4E9WA

Multicopper oxidase mglac (data2)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Multicopper oxidase
publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Uncultured bacterium
total genus 95
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9wA02
4YL4A 2ZOOA 2J5WA 3QPKA 1A4AA 1EHKB 1MG3C 1HFUA 3AY2A 1PZAA 1A4CA 4AKQA 1JOIA 5IY5B 3TASA 2QT6A 2PP8A 4G7QB 1AACA 3ZIYA 4F2FA 1KYAA 1IUZA 1XB8A 4WTQA 3GXUB 3WG7B 3AG4B 7PAZA 2GC4C 3FS9A 1ADWA 3NJFA 3FT0A 2I85A 4G70B 4E9SA 1QHQA 3OQRA 1MDAA 2YAHA 2FT8A 3N2JA 1J9SA 1GY1A 2HXAA 1NIBA 2BHFA 5AZUA 3S3BB 2IDTA 3FQ1A 3FU9A 3OMIB 3PAZA 4DP1X 1OE3A 2B08A 4JKNA 4YVNA 1PLCA 2FWLB 3QQXA 1ZV2A 3UAEA 1JZJA 3EH4B 1L9TA 1SF3A 2XLLA 1CUOA 1PMYA 1OF0A 1W8EA 1SJMA 3X1BA 3AZUA 4CSPA 4DPCX 3PLYA 1ET8A 1GY2A 2BW4A 4KO6A 2BP0B 4KO9A 2P80A 1GSKA 4A2GA 2OCCB 4KO5A 2YAEA 3V9CA 3WNJA 4FA7B 3OMAB 2PLTA 2MRYA 4YSSA 2CUAA 1AAJA 1SNRA 1PAZA 4FAAB 1JZFA 2QDWA 5F7BA 2VSKB 4E9QA 1DYZA 3HB3B 2AZUA 4E9RA 2CJ3A 2DWTA 2YAFA 1OCCB 2YAOA 1GS8A 4BWTA 1BXAA 2EINB 2JFCA 2VW6A 3ASOB 5I6LA 1FA4A 1SF5A 3IBOA 3NJLA 5I6OA 1NICA 1OCZB 1AOZA 3EHBB 3ZBMA 4GXFA 1ET7A 3NJJA 1KBVA 2YXWA 1WS7A 1NIFA 1V10A 4MFHA 4KNTA 3OD3A 2PP7A 2FQFA 4PCYA 3EH3B 4ENZA 1CURA 3FU7A 1F56A 2FT7A 2IH9A 1ZDQA 1SFHA 1AS6A 1RZPA 1PF3A 4DP8X 4KNUA 2I7SA 2WO3B 1JZGA 4GY4A 3TBCA 4YSAA 1A65A 3HEIB 8PAZA 5I5IA 1IC0A 5I26A 3BQVA 4HZ1A 5B7FA 1J9TA 1PNCA 3TBBA 3TA4D 2BP8B 1BXUA 1WA0X 2PP9A 3H4HA 1BQKA 2HRGA 2Y69B 1SDDA 5FC9A 2EIJB 4E9WA 3DKHA 1W6LA 3D12B 4W1TA 2J55A 1JXFA 5AFAA 2Y1AA 1ASOA 3FQ2A 3QJQB 3IE9A 3ZX1A 4WKXA 4YSEA 4BK5C 4W9ZA 1WA1X 1NZRA 2CCWA 2VN3A 1PZCA 4KO7A 3AW5A 4QLWA 1GS7A 3CZUB 2WO2B 4DP0X 2YXVA 1MG2C 3NJMA 1L9OA 2TSAA 5LDUA 4A66A 3X1NA 2EILB 1A8ZA 2DYSB 3NJGA 1ASPA 1NTDA 1ILSA 3TU6A 1JZIA 2H5UA 4YSDA 1AZBA 2X87A 1ETJA 4HALA 2DY2A 2RACA 2BWDA 1L9QA 2ZWNA 2R7EA 1ILUA 2YQBA 4HAKA 3ABLB 1FFTB 2IWEA 2CALA 2WSDA 3T9WA 2LLNA 2YAMA 1M9WA 2VMJA 2VM4A 3FSVA 1URIA 2JXMA 3CVBA 4E9XA 1SDDB 2IDFA 4UANA 3CDZB 4DP6X 3OMNB 2FQGA 4YSQA 1DZ0A 1IBZA 3S3CB 4BWUA 2VW4A 2A3TA 2XXGA 3UADA 2I7OA 2BW5A 4KOBA 4E9TA 2H47C 5D4HA 1AS8A 1BXVA 3N55A 1AZCA 5B1KA 4TXVB 2GBAA 3C75A 4HHGA 4P5SA 3NJIA 1GYCA 2GC7C 4N4YB 4A2EA 2IWKA 1R1CA 4DPAX 3NP3A 2ZONA 3FPXA 2BWIA 3NJNA 2BZCA 4PAZA 3WI9A 4BWWA 1JERA 2NRDA 2GB2A 3S3DB 1TU2A 2OV0A 1HAUA 2PPCA 3ABGA 5E9NA 1J9RA 1M56B 5A7EA 1OCOB 4GP5B 2UXTA 2PCFA 2PPFA 4E9VA 1NINA 1PCSA 1V54B 3JT2A 6PCYA 4X4KA 3H56A 3SBRA 4Q8BA 3T71A 1CYXA 2DYRB 3OM3B 2IH8A 1J5DA 3KW8A 2FQEA 1WAEA 2IAAC 3ERXA 2XX1A 4NAJA 5PCYA 4DP4X 3QJUB 1AQ8A 2PCYA 2XV0A 4GP8B 5B1JA 4CSZA 1CYWA 4G7SB 4BDVA 2QDVA 1E30A 3ABKB 5I6NA 1PLBA 1X9RA 4NB7A 2XV3A 2HX7A 4AKPA 1FWXA 3NYKA 3NSYA 1AR1B 1A3ZA 4YSRA 3PPSA 2BZ7A 5B3SB 4EF3A 1ZIBA 2W8CA 2GSMB 4YSPA 2JKWA 2OJ1A 1RCYA 1KDJA 4AX3A 1JZHA 4UAHA 3CG8A 4YVUA 1MZZA 2XX0A 1OV8A 3NJKA 2FNWA 2HZHA 3AG2B 3NP4A 3QJSB 2J57A 3NSFA 4DP9X 1BEXA 5B1BB 3UABA 4K9JA 3EF4A 2DWSA 3NSCA 1KCBA 2UXGA 4JHVA 2Q5BA 3SBPA 4DP5X 3ASNB 4JHUA 7PCYA 1N70A 2CAKA 4M4RB 3X1EA 1PNDA 5B7MA 1OE1A 4KOCA 1W6WA 1EZLA 1ZPUA 3QJVB 4BXSV 2VSMB 1WA2X 2Q9OA 4HCGA 3T6VA 5I28A 1WS8A 4DP2X 1ZIAA 2CBPA 1BQ5A 2XXFA 4G71B 1JVOA 3IN0A 1KDIA 2P80D 2HRHA 4F7KA 1PZBA 3FSAA 1AS7A 2AANA 2IDUA 1TKWA 1ASQA 3FU7B 1SFDA 1X9UA 3DIVA 3NJHA 3FU8A 3NT0A 5PAZA 3NSDA 2TSBA 3AG3B 5F7AA 3FPYA 3QJRB 4A68A 4BXVA 5I6MA 1E67A 4YSOA 2BP0A 3FQYA 2XU9A 1BYPA 4AI7A 2GIMA 1L9PA 1KGYE 2UX7A 3KW7A 1TEFA 2AVFA 2IDQA 3PAVA 2EIKB 1GW0A 4GP4B 2IWFA 1NDTA 3SQRA 1BAWA 3UGEA 3RYMA 3JTBA 4DP7X 4NERA 3WIAA 5I5MA 1IKOP 1E5YA 4F2EA 4A67A 4HIPA 2VM3A 4YSCA 1UATA 2FJSA 1YLBB 3AG1B 3DTUB 3EH5B 3BVDB 4GYBA 1QNIA 2N0MA 9PCYA 3L45A 1PLAA 1GR7A 1BYOA 1M57B 2AFNA 2FQDA 4AZUA 1RZQA 3V9EA 1NWOA 3S8FB 3G5WA 5TK2A 2YAQA 1SHXA 1ET5A 2XUWA 1AG6A 3FSZA 3T6ZA 4G7RB 2HLEB 1MZYA 1HAWA 2R7EB 3X1GA 3PXLA 2BP8A 3S8GB 3GDCA 5D4IA 2ZXWB 3IN2A 5AKRA 2HX8A 1NIDA 1CC3A 1NIEA 4QKTA 1NPNA 4A2DA 2FT6A 4P5RA 4YSUA 4L0PB 3WKQA 2X88A 1I53A 1AZNA 4G72B 3X1FA 3UACA 3CVDA 4DPBX 3PAUA 2XWZA 3WNIA 2PPEA 4Q89A 5B1JC 1GS6X 3GYRA 3IEAA 1QLEB 2J56A 1V55B 3ZDWA 3MX0B 1NPJA 4A2FA 2AZAA 2BO0A 3PCYA 1J9QA 2H3XC 2XYBA 1L9RA 2QPDB 5EHFA 4ZK8A 1XMEB 5I6KA 1OE2A 4HCFA 2FTAA 1KBWA 2W88A 1E5ZA 1VLXA 3WKPA 1AZUA 2XVBA 1JZEA 1KV7A 1AZRA 4UF7C 1JXGA 1TEGA 4N8UA 3X2QB 3SBQA 1JXDA 1XB6A 3ABMB 1NWPA 2XV2A 1JVLA 1OOWA 2QPEB 3U25A 6PAZA 1OCRB 3MBWB 4E9YA 5I5JA 2HX9A 1RKRA 1N68A 5ANHA 1IBYA 2UX6A 4RH4A 1AIZA 3CDZA 3CVCA 3FYIB 2PPDA 4HHWA 4BDVB 1BQRA 1B3IA 5TK4A 1A4BA 2YAPA 2IDSA 2VW7A 1AG0A 3FYEB 3T6XA 2MTAA 5B7EA 3T6WA 4YSTA 4KNSA 1E65A 5I6PA 2PPAA 2GHZA 5D4JA 1SHWA 1PY0A 1XB3A 2GI0A 2YARA 4M3HA 3QJTB 2UXVA 1KCWA 1ZDSA 1J5CA 4AKOA 3UAAA 3FSWA 4HCIA 4A2HA 1AANA 2EIMB 2UXFA 1L9SA 2B3IA 1ID2A 1NIAA 2E86A 5B1AB 2DV6A 3H4FA 1T5KA
chains in the Genus database with same CATH superfamily
3WD5H 1IM9D 5B38G 2WW8A 3MRLA 3T65A 4Q6YA 1A4CA 1WC7A 3IJHB 5I8KH 1PDKB 1NOAA 5DK2A 2QZQA 2AJSL 2HT2D 3O2DL 4TL5A 3RUGE 2P9RA 3CLFL 3GXUB 3JQOB 4Z7WB 4BQ8A 1CPUA 4M43L 4ANXA 3EO9L 1JHKH 2YGPA 4ENED 3RNQA 1Z3RA 3N2JA 1WYJA 1HEHC 2O6DA 4IIQA 4MNGB 1MIML 1NMBL 5CJOL 5DA0B 4RFNC 3T4AB 3VI3E 5FCUL 3ZZSA 3S35X 4AXWA 5LGHL 3DMMA 1SM3L 1BGXL 2GK0B 3WSQH 1XH0A 3O9WC 1OE3A 1KPRB 5EOQL 4WUUD 1WITA 2BY3A 5F1NA 4CVXA 1QTPA 3RTQB 2QV2A 3UG4A 4YVNA 5L4FA 1M9SA 3QIBC 4WLCA 4AY0A 2MQCA 2Y7LA 3GMNA 5CJXC 4D9LL 2F7RA 5HHPA 1CFTA 1KB5B 2X53A 8FABA 3U30B 1U9KA 3DPDA 5D55A 2BNUB 1IGFL 1JWUA 4BFJA 1KN4L 4K23L 4DN4H 1Z0MA 4HKZB 1O75A 5AAPA 4L5FL 1QNZH 4KO9A 1J8KA 1CLYL 2J20A 2RA1A 2BS71 1FYTA 1KB5H 3BZEB 2MHAB 1MLCB 5JIPA 4NQVB 1ERNA 2VDQB 3IDXL 3O3EA 1QRND 4EZMA 2ITFA 2OCJA 4WI0A 1U8QA 4V2CB 4XBMA 3TFBA 1GIGL 4PN6A 4ZUUA 2X9XA 3EOTH 1VRSA 4H25B 1OB0A 3LKPB 4HS6B 4LMQE 4NJAL 4B9IA 3EADA 3S5LA 5KSVA 3MREA 2D31A 5HI5D 1HHIB 3GPEA 3VSVA 4Y4KC 1A6ZA 4ZPVA 1YEDA 5DJ0B 4B9ZA 1ZGLP 1YG9A 3C6LB 2FJGB 2VDQH 1BX2B 3ZBMA 2J8UE 1J5IA 4PTUB 1GZHA 1QPXA 1T5XB 2IH3B 2QQQA 4U1LA 2DW5A 4G6ML 4LOFA 3VSQA 1VEOA 5CEYB 4GBXC 1F3DH 3T2NH 1E90A 4JFHD 4NQCE 3GHPA 2CIIB 2Y3NA 4FFZA 2OA9A 3MV7A 3UYRH 3VB8A 3DJZA 4HK3J 4HETA 2VYRE 4HIEB 4WUKL 4PJ7E 3WFDH 3LRMA 5I30L 4JE0A 2CLZB 5I0ZA 4D0DB 4CKVX 2PYED 2ALAA 4XB7A 5J13C 3GBNL 2DMGA 4HV8A 2NY3B 1SEQH 3RURA 2R0KH 3P30L 5IB2A 1NBVL 2JCCF 4P4RA 1CDCA 5TPWL 1WIUA 1LK2B 2J55A 3F62A 2WVUA 4N2NA 3O3AB 5KG9B 1J1PH 4JFQB 1ASOA 3TA3C 1K4CB 3CHRA 2HFGH 4BKSC 4B9PA 3VD5A 4JVWA 1DUZB 1NUFA 4O02A 3NABL 1H3PH 4HSAC 3SE8L 2KPWA 3VXSE 2WO2B 4P2QB 3S96B 3MRFA 4ZQKB 3WFEL 4PJFB 1ED3A 2YEZB 1INDL 3H6JA 2HTKD 3EYOB 2XJKA 2YUZA 1L9OA 5DLLA 4EN2A 4I0PC 5C0RL 1WFMA 4A66A 3M7OA 4KXAA 1AGDB 4Y2DC 5BRQA 5L2KE 1QVOB 4KI5D 3BVUA 4RVBA 4MGXA 4YBQD 5D7LD 5F88A 1BQUA 4P9ML 3VFGL 3GUTA 3G5XB 1UA6H 1D5ZA 2NZ1A 4YBHA 3LQMA 5FB8B 5IVNA 1B4JL 1S7SB 3NIGE 1ILSA 4CMMA 4MJ6A 4MS8D 1QPKA 3U46A 2CRYA 4O9HH 4YZFE 1P4LA 4PJ8B 2GKIA 3OTTA 2Q7AA 2YA0A 2VC2L 5J8OA 1F11A 4JN2A 4L0YA 1FVDB 5AKVA 4CC0A 2DLTA 4ATWA 4Q0XH 4Y16B 3HCVB 3TN0B 5HHOB 5HGGS 2NDGA 1CLOH 1FC1A 1F4XL 4KAQH 3HBPA 1WV7T 5EA0H 4R9HA 3RA7H 4OAWA 2OXHB 3QNXA 4P8QA 3MLRH 4K7FA 1SY6H 1B88A 3QDGA 4HCRA 2G4GA 1I1FB 2LU7A 3SOBH 4ES8A 1M1XB 1NCDH 3K6IA 4PGBB 2L4OA 5LGKA 2ZWZA 2VKXA 2AQ3A 1XF5A 1HZLA 1KIQA 2ZCLH 3FF8A 3WNLA 3VQ2C 4WK4B 4I5BA 3K7UA 4UT7H 4OFPA 3RVTC 5EZLB 3NEEA 2IPTL 5F2FA 4LBEB 4N4YB 2VZTA 3NP3A 3O0RL 1HCVA 3D6GA 4F57H 2BWIA 4PJHE 4PS7A 2H4EA 5FGBA 1ZLVH 4F33A 4M7JL 1HEZB 1NBZB 5KVEH 3GS4A 3NN8B 5CUSL 1C5BL 2R2BA 3KM1A 4NQQA 1EAQA 1M2OA 3EO0B 3MNMA 4QNPE 3LXBA 1YEHH 3MLUH 1N67A 4X9BA 5AVRB 1CFQA 3E3QC 1NL0H 2NY5H 4LQFH 5E03A 5EU6B 2CPCA 2YZ8A 4YC2B 5CLWA 3TYGH 2JJSC 2J72A 5ESVA 5HJBA 1NEZG 3ULUC 4N20A 3T71A 1X4ZA 1DQJA 5D6DA 4OLEA 4R4BB 4YPJA 5CZXD 1ZHBA 1P5UA 1MRDH 1KXTB 4N0FB 4FNPA 4IRSB 2F2HA 3KH4A 5JPNA 1DCEA 1A6WH 3U6XA 4ONGH 4F5CE 3HJ0A 5ICZB 2O4EA 4UNTA 5I6NA 1CDUA 2KKQA 2DPKA 5TQ2L 4GG6B 4NB7A 3SO3B 3A22A 3BP5A 2HX7A 3NYKA 3LDBB 1DBJL 5E6ZA 2FSEA 5F9OL 5EZOL 3NIFB 4B5ZA 4P5TA 2AJSH 1MWAA 3O2DH 4F9PA 4PIRF 3CLFH 4NKOB 3SDAD 2P44B 1INQA 2OJ1A 3VFMA 3WJLA 4J4PC 4JX0A 4M43H 3EO9H 3L3OB 4KUCD 3M1BB 1QLFB 3UIZA 4LLQB 1G9MC 1MIMH 1NMBH 5CJOH 5LGHH 3GXFA 5FCUH 2OW6A 3QDAA 5DHDA 1SM3H 1BGXH 3BESR 1KEGL 5AVWB 1L7TL 3BMVA 2UXGA 5EOQH 3QHZL 5JHDB 3O4LE 1CFVL 5JDJA 1XGZA 1C12B 1MJ8L 2H9GA 5FA3A 4TVPE 1UWYA 2TRHA 1BZEA 4D9LH 2K78A 5IM7B 1IGCL 3MUHL 1UJ3A 2Q9OA 5F7NC 3D3VE 1IGFH 1KN4H 1D7BA 4M00A 4PW4A 4K23H 3MAWA 3WLBB 4L5FH 2VLKA 2Y25A 3M45A 1KB3A 1CLYH 3RE0A 3KJ6L 3IN0A 2DKUA 2P80D 3QEGL 4KZCA 5KVDE 1D7CA 5DFVD 3IDXH 4NZTL 3QPXL 1EX0A 2GJ6D 2JJVA 5HVHC 3SPIA 3G6AB 4A7UA 1NKRA 1GIGH 4LKXA 4X8XA 1M7UA 3E6FB 4X98B 4LEOA 1R9FA 4NJAH 1RJLA 3ZGIA 5D71L 2QKIB 1MELA 4KDTA 4OCMC 4LLVB 1HH6A 5DJAA 1ETB1 3PWVA 2V33A 4CN4A 2EE3A 1E67A 4UAOC 4JM2F 1BVZA 2R1XA 4OD1L 3FQYA 4N8VA 4HUWB 4MMYB 2GIMA 4L8DB 2JSFA 3CSPA 5KBPA 3BE1L 4G6MH 2PWFA 2W94A 2A0LD 2VSCA 5AG9A 3RZCA 4UB0L 3N91A 3B8YA 2IWFA 3BC9A 1OW0C 4G9FD 2Y22A 1HNFA 5IQ7L 4WUKH 4Z7UB 4MCZB 2AQSA 5I30H 2AQNA 4LSSL 5FYJE 3CC1A 3QRLA 5CIPB 3LKQA 4YSCA 2V2XB 2UWEB 3GBNH 1DVQA 3E7JA 4HJJL 3HG1D 5DVNA 1ETA1 1ZT4B 3E38A 2D8KA 3P30H 4WTZG 4LQ1A 4TNVK 3RWHB 1NBVH 3T08A 4HFWB 1R17A 5TPWH 3T1WA 5IFJB 2N0MA 3L45A 1GR7A 5CIPH 5GSRB 1RULL 4RAHA 3NSXA 5D1ZD 5GS2H 3C09B 5T8IA 5AVSB 4AQOA 3NABH 4XMWA 3PWNB 5KZCB 1DEEA 5EH1A 3SE8H 1A66A 1T1YA 1DSFL 3ULUL 1W15A 3WFEH 3UTZA 2B2XL 2DH2A 1INDH 4XWGL 4IBZA 2VC2B 5C0RH 4N0UA 3N40F 5KSBB 3Q01A 4F7CB 5DGQA 4NFDA 1KULA 2JXMB 1NPNA 4LEEA 1KJ2A 4PIBA 5F0MB 4P9MH 4XT1C 3VFGH 2X88A 1B4JH 4LDEB 1XGPB 4JRXD 2W59A 3AQDA 3D8MA 4L9LA 4NUQA 5EN3A 2ZF9A 1W80A 2VC2H 4G3YL 2WLNA 5C9JA 1R5IB 4PWKA 4R7XA 2C3VA 3MI6A 2IEPA 3E1ZA 4AQ1C 1RLBA 3MX0B 1FZOA 1F4XH 1IAOA 1WTGT 1F58L 1S8DB 4ODBD 2QPDB 3QXVA 1D5MA 2G75B 3QZWA 2NW2A 4OV5B 2NTSP 3DOIA 1AZUA 1XF1A 3DYMA 4RQQB 5E2UL 1FH2A 1T7YA 5DXWA 5DUBA 1OZUA 4PYHA 5I0VA 5DJ6B 3AU1A 1OARL 1YY8B 4U1SA 2ADGA 3AS1A 3BYYA 1KIRA 1M6OA 2F8OA 2IPTH 4J3OG 5CMAB 3UTPE 4ORGA 1NFIA 3V9FA 3BWSA 4HZLB 1MCRA 4Y1AE 1N68A 3DUSA 4OLUL 3DX0A 4BFFA 4M7JH 5E1AB 5CUSH 1C5BH 2FEDD 3CDZA 1UASA 2WC7A 2CDEA 3VA2C 3IXTA 3BH9B 4E0RA 5F7UA 2QELA 4OZHF 5A7BA 2WXLA 1ZSDA 4XAWL 4LPVA 4KKLC 3ZE1F 3GLDA 1G7MA 4N26A 1U8KA 4PJEE 3T6WA 5GGRY 5GRWA 4K94C 4ADGA 5E8PB 5I1HL 4OM0L 5DR5L 3IT8D 4ZFOB 4BFNA 1TYEB 2KC0A 4GQQA 3VXTB 4UOW0 4RIRA 5HHQB 3MA7A 2FX9L 5K1JA 2GTZA 1SUJA 4PRPD 1NC2D 2UY7A 3X12A 5GSVA 3WE6A 5I23A 4DUVA 2IV9A 3U6RB 1YO4A 2E86A 3NJVA 5TQ2H 5FKPB 2WWNA 1BZ9B 4RRPG 5EULV 3DRQB 4FL4C 5AZ2L 1DBJH 5F9OH 1AKJB 3D4YA 5EZOH 2OR7A 3CDGA 4LT7A 4TSCL 4D0CA 5IEKB 4LCYB 1G9NC 1VGKA 1KYAA 3S36L 1YY9C 3X14B 2DQEL 1IEAA 3VFOA 5J7CC 5A2JH 2DLEA 2Z35A 1EHNA 4GI8A 5KN5B 3G5VB 2X4QA 3R06A 4W9LC 4UIKL 4L4TD 3ARSA 3WKNA 3MR9A 4UQBA 3QUMA 1KTDB 3BPNB 3DIFB 2AGJL 3T4YA 1KEGH 5I0DA 1E2WA 1L7TH 3FDWA 5DTFB 3S0PA 3EJZD 3KLDA 3QHZH 1RHHB 2GJJA 1CFVH 4XXWC 2E6QA 4HHAB 1MJ8H 3VXUB 3CX2A 4OGXL 4OCLC 2CDGA 1IGCH 3INUL 3WL9B 4PYGA 1SF3A 1GC1C 3QI9A 4J28A 5E23A 2X7LA 1PMYA 5GRVL 4B9CA 5MENA 2AEPL 2OR9L 4NKIL 2FHBA 4U1KA 1I9RL 3OMZA 4I18C 4LNRB 32C2A 2CBMA 2Z31D 4KO6A 1IX2A 4FQHB 3KJ6H 5FIEA 4TM9A 4X4MA 2IVFC 4HIJA 1NFDB 5FOBA 3QEGH 1XR9B 1G7JB 3LAFA 4HOMA 4HAFA 5HXMA 3GSQB 4Z3FA 5IJVA 4NZTH 1SGKA 1N6QL 4OZFA 3QPXH 1SJEA 4QJ3B 3OV6A 4ZW6A 5D7EA 1PAZA 1UD6A 1JZFA 4P5MA 4PJIF 1VKXB 3EBHA 1GL4B 5D71H 4FFVD 3BQUC 4YH6A 1XCTB 1FUNA 2BNRB 4OD1H 2DKSA 3RIAF 1FA4A 3FUEA 4G1MA 4FQXD 5E56A 5GGTL 3STBA 4YO0A 4GXFA 4P2RA 3NJJA 3BE1H 3FB7B 3IJYB 4M6OL 5DI8A 4P5KA 1NIFA 2VISA 1OP3H 2YJQA 2NR6D 1V3KA 4JY4A 4UB0H 2LGNA 4XZ4A 4ZSOE 3BJLA 4NNXB 1F56A 1XZ0A 5E5LA 5IQ7H 3FTGA 4KK9D 2AHIA 1Z9SB 4LSSH 1WAAE 5AOIA 1FC2D 1UQSA 5BVJA 5IW1A 2IANA 3UGXA 4HJJH 1FZMB 2IAMA 5HYSA 1GA2A 1JRHI 4LCWD 4PRHA 4W4OC 3VI4E 2AI0L 1AGEA 1KPVB 1R3IL 3EFOA 1BVKA 1D5XA 3CD4A 4W1TA 1RULH 2R56L 1YDPB 3Q06A 3AS0A 4LVOC 3FQ2A 4OKDA 1CGWA 2W80C 3AXLA 2EYRB 3IDNA 4EEEA 1Y07A 4KRLB 4WKXA 2ZZUT 3C5ZA 2J88L 2F9BT 4Y4FC 2E27L 2CMRL 4XNXL 3ULUH 1WFTA 3NA9H 4EUPB 4PJFF 4HFUL 5I19L 4XWGH 2FJHA 1QFUL 2CUIA 4MD4B 4NQTA 1E4XL 4Y1TA 2CM5A 3MGTB 2KMWA 4K5PA 3WS3A 4MJJA 4A7GF 3KR3L 2G9HA 4ONFL 5IMMA 5DZOA 2H8PA 3LNHA 2I60L 5C0AE 3S5ZA 1R0AL 1I1RA 4EUPH 1YC7A 3QIWA 3HR5A 1JFQL 1LYQA 2DQIL 1RURL 1J0HA 1J12A 2EEBA 2HJFA 2JI2A 4G3YH 4M93B 1AZBA 4YHIA 5HYJD 2XQ0A 1XGQB 2R7EA 1G9NL 4X99B 1ZD6A 5LNDA 4Q4IA 1IL1A 4NUPA 4C56B 2ROXA 1F58H 4HCRL 2ERJC 4HJ0C 5FS5A 5GZOC 3VFSB 2JELL 5IUCA 1MI5B 2ZWSA 2MCAA 5F44A 5E6RB 4OGQC 4EUPG 4UANA 3HE7A 1S7RB 3LZPA 3OMNB 5E2UH 2OTUA 3K80A 1IKNC 3RWGA 2M83A 3CFJA 3P3YA 5DZPA 2AKRB 2F54E 4YK4C 2WXFA 3ELQA 3IMWA 5DJXA 3F7YB 3U36A 4ZX3A 1OARH 4X8JB 4Z7VB 1YEIH 3OLDA 2N7AA 3HS9A 1JYVA 3FUIA 1JDDA 2FZ3B 4N86A 2FYYA 4YMPA 3OZKA 4EI5D 2OXGB 2EACA 1FAKT 4LVNB 2H41A 4OLUH 4Y9FA 2ATKA 4JFED 2WTRB 5EBWA 1RH8A 4AJYV 4JFDE 3JWOC 2MWCA 1EO7A 4YFLI 3EXJA 4ANWA 2GB2A 5C0NC 4UM9A 1H6UA 4ZTEA 3QRFM 3BP6A 4XAWH 4LK4A 3I6GB 3W39B 5I1LA 3VXME 5FUCE 3MRLB 3BWUC 2X6BA 3T65B 4AYBA 1KY6A 3A4AA 5J3HD 3LN5A 3L4XA 2MSPA 1WC7B 5I1HH 4OM0H 3CFIC 5DR5H 1V54B 4JY6A 3PJNA 3V7AE 5FO2A 1OT2A 3QUZC 4NO3A 1LLAA 4OUOA 5DK2B 3QFJD 2FX9H 3FZUC 4K8RL 3QIUD 1NGQL 2VJXA 5T1LA 2C4XA 4DP4X 4MAYA 1AQ8A 3GSUA 1CDBA 3RNQB 4APQA 1ACXA 1VF5C 4CSZA 1NGPL 3NCFB 1EGJL 3A5VA 4IIQB 3EIFA 5AZ2H 3DMMB 1MWAL 1E7VA 3FCUB 2SODB 5JW5A 1KB9K 3ZTEA 1EXUA 4TSCH 3F2LA 3O3DA 4URTB 5F1NB 2DMBA 1LO3L 1NMAL 4FZEL 1OLLA 3S36H 2DQEH 3GMNB 4OZ4A 4JKLA 5HHPB 1EEQA 1N8ZA 4UIKH 4YVUA 1QPPA 8FABB 3ZYOA 4LHQB 1TZAA 2A6DA 4ELKA 2J57A 1YEFL 2AGJH 1V7NL 2VMDA 4JS7A 1N59B 2Z1KA 4QHKJ 5ES4B 3TO4D 5EPMA 5F96H 1FYTB 2IOOA 3CXDL 3FFCA 1I8UA 4OGXH 3V6OA 1V3MA 3WIFA 3INUH 3O3EB 4K7PY 5LGJA 2XV6B 5D1XB 2ESVA 2VUYA 1Z5LA 4WI0B 1YVLA 1U8QB 2AEPH 2OR9H 4NKIH 2LFEA 1COBA 4G7VL 1AHWA 2KZBA 2O5XL 1I9RH 2BVPA 2D0HA 1XVSA 2K6ZA 3S5LB 5KSVB 3MREB 2D31B 1F4YL 5FM5M 3NCMA 1A6ZB 4ZPVB 1U91A 1A21A 1KGIA 1NDGA 4PJXE 3MLZL 1YJDC 1PZBA 5TJWK 2FYVA 3T3MB 1N6QH 4R2GB 4U1LB 1JI2A 3ESPA 3WNMA 3QZOA 4BEIA 4KROB 1SFDA 5T5FL 5AB2A 3MV7B 1DQKA 4OCXL 5IVZA 2E3VA 3RDTC 3ARUA 4LHJB 4JFFD 1XF4A 3DSNB 4ZXBB 5F7AA 1URZA 1B2YA 2ZXEB 3W1ZA 4L29A 4A68A 5CILL 3PL6C 1HOEA 2OSLA 4M7LL 5GGTH 3G6JF 2CO3A 2ZKXA 5D7JC 5SWZD 1OCWL 1KGYE 2UX7A 3CHQA 4M6OH 1E8WA 4RESB 3MJGX 5IB2B 4P4RB 1TEFA 3S5LG 1WT5C 3OKLA 3SDXB 4PJAA 3VXRD 3LEVL 3D2TA 1QW9A 3D0AA 4F9LC 4N9OB 4ZMQA 3QNYA 2V5TA 5I15L 3HFML 4O02B 1OB1B 4W93A 1G7HA 4IBTA 3Q43A 2AJVL 3SCMC 2AI0H 1R3IH 3MRFB 2XN0A 1ED3B 3BUPA 4O51A 1RL1A 3IRCA 3OHXA 5G55A 4HJEA 2E0PA 4ZT1A 5GZNC 5ID0B 3DVGA 1XFPA 2R56H 1CDIA 4B41A 1KTRL 3VCLA 3KPOA 2NMSA 5F88B 4AZUA 3GUTB 3NG5A 3V9EA 1D5ZB 4HGMA 4I4WA 4J3XA 3ZGHA 4BZYA 4F8OA 1H6FA 3BRGC 4CMMB 2BC4A 3FOLA 2J88H 4MJ6B 2VMCA 4FXGC 3VJ6A 2E27H 2CMRH 4XNXH 4G7RB 4XMXA 3FQWA 4HW6A 5KVGE 2P42B 4HFUH 3WUWB 3ZJAA 1F11B 5I19H 1QFUH 3EF7A 4JN2B 3UBHA 1E4XH 4X9IA 1KJ2L 3ZL2A 4K2UL 4FADA 1SLUA 3KR3H 1II4E 3L4ZA 4MX7A 4ONFH 3PQYA 5AKRA 4AM0B 5KBNC 4TQPA 4OAWB 2Q7NA 4XTRC 2I60H 1H3UA 4K7FB 4FCAA 1R0AH 3QDGB 4I3SH 4A7QA 1E9QA 1JFQH 4ACPA 4AE0A 2DQIH 1RURH 3UACA 1XF5B 4F1SA 4DPBX 1KIQB 2A74A 4Z7QF 5EU4A 4P49A 4JO4L 3WNIA 2EDNA 4I5BB 4JPVL 5D1QD 1TJXA 1G9NH 2FR4A 4KTYA 3QJHB 3KL5A 5DRWA 3ATAA 4NUMA 4S0TD 3UBXI 3ZDWA 2VN5A 4HCRH 3BP7B 4LU5H 3IBEA 2JELH 3OPUA 1GGCL 2W1NA 4OFKA 4I2XB 3G6JA 4F33B 1CD9B 4YDMA 2CDFA 2R2BB 4MD5A 4PUBH 3FN0L 1NM4A 2BXZA 4H1LA 1AZRA 3F3HA 1JXGA 1TEGA 2E7DA 2C4FU 4HLZG 3X2QB 3ZYZA 1CFQB 2FBRA 2VERN 5FO7A 4HF5L 5KEZA 1XSIA 1CT8A 1XB6A 2P28B 3IAQA 5JXAL 3R19A 5ESVB 4QIRA 1DVTA 4O2CA 5I1CL 1DQJB 3KHOA 3L3HB 4GEJA 1ZHBB 2CKBL 1P5UB 3SDDC 3L4UA 5IHZA 1HE8A 1W16A 3IS0X 5H37A 3CH1A 2VQTA 5JPNB 4J3TA 1FL5A 3WY2A 1ZLWK 3L54A 4HHWA 4WI5A 4JKMA 1OTTC 3F6JA 1SLXA 1WWWX 3CFBA 1U92A 2Z7YA 3BP5B 3DROA 4WFEE 3TVMD 3H55A 4ZOBA 3TZVA 1MWAB 2VLJD 5D4JA 4K8RH 2JTYA 3Q2CA 1Z3GL 1INQB 1NGQH 2BRRL 3VFMB 3RY6C 3QWQB 3BYTA 4W6YB 4Z76A 2YC1B 1U3HD 4ALAC 3PWPA 4CNIA 4JPIA 1NGPH 3TLRA 1EGJH 3PG2A 1Y1DA 3EBGA 1LWHA 1MWAH 5F6HJ 1EO5A 3IU4L 4ZAKA 3GJFH 3TP4A 5IY5B 1LO3H 1NMAH 4FZEH 4I77L 1SMAA 2G2PA 1GGBL 2H9GB 5LBSA 5FA3B 1F1GA 1MHCA 2C3GA 3BKCL 5F0LB 1X6LA 3RGVA 7PAZA 1RFDL 3M17A 1UJ3B 5BZWA 5DQJA 4OI8A 1QHQA 1MDAA 1YEFH 4F92B 1V7NH 4NN5C 4NPKA 2VLKB 4O00A 1XTMA 1ZS8A 1N7ML 4XODA 4DTGL 2EC9U 3GSNL 2W95A 3BUDA 2ZUSA 1E4KC 3CXDH 5ESQB 1W72A 2ZUQB 5F72S 4W9CC 1N19A 2RTTA 3EFFA 4UWQB 3MRRA 3WNKA 1PLCA 5D7IF 5F0JB 4LKXB 1CFSA 2VJ8A 2XLLA 1CUOA 1MCWW 4LEOB 1FG2A 1RJLB 3MJ7A 4G7VH 2O5XH 3WY3A 4OZGE 5IR1A 5ICXB 1HH6B 4IK7A 1F4YH 3PWVB 2DWXA 4XO8A 2ZUVA 5I2IB 2R1XB 1KYUA 4XBEL 4M7LT 3MLZH 4N8VB 5JOFA 3WCYA 2CNZA 4XZUA 2AERT 1XXDC 1H9VA 2YFNA 5KOVC 2EP6A 5K5YA 3RZCB 5T5FH 5E0FA 3RTQD 4OCXH 2XBTA 4MXVE 5GRZA 2DDQL 3AT9A 2WWMC 1F42A 4E9RA 3TURA 4GUOA 2P5WA 5BS0A 2YAOA 5AB1A 3LKQB 1F4HA 4M7LH 4YK4B 1OCWH 3B7RL 1GYAA 1SMOA 1OCZB 4ZW5A 2YK1L 1O7DE 3ETBF 3PGFL 1K2DA 4ZDHA 1PD6A 3WFCL 4MMZC 4LHUA 5I9QC 4RA0C 4LLUA 4N8VG 1ZSHA 3O8XA 2PCXA 4G8IA 3WEBA 4DP8X 1NGYB 2KPNA 3MXVL 1A1NA 1JZGA 3HFMH 3Q2VA 4MWFA 8PAZA 5I15H 4BZ1L 1JG9A 1DEEB 2AJVH 1T1YB 4F8LA 5B7FA 2Q76A 1LL1A 3UTZB 3CGTA 1RIVL 3SPJA 2Q1EA 4LIQL 2N1KA 3ULUF 3DJSA 1U8NB 4L37B 3N0PB 3C6LD 2HRGA 4N0UB 1QOKA 4H44C 1NEPA 4N8CL 5C0CA 3AT0A 4CSSA 1KJ2B 4PBWD 1TMQA 2P5EA 4QHUA 5DVLA 1ZK9A 5F97E 4WW1A 1WZ1L 5E4EB 5BOZG 1T22B 1VSCA 3BPCA 5C71A 1NBYA 3WTTA 3EJSA 5C9JB 1EERB 4R26L 2EQDA 2X4PB 3HC3L 4LXFA 4AZ8B 1KJ2H 4QRSA 5ADPL 4JDZA 4K2UH 1FZOB 2XRAL 1IAOB 3AADB 3G08B 1TTBA 2OR8A 2NY3D 3WO3B 4X7FC 3T5WA 1XAUA 1D5MB 1MVFA 3QZWB 1J8HE 3QG7L 1L0PA 3GSVA 2YRPA 4OBSA 1FVCA 1JTPA 2ZG1A 1ZVSA 5DUBB 4UQIM 1WD9A 2AK4A 2H5UA 4JO4H 4XX5A 5T1KA 4FQ2L 1JE6A 4JPVH 5AEAA 5C6WH 3AU1B 4OBRA 5DWPA 3VAEA 4NM8L 4U1SB 2ADGB 5DURD 2Y6SC 4U1GC 1M6OB 5KAQF 2CK0L 3EJRA 5EEUA 4ORGB 1NFIB 2NQDA 4P2QD 5KVFE 3RBGA 1BAGA 1GGCH 2NY1C 4M3JA 4KRPB 4F93B 2QQNL 3DUSB 4PRIE 1FHNA 1FZKA 1OGAA 4L8SC 3WOVA 3DXAB 4XNDA 4DP6X 2OL3L 3CDZB 4GQPH 3FN0H 4OCSL 4FGMA 4KI5E 1Q94A 2CDEB 2WNGA 3GLAA 2DWEA 1CVRA 2CKBB 4L4VA 5D7LE 4E0RB 4TF4A 3RJOA 4QGTA 3NBNA 3GBEA 4HF5H 3HUJA 4NHUA 3UADA 5JXAH 4MXQC 4P46C 3QZWG 1DVFC 1G7MB 3VG0L 1U8KB 4PJ8D 3T0XA 3QULA 4H8PA 2GBAA 1QI3A 4AT6A 5I1CH 3WEOA 3NJIA 5GHWL 1R1CA 3MA7B 2CKBH 3TEXA 4Y16D 2ZONA 4W6XB 5HHOD 3TN0D 1SJXA 3FPXA 1ND0B 3KPQA 4DEPC 1OXYA 3WN5A 5ICYA 1PTZA 1U3ZA 2JJSA 2UY7B 3X12B 2VR6A 5GSVB 3GINA 3WE6B 2AXFA 3AWGA 3DJRA 4UOW1 4YZWA 5F7EL 3IMBA 5KUMA 3JWNE 3BAWA 1PZSA 1JYWA 3N0AA 4L05A 5B1CA 4YBLB 3CZKA 1GTNA 2WZPA 4BQCA 3ESOA 3CDGB 3RIFK 4D0CB 1N12A 2CGRL 1Z3GH 1VGKB 2BRRH 2F53E 3EYQD 1IEAB 3VFOB 2Z35B 2G9KA 4ZMAT 2Q3ZA 5IQOA 2D9CA 2PKDA 5JUEL 5CFHA 2EDKA 3R06B 5LG1A 5EUOB 4ZMPA 3IDMA 3MR9B 4GP8B 3QUMB 4GFTB 4G8GA 3SE3A 2Y2YA 3T4YB 2B20A 3IU4H 1B2WL 3ML8A 4U31A 5LN4A 4LOUD 5FYKL 2XQYK 1G7IA 2WV3A 2NNAA 3SPHA 4YSRA 1S9WA 1F5WA 2L7UA 5EU6D 1GGBH 4ZZKA 2BVYA 2CDGB 2X10A 2AJYL 3BKCH 3VFRA 4YSPA 3WKYA 3K4AA 3ZHDA 3DSFL 1RFDH 1JXKA 4A04A 1UXWA 3QI9B 1JZHA 4I88A 1S7VA 5MENB 2Q20A 5F1OB 2EDYA 3MTXA 1U58A 3SE6A 4GXUM 4O4YL 4FXGB 2GVYA 4U1KB 4WCYL 3ULVH 4IRSD 3SGKA 1N7MH 2VJ0A 4DTGH 3GSNH 3NSCA 2IGLA 3V0WL 5FOBB 2MNUA 4IBWA 1CBJA 1UWGL 1DE4A 5CEZE 3TO2A 5IJVB 3JZYA 3CC5B 5INCA 4OZFB 4WO0A 1SJEB 3B9EA 5IQMA 2ZXGA 2DJ4A 2WMPA 4YDVA 3W0WA 3BDYL 3SD2A 4P5MB 3ZHKA 3WELA 3ESNA 2XTLA 3VQ1C 4HCGA 3QUYC 4NP9A 4N9GA 3QPQC 4FNTA 3MZGB 3MFGB 2WINA 4ZRGA 3U9PL 2EDFA 4XBEH 4OZFH 4G1MB 1SDAB 2FEEL 1WFUA 5D2NC 1WZLA 3NZUA 4LRNL 1U8CA 4JB9L 4YO0B 4AVIA 4P2RB 4W9IC 3B2XA 4CUCA 2E4FA 4P5KB 4HKXA 2IQAA 1EBAA 1WJ3A 5JHDD 2WQXA 2M26A 4JY4B 2R69A 2DDQH 1XZ0B 2NLJA 3FTGB 5BVJB 1UQSB 2IGFL 5IW1B 2IANB 3QNZA 5DK0A 2OMWA 3V5DA 1JGLL 2IAMB 4L9DA 3GJEA 5HYSB 1HHGB 5FW6A 4LSVL 4PRHB 1I3UA 2DTML 1AGEB 2YK1H 3B7SA 1BFOB 3SKNB 3EFOB 3RWEA 1BVKB 5K69A 1D5XB 5ADOL 3PGFH 4G82A 1JK9B 1OQXA 3WFCH 1MQ8A 3PAVA 2WCPA 1KBKA 4BKTC 1UKQA 4U3CA 1BVNT 1KY7A 2GJ6E 3AXLB 3IDNB 3MXVH 3FO0L 4GI6A 3C5ZB 4BZ1H 1OHZA 4NZDA 4A67A 4OGAD 1RIVH 2FJSA 4LIQH 1P0SE 1KBBA 2FJHB 3ZKQD 2BSEA 3SEPA 4TRPL 4P23A 3VFPA 1TTUA 1X5KA 3WS3B 4BM7A 4N8CH 2G9HB 5IMMB 2XJLA 5HYSG 5FWRA 5GGVY 1LE9A 1WZ1H 4HK0A 3SN6N 5DZAA 5F7DA 3QIWB 3HR5B 4YGVA 1JPST 4G9FE 2YD9A 4EI6A 1WGOA 3LZLA 1PZDA 2HP4A 3DI2B 4R26H 1VJSA 2OPCA 1MCEA 4YHIB 2CHNA 2J8HA 4LPCA 4Y9BA 3VUAA 3HC3H 2IH1A 1GGYA 4PJ5E 3VFTA 1HAWA 5ADPH 2R7EB 4E5XA 4OQ1A 4FXLA 1WFOA 5ANMA 1IL1B 2XRAH 3HG1E 4BK8A 5GS2D 3SKMA 5BUGA 1B4LA 3QG7H 4ZUWA 3LD8B 4ZJ9A 4A38A 4UQ2A 1OTUD 3HE7B 4L0PB 2OTUB 1E42A 2O6CA 3RWGB 3CFJB 3KG5A 1BAFL 3BZ4A 4NN5B 4FQ2H 5DJXB 3U36B 1PIFA 2OL3B 4K5MA 4HUMB 4NM8H 1KCSL 3QWOB 4U6HA 2BSTA 3VG9C 5L0QC 5KZCD 2CK0H 3CBRA 4M1CD 5IJDC 2FYYB 2V3FA 5CF3A 1SOQA 3O41A 1F6LL 3P0YL 1HC1A 2EUXA 2CO6A 2QQNH 2YMOA 4NCC2 1X7TA 2ATKB 3QXAA 2OL3H 4OCSH 4WSGA 2CM6A 1M7IA 2W88A 2X1QA 4U1MA 2IBZY 1GGUA 2ZXDA 1EV2E 3FUJA 3KPPA 4UM9B 3BP6B 4XOEA 2RR3A 1KZYA 3CN1A 4JRXE 5IROA 4PJ9A 5I1LB 2BX5A 3VG0H 4IOSD 3NCEB 1MJ7L 2WZAA 2JIXA 3LN5B 5F21B 5DDHA 5B8CC 3ABMB 4JY6B 4JRWA 4NO3B 5GHWH 5FYJU 2EDOA 1TZOA 2ZWKA 3ZMRA 2HT4D 4QOKB 3VD7A 4MMXC 3UXFA 1IBYA 5T1LB 3E2HC 3QIBD 4MAYB 4PJBE 3GSUB 2F7OA 4RISL 3ZT5A 5F7EH 4APQB 5LGYA 1BFSA 1WG3A 2NZIA 4X9GA 1RUKL 3SOTA 3CXFA 4U4IA 1CYGA 4Q97A 3D0LA 2YAPA 2VW7A 4UV7L 3Q1EA 5KBDA 4XB3A 3VACA 3W82A 2VAJA 1ZJAA 2WBWB 1JZ8A 3O3DB 2VRKA 3OZLA 1FNHA 2CGRH 3HR6A 1LO2H 2ZUWA 5FECA 1XB3A 1BSIA 1Z9OA 2YRLA 3BO8A 3LHPL 4E9LA 9CGTA 4OZ4B 35C8L 5JUEH 1N8ZB 1ZDSA 4NZRH 2FX8L 3BJ91 3OAYK 2A6DB 2UXFA 3VGAC 4ELKB 1JZ6A 3NRQA 4IEFB 1SXSA 2WO4A 2J5WA 5FYKH 4ATTA 5LBSL 2XN1A 3ILQC 5EPMB 4MQSB 1OGSA 4AKQA 2AJZA 5HYIA 3FFCB 3FTUA 2AJYH 3UOAB 1GCFA 3X11A 3ZIYA 3DSFH 5LGJB 4XMVA 2ESVB 2GUYA 2WKOF 3FU5A 4UIMA 1Z5LB 5DD3L 4EAEA 1L9NA 5MERA 4IRZL 4A7TA 4GAGL 2QMJA 3E6HA 1QSZA 4O4YH 4WCYH 4PRPE 1AHWB 3OQRA 3WMQA 2FT8A 5D6CA 2EXYD 3AU0A 3QHTC 5JIKA 1NIBA 1W72L 1GYWA 5AZUA 3M1CA 3V0WH 2JLPA 4LAJH 1NDGB 4NBZB 3Q2WA 1UWGH 3S37X 2IPUG 4DP1X 2NW3A 3WUZA 4MDRA 1DQVA 2WLZA 1AKJD 2XNAA 4JG5A 4WZ9A 5JOPE 3BDYH 4PVNA 4G5ZL 5DC4B 2VMEA 1MLBA 3K81A 3QBTB 5IVZB 2MMXA 4XN9A 1SJMA 3NUKA 5FR3A 3AXHA 5E6IA 4L29B 1Z9MA 5IBUB 1P4BL 4WKZA 1H3VA 2OSLB 4L4TE 2DQGL 1ET8A 1GY2A 3U9PH 4KJWC 2HSIA 4LRNH 3SYPA 4JB9H 1JCVA 4DETA 2YAEA 3OGCA 3VQMA 2X9ZA 4Q9CA 1E3FA 1T7XA 2XIIA 4X8CA 4WI3A 4XO5A 5HGAA 3AUVA 2VXQA 2G5BA 3VXUD 4PJAB 4FAAB 5IHUL 1BOYA 5FHBL 5F7BA 2VSKB 1SOSA 4TUUA 2BPBA 3KGUA 3IJEA 1ETZA 2FD6L 2YUWA 2IGFH 3RVUD 3P73A 3QNYB 5C0DA 5JQIB 2WNXA 4KX9A 3REWA 1JGLH 1G7HB 5I0WA 2X1PA 1K3ZA 4LSVH 3GXMA 1BG9A 4R0LA 2DTMH 3O2WL 3JYBA 1E2ZA 5ADOH 3ECQA 3SKUD 1DBML 1IGTA 3GS7A 1WS7A 1AIFA 5IBUG 4PGCB 3D2UA 3EH3B 1CI5A 2P1YA 3TBSA 2DQUL 4LCVA 2EH7L 4I4WB 1TJGL 3FO0H 1KXVC 4FTDA 2WVTA 2BC4B 2I7SA 3FOLB 5IVXF 1NANH 3VJ6B 4WW2C 3BWUF 5JW4R 5E5UB 2A6IA 4HZ1A 5FUCC 3FQWB 4WU5B 3MRMA 4KXZH 2R2EA 4MVBC 2BNRD 4G6AC 4TRPH 1QTYT 5EO0B 3SYOA 3K1KC 3G04A 2PWDA 3RVTD 4LZKA 2Y69B 4NNYA 3IPEA 3GIZL 1VEPA 1ITBB 4GB9A 4BYHA 3B4NA 1D9KC 3BVNA 1E9QB 2JQMA 2Y1AA 4HC1A 4X7TA 4ZO7A 4LESA 4NHCL 1KBPA 1KELL 4S1RL 4HSCX 2D3NA 5EU7C 5EU4B 2V7HA 1OTSD 1S7QA 1YPZA 3HI1A 3CMOL 3OLGA 4NO0A 1A6VL 5IBLD 2FR4B 1IIKA 5DRWB 1ZLEA 2NDFA 1XF2A 3VXQB 3AWFA 4M61A 3BDBA 5DS1A 2VDPB 4QHMA 5C07A 4NKQB 1TITA 2XSKA 4FLHA 2OMYA 2CDFB 3NJGA 4MD5B 1BAFH 4H1LB 2ADYA 3TU6A 2LE9A 5J06A 3E8UL 5KS9E 3BH8B 1KCSH 1AO7E 3KBEA 1AE6L 5FO7B 2CO2A 4LCCA 1CT8B 1GAFL 3HE6A 4M1DL 3HLKA 1L9QA 2DQDL 1SVZA 1IKNA 3V52L 3X3FL 1BQSA 4WHTA 3P0YH 3TBTA 4O2CB 3NCYP 3KPSA 4QRTA 4H1LH 3ZE0F 3NGBB 4Z6AT 5IHZB 4Y19A 1SDDB 3CFKA 4FEIA 2XIBA 3CH1B 4WHYH 4P2OC 1FL5B 4BHUI 2JCCE 1HQ4A 3MUY1 4KI1A 2WQRA 4P99A 2Q86A 1UM4L 4WI6A 2BSDA 2ZICA 3OX8B 3CAFA 1MJ7H 5I8CA 3CFBB 1U92B 2JWYA 5HYJE 5KJ7E 3DROB 3L2NA 4RGMC 3MRCB 3X17A 3WLWD 3TZVB 3L5JA 3QUKA 4HHGA 2WGNB 1PGRB 2HKAA 4H1LG 4A2EA 2J4WL 4C56D 4Y7OC 5G4OA 2ZUUA 4Z76B 12E8L 1HJCA 3N9GH 4RISH 5IB3A 3OJDA 5ERWA 5FW7A 1MI5D 3PWPB 2Y1YA 4CNIB 4JPIB 4J7RA 4DGYL 4QYOA 2YQGA 1OVZA 4ZMLA 1RUKH 5D96C 4PH8A 5DYFA 4LSTL 5B39A 1TU2A 5HDBB 4WNQA 4UV7H 3D4GA 5E9NA 3TX4A 4LDOB 4CGUB 4P05A 2L7JA 4NPJA 4DT2A 3QQ9C 5H37G 3V2AR 3IPFA 4X4KA 3LHPH 1N0XL 2W92A 3EJTA 4Q8BA 3SBRA 4WWOA 1MHCB 35C8H 3RGVB 2KZ1B 3AM8A 2FX8H 3M17B 1D3CA 2XX1A 4NAJA 2HB0A 1IC5L 2Y7NA 4JFEE 5DQJB 5BZWB 4ONOA 3WV0A 1DLHA 2PCYA 3BGMA 2X2UA 2ZOWA 3D09A 3N41B 3QRBA 5FO9A 5GS0D 3GQFA 3QEQE 4U3SA 4UU9A 3L08A 2GJZB 1ZS8B 3VGEA 3ABKB 5LBSH 2Z64C 4Z7AA 4XO4A 4HWEL 2CO4A 3WENA 1EEUA 1W72B 1KB9J 3CLWA 4N25A 1KCUL 4LLYA 3EFFB 3O2VL 3MRRB 1QFHA 5DD3H 3DJTA 3MHZA 3KLQA 4HJUA 3QFJE 4IRZH 4GAGH 3U4BL 1CFSB 4GQRA 3ZE2E 2VRAA 5AVTB 1NUGA 3MJ7B 4MAUL 3RHWK 1RSFA 1QI5A 1K4DA 5IR1B 1IILE 3AG2B 4XNAA 3C2AL 4AJWA 1KSRA 3QJSB 1EHAA 5D7KD 1W72H 2O93L 2WZ0A 4IOFD 1IGYA 1ROCA 4GAFB 3WGUB 3GUFA 1U33A 3T0DA 1MQKL 3DMMD 3NFPA 1LTXA 4XZUB 2HTLD 2QFPA 1G1CA 2BXYA 4G5ZH 1UT2A 2E46A 2W81C 5BOPA 5HGDA 5IJKC 2P49B 4XXCA 1BVOA 4BXSV 3QCVL 2P5WB 3TNNA 4HWUA 4BGDA 4PS8A 5BS0B 2COVD 1P4BH 3HNSL 2O6FA 4X6DF 1OP5K 2DQGH 3UDWA 3VI3F 1V7ML 5AW5B 1U8JA 4N3UA 4Q6IC 2FGWL 4LP5A 3TBYA 2XXFA 3ARVA 4XNMA 4KK8D 4O2EB 2AAVA 2WYIA 4NKMA 1K2DB 2V5YA 3FBKA 4ZDHB 5C0BA 4LHUB 1FYTD 5IHUH 1IZJA 5FHBH 2JKLA 5D7JA 3O8XB 3MRBA 4G8IB 4FABL 2FD6H 5D1XD 5A6IA 4MWFB 3EXLA 3U82B 3WY4A 3H9SA 1KT2B 3UBFA 3L5IA 2DM4A 4ELMA 2O5NA 1UFGA 2Q76B 2PTTB 4OFYD 2EXSA 5MI0B 4E2OA 1TXKA 1DBMH 3BISA 3D87B 1HNYA 4HUVA 2XTJC 4HP5A 5C0CB 3GLZA 4N5EC 4R2GD 5KYUA 3VRIA 2DQUH 2A5UA 2NNFA 2EH7H 1K85A 1TJGH 3SQRA 1SXZA 4KROD 5CGTA 3BHBA 3L4WA 3MV7D 3BPCB 4M6AA 4WSKA 3ZU8A 1NBYB 5AB0A 1IVTA 1KLFA 1X5JA 4BIKA 4JFFE 1M3IA 4ZXBD 2ALWA 4LHUG 5CN1A 3J8F7 2XPGA 4QRSB 2ZKYA 3EYFA 4JDZB 4KKBD 4J3UA 3STZA 3D51A 5SWZE 1KJVA 3GIZH 4UZUA 5F7WC 3WY1A 2P4AB 2ZWYA 1IMHC 3GSVB 3FQNA 4NHCH 1FVCB 4PJ7F 3S6CA 1KELH 1VZGA 4S1RH 3D08A 4L1HA 4EN3A 1E0OB 1ZVSB 1SHXA 3ZDYB 4G9DA 1ET5A 1JWMA 2AK4B 3BSHA 3EJCA 3NK4A 3F12A 4X4ZA 5T1KB 3RUGA 2DIAA 3FT2B 3CMOH 3OXSA 2VABA 4EIZC 1A6VH 1QFPA 4DFHA 2OULB 4L3FA 4DPRA 4MD0A 1TJHL 1Z5YD 4LPTA 1L7IL 1JTOA 2ZKMX 3G9VA 4V2BA 5GGRB 3O6FC 1FZKB 3OKYA 3QWRD 1KIPA 2FT6A 2WTOA 1Q94B 4L4VB 2DWEB 4IS6A 3E8UH 2B77A 3ZKMD 3CVDA 3E8VA 1AE6H 1DVSA 3NIDB 2V4LA 1GAFH 2AXGA 3HUJB 4M1DH 1XV8A 4NHUB 5EEZA 1GZPA 2DQDH 3V52H 4LNVA 3QULB 4X7DC 3X3FH 1B3JA 1HDMB 3TC9A 4AT6B 4YDNA 4PV1C 4ZK8A 1SBBA 4QEGA 4F7TA 3D4CA 3KPQB 5JMOC 2HT2C 4EZJA 3WN5B 5GS1C 1B4RA 3N1MC 4GSXA 3V4UL 1KBWA 3PGDA 1NFKA 3NIGF 4U6YA 1THCA 4YZFF 1JZEA 2AXFB 3QDGD 3SDCC 4S1DD 5DGRA 5A1AA 1UM4H 4ENEC 1EANA 4N8UA 4FOMA 2X0UA 3SDDA 1FFNA 1HWWA 1LGVA 4XX1G 1OHQA 5D1QE 1LEGA 2J4WH 4GAAA 3U25A 1VADA 12E8H 3US1A 5ANHA 2HJKA 4PHZA 2UX6A 2CPUA 2J8UA 4DGYH 4Y4HA 5D2LE 2WJ5A 1DQIA 2YHGA 3IDMB 4LSTH 1D7FA 4G8GB 1QO3A 2B4CC 2YZ1A 2WCSA 4NQCA 3F01A 1F02I 2BMKB 3FYEB 4PY8J 4XCYA 3WAKA 4EVNA 2VL5A 1L5GA 5ECGA 1G7IB 5KSAA 2NNAB 1S9WB 1N0XH 2CR3A 2Z8VC 4V33A 5AAMA 4BH8A 3VFRB 4FTVE 5I8OL 2GI0A 3H7LA 4K7PL 1TTGA 2IXQA 3L9RA 1UXWB 3AVEA 5IFHL 1IC5H 4RGNB 1S7VB 3B2VL 1V8HA 5I66A 3O81A 1PX8A 3FSWA 3EG9A 1AGBA 3BDXA 3IFOA 2P8MA 1BV8A 3ETTA 2F68X 4OJFL 1JSYA 4K8RD 3PNWA 2ZOOA 1F4AA 1ULVA 3RNKA 1MG3C 2APSA 4WNJA 5HI5C 3TEWA 3DVIA 4IMLA 1DE4B 3TO2B 1KCUH 3LIZL 5INCB 3O2VH 4H8QA 1CLVA 3VXSA 2WMPB 4YDVB 3U4BH 3OVUB 3RVWC 1RJYA 1YNTA 3UL4A 2FO1A 1PFCA 4MAUH 5ELIA 4U05A 2MQ3A 2O5ZL 3C2AH 4N9GB 4X6CF 1HINL 4XNZC 4N2MA 1Q9KA 2ORBL 1BBJA 2WINB 4QLRA 4ZNEE 5L2KA 4Q9RL 3L7EA 4LGSB 3PAZA 1MQKH 1U8CB 1JZDC 3IFNL 2Y5QA 3D0VA 1TQCB 3NPZB 2W07B 1QSFE 4JKNA 5KAQG 4QYAA 4WEBL 2H1PL 4HKXB 2IQAB 4OZHE 3C9NA 3UAJA 3DRTA 4YHZL 2FWLB 1QR1A 3FCSA 2NLJB 3QCVH 3BKJL 3HNSH 4Z3TA 3W81A 2ZOUA 3BT2L 1V7MH 3QNZB 5DK0B 3T6QC 2FGWH 3V5DB 2HG5A 1BJ1H 3GJEB 1G84A 2ZAGA 3LCYA 2VLKD 2QSQA 2VXQL 3AROA 4Y2LA 4YHPA 3RWEB 3WNJA 2AMGA 1XCQA 1XSOA 4IHOA 5GJTL 3VGDA 3ALXA 5EEVA 4F15B 2WGXA 3UZQB 2HTKC 4OY9A 1B0GA 3NSJA 4FABH 4PGDA 5ALBL 1R5WA 1DDTA 1HI6A 1MFUA 3QQ4B 2AZUA 4KI5C 4YBQC 4P2OB 3OXRA 1EWHA 4WFHD 5CCGE 2HKHL 1L0QA 1MF2L 4MS8C 2FH8A 4JZJC 4PJHA 1UZ6E 4OCWL 4OFIA 3ZYJA 1IC7L 2BIIA 2NOYA 4MHHG 4P23B 3U7YL 3KBFA 3EGSB 3IRPX 3FU7A 1LE9B 4HK0B 4Q56A 5F7DB 5SWSA 3RZCD 2FCBA 1MIEL 3MUJA 4YGVB 2ADIA 4EI6B 2EVIA 3JWNC 5D5MF 1TG8A 1BD2A 4DNLA 3V5HA 2AXHA 1MFCL 3C60A 2X4OA 5IOPA 3KE0A 2D73A 2IH1B 3OF6A 1OM3L 3KJ4B 1J9TA 4E5XB 1BCIA 2VAAA 5ANMB 1X5IA 3H4HA 4NT6A 4P57A 3SKMB 3QB7C 5FC9A 3DKHA 1E7UA 4JRYA 3E80A 4UQ2B 4UM8A 4AE1A 2B4CL 4IMKC 3B2PA 3BOVA 3IE9A 4PLKD 2AEOA 3BZ4B 4KKZA 4W9ZA 1WZKA 3BLPX 4HLEA 5HYFA 1MH5A 1W2KT 3QSKB 1J1XL 1IFGA 1G7PA 1MCLA 3AW5A 4U6HB 2APXA 2BSTB 3ETSA 4R7LA 3T0AA 3ARZA 2PO6A 3LKSA 4ADIA 1TJHH 1GW6A 1L7IH 1FNGA 1MG2C 1E5CA 3O41B 3NJMA 4QF1A 2CO6B 3VYNA 3HZYA 4BFIB 2DEYX 3QUZD 3QXAB 4U1MB 1M7IB 3O4LA 4K55A 5CZXC 2D7OA 4PREA 4E5XG 4X9FA 3KPPB 4C59B 2VO5A 5EC1A 3MV11 4PJ9B 1HH9A 2P47B 3RY4A 4LKCA 2XWRA 1C5DA 2JIXB 4F37F 5DDHB 2RACA 1N8OE 3VM5A 3D3VA 1ILUA 1K5WA 2BJML 2CA4A 2QVTA 2IWEA 5D7SL 3ZW3A 4U7KA 2K7PA 2OMBA 3T3PF 2CA3A 1UENA 3NCCB 3V4UH 1IQWL 1R3HA 3MNZA 1AZVA 3V6ZA 3SDAC 4GINA 4X5QA 3SGDH 1A5FL 5EIVA 3I84A 4XNUL 1GPOL 3DO3A 1JNNL 1UKSA 4Q6IB 1QEXA 3D0LB 4EE2A 4YX2L 4BUGA 1X7QA 1DZBA 5FECB 2AVGA 4W9KC 4UNUA 3BO8B 3HZMA 4P2QE 1I8IA 1M2VA 4PJFE 4CN1A 4KRPD 4ESKA 4FHJA 1TF4A 2BOCA 4LOEA 5CINL 3DXAD 3DO4A 3CZNA 1WWCA 1O5DT 2F7PA 1A4JA 1RY7B 2XQYA 3NPSB 4PFEA 1TQBB 1AGFA 5EF0A 2AJZB 4DQOL 1PCSA 3K5RA 3P2DA 4F27A 3Q13A 5I8OH 3X11B 4K7PH 5BZZA 3ZR5A 1FG9C 5DFVC 3MBWA 5MERB 4OCRL 4Z1PA 4UIMB 5IFHH 2WQUA 4LP8A 3W11D 3B2VH 4MLSA 5JYLA 3E6HB 4AMKL 3KCWA 1XAKA 4FCHA 4OJFH 1UYWL 2X40A 2HFEA 5D6CB 2W91A 2QKSA 3RDTD 3ROLA 1JGEA 2ZX9A 2R9HD 4PJEF 2YD6A 1R3LA 5K39B 2E56A 5E1QA 5IREA 3LIZH 3MRNB 3CPUA 4ZFGL 4HJSA 3B83A 2JNZA 2XNAB 1U8LA 5B22A 1KTLA 1ZIBA 2GSMB 4HWNA 1MLBB 3LIUA 2A0LC 2XKSA 1RCYA 4Z7OB 2O5ZH 4B96A 1HINH 3GKZA 2BP3A 2ORBH 5E6IB 3WFHA 4WKZB 3PPEA 2ICES 4Q9RH 1FFOA 3MRKA 1QHOA 3WFZA 4JGMA 4K9JA 4AWJC 3IFNH 4LLWA 1KCBA 3OGCB 5E9DB 2XA8L 3CBKB 4BSWA 4Q4EA 4XP5L 2Q5BA 4WEBH 2H1PH 3SBPA 4DP5X 1QP1A 5GJSL 4BZ2A 5HGAB 4ZMVA 4YHZH 3X1EA 3ULVD 2G5BB 3KVDD 1HHKA 1EZLA 4XHJD 2WVVB 4OF8A 2VB5A 3BKJH 3IJEB 1ETZB 4DHLA 3BT2H 4OTXL 3P73B 3QI9D 3L5HA 5D1ZC 5FKAA 5C0DB 2HMIC 2BSRA 2OJEA 3REWB 4NC2B 3ZKXC 5MEND 3QQNA 3KHQA 2VXQH 4I8DA 3V0AC 1JUFB 2WXGA 3ZZQA 2CXKA 5GJTH 1IGTB 1AIFB 5EBMA 3MJWA 3FSAA 3V4PA 4ZS6D 2K7QA 5IW6A 1YNKL 3AS2A 3D2UB 1SLWA 5ALBH 3P4NA 3NIFE 3QAZB 3TBSB 2WQSA 5MP6L 3GS0A 2EZ0D 2HKHH 2VDLL 4QCIA 1RVFL 2J1KA 1MF2H 4Y1AA 4IKLA 3DARA 1PCXA 1TETL 2ITDA 4OCWH 5E8EA 3MRMB 4FYSA 2R2EB 3F7QA 2LU3A 4U1HA 1IC7H 4C58B 3EJYC 3G04B 3U7YH 3ECUA 4A6YA 4ZZFA 4EXKA 4P2RD 1HVXA 4RSYA 2HLFD 2IDQA 2B3RA 5BMFL 1DJGA 1GW0A 1RV6X 3BVNB 3FAWA 4L5FE 4X7TB 1MIEH 1P53A 4GI9A 1IE5A 1MW1A 1O6SA 2P26A 2K4WA 2GITA 4FLQA 1MFCH 2V7HB 1YPZB 3HI1B 2MFNA 1PS3A 1OM3H 4NO0B 1KGUA 2IAND 1U2YA 1YEWA 2PWHA 3LX9A 1FFPA 2IAMD 1SEBA 5CJBA 4LEXL 3T0EE 2Z34A 3JBG7 5A2FA 5C2UB 1XF2B 1XSKA 4PRHD 4M61B 4OV6F 2A4ZA 4MNHB 2K45A 3FMGL 3GIVA 4EJ1C 2QL1A 4QHMB 5C07B 4N2GA 3HG5A 3V10A 2B4CH 1WAAF 3IJ7A 1AMYA 3U9WA 1N26A 1NWOA 4LLAA 2FEDC 1K8DA 2KZWA 1RPUA 1J1XH 5LXVA 3KYMB 4Y5YA 2WWOA 3C5ZD 4LCCB 4LRIC 4RZCA 4UI2A 3VI4F 1XGRA 1VCBC 4N0YL 4YEEA 3BIAX 1BZ8A 3MFFA 4OJEH 4WHTB 3TBTB 1MCPL 3T2OA 3KPSB 4N1HB 3IN2A 1U2HA 1NIEA 4Y19B 1T0MA 3CFKB 4QAMB 2H2SD 3CFDA 3P0VL 1D5RA 1I53A 4KDVA 1S7UA 1SHSA 2HKFL 1HQ4B 2Q86B 4AQAA 3QIWD 4B7IA 1PY9A 4N2EA 3IU3A 2VZUA 3FF7A 5HDRA 3ZDXB 4Z7UE 1GS6X 2ZKHL 1F2XK 3GYRA 3UFIA 4C47A 2BJMH 1A3QA 5D7SH 3OAZK 5FFLA 1VESA 1NKGA 3QUKB 1DQQA 4KY2A 2HH0L 4WWPA 3ZT6A 1Z9PA 2M1KA 1IQWH 5FDYA 4RETB 2C4FT 3DHUA 5IB3B 1A5FH 1XGUB 3OJDB 5ERWB 1E5ZA 4XNUH 3W9EB 1GPOH 4QYOB 4F7PA 2FGZA 3HE7D 4QXVA 2OMVA 4ZPTA 5B39B 1JNNH 4PG9A 1ODUA 1F1AA 1TU2B 4WNQB 3VNZA 1QI4A 4ZBJA 2WLHA 3DC0A 2G3NA 2R1YA 4YX2H 3X3GL 4N2KA 1JNHA 2AC0A 2RB8A 3DURA 1ONQA 4JZNA 3SPCA 3PY9A 4ZMNA 4CW1A 1JV2A 4JE4B 2VDKB 1G6RA 4IDJL 4I9WD 5CINH 5I71B 1DLHB 2D2CC 3BGMB 2WBKA 4U0RC 4GRWB 4UU9B 4U3SB 1L3NA 1VZIA 2YO3A 1GJIA 4ZSOA 1SJHA 4UM9D 3SBWA 1HJBC 1T7ZA 4ODHL 5HVGB 3VH8B 3PWLA 3SPGA 3T6XA 2Z31C 4DQOH 1J5HA 4U6TA 2NNRA 4G6JL 1E65A 4V11A 5JIMA 3GKWL 5DHEA 2CBOA 3ZDZB 5B39G 1A6TA 1PY0A 4OCRH 2D2OA 2X4RA 4GRWH 3UZEC 5FLVA 3OR7A 1XBDA 2FJFA 4AMKH 4QOKD 3L2MA 5E6SB 1WZAA 4FFTA 4DGIL 1WTLA 1K4DB 4WW2F 5T1LD 1UYWH 4HCIA 3ZKSD 3IMVA 1YQ2A 2PW1A 4MAYD 2WWMD 2BY1A 3GD1C 2OMTA 4FFVC 4U2YA 4APQD 3K6SA 1IGYB 2KDYA 5HSFA 4YDIL 1AR2A 3H1ZA 1ZGLM 3DX9A 4ADJA 3NFPB 4FQXC 5FGSA 4GUQA 1AACA 5AVQB 2JMRA 4QXTB 4WGWB 5F6IC 5HGDB 5I1DA 3POCA 4R97C 2IC2A 3CU7A 4X6EA 5IV2A 3ZTCC 4DGVL 4YHLL 2I69A 5FYKD 2NR6C 1ADWA 1OKEA 3VWKA 2ATAA 2PWEA 3TNNB 4G70B 2VDNL 4QTHA 4KK9C 2D7PA 4W9JC 3B2MA 3RFZC 1U8JB 1QZ1A 4OZIA 2OTPA 3TBYB 2VLLA 3ZRCC 5C0AA 4M5SA 2VXSL 5A2AA 4UDUA 2XA8H 4FI6A 4XNMB 2J5LC 4XP5H 4YLBA 2IALA 5GJSH 3MBEA 3NQKA 4F7MB 5LKNA 4NKMB 5C0BB 4PWIA 1HWHB 1ZV5A 4GQZA 4KMQA 1N5AB 3FFCD 1E6JL 3M7FB 1Y7VA 1DVZA 4L8CA 3MRBB 1LWJA 3LSOA 3HN8A 2ESVD 1GVIA 2YSSA 4OTXH 2F1AA 2XKNA 2ZIDA 4Z0XA 3H9SB 3OPZL 3F65A 4PLOB 4ELMB 4LSUL 5EDSA 1INEL 2ZCZA 3SIKA 2VDLB 3AREA 2D9QB 2IDCA 3BPLC 1DHKA 1WUNT 2KHAA 3MC0A 3BFWA 4JFSA 2F54A 1YNKH 3U6XS 5AG8A 4HUVB 1NC4A 1ZKAA 1VFMA 4ODVH 4J3SA 4L4JA 1AAJA 2ITCA 5KYUB 2B1HL 5GGVL 3VRIB 2YEVB 5MP6H 1DJWA 3N1PC 5I0YA 1CWVA 3BHBB 4MA1B 2VDLH 1RVFH 1OCCB 2HVKA 2JKXA 3SGEI 1B0RB 5I1AA 1KLFB 3U7WL 1TETH 5C1MB 5EBLB 2JFCA 1NCJA 3WMSA 4JVPA 5GRJL 2XPGB 4JFDA 3NEXA 5I6OA 1UM6L 3EYFB 1AOZA 3STZB 3EHBB 2BVTA 3OKDA 4BUHA 2YXWA 4TQ8A 4IBYA 1KJVB 4XCFL 3SD5A 3JZ7A 5AKTA 1Y6MR 2PP7A 5BMFH 3K6OA 4CDHA 4NZJA 5J57B 3I74A 1P9MC 2D3LA 1EJ8A 3FQNB 3RY5A 4K0OA 4EN3B 1YEGL 4G9DB 1JWMB 3RUGB 1QRKA 2XVKA 1KMGA 3F12B 3QDMA 5TFSL 3OXSB 5CP3A 2VABB 3BQVA 5D7IE 1S46A 1IBHA 1KXQE 5IB1A 5IKCB 1QG3A 4LEXH 2XPZA 2YGVA 4Z5RA 3WTSA 1ZY9A 3K8MA 4BE5A 2E9IA 3FMGH 4O58L 3GXTA 5GGUA 4EI5C 2FX7L 4XP1H 4JZOA 1JXFA 1KIPB 1ZK5A 3H3KA 1EFXA 3QQ3A 4NYLA 2A99A 1ES0A 4IS6B 2Q8BL 3C87A 1VFBA 1NZRA 1BA9A 3VTMA 2AXGB 5IP4A 3CPLA 3OKEA 4N0YH 1GZPB 1DSYA 1ZTXE 4UZSA 5J3HC 1MCPH 5E1GA 4AVKA 5DEFA 3DECA 3F84A 4N5UA 3L9YA 3DK0A 2G2RA 2QADB 2FNBA 3SE4C 2NY4B 4RA3A 3P0VH 2XWTB 3PGDB 5INDA 5HGHA 3QIUC 2DKMA 2HKFH 3FONB 2O5YL 2F5AL 3KYNA 3APMA 4MZ3A 1YMME 1FFNB 2V5MA 2Z3FA 4GEIA 3TH4T 2ZKHH 4UT9A 1R46A 1I31A 1LEGB 5BO0D 2HH0H 1XWVA 4JFXA 1ZLWH 3T9WA 3Q6FA 2LLNA 1G4RA 3QR0A 2AEIT 3E3QE 4KGLA 4XP9L 1CS6A 1M9WA 4TMPA 5KVDL 2VQ1B 3ZQWA 1CGSL 4PJXA 2HJKB 2EICA 4HDIA 1JRHL 2J8UB 3ML9A 1G7QA 2Y2WA 4X2UA 2ZUTA 3ULUE 4Y4HB 4WI7A 1PYWA 4V1DE 3S3CB 3HG3A 4C4KT 2B5IB 4HA1A 1LQSR 1QO3B 2VW4A 3DGCR 4JCLA 5DC9B 4NQCB 3PFUA 4YXHL 1QW8A 4E9TA 4XCYB 1PD1A 1SN0A 3X3GH 1SQ2N 1BXVA 4EVNB 3S7GA 1L5GB 5KSAB 4F3FA 2XY2A 3RKDD 3TO4C 5IHWA 2F61A 4BH8B 3D33A 4ZW7A 4FQIL 2ZNXA 2GC7C 5F8QC 2KYIA 3LNEA 3FTXA 5JNYA 1TDQA 1XIWC 2IXQB 4BSVB 3L9RB 4IDJH 1Z1WA 2NY6B 2WP3O 2BZCA 5I66B 3WI9A 4NAMA 4PJDA 2Q6WA 3EG9B 1AGBB 3FO9B 3DTXA 2P8MB 3IFOB 3P9WB 4IQHA 4GW1A 2ZT9C 4Y0GA 3RVVD 4YFEA 4JDVA 4KTEL 5E5MA 4Y5XC 3PNWB 1HXMA 4ODHH 4FQJL 3UJTL 4Y8DC 3ABGA 3EJJX 3RNKB 1GH7A 2X6MA 4G6JH 4IMLB 4CSTA 3ZZ1A 3H9HA 1MHHA 3GKWH 5CSZA 5F6HI 4FDWA 2Q87A 2N01B 3ZTNL 3HAEA 5E0QA 2NQ3A 5K1NA 1KWKA 2A6KA 3TZVD 1KTCA 1YNTB 4DGIH 3MRIA 4YXKL 2G0KA 2DI8A 1FSKB 2FE0A 3NQIA 2RBLA 2UVEA 3EJUA 2NTFA 1UADC 2J21A 3ECBA 1BBJB 3DDGA 3PWPD 2XN9E 5L2KB 3CSFA 3L7EB 4YDIH 1RJZA 2VDNB 3APDA 2QV4A 4I3GA 2GY5A 2QQKL 3ARFB 2KT6A 3D0VB 3G7TA 4PJCF 4Z77A 3SGJA 5JPMC 2I07A 3PPSA 1YMHA 2YPLE 4LEBA 3C9NB 3QXUA 3DRTB 2ZG2A 1QR1B 2JKWA 3TIDB 4DGVH 4YHLH 3FCSB 2DF3A 4EO5A 1KDJA 3OKNA 3RGVD 1BJ8A 2VDNH 2XX0A 4MAZA 4BQ6A 2HZHA 2HG5B 1ZJBA 2OI9C 2YMTA 2VXSH 2OYMA 1T7VA 2GEEA 4ZFZA 5IJBC 4DF9A 4YHPB 1XCQB 4IHOB 3NOIA 4BFEA 1CF1A 3EBIA 1CE1L 1E6JH 5DMKA 1B0GB 4AUJA 4PGDB 3ZO9A 1R5WB 5G4MA 5I73B 1HI6B 3DUHA 4CJ1A 3FN9A 4OJYA 4HUUA 2VTFA 3IMTA 4L23A 3OPZH 3OXRB 4KK6D 2Z4TA 1BEYL 5C70A 5I28A 2A7BA 5I1GH 1INEH 5D9SB 4AYSA 4PJHB 1P5VA 5D7KE 3V4PL 4UBDD 1NEZA 1VFAA 4LASL 3BN9D 1TYRA 5C7ZA 2YD7A 4XR8C 2NNXA 1VERA 5SX4I 3GPSA 3G5YA 4IBVA 5DWUL 5JIQA 2QGEA 2B1HH 5GGVH 3F7RA 1E43A 1TKWA 3FU7B 1HYRC 1CGXA 3GFUA 4GUCA 5LB1A 1FL3A 5SWSB 4OZGF 5HBBA 2ADIB 3AG3B 3E9TA 3U7WH 4FJZA 5EOCJ 1X5XA 2AV1A 1BD2B 3DX1A 3V5HB 3C60B 5IOPB 5BS0D 4P2AA 5GRJH 5BUAA 3KAAA 1UM6H 3VGBA 5D1QC 3WN6A 4NT6B 2C9SA 4P57B 4XCFH 1TLMA 4QHLA 3GGWA 1UXSA 3CZFA 2A77L 4JRYB 1LEKA 2EDMA 4B53A 4IKIA 1XD0A 3NFNB 4LHUD 1KGCD 4UYQA 3DA0A 1YEGH 4WO4A 4R90H 4DP7X 3WIAA 5TFSH 2R59A 4BJLA 5D1XE 2AJUL 5C0EA 1MH5B 1E5YA 2OSXA 2WLIA 3DVFA 1G7PB 2PO6B 3LKSB 5BJTA 1A8JH 2HAZA 4O58H 2APTA 3QUXA 3HZYB 2FX7H 3FNKA 1O9WA 4TSBL 1RAMA 3GF8A 1BYOA 3MV01 1PBYA 2BIOA 1M57B 2AFNA 3WNPA 5D70L 2FQDA 4OD3L 3O4LB 4ABUA 1NAKL 4N2FA 4PREB 4PVBA 3MODL 2QPFA 4F7EB 2Q8BH 3UJJL 4GRLA 4F2MB 4KTGA 1OM9A 1WE5A 3KL0A 4JJ5A 4JCMA 5EC1B 3FOMA 1AG6A 4JFYB 1HH9B 3PAYA 1OWRM 4LKCB 3O6FA 5TE7L 1C5DB 1SXAA 4NM4L 5HYQA 5F7HA 4M9PA 2WCGA 2EDEA 3D3VB 2R8SL 1GKOA 2CCVA 2G4EA 3FUKA 4PG2A 2HT3D 3ARGA 4JFUA 5D4IA 4YOKA 1MCDA 3TVMC 2O61A 3FO2B 1R4XA 1NIDA 4PJGF 1R3HB 4N90D 3MNZB 1QAWA 1T0OA 1MCNA 3V79C 4G8EA 1TPXB 3UPCA 4XAKD 3U79A 2YFOA 3OB8A 4NWTL 2O5YH 1IJNA 1U3HC 2F5AH 3LPFA 4KTDL 1ZLSL 3SDXE 3IGFA 1QEWA 1T5WA 4XI5D 3AACA 3QORA 5ALCL 4MSWA 2AK4D 4D3CL 5T1KD 4CL7A 2FECI 3LXCA 2KBGA 3ECWA 2X3CA 4OZGA 3KYOA 4X5XA 4GG8A 4XP9H 5KVDH 1X7QB 2A38A 5FAAA 2AZAA 3ILQD 5IQLA 2BO0A 4Z3EA 5J0BA 2H3XC 3HZMB 1CGSH 1QFWM 4PSRA 1A3RL 1I8IB 1JRHH 3IGAB 1M2VB 2DOCA 1OAQL 2OM5A 3LKRA 1DFBL 3WKPA 3PXHA 2XDHA 2BOCB 4OIBA 3DNKA 5E8DL 5EU3A 4P3DA 1ESOA 2X2YA 3JYCA 2L0DA 2ZXAA 4L4VD 4JQXC 5IHHA 4POYA 4GXUN 4LSRL 1ML0A 3EO1A 1WCQA 5E4AA 4G43A 4YGAB 4AITA 4U4BA 4FQIH 3LKNA 5C08D 2V3EA 2CCLA 5A3ID 1BHGA 2H32A 4Q2ZA 3MBWB 5J1AA 5LCVL 4KI5F 2C9AA 5HHVL 3FN3A 5AW6B 2JH2A 5EG6C 2P8LA 3QR2A 4KTEH 2HFEB 1USZA 4Z7IA 2P45B 4FQJH 3ROLB 3OSVA 3QDGE 3UJTH 1JGEB 3DUUA 5TK4A 1X3DA 1A4BA 1R3LB 5IF0A 2IDSA 2WXJA 3B56A 4KJQD 5CHNA 5DFWH 3ILEA 1TIUA 5H35A 1NCUA 3ZTNH 2WZPD 3T4AC 3KPNA 4AW7A 4BELD 1U8LB 1KTLB 4YDLB 4YXKH 3F64A 1KCWA 2XQYG 5FOJA 3BAKA 5CLZA 2DQJL 3RTQC 4KQ4L 4BD4A 3WFHB 3JV0A 3WEXA 4I2XE 2BIMA 3TCXA 1G1YA 1FFOB 3MRKB 4G8GD 2F8VA 4YFDB 3U30C 4B60A 2QQKH 4LLWB 4AYGA 4HWBA 3AY4C 1B9KA 4E41E 2ITEA 5CBAB 3CNKA 4BSWB 1EIBA 4AYEC 2HPOA 1S3KL 1MKFA 5FGRA 5KBMA 1IUZA 1DFXA 1PG7X 1QSEE 3KGRA 3AG4B 3GM0A 3QW9A 3AT8A 2W0FB 3BT0A 3EJPA 5CCJA 4P0DA 1JV5A 5FKAB 2BSRB 2OJEB 4RGND 3V4VA 1J9SA 2VN6A 4MS6A 1J8HA 2HXAA 3RPKA 1T1WA 3I6KA 4LBAA 5IMKA 1FFRA 3OZ9L 5BZXA 1WIPA 2ZAIA 3V4PB 3IGKA 1B0WA 2C1PA 5IW6B 1RZGA 3F5WA 1CE1H 2GFBA 3C6LC 4IJ3B 4GAYA 4J6RL 1QASA 3ARDC 1JWSA 3P4NB 2N56A 4XC1L 2EIZA 4PP2A 4Z18A 4J5VA 4IYKA 2LR4A 1BEYH 4QCIB 5IHLB 4DPCX 5BCAA 4Y1AB 4XN8A 2ITDB 3B3IA 4PRIA 5E8EB 2NYYD 5HDLA 3QARA 3Q3GB 2BHYA 3V4PH 3RIAK 4U1HB 4LASH 1CGUA 3CSYA 3NZHL 1O9ZA 5DWUH 4A6YB 2XI9A 1T89C 3I6SA 1GMEA 4P3CL 3BP4A 1U8MA 3V0JA 2LFGA 1SNRA 4NCC1 4R8WH 3HN5A 3U2SA 1SZNA 3TTSA 3HB3B 4LARL 4LB8A 2XKUA 4JL2A 1O6SB 4KUCF 1ANUA 3I3BA 2GITB 4MJ2A 1ZLUK 2H6PA 3CZEA 2ZCHL 4BWTA 1JF1A 3R8BB 1KCLA 1H0DA 5CR8A 4DEUA 1NICA 5E2WL 1FFPB 1SEBB 4MHHI 2VLKE 3MRDB 2ED7A 2L8AA 1JYNA 2A77H 4WJ5A 3B2DC 3OD3A 5CN2A 3TGXA 3GEWB 4X7EC 1XIWB 1Q90A 1XQ4A 3F00A 1HK6A 2W0PA 3PUCA 3RI5F 1RZPA 4PCTA 2AJUH 2F53A 1A65A 3ULAB 3IDJA 3A67L 4Y5YB 4P2OD 4RZCB 5E2JA 3B3BA 4NQDE 1XGRB 4NPYA 1AHMA 3RDJA 5F0PB 1PNCA 3TBBA 4WWKA 3MFFB 3QGVA 4KK5D 4PJ8C 1VPOL 1BQKA 5K9QI 2BSED 4P23D 4TSBH 1IBFA 4NXSA 5D70H 4OD3H 1NAKH 1T0MB 3KEDA 3CFDB 1EBPA 3MODH 1D5BA 4Y16C 3UJJH 1UTDA 3TFKC 3BD4A 1LJMA 3K74B 4R5VA 1S7UB 1VEMA 1PX4A 4HUKB 5DJ2A 3RPIA 4BK5C 4YSEA 4AQAB 5TE7H 1ZXQA 3RL1A 1M53A 4NM4H 3IU3B 3CQFA 4DOHE 2IMMA 5GS3A 5JHMA 1GS7A 2R8SH 3K2MC 2IPUK 4UTBA 3CDCA 4Y2OA 1T66D 1DQQB 1JS4A 3KPLA 2WXPA 2V2TA 5FUOL 3X1NA 4KZDL 4GSUA 3WJJA 4EDXA 2Y7QB 3EYQC 2DYSB 3WHE0 1ASPA 4C83B 4F7PB 4OQTA 2NY5C 3FHAA 4KTDH 1ZLSH 3OKOA 2I26N 3FHQA 4ZPTB 4PG9B 5ALCH 1FGVL 2J73A 4ZS7L 3VE0A 4N2OA 4D3CH 2X87A 1E8ZA 4RZKA 1KLGA 3UZVA 3JVFC 4XXDA 4JQVA 5DFAA 1JNHB 3F7KA 4HAKA 3DURB 2XCMC 3L1OL 5IVXE 3FT1A 4LOUC 2VXTL 4JZNB 1A3RH 3I9AA 3HZKA 1OAQH 1JV2B 1MHEA 4CW1B 3CZGA 4YC2C 3UMNA 1DFBH 3G5ZA 4NI3A 4HKJA 3EH1A 4N0UE 3MUGA 5E8DH 3UO1L 3OR6A 1SJHB 5A2IH 5CCKL 3HFFA 1KACB 3PWLB 5IROD 4Y5VA 4PJ9D 4M7ZB 1AS8A 1TMCB 3VXOA 3OAYH 3ZHNA 2JIXD 3C75A 2VN4A 5CXPA 1P6FA 3L16A 1CDHA 1XMWA 2X4RB 3SO3C 1ZHKA 1WHPA 3BIKA 3B37A