4E9WA

Multicopper oxidase mglac (data2)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Uncultured bacterium
molecule tags Metal binding protein
molecule keywords Multicopper oxidase
total genus 95
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9wA02
3QJVB 3NJKA 5PAZA 2UXFA 1W6LA 1CYWA 2J5WA 1A65A 2BO0A 2PCFA 4AKQA 3PXLA 1RCYA 2YARA 3TBBA 2CAKA 1GS7A 4KNSA 5I6KA 4ZK8A 3FS9A 1WA2X 1TKWA 4KOBA 1PF3A 4DP2X 4GP8B 3ABMB 2R7EA 3TU6A 1FWXA 1GY2A 4YSAA 2IAAC 5B7EA 1WA1X 2AZAA 3ZIYA 3S3CB 4DP6X 1J5CA 4Q89A 3WI9A 2HX7A 4G7SB 1AOZA 3WKPA 2H47C 4KO7A 3S3BB 1N70A 2BW5A 4CSZA 9PCYA 3SQRA 7PAZA 1AQ8A 3NJJA 2YXWA 3FYIB 1KCBA 1JZHA 3OMIB 4YSEA 1ZDSA 3WIAA 2GC7C 1GS6X 3X2QB 4AI7A 1L9TA 1PLAA 2BHFA 2YAMA 3T6XA 3TASA 3AG2B 3ERXA 1BXAA 4HALA 4JHUA 1JVOA 4YSUA 1XB3A 2DV6A 3UGEA 4E9QA 1V10A 2XU9A 2FWLB 2Y69B 2IDUA 2BWIA 4HHWA 3IN0A 2I85A 2QPDB 1AS8A 4KNUA 4BXVA 1X9UA 3X1GA 3CVBA 3PCYA 2Q9OA 2HLEB 4TXVB 2ZXWB 1CC3A 2DY2A 1OV8A 2JXMA 3CDZB 4NB7A 5E9NA 2BZ7A 4KO9A 1OE2A 1WA0X 1NIAA 2XUWA 1J9SA 1NIBA 2ZWNA 1EZLA 2WO2B 3FPXA 1KBWA 4BWTA 1PLBA 3BQVA 3ABLB 3NJLA 2PPEA 1FA4A 2TSAA 3FSZA 5IY5B 5D4HA 2VM4A 2BZCA 3T6WA 4A2HA 1J5DA 4F2EA 2YAFA 1AZUA 5I6MA 1WS7A 2QT6A 2UXTA 2XLLA 4YSOA 3OD3A 4GYBA 1L9PA 1ZDQA 2XV0A 1MZYA 2AZUA 4EF3A 4HCIA 4A2DA 1E67A 1ZIAA 2EINB 1KV7A 3NJHA 1IBZA 2WSDA 4DPCX 5B1KA 1ASQA 1KDJA 1CYXA 2FQFA 2IWEA 1AIZA 1AZNA 3V9EA 2RACA 3NSCA 5PCYA 1DZ0A 3NP3A 2VW4A 1PCSA 1JVLA 3FU7A 1GY1A 1BQ5A 1OCZB 1MDAA 2FNWA 1HFUA 1I53A 1BXVA 2W88A 1B3IA 1NIFA 4DP1X 2FQDA 4G70B 3QQXA 3X1FA 4UANA 1EHKB 4KNTA 4YSQA 2IDSA 1SJMA 3PLYA 3L45A 3AG3B 3MBWB 2J55A 1RZQA 2GB2A 1JXFA 2EILB 1OOWA 2QDVA 1M9WA 1WAEA 3UACA 3FU9A 1A3ZA 1V54B 2J56A 2PLTA 2QDWA 3FSAA 4K9JA 2E86A 4YVUA 2PPCA 2XXFA 3NJMA 3WNIA 5AFAA 1JZFA 1RZPA 3FQ2A 4YSDA 3QJRB 1JERA 2EIKB 3CVDA 4MFHA 1JOIA 3EHBB 4M4RB 5B1AB 3N2JA 3MX0B 2QPEB 1R1CA 5B7FA 2HZHA 2FT6A 2MTAA 2Y1AA 4E9VA 2GI0A 5I26A 1V55B 2XX0A 6PAZA 4UF7C 3AG4B 3FU7B 1A8ZA 1OF0A 3QJSB 5D4IA 3V9CA 5I28A 3NYKA 3G5WA 1NTDA 2WO3B 1PLCA 3UAAA 3WNJA 4YL4A 2W8CA 1JXGA 1JXDA 2JFCA 3NJIA 3OMAB 1W8EA 1SFHA 1PNDA 3FYEB 1PMYA 4HAKA 2XVBA 4HIPA 4A2EA 1VLXA 1TU2A 3EF4A 5B3SB 4M3HA 2XV2A 3X1NA 4KO5A 5LDUA 3CZUB 5TK2A 1JZIA 2UXGA 5B1JA 4WTQA 1QHQA 3UAEA 2VM3A 3WKQA 2YAHA 4KO6A 2HRHA 3NJGA 3FU8A 4BWWA 2LLNA 4GXFA 4DPBX 1ET5A 1FFTB 3NJFA 1QLEB 2XXGA 3FPYA 3S3DB 2PP7A 2VSKB 4A68A 1W6WA 2FT8A 2B3IA 1NPNA 2VSMB 2GBAA 4YSPA 3QJUB 2HX8A 4DP9X 1XMEB 1GS8A 3H4FA 1ILUA 3IBOA 4F7KA 2HX9A 3PAVA 1PZBA 1SF5A 3CDZA 1SHWA 3IE9A 4N8UA 3IEAA 2MRYA 3SBRA 3DIVA 1ETJA 5I6OA 3T71A 1AS7A 1AZCA 1ZIBA 2GSMB 2P80A 4F2FA 1J9QA 1IC0A 4E9YA 1NDTA 3OQRA 1AACA 5ANHA 3X1EA 1NZRA 4A2FA 2IDTA 2J57A 2FQEA 2IDQA 3S8FB 2GIMA 4P5RA 1BQKA 4YSCA 2OJ1A 3AZUA 4UAHA 3UADA 2H5UA 2XV3A 2BP0A 2I7OA 1AZRA 1L9QA 4AKOA 1SDDA 1GW0A 1NIDA 3U25A 1NWOA 3T9WA 3DTUB 3T6VA 5B1JC 1AG0A 3H4HA 4DP5X 4G7QB 1OCCB 3ASNB 1DYZA 3AG1B 1NICA 3ABKB 1QNIA 1WS8A 2H3XC 1YLBB 2ZOOA 1L9RA 1BAWA 1AG6A 1CURA 2B08A 2ZONA 4BWUA 1ASPA 1BQRA 4E9TA 1RKRA 4W1TA 1BYPA 4DP7X 1OE3A 3GDCA 1PNCA 3QPKA 2UXVA 2YAEA 3FT0A 1ADWA 3EH5B 4PCYA 2X88A 4RH4A 1E65A 2GHZA 3CVCA 3HEIB 4GP4B 2EIJB 2UX7A 1J9RA 3T6ZA 5I6PA 2N0MA 2R7EB 4GP5B 6PCYA 1GSKA 2I7SA 2IWKA 2Q5BA 2XWZA 2TSBA 3H56A 3NT0A 4DP4X 3KW8A 1A4AA 4YSTA 1UATA 3DKHA 4E9XA 5I6NA 2GC4C 1HAUA 4PAZA 3FQYA 4GY4A 3GYRA 3X1BA 2BP8B 2DYRB 2AVFA 1AANA 2X87A 4E9SA 5TK4A 1IBYA 2VMJA 3BVDB 3NP4A 5A7EA 2HXAA 1ILSA 4JKNA 4P5SA 1ASOA 2FT7A 4AKPA 2YAQA 1OCRB 4NAJA 3ASOB 3FSVA 1AZBA 2EIMB 2PPAA 4HHGA 1KBVA 5F7AA 1MG2C 1XB8A 1NPJA 2XX1A 2FJSA 4BXSV 2NRDA 3OMNB 1OE1A 4G7RB 3RYMA 1TEGA 1T5KA 1M57B 2FTAA 3SBQA 3NSDA 1BXUA 2PP9A 4FAAB 1PZCA 2BW4A 1N68A 1ID2A 3ZDWA 1AAJA 3TA4D 2OCCB 1ET7A 5B1BB 1BYOA 2BWDA 2PPFA 3C75A 5I5JA 4DP0X 4BDVB 3AY2A 2PPDA 3KW7A 1SF3A 5I6LA 1IKOP 4HZ1A 1URIA 1F56A 2IWFA 5AZUA 5I5IA 2DWTA 4CSPA 1AR1B 1E5ZA 2AANA 3QJTB 2A3TA 3JTBA 3OM3B 4L0PB 3SBPA 2UX6A 1PY0A 1SNRA 3CG8A 4YSRA 1ZPUA 3D12B 4A66A 5AKRA 3AW5A 4HCFA 3PAUA 3WG7B 4AZUA 4ENZA 4G72B 4G71B 2AFNA 5B7MA 2CJ3A 3QJQB 3ZBMA 2VW6A 4YVNA 1BEXA 1L9SA 4YSSA 2DWSA 1MG3C 2CBPA 7PCYA 2IH8A 1A4BA 4W9ZA 2CUAA 1AS6A 2DYSB 3FSWA 1OCOB 1SFDA 4E9RA 2P80D 4QKTA 3TBCA 2XYBA 1NIEA 5D4JA 4BDVA 2YAOA 1KGYE 3NSFA 4BK5C 1GR7A 1XB6A 3S8GB 4X4KA 2VW7A 1JZEA 4HCGA 3NSYA 4DPAX 2CCWA 3HB3B 3IN2A 3ZX1A 3NJNA 1ET8A 1M56B 1SDDB 1HAWA 1JZGA 2JKWA 3EH4B 4KOCA 1NINA 3UABA 2CALA 1JZJA 3JT2A 4FA7B 4A67A 4N4YB 3PAZA 4E9WA 4DP8X 2PCYA 3PPSA 8PAZA 2BP0B 5EHFA 2FQGA 4QLWA 1KCWA 1J9TA 2BP8A 1NWPA 3EH3B 1CUOA 2HRGA 3GXUB 1A4CA 2PP8A 1KDIA 4NERA 1E5YA 2OV0A 2YQBA 2YAPA 2YXVA 4AX3A 1TEFA 3ABGA 1E30A 4A2GA 4Q8BA 4JHVA 1L9OA 1X9RA 1ZV2A 3FQ1A 2IDFA 2IH9A 2VN3A 3N55A 5F7BA 1IUZA 1PAZA 4WKXA 5FC9A 1PZAA 1MZZA 5I5MA 1SHXA 1GYCA 1KYAA
chains in the Genus database with same CATH superfamily
1NUGA 3JSSA 3EG9B 4PM1A 4FRWA 4WHYH 5I16B 5IMLB 3H8NA 4H26A 1C16A 3UJIH 2J5WA 4XPTL 4NKMA 1HIMH 5IVOA 4B7IA 3IDIB 1ZD6A 4PCSA 5DDHA 4BCXA 5EIIB 1RZKH 3LNEA 1MI5A 4AQ8A 3BP4B 3ZR5A 2Y2TA 1MHCB 5F7LB 3ZKXC 1D2OA 1H3WM 1SXCA 2IH1B 5G55A 1IBGH 1S9WA 2V2TA 2HKHH 4NQED 5JORA 3MXVL 1I4FA 4DN3H 4UTBA 3S3BB 3Q13A 5DRXA 4MJJA 3R4DA 4A2LA 4G6AD 2HJFB 5T3XE 3RZCA 4POZC 3HBQA 1JZHA 1Q1PA 1E5CA 1QNZL 2JCCE 1J0HA 3W1ZA 5DURB 3SY0A 1NCGA 3VD1A 2WLJA 1P7QA 2NUTA 1TTGA 4MD4A 3H0TA 3TN0D 5GGSY 4I2XB 4TLTA 1MJJA 2X05A 4ADIA 4P2QA 3OMZA 2FCBA 4X6EA 1ZTMA 4MBOA 4KVCH 5L2KA 1RIUL 2WGNB 1B4RA 1JGUL 4KK5C 4BXVA 4QTHA 3DGGA 3U2SB 2XBZA 5D93C 2WXLA 4QKXB 4H8WH 2E9JA 5F1IA 1RHHB 3H55A 2IAND 3GSNA 4MXVE 5DK2B 5JHBA 2LLLA 3UBXI 4RRPA 4ZJ9A 4QHLA 4MZRA 1RZJC 5GHWL 2E27L 3BKJH 4F33A 4DCQA 3FB6A 1WGOA 2CMRL 4NQDE 3MLYH 2RGSA 3BGMA 1IL1B 3MJGX 4P3CL 4XC3H 3G6JB 1A2YA 1UWFA 2XN1A 3QJHB 1M2OA 3QNFA 4U7SA 1C8PA 4NQEE 1UJ3A 3AREB 4X4ZA 1R3HA 1UD6A 4IRJB 2FO4B 4J6RH 1MCKA 4OCYL 1OAUH 3UC2A 3VRIB 4E42A 5H2BA 2H1LM 3RGHA 3VQLA 4NOBA 4GW5B 4FMKA 4GW5A 5CHNA 4WHCA 4MRBA 2D03L 4M6OH 1RD6A 4FTVB 1DJZA 1ZOXA 3B3BA 1IBZA 2DMCA 3DURB 3G9AB 1NDGB 4ZFZB 1L0QA 1ASQA 4GAAA 1CYXA 5CD3B 3CDCA 1ICTA 4FFWC 4ZW7A 5DD5H 3T4YA 1I1CA 3E2HC 1T2JA 3M7OA 3TZVC 5J13B 3TESA 2APBA 4RNRA 1AZNA 4DTGL 5F0PB 1FNSL 3JWNC 1A9BB 3R06A 3NSCA 4IRJC 4LRNH 4ETQA 5I1LA 2VO8A 3N44F 1FDLL 4OU3A 1IB5A 1O7DE 2EXTA 5T1LD 5GGSB 3ULVH 4OJAA 3H3BC 3FXIC 3NA9L 4KXDA 4PUBL 5HDLA 2W9EH 4G70B 5AD0B 3LZRA 2WB7A 1AHMA 5FK9B 5HYJE 3QYCA 2UWEE 2OMBA 3TNMB 2VXQA 2WLYA 4D8PB 5HD8C 1MQ8A 2VMFA 3FW6A 4RFOH 4EXPX 3ARWA 3MLWL 1GC1L 5AW0B 4PUBH 43CAB 5CZKA 4GS7B 3ZT5A 5JO5B 3WNIA 2XICA 4Z7QB 3KL5A 1IRAY 1ZWIB 4WWKC 1HOCB 4YPJA 1YUKB 1NCCL 4EN3B 1JERA 4BE6A 1LM8V 5ESAA 3EO1A 1HKFA 3D9AH 1K6QH 1F4WH 4EOWH 1EVTC 5B8CB 3QWNA 1GC1H 2BRRH 2VR8A 4KI5C 4YUEL 4MQ7A 5D7JC 5EU6A 5B7FA 2ZWLT 2CBMA 2XWTB 2Z8WC 1B90A 2L0DA 1WFUA 1AMYA 3C9NA 2PR4H 3DHMA 3NPSC 2EQDA 5GRJL 3IU3B 2X4QB 5GSVA 1P4IH 3IRPX 4U3SB 3NFNA 1TJGH 5F88B 1F4WL 1K6QL 4Y2OB 1N10A 2R4SL 3ROLB 3MRHA 1QHPA 4G6MH 2DEWX 1J8RA 2WC7A 3ZW3A 4X4ME 2R2BA 1A7OH 5I1DA 2HMID 4K7PH 3AAZA 3KG5A 1MEXH 4AEEA 3A23A 4YNYA 1IT9L 2O5ZL 3ZHDA 4AQAB 4UM9B 1PG7L 1WFNA 4HCRH 2XV2A 3IRCA 4PJIB 1LWRA 2ENJA 4A55A 1H5BB 3P0YL 4Z7VB 4OJYA 1R3KB 2P45B 3FRUA 3IDGB 3IE4A 5C0BE 3TZVA 1MDTA 2XKNB 5I1JL 1OIOA 5F21B 5L2KD 3OLGA 4NFBA 2VH5L 1KG0B 2J3SA 1KG0A 3V4UL 1QRKA 5GS1C 4CMHC 3V4PL 1X5LA 5H94A 3PY9A 3WMPA 4GXFA 1ET5A 4XAKD 1VFBB 1FFTB 3RB5A 5DRZB 5I23A 2CRZA 3B2MA 1W0VB 2PP7A 4XO5A 4J5VA 3LXBA 2GW5A 2DBJA 2VSMB 5SWQB 1O0VA 1W9XA 2VLLA 4LGSB 4K07A 3B9DA 5AALA 3PGFL 3U9PH 4F8PA 2H2SC 3D34A 2Y7NA 4ZW3A 1TCMA 3CDZA 3OJDB 3IE9A 2EYRB 5T3XH 3GXDA 3HKZA 3UAJD 4L4VB 3WD5L 4H8QA 4J3XA 5I6OA 4ZUUB 2I07B 1YUHA 1NGXB 5G5DA 1R3IL 2XZCH 1PKQB 1IC0A 4ZMLA 2OR9L 3VTTA 1A1MB 4H1LB 4DGVL 3A6BL 1AACA 1MFEH 1CJYA 25C8L 3G5YB 3DV4A 4DVRL 3CFDB 1XCQA 4IBZA 1N2RB 3O6KH 1JIBA 1H8SA 3BFQG 4L37B 4AC2A 1NL0H 3VFPB 4ZFOA 3P30L 1HE7A 3R0NA 3EOBB 4LOUC 2BVPB 1CXHA 5CLXA 5K9JL 3EFDH 1GJUA 3I9PA 3C2AH 4XO8A 5DCCA 2YSSA 1U9KA 5A43C 1KC5L 4PJGB 3JQOB 3RBGA 3GTNA 1IO4C 4JGMA 3TBSA 2PN5A 2G2RB 1SVCP 4XO4A 1I7UA 2GAZA 1MRDL 4JFZL 3AG1B 5FA3A 3IMRA 5KANG 1T03L 2EE6A 5HDQH 1YJDH 1J0IA 3L08A 1BZ7A 1DL7L 4YXKL 5I73B 1V3LA 3WEAA 3KPPB 4HUWB 1TO4A 2ZYHA 3RZCC 2Z93B 2YSTA 3TOPA 1JD7A 3BH9B 2GBVA 4M03A 4I18C 4P49A 2EC9U 5E2TL 3Q44A 4OJCA 2JIXA 1YEHH 4ZSOB 5I1HH 2ZSVB 4TNGA 5AG8A 3J8F7 1IM3B 1GPOL 5IP4A 3UPRB 1JV5A 3WTYA 4HK3N 3Q1EA 4IOFC 5DUPH 2ZUWA 1D5IL 5FYKE 3BKMH 1ZHLB 2D7NA 4FADA 1NC4B 2E0PA 2ZG3A 2AJSL 1WAAA 4BZ2L 4CN6A 2CA4A 4V1DA 2IWKA 4MXQD 4PRHA 2TSBA 1NAMB 2A77L 5BMFH 3D3VE 2AXJA 4P2OD 2CJUL 2PYFB 4KRNA 1S7UA 5DA4A 2PW2B 1MFBL 1V7ML 2HPTA 1T3FA 4N8PA 3VFWA 4PLNC 1WWAX 4W9FC 5IB4A 3RLSA 4IU2B 3F5WB 1XIWB 2YKLL 2VXUL 1S46A 2EIDA 5IQ7L 1SYSA 4U4BA 2X87A 3BPCB 1R0AL 3WNNA 1E3XA 3ARGC 4UQ3A 3D85B 1VCAA 4NCC2 5K39A 1MN4A 3SQOH 2DDQL 4P5SA 2FT7A 1EAJA 1IAIL 4AKPA 5J7CC 2A9ML 3JVGC 3ASOB 4PU2A 2ZSWB 4RVBA 4XBPB 5ISZA 2EIMB 4A6YL 2WXNA 3U1SL 3EJSA 1NGPL 3L1EA 1NPJA 1WFOA 1ZKAA 3NA4A 4PYHA 3GBEA 4JM2C 2B7DT 5LGKA 2A9MH 3RNKB 5JW3L 4G7VH 3VNZA 5HHNB 1DANT 3QIWD 1NAKH 3P1VA 4G9DB 5TPWH 1HCFX 1A3LL 2FECL 4DUWA 5JHDD 1FFNA 1F41A 3O2VH 5I5JA 4Z76A 4WFFD 2ICWJ 5J6HA 4NQEB 1PY4A 3QIBD 1UXWB 3C6LB 3DROB 3MRDA 4FQXC 4OZFB 3SY0B 3D05A 1OPGL 3KPRE 3K6OA 2WB1A 3REWA 1CU4L 5I8OH 5SWSB 3RPIB 1EXUA 1BMGA 5I1AA 1IGIL 2ERJC 1G1KA 1HQ4B 1MH5B 3CFCL 3I6LE 1PY0A 3L5XL 4NOFA 5CGYD 3BFOA 4OSUL 2X3CA 4WW2F 1W72A 3VWJC 2XRAH 1E8XA 4HCFA 3RPBA 4R6UA 5AAWA 3O9WC 2ICWI 5EG6C 4G71B 3FJTA 3QJQB 1HILA 3HFML 4H5SA 4E41E 2C3WA 1ZLEA 1SRDA 1QLRA 4NKQB 3AGVA 2JB6B 2O5YH 4AK1A 1AS6A 1SFDA 3BT2L 4RFEA 1P4LB 1SBBA 4NNYB 1SY6H 4QKTA 4WQOA 4OZGA 3GSVB 3WELA 3IU4H 2D3VA 3BH9A 1YNTF 4XO9A 1FGNH 5IVZA 4P2RB 4FHJA 3VX0A 2R2HB 4S2SA 3Q6GH 5KN5A 1QEXA 1S6NA 4WTWA 1CBVH 1GAFH 1CE1H 2QVTA 4P9MH 1GZQB 1BG1A 2JTDA 1A6TB 4XC1L 4DUXA 1KEML 2ZX5A 5EEZA 5EOQH 3MKKA 4LFHG 2ATAA 3G04A 4R7DA 5SX5H 3WJMB 1Q9LB 4YDJB 2ZOKB 3O9WD 4K8RH 1WWCA 4PFEA 5DQJA 3T5WA 3ZKMC 2Y5TB 3UZVB 4UM8B 3QDJE 1BG9A 1V7NL 3SDDD 1XF2A 4D0BA 4A67A 5C0CA 4ODTH 3CZFA 3WAKA 3O9WB 1OW0A 1JYNA 5DC9B 5FOBB 4IBWA 1ADQL 1XH2A 4JS7A 4PWEA 4RGNE 3GXUB 2OL3A 4Y1AB 5L6YH 1MLCA 1BD2E 5IJKA 4QAMB 2LVCA 2WXFA 4N8VG 5HI4C 4N6QA 3ZYJA 3SKNA 4OQTL 1JFQH 1FZMB 4QYOB 2XQBH 2VDLH 4P2RD 1WTGT 1BAFH 4I4WB 4EPSA 2OMTA 3HLAA 5CBAA 2UZIH 4BK4A 5ADOL 5I5MA 2AV1A 4N8CL 4TVPE 4ZUVA 1T5XA 2C7UA 2EYRA 3GBLA 4D9QD 4OCNC 1Q94A 1F18A 7FABL 4XHJD 1E40A 2OMYB 1MCWW 3BVNB 4DQOL 1B4TA 4RMVA 4NO3A 1HCYA 4U4IA 1KUMA 3LN4B 3ZIMA 1FFPB 4YHKH 4ZAKD 3D51A 3SQBA 2B9BA 2C7UB 1AO7A 2IAAC 2ZAHA 4GT7A 5KYUB 1KB9J 3VXPA 1Q4NX 2ED6A 4LOUD 2QVMA 1ECZA 4X9FA 1UZ6F 5LNGA 1VEPA 2GG1A 3ATDA 3QDME 4RWHA 4XNZB 1AE6L 4HWEL 3NCYP 1N70A 5I1GH 3KVPA 4PW9A 1ZSDA 1I1RA 4JY4B 1QUNA 3SDYH 3IGAA 5DJDB 3EJZC 4Z6AT 2JNZA 2PTTA 3O3UN 3ZMEA 5C0DA 3NIFF 2CXKA 4QNPE 4F57L 1HC1A 4X5XA 1NCBH 3BXNA 2UY6B 2ZWYA 3WS3B 4ABUA 1KIRA 4AH2B 1U8KB 3VG0H 2RALA 3ZYZA 1XB3A 3M1CA 5EOTB 1R5IB 5C1MB 1ZS2A 1T80A 4HK3J 1HYSC 1XF5A 1GZPA 4RBPH 2A6DB 2R2EB 1JS4A 3M07A 4NDMA 3GZOA 3T3PB 2FX7H 2CR0A 4Y4HB 5BZWB 1JMXA 3V0VB 4NYLB 1TFHA 4QRTA 2Y4SA 1KCUL 2DMBA 2H4EA 3BP7A 2IXQB 4JHWH 1KGJA 3MV8E 3RX8A 3BKYL 3W9EA 5JZ7D 4NO2A 1B0GB 3EO1B 2JE8A 2AQ3A 2OLDA 1JCKA 1HNYA 3MV9D 4Q2ZB 3V6FA 5C07A 3TBYB 3DVIA 5AW8B 4IIQC 1WJ3A 3B3IA 4L1BA 4PSPA 2G2PA 5E6ZA 3KWWB 1Z66A 4M5ZH 2LU3A 1YNTB 3CVHA 2WO2B 4U31A 5J12C 3LZOA 4HPOL 4XWGL 1QUPA 3JWOC 5JA9A 3U4BL 1ZT4B 4LSSL 2VYRE 4WU7A 2LOEA 2AAAA 3MRBA 1L6XA 2H3NA 2IOMA 1J8SA 2O72A 3BHBB 4JFXB 1ZLUH 4HH9A 5BV7H 1WWBX 4X4MA 4BSWB 3VGEA 3BH4A 2QT6A 4FYTA 3TBWB 4GBXB 2C9PA 1ETA1 4LSSH 5DD1L 4XNXL 3NZ8A 2AJSH 3AS0A 4EF3A 4BZ2H 3BMVA 4G9FD 3FO2B 3ULUE 2GSGA 1KIQB 5JXEA 3KYOB 1CGSH 1IBGL 4Z76B 2Q2LA 5B39A 2G3NA 3G6DL 1ZCRA 3DOSA 4R26L 4HEPA 3V5KA 1I1AC 3B2XA 5PCYA 3ZLQC 5HYSB 4EIBA 4F7EA 4Z3JA 2FL5B 1GY1A 1SXSA 1BQ5A 3FUEA 3ULVC 2VZTA 1AYOA 1HIML 1GVIA 3O3BB 4ADGA 2CK0L 4LBAA 2JMRA 1B3IA 2OZ4A 1IAIH 3HG2A 2ENSA 2J4WH 3C09C 2BM3A 3UIZA 3VFSB 3L3KA 1OM3H 5HGAA 3QUMA 2P46B 3IMBA 3P77A 1RJLB 5IB2B 1N8OE 3CHSA 4O02L 4UTAH 3FHAA 4WV1C 2WBJC 2GJRA 4EI5B 3QFDA 2PLTA 2XN9D 4LCIL 3PHOA 4KJQD 3MA7B 4FG6C 2BS8A 4JFEE 4KVCL 5F9WB 2JKLA 2AJYH 3GSNB 5DK2A 4F15B 2R29H 4ZZFA 4OUUB 1ZXQA 1DFBH 1FPTH 2DMHA 4NX0A 4HDIB 4QOKA 4QOKB 4QHPA 3RJOA 4KKBD 3WIHH 3GMPB 4OKDA 2R0KL 1ZEAH 1I3GH 4N9GA 4B5EA 2YQGA 3MA7A 1KLFA 4E9VA 1M1XB 3VXRD 5T3ZE 5GGVY 3SJVE 3CDFA 4GAYA 4UZSA 1YYCA 3RBSA 4X0KA 2YR3A 1J8HA 5IJKC 3K1DA 3D52A 4LCCC 5DJ6B 1JI1A 3O3EA 3VXQA 1N59A 4YL4A 3I6GA 4XC3L 1JXGA 5GRXG 3DLQR 1JXDA 4R7XA 3JWOL 3GSRA 4C54A 4Z7WA 3UIYA 3FYEB 1AVAA 2XRAL 5B3SB 5FFGA 2DQHH 4UQCA 4NQCA 2AJXL 5L7XL 3QYNA 2X09A 4FFZH 4JN1H 4PWKA 3ET9F 5EZPA 4FFTA 3JV0A 3B34A 3FONB 1TETL 2OQJA 2VN6A 2WLMA 3CZUB 3Q48A 3TVMA 3OGCB 2ZNWA 3QO0A 4LO9A 1LDSA 3GRWH 4PJ5A 2A4ZA 4WGVB 4G82A 2ZXCA 4M1GH 3G6AA 3RWIA 5ACZA 1TQCB 3OJVC 4MMYB 3VWKA 1EDYA 2A9AA 5C8JB 2AQPA 4HS6B 3SDXB 1IKNC 3EHBD 3P73A 5F9JB 1A7NL 5H37G 3WN5A 1XSJA 5JYMA 1KLGA 3BZFB 2VSKB 4OV5A 4Y7MA 4Q56A 3TS8A 4LCWE 3FU0A 1H0DA 3NPZB 2YBGA 4HHAA 4NKMB 1G5GA 4X5WB 3VFUA 1SMAA 4ZTEA 5DRNA 1QKZL 1FJ1B 3VSUA 5J0BA 3BVXA 3B2DC 2YD9A 4UZGA 1MF2L 1AS7A 3PHAA 4E41A 1A1MA 1AZCA 2GSMB 4FHBD 4JDZB 4WO4C 3ARFC 4R7LA 1YVLA 2NY6D 1OO2A 2ZKWA 4EAEA 3HI6H 2BMKB 1IC7H 3WMSA 4KROC 4ZUUA 3QDMB 4A2FA 3WY4A 3QXDB 4OI7A 1J12A 3P4MB 1XTLA 3GGWB 3GJFK 3I9AA 4I1RA 1GCYA 2Y25A 2ATKA 4Y1AE 3FBKA 2D7OA 2XZAL 4G5ZH 3RNQA 5GIRA 3VFVA 4UINL 5AL0A 2QQLH 5EOCL 3GLDA 2XZZA 2BFVL 1DVZA 4DP5X 1QUNB 3QUYA 1A4KA 3RHWK 3UZEA 4U1HA 4M5SA 1AZZC 2GKIA 5I0ZA 5EOTA 3G5XB 1YEEL 2Q3XA 3ECWA 1ZA3B 5F7YC 2ZG1A 5CJXA 2DQFA 4X99B 5HJBA 5LCVA 4FQ2H 2XKNA 3FO9A 3TZVB 4N0YH 3ZDYE 3HS0A 3SE3C 3ZU8A 5L9DH 1F3DJ 1BSIA 3RWGB 1E3FA 4FNPA 4XN4A 5AZEH 1IE4A 1QTYT 2M2DA 1IEHA 5BRZD 5FXCH 1TU2B 3DBXA 2RAMA 2YAEA 3QQ9C 3BVNA 4HLEA 5I1GL 3EYQC 3KYMA 3MNVA 4RH4A 1E2ZA 1U8CB 1A02N 1F6AA 3KYKL 5KVDH 4L18A 4WUUB 4X98B 1DCLA 1BA9A 3CFJB 2BNUA 2I7SA 1JJUA 3NCCB 3RGBA 2NTSP 4I5BA 1NCAL 4Y9BA 1PG7W 4HV8A 2AJUL 1OSYA 5IHLB 1AKJB 3QIBA 5DURD 1S9YB 3L48A 1GC1C 4EN3A 2DYRB 2Z8VC 1AANA 3QJFB 4ZXBA 1MLBB 1WSST 3LNIA 3UTOA 2IQAA 4Y4HD 1A3QA 1MIMH 5CJ5A 3TO4C 1DDHA 5CMAA 4QHNB 2CGRL 5HD8D 1JPSH 1TZGL 1ODUA 1KXQE 3QUYB 3VCLA 2BNRB 4C83A 1CI5A 2OL3H 5DJCB 3S4SA 5HHQB 3P69A 2FJSA 2VDOL 2FJFA 2C1PA 2NRDA 5DEFA 5IJBC 3OKNB 3ZL1A 5GRYA 3EF7A 2FX8H 4YHZH 4KAQH 4DT2A 3HG5A 1PZCA 3ZDXE 5J06A 4EZLA 3DX2A 5JLZB 4RCAA 4GW4A 2D31A 4XR8C 3UZVA 1DN2A 1RURL 5EWIH 1FRGL 4HS8H 2F19H 4OGYH 1X5JA 4HJIA 4YFLI 1JFHA 3MAWA 4B3EA 4DZ8B 4MKTA 3KJ6L 1CD8A 1FHGA 1J1XH 5EBWB 1OTUD 1YY9D 3QZLA 5I5IA 3MRMB 4I0PD 3BIAX 2AANA 4MNHB 5HYJA 3HMXH 4YIQB 1U3NA 5CN3A 4F58H 1BQUA 4QPEA 4J1UB 2AK4A 4JG1H 2HWZH 3L2NA 1IEBB 3OM3B 2MOVA 5DRNB 5AYUH 4Z7UB 4YSRA 4Y4FD 2R1WB 4RMRA 3FFOA 2XI9A 4F7MA 4NZFA 3UJTL 3V55A 3EJYC 1WPCA 3LNFA 2WOBA 3PWLB 2VC2H 3QW9A 3MCYA 5DUPL 3OKLA 3VXMB 4L4TE 3BVUA 3VMPA 1X3DA 2B3RA 3KVQA 4W9ZA 3QZOA 1PVHA 2IBZY 3QGVA 1MAJA 4S1SH 3HRZB 2W0LA 1D7BA 5T3ZL 5IKCA 1NAMH 3IKCB 1XGQB 1KB5A 2WWKO 3A67L 4YHOH 5GS1B 3Q2CA 2LAGB 2NYYC 5C2UB 5TDNA 1YY9C 5IQ9A 3QPQC 2VW7A 5CEZL 4LLDA 2DBLH 4PRDB 4EIGB 1FO0A 1X9LA 3AXHA 1C7TA 3OF6A 1KB5L 2JWYA 3PWJA 4GRWF 2IFFL 4JEGB 2XTLA 2JKWA 4P2QB 4TKWA 5ITFA 4UQIM 4F2MB 3D0LA 5D1ZD 4WFFE 2HRPL 1JDDA 4Y19B 2EUWA 1J5HA 4TNEA 2Y07H 1S78D 4LDCA 5AEAA 3BZ5A 3WEBA 4EDWH 4L29A 5JHDE 2L8AA 4NBXB 1TOXA 2PCYA 2X4SA 3EYOA 1E27A 4JZJB 2FQGA 1MAML 4P4KC 1SYSB 1LMKA 4NAQA 4F5CE 4HIQA 5E6IC 1I1FA 3HZYA 4NERA 4Z9KB 4WF7A 2XA8L 3NCJL 3QCTH 3G5VA 2X1OA 5DRXB 4IIZA 1K8IB 2VAAA 3NDZE 4G8IB 4MNQE 1L9OA 4F8LA 3F7YA 3GBMH 3IXAA 3UZEC 4X42A 4EVNB 1BVNT 2JCCA 2FIKA 1BD2B 5BVJB 1E2WA 5I30L 2QFRA 1GYCA 4G83A 4MKMA 2APVA 5EIIA 4FZ8H 2NX5E 1N5AA 5DMGD 1E42A 4XBMA 4DO5A 4XXDB 4KDTC 2NY0C 3D2UA 3F00A 4JL1A 3L4TA 2X6MA 5CCJA 4NRYB 1IGJA 5CWSA 5GJTH 1TKWA 3HA0A 3IMSA 4MZIA 4ATWA 4FFWD 1B88A 2VR6A 3KPPA 4G80B 5FOJA 2AZAA 3IF1B 5LG6A 2YC1A 2O30A 15C8H 2BDNL 2EUXA 3SDCB 3LQAL 1X6LA 5E99H 2VERA 4KTYA 4WO4B 1KULA 2B20A 1JVKA 3BRDA 3DSFH 3LDBB 1BFTA 4LCWB 2J1YA 2ZKHH 2JB5L 1J1OH 4MXWL 2X6CA 3B43A 4N9OB 2JJSA 4LSTL 4E68A 1QZNA 1HSAB 3NZ8B 2XPGB 2YXWA 1S5HA 32C2A 4FKHA 5KSUA 1FGNL 2R1XB 4JB9H 4QXUH 4IRZL 2BHFA 1VENA 3CCHA 1DR9A 4P48A 1E9OB 5DYOA 5JW5A 3NBNA 2ZF9A 3UG5A 2ID5A 2YD1A 3ULSA 2K9UA 5EBMB 4KHTL 4M8QA 1FAKT 1QQDB 5ALBH 3TO4A 1X6NA 4HC1H 3NTCH 4LEOB 4OCXH 3WY3A 3BPLB 5JXAH 3L5WA 3EXJA 4JG0H 1ZLVK 4RESB 2COVD 1D5XB 1KY7A 2HT4D 3VXSB 4XODA 3EAKA 1CICB 4N87A 4F8QA 1TQTA 4HJ1A 4N2FA 4YDKL 1NMAL 4LLYB 1U2YA 4FG2A 4OF8A 4UAOC 1K8DB 2G9HB 5I15H 5IQNA 4N0RA 5E1IA 3TPUA 1AC6A 2W5PA 3N0AA 1S9YA 4AQ1B 4G42B 2IXQA 3BP7B 4GMTL 1A6UL 4H1LA 2XN9A 5AVTB 2OSLB 5GISH 3CFBB 4WHYG 4TNWK 4WFHD 3CPUA 4FXKC 4PS3A 3MQIA 3RDTA 3UXFA 3JWDC 1XSOA 2AQ1A 4ZPTA 4M62H 1T6WA 3BUYB 1ZV5A 4WJG3 1MCPL 2R69H 4YXLH 1U92B 4JPIA 2NY1C 4KKCC 5L8JB 1KJ2H 1R3KA 5GS0C 3A6CH 1JGDB 4LLMA 3RX7A 3VFGH 1IEAA 3TN0B 4HKBB 4YDLB 2NT0A 2L7JA 2ZUSA 3BAEL 3EZ8A 2NOYA 4Z18A 4TTDC 5C09B 4UV7H 3D48R 1C08A 1ZSDB 1IQDA 2R0WH 2X1QA 4E41D 3FUNA 1MCOL 2DQEL 5H94B 3V0IA 2AJUH 1GGTA 3IDXH 4NRZA 3SYQA 2H2SD 3OHXB 3IJ8A 1QLEH 3UMNA 1UKSA 3FUFA 3UAJC 1AHWC 1J1PL 4U3SA 5LKNA 3IU3A 6FABH 3BCDA 3GK8L 1DQDL 1Z9SA 3MZGB 3FF8A 4GG8A 4UILL 5E6UB 3L9EA 3V6ZB 1QEWA 1HFUA 3HZKB 4NFDA 5D7SH 4N24A 2G5UA 1A4JB 3DV6B 2APSA 4KKCD 1YO4A 1DBBH 2G60H 3RVVC 1YDPA 1AGFA 4PGCA 1CLYH 2QSCH 2YD8A 4R0LC 4HJUA 4K94H 5ERWB 1CICA 4JQIL 5D7SL 2F9BT 4M1CC 2OFQA 3O6FD 3NJMA 1ORQB 2WKGA 4N68A 4OZIA 1MCFA 1YYML 2WCGA 2XWTA 5BUGA 2HT2D 4JAMB 3CVDA 2GTZB 4B97A 5M94B 1JOIA 4YK4C 4U1KB 5DWUL 4C55A 1I3RB 4LSVH 4KTDL 4YBLB 5D7EA 1ES0B 4U1NB 4U2ZA 3IDYB 4BFIA 1RSYA 8FABB 5HPMB 1UWEL 43CAA 3QG6B 4XNUH 5B38B 3SDAB 4K3EL 3UAAA 4F91B 2P52A 3JXAA 3FN9A 2HWZL 1VF5C 2N7SA 5BRQA 1WFTA 4HT1H 3QQ4A 4HGWB 1UACH 2V8MA 3I6KB 2XG4A 4G6FB 4HJGA 3RKPA 1AXSA 1A6TA 5EU6E 2VR7A 1CD1B 4P46B 2B4CC 3DPBB 3QG7L 4M1CD 1UWGH 4OFQA 4WFGD 3D69A 5LDUA 4E9LA 4XMLL 3ARTA 4RZKA 1UACL 3LPWA 2C9VA 5D7IF 1FLRL 2A74A 1RUAL 4TULH 3IM1A 4CADA 4Y8DC 2CR6A 1MCDA 4G1MB 3TCLB 4XCNB 3V5HB 3O6FA 4P2OC 3U7YL 4DPBX 1WZMA 3NK3A 1I85A 3QZPA 3FPYA 1YAIA 3BGMB 4JFPB 3MRJA 3HR6A 4GQQA 4M61A 1KIPB 4R96B 2ROYA 4GIPD 4J3BA 5F89B 2GBAA 1NFDA 3TYGH 2PYEA 3ARGD 1FNEA 4N0UB 3SCMB 4KK9D 5TFSL 4JFYA 3ME0A 5I1AB 4EQ3A 1DBJL 1SEBB 5IMMA 3WFEH 5FEBA 3POCA 4ADJA 2NY4C 1G9HA 4G9FA 3O8XD 5IESH 2EDKA 3N40P 8FABA 4S10A 1CGSL 3TWYA 4WFHE 3MHZA 4ONHB 4NN7B 1NDTA 1RULL 1INEL 3VH8G 1KZQA 4JM2D 5ANHA 3X1EA 1G7PA 4TQPA 4B9YA 3W9DB 1RUKH 3KPLB 5BUPA 3S8FB 1A6PA 1RHHA 1QVOB 5ITFB 4L1TA 2WZAA 3TTSA 2FEDC 3MNDA 4DPRA 1ORQA 4TNWF 4F93B 3RNKA 4AKOA 3ZOAA 1NIDA 2EE9A 1SLUA 3U25A 3WKNA 2F8VA 5T1LB 4ICXA 2J4WL 3KPQB 3N41F 4X83A 1HK6A 5J4MA 3MV01 4XGZA 2VDKB 3AB0B 5TDNB 1TNMA 1TCRB 3LKNB 3E0GA 1CL7L 1GYUA 3O45A 4W81A 3RGVC 1W8OA 2X4OB 4QJ5B 3GXTA 3W0WE 1FAIH 4KPHH 4ZFFA 3KYOA 2I9LB 5CP7A 3VWJD 5I1CH 4MA1C 3BPCA 3FCBA 1BJMA 2CO3A 4KMTH 3H7LA 3QUYD 3UTZB 5JHLH 4HIHA 5EZJB 4M5YL 5IM7A 1YEKL 5EZOL 2OCJA 4OF7A 4WW2B 4JN1L 5ESVA 1HXMA 2YD3A 3P2TA 4MDRA 15C8L 2BDNH 2QADD 4AW4A 3VFWB 4Z7IA 1BYPA 4DJMA 1B2WH 5GGUA 3MTXA 3L3OC 1HHKA 4URTB 3EH5B 1NAMA 5I16A 3VW3H 3QZWB 2PXYA 1W80A 5DFTA 4OQ1A 3ARBB 1FHNA 2Z7WA 4GXVH 3N42B 5C09A 1QFWI 4MD0B 3QRBA 1P1ZB 3T0DA 2IANB 4JO1L 2GT9B 2D0GA 2FWSA 1KYOJ 4GP5B 4PP2B 2YN3A 1EH9A 5C0BD 5FWRA 5C97A 4CW1A 1ETZA 5FYLL 3WFHB 3KWWA 5SWSD 3F12B 1E6OH 1QFUL 1INDL 4PEEA 1C16B 1AIFA 1FNSH 4TQEH 3DBSA 3I50L 4WSGA 3MUZ1 2R0LH 2EZ0C 5TE6H 5EF1A 3HI6L 1IAMA 4OVVA 1LO3L 1OGAA 1U8LA 2MNWA 3ML9A 4EEEA 1SOXA 5CBEA 3VFMA 2ZXAA 1IV8A 3CH8A 1F4YL 5DC0A 1JZ5A 4TTDD 2O61B 2G2NA 1OSEA 4IK7A 4L3CA 5CMAB 1MCQA 3FCTB 3RTQB 2OYPA 4G7RB 1TEGA 2F58L 5KBDA 4LEOA 4JCLA 4FAAB 1DQIA 4HIIA 5DR5L 3ZSTA 3UO1H 4Z7NF 1DUYB 3VAEA 1AHKA 4OIBA 1JRHI 2DS4A 1KB9K 3RUGF 1QAWA 2DIAA 1CFSB 5B1BB 3TIDB 1TQVA 4YAQB 1JL8A 5D2NA 2EUZA 4BDVB 1A6AB 4ODXA 5IMOB 4J23A 2QGCA 2YFNA 2MPAL 3KW7A 5DQDL 2CDFA 5E8PB 1V3JA 3V4VL 1M7IA 1LNUA 3MUGA 4M1DH 3I75A 5KVGE 5FPIA 3SO3C 2FYYA 3CSYB 4Z3TA 3J07A 3WLBB 3QIWB 4HMDA 2KMWA 4TNVF 5GS2D 3NIFB 3K6SA 3RU8H 4DGIL 2ZCLL 2YRPA 3WFHA 1FFPA 5MHSD 5LXGH 2CUMA 5AG9A 2ODIA 3KM2A 4PTTB 2QQLL 5EOCH 1A6ZA 4BKLA 5B7MA 1T89A 1UASA 5FFOA 2C3VA 1NCAH 4L8SB 1U33A 3RY6A 1HHKB 2OMTB 3PGCA 5FCUH 2QV4A 5I18H 5FF6A 2W59A 4UILH 3EO0A 3TBCA 1FNGA 4IRSC 1FVDB 5J8OA 4Y1TA 1XR8A 4NSKB 4PV8A 3B8SA 1Q9WA 1KYFA 4F1SA 2ZQKA 3B7YA 5I6XC 3V0FA 1F13A 1OSZB 5FHBH 4JK0D 2XY1A 3EH1A 4JFDB 4HGKC 2HVKB 4GG6E 1Z1WA 1F4XH 4UM9A 4ODUA 5E5RB 3T0EA 4WRLA 1K4CB 2PWEA 1DQQB 1M56B 3RNQB 3ZY7A 2C26A 3MJ9H 1IKFH 4Y16D 2E9BA 1H6TA 4CILA 3ZKMD 2ARJQ 3BZ4B 4DAGL 3N6YA 2IMNA 5ISZD 1HQRA 1MI5D 2J43A 3JT2A 4FA7B 4ZMWA 3RDJA 2OR7A 3K0WA 2NW2B 4PJIE 4Q6YA 2ESVB 5DZVA 1GZQA 3OL2A 1SXBA 3EH3B 2ZOLA 1LP9A 1FF5A 2D7TL 1ZHNA 4ZPVB 3WXVH 5FGSA 1T0NB 3ATFA 5JYLA 3GXPA 2Q6WB 1MFVA 2ZXEB 4G6AC 1ZV2A 3HG3A 4HHAB 1QYGH 1U3YA 3T0WA 5B3JE 4G9FB 3KPSE 2GYSA 2D7TH 3WXVL 5DXWA 1Z9LA 4PRHD 4WI5A 2YO3A 4HF5L 4JFYB 1YSOA 4WV1B 3ETSA 4U6VL 3WKYA 4LKXA 5KYXB 4JPWL 2Z92A 2DYPB 3IDJA 5AZ2L 1K4DB 4PRIA 4U3CA 5HDQL 2DM7A 5J5EA 4WIQA 1N7MH 4ZX3A 3G6AB 1NFDB 1OARL 2J6WA 5I6KA 1IAOB 3PL6B 4FLRA 3HFMH 3QCUL 2NR6A 1WCQA 5JIQA 4AIXA 1DQLL 4APXB 1VFOA 4LGPB 4OM0H 4UTAL 1WGVA 5E5MB 4OGYL 4QCIB 2MKWA 1AOZA 4HG4K 3ESNA 3LZLA 4Y19D 3MRKA 4ZTOL 2YPLA 3G5ZB 3CZJA 1ID5I 3MMEA 2FH6A 4BH8A 4HUUA 2BS71 5DVPA 4PYGA 4IS6B 2J6EA 1AQ8A 3B7SA 3AC0A 2ZUXA 4KDWA 2OPCA 5DJZA 2OSYA 3A47A 3FUJA 3DNKA 1ZVHA 3KMDA 2D4FA 1G7JB 4X0KB 3VXSE 3KYNB 3HNSL 2ESVA 3HNVL 3IPBA 3X2QB 4HEMA 3S9DB 1JF5A 2KZBA 3KWXA 3WTVA 2E6QA 3VGAB 2FSEB 2X9YA 4MHHI 2OK0L 4XBPA 5FW8A 3C5ZD 5JLZA 5ISZB 1A0QH 3SKJL 3B7UX 3V95A 2MQ0A 5EZIH 4B53A 5B8CC 2IDUA 2JKNA 2F15A 4HHWA 4CVZB 4L5FE 3RZWA 2DQCL 2VITB 2GSIA 4AY0A 3US0A 5D7KE 4KJPD 2FB4H 3O6LL 3D18A 2X4RB 4HAGA 3ATBA 3X1GA 4AYEC 2C1OA 1ZTXH 4CJ0A 2JXMB 1S5IH 1DJGA 3KXFA 3D7PA 4JAMA 1L6ZA 1A7BA 1CF1A 2X0VA 4P2CG 3MNZB 3VU1A 2PTVA 3X11B 2QV2A 5J89A 2QSVA 2VRQA 3D0VB 3GSWB 4J3VA 3TEYA 2IOOA 2ZWNA 5ICUA 1RP8A 3O4LD 1Q1JL 4FTDA 1AGFB 4KQ4L 4LLAA 2IALB 4J27A 1XAKA 4G3YH 3TL5A 3TURA 3K6NA 2WWOA 5A2KH 2VTFA 4LSUH 2VDNH 3EJPA 1ZMYA 2Z4TA 1I7TA 4KK6C 4Y8AA 5L2KE 2LU4A 3P40A 2J20A 3KHQA 2E9IA 1B0WA 5AUMB 4QYAA 4Z1PA 1JPGA 2OKMA 3C8KA 5CFAA 3BT2H 1P4UA 1WS7A 1NUDA 3CBKB 3CU7A 5AB9A 4KWUA 1ZT7B 3WFCL 1VPOH 2C9UA 3MBEB 4JY5L 2CLZA 1F3RB 3MCKA 3TA3A 3BOVA 4K73A 4UYQA 1E5AA 3FC8A 4W9HC 5D8JH 5E99L 1PL3A 1NBVH 1AFVL 3LIUA 5KJRH 5FA3B 2F54B 5DVMA 2A6IB 5KEZA 1MHCA 4KGJA 4LCCA 2X2IA 1ZLDA 1VHPA 4K8RL 1TFPA 5ICZB 1DLHB 3QPXH 4Q97A 3FRPA 2WP3O 2ZXDA 3RTQA 5IQMA 3RY6C 1TQBC 3NJXA 3LRGA 3ARFD 3E6FA 3C12A 1MQKL 2BVPA 2EDQA 2VRKA 1KTCA 3E3QE 1TR7A 1E9QA 1T89C 1AH1A 3Q8CA 3MODL 1UHVA 4L8DB 4ZAKB 3U6RA 2R2CA 1XCQB 1JXFA 2AJ3A 2ZXBA 3CU1A 4NIYE 2RFXB 2AI0H 3T3PF 3FSAA 3OKDA 2YMXH 2X2YA 5D93B 5DQ9B 1U4EA 1NEZG 4NS0A 3NTCL 4N6RA 4YVUA 2P43B 3ULUF 3VFTB 1UJTA 3DETC 2FBRA 2V9UA 4KROB 2ZZUT 4PJ5D 2NNXA 5IEHA 3S8WA 3W82A 5HHPA 2P5WD 4I77L 4I48A 1S3RA 4QHUB 4G8EA 4JPKH 2IC2A 2GIYA 1CDYA 1L3WA 1F00I 2VLKD 3HE6D 3IDNA 3MACH 4MMZB 5E1AA 3S36X 4N6RB 4AMKL 5H35A 4ZMZA 3WS3A 6PAZA 2UY6A 4XNDA 2K3HA 2GCYB 3F7KA 1UJ3C 3O4LB 1A8ZA 5EFIA 4A04A 5EO1A 3EYSL 4WI3A 3F6IA 1EZUA 2A7BA 3FFCE 3OAWA 2WO3B 2V5MA 3US1A 1QTSA 2W8CA 3ARED 3JWDL 3MRNA 5ETUA 1A7PH 2CSPA 5K9KA 3QIUC 1TZAA 2PR4L 3K2IA 2DQTL 3EF4A 4UNVA 3FUDA 3ILPB 4N2AA 2Y6TE 5JR1H 2NQDA 2ESVE 2DRUA 4KO5A 1IGML 4HBQA 2GUOB 3O11B 5KYUA 3TJEL 1JNNL 3L17A 3NIDB 2QQNL 5B1JA 1X5KA 1BIIA 2G3XA 4LSDA 5E4OA 3S36H 5FUCE 4KO6A 2N7AA 3P2DA 2VQ4A 4WEMB 5C9JB 1XH0A 2R4RL 4BWWA 4PD4K 5DLMH 1KJVB 4K3JH 4U05A 3BD3A 4YDMA 1P5VB 3VG0L 3O8XA 3TA3B 1Q94B 2EVGA 2DLFL 2IPTL 4APQD 5FHAL 4ODVL 3GXIA 4QWWC 1KPRB 2V37A 2HN7B 1MPAL 1CFTB 4B7LA 1RIUH 4PJAA 4K8RD 2G4GA 2G4EA 5DVKA 1R46A 4URKA 1L0YA 3NVQA 3QIUD 3ZE0B 4D9RE 3PWVA 1XZ0B 1EAPB 4YZWA 1D6VL 3IEAA 2FEJA 4O4YH 3SZ6A 3L9YA 2ED9A 3QNZA 4EO5A 2WP3T 1PX3A 3LN5A 4N26A 1KFGA 4Z77A 4ONHA 3ZE2F 3GMRB 3B37A 4YHLH 2NZIA 4XMZA 5GGVH 3U2IA 1OTTC 5T1KB 2JIXD 4JFQB 3ZDZB 2CBTA 2F54D 2K8QA 5CD5D 5E2JA 2H0FA 4GKNA 1WC7B 3QYMA 2H5UA 2MNJB 3BAYA 4JGJA 2FX7L 2CRMA 1RVFL 1UCBL 4Y9EA 2KDYA 3WTWA 1NWOA 1H3UA 2V2XA 3I84A 4NZTL 4APQB 1QLFA 4X9GA 1J10A 4LDLB 1TQBB 3VDCA 4U6YA 1T2XA 2OI9B 4XVJL 1TMQA 3T3ME 3F2LA 3WE6A 1BM7A 2CGZA 2XOTA 5E4IA 1FFQA 1AJ7L 3LV3A 5C0AD 5GQBA 4HKZB 3TPKA 2V3FA 2LR4A 1H5BC 1L9RA 1BAWA 2WNXA 2XFXA 3VRJA 4GJTB 2YRBA 1M53A 3DTDA 2C34A 4FCAA 2Z0UA 1XGTB 3MC0A 2X38A 4LB8A 2ZONA 3I6SA 3BLPX 4OLYH 2NY1D 4OAWA 4PCKA 3OXRB 1NUNB 1OE3A 4XNQB 3S96B 4KHXH 2DYPA 3QQ4B 4HGWA 1IM9D 4YGAB 3VXOB 3ETBF 2LTQB 1R3HB 1E0OB 1X5YA 3L4UA 2R1YB 1E65A 2HRPH 2BH0A 4Z78A 4ZS7L 2EO7A 1QPPA 3GS4A 5BXFA 5EUOF 3U1PA 4O02H 2OS7A 3MV8B 4CMHB 3QIWC 1T5WA 5HBBA 4FFYL 1RZ8A 2VDPL 4XP5H 3D4GA 5DO2D 4P3DB 4PGBA 4PHZA 4Z0BL 5AVSB 1DVTA 4A63A 5IHWA 2EDBA 5EBWA 3U2SA 4OCSL 1WEJL 3JYBA 5GGRA 4X4YA 3WFEL 4WNQA 5A7EA 4FFYH 3MRFB 4Y9FA 1TEYA 2GJZB 3VXMD 2HJKB 2EP6A 4NUJA 3GT6A 1BM3L 1GIGL 1VERA 3N43B 4XTRC 4A7TA 1R33A 4XXCC 2VJ0A 3FSVA 4J2XA 4AQEB 2YGVA 1ITBB 5IFHH 1BD2D 3H0TB 4ZYKA 5K59E 3FB5B 2NW3A 2J88L 1GRWA 4JRFA 1I8AA 1FLTX 1FV1B 3NPSB 2BOBA 1FL3A 1IFGA 4F37K 3SBQA 5I8KL 1UXMA 1XDTT 2BSRB 2ZOUA 1JZ8A 2A0LD 1OSZA 2H1XA 1WFIA 3OHXC 1DJHA 1EO7A 2BWDA 3F5WA 4ZO7A 1KTJA 1KBKA 2VDNL 3EKCA 3RAJL 3D3VB 3NESA 4JFQA 5B3NA 5K9QI 3SE4C 3ZMNA 3OKEA 5IB1B 1MELA 3VSQA 5E70A 1YEWA 1DSWA 4PY8J 2Y7OA 2YFOA 2WUCL 3LN5B 3ZE1B 2B1OA 3RG1C 3VA6A 5F6HI 4BH7A 2A1WH 5D71H 3BP4A 4KMTL 3SSGA 1U8OA 4JB9L 2AXWA 4I9XA 1ZLSH 2CO1A 1EAPA 3SBPA 3PWVB 3O2DA 4LVOB 1JZ7A 3L9RB 1CR9L 1FVDA 1XEUA 4AQZA 3EJYD 3D07A 2VDRB 1RIHH 2BVUA 1OK8A 2AFNA 4JZNA 4X6CE 5D71L 1SVBA 3DYOA 1SMDA 2EEAA 1IJNA 4ODHH 4WLCA 2R51A 4BE5A 5MEND 3ARYA 5C0EA 2CBPA 4LCUB 5J1AA 4OSUH 2ZJSL 2IH8A 3RIKA 3SQBB 3LKSA 4HJTA 5F97E 1QWNA 4Q74A 2J73A 3V9FA 1BVLA 4X6FA 1E4WH 2XYBA 1X4YA 4AXWA 1A22B 1MFEL 25C8H 4ABWA 2WXRA 5D2NB 4YAQA 2G2RA 1MVYA 3FCSB 1JK9A 3T1WA 4PBWD 3FUIA 3U7WH 4HIIB 1JZEA 4OZHB 3VXSA 1X5AA 4KJWC 2AP2A 2QSQA 3X14B 2VLMD 4DEWA 3SKNB 2WXGA 1SDDB 5E24E 5BRPA 4L3CB 3IMTA 3W39B 1WHPA 2WYTA 4M8QB 4N20A 4UINH 4KOCA 2KZWA 3ZDZF 4Z7NE 3O8XC 4BHUA 4PJEA 1TT6A 3MBXH 4PJEB 4QNPF 2ICEA 4P9ML 1MRDH 3QDHA 4JFZH 5JW5B 1DUYA 2QQQA 4KBPA 2NQ3A 4ZMYA 2BK8A 2VC2B 5FECA 4JREB 2JKSA 4RIRB 3NJVA 2BP0B 4PJ8B 1BOYA 3GRGA 2AW2A 2VAJA 1JN6B 4PW4A 4FQ1L 3KXFE 4FXKA 2HRGA 2OAAA 1ZA6A 4GNKB 3KPMB 2NY4B 2J72A 2VERN 2GPZA 3ZPDA 3P11H 3BP6A 5FX3A 1X9RA 2J1KA 3X12B 1ERNA 1PX8A 1KCSL 4KJWD 4WK2B 3SE8H 1NBYA 1MZZA 1DQML 4MD0A 4IQHA 1E9QB 3HVDA 2NXYB 2BRRL 4YUEH 4PJ9B 1L5GB 5D1XE 3N1GC 1TLMA 4AKQA 2X4NB 1I75A 1QO3B 1WZKA 12E8H 2CLVA 3TBBA 2AQRA 5DS2A 4KNSA 3LRKA 4P4KA 5EEUA 4YBQD 1ETZB 3TT3L 3B6SB 3THML 3QEGL 2YMOA 4KKAD 4KOBA 1M3JA 2HT3D 2PWFA 3FQXB 3T2PA 2CQVA 1BD2A 3OJMB 5L0QC 3S3CB 2EVJA 1J5CA 4YX2H 2P5EA 3VI3E 3VWKB 3QFJA 4PJ6A 3ZDYB 3LDBC 5C92A 2K6ZA 1R3JB 3BEWA 3QO0B 2H8PA 2FGWL 4NZRL 2WO4A 2BINA 3KEDA 1DQKA 3SPJA 1CE6B 4HIXL 5T8IA 2P8MB 3FTXA 4GW1B 2HKFL 1CF8L 4AJWA 2E4FA 4IW4C 2GC7C 5KSVB 3TTYA 2H0JA 1L9TA 4ZFFB 2EIEA 1P2CA 4V33A 5DMJB 4PJDB 3IGFA 4HALA 4E36A 1JVOA 3MV8D 3PNRB 5EU7C 4YSUA 2WQ8A 2VN7A 3GRBA 3B9AA 1PEWA 2HKFH 1JD9A 4E9QA 5BUAA 4MASA 3J2PA 5D1XB 4Z0XB 1BVOA 1F6FB 2MCPH 2KBGA 3LHPL 4QHMB 1ZHKA 1UA6H 1T21A 3CLEH 5HHMB 1DLFL 5CINH 4LL1A 4XVUD 4OFYD 1DEEB 1WBXB 1GJIA 3MR9B 4QRUA 2V3DA 1ZK9A 2HLEB 4XMPL 4BA0A 3RL1B 2DJ4A 4I18B 5F7DB 4BHUI 5LHDA 4A7SA 3C60C 4HSQA 4QRRE 2CRIA 4JO2H 1JF1B 2EDYA 2PYEB 2QELA 2X4RA 3GS7A 4M43H 4IDJH 3HJ0A 3E8VA 4XMKH 5A16B 5LVEA 4C56B 4ZMAT 1CICD 3KHOA 2C4FT 1NCDH 3KBEA 1KIPA 3TGXA 1UM5L 2YN5A 2JQAA 3BQVA 4AGQA 1A9BA 5C6WH 1YHPA 2TSAA 3GEWB 3UJIL 4M43L 1D3CA 4X9YA 1EAOA 3VVWA 4JE0A 1LEIA 3GNML 4F7MB 4A2HA 2YAFA 4RAVA 2ZG2A 1ZGLB 3QXAB 1OAQH 4PB0L 4QOKD 5ALCH 2I60H 4X7TA 4UTBH 3GIVB 3T3PE 1G7LB 1XGTA 2O6FA 3ENEA 4BH8B 2OZNA 5CZVH 3VRIA 4E42B 3NJHA 1YA5A 4WW2C 4RAVB 4JKPH 5HI4D 1ROWA 1DDTA 3DSNB 4PS4L 1EJFA 2JIXB 3WO4B 3DVGA 4YEFA 2QR0A 2FQFA 3Q1SH 2LT9A 4ZXBC 4FTVD 2IFFH 1YYLH 2AQSA 5A1AA 4HUWA 3D85D 3QG6A 3MRLA 2PYEE 3QO1A 1PD6A 2FJHB 2DM3A 5L2JA 5CILH 2Z91B 4JPWH 1HYRC 2EEXA 3FOLB 2XVGA 2Z8RA 3Q1SL 3RIAF 5KBPA 2G30A 1F8TH 4YHOL 2YD6A 3LPPA 4D0CB 2APXA 5L6YL 4AV4A 2IDSA 3AG3B 2A83B 1F5WA 3DGGB 4QTHB 5GRVL 4OF5A 1RK1A 3D25A 4BZ2A 1A0QL 5T1KA 5KOVC 4ZTOH 5E0QA 3LXAA 1GCFA 3QUML 2EIKB 3K4DA 4NQVA 1N2RA 4W9JC 4M8VA 5B1CA 3ESMA 1BQLL 3VGDA 5I6XB 3EHBB 1RK0A 3DX9B 1HZHH 1PS3A 2HZHA 4S1RL 5E03A 1OZUA 5ID1A 1P2CB 1QSFE 1URLA 2V8LA 3Q05A 5I0XA 1C8QA 1T4KB 5F0LB 4YC2B 1UZ8A 1G7MA 3F3HA 2ZIDA 4K94C 5C0IA 5GXBB 5I28A 2R2EA 1VRSA 2E27H 2IAMD 2RA1A 3BKJL 1T1YA 5D2LB 1RXLA 1F58L 4K9EH 4GAGH 3QUYC 4JCMA 3ARDC 1OALA 5AKTA 5HHOD 1OAUL 4WI8A 3CFQA 4HIPA 5F6HJ 1K4CA 3CQFA 2AAVA 1LQSR 4Z7QF 4FABH 3A6CL 3WFCH 4XOAA 3UERA 3BSZL 3OXSB 3O41A 1EHNA 2J8OA 3DXAA 3HS0B 3IFLL 2R0LL 5GZOC 2EDXA 3QEUB 3WIHA 3ILQD 1AO7D 3TEZA 1SY6L 4EKJA 1OAJA 3FT1A 4IRZH 2WZPA 3RWHB 2LLNA 4IK6A 3E8UH 3IFPA 3DJ9A 4EXKA 5K1NA 5D7LA 3NRFA 3OR6B 4OFDA 1JPTH 5J6GB 1E50A 4OFIA 2FT8A 4YE4H 5GS0H 4HWBA 1JRHH 2QHRL 2MCMA 2Z34A 1MOEA 5EFIB 1FNAA 5IGXH 3MUJA 1JDAA 5HI3C 2YGNA 5A2AA 5IF0A 4HJ0D 2RBLA 1PZBA 2H32A 2YKKA 4OZ4B 3MLXL 1FL6B 3SBRA 1N3NA 3QXDA 5HGBA 4HU8A 3KLAB 4JLRB 2H6UA 2VOTA 4GQZA 1BIHA 2E46A 4NQDD 4YEEA 3H9SD 3VWKC 3GRWA 4RGMC 4Z7OE 3OQRA 3M88A 4XE5B 3PV6B 2OMWA 3DRQB 3NQKA 3I9GL 1NZRA 1RK0B 3DX9A 3GHEL 3T0BA 3ULSB 4K3DL 5CJOL 2GJ6A 2BY2A 4D3CL 2YOAA 5I76B 1ORSB 1TQUA 3UADA 4IBTA 2RIKA 4LLUA 4ERSH 2UWEA 4KTEL 4OBRA 5F3HA 5C0CB 4PBDA 4ODSL 2R4SH 2MKLC 4A37A 5ICZA 1MQKH 1YN7B 5HI3D 32C2B 2YPVH 4TLSA 5F71A 4AIZA 3HE7B 3O4OC 4YDIL 4M8UA 1U8LB 1MFAH 4MMYA 2K1MA 4OF3A 5CJQL 1SBSH 2WBJD 1J48A 3HNTH 2BFVH 4LSPL 1KZYA 5L2JB 2FX9H 3CLFL 5DUJA 1WAAF 1YEIH 3EOAA 2AC0A 5DVOA 3EGXB 4OM1L 4OVUA 1MHPL 4P3WA 3VFOA 3I02A 1MNNA 3CDGA 3N06B 3QEQE 4NRYA 3GKWL 4MAZA 4BQCA 3GJFA 4NNPL 1PNCA 1P4LA 4NNYA 4RFEB 1J8HE 4DGYH 4TVPD 4D9QE 1HNFA 2IIJA 1PIFA 1A5FH 3AUWB 1VFMA 4HX1B 2NSQA 2F7QA 2APWA 2UUDK 5T5NG 3ZGIA 3BJ91 3T6ZA 3LKQA 3Q6FA 2MHAB 1TKWB 2Q5BA 4GAYB 4DGYL 1WBZB 1FORL 3ARBC 2Y3NA 1OGTB 2BX5A 4YLQT 1LEIB 4AGOA 1A25A 1JK8B 2CJSA 1A2YB 4GY4A 1NCUA 3G6JA 4XZUA 3MGAA 4UQAA 2XTJB 4GSUA 1ZSHA 3QORB 4V2CB 4Y4KA 2WBJB 2O5NA 3BVDB 1PTZA 1S7VA 4K5OA 1ILSA 2GSIB 3LOWA 4OR1A 5DI8A 1FH5H 4G1EB 4HKJB 4YWGH 4L0ZA 2BVTA 3MKGA 3W2DL 1ND0A 3RURA 1Z6JT 2A99A 2VLME 5F7AA 4O2EA 1EANA 4U1SA 2XX1A 1KJMA 3B7RL 2XQYA 2HJKA 2I9TA 2GJZA 5ESQA 1OHQA 4OLEA 5FB8B 1N8ZA 3KPSA 3PL6D 1GGIL 4PRDA 4RGNC 1T5KA 3FN0H 5DS1A 1BFVL 3ZQ9A 4Y2DB 4MAUH 3CNKA 4J3TA 1AQDB 1BQSA 3CFEB 5GZNC 4I2XA 4YK4B 2WSKA 1SZNA 3FT3A 3BO8B 2GBUA 5BS0B 3EGDB 3FAWA 2KYIA 1FBIH 2CKBB 1NKOA 1S7VB 3KPOB 1QPKA 4HKXA 2A6JA 4M1GL 4XCYB 4B60A 2ADFH 3K71B 1SDYA 5G4NA 4BKTC 4XCCH 1OM9A 5DHEA 1YMMB 3UYRL 5KYWB 5CZXD 3PWLA 2WQVA 3RUGA 4PG9A 3P02A 5IROD 5A6MA 3SEPA 4GKZA 1JMZA 3P4LA 2IADB 3BKML 3K6FA 4IMKA 4XCCL 4AZUA 2VDQB 2DH3A 4V1DB 3VXUA 2Y9RT 3PL6C 2CJ3A 4G8GA 1DN0A 4XPBL 1I1AB 2DWSA 3D8MA 3BEVA 3VXMA 3ZDXF 3JV5A 2V7HA 1G9NL 4GMSL 4TULL 2CUAA 1QA9B 3TCTA 3IDYC 4S11A 4L9LA 5BRZA 1AKJD 1U3HC 3OKKA 4P2OB 4B41A 5IMLA 1QSED 3NSFA 3FTVA 4K7PY 1G4MA 3OX8B 1NC2D 4GW4B 2CUIA 4IOIB 4NWUH 3TN0C 3ARDD 1SGKA 1HI6B 2Q3AA 3N50A 2WWMD 5DZ9A 1MW2A 4PJXE 1Z3RA 5F7HA 3LPFA 1C5DB 3MJ6A 3MA9H 1BREA 3WFZA 2WANA 1QSFB 2BIIA 3X13A 5CLTA 1HAWA 1C7SA 1Z9PA 3IJ9A 1X7QA 2WKLA 3MOBH 4KJPC 4XP9L 4ZUTA 4QJ3B 4F24A 2FUQA 3CHPA 4LLWA 2B39A 4ZUWB 4PV9A 1OW0C 4KI5F 1AR1D 2V0AA 2YRZA 3GSQA 4XX1E 1JGEA 1YN6B 5IFHL 4J6RL 3KPRB 4CNIA 4FS0A 3T8VA 4TSCL 3UO1L 3K5RA 2ICEB 2X28A 5DJCA 3S4SB 1U8IB 1ZK5A 4KXAA 1VPOL 5TPWL 1NBZA 3M45A 4U6XB 5FO2A 4LT7A 4D9LH 1G94A 1UURA 3V6BR 2IDFA 3K80A 4CMMB 4NGHH 2BNUB 5ERWA 3N55A 1EMTL 2ZKXA 1XX9C 1UD5A 1O5PA 2X88A 2RB8A 4FKKA 4OLWH 3QJVB 4LPYA 4KMQA 1CR9H 2HKAA 2NYKA 1J87A 1Z0NA 3CVHH 3TYFA 4MD5A 2BO0A 1PZ5A 3TXAA 3CFMA 3MV11 3HR5B 4B9GA 3CK0L 3GO1L 4WSJA 4LAQL 5CIPB 4R9HA 3ABMB 2ADGB 5JHLL 2F68X 4Y19E 5B7EA 2DQJH 1HXKA 4AL8H 1OLZA 4R4BB 2WKOF 5HYQA 3KYMB 3MNVB 3QWQB 5DMIH 5LWYL 1C1EH 4JY6A 4FD0A 1HX0A 4PLKC 3LH2H 4NIKB 1H3XA 1M7IB 3N85L 4MMXA 4J39A 3LVTA 3TJPA 4AGLA 3DUSB 4MGXA 3FSOA 5FYLE 5JQ6L 4UT9L 1IEAB 4N2KA 2WZ0A 5J6SA 5EDXA 3WHXB 1I8KA 1U8HB 2LQRA 4PRHE 4WK4B 3T6XA 3KPSD 1XF2B 1AHWA 1V5JA 4L4VE 5F7MC 4Z95H 1QFWM 2X4TA 4PGDB 4NQQA 4L3AA 1V10A 4OJFL 3BW9B 4GRWE 4XPAL 1QSFA 2XU9A 5FLVA 3VXRA 4YFEA 1MY5A 5IBTL 5GS0D 3PDDA 3QQDA 5CSGA 3TF7C 4PRPA 4WUKL 4F15C 2AJ3B 4HULB 5B8CA 4IOIA 3GUTB 2HYMA 3LIZA 1OL0A 4EBQH 3ZO0A 4PJHE 3OVUB 1QG3A 4F80A 3P11L 3VXSD 3DXAD 2XN0A 3I9IA 4S1QH 1RJYA 3OKKB 1NIAA 4U3HA 4PJ8C 2XTJC 3A6BH 2EDMA 1H0DB 2CD0A 4L5FH 2J2ZB 4DEUA 3II2A 3N41B 3TCXA 3VA2C 4P9HH 2UZIL 1NMAH 2OTUB 4WI0B 3FSZA 2R15A 3MLVL 1E4KC 4AEHL 1KTBA 2OW6A 1Y18A 3WGVB 2VSCA 4PJ5B 2XJKA 1D7DA 4PBVC 3NAAH 4DQOH 2N56A 5I1LB 1O6TA 4HCRL 3FN3A 4L8BB 3B56A 4YXHH 2DN7A 1ZDQA 3P3SA 1E28B 1LGVA 3T4YB 5CEZH 5D1QD 1G7QA 1PJ9A 2AQQA 4XMXA 4KXBA 5E00A 4ANVA 2Y3AA 5DJ2B 1MJUL 2ATPA 2HT2C 4UNIA 3IDUA 5EA0L 4K8RC 4FQ2L 4N2LA 2X4OA 4FMVA 5F9OH 1W16A 2EKSA 3H1ZA 4YLBA 3SOBH 4G80A 3V9EA 1DQMH 2OQJB 4FCHA 3HN3A 3I3EA 5E2TH 3CFEA 2K6YA 3RWCB 4LMQI 3MRQA 5H2BB 4AGNA 1F11B 5JDJA 2HSIA 1ZS8A 1TYJA 1H3PL 3MOAH 5IUCA 4XN7A 4ELMB 1KLFB 5E9DE 1FE8L 4U1GC 2MQGA 4TPRH 5ESQB 3KLSA 3H9ZA 4LDOB 2OP4H 2O1AA 4HDIA 4LASL 4P99A 1UOKA 2RQEA 2Y24A 5D7IB 1NCTA 3KPLA 5FGCE 3UACA 2E7HA 2VLJD 1A6VL 2V2XB 3K1KC 2W0KA 1V54B 4FMFA 1RV6X 3SGEI 4JM2F 4HCRA 1SUHA 3D06A 5FCSH 5C6PB 2FBJH 1WC7A 1DBML 4XPGH 3GHBH 3GMPA 1MKFA 2V33A 1QSFD 3V0DA 3IDMA 4NENA 5MENA 3KDMB 1WFJA 1I9EA 2VXVL 1C12A 4HF5H 2XWBB 3VFNB 3E38A 1NM9A 1FIEA 3KE0A 3GM8A 4M7LL 1Q1JH 4Z0XA 1KYOK 5IMKA 1OF0A 2VGLM 5IOPB 1TTUA 4IU3A 4PJAE 1ZVSB 1NTDA 2K78A 1DP0A 4U7MA 3CBJB 3PS6A 4OV6F 1R5VB 1U8QB 4Q9BA 1RZKL 5B39B 4Y2NA 1K5NB 1JV5B 2CHWA 3U2JA 4JQVA 3PFUA 1PMYA 1UYWL 3EUDA 4IRSA 4LSQL 2K7PA 3PWPD 1SPDA 1KPRA 1WZ1L 1T6VN 2WBXA 2PW1B 4FNLL 5E2VH 3GMLB 5TK2A 5MERA 2Z8SA 2Y22A 1P5VA 1QBMH 5GS1A 1SJEA 4P2YA 1WEJH 3HCVB 5IFJB 4PJXF 3VSTA 5JORB 4FTVE 5DJYB 1KLUB 1FYTB 4ODWB 3AMLA 3C5ZA 2H3NB 3PXHA 3MRBB 4JFXA 4LL9A 3V6OE 3A67H 1YEDA 4HOZA 4PJXA 3IB4A 3BKCH 2Z7YA 4GI9A 3PV7A 4A68A 2X4UA 1XGYL 1XR9B 1YYLL 2Z4QA 2GY5A 2HAZA 2I32A 3BIBX 3B2VH 4XVTL 1JV2B 5HTSA 4GSXA 5KVMC 5DA0B 1XMEB 3AXLA 4BFIB 1WIUA 2R1WA 5HPMA 3RIFK 4QOKE 4JJ5B 4IBYA 2NSXA 4GOSA 4K71C 2EDLA 3VXTA 1NBYB 3ESPA 5IVXB 4K0OA 1AY1L 4E5XG 3LXCA 5HYJB 3G5YA 5F1KC 4Y5VA 1VZGA 4JO3H 4WI0A 3AU0A 2Z35B 4KVNL 3DX7A 2P24A 3WO4C 2ITEA 3C5XA 2OJEB 4ZTPH 5BZWA 1TTRA 5DFVC 1UOLA 2QGDA 4LCIH 4P5MA 1YMMD 4XMWA 2WNWA 4PGCB 1BFOA 4WZ9A 3MXWL 4EOWL 3AZUA 2D31B 4FFVC 1XF1A 4KQ4H 4LLQB 2H2PD 2EABA 4UB0L 2X7LA 5EZIL 3GUTA 2FD6H 2I7OA 4PRPB 4AYFB 4QEGA 2WUBH 4M7JL 3DV6A 4QMEA 4HUKB 4TNVK 1TJIH 1IZJA 2VO5A 1RU9H 1EVUA 2YD5A 5HSFA 3V0VA 1TVHA 1J5OL 2HVKA 2IBZX 3MLSH 4QRBA 4RGNB 2VWEC 1QRND 3CSFA 3V8CA 4G59C 4G7QB 4ECNA 1IGTB 5C0ND 5DVNA 4L1HA 3RVVD 4FQLH 5IHBA 3IFOA 3V7AG 4JDVA 5I1IH 5JIPA 4XN1A 3FB7A 4J3SA 4LBEA 4ETYA 4RGOL 2NX5B 1RMFH 3ELAT 2WZ6A 5HYQB 5CSZA 1GHFL 3NZHH 3PJLA 1KEGL 1AGDA 1CL7I 1KXVC 1IQDB 4MRCA 4LAQH 1EPFA 4YE0A 1AO7B 5D7JA 2VDMH 1EBAA 4K23H 2ISDA 2V2WA 1RZIA 3BSZH 1QABA 3FTGB 3S6CA 4BYHA 4ALAL 4JFDD 5DFAA 5ITBL 4YZFE 4KXZH 2F53E 4PRID 4U1IB 4AYBA 3BPNB 4WEEA 4LCUA 2OYLA 1D2PA 4NN6C 2L7QA 3L3DA 3CFJA 4ZUVB 4Y89A 1KNOB 1ZT7A 4EDXA 2JI2A 4PRAA 5HI5C 2DF3A 4PRAB 4Y2OA 5JNYA 5JNYB 2ADGA 3G7TA 2WINA 3QORD 3S5LB 3SB3A 1MPAH 3CGTA 4PJ8D 5DEGA 3C8KB 3V52L 3W0WA 1EZSA 2IMMA 3LN4A 1MRCH 3IPEA 4W93A 4W6XB 1A8JH 1DEDA 3RDTD 3ALPA 5GJTL 2W38A 4Y1AA 4JFUA 3FQYA 3KH3A 5DWUH 4NBZB 3GHPA 2AVFA 2X1WL 1VGEH 2W80C 4L05A 5FM4A 5IUSA 4F8TA 3FO9B 5AAPA 3ARFB 2XWRA 5E8NB 4QRQA 4BUGA 5EU4B 3UJJL 3VRLF 2D2OA 3NFSL 1Z7JA 3G5XA 4H8PA 3WXWH 4UM8A 3TT1L 2Y5TA 4NAJA 3ZJAA 2W65A 1MLCB 3TNMA 1IGTA 2PWHA 5L0QB 2FGZA 3E7JA 2ZICA 4PWGA 4C47A 3GEFA 4OZIF 1G84A 3RVUD 4QGYA 4B27A 1N64L 4LEBA 4LEXL 3LRMA 3RA7L 1VEMA 1TQSA 2ITDB 1M57B 3QDGA 4OFPA 4U1JA 1I8MA 5EUOE 3B5GA 3CZSA 3KLDA 3IPFA 3KL0A 4D0BB 2HFTA 2N59A 1IT9H 2O5ZH 4I77H 4N5EC 1N5YH 1UXSB 4X8XA 1O9VA 2YK1H 1URZA 2WLIB 1XT5A 5DJXA 3WE1A 3ZTNL 2EACA 2VUKA 4XE0A 4A7UA 4ZFZA 2C3HA 4HZ1A 3E3QC 3T0EC 1E5ZA 3BEVB 2GT9A 2DKSA 2IANA 3LRHA 4ZAKC 2LE9A 1NEZB 3EYFA 1GXEA 3GQFA 3LTVA 3MUY1 1BX2A 3PABB 4HXBH 5EU5A 4ERSL 1OP5H 4MNGB 4Y9CA 2HLAA 4Y16C 3O6FC 4P2OA 5AKRA 3IDXL 1JWSB 3RILA 2YUZA 3HZMA 4ENZA 4NO0B 2PCFB 3II3A 1KBPA 4PG9B 4TRPH 2OJZL 3R8BB 4NI3A 5GS3A 4QRRA 2WVVB 4K3HA 7PCYA 1B4JL 2ZCLH 4BSVA 5A6IA 4DCQB 4PJXB 3BH8B 5BOPA 4LU5H 3TWCL 5CP7B 5TQ2L 3VXUB 1M6OB 4P23A 2P80D 2W1NA 4MWFB 2X3BA 1OQOA 4DEPC 4BQBA 1K4DA 5IZ7A 3ULAB 3SJVA 2OJZH 3BD4A 1JNLL 1Y0LA 3MV9B 4FJYA 4ZO9A 1I8LC 1AR2A 1JGIA 1RP9A 3LKNA 3V5DA 1AMXA 4KV5F 4JGUA 4ANWA 5LBGA 1X9QA 2B5IB 5HHNA 1KCRH 4C56D 3REWB 3LCYA 1TZHA 5I1KH 1E8ZA 5D7IE 4JZJA 5DJ8A 1H8NA 3K2UL 3VE0B 2W0PA 4NQEA 3IRZA 4TLUA 2BVYA 4PJAF 4RMWA 1NANH 1EXGA 2DIJA 3FT2A 4H0GA 1S9VA 1FH5L 2PMZA 3QWRD 4FULA 3HE7D 4PB9L 1IKNA 3BPNC 4Z7UF 3U4EA 3U4EB 1ND0B 1ZVSA 2AEIT 4AOFA 1YCSA 4BZYA 2NY6C 3ARVA 4CU6A 4OKVA 3H6AA 4ZMTA 1CK0L 4MMXC 4YHLL 1JZDC 2XIIA 1M1XA 5AW1B 5FGRA 2HTKD 1T03H 1KCWA 1VB9A 2D9CA 5HDBF 2WLLA 5IB4B 1Y6NR 3C5JB 4G6FD 2XG5B 3HRPA 4HC1A 2YQBA 1DSFH 1WBYB 1J9CT 3ABGA 4IRZA 2X12A 3PHOB 4JKPL 3T0EB 2V17L 5DHYA 3UP6A 4J8QA 2JI3A 4PJCA 4JR9L 4JJHA 3LSOB 3DX6A 3KGUA 3VU2A 3T6QC 5C0AA 1NC4A 2B0SH 5DMIL 1A1NA 1JYXA 3QUKB 5CN2A 4PJFA 3UAJA 1QR1B 1EJOH 3JWNE 1WK0A 4JO4L 1JK8A 1YNLH 1ACYL 4YHPB 2PCFA 1FNGB 3OPZL 3S88L 4ZSOA 1CCZA 3K6IA 2CAKA 1GS7A 1NGWB 5ANME 2HA1A 5C6TL 1G7HB 4J3OG 3QDAA 3PABA 5HYSA 4GP8B 1EJOL 1G6RL 1LK3H 1BZ9B 3ZIYA 4XXCA 4YHML 4FXLA 2YIHA 1IC1A 5AWNH 2PXYC 1BZ7B 3WKPA 5D6CA 3QRGL 1ZRUA 1V3MA 4AC4A 2XACC 4CSZA 1RY7B 5I8EA 1YY8B 2XSKA 4LXFA 1JGVL 4XN5A 2F1AA 5E95B 1K85A 1L9NA 1NPUA 2OA9A 1JN6A 5C0NC 4BFJA 4UDUB 3BZEA 4WI6A 1I3GL 4KVNH 4PJDF 1PLAA 2LVEA 3FQWB 3OKNA 3FMGH 3ERXA 3WDJA 3BHBA 1OP3H 3B5HA 1I7UB 1S7WA 4CBPA 2WCPA 4G8FA 4LDEB 3QA3B 2XIDA 4H0IA 4HMEA 4OIFA 3ZRCC 1N6QL 4QGTA 3ECBA 3IN0A 4B9ZA 2BHYA 1G1OA 5F3HB 1IM9B 3TYGL 5EOCJ 3ZE2B 4BSJA 3ZDYF 2VDKH 1EUUA 2CHNA 5DFWH 3BYYA 2G75B 1G1YA 4BGDA 5E2WL 2WIMA 4TXVB 3M86A 4ZFOB 3V0HA 3VFPA 5JW4M 3ZHFA 4WEBL 2F5AH 2J6EH 2WXJA 3CDZB 4X9BA 1VEOA 5DYFA 2XPZA 1AXIB 3KBHE 4UDTB 4IGBC 2IEPA 4RGOH 5CCKL 4NC0B 3E1ZA 1HHJA 4H0LC 3RB7A 5MI0B 1PKQA 4WGWB 1JNHA 4R97C 3DYPA 2BVOB 3T09A 2OULB 4QDGA 4KY1H 2VCOA 4FQHA 1KENH 5DC2A 1KNOA 2MCG1 5GGQL 3Q5TA 2WJ5A 5D55A 1AHWB 4OD3H 4M3KB 5DUMH 4GO8A 1Z2KA 1UZ6E 1HL4A 4GRLB 4NJ9L 3VDAA 5FUOL 3POHA 4CU7A 3O41B 4WNSA 3OXSA 4FFZL 1LJMA 4UTAA 1WHOA 2A6IA 2NY2B 2FHBA 3IFNH 5EU6D 2BCKA 4HCIA 5GZNA 5LWYH 3DUSA 5D1XD 4BUHA 4YMPA 3RWHA 3DETD 4DPCX 1NJ9A 2OXHA 2NX5A 3PWPA 3UCQA 3CMOH 1KACB 5DSCB 3QEUA 4QXGH 4G6JH 1KEMH 5GJSH 3H85A 1HWWA 5BV7B 3FO0L 3IJSB 4ZUSB 3NFNB 3ML8A 1UZ8B 4JFOB 5I0VA 3CFBA 2IDCA 3WIIL 3RWFB 5AUMA 2W88A 4X7SH 4BELD 3V4LA 4QXGL 2BJML 4HLZG 2BNQE 4MD5B 2MQCA 1KELL 1IC4L 1T5XB 3CTTA 4OT1L 5TDPA 3WD5H 1BFOB 1RLWA 3L45A 4JMNA 4BZ1H 2IQ9H 4UOQA 1RUML 1WISA 1JBJA 2BJMH 2J56A 3DRTB 1LE9A 5AOMA 1KXTB 3HC4H 4Y5VC 5ID1B 4YSDA 1PGRB 1DQJB 3U0WL 4AM0Q 5CM1A 2ZX6A 1LDPL 5I2IA 3F7RA 1A21A 4IJ3C 4TUUA 1RZ8B 5LAPA 4ZMPA 1EO8H 1MWOA 3MNMA 4KZEH 1MIML 1OKEA 2FECI 2VITA 5HDOA 3O9WA 2H41A 4GIOA 3H9HA 1PPIA 3LKPB 1R47A 3LY6A 4BQ9A 1P84K 3QQ3B 2DQGL 2AVGA 3PXJA 4LOEA 4NWTL 2MWCA 3MLTA 3FQRA 4OCWH 1LHZA 1YY8A 1QFWH 1SEQH 2VLKB 3HE6B 3P73B 2QLYA 1GOHA 1NDGA 3PFQA 4NO0D 1PNDA 5CEYB 1C5DA 3UTPE 5EH1A 5G4MA 4HZAA 3BD5A 2V5SA 4FN0A 5F0JB 1U91A 4M61B 1NFKA 2BVQB 4KUZL 3JWNH 1BOGA 1O6VA 3PUUA 4TQIA 4S1DC 4YZFF 1NCJA 1H3TA 1XGZA 4YO0A 4NC1C 3SDCC 2AKRA 4R3SA 4NZUH 3HG4A 4P46D 4QRSB 3UAEA 5C7XL 2CIKB 1OGAD 3BAEH 5C0CD 4L2YA 4A7VA 1DUZA 4TSAL 5CEXA 4YWGL 3HAEH 3N1FC 4AVKA 1CGTA 1JI2A 1QLEB 5K9OA 3S36L 5AOLA 1LO2H 5C0AB 1IAOA 5TF1H 3RX5A 5IMKB 5FIEA 3V8OA 3FZUC 2IADA 3RVTC 1FFRA 1H3PH 2VXSL 5BZXA 1SF5A 1GGBL 3BYTA 5F7DA 1UJ3B 5KZCB 3QZWG 1X44A 3KDPB 2NXYD 5ID0A 3MGOB 3QJZA 5CGTA 1KJ2B 2JVUA 4H8WC 1HH6A 4NQSB 1H6EA 3K71A 4PRPD 4KH2A 4Z8FL 1JGLL 5IFAH 3FUHA 1DBMH 4JX0A 2WYIA 4KROD 4XPGL 5B4MD 3SKOA