 2BY2A 4WI7A 4UT7L 4IRSD 5FYLH 1JRHI 5JHLH 3CFEA 4P4RB 3WL9A 1Y6NR 5DGRA 1TMCB 4HPOL 4GW5B 4GUPA 1AR1C 2X4PB 3NH7L 7CGTA 3LAFA 2E6JA 1QVOA 3GBML 3MRCA 1QO3B 3L3IA 2H32A 1CGTA 4JQVC 4P2QD 2I9TB 5IOPA 2VC2L 4X4XA 2DLIA 2OTUA 3GDBA 1FH5L 4PRHA 2JELH 3O4LE 1RU9L 4P2OC 5F1NA 2NX5A 3PGFL 3F7VB 3DVIA 4OF0A 1WWBX 4P2RA 1YMMD 1T2XA 4OB5H 5HYSG 2ZCKH 5D7KD 4PJBA 3H42H 3BGMB 1LO0L 3QIUA 4X4ME 3B2UD 5DMIH 4JZOA 3TBWB 4LU5L 5KN5A 4NP4H 5E1AB 4KVCL 1DVFC 2R0KL 3ARFA 1OSZA 1JUFB 4LHJB 4Z7VF 4C83A 2XZZA 4L9LC 4HXAH 2H8PA 1ZT7B 3I9GL 4NJAL 4PJFE 4DKAA 2MNUA 2GTWB 1QHPA 5CZXC 3OF6A 5F1IB 4P99A 1RZKC 2CLZA 2XWJB 5D1XB 5L2JB 3OSKA 3FZUC 2HT3D 5EUOE 1EBAA 4M62L 4ZSOE 4YBHA 4GS7C 3EHBD 5GRZA 2ZZUT 5DD0H 2A6KA 4JDZA 4PJAB 3BXNA 5KSAB 5I16A 3JWOH 5AG9A 3I3BA 1LO3H 3D9AL 3QUYB 1QBML 3MLUH 5FCSH 1U8IA 4NSKA 4QHNB 4P2CG 4M7LH 4K7FA 4M6OH 1KN4L 5TDNA 2FO4B 4DTGH 1KLUA 4XGZB 2NXYD 3FO9A 4IM8A 1VESA 4YBQC 5E08H 4KC3B 4BZ1L 2ZUVA 2E9BA 5FUCC 1X5HA 3SE4A 3FB8A 5GS1B 2Q76A 5EO0A 2EE6A 4PJ8C 1KJMB 1INDL 1VADB 5D6DC 1A7QH 5C0AA 5FGBA 5CBEA 3U0TA 4IIQC 4UOW1 4XPTH 4XMLL 4UQ2B 3H3KA 4DFIA 4HUKB 3WN5B 3IJYA 1U3HC 4D2NA 3G5XA 1OGAE 4HD9A 2F5AL 3NIFF 1NGZB 5F3HB 1MH5B 5HY9B 3O41A 2C4FU 1DBJH 4PGBB 4KDVA 1TTGA 4MNGB 3FN3A 1T83C 1CLZL 1BQLL 2F53D 3GB7B 5ISZB 1QR1B 3GSRB 1IAKA 3SKNA 2HVJA 3QXAA 3R06A 5L88H 5D9SA 1BZ7B 4QXUH 1B2WL 3LKSA 4ONGL 3VXPA 5CGMA 4JR9L 4POZC 4BKLA 4U6HB 2PYFB 2GJ6E 2AJXH 4RWHA 2YD8A 5DS8A 3MOBL 3RWEA 1LEIA 3TM6A 4P46B 2WUCH 4E42A 1CLOL 3GSVA 2HLAB 1DUYA 2EE3A 3JUZA 1AC0A 3LH2L 4RGOL 1ZVHA 4L8SC 2IH1A 3KYMB 4UAOB 1K8IB 2HT2D 5E6IB 5DMYA 1P4LB 4NQSB 3MACL 2AJYH 1BAFH 3I6KB 1QLRB 2JK5B 3CVHL 4NN5C 2BNQB 2AERT 3DARA 5C0BE 3L5HA 1RUQH 4QRUB 5HDOA 5AD0B 2NY3D 4WENB 1FGNL 3S4SB 3DX6A 1DQLH 4LSDA 5IT2L 2GKIA 4CNIA 3D3VE 1TVDA 1LDSA 3IAQA 3VWJD 3FO1A 2DDQH 1GGIL 1ZKAA 1DSFH 3UTSE 1HNFA 4JY5L 5FM4A 3VGGA 4JGMA 1BFSA 5CUSH 3QEQA 2D03L 3T2PA 2D4FA 1KIPA 2DLHA 3PV6A 2IH3A 3Q5TA 4L4TA 1K6QH 4AH2A 1C7SA 3FRUA 4HUVB 4NQDB 1S7WB 2NLJB 4G6ML 1IAIH 4MJ2A 4UIKH 1LO4L 4FA8A 5JW3H 1K4DB 1T3FB 4I0PB 1YNTB 5E4EC 5KSBF 2E8ZA 5HYQB 5ERWB 3WD5L 4HS6A 5JIIA 4XNZC 5FECB 4WFFD 3HG1E 3SJVA 3D39D 3KHQA 1A5FL 2R1XA 2VUOA 4NZJA 3RGVD 1FYTA 4S1SL 3V9FA 3UTQB 4AT6A 1PG7W 2V5YA 5CD3A 3MJ9H 4K7PY 3RUGF 1NUFA 4H0IA 1EEYA 1F4YL 2DLFH 5KG9B 1T7ZA 4UB0H 2FIRT 1YDPB 2DQUH 3SDCD 1R0AL 1J7VR 4ZOEA 5SWZA 3CZJA 3LKOB 4Y0GA 3V6BR 5J06A 2YRLA 1I9EA 3HLAA 4F7CA 1LVEA 5A43C 1S8DB 4M8QA 3C8HA 1P4BL 5JDSA 4Y5VB 3MFFB 3BP6B 4RGND 5E0QA 4QHLA 5IG7A 4PRDA 1D5BA 4R2GD 4ZAKA 1R5VB 1MJ7H 2WUBH 3R4DA 2DIBA 1KFAH 3HB3C 1QSFA 3HAEB 5IB5B 5DEFB 4HIXL 4HC1H 4Y2DD 3PP4L 3PHQB 5FO9B 3MRLB 4ZD3L 5LAXB 2ESVE 5T5NG 1J10A 4KZEL 2AEIT 4YX2H 4LAQH 1OPGH 1QFWI 2VLJB 1T89C 4BQBA 3WO4C 3ULUC 1RJLA 4GMTL 4FFYL 4PJIF 1F4XL 4LF3A 3QO1A 2CXKA 2O5YH 1E28A 3UJIH 1MFEH 1VB9A 1JWMB 4U3HA 3ZT7A 3S98A 5EORH 4JDTL 3SKUD 5KZCD 3EO9H 2QSVA 4F15B 4ZTPL 4XP1L 2N56A 2A2QT 1JN6B 1AI1L 1KUMA 1ZHKA 3KYNB 1K3ZA 3MV8E 2CJUH 3LDBB 5IBLD 2IQ9L 4GW1B 4MDIA 1LO2L 5DJ6B 4J2XA 2P8PA 2AXGB 1A47A 4TPRL 1IC5L 3C2SA 3I6LD 3NFPA 1U42A 1FBIH 3O3AB 5C0CE 2AK4D 1U92A 1OAKL 8FABA 3VXQA 4PJ5E 4JFOB 3O9WB 5DVOA 5LBSL 4BFGA 4YR6B 4G6KL 4DOHE 2R2HB 1Q38A 1ROWA 5CJQH 4XCFL 5I8OH 1R3JB 3KWWB 1QKZL 1CBVH 1ZA6A 1IEAA 5AWNH 3MREA 2XRAH 5J0BA 2H3NA 2ICWJ 1VPOH 4N8CL 2GCYB 4YDJA 1UM4H 1S7XA 1SJXA 2WWMC 4CU8A 4YEEA 4G9FB 2HTLD 4WFHD 5EZJB 5FYJU 3MROA 3OR6B 4JANA 4M43L 1G84A 4TYUA 2DF3A 4UT6L 2V2XA 5EU5B 1YC8A 5I1JL 2IALA 1KEGL 3KAAA 2IWGA 3IDIA 2FECL 2X4NA 3RQ3A 3BH9A 1IEBA 5BVPL 2AI0H 4WUUB 2AEWA 1UXSB 2RB8A 4BH8B 3KPOA 4YZFE 1MCSA 2GJZB 3D2UA 2A6IB 1MAKA 2VABB 1BVZA 4ZTOL 4WI8A 5EH1A 3FQWB 1S78C 5HHPB 1AGDB 3MRGB 1FLRL 4EOWL 4MNQE 4O2EA 1CXEA 2PTVA 2J12B 3EGSB 3PIQB 3P73B 7FABL 5HXMA 2BFVL 2DM3A 1HCFX 4QKXB 3MMEA 1AHWC 6CGTA 4K3GA 12E8L 4G6JH 5FK9B 4M02A 3ZDXF 1XGRA 1MJ8L 2ITDA 2HVKA 1G7HA 35C8L 4PV8B 3TJHD 3QI9C 4U6VL 2OBGA 5CILL 4OZIA 2OR9L 5B4MC 2HYMA 4KQ4H 5JPMA 3A6BH 2YPLD 4OUUA 1LEKA 4Q6YA 2FD6L 1P1ZB 5ESQB 5JW5B 2ZSWA 4DW2L 2OL3B 4JPKL 3QDHA 3SGDI 3CFCL 1QFWH 4V1DB 5EFIA 4C57C 1U3ZA 3QNXB 3VG9C 2PKDA 3L7EB 5DHVB 5DO2C 5L9DH 4M1DL 1A6TA 1UWEL 4HDIB 3VXOB 3RWJA 3ARBD 3CVIH 1JWUA 4H26B 3I6GA 3BKML 4OGYL 3RY6C 2C4FT 5DRWB 5TQ0L 4APQA 2AVGA 3ECBB 3AREC 4NQDE 4L3CB 4H1LH 2NY6D 2YWZA 3VMOA 4X6DB 3LKPB 1MWAB 4UT7H 4Z78A 1KYOK 5TH2B 3VXSB 4TULL 3HZKB 5I66B 2XQYG 2G5RA 1WICA 2GUOB 2PCPA 5CJXA 5LQBL 4HPOH 1FFQA 1X5ZA 3NH7H 2DD8L 43CAA 1I1YB 5AYUL 1DBBL 1NGYA 3GZKA 3TO4D 5HHOD 3GBMH 2BOBA 2FIKB 4ZFZB 2Q7YB 3VFRB 1F3DH 3WV0A 2VC2H 4PJXF 3QIWA 1FH5H 3V5DA 3LIZL 1RU9H 4JREB 5DD6B 4HUXB 3PGFH 1F3JA 2D9QB 4PJCF 5DQ9B 1I7TB 2EDXA 4LDEB 1AGBA 5GISL 5L2KD 3PWVB 5FF6A 3DROA 2V9TA 1I8KA 1KB5L 1LO0H 1TTFA 3R8QA 3VFMA 1INEL 4NO3B 1EEZA 4LU5H 2FEEL 5F7KC 4KVCH 1XF2A 2R0KH 1YY9C 4M7LT 4MLSA 4GAFB 2VWEE 3F7RA 3D0LB 3P4NA 5C2BL 3I9GH 4NJAH 1A6PA 4HG4J 1NC2D 3HE7D 4JM2B 2MTPA 4PTUB 2YN5A 4K2UL 3MRKB 2FEDD 4WW2A 1S7TB 2HFEB 2Y5TB 5JW4N 3JWOC 3PWPD 1TZHB 1QRND 5IW1A 3S5LB 4M62H 1K9TA 4OKDA 1KJ2L 4QRRE 5EN2A 1AIFB 4JY4B 5MHSD 4TVPL 3T8XA 3U6RA 5K9OB 2ADIB 3D9AH 1QBMH 5D2NC 2D7NA 3QFJD 1U6AL 1BZ9A 3VW3L 4G7VL 4R7DB 1HCVA 3PL6C 4N0UA 5DSCB 1KN4H 1CI5A 4LHUG 5D96C 3ZZ1A 2GAZB 3AXLB 3WLBA 4BZ1H 4FTVA 2G9HA 4Y5YA 1AC6A 2W91A 4Y4HA 5I8EB 4F2MB 1H0DB 1CICA 1XCQA 1XT5A 4P3DB 5A3IC 2JIXA 3CZFB 4NQCB 5I19L 1INDH 1EHNA 3VFPB 3G6JA 4XHJD 5EU4B 3EYOA 3AS0A 4XMLH 4U7MA 5FUZL 5ANMA 1EVTC 2HLFC 2ZJSL 3U9UA 1AR1D 3UTZB 2F5AH 1UJTA 1PKQB 5DJZB 5SWQB 4HK3J 5HYSB 1FZJA 4HWBA 3RX7A 4XPBL 2A0LC 2XOTA 4HGMA 3DIFA 4P2OD 5A2FA 1CLZH 4NBZB 1BQLH 3VFUA 3IDNB 1A21A 1JTOA 3SGDH 3K74B 1KLGA 1B2WH 4ONGH 2X10A 5MI0C 4LCWD 4JR9H 5ETUA 3ZTNL 1AFVL 4MNHB 5IB4A 1EFXB 4MX7A 2PN5A 2ZUWA 1DVFD 4FS0A 4UV7L 3SKMA 3MOBH 1T6WA 1HHGB 4YXHL 1CLOH 1FVEA 4LKXB 4PREB 4Z9KB 4PJ9A 5FFLA 2CRZA 2X05A 1ZK9A 4ZXBB 4ZFOA 3KNBB 3LH2H 2W9EL 4RGOH 4UTBL 1JP5A 2FL5B 5FOBB 2H1PL 3FJTA 1JZ4A 1I9JL 2FSEB 4KHXL 1QVOB 3VA2C 3MRRA 3BYTA 3MRCB 4K23L 2H32B 2I9LA 4X4XB 3MACH 3QT2A 1N5AA 1SY6L 3CVHH 5F1NB 4XI5C 1MRFL 2NX5B 3P0VL 3QUXD 5E5MB 4LCUA 4NN7C 3TZVA 2W1NA 3QEGL 1FGNH 4WUUE 4PJBB 3OXRB 2VLRE 2A38A 5IT2H 1OAYL 4JZOB 5KN5B 1CQYA 5AG8A 2FWOA 2K3TA 4GAYB 4YBQD 3ARFB 1GGIH 3CDYA 2BSTB 4C83B 4JY5H 2YBRA 4YUEL 4L3AA 4KH2A 2D03H 3L95B 1F42A 3ALWA 5D1QB 1T0NB 2CLZB 4ZUVA 5K33A 4G6MH 4F9LA 4F80A 1LO4H 4HH9A 4OGAD 5MEQB 2APVA 1U3HD 2CDEA 1D5MA 2EEBA 4LCCA 3WD5H 4E5XA 2FBOJ 5HDQL 4GW4A 1TVHA 4JDZB 3V6OA 3BXNB 4TNVK 3NCCB 3QCTL 1A5FH 2QHLA 1G6RB 1YECL 5MENE 4I4WA 3D6GA 4S1SH 1SBBA 5DJ8B 2QV2A 1U8IB 2LVCA 4N8PA 3BGFB 4NSKB 2RQ8A 1A6WL 4ZO9A 3RL1B 1A7OL 4FQPA 2FYYA 1WAAE 2DQJL 1S5IL 5HJ3B 2AAVA 3IETA 5TDNB 1VEOA 1F4YH 4QXWA 3MRPB 4POZD 4PJEF 2ICES 1M7DB 1DUZA 1R0AH 4RQQA 2Q76B 1HHKA 3FB7B 5EO0B 4D0BB 1L0XA 2CDGA 3IDYC 1MUJB 3FQTB 1VFOA 3QEUA 4LLMA 1WFUA 5C09A 3SDAD 3RA7L 5CBEB 5J57B 2HA1A 2JB6B 1HILA 3MCLL 4B50A 2E7LC 5BQ7A 3ARGA 1A6AA 1P4BH 3IJYB 2R29L 3RZWA 1C5BL 2IG2L 3SO3B 3CFBB 2VLKD 1NUGA 1GIGL 1EUTA 1KPVA 1F58L 3ES6B 3RTQD 4ZG1A 4HIXH 1TJHL 2NY0C 1IAKB 1GZQB 2HVJB 1N59A 3PP4H 1BFTA 3R06B 4NNXA 3VXPB 4YDLB 3BPNB 3KJ4C 3H7BB 4Y1AD 4ZD3H 1FORL 3UTTE 5A40E 1U8MB 4U1LB 4BKLB 1H3GA 4KZEH 5IP4A 2XIDA 4JFHD 5DS8B 4HCRA 3VFOA 4BUGA 4GMTH 3B83A 3GSVB 4FFYH 4KUCD 3QQ3A 1DUYB 3QAZC 3V7AG 2XFXA 2EXWC 3MRMB 5I1EL 4NFBA 1K2DB 4WI9A 4YPGA 5DEZA 2IH1B 5IEKA 1LK2A 1NC4D 4JDTH 4KUZL 4ZTPH 4XP1H 5D7LE 4D9QE 5KSVB 1AI1H 1FZMB 1KGCE 4HH8A 3TYGL 2DYPD 1DDHB 2C3VB 2IQ9H 4U05A 1NFDE 3U48A 3UEZA 4F57L 1HSAB 1LO2H 1KT2A 4P2YA 4LQ1A 4TPRH 3DX6B 1IC5H 3P9MA 3VXUE 4X6CB 3MNVA 5C92A 3B9KA 1YYML 1TNNA 32C2A 1OAKH 4UQ3A 1A3QA 4PFEA 5CWSB 3FO1B 5FB8A 5LBSH 1C16A 2EO9A 1YJDL 4G6KH 4Z7WA 3GI8L 3IDUA 4XCFH 3MX0A 4OLXL 3RFZC 1QKZH 3QEQB 1AD0B 3ULSB 2IH3B 2VZVA 1OM3L 3MXWL 5JOFB 1FL6A 4N8CH 3CFIC 1P84K 3RWIA 4P23A 4HS6B 1QSZA 5I75B 4W6XB 2J8UB 3SHSA 4WV1A 4DCQB 1BQUA 1IQDA 3GJFA 1Y0LB 3FT4A 4WHDA 2UWEB 3FN0L 3U7YL 4GBXA 4AT6B 4JKLA 4UBDD 1BGXL 4M43H 4I2XA 1XZ0A 1J88A 3MRNB 1H5BC 4XPAL 1ZXQA 4UT6H 5DYOB 3OKYA 5I1JH 1KEGH 2X44D 5IW6A 5EUKA 5JORA 2X4OA 2Q8AL 5SWZB 2IADA 5BVPH 2P5WD 3BDYL 4C4KT 3HLAB 5HI5C 5HYJD 1V7ML 3TA3A 1U41A 5EIVA 1YYLL 1XGPA 4U33A 4Y16A 1RJZA 2X70A 2IJ0C 2Q7NA 3PDGA 4ZTOH 1TVBA 1L9MA 3EO0A 4LGPB 5MERA 5IG7B 4PRDB 1FLRH 3LEVL 3VU2A 4EOWH 1D5BB 1RIVL 2VRAA 4L4VA 2C7UB 1F3RB 2DWEB 1UJ3A 7FABH 3ARZA 1DN0A 2BFVH 3FKUS 1L0YA 1BQSA 3IVKB 12E8H 4R4NC 5E8PB 3MUJA 3ZHKA 1HINL 1MJ8H 2FJGA 35C8H 5L7XL 1GGYA 4PB0L 4U6VH 5CILH 3PWNA 2OR9H 2QADB 4PRHE 3DURA 3QSKB 3GMQB 3RVWC 3S34L 4D0CB 5CHNB 5ALCL 4EEEA 4KY1L 2NX5E 2VZTA 3BN9C 4P2RE 3GMOA 1YQVL 2FD6H 2ORBL 3NPSB 4PJBE 1T6VN 2V7NA 4F7TA 4NKDB 4LF3B 4DW2H 3QO1B 4ZPTA 4H5SB 4JPKH 3CXDL 1E28B 3DBXA 3CFCH 4EQ3A 4XBGB 3OTTA 4RMWA 3TFKC 3QJFA 1FIEA 4DGYL 4JQXC 2EICA 4M1DH 3M1BB 1HQRB 4N1HB 1UWEH 2W65B 4HIEA 3A0OA 2VLMD 3BKMH 4OGYH 1U8NB 3HR5A 1MHCA 3PQYD 2WWMD 2WW8A 5TQ0H 3LY6A 5J1SC 3OAZH 3G6AA 2VXUL 3IXTA 2P8PB 1I7UB 5CIPB 3H3PH 2ZUQB 4G8IA 5GGTA 2K1MA 4TULH 3TCXA 5IR1A 1I3UA 1EK3A 3L3HA 5LQBH 3PWUA 1U92B 4FQJL 4KDWA 4MXWL 3ABZA 4L1HA 2EDJA 3BD4A 4M3KB 1NGPL 2DD8H 1AKJD 3QB7C 3SGEI 1KC5L 5AYUH 5HVHC 1DBBH 1RZGA 1LK3L 3AMKA 3VD3A 1QSEA 3CFJA 5JO5A 4G80B 4POUB 3O3EB 4QCIB 4KROB 1S7RB 5HPMA 2QQKL 4EI5D 5IJKA 3OB0H 1P6FA 3B5HA 3RPIA 1ZA6B 2PTUA 3PG2A 4O02L 1IEAB 3LIZH 4Z5RA 3BP7A 3MREB 4PJDF 2H3NB 1U2CA 1ADQL 1OTSC 4QRPA 4RMVA 4CDGC 5GISH 2MHAA 5BW7A 2OTWB 5GS0C 4ALAL 2PW2B 2GTZA 4RMQA 1KB5H 1S7XB 5C0AE 3ET9F 4XZUB 1U91B 1INEH 4MXVE 2Z92A 4HBCL 4IRSA 3RVXD 4LSRL 4LIQE 2APFA 3MROB 4JANB 2M26A 1P4IL 1JK8B 1TQCC 4ETYA 5CEZD 2A73A 3OL2A 5C2BH 4X6FA 1ONQA 3QUZD 1V3LA 3LQAL 5B4MD 4P2QA 5I17B 4NO0B 4K2UH 3IDIB 2EXYC 3GMRA 1G7PA 2QSQA 4TVPD 1KJ2H 2ZNWA 2CKBL 1YMMA 5IMLA 3SDXA 4TVPH 4KV5F 2NY2B 2VR9A 1U6AH 3QUMA 3VFTA 4HLZG 1WIOA 1X6LA 4X98A 2VXTL 4QHMA 4Q97A 2NNAA 5DRXA 4KU1A 2OL3L 3VW3H 5DO2D 4Y4FC 4G7VH 4MMZC 2NXZD 4Z8FL 3C5ZC 4G8EB 2FNBA 3QRFM 4D0DA 1IILE 1H15A 4NO5A 1R24A 5D1ZC 5SV3A 2EYRA 3RWDA 3HZYA 4MDJB 4WFEE 5I19H 2P5EB 4P9ML 5L8JB 4QRQA 1GPOL 1YEDB 3AMLA 1W0WB 5I1HL 1TQBB 2CIIA 2ERJC 2A6JA 4OUUB 5FUZH 5IROA 2ZJSH 4F9PC 5EU6D 2ICWB 3O3DA 2VISA 1U8KB 1P5UA 4XPBH 3G9AB 3STLA 5EFIB 4X7SL 4RFNC 2MFNA 1NAMB 3CDFA 5I8CA 2WZPD 5GGVL 3RWJB 2IQAA 3QEQE 1FAKT 1IARB 3UZQA 1UC6A 1JWUB 2YUZA 4L4TE 1BJMA 3ZTNH 3GKZA 1AFVH 4BK4A 5K93A 2K7QA 1F4WL 2Z0BA 3K0WA 4UV7H 1RULL 3BO8A 4QXTB 4Y19A 5EUOF 4YXHH 5EO1A 4Z78B 2FHCA 1BECA 2PO6C 3JWNC 2ATKA 3QZWA 3O4OC 3WFEL 3IXAA 4L9DA 3LN4B 3SJVE 3BISA 2DLTA 3TBYA 3SDDD 1FYTE 2W9EH 4UTBH 3MRHA 2H1PH 3HHRB 4XBEL 3QIBC 4FN0A 4CMMB 1I9JH 1NGYB 1UWXK 4KHXH 4KRNA 1FG2A 2WBJD 5K9QI 1NPUA 4YHZL 4XAKE 4K23H 2F53A 3SGEH 3HCVB 5T3ZE 2LAGB 5BXFA 1SY6H 4Q58C 1G7JA 1MRFH 3P0VH 5CEXA 3JVGA 4LHUB 3MODL 1KCVL 1DQQA 1AGBB 2KBGA 4FZEL 5JNYA 3QEGH 3DROB 1I8KB 5GHWL 3VFMB 1OAYH 3S88L 5J3HC 4LEOB 1NEZG 1EEZB 5FAAA 5GZNC 1XF2B 3JUYA 1ZVYA 2CD0A 2AQ2A 4DWHA 4M5YL 3GSOA 4NRXA 2EDWA 1DL7L 3T4AA 4G6AC 2MMXA 4RSVA 4YUEH 2HMID 1H8OA 2KL6A 5A3ID 3P4NB 1SJEA 3IF1A 1TIUA 2LABA 5GXBB 5DMGD 1QSFE 1D5ZB 2HLFD 5HHVL 4CMHC 4MA7L 4RA3A 5HDQH 2LAAA 3DVGB 4KK9C 3LQZB 3QCTH 2XZCL 2RFXA 1YECH 3U6RB 1D3CA 1RURL 4NQXA 4OCLC 5T33L 4AQ1B 4JM4L 3ROLA 1NGXA 2P46B 3VWJA 1A6WH 1A7OH 1DEEA 3QUKB 2DQJH 4N0UB 1S5IH 2VXQL 2X1WL 2BRRL 3D25A 2YPKB 5FHAL 3D85D 4LRIA 1W72B 5H37H 5J1AA 3GSQA 3QA3A 1LP9A 4MS8C 1XCQB 4YE4L 4JO3L 2CKNA 3B4NA 4NZUL 4QTIL 2JIXB 2IANB 5D72L 4DUVA 3L3DB 2W0LA 3EZ8A 5D7IF 3RA7H 1YNKL 1B90A 4KDTC 3ZLQC 1QG3A 3MCLH 1J1PL 1E4KC 3D39A 2R29H 5SX4I 1C5BH 2IG2H 3T65A 3ZKSD 3RGVA 3MJ9A 1CD8A 2EDFA 1GAFL 4RNRA 5D7JC 1GVIA 1G7QA 4LSTL 4Y88A 1FZJB 5AAMA 1GIGH 1Q94A 3OGOE 2BSED 2WV3A 3SY0B 1F58H 4MJ6A 4J3OC 1RZJL 3DIFB 3C9NB 5DJ0A 4XI5D 1FHGA 2O5ZL 2EZ0C 2VL5B 5IMMA 2ITCA 4XPHL 1TJHH 4HLJA 4MJ5A 3SDCA 1Q9KA 3P4OA 3CSGA 2GSGA 3VXMA 4G43B 2NY5C 1N2RA 4HKJA 3QDJD 1X5XA 3NACL 4Z0BL 1FORH 4PY7A 5IB4B 3BPOB 3BPLB 4J8RA 1GZPA 1U95A 1WWWX 4HGWB 3BZEA 3QJHB 1JPSL 4I3SL 1FVEB 5F1KC 4Q9RL 3REWB 3UP1A 2HFFA 3WLWC 5I1EH 1P2CA 4G6FD 1UCBL 1JYWA 1C5DB 2ICEB 4HC1A 4KUZH 4OIBA 3S35X 5KSUB 4FQXD 2V9QA 2I9LB 4LSSL 1FNHA 4CADA 4XVTL 4Y2DA 1OLLA 1N5AB 2PYED 3KLSA 1YEIL 3TYGH 4JKKA 5D5MF 3BN3B 3U4EA 5E7BA 5E9DA 1HDMA 1VFUA 4A6YA 4LCUB 1FL5B 1UQSA 4F57H 5HSFA 3FO0L 3OKMA 1AP2B 1IKNC 2Y06L 5FM5O 1D9KC 4HJJL 3TYFA 4AEEA 3RZCC 2N4IA 1YYMH 2FWOB 1CXLA 3AVEA 5AAWA 3LN9A 1AO7E 2JF1A 3QWQB 1P7HL 4MAYC 1CDUA 1P7QD 1YJDH 2QLVB 3IJSB 3GI8H 3LMJL 2P45B 4NKOB 4OLXH 2FDBP 4N5ED 4C56D 3UTOA 1OM3H 2DLGA 4KTEL 3MXWH 4ZUWB 2QQQA 3HI1A 1CE6A 1B0WA 1BD2D 1U8JA 4HH9B 5AYQA 3MCKB 2CDEB 3GIVA 1D5MB 4LBEA 5IQ9A 3DTXA 2DRUA 3MV9B 1GYAA 3HNSL 4K8RL 4OZIE 1BLNA 1TVHB 4LIQL 1QQDB 3FAXA 2IMNA 4XCNA 4OFYD 3ZTJG 2OQJB 4I4WB 1KG0A 2AK4A 3FN0H 3U7YH 1JZ8A 4JKPL 1JZ5A 1BGXH 3VFNB 2EIDA 3DSNA 1MRDL 2X9WA 2FYYB 5FYJD 4MA3A 1FFNA 3IETB 3RWGB 4XPAH 1T04B 2P42B 5E6YA 3RDTC 4QRRD 3G08A 4U1HA 1JYXA 4O2CA 2F8OA 3WHXA 1DUZB 1V7NL 2Q8AH 2C3XA 4RQQB 3IS1X 3WIHA 1XGTB 5GS2D 1HHKB 4BFIA 5CBAA 3BDYH 3SCMB 1NANI 3QEUB 5C09B 1A2YA 1V7MH 5DURD 2EXWD 1YYLH 2WIMA 1HILB 5BQ7B 2BHYA 4XNZB 3BOVA 1CE1L 1J05A 3OG4B 4AZ8A 3SKJL 1T21A 3LHPL 5EA0H 2EEAA 1OW0C 4PJAF 3LEVH 2ZPKL 3D18A 1RIVH 5CGYC 2ZSVB 5C0IA 4TTGA 1KPVB 5SX4H 1P9MC 4N9OB 5FEBA 3UMTA 3WYRA 3O3BB 1WZMA 1U3JA 1L0QA 4MLIA 2WINA 1NCWL 1HINH 4XBPA 4N9GA 5L7XH 4PB0H 3TESA 4ZNEA 3WE6A 4ONHA 2Z8RA 3S34H 5ALCH 4KY1H 4KXZI 1Q72L 3OAYK 1X4XA 3U4AA 3IKCA 1JCKA 1F3DJ 1YQVH 5JXED 1Q9OA 2ORBH 4I0CC 3MZGB 2XV6B 3QQ3B 5I1DA 2XFXB 3CXDH 1CDYA 3DVNA 4Z7NE 1SVZA 2FJHA 3O2DA 4YPGB 5IEKB 1S7VB 4DGYH 1RMFL 3TH3T 1OTUC 4Q74A 1PLGL 4YHIA 5K9KA 3HPLA 2UZIL 3FQRA 2V5TA 4P0DA 1RK1A 1Q0XL 4XCEA 1MFCL 1C7TA 4N90E 3DUUA 3FAWA 5IVXE 1NJ9A 3BW9A 4BQCA 5EZIL 2NYYC 3IU4L 2VXUH 2RCSL 2YPLA 5CD5C 5LGJB 2H9GB 1KT2B 4LLVA 4HJGA 2DKSA 2OX5A 5E6ZA 3GK8L 3MNVB 4LGRB 4YZFF 3B9KB 4I18A 5H94A 5KOMC 1WJ3A 4XC3L 4FQJH 4MXWH 4UQ3B 4U6XA 3H9YA 1NGPH 3MLZL 4GAGL 5DJCA 4YJZL 1KC5H 2F54B 5I30L 1C16B 1LK3H 1HOCB 4WI6A 2QQKH 5CAYB 5T3ZL 4P5MA 4N0UE 4KHTL 3RRQA 1H8SA 3T4YA 4O02H 5HI5D 2BRQA 3ARBA 3VD4A 4FTVE 1WBYB 2RIKA 3O6FB 5F71A 4GLRI 1ADQH 2VL4A 2XN9D 1WUNT 1FVCA 2OYPA 1HWHB 4ALAH 3G6JE 3WKNA 3LRHA 4U7SA 4HBCH 4WV1B 5ADOL 1KTKE 3DRQA 4LSRH 5ANME 4Q9BA 1JIBA 2W0FB 1XF5B 4GBXB 2Q6WA 4BYHA 4HWEL 1P4IH 1T5WA 1XZ0B 4R4ND 3GUTB 4Z7QE 4PYHA 4I77L 2FH6A 5ID0B 3QHZL 3TO4A 5HHOA 2X1QA 3LQAH 2GJJA 1KJVA 5IW6B 2VERN 5JORB 3B6SA 4JHAL 1MF2L 2QKIA 1SHMA 2CKBH 5L2KA 3WS6C 1ZLWK 3TV3L 4Y16B 1RJZB 4EKXA 5DQDL 5BJTA 2VXTH 1QFHA 1NANH 1EAPA 1Z6JT 1UG9A 2OL3H 4JFFB 1V3JA 5DT1L 1IM9D 4Z8FH 4PRNA 4H1LG 3HUJB 4JVPA 1A0QL 3AAZA 3OJDA 4YHLL 2VSCA 3V5KA 1NC2A 3HE7A 3P9LA 2FJGB 4GXUN 3VE0A 5HPOA 3GSNA 5D6CB 3PWNB 4P9MH 4KRPD 3PWPA 4IMKC 1GPOH 5DMKA 1QRNA 5HHNB 5I1HH 1U93B 4GRMA 4MVBC 1AXSA 1SVCP 3GMOB 3VRIB 4NT6A 4QT5A 3ARDD 4FOMA 2DQHL 3QFJA 2V7NB 5IM7A 4HFWA 4EDXA 4HPYL 4KXZH 1CFVL 2CK0L 4TTDD 3FT3B 3K7UA 2BNRB 4NQVA 3D69A 5JMOC 2AXJA 5FDWB 2GT9B 4WIQA 2JCCB 5GGVH 4HIEB 4EJ1C 5GS0D 4F8TA 1AHWB 4I8DA 2UV3A 2GY7B 3HR5B 1MHCB 4JRYD 3L3GB 1F13A 1INQA 3QXDA 1ORSA 1KENL 1P7KB 5DJ2A 2B1HL 5T1MB 3GHBL 1F4WH 2DJ4A 2FX9L 3G6AB 1RULH 3IXTB 5C08D 4FFWC 2YMXL 1NCBL 3WFEH 5IR1B 2PNDA 3V6OE 5EIIA 4X6EB 5HDBE 2JLLA 4YPJA 4XBEH 1R3LA 1KGCD 2VITA 4EDWL 5D1XC 5JO5B 3PDOA 4L8BB 4YHZH 5HPMB 3EDDA 1QRKA 5GSRB 1QLEL 3STZB 3VG9B 4Z7OE 4OF6A 5CSBA 3BP7B 2F8VA 4IBLT 4ELKB 2FHBA 5KSAC 3VXUD 3RNQA 1Q9LA 4M6NL 1XF1A 3MODH 4LCWA 1KCVH 1T66D 4QRPB 3QUYC 4X5XA 2IF7A 2Y7QB 2EDDA 5DFTA 4FZEH 3RVVC 5F9WB 2OCFD 1DVFA 2GTZB 2R0LL 3MUGB 4JG1L 5GHWH 4Y4FD 3CCHB 3S88H 1OP5H 3MJ7A 4IRSB 5CP3H 1FZOA 1GOFA 4L9LA 1T20A 4NHCL 2BVTA 4QYOB 3OKNA 4FQQA 5D1ZD 4R97B 4M5YH 1DL7H 1JZ7A 2FX8L 3E3QE 4TRPL 4KK6D 4P5KA 3F62A 3S96A 5I8KL 2Z93B 3CVHA 4P2QB 3BHBA 5CP7A 1NDGA 3BEVA 5HHVH 3GMRB 3KXFB 4MA7H 3QUXA 2QEJA 3EAKA 4Y4KA 1VERA 3BVNA 4KWUA 2GK2A 3TPUA 2XZCH 3IS0X 4KI1A 1RURH 1C08A 4P4KD 5DR5L 2YEZA 1NBQA 4HIJB 5T33H 4JM4H 3LB6C 2Q3ZA 2XQYK 3QWOB 4YFLI 2NNAB 5DRXB 3MSPA 3QR2A 5DZNA 3P40A 4WEUD 1NBZA 2VXQH 4AIOA 2YD6A 4KKLC 2BRRH 3JTSA 3IFLL 3MGOA 1TITA 2JKXA 1R24B 4GQ9L 4NO5B 3I85A 2EYRB 5EBWB 5IHZA 4G42B 3HZYB 4IIQA 4KJPD 4YE4H 4JO3H 5DJDB 4NZUH 4QTIH 4IOIB 5D72H 2DQIL 4P46C 1U3HA 3CFKA 5T1KB 5C9JB 1YNKH 4OZFH 1S7QB 4RFOL 3CLEL 3K81A 5GGSY 1HYSD 1J1PH 3RY4A 5J7CC 4P3CL 2NY4C 3QIBD 3DXAD 1DBML 1GAFH 4JAMA 4UAOC 2ADFL 3L3JA 5E6IC 3RWHB 4LSTH 3WUWG 3E8UL 4FRWA 3W0WE 1DQJA 3EJZC 1RZJH 4CL7A 1NEZB 2NXYB 2H32H 2O5ZH 5I8CB 4XPHH 1J0KA 4Z7WE 4PRID 1RUPL 4NRYA 2ADJB 5T5FL 3VXNA 3RL2A 3NN8A 3NACH 5DJYA 4Z0BH 2HRLA 2YD3A 4WWKD 3SE9L 5J3HD 3RGHA 5DRZA 1BX2A 2NW2A 2NY1D 1BOYA 3SDAA 4HS3B 2GW5A 1JPSH 3B9AA 4I3SH 3BO8B 3FT2B 4Y19B 3EOAA 3V7MA 5EO1B 4WHTA 2ATKB 4Q9RH 3IXAB 2VLKA 3KDMA 3QULA 4NQTA 2V2TB 4QNPF 4JE4B 4WW1A 4Y7MA 3FCTA 1UCBH 2WANA 2CPCA 1FG2B 4I2XE 3RTQA 4ZFFA 4I0PC 4HV8B 4LSSH 2F53B 1WQVT 4DKFL 4XVTH 4OUOA 4KK9D 5BXFB 4KJQC 1YEIH 3X14B 3H9HA 4HK0A 4Y1AA 1DQQB 3V4VL 2D4DA 3FO0H 2Y06H 5BVJA 1VFBB 4YGAB 2ZUXA 4HJJH 1CGSL 1OAZL 1J0YA 2IBZX 4FQHB 1VFAB 3J7HA 4F7PB 3FOMA 2P49B 2NR6C 3B8YA 3U0PB 2Q86B 1BBDH 4X6DF 2D7PA 4ONFL 1ZHBB 4S1DD 1U2HA 4NRXB 4WTXA 4JLRA 3LMJH 3RNKB 3T4AB 2CO7B 4MSWB 1NC4A 4KAQL 5FM5M 3P0GB 3X13A 1O7SA 1WBXA 4L4VE 4GRWE 3IF1B 4MWFB 3C6SA 4KTEH 1FO0A 5TDOB 4DZ8A 5JPNB 1LGVA 2DYPA 3ETBF 4MA1B 3HNSH 3ILPA 1I3GL 2NY3B 4LIQH 1NL0L 5D7JD 2VWEC 2F5BL 5SWSD 1YEHL 1O7VA 5EDXA 4NQXB 4RDQF 3QDMD 4JKPH 1HNGA 1NGXB 1MRDH 1DEEB 4NNYB 5F9DC 2KH2B 1FFPB 1TZGL 3EYUL 5JLZA 3EFFA 4FNLL 4DVBA 3AUVA 1PFCA 4KPHL 2HAZA 1V7NH 3OXSA 2OLDA 1M6OA 2QBWA 4QRTA 4X4MA 4YXKL 4BZYA 2BVEA 3PWJA 3VFSA 3S97C 5DDHB 2KZWA 4JM2F 1JZ2A 1MVFA 4WI3A 4F58L 3VFGL 1CE1H 3EW3B 5I1LA 3SKJH 1J1XL 3LHPH 4RNRB 4ZFOL 2ZPKH 3ZDZF 2LQRA 5JXAL 2DL9A 1B4JL 4QRSA 2XTJE 5SX5H 3ZKNC 3T0EE 3QG7L 1JL8A 1AE6L 5DUML 3O6ML 4Z7VA 5DJ0B 3D48R 1T4KA 1QSEE 1S9WA 1NCWH 4O4YL 4MJ5B 3P4OB 4BQ8A 2Z9TA 3VXMB 2XG5A 4PBXA 2NZ9D 5A2JH 4LVOB 1T89A 3TN0C 2P5WA 3GM8A 5FYKD 1MCFA 3IDYB 3IDXL 4X9BA 2XWBB 1Q72H 3NMEA 5HYJA 4QRPE 3RIFK 3BZEB 4N8VA 3VA6A 3O9WC 1JF1B 5T1LD 3C8KB 3FB6A 2DM4A 2ZP0T 4RGNB 3NCMA 2HFFB 4OCMC 1P2CB 1JGLL 4R2GB 2CR3A 3PDDA 1YPZB 3EDFA 4G3YL 4OQTA 1RMFH 4XH2B 3BQUC 4M6AA 5E2JA 1PLGH 2IFFL 1D5XB 2UZIH 1BFOA 5FUOL 1Q0XH 5C6WH 2EDRA 1MFCH 3PJSA 3L3OB 3HE6D 3VGAC 5FGCE 2KKQA 5EZIH 5E9DB 1HDMB 4A6YB 4RWYL 5DEGA 1UQSB 3AC0A 2BY1A 4X4ZA 2P8MA 3IU4H 3VDAA 2RCSH 3G5YA 4DJMA 1IM3A 1YMME 3GK8H 3UJJL 3SDXE 3QQNA 3LS4L 5D7KE 3C2AL 4XC3H 1JGEA 2YD5A 3TVMD 5JW4M 2FLBT 1TCRA 3MLZH 4E9LA 3QAZB 5I30H 3MLWL 1OP3H 3QEHA 5JW4R 5T3ZH 1MY7A 4KHTH 5KZCB 2CSPA 1PY9A 1I3RA 4N68A 4MHHG 5M95B 4N8VG 1X4ZA 4OZ4B 5LGHL 1CE6B 1MOEA 3BZ4A 3U46A 4LAJH 3Q6FB 3IDGA 1OHQA 1ZVSA 2ILLA 3DX7B 3DTXB 1ED3B 2W92A 3AS1A 1Q9WB 2YRZA 5B3NA 5C0EA 3UROR 4XCNB 3VGFA 5ADOH 5EU7E 3MUZ1 1KG0B 4HEPG 2AK4B 3QFDB 4QGYA 4HWEH 1JJUA 3LQAC 1AKJA 4PJBF 5A2IH 2EH7L 4I77H 3LOWA 5EO9A 1FFNB 3QHZH 4J23A 4IS6A 4EI5A 1EPFA 1A9BA 4E41B 3H3BC 2VIRA 3G08B 1XGUA 4O2CB 2ARJQ 1XF4B 4LVHB 2JJSC 3BIAX 1UKSA 4KKAC 4JHAH 4BFIB 1IAOA 1MF2H 2R69L 5BMFL 4ELMA 1V5JA 1T22A 4P5TC 2ZUTA 1BMGA 3Q0HA 3TV3H 3TNMA 1H9VA 5DQDH 1UB6B 3CIQA 3ELAT 1J05B 1T21B 5JZ7D 5FOJA 2EYSB 3C09B 1OTUD 4R9HA 2AJ3A 3O2VL 4FMKA 5DT1H 4D8PB 3SQBA 1A7PL 1B9ZA 3D18B 3SPVA 1SEBA 2DLEA 1K4CA 2W0PA 1S9VA 1A0QH 1IGTA 4QTHA 3TWCL 3KLHC 1MCWW 3QUZA 1T1WA 4X7FC 4YHLH 5D93C 2WINB 3GMLA 5TJWK 4XBPB 4N9GB 4XXDB 2F53E 4XTRC 5IHUL 3ARUA 3E1F1 3WE6B 1HWGB 5TGBA 1X9QA 2NW3A 3MRDA 3NAAL 4U49A 3FO2B 4OV5A 4F7EA 4Z77A 3IKCB 1G7MA 1OCWL 3I3DA 2AV7A 1CIUA 4MQTB 2DQHH 3C08L 5MEOA 5HHMB 5I1DB 2APWA 1CFVH 2CK0H 2IGFL 3DVNB 2RBLA 5IEHB 3MUHL 4OD2A 4Z76A 5I71C 1IL1A 3JTTA 4JREC 5B38B 1GXEA 1UKQA 3I02B 2V7HA 2XZAL 2W9LA 1JWSB 3RY6A 3TPKA 3EOBA 4MXQD 3HPLB 1LMKA 3FQRB 2WP3T 5GRXG 3UBXA 1RK1B 2ED7A 1HI6A 3DUUB 3QH3B 4Q6IA 1KENH 1QEWB 2EDEA 4PLNC 2B1HH 4OFPA 3GHBH 2UY7A 4YFLF 1V3KA 5E70A 1CGUA 2FX9H 5KBNC 1SJVA 5JDJA 2QTEA 5FGSA 3NCEB 1VDGA 5EU6A 2DOCA 2YMXH 1NCBH 2CXGA 3QDGB 4DN4L 4KZDL 4YWGL 4M1CD 3PP3H 1ULVA 4NO2B 1YEJL 4U6XB 3ZE1E 5E2TL 2VXVL 4EDWH 2OJZL 4NFDA 3VH8G 4ONOA 4P5MB 1MI5D 2ESVA 1QLEH 5A2KH 1CFTA 4MJID 4KKCC 3ARBB 1RHHB 4M6NH 1UEYA 1Z9OA 4XVUC 4H1LB 1LP9E 2DWDA 4OCYL 1NDMB 2P43B 2O5XL 1FVCB 1ACZA 3MV01 4NC1E 5CSZA 1AO7D 1I85C 2R0LH 2OTPA 4JG1H 4MD0B 5JIHA 5FKAA 1X5GA 2PTTA 2DIJA 3B3IB 3PWLA 1XR9A 3HS0A 4TUOB 4WFFE 4N0FB 3OQ3B 2K9UA 4NHCH 3D39E 1BJ8A 1ZS8A 3HA0A 3WIIL 3SDDA 2ATPA 3UBXG 5IUSA 4PJIA 4X6CF 1NSNL 1FV1A 2FX8H 1KCSL 4TRPH 4GSDL 2WBJA 4JG0L 4W68A 5I8KH 1KJVB 4L3EB 3F7PC 3NA4A 4NCC1 25C8L 3BMWA 2VDOL 5C0CA 5KVDL 3U30B 4YK4B 5L2KB 4LFHG 1OTTC 1DZBA 4IOFD 4KKNA 5DR5H 3W11D 1FIGL 4I3RL 5BJTB 1MJJA 1ZWIA 4WJ5B 2J8UF 4LLYA 3QRGL 4PRNB 1A7RL 1CTNA 3IFLH 5EC1B 3V79C 3AAZB 2UWEF 4GQ9H 4PP1D 5T5NF 5FO8A 1UVQA 3HE7B 3P9LB 1MCOL 1YC7A 3WNNA 1L6XA 4R3SB 3VE0B 2DQIH 1BF2A 2VDLL 3GSNB 1T7YA 1ZA3B 2V17L 4RFOH 3CLEH 1AXSB 4ZXBC 4CN1A 5GGTL 2WQ8A 4QT5B 4P3CH 1KPUB 4NYLB 1OQOA 3QFJB 5D1XD 1DBMH 1TZIA 1RZJC 4ODTL 2ADFH 4YDIL 4QWWC 3KS0J 3LKRA 3EDEA 3E8UH 3FB5A 3BI9X 3VGDA 2BC4A 4JVUA 1QYGL 3V4PL 5KSAD 3UPAA 2APBA 5TF1L 2RJMA 3D85A 3CLFL 3QUYD 2FCBA 3K46A 2R1YA 1RUPH 3JWDL 1Q8MA 1ZHLB 2EIEA 5T5FH 3RVVD 4EI6A 5IKCB 4Y5XA 3H9ZA 5D7SL 1SBSL 4W4OA 3QIUC 1S9XA 3SE9H 1INQB 4RRPA 3QXDB 1ORSB 2OMNA 2WNGA 5DJ2B 3W5MA 4JZJA 3ARFC 4NQUA 4OQ1A 4NC0B 5IMOA 2YXFA 3WS3B 4DGIL 1WCBB 3MV11 3SGKA 4EXKA 4MQXC 5GGUA 4M9PA 3I6LE 2VAAA 5D1QC 5DMJB 2AK4E 1R3LB 1QBAA 3PDOB 4JZNB 2BDNL 3ZT5A 2CR6A 2WLZA 1JGDA 1E4JA 4RFNB 4DKFH 5IB3B 3Q5YA 5HI4D 5CKGA 1XR8A 1QLFA 3KLDA 2IBZY 3HNTL 1FE8L 1UZ8A 5DVKA 4X5XB 3V4VH 5GS3A 4K7PL 4J3SA 5IF0A 5JR1L 4X0KA 1ZGLA 3A6CL 3C6LB 3KPLB 3OX8B 3BGFC 1CGSH 3F12B 1OAZH 3N50A 5H37G 1UM5L 2MPAL 3QUML 1L9NA 3MC0A 4KKLD 3UYRL 1DANT 15C8L 1T20B 4GKOA 4U3CA 4CVUA 4FQQB 2DMCA 4ONFH 1A3LL 2FH8A 3B8SA 4WFHE 4U31A 5C0DA 4IDJL 5HD8D 4JO4L 4KAQH 3N9GL 4RRPG 5DTFB 5J9PA 4FQXA 5DRNB 5LWYL 5FGBC 1U36A 1X3DA 3CVHB 4FQLL 4PJGF 4K8RC 1NDGB 5CP7B 3WUWB 1NEUA 2NY7L 3LN5A 2PYEA 4YNYA 1YMHA 5GSVB 1IMHC 2DI7A 3QUXB 3SO3C 4Y4KB 3JV4A 4ZNEE 5JHDB 1I3GH 3SE3A 5DK2A 1NL0H 1RFDL 2EDHA 5EOQL 2F5BH 4JJHA 1YEHH 2XA3A 3QPQC 3TBTA 4HBQA 2WIIA 2ZUUA 2OM5A 2JE8A 1IGIL 4WWID 1R3KB 2BNQD 3IYLW 4X5WB 1P7QA 1BREA 1TZGH 2VDQL 3EYUH 3BPNC 4FNLH 4DEPB 3GJEB 1KNOB 1BM3L 4G8FA 4KPHH 4C56A 5F44A 1N6VA 3U1SL 3WDHA 4AM0B 3MNZA 2H41A 4BM7A 2FR4B 1BD2A 1CK0L 4PJXA 4YXKH 3S9DB 2EIBA 3KJ6L 3CFKB 4GJTB 3N06B 4X4YB 5HVGB 4F58H 3VFGH 4JN2A 4OFYA 3RJDA 3KPMA 2YPLE 1M7IB 1WSST 1J1XH 4KQ3L 5HDLA 3DUSA 4JAMB 2EC8A 3MBED 3X12A 5JXAH 1B4JH 2AJZA 2X4RA 1GSMA 3QG7H 4BQ9A 1AE6H 3O6KL 5DUMH 43C9A 5ICXA 3O6MH 3JV6B 1NQBA 5F89A 1JBJA 1NUDA 4QRRA 4PJHB 4O4YH 2X4QA 4NRYB 3T0DA 3VXNB 4O51B 3KPSD 5BV7L 1SYVB 4Z7UA 3RL2B 3NN8B 5DJYB 4KK5D 2DQEL 2E9WA 3BUTA 2CUHA 5DRZB 3IDXH 3WEXA 3CH8A 4PV9A 3SDAB 3FONB 3VFWB 4NKIL 2ARJB 4GG6A 1F8TL 2APTA 1WFNA 3CUPA 3DV4A 3VGHA 5IFHL 3GNML 5FM8A 2CDFA 1PX4A 2VLKB 5E4IA 3QULB 2XT1B 5B3JE 1T1YA 2N1KA 4EUPA 1JGLH 3IJHA 4WW1B 2C9AA 3FCTB 1JPGA 4G3YH 1AQDA 5HBBA 2ZOLA 4WHCA 4X80L 2HP4A 4NNPL 2GQHA 2IFFH 1OAQL 5HHOE 5ACZA 5I75C 4C54A 2XICA 4JFPA 2VDRL 3S36L 4NBXB 4GG8A 4RWYH 3FL7A 4OZHB 3GSUB 5BVJB 2KZ1B 1JYNA 3VI3E 1PX3A 4YHPB 3ZE0E 2G5BA 1W2KT 1NMBL 3UJJH 5JXEA 3LS4H 1T0PB 5B39A 1N3NA 1WITA 1I1CA 3C2AH 3DO7A 1YN6B 4JRXD 3HC0A 1B0RB 3MBXL 3MLWH 3BMVA 1BIIA 3V0AC 3V2AR 2VLJD 3DMMD 3DV6A 3DWTA 4OZGA 1WBXB 1O5DT 2Z31A 1BFVL 5LGHH 2VZOA 3I2CL 3ZO0A 4DZ8B 2DYPB 2X42A 3ILPB 2G2RA 1S9YB 1IGJA 2BJML 3PWPE 1ZANL 1HEZA 1QRNE 1JPTL 4FFZL 1UADC 5I1CL 5LGKA 4OCWL 1RK0B 5FKPA 3ZKND 5GZOD 5MHSE 3RZCB 1W0VA 2UYLA 3T3ME 3OR7A 3QFJE 3MLXL 3O4LB 2EH7H 1CVRA 1MHPL 1ZHNB 3CPLB 5BZWA 4J4PD 4Z7NF 5JLZB 3FFCE 1T1ZA 5ID1A 3EFFB 3B9VA 3GMMA 3G6DL 4X6BA 2HG5A 4WFGD 3OXSB 1EA9C 5INCB 4XP4L 5BMFH 2R69H 1EHAA 2D0GA 3O9WD 4KTDL 5JQHC 2XN9A 1KCUL 1PEZA 3NPSC 3GM0A 3L5WA 3VFSB 3QDAA 4M61A 1NGWB 1OGTA 1AGEA 4RMRA 5BS0D 2ED9A 2PR4L 4CKVX 1MSPA 3FFDA 4PLJC 3JXAA 4PJFB 1FSKB 3W9EB 4PG9A 4PR5B 3O2VH 1I3VA 1A7PH 4QRSB 5IMKA 4G9DA 1XIWD 4PP2A 1FG9C 2FBJL 4BFBD 4DUXA 4ZUUA 3TWCH 1LEGA 4G9FD 3RDTB 5HGHA 1FNEB 3WO3B 1XFPA 4R8WL 5IHUH 2CKBA 5MENA 3OKEB 4A6YL 1RZFL 3NAAH 1WK0A 4ODUB 4EXPX 3EJYD 3BZFA 4LCWE 5HYJB 3SE8L 4NOFA 4N8VB 4AIZB 4ZS6D 3W0WD 1OCWH 4OLWL 5C9KA 4HS8L 5E24E 3C08H 1HSBA 3FB6B 5ADPL 3M45A 4JQXA 4BH7B 2BVOB 2IGFH 1MLBA 3K80A 1IM9A 1QNZL 2W59A 3F7YA 1CT8A 4HHAB 1I7RB 5IVOA 2IAMD 5HYEA 3C5SA 2XZAH 2BVQA 5BZDA 1FCCA 4KMTL 2WBKA 3C5JA 3E0GA 3F6LA 1H3VA 1OGAB 4PJEA 2C4XA 3ULVE 4F37F 4B41A 2AJVL 2P8MB 3HRZA 3T3PE 3G5YB 3O11B 1UB5A 3JZ7A 4KZDH 2N7AA 4DN4H 3GJFH 3ARDA 4ZPVA 4YWGH 3R8BB 1BQHA 3DRTA 1DCLA 1EMTL 4LK4A 1JGEB 1YEJH 1EEUA 5E2TH 1X4YA 2VXVH 2OJZH 5F97E 3UAJD 3WJJC 4LCYB 4DQOL 1VEMA 5FUCE 1GGCL 1LNUA 1I3RB 3LSOB 3PHSA 5INDB 3WIHL 4N1CA 5IV2B 5D2LA 2NY2C 4JRYA 4OCYH 4GH7B 4U1SB 2VJXA 2O5XH 3QG6B 4V1DD 1JNHA 3ZE2E 5I74B 2R9HC 3LKQA 2HFGL 4B7IA 5C08A 3V6FB 2RAMA 4L4JA 1WWAX 2P48B 1HQ4A 3WIIH 3KLHD 2CO6B 4GRWH 1WBZA 3ME0A 2CRIA 1NSNH 1KCSH 4GSDH 4JG0H 4XTRD 3T0XA 1IC1A 3HMXL 3VG0L 3WUZA 1U8OB 4IS6B 1NFDA 4EI5B 1A9BB 3VXSD 5C0BB 2VIRB 2BVPA 2HJKA 1TQBC 5GIRA 3SGJA 25C8H 3VXUA 2VDOH 2VZ3A 2QQLL 3ILQC 1BQHG 2EDOA 5KVDH 4ELMB 1FVDB 1KB5B 3D3VB 3SN6N 2OK0L 2BMKA 2DQGL 4G8GD 3S3SA 3DETC 4Y4FA 2I07B 5CMAA 3TNMB 5DHYA 3UTSB 1FIGH 3PE9A 4I3RH 5HGBA 5CLWA 1N7ML 3DYOA 4GRLD 2AJ3B 2EDLA 3QRGH 4A2MA 3U9PL 1A7RH 1E4XL 3SPVB 4MCYA 3O2DL 4BSWB 1UWXH 4ZO6A 3V0WL 1K4CB 4KI5D 8CGTA 4OM1L 5IB1A 4APQC 1CFNA 4Y2OA 3B5GA 3QUZB 3MO1A 1MCOH 3HG1B 4KGJA 1KJ2B 2VDLH 2B20A 3VH8B 1A02N 2NZIA 3TCLA 4M00A 4LLQA 2V17H 4WTWA 2FLRT 3TT3L 3MRDB 4XXCA 5CJXC 5C1MB 1I8MB 2WM0A 4Y1AE 4TSBL 1X7QA 5GGTH 1G7MB 5DFVD 2AV7B 4P4KA 4JM2D 4YLQT 2VZUA 3T1WA 3NTCL 3EYQC 3Q3GB 4JFHE 4ODTH 4UT9L 4YDIH 5KTEL 3SKOA 1MLCA 3HKFA 4ZUTB 1UZ6E 1Q0YL 2NXZB 2Y6SD 3QIWC 2VLLB 4OD2B 3MLSL 4UNVA 3DX8B 4KKCD 1QYGH 3V4PH 3JTTB 4KJWC 1CXHA 2DIAA 5TF1H 2DQFB 2V7HB 1P53A 1BOGA 3CLFH 5F7DA 2CLVB 4LRNL 3JWDH 2BSRA 3P30L 3UBXB 3F5WA 1DE4A 1HI6B 4DK6A 3VCLA 4ODSL 1SBSH 5D7SH 4OZFA 1B0GA 5DXWA 4PLKC 3FHAA 4DGVL 1UYWL 2V2WA 2DMBA 2IC2A 3T2NL 2A83B 4HMCA 3HPJA 4DGIH 3DXAA 3UXFA 2OJEB 4NQCD 3GGWA 3AS3A 5CEYB 2BDNH 3PGCA 4KTYA 5HHQA 4WW2C 5F9JA 4CW1A 1FZKA 3CXHJ 2ESVB 1T1XA 1CFTB 1JFQL 4PRIA 4HKBA 3U36B 4TNWK 4MB4A 3HNTH 1FE8H 2DWDB 1GCFA 4LCIL 4WWKA 4YHYC 3ZYJA 4K7PH 3IDMA 5JR1H 2P44B 3A6CH 3RWFA 1FNSL 1V05A 3OHXB 2AW2A 1UM5H 1A3RL 2MPAH 3QUMH 1DQDL 3LZFL 3PWLB 1XR9B 4WHYH 3UYRH 15C8H 1IAII 1ZS8B 2WLYA 3V0VB 3SDDB 5J13B 1A3LH 4Y4HC 3MV8B 1CICC 4RMUA 4IDJH 4OZFG 2QSTA 4JO4H 4U1MA 3N1PC 2WBJB 3N9GH 3ULUF 5LWYH 4XPFL 4PGZA 4FQLH 4RAUB 2NY7H 3PV7A 4Z7VE 2X4SA 2AEPL 3GSNL 4ZXBD 2Z35A 1R3HA 1RQ5A 3IFPB 5C0CB 4KVNL 1RFDH 3EYVA 4WGWB 5EOQH 3VXTB 4PJ5B 4ZOCA 2P5WE 4DOHB 3M8OL 4CN4A 5HYJE 1FNFA 1A14L 1G7LB 2X7LA 4J3XA 1IGIH 1MJJB 3GEWB 1DP0A 5GPRA 3ROOA 2AS5M 3BJ91 2VDQH 3DJ9A 1TTUA 5IVZA 1BM3H 3BPOC 3BPLC 5FO8B 1UVQB 3U1SH 1ETZA 3Q5OA 2JJVA 3P4MA 5GJSL 1CK0H 3KYOB 5EC2B 1MCLA 1I1AD 1FGVL 3BKCL 1JHTA 3KJ6H 3QCVL 3WSQH 4CRPA 5D1QD 1SQ2N 3NZ8A 1J8HD 3W9DB 1CFQA 4KQ3H 1VA9A 2Z4QA 1TZIB 4WU7B 2O93L 3QDMA 3LKRB 1PQZA 3FB5B 1F6AA 2VB5A 3O6KH 4EN3D 1NCCL 4HKZB 5E03A 5DQJA 3CX2A 2O61A 1WIUA 5K59F 3QBTB 4JFXA 2D7TL 5ENWA 3MNWB 3TZVC 4IRJB 1NFKA 4GT7A 5BV7H 3HUJF 4OBRA 1KPRA 4Y5XB 2DQEH 2VLME 3CNKA 2Y9RT 5H35A 1ZSDB 4NKIH 3PQYE 4LHQB 1F8TH 1S7SA 4MNQB 5IFHH 2IPKA 3GNMH 3IAPA 4WDIA 3LKNA 4PGJA 4HWZB 2NY4B 5GGUB 2ADGB 3WFHB 3KGRA 3PGDA 1RZKL 3BH8A 4X80H 1N8ZA 1U8QA 2W60A 4NNPH 3C60D 1OAQH 2DKMA 4LCCC 3ULVL 4JFZL 2GSIB 3V6OC 3G5VA 4UIMB 3TGXA 3QPQD 2VDRH 3LRSA 3O0RL 1QLFB 3S36H 1DR9A 1UZ8B 2MCG1