4E9WA

Multicopper oxidase mglac (data2)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
b'AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multicopper oxidase
publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Uncultured bacterium
molecule tags Metal binding protein
total genus 95
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9wA02
3CG8A 3N55A 1X9RA 4N4YB 4G71B 1A4CA 1JZFA 3AG1B 4E9VA 2FT6A 5I26A 1E5YA 2PLTA 2Q9OA 1RZQA 2R7EA 1YLBB 3L45A 4ENZA 4EF3A 4A2EA 4YSPA 5B7FA 2VMJA 1BQRA 2GHZA 4DPCX 3HB3B 1AS7A 2FT8A 2YQBA 3U25A 1AG0A 2IDSA 3TBCA 1IC0A 2JXMA 1JZEA 1AZNA 3FSZA 2BWDA 3KW7A 4GYBA 3IE9A 2XXGA 1OV8A 9PCYA 1JVLA 1IKOP 1J5DA 1DYZA 1WA2X 3PLYA 8PAZA 1PNDA 3H4FA 3EH3B 4YSAA 4BWTA 4BWWA 4YSQA 2P80A 1JERA 3BQVA 2IDUA 1AG6A 1KV7A 4HAKA 3T9WA 3IN0A 4YSOA 1FA4A 1WS8A 1A8ZA 2MTAA 1JZIA 4Q89A 1AIZA 3FS9A 2W8CA 4HHWA 2XV3A 4KO5A 1W6WA 2BW4A 2VN3A 1GS7A 4YSUA 2QPDB 4A2FA 3AZUA 1L9TA 4AKPA 4ZK8A 2FTAA 2GIMA 5B1JA 3FYIB 1HFUA 2QT6A 4E9XA 3DKHA 2Q5BA 2XV0A 3ERXA 1OE1A 2QDVA 3DIVA 4AKOA 1PNCA 2YAOA 2EIKB 1A3ZA 1GYCA 2YAFA 2H5UA 3EHBB 4AZUA 2R7EB 1OE2A 3QJVB 1JZJA 1JVOA 2DY2A 1AS8A 2FQEA 2UX7A 1OCOB 3NP3A 4Q8BA 3NJJA 1IBYA 5I5JA 1GR7A 2IWEA 2BP8A 3H56A 4JKNA 3QPKA 4JHVA 3CVCA 2PP8A 4YSEA 2EIJB 4DPBX 3QJRB 3UGEA 3BVDB 2BP0A 3NJHA 2Y69B 2YAEA 3V9CA 2GSMB 1V55B 2UX6A 3NJLA 4WKXA 2PCFA 3WNIA 4HCGA 1A4AA 1NIFA 4KNUA 4DP4X 3X1BA 4HIPA 5PCYA 4DP0X 2FT7A 3PXLA 1AAJA 1N70A 2E86A 3FPXA 2TSBA 2PPFA 1J5CA 1NPJA 1CYXA 2IAAC 1JXFA 4YSSA 1VLXA 2DWSA 2W88A 3S3CB 5I6NA 1ADWA 4W1TA 2VSKB 2PP9A 4GXFA 4HZ1A 4CSZA 1HAUA 2MRYA 3FQ2A 1JZHA 5A7EA 2CUAA 2VW6A 3H4HA 4G70B 1M9WA 4PAZA 6PCYA 4E9QA 1L9RA 2HLEB 1BEXA 1WAEA 3UAEA 2HRGA 2PPAA 5B1JC 3EF4A 2DYRB 1XB3A 1PZCA 1NIBA 1L9QA 4L0PB 1NTDA 1PLCA 3UACA 4JHUA 1ZPUA 3AY2A 3RYMA 3AW5A 2YXVA 4N8UA 1L9SA 2CCWA 1BXUA 1NDTA 3OD3A 2OCCB 1BQ5A 4P5SA 1NWOA 3ASOB 1ZDSA 2BO0A 1AACA 5D4JA 1CC3A 7PCYA 2GI0A 2IDFA 3FU7A 3T6WA 3ZX1A 5AZUA 1F56A 1GS6X 4YVUA 3QQXA 1SDDB 1A4BA 1PCSA 4G72B 1ZIAA 5I6LA 2TSAA 3NJFA 4YSDA 1PZBA 1XMEB 2BWIA 4A66A 2BZ7A 3QJSB 3FSAA 1E67A 1SFDA 5I28A 1ETJA 2UXFA 4KO9A 2VW7A 4YSTA 5I6PA 1ASQA 1E65A 2XX0A 3NP4A 3UAAA 3UABA 5IY5B 1KCWA 1W8EA 1E30A 2WSDA 2XV2A 4DP5X 2PPDA 2N0MA 2HXAA 2P80D 2NRDA 1J9TA 3GXUB 1BXAA 2DYSB 2XU9A 1MZYA 2HX7A 4RH4A 2UXTA 4BWUA 1ZV2A 3ABGA 3ZIYA 3PCYA 1BYPA 2FQDA 3ASNB 3DTUB 2WO2B 1ASPA 3TBBA 2IWFA 5D4IA 1BXVA 3NSFA 3CVBA 5TK2A 1AZCA 3SBRA 1CYWA 2GB2A 2AVFA 3NJGA 2H3XC 2BZCA 5B1AB 2JKWA 3WKQA 2B08A 2YXWA 4F7KA 2PPCA 1IBZA 3NJMA 3NSCA 3NJNA 5I6KA 4KO6A 2QDWA 1AANA 4NAJA 4X4KA 3EH4B 1J9RA 1URIA 3C75A 2IH8A 3FU7B 4CSPA 3QJUB 3TASA 1SJMA 1SFHA 2OJ1A 4KO7A 1TEGA 2J57A 4HALA 1E5ZA 2YARA 3FT0A 3S8GB 3T6XA 1CURA 3OM3B 1BYOA 2VM4A 4KOCA 1OOWA 4UANA 2HX9A 2UXVA 2ZONA 2XX1A 3V9EA 5I5IA 1ZIBA 3CDZA 1M57B 3IEAA 4DP1X 3PAUA 1AR1B 1KDIA 4YSRA 2PCYA 1NZRA 2YAMA 4A2DA 2ZOOA 4K9JA 3NT0A 1SF5A 1OCRB 1KCBA 4DP6X 2Y1AA 1RKRA 3WKPA 2YAQA 4GP4B 4DP2X 1MZZA 4KNTA 2EILB 1XB6A 2EINB 5B7EA 3SBQA 1BAWA 7PAZA 5AFAA 4A2HA 4UF7C 2AANA 1ILUA 1FWXA 1AZBA 1GW0A 4YVNA 2A3TA 2FWLB 2HZHA 2GBAA 3QJQB 1PLBA 2XWZA 5F7BA 4HHGA 1AOZA 3T6VA 3JT2A 3S3BB 3HEIB 5FC9A 5B3SB 1AZUA 1JOIA 4UAHA 4E9SA 1WA0X 1ZDQA 1AS6A 1OE3A 3CVDA 1MG2C 3NYKA 1V10A 1RCYA 1IUZA 2AZUA 1NWPA 2WO3B 2J55A 3NJKA 5D4HA 1TKWA 4WTQA 1SHXA 1UATA 2GC7C 2BP8B 4BXVA 2YAHA 4F2EA 1OCCB 1QLEB 3SBPA 3ABMB 2VM3A 1J9SA 1TU2A 1CUOA 3FSWA 1GY1A 2BP0B 3FYEB 1ILSA 4HCFA 4BDVA 4HCIA 2QPEB 3ABKB 3TA4D 1EHKB 4QLWA 4DP9X 1SF3A 2FQGA 4M3HA 4A68A 1N68A 2XXFA 1T5KA 1TEFA 5TK4A 2AFNA 3CZUB 1W6LA 2I85A 1A65A 3AG3B 1ASOA 3X1GA 3NSYA 2FNWA 5I5MA 5B7MA 3PPSA 4E9WA 3OMIB 4BXSV 1JXGA 1OCZB 2CALA 4E9YA 1MDAA 4AX3A 5EHFA 1ET7A 4DPAX 1J9QA 1FFTB 5I6OA 4DP8X 3WNJA 3NJIA 1GSKA 3EH5B 4P5RA 4GY4A 1KGYE 5B1BB 2PPEA 3MX0B 1KBWA 3NSDA 3IBOA 5I6MA 3S8FB 4MFHA 3ZDWA 4QKTA 3OMAB 2UXGA 4YSCA 5PAZA 2ZWNA 3X1NA 1PAZA 2JFCA 3IN2A 1KYAA 1PLAA 3FQ1A 2XYBA 4NERA 4GP5B 1NINA 2CAKA 1ET8A 1ID2A 3T71A 3AG2B 1PF3A 1SNRA 3FQYA 5AKRA 4E9RA 4KNSA 3PAZA 1DZ0A 1I53A 4G7SB 6PAZA 3UADA 4A2GA 4BDVB 4GP8B 1AZRA 3SQRA 4DP7X 3OMNB 2YAPA 1KDJA 2H47C 3OQRA 4W9ZA 2I7SA 2CBPA 1JZGA 1GS8A 2HRHA 3AG4B 2XVBA 3FU8A 1L9PA 3D12B 4G7RB 1NIEA 3WG7B 5ANHA 3FU9A 1EZLA 1V54B 2BW5A 4FA7B 4A67A 1QNIA 2DV6A 2J56A 2J5WA 2XUWA 3ZBMA 2X87A 4BK5C 5E9NA 2B3IA 1HAWA 3T6ZA 3KW8A 3ABLB 4F2FA 1PY0A 4YL4A 2GC4C 5LDUA 1B3IA 1RZPA 1BQKA 3FSVA 4AKQA 1SDDA 2CJ3A 2EIMB 1WA1X 1X9UA 2X88A 3FPYA 1L9OA 3QJTB 1ET5A 1XB8A 1M56B 3PAVA 2LLNA 3G5WA 2BHFA 2XLLA 2ZXWB 1KBVA 2DWTA 4KOBA 3TU6A 2OV0A 1GY2A 2IDQA 4NB7A 1AQ8A 1PZAA 3GYRA 2VSMB 2PP7A 2I7OA 5F7AA 1MG3C 1NIAA 1PMYA 2FJSA 4G7QB 1WS7A 3S3DB 2IH9A 1SHWA 3X1FA 4E9TA 3X1EA 2HX8A 1OF0A 1NIDA 2AZAA 3X2QB 4AI7A 2IDTA 4PCYA 2RACA 1NICA 1JXDA 3MBWB 4FAAB 1R1CA 1QHQA 3JTBA 1NPNA 4TXVB 3N2JA 4M4RB 5B1KA 3WIAA 2VW4A 3GDCA 3WI9A 3CDZB 2IWKA 2FQFA
chains in the Genus database with same CATH superfamily
5C7ZA 4XP4H 1A47A 3FH8A 4UIKL 4OZ4A 1YNTA 4E9VA 3MXWL 4YL9A 1FJ1A 4PJ8A 5EU7E 2NSXA 4XXCC 1X9LA 4KAQL 1S7WA 2HVKB 2VISB 4ENZA 5EZIL 2WSKA 1Y1UA 3O3DA 4QGTA 3HG1E 4OIBA 2HT3D 4A2EA 2CRMA 1LWRA 3V0JA 1EXGA 3O4LB 1WE5A 4N0CD 5H35A 4U1JB 4FOMA 1DZBA 4Z3HA 4LLYB 4XBEH 1A7NL 1FNFA 1T83C 2IDSA 1IC0A 4O2FB 1JYWA 2FGWH 3C6SB 5GGSA 4WEMB 4JVPA 3F3HA 1JZ3A 3ULUD 1IQDA 3ILQC 2XOTA 3QXWA 4N68A 5GS1A 3ZDYE 3GI9H 3I2CL 3NSXA 4G7VL 2UY6B 2XZCH 4Y88A 5C0RL 5LXVA 5FM5O 4NRYB 3CSBA 4Z7UE 3PWPB 3VFSA 2OMZA 3S96A 3WXVL 3KPNA 4R7VA 1NMAL 4DEPC 1BZ7A 2AJSL 1SN2A 2LU7A 4OSUH 1G9HA 2P5WD 3RFRA 4FNQA 5C6TH 1DEEA 3CVHL 3IDUA 2E74C 2O72A 2WBWB 2Z92A 3OJVC 3MGAA 2HFEB 1TKWB 4K3EH 1A8JH 2G5BA 1S46A 1XH2A 2W60B 4AUJA 3DK0A 1S5IH 1W6WA 4JRWA 3S36X 4D8OA 1PZSA 2VLJB 5I1AB 3AXLA 3LS4L 1J5OL 1O6TA 3QXUA 1JJUA 5GGUB 2F53A 1G7MA 2OR8A 4GS7B 5B1JA 1I82A 1NANI 2X70B 5DHXB 5BPPA 1HFUA 3CMGA 1XWVA 1TNMA 3UTSD 3RJQB 4PCTA 2J20A 1YRKA 4NZ8A 2EIKB 3KNBB 5GGRB 4DVBA 2A6DA 2CZNA 1PEZA 1H0DA 3SE3C 3RGVC 1R3HA 3UYPB 2XBTA 1JPST 1MFAL 1LK3H 3MREB 4AGPA 1JVOA 2NCMA 4NOBA 5K9KB 1H15B 4MA8H 1AS8A 1MNUL 1KUMA 2V2WA 4UNTA 4C83A 3RWJA 3WN5B 3GRWL 1TZHA 3QHZL 5I5JA 3H7BA 1OPOA 2R1YA 5AVUB 5ALCH 3EBHA 2VUYA 1WBXA 4P5MA 2W92A 3K2UH 5HPMB 1WQVT 2J8UE 5EEUA 2YAEA 5ICUA 4XP9H 2Q3AA 2UX6A 1FV1A 5D2NB 1TMQA 5E08L 4WQOA 4QO1B 1U6AH 1KLGA 2CU9A 3RDJA 1GYWA 1EUUA 4WI6A 1DLHA 1G7QA 3IFOA 3HKZA 1JP5A 4F15B 3IT8D 3NCWA 5I1KL 3Q2WA 3KGRA 4PV9A 3RVXD 4Z76B 2ORBH 3S3CB 4BFKA 1T2QH 3PWPD 3SN6N 5KBPA 3QJFB 2X6VA 2GEQA 1T0NA 1RURH 2QR0A 4MSWA 4TLTA 4N1HB 4YHZL 1I31A 2YRLA 3R4RA 4PAZA 1U41A 5E8PA 3M1CA 4L0YA 4WFGD 2NY0B 4F2ME 4GIOA 1CGYA 1TZGL 1P4IH 1ZLSH 2WWKT 1K5WA 2QPSA 5CGYD 4I3SH 3LTVA 4UBDD 4B0MM 3G5XA 3TBYB 4Y4KC 5DR5L 4AM0B 4HUMB 4OD2A 3FB5A 1U8KB 1DJHA 2I25N 4YIQB 5EOTA 3L5XH 4MA7L 3NAAL 5F9OL 4RDQF 1FO0A 1Z32X 4OZFA 5GIRA 4F9PA 5JNYA 1QABA 1FBIL 3SOBH 2DD8L 3KWTA 1Q9LB 4ZPVB 3MRQA 3D9AL 4Y5VA 3TPKA 1ITCA 2YQ2A 3IFPA 2P43B 4YDJA 2B4CL 2V3EA 1RZJC 2VDOB 3BGMA 3ARDC 3LHPL 1IBGH 1I9RL 4S1RL 5KN5A 3V4UH 4Y1AA 4WK4B 4YO0B 5KSBA 5E4AA 3SHSA 4QJ4B 1QKZH 3Q9QA 1RZ7H 3SPIA 1RJYB 3SOTA 2HFGH 3QZOA 1JRHL 5FYJL 5ID0B 3SKOB 3SGEI 3ARED 5BZDA 2GIYA 4P5KA 4MYWB 1E28B 1Q0XL 4U1MA 1OL0A 4OLWL 1IC4H 4WHTA 1Q0YH 1Y0LB 2OSXA 2LABA 5DMGC 5IZ7A 5EZOH 3VXPA 1YEEL 4XPGH 2ITDA 3UAAA 1KT2A 2LU4A 2XV2A 3VFNA 2XJLA 1BJMA 4PCKA 2VYRE 5HGBB 4WGWB 2YLKA 1BXAA 2AK1L 2WLZA 4HFWB 1NC2B 2GJPA 4CC0A 1J8SA 1ZK5A 3EF7A 4UQ2A 4JFDD 3QUXB 3BYTA 2ZOTA 1IEHA 2ZP9A 5C07E 2VDKH 4K7PY 2QKSA 4OM0L 1FVCB 1F4XH 3IB4A 2AEOA 5DD1L 5TK2A 1K4CB 4AYFA 2WWOA 5DRWA 1CFQA 2A2QT 3PPEA 3RWGB 1T21B 5DK0A 2R0ZH 2BSEA 1HH6B 4B9JA 4CKQA 1XSOA 1IBZA 4PJCF 5IVXE 1N26A 3BJ91 4MASA 3WY4A 3WIHL 4I5BB 1F4AA 4YHIA 1YUHA 5DUJA 3CVHA 1SJMA 4GLRI 3ZL4H 4PWGA 2B0SL 3C09B 4P2OA 4UUJB 3HNVL 3UIYA 3VXQA 3ABZA 1OOWA 4R4BB 3RLSA 2ATPB 2JKNA 5GPRA 3ARGA 3QWOB 1GTNA 1YJDH 3PJNA 2ZKWA 5I5IA 4LCUB 2HCZX 1MRCL 2APVA 2E7HA 2Z7WA 5MEOB 4Q7DA 2V4LA 4IS6B 4B9YA 3QFJD 3IWVA 5KBKA 1DN0B 1EJOH 3COOA 3UTQA 4E41E 1QR1B 4DP6X 1E4KC 1BQLH 3IJHA 3LKNA 5ISZB 5HYQB 4GP4B 3TEUA 1VEOA 5EN2B 3B7YA 4Y4FA 2H0PA 4KNTA 3SY0B 1XB6A 1P5UB 2GJ6E 2IJ0C 5HI4C 5B7EA 3SBQA 4D0CB 3WV0A 4LE8A 5KYYA 1IC7L 4FKKA 3RVUC 2A1WH 1FFQA 4NXSA 2F9BT 2OSLB 4PS7A 3ZT7A 1HWHB 4JBSA 2ICCA 1XL4A 3IJYB 2A6JA 4N5UA 4PVNA 1NCCL 3T6VA 4MGXA 2C9VA 2I60H 3C5JB 4FQLL 4X6BA 1YHPA 2D03L 2DJ4A 4EUPA 5C6PB 3MA7B 4FQCH 1TQUA 3AMKA 3ARFA 1GHFH 1KXVA 2DDQL 3RKPA 2BXYA 1XGPB 1K3ZA 3I3EA 1CLOH 1MFNA 5BV7C 4DSYA 4YXLH 2R69L 5EF2A 4S2SA 5IWLC 4BSWA 3NYKA 3TNNB 1IUZA 1DJGA 2NY4D 4MKMA 5D1ZI 1I1AC 3WIFB 5F70A 5D4HA 1GA2A 1M71B 2P8LA 3KPTA 3VI3F 3MRCB 1U8MA 4ZTOH 1TQTA 1IEAA 3MKGA 1AP2A 1HL5A 4Y19D 1GH7A 4PD4J 4K23H 3BN3B 3IGLA 3L1OH 4OI7A 2ZJSL 2NPLX 2W95A 4WHYH 4D9RE 1P0SE 1FZJA 4HPOH 2BVPA 4Y4HC 1F11A 5AVVB 4OF0A 1F4YL 5E1HB 4PS4L 1FNSL 3ZE2E 4CU7A 4L3EE 1DVXA 4RGOH 5AWNH 2ZOUA 2VM9A 5ERWB 1WIOA 1G43A 1U33A 1SEBB 2JKXA 4C56B 3R4DA 4J4PD 2GG1A 1FN4A 2YJLA 1MHEA 3AB0C 4KK5D 1TJGH 2VMFA 5I71B 5EBGA 2ROXA 2AFNA 2C5DC 2I9TB 2I85A 3A5VA 4URTB 3L4TA 2CUIA 4UNIA 1RZFH 4TSCH 1R5VB 2VXQA 4NQDB 1X5ZA 3BH4A 1S8DA 3HPJB 1O5PA 1PX8A 3HNTL 4HU2A 2E9WA 3QDGE 3E7JA 3MKKA 1HCYA 1WTGT 4G8GD 4DP8X 3JWDH 4G6JH 2ICEA 4XN5A 2PPEA 2PYEB 3OGOE 3WFDH 5EEZA 4WWNA 3IBOA 4CL7A 3NCCB 3TO4C 3FQUA 2E7DA 2QSCH 4I0PB 3MLRL 5SX5H 4WEEA 2Y9RT 1OGTA 3H2PA 4QUOA 4WTWA 4AVIA 3T4AB 5K9QI 1ZE3C 2BSSB 3G08A 5FXCH 2YN3A 2Z7UA 3QISA 1IC5H 1KYOJ 3TCLB 1J0IA 5HDBF 2JFCA 2V7NA 4XGZA 4MJIA 2MWCA 2EIEA 4GBXD 4Z78A 1WK0A 4NERA 3GUTB 3E8UH 4RZCA 1BQHG 4KKAD 1QLRA 4JHAL 3FQYA 1CGVA 2GK0A 3EOYG 2AJZA 3NGBB 4UINL 5GISH 2VXSL 5IW1A 3QIUC 2Y1ZA 1O7DC 2RFXA 1MCJA 3DRTA 3PAZA 3RHWK 1INEH 4PRIE 2JTDA 3D85A 3MLTB 3P69A 3QDMB 1Z2KA 4QIRA 4V1DB 3CE1A 5JHDA 3BPLB 5AKTA 5KOMC 2VXVH 4IGBB 2I7SA 1YECH 2J88L 2OI9C 4HPYH 3DGCR 5LGYA 3FU8A 3IXAA 4UQAA 2W94A 2HT3C 4WKZB 1J8HD 4YHML 4A67A 2ERJC 3TZVA 1PG7L 4N0CC 3ATDA 1S7SA 1QZNA 5DJ2B 4ZODA 5BO0D 2AHIA 3MBEC 2EP6A 3ECBA 1PZ5A 2YGPA 5A2BA 2JB5L 4PJIE 1UASA 1PY0A 4F2FA 2DEXX 4YL4A 5FGRA 3RE0A 1RFDL 1N5YL 1KLUA 3Q3GB 3ULUC 5KJRH 4BFGA 4FQPA 5K5YA 1CDYA 3GUFA 2Q10A 2Z4QB 1C5CL 5H4ZA 3HAEB 5F6HI 2DWTA 4KOBA 3BLPX 4RBPH 3X3GH 2AV1B 2XC8A 4ZMYA 1QYGL 1Y07A 3DSFH 4P05A 1XR9A 1KF9B 2Y3AA 4Y1AE 4XN8A 3LKRB 2K70A 4Y2NA 2BIHA 4ZFOL 4KVNH 1MG3C 3QT2A 4PRPA 2PYED 3EJUA 5TE6H 2AXWA 5HY9B 1IM3A 3JV6A 5CJQH 1KMGA 1T03H 3PGFH 1KJMA 2HX8A 3V4PH 4LF3A 3OC5A 1T80A 3PG2A 3S2CA 3RAJL 1HINH 3TBTB 4WO4D 2FIRT 3CCHB 4PCYA 3A67L 3QQ9D 1E27A 3O4OC 4W81A 5D5MA 4NO3A 2YKKA 3UBFA 5SWQB 2MPAH 3ZTDC 4JO5A 1M6OA 2ZYRA 2I5YH 3ZTJG 4QEGA 2WYHA 3ELQA 4L37B 4MZRA 3VD2A 3DX6B 1AOHA 2ENYA 2NQCA 1U8PB 4ZAKB 2J5LC 3CG8A 5DUMH 2BNQE 2G3ZA 3UEZA 2CBTA 3GXNA 3S35H 4H8HA 4ABVA 1E5YA 3T3PB 3GMNA 3FQNA 4JFFA 4Q2ZB 4AC4A 3FQRA 4BQ8A 4P2RB 4M3JA 3GMMA 3FSOA 3CBKB 5JPMB 5BJTA 1BQRA 4BCYA 3CPUA 3L17A 2NY2B 2NX5A 3HE7A 3OF6D 2AK4D 3PNWB 2OMVB 2HKAA 1S3RA 3O0RH 1MFCH 1RZIA 3GEFA 5D7JD 4AQAB 5C0BA 4NO0B 4AIXA 4XMTA 1OV8A 3VD0A 4IBQA 2C1PA 3LEVL 1ZLUH 3VRLF 3WD5H 3N04A 5CCJA 5CHNB 4OD1H 4BWWA 4YSQA 1AHWA 2VZSA 1XVSA 3QZNA 4HAKA 4OCWH 3L3JB 1WC7B 1X4XA 3QZBA 4RDQG 4PJ5A 4HJUA 3W9DA 1E4XH 2AXGB 3DV6B 2MTAA 2VMEA 3TYGL 4N20A 3L2NA 2KZ1B 3ZYOA 1YEGH 3WUWG 4M56A 3TBVB 4MWFA 4Z7OB 5CGYC 1U95B 4JY4A 4UBDC 5C7XH 3WJLA 2OP4L 1Q0EA 4NNYB 3VD5A 1QMUA 4M62L 4NJ9H 2QPDB 4PB9H 4MAUL 1LEKB 4ZK8A 3GS0A 5DFTA 1YMMA 4MNGE 5IBTH 2DQHL 1KCRL 3I02B 4QI3A 3VSQA 1VFBA 2Z8SA 4O9HH 1PSKH 4OZIA 1OB1A 1UD4A 2H5UA 1YYML 2EH7L 2BDNL 1KXTA 1Y6MR 2DYPA 5IB3B 3DV4A 3TBSA 1JZJA 4KI1A 4ZAKD 3T0AA 5D7LA 3OAWA 2ATAA 2OTUB 2TRHA 2AEPL 4MLIA 3QDJE 2IADA 4QHMA 3SPVA 4XVOA 3WN5C 1A9BB 1RH8A 2ZSWB 3GS7A 1TVHB 4P2RD 4YSEA 3D51A 4DPBX 1FYTE 3QJRB 4JPVH 2AF2A 4D3CH 5IGXL 3HG5A 2W9DH 4KJPC 5SWSD 3ARVA 2GSMB 4M8UA 1ZA6B 4XVJH 4G11A 4QHKI 1KIRB 4L8BB 3FO0L 1CDJA 2P5EB 3GXTA 4HWBL 4NO0D 3OG4B 4PJBE 5DHMC 4XP1L 3HCVB 5JHAA 1BF5A 1NPJA 2QFRA 5D7IB 1E5AA 5J11B 5E4EC 3VG0L 2RHEA 1D7CA 3MC0A 5EA0L 1CFBA 5IMMB 1X4YA 1ADWA 3P0GB 3K1KC 4QTIL 4GXFA 4HZ1A 1U3HD 3GBNH 3NCJH 6PCYA 3IDJB 4E9QA 4HK0B 2QHLA 2WJ5A 2R29H 5IV2B 4XXDB 1WAEA 2R0WL 4WWKD 1JHLH 2YGVA 1QFHA 2HLFD 2VITA 3MUZ1 4ABUA 3VW3H 1FC2D 5IBLD 1WBYB 4FP8L 1DVTA 2VN7A 4WI7A 1I7TA 1RULH 2CCWA 2PABA 4G1EA 2D73A 3M1OA 5AOLA 1NWOA 3KR3H 2ATKB 4NENB 3TPUB 2E75C 4MDJB 4WSKA 3ZHNA 3P4MB 4KRNA 5DYOA 3O41A 4Y8DC 5AZUA 5BRPA 1DVFA 3EO0B 3PS6A 3EBGA 4JM2F 1VESA 1C16B 2OAAA 2J1KA 2EYTA 2VDKB 1ZT7B 1MXDA 1NC4A 3ZRFC 1P4LB 3OJDA 3MV01 1H3VA 3PWNB 4OLUL 3X11B 1D5MA 2E8ZA 2V5RA 5C09E 1D5IL 1N0LA 5GRJL 1J18A 1FH2A 4ACPA 2DF3A 3N06B 4RRPG 5D4QA 2A73B 3D18A 4X4XB 1V3MA 3OKDB 2X7LB 1KFAL 5B8CC 2IQ9L 1XFPA 2ICES 5EIVA 5C3IA 1FIGH 4PU2A 4DGIH 1OK0A 2CO2A 4XMKH 5LKNA 1U8OB 1F90L 3JTSB 3P30L 4X6EA 3B3IA 5J1AA 4FN0A 1KCVH 5EBLA 3EOBA 1XR8A 1ZSHA 5I17A 4XMZA 5AKVA 2AC0A 3QUXC 1AZVA 2V2TA 1BYPA 4AQ8A 1NCJA 4N87A 5CXPA 5KS9A 3TVMA 1FVEA 3WFHB 2J4WL 4F33B 2ADFL 1B6UA 1IGFL 4FYSA 5IUSA 4N6RA 1EAPA 3LN5A 1C7TA 3FOMB 3VWJA 5I8OH 3L4VA 5HTSA 2H3XC 3G04B 4X6CA 2DM7A 3NQIA 4JFYA 3V0FA 4DN3L 5GGQH 4LLUA 4RLDA 1Q1JH 3CFDA 4FI7A 4EBQH 1JYVA 2V2XA 2BC4A 4MJ5B 43C9A 4NAJA 3EH4B 3M45A 4AH2B 4EDXA 3LS5H 1JXKA 3MV9D 3HI6H 4LCYA 5GS0D 4YHNA 5JW3L 4GUQA 3KHQA 2Z93A 4B9ZA 3BWAB 3Q6GL 4DEUA 4KOCA 3MROB 4Z7WB 3BH8B 2P7TB 3ME0B 1UD3A 1ZIBA 3CDZA 3IDGA 5DEFA 3DI2B 3FCUB 3LPGA 4B96A 2EEBA 3OB8A 3VSTA 2GJZA 3FMGL 4OW6A 4HLZG 5A2JH 4KK5C 3J8F7 1JRHI 1T4KB 5B39G 2VUOA 1JF5A 5EUKA 3WKPA 1E6OL 4GOSA 3HJ0A 4JDEA 3D39D 2BSCA 5DD0L 5JW4Q 2WCSA 2DQCL 2EINB 1I9JL 3IKKA 4FFVD 3VM5A 5LN8A 3OR7B 4BINA 2ICWA 4FQJL 1S7VA 1X5LA 4YHOL 2YSSB 1HEZA 3VRIB 3RZCA 1BAFH 1AXSB 2QLVB 5IQMA 3TO2B 3VI4F 4GKOA 1TJXA 2A3TA 1T20A 2FWLB 2H1XA 2WLLA 3US9A 5J6GA 1KEGH 3CBJB 1I85A 1ZEAH 1RUAL 2XWZA 4PTUB 5MEQB 2PW1B 5E8DL 3B5TA 4JFFE 1S7UB 4CVZA 2F8XC 3S3BB 3LMJL 3HG1B 4LASL 3CU7A 2RIKA 1F4HA 1DFXA 4N0UB 1YN6A 5ICXB 5DJYA 1WAAA 4E9SA 4TNVK 5T5FL 3QNYA 1G1OA 1E9PA 5LCVH 1EEZB 4HWBA 1T7YA 3LOWA 4AEHH 3WTYA 2UVEA 2VLRE 3L95A 4X9GA 4GBXC 2FD6L 2H7WA 3MN8A 2CLRA 3KGTA 2XZAL 4KKAC 1Y1DA 1ZHLA 3ZDYB 1TFHA 4MQ7A 1NSNH 3H0TA 4FQIH 1JZ8A 2WPGA 5LXGL 4Z7UB 4OCYL 2KL6A 1LO3L 4F2EA 5ID1B 5JUEH 2XWBA 4LHUG 5JHMA 5JORB 1AKJB 2G3MA 2PTTA 1ACYL 1F8TH 3N85H 5J06A 3DSNA 5LNEA 2QQNH 5B3NA 3NOIA 2E9JA 1M1XA 4PRDA 3BSZL 3NDYE 1ROCA 5F0LB 4LP4A 3KL0A 1JHTB 4DOHB 3LNEA 1SVBA 2FX8L 4DGYH 4IDJL 5EO1B 3WHE0 1NEPA 3OLDA 3W0WB 3HR5B 4Z7VA 1XCTA 2FQGA 3APDA 3POCA 3VXSA 2QKIC 3E2HB 1AO7E 5I0XA 4R90H 3QRFM 5FW7A 1L7TL 4UIMA 4ZUSA 3FH7A 1NDGA 2J8OA 3GM0A 5D55A 5I71C 5CBEA 3PABB 1CZ8H 4OJCA 4LGSB 4PG9B 1X5FA 5JHLL 1OAUL 3IKCB 1J8HE 4LBAA 5I30L 1BBDL 1INQB 3PHQB 2IH3B 2DQUL 4PWKA 2APBA 3R7QA 4RISH 4ACTA 3N40F 1NMCB 1SBSL 3M46A 3INUL 1CS6A 1OP3K 3U0TA 5KTEH 1JMXA 1XGTB 5J57B 5B1BB 4F7MB 2EC9U 3D87B 2FJFB 5I6MA 3CN1A 3FONA 5FKPA 5SWZD 1T1ZA 4QXUH 3IXTA 1E4JA 3IJSA 2VL5B 4OQTL 4ADGA 2VC2H 4W4OC 3DXAD 4I0PC 1C8QA 1B0GA 3U7YL 3ARUA 2J8UB 5DJXB 5EU6D 3FTSA 4KHXH 4NUGH 5ABZA 4ICWA 1EJ6A 4JM0A 4RMBA 3GB7A 4OLYH 3MJ7B 1K3IA 3BH9A 1MQKH 3MRBA 1CFNB 4PJGE 1M1SA 2R0KL 2KZBA 2VABB 4WSJA 5K59E 4KKBC 4AEFA 3VWKD 3BVVA 4F8PA 2VR6A 2EVFA 3B7UX 2WIIA 2E7MA 4OCXL 4KY1H 4A7VA 3VXTA 3ZGHA 1YYLH 1A7QH 1NCGA 4DGWC 3HG3A 4WJKB 5LWYH 1D5RA 2HH0H 2YAPA 4JHWH 4MS8C 4OU3A 3WJJA 1RAMA 3QHFH 1C8PA 1TIUA 3GIZL 2AGJL 4J1UB 2X05A 3BP5A 4JM4H 1TETL 2CQVA 2ZSVA 5CD3B 1A66A 3IMRA 3B2DC 1XGRB 4F2MB 1YY8B 3FCTB 3D2UD 4LIQH 4XE0A 3P3YA 1MFMA 3CC1A 5E9NA 4ZTEA 2ZCZA 1NGXA 3O6LH 4IQHA 1U58B 3MRKB 3V4PB 4ERSH 4LT7A 1JGVH 3Q6FA 5E00B 1EHAA 5D7JC 3TBWA 4NBZB 1RZPA 3U79A 1BQKA 3FCBA 4DZ8B 3SQBA 2QBWA 2EZ0C 1KIPB 1OAQL 2JQMA 1YA5A 2ZXAA 4K7PL 4NQCA 1ERNA 1WZAA 3BLKA 5INDA 5T1KA 3H3BC 2R8SL 4OF7A 1ED3A 3MNVB 1FSKB 3QJTB 2GVYA 3CDYA 5EOCH 3F65A 1NCOA 4A2LA 2E6JA 5GS2H 5CLXA 3CSFA 4JGNA 4XNUH 3L7FB 2GIXA 5IFJA 1KIQA 2VB5A 4JDTH 5FV2A 5I6XB 2Y1YA 2R59A 1M3IA 3T3MF 4PJXF 1O7VA 5IHWA 3MVSA 3QUGA 4M1GH 4KHTL 2CXKA 4UOJA 1SYSA 4G8FA 4OUOA 2XIDA 2D31A 5HHME 3X2QB 2VXQH 1FNEA 2DQ6A 4MAYB 4U1SA 2UZIH 5CLZA 4AV0A 4KI5E 4BFOA 4BE5A 5BQ7B 1NICA 4GXVH 4EI6A 2A9BA 3JTBA 5A3ID 3MLYH 4TXVB 1BFSA 1BIIA 3GDCA 1Z3RA 2E7LA 5GRXG 2C1OA 4R0LA 5HJ3A 2XWXA 2G5UA 1H6TA 3CFUA 1YDPA 3QZPA 3AABA 1W0WA 1S4IA 3O3AA 4QNPF 5T5FA 4ZAKC 1UB6A 3HI5L 5L88L 3PP3H 4EKXA 2PLTA 3CUPB 5C07B 5HYJA 5HGGS 2FR4B 5G5DA 3MRLA 1GRWA 3EFOB 5D1XE 2WXNA 2D2OA 1BZQK 1UZGA 3ZK0A 4LRNH 3QIWD 4L23A 4OM1H 1JGLL 4YNYA 4Z3FA 2E5EA 3WY2A 3EOAB 2NY2C 3WAJA 5IVXB 3T0EE 1IGJA 5AW8B 2A83A 4RGMB 5C0IB 4R4FL 4NC2B 2H32A 3GMRA 5HD8D 2RQEA 3APMA 2XKNA 3BWUF 3FRPG 4KX9A 1MCOH 4AE0A 4CADB 3RTLA 4NRXA 3BFWA 3GIVB 1MRDL 5ALBL 3KPSD 4G6ML 1BG1A 3MNZA 2C9UA 2K45A 2E6PA 3SDXB 2AXHA 3BVNA 4EOWL 2CDFB 1U3HC 5E9DA 1AJ7H 1Q9WB 5CBAB 1UJ3B 1SMOA 1TSHA 3H55A 1J88A 1HHGA 1G7LA 5DK2B 4JCLA 5IMOB 4UV4H 4L9LB 5DUBA 4E41B 2X4UB 4WWKC 5BMFH 4FABL 1GS7A 2GJ6B 3WFBH 2P49B 2YEZB 1R3JA 4R6UA 4WENB 2DQDH 4KTGA 3FT4B 5IBLC 5DLML 5LGJB 4MAYD 1OAKL 4KK8D 1DHKA 2WXFA 2XV0A 4X2UA 5F9AC 2HLAA 3SJVE 1BF8A 1CMOA 3GKWL 1ZVYA 2VN4A 4UM8B 4X5XB 1FJ1B 3TEXA 3KPPA 2P3YA 2VDRL 2GFBB 2EDRA 1QPXA 4OQTA 3X12A 3O3DB 2HWZH 4H7VA 1E9OA 2DY2A 3EYOB 3QUMA 1PQZB 2UX7A 5H35B 1CI5A 3HE6A 1G9NH 1LP9A 4H0HB 4M02A 2VZTA 4RMQA 1KJVA 4HUVB 2IWEA 2BP8A 1FL3B 1PFCA 2W38A 4G6KH 3VFVA 2A6IA 5C3LD 1VPOL 2BFVL 2YKLL 1G87A 5CJOL 1CXKA 3O81A 1WH0A 4R7LA 1S9VA 1F58L 4M93B 3KDPB 4L4VA 1TVDA 3T77B 3VFSB 3GSVA 4LSPH 2KS0A 3KPNB 4P48A 4ZMWA 5C97A 2R2EA 3ARBB 2BP5M 1R17A 4LOFA 5EEWA 1KJ2L 2H3NA 3NN8B 1AI1L 4U4BA 1CBJA 1RK1A 1NPUA 2X4QB 2Z92B 1TVBB 5DJ6A 3FUNA 4W1TA 4ZW3A 3DUUA 4U3HA 3KVPA 1U0QA 1XD0A 4F7EB 3UPAA 4N2FA 3U83A 2BSTA 1WD8A 4JQVA 4X8JB 2EABA 5JQHC 2Y2YA 3ZE1E 1HDMA 4ANUA 1G7MB 3BUDA 4TVPH 1OPGL 4J3OF 4JQIL 4E2OA 4X80H 5IROD 2Y3NA 4J2QA 2QVTA 4JRXD 3ARYA 5KVEE 2D7TH 1P4BH 1BD2E 3BKYH 3RYMA 1GGCH 1H0DB 3ESNA 4OF8A 2PF6A 3VSVA 3SYCA 3JWOC 3UO1H 5CJBA 5D8JH 2WZ0A 4ZFGL 3GM8A 2H26B 4QR7A 4C83B 2BVOA 1HC1A 1TZHB 3EFFA 4W9GC 4PJ8D 4UTBH 2R1YB 1O9WA 1MLCB 4LSQL 3AY4C 4LLQA 1YY9D 4HSAC 3LZQA 3CN0A 1JFQL 3FHQA 5AAWC 2VDQH 2RQ8A 2ZCKL 2EDQA 1BBJA 1MKFA 1NM9A 3OKEA 2BZ7A 4XC3L 1C1EL 3L5IA 3DGGA 4UQBA 4I77H 3CZEA 1YEFL 1CFVH 4JG0L 1KLGB 4TKWA 4N0FB 4JMNA 1F41A 1SMDA 2BCMA 3VGGA 1ASQA 4XNYL 1T66D 3QXDB 4IMLB 3IFOB 1GC1L 3KHOA 1PLGH 4I0CC 2PCPB 4PJHF 4PRIB 4PV9B 1I8KA 1V3KA 1ETB1 5ADOL 3KYKH 2XU9A 2BS71 3UH8A 3MGOA 3QARA 1DBJL 1UEYA 4Q0XH 1HZKA 1TTBA 3FAXA 1M53A 5E8PB 3F7KA 3A6BH 3QDAA 4PJEF 5FAAA 1OTUC 4FNRA 1VENA 1GKEA 3F64A 5IUCA 3ULVD 4I0KA 1UOLA 4EI0A 2WO2B 2DW5A 3HI1A 3UOAB 1OO2A 4TQHA 4MXVE 2JCCF 2DQTH 1BQHA 5D4IA 1CR9L 5L2JA 4G8EA 4HC1L 5DC9B 3E9TA 4PJIB 3EYSL 4AZ8A 2NMSA 3SBRA 3VXUE 5I8CA 4NI3A 4OZFB 1OGSA 2DQGH 2F53D 5JNYB 3TF4A 4JFOA 4KRLB 3CIQA 4MDIA 1WFUA 3MRQB 5D7KE 2ENPA 4JKPL 4YEEA 4F8NA 5I16A 4HIXL 1QFWM 3C75A 3BGMB 1RQ5A 1U2YA 3MA9H 1BJ1H 1SFHA 1MREL 2CGRL 4ONGH 3S37H 5KN5B 4Y1AB 1MCPL 4NN5B 5BRZD 1IGYA 4PGCB 3L6FA 3NRFA 4C8XA 3DI3B 4XTRD 2GBTA 2JXMB 1DJIA 1UD5A 2YD9A 1TOXA 2LVCA 1W16A 2YZ1A 5BZDB 1AHMA 2HT4D 4NUJB 4U1MB 5C9JB 1KDIA 2HAZA 1O7SA 1WHPA 3A0OA 3HFMH 2YAMA 4WHTB 4FYTA 3TH2T 5I0DA 2CR0A 5GGVY 1MOEA 3RUGF 4M43H 2OMUA 3EYUH 4YC2B 2Z35A 1OAYL 2YAQA 2GHWB 3OKNA 2L4OA 5LG6A 1NGQL 3O6KH 1VFMA 3VFNB 4XCEB 3H42H 1YEHL 2VDPB 3WCYA 3D30A 3QCUL 5AFAA 1OT4A 2D3LA 1R3KA 4WV1A 1ILUA 4UI2A 3GTVA 4PGEA 1JNHB 2BNQB 2VDNH 4UQ2B 1GGBL 3Q5YA 4N2AA 4LLDA 5BCAA 4PMEA 1U3NA 3OJMB 5F7BA 5IW6A 2IAMA 2AQ3A 4Z0XB 1AOZA 5BW7A 4PP1D 4XCCH 1ES0B 1JXJA 3D3VE 4XMPL 2K6ZA 3MRMB 4PV1C 4PJDA 1AQMA 4OCNC 4AYFB 5KG9A 4TNFA 4NZFA 5LVEA 1BZDA 1IGML 3CN3A 4ADJA 1N3NB 4WUUE 1ZDQA 3U1SH 35C8L 1IZKA 1MG2C 4FYRA 2WANA 4RAUB 5I19H 1VKXA 3DNKA 2AZUA 4MB1A 3QHTC 3O2VH 4YHIB 4F37F 2A4EA 2MHAA 4ALAH 3VWKC 4JLRB 5IB1A 3MV8E 1QWUA 2O26U 3GNML 4QY8B 1DL7H 2K8MA 4Y9EA 2XWJA 2NNFA 5AW4B 4APXA 4DVRL 3QFDA 3ARGB 5KW9L 2ADJB 4XWGH 5EU6E 3SGKC 4BSVB 3SEPA 1CUOA 3EYFA 4V2BA 1CXEA 1RUKL 2OULB 2E27H 3ABKB 1I8UA 1EHKB 5JPNA 1MFUA 5TQ0H 4MD5A 3IJHB 5ESQB 1BZEA 4DP9X 2E3VA 2VC2B 3QQ4A 4G3YL 5FGBC 3EZ8A 4KQ4L 1HKLL 3MNDA 2XWEA 4PWHA 1TEFA 4X9HA 4L0ZA 4QXTA 3LKPA 4AQOA 1ZGLA 2P28B 3F7VA 4ZW5A 4MNGB 2ADGA 2FNWA 3FF7A 4EI5B 2OKMA 4G1MB 2CHWA 1AQDB 2B1OA 2NY6B 4P9HL 4WRLA 1GL4B 4NFBA 4PV8A 2A6JB 1XGYH 5JR1H 1QLEH 1UA7A 3INOA 1J9QA 4EUPB 1PTZA 3WUWA 4XBGA 1FL6A 1G0YR 4FTVA 4LDLB 1JGUH 4P5RA 2X4TB 1DQDL 3ARFB 3MX0B 3CK0H 3QDJB 2GCYB 3A6CH 5KYUA 2R4SH 1KN2H 2EVGA 3FW6A 4YDIL 2CDGA 5F97E 1RU9H 4K8RL 3FUFA 2YWYA 1FYTB 3N42F 4PHXA 3UFIA 4LLVB 1SGKA 1EANA 2BY0A 2WUCL 3AJ7A 4PREB 1DANU 2BHUA 3QG7H 1IX2A 1Q9OA 1IEAB 2BSED 4M7LL 1AP2B 3WE6A 3KS0H 5GXBB 1JNJA 1C5BL 3F7LA 3GD1C 2VMCA 3QCVL 4Y9GA 4PJBB 3HG4A 3LZFH 3DO4A 4TNWF 3TT1L 1FZJB 4M6OL 5TDPB 1FDLH 3DVGA 5J8OA 4XNMB 1ZLVK 1DQJB 3UJIL 3C2AL 1UA6L 3VFWB 4P2OD 2IGLA 2EKSA 3O45B 4XWOC 3OPZL 3ARGD 1JZGA 3IDXL 3S0PA 1IBHA 5F9DC 1GCFA 1FN4B 2YPKB 3EADA 1V54B 5ITBL 4PVMA 1JVKA 3QIWC 4IEFA 4YZFE 3F01A 4XB7A 3HLKA 3W3BA 4D9LL 3IMTA 1B4TA 4KXCA 1OQOA 4GSXA 1CB4A 1INDH 5F96H 2WSPA 1QUNA 4JVUA 4UTAH 3EYVA 4Y4FD 3UZVA 3RJDA 3TV3L 1S8DB 4GSDH 1MJJB 1SDDA 3GHPA 4PGBA 4EIBA 4F27A 2EUZA 2FB4H 4JR9H 3C6LA 5HD8C 3W2DL 4X5PA 2FNBA 1OTTD 5HGAB 1ULVA 4LNRB 1KTJA 1QSVA 3MV7A 4P4RB 4N2NA 1DJXA 5JHBA 1XB8A 4PJAE 2NY6D 3G5WA 1FSKC 2CE6A 2OV0A 3BGAA 1C9SA 4DUVA 1AKPA 1X5XA 4PPTA 4AGOA 1OGTB 1D6VL 5LBSL 4G6AD 4BJLA 4RDBA 4RMTA 1E4WL 4YQXL 2DI8A 3GTNA 5K1VA 5IQ9B 2XN0A 2UWEE 3B56A 4G7QB 4H2CA 1WS7A 4OCSL 1J1PH 2V7NB 3MLZL 4X7DC 1I8AA 5C09B 3RWCB 2E59A 4L8SB 2FATH 1RUPH 3F5WA 4BSJA 1HXMB 1QLRB 1D5BA 5KVEH 2RACA 2AJZB 1LDPH 4H26A 4FAAB 2YUVA 2BY3A 3IJEB 4MAYC 3TA3D 2WB7A 3HRZB 3IGAA 4KK8C 3GSQB 2HN7A 3MLXL 4M4RB 1DSWA 2ZPKH 2VW4A 4GNKB 3WIAA 2Q3XA 5TE4H 4NNPL 1OARH 5FLUA 4P46B 5T1DH 4N6QA 5DZNA 4HX1B 1X9RA 2NY3B 3ZT5A 2XQBH 2Y22A 1JZFA 4LPYA 1RZKL 3UBXB 4KU1A 3UL4A 5I1HH 5I26A 1F6AA 1ZLEA 3DUHA 4TSAH 5HDQH 5IVZA 1JK9A 2XFXA 2JJUA 1EERB 1YLBB 1G7HB 2NNAA 4FQXD 2JI3A 4RRPA 2WQVA 4MJHA 5J9PB 3CSYB 2X3BA 4DPCX 2WOBA 2PWDA 1YPZE 2QHRL 1KELL 4UT6A 1IMHC 1EAOA 3F83A 4HXAH 4RSYA 4X8GA 3TBCA 3PHOA 4Y1TA 3DVNB 3ZW3A 4FXGA 4NQSA 4JKMA 1U8LB 2Z31A 4ZTPL 2H6PB 4J3OG 1DYZA 4RGMC 3WNLA 4F58L 3K0WA 3U46A 3KJ4C 4WK0B 3NZHH 5DWUH 1WITA 1GSMA 4FLHA 1ZWIA 4TQEH 2V5MA 1RI8A 2PMZA 5FYJD 1A3LH 2OFQA 3TS8A 2DIEA 5K9JL 1A8ZA 1XGQA 4HWUA 2O6CA 4EAEA 1XF1A 3SYQA 1S7XA 3I74A 4JO4H 4LF3B 4BHUI 4HHWA 3GT6A 2RB8A 3ALPA 3DX4A 2R23B 3BP7B 5AYTA 5IROC 4C55A 2HVBA 4L9LC 3L3KA 5C0NC 5IHHA 2YSTA 5G4MA 1KLFA 1TTGA 3HG2A 3K5SA 4MJID 1L9TA 5IFHH 3HZ3A 2K78A 5DMYA 2P8PA 1IKNC 2QSTA 1JIBA 2MOVA 4JN2B 3UG5A 1SUHA 1HCVA 4PI0A 3UBHA 4HJGB 3LH8A 3IGFA 2VH5L 3NFSL 3UTTA 2PW2A 2O61B 1II4E 3D85D 1B88A 5E1QA 4JFFB 5JHDD 3K8KA 1KULA 1OE2A 4PJ8C 1BQUA 3L3IA 3VXNA 1HXYA 1HXKA 2VXTL 4TRPH 5B39A 1VCAA 4HH8A 1A6VL 1KWGA 5IKCA 1RK0B 1WDAA 1EFXB 1IBYA 2WCGA 3WOVA 4O4YH 3TZVD 1G7JB 1PBYA 4JFSA 5FK9A 3Q1SH 4PGDA 3B4NA 2CRZA 2VLRB 3MRDA 1F0LA 2C1PB 1NAMH 3QEQA 4EQ3A 5HHOE 4I9WD 1BVZA 4IBSA 1T66C 4OFKA 1NANH 4FZEL 4ZUUB 1NCAL 2F15A 3T65B 2H9GB 5CN2A 4POZD 1U42A 4BCXA 3VFRB 4FQQB 3W9DB 3K91A 4IJTA 4M6ML 4BYHA 2E86A 2RALA 5TQ2H 5A2IH 5T3XE 3MUUA 2NT1A 3O3BA 1URZA 2IAAC 1BECA 3QXAB 2YD8A 3HZMA 1DSFH 4FXKB 4S1SH 4OZHA 4PRPD 4TUKL 5A7EA 5F3HA 1IM3D 1NBYB 2HUEA 1AO7B 3KPRA 3V6OA 3WKML 4P59H 2YPVH 4R5XA 4XCFH 4D7PA 1SM3H 5AD0B 3C6EA 2VZOA 4MXWL 4ZUVA 2XTJD 5B1JC 4PG2A 4LHUA 1NIBA 1TCMA 1KXTB 3ULVE 3DJSA 2C34A 4K9EL 5TFSH 1IFHL 4XO5A 3DV4B 1AGFA 3HZKA 3SYOA 2N3JA 3W56A 2IADB 2QADD 4XTRC 1JHKH 3NPZB 1DQQB 4M7KL 5IR1A 2WZPA 4BZ2H 5IQ7L 2HT4C 1FH5L 5CMAA 1IE4A 5C8JA 5F8QC 4M5YL 4TQPA 3WEAA 2XWRA 4A38A 3MLVH 3BGFC 4Y2LA 1PZBA 5ESVA 5IVOA 1EXHA 2NX5D 3HE7D 1HHKA 2ARJQ 2N4IA 1ZGLP 3MR9A 2DS4A 2IFFH 5DURD 1N64L 5LAPA 3NEEA 1T2JA 1CFTB 4KDVA 4PJGB 5IOPA 5FYKE 4YSTA 5C0BD 3T09A 4YHPB 3MTXA 4XOBA 4QRBA 4FA6A 3IPEA 2EDXA 4DKDC 2B3RA 5B3JF 1W8EA 3T0WA 4KTEH 3K8LA 4Q14A 1VRSA 3QQ3A 4ZDHA 1J1OH 3QR2A 4S1QL 2EH8H 4OLZH 4GQRA 3GXUB 2JKTM 3D69A 4KROB 1I7UA 2VTFA 2X41A 2WLKA 4LEEA 4PJ5D 2IV8A 4P23A 5F1IA 2OTPA 4PP1C 3MLSL 1SOXA 3VU2A 1FIEA 3GSRB 4Y9CA 4AIZA 2VAAA 5T3ZL 2VIRA 3THMH 2Q86B 4N3TA 1DBKL 1FG2A 1KENH 2N56A 3SGEH 3KGUA 2OYMA 1SUJA 1MCFA 4FFZA 4HK3J 4U6YB 4W9FC 2GB2A 4PJCE 3JV4A 2Q20A 4OCRH 1H8OA 4G1EB 3OZ9H 1RZJL 1YMMD 3ML8A 4F9PC 2N7AA 2J1ZA 2X4NB 2NUTA 2ED7A 4F91B 5D6DA 4XC1L 5DUPH 2WN3A 1QQDA 5FHBL 5ILTH 4Y5VC 1U8IB 2IH8A 1SLXA 2DAVA 5DYOB 3V0GA 2VDNB 1SOSA 2XN9D 3B9EA 3O41B 3UTOA 2DYPD 2HG5A 4KO7A 3S4SB 4H5SB 3PHSA 4B97A 3CLFH 1CD1A 5I1EL 2EYTB 5D7LD 4XPAH 1DQML 3PAYA 4NN5C 2PR4H 3OJDB 2F19H 4HFUH 4XPBL 1EPFA 2RR3A 5HHMB 3GGWB 2GTZA 4GW5B 4TQ8A 3SDYL 1D2OA 4JRYA 4XXCA 4D8PA 1QZ1A 1JG9A 1RKRA 2VQ1A 1LEGB 3ARSA 1MZZA 4AY0A 4NKQB 5JIDA 2BSRA 2J6EL 1LEIA 4AEEA 1CXHA 4Y5YA 3C08H 4A2HA 3ARRA 2JKSA 5C71A 3B3IB 5J1AB 4GLRH 5AG8A 3F58L 1T6VN 2NTFB 3EOBB 1XR8B 4BUQA 5I17B 2PYFA 2V2TB 2C3XA 1JV5A 3BKJH 3HG0A 4UWQB 3ZMNA 5B38A 1N0XH 4BUHA 5KS9B 1CG9B 5D1XB 1T6BX 1T4WA 3L9RA 2A9AA 4JN1H 4ZQTA 4K07A 1A1OB 3M86A 2XBZA 2QQLL 1ZMYA 5KSUB 5TD4A 2Y5EA 1AS6A 3L9BA 3CLWA 3T0EB 1NMBH 1JN6B 2V2XB 3WSQL 3NCFB 5CLWA 1L3WA 1I8MA 1ZVNA 4GQZA 3VI3E 1V05A 1V10A 4JDVA 2BNUA 5A43C 3OAUH 1XGZA 4YUEL 4EDXB 4LCYB 5DMKA 4NZTL 3GMLA 5FW8A 2Z93B 2V7HB 3D07A 4N2GA 4O02A 3D4GA 2ARJA 3FUIA 4Q9QL 2WINA 3NZ8B 5I76A 1MCBA 4JFEA 1Z0MA 1QLEB 1OM9A 1ZT4B 4D0BB 3H3PH 3LDBB 1J9SA 1JUFA 5EMYA 3ARGC 2BP0B 1DVFD 4LNVA 1H6EA 3UC0L 1OF2A 4HJ1A 5HYIA 1OW0A 4K55A 4M6AA 1NC4D 2OXHA 1FAIH 3CXHJ 4H8WL 4ZMZA 5DRZB 3F04A 5TDNB 1WFMA 3SKJL 1AGCB 3GJEA 3S5LB 1Z6JT 3NA4A 4Y4FC 4EZMA 2J72A 4ADIA 1S7VB 1IT9L 2B59B 1HEZB 3VNZA 5CCKL 1ASOA 3X1GA 3NSYA 4BGLA 5CJXA 1P1ZB 2GSGB 1IAII 3MOAL 3KPMA 3SJVB 1T20B 3OMIB 1OTTC 3SE8L 5J6GB 5C2BH 1B0RA 1JXGA 4CSTA 2H41A 1SJVA 1XMWA 3BVTA 3DTXB 3IDYB 4LEOB 5JXEC 2NY6C 4J28A 1RPKA 3DETD 5JOEA 4CVZB 2F5AL 3U4KA 3N9GH 2FO8A 4BZ1A 4JKWA 1U8JA 3SGDH 5BV7L 1QR4A 3L3DA 3S5YA 2RAMA 4G6AC 1YN6B 4YBQD 5HGDB 5I15H 1FHNA 3U9PL 2OX5B 4P57A 2P47B 1FNLA 4R26L 3QNYB 2IMMA 4MFHA 4NKMA 3ARFC 1KXVC 4KH2A 5GHWH 1DBAL 3TVMD 4UILL 1ETZA 3DLQR 2XVKA 4MNQA 5HDBE 1DBMH 3D05A 3VWJD 3PIQA 3B5GA 4FNLL 3MRIA 3VDBA 4MQ7B 4NZUH 1F3JA 1A64A 3FQXB 4ZS7H 2P26A 4JCMA 3HAEG 1ZSDA 5DEGA 5CINL 3C5SB 4QRTA 4ORZC 7FABH 3KD4A 1ZA3B 4A7GF 4PFEA 1M7UA 5I0WA 1SY6H 2Y06L 3NH7L 4KDTA 1MFEH 3HLAA 2DICA 4IJ3B 4YFDB 4WFEE 5J6HB 3QO1A 1M1XB 3WNOA 5GGTH 4DP7X 2XY2A 3AAZA 2UVFA 3DIDA 1R34A 4WZ9A 2YA2A 4AMWA 1P7KA 2WIMA 3SE4A 4Z7VB 1WZLA 1NIEA 4OFYA 3ZTJH 5H94A 4MXQC 2QJDA 1X7QB 1R5WA 3K74B 4ZUSB 5EG6C 4HOXA 3P3SA 5I66A 4HAGA 4ICXA 5I74B 5I1GL 4G80A 4H20L 1QNZH 2B4CC 2M26A 1BD2B 1J87A 4ZMTA 3RL1A 2ENJA 3FSVA 4LP8A 4NP4H 3GZQA 1P4UA 2EIMB 4P04A 3MUJA 1S78D 4ZD3L 1MW0A 4CW1A 3RZCD 2OTWB 4KKCD 5ACMA 3UDWA 5T3XH 4JREC 1NGPL 32C2B 3ZN6A 3N41F 1HCZA 2V9TA 3B8SA 3EOTH 1M7DB 4PS3A 2ICEC 2X5PA 3FONB 2H3KA 3RL2B 3LQMA 1T1ZB 3IXTB 5BOJA 1YN7B 3OV6A 1L9NA 1KYUA 2Z7ZA 3RWHA 1IE5A 1B0GB 4GUCA 5DVKA 4IBVA 1CF8H 2WUBL 2J6EA 1CIUA 2IH9A 1UWGH 3WDHA 2JELL 3QI9A 4KUZH 2EDYA 4GAGH 1OF0A 3MRBB 3DURA 1J1XH 5DT1L 4R8WH 2LU3A 2A4ZA 1XAKA 3CVIL 3KLQA 4CILA 4M00A 1KNOA 3VDAA 2WZ6A 4GI8A 2WIIB 4JGUA 4UQ3A 2ZWLT 2BVUA 3PUUA 2CBOA 3N2JA 1KCUL 4ELMA 2ZIDA 1RY7B 1Q38A 5JOFA 5KZCD 5E2UH 5GGVL 3RWIA 3MCKB 1BFOB 2ESVA 2VZ3A 1QBBA 5KAQF 1UM4L 4XPFH 4LARH 4R7DB 5FUCC 4NQEE 5D2LE 5DC2A 1W72H 3AG1B 4X7EC 5AL8A 2VSCA 2DWDA 1OCWL 4XH2A 1R0AH 1I3RB 1KIUB 3BAWA 3QWQB 4GPVA 5E8NA 4EF3A 1P84J 1N5AA 3ULUL 1C08A 1Y6KR 3VXUB 3VXSD 1KBGH 5DHDA 5FECB 3QEGH 3SY6A 3W9EB 1WBZA 1L7IH 5FYKH 3B43A 5T1KB 1IJ9A 2QGEA 3FSZA 1JZEA 2HTLD 2ZCLH 3F05A 4DFHA 3LQAL 1ED3B 3ARQA 4GEIA 1WWCA 2KPWA 4POZC 4WW2B 5D70H 1LMKA 1WHOA 1HE7A 3I9AA 4OLXH 1KIQB 4U1NA 3JZYA 4BWTA 5F7DB 2Z1KA 4CJ1A 2NCEA 3ARTA 3REVB 3QSKB 1A21A 5AYUH 1CLZL 2BRRL 4YGAB 3V0DA 3ZKND 4YLBA 5FHAH 2ZX8A 2QQKH 2X4RA 3U9WA 3EO9H 3TFKD 4NJAH 2EYSA 4ETYA 4FADA 4I13B 1A7RH 5E8OA 4AIOA 1CI3M 3V6BR 3G5ZA 5E2WH 1RZGB 2VZ1A 4NPYB 5IB4A 3QFGA 5CEZE 1TZIB 3HC0A 3TIEA 5E2VH 1EBAA 5DTFA 4XN7A 1PL3A 1W9XA 2CRYA 1A3RL 3NCYS 1N7MH 1UVQA 2XTJC 1KN4L 4JPKL 5FUOH 4PUBH 3QORA 4TUOA 3CFCH 5J6SA 1FNGA 2C1OB 3BT0A 3DJTA 1N6QL 3JQOB 4GO9A 5CD5D 2D9CA 3MRHB 1ANUA 2RA1A 4TQIA 3I85A 1T1XA 4LP5A 3VQ1C 2QMKA 5BZXA 3U0PA 1W0WB 5IJKA 1WZ1L 3O3AB 3IDIA 4NWUH 4CMHB 1A6WH 4Q6IA 1UB6B 1ZS2A 1U21A 4CVXB 2UZXB 4AZUA 3RNQA 5G5DB 4LSRH 3LN4B 3MRLB 1EFQA 3D3VB 3H9SA 1PYWB 4X83A 1ML0A 1D9KB 3L7EB 4F3FA 4IU3A 2A9NL 2V9RA 3FO2B 4WUUB 1TNNA 3P54A 2AJXL 3HE7C 1U8QA 2KZKA 3IMSA 2V5SA 2YEQA 3CX2A 1E50A 3GMRB 3CZFA 2DMGA 4F1ZA 5C0DA 4X4ME 2VR5A 3MV8B 3SD2A 2YPLD 4BKLA 4NQCD 4QT5B 4A6YH 5T1KD 1TTUA 2PCFA 1F45A 4YX2H 1FPTL 4KZDH 4FFYL 1MJ8H 5EU4A 1AHWC 3BXNB 4G43B 2IANA 4OI8A 2Q7NA 1KB9J 3HNSH 2WGXA 4LEBA 4AGNA 1DCEA 3P4NB 3BZDA 3JSSA 2FBOJ 3K6FA 2ZP0T 1CICB 3MXWH 5FYLL 2AQ1A 5DUBB 2OS7A 5FYKU 1NBZB 2PO6A 4JB9L 4F8TA 4KAQH 3BT2L 1HAUA 2IPKB 1TCRB 4UT6H 1JZHA 5IB2B 1AE6L 2X4OA 1DVZA 3IU3A 3OKLA 1NFIA 2IBZY 3EDDA 3O11B 4LPCA 1VAHA 4H1LH 3WJLC 1R3JB 5DO2D 5E4IA 2XVLA 1PVHA 3UPRB 4RVBA 1KPUB 2Y6SD 3EF4A 3PWUA 2OXGB 3PF2A 1A1NB 3QUZB 1MQ8A 3W39A 5C0FA 3O0LA 3ALXA 2EXWD 3DVIA 3DPBA 1NDTA 1Z5YD 3LEXA 4HUXA 1Q9KB 4YBLB 5EEVA 4AT6A 4ABQA 3I2CH 1ZANH 3OQ3B 5C0RH 3QUMB 4PWEA 4ZW8A 2IPUG 1R9FA 2EACA 1K6QL 4IRSB 1BM3L 1DN2A 3DIFB 4MHHG 3DO7A 3B9KA 4XP5L 1KGCE 5HYJD 5JOPE 2JWYA 4U1GB 1ZHNA 1Y6NR 5KWYC 1UTDA 4G72B 4HVBA 5DHYB 5IF0B 1ZAGA 4YSDA 4O58L 5EC2B 2BWIA 2ZX6A 4OVUA 3MOQA 5J7CC 2ZKYA 3PDOB 4L4VB 2H2PC 2X09A 3ZE2F 4RMVA 4DQAA 1P2CB 5E5UB 4D0DB 3LS4H 4IU2B 1AR1D 4QRRE 1MI5A 2R2EB 4FJ6A 4PP2B 3S98A 2H0JA 2C4FT 1DQIA 4DT2A 5DGQA 2NRDA 5B22A 4TVSa 3FN0H 4UU9A 3VQ2C 3DUUB 4RH4A 4EZKA 2NZ1A 2DEYX 2CUMA 1MFAH 3KPQB 5DJDB 3SODB 4P0DA 3VFPA 2ED6A 3N1MC 4GAJH 5E9DD 4B5EA 4YXHH 3P77A 1HSAB 3QHZH 2CGZA 3QUYA 1DBBH 4HXBH 1CBVH 3NSFA 1NLBL 4ZFQA 4JFTA 4ODHH 1DR9A 1QI4A 1A4JA 5A6MA 1A5FL 3MGTB 2DRUA 1DDHA 4WHYG 1IVLA 4BELD 4KPHH 2FJHA 3B2UC 3MRNB 5I6KA 2VDOL 4PJAB 1DQTA 1A7OL 2VSDA 1FCGA 4NN7B 1XCWA 3QJUB 2H6OA 2ZOKA 2OJ1A 2Y7QA 5F88B 4CBPA 2O30A 2MNJB 1DVFC 3PGCA 4WK2B 1OAXL 4X7SL 5F8RC 4AENB 1QBLL 4RNRA 4HKJA 5FWRA 3HE6D 5I9QB 2NLJA 2KMWA 1RUML 3IJ9A 1HTYA 3BKML 1MHHB 1L0PA 2GUOA 4TUJB 4LCIL 4AOFA 1KTDB 3QZMA 1RPUA 1QSFA 5BVPL 1HQ4A 4I1PA 2J44A 2ZOOA 1SJXA 3F12B 4DAGL 1YQVH 3RY5A 3BO8B 4GW1B 3I50H 4QRSA 5AYQA 2HVKA 1P7QA 2VISA 4L4VD 4FG6C 1ZHBB 3N43B 2XRAL 2COQA 1Z0NA 1UOKA 3SQOH 1DVSA 4P3CL 2OCJA 3VI4E 2V3DA 4MRBA 4MA7H 3MGOB 3FT2B 1OIOA 2BY1A 3DETC 4LLYA 2ZOWA 4XMVA 4NQQA 2JSFA 4O2FA 4KV5F 3D9AH 1VZGA 2OZ4L 3C6SA 4YBQC 3LHPH 2A38A 4Q56A 5I8EB 4OKDA 4Z9KB 4I1RA 1BQHB 4AQ8C 5CAYB 5GS3A 1UD2A 5BUAA 3TVMC 1I8LC 4YDKL 5BS0E 2DM4A 1OGAA 4NRYA 3VWJC 4ORGB 1JRHH 1OZUA 3PGDB 4FFYA 5JA9A 4MDIB 1XX9C 1KC5H 1UQSB 1WYJA 5I16B 3ULUF 1PY4A 5D1ZB 2XI9A 4WFFD 1UKTA 2HFEA 3AWGA 2EDDA 1TKWA 1YNKL 1YEEH 4J12A 2W60A 3HFFA 1TLKA 3L6FB 1B9ZA 4M7ZB 5ES4B 3AS2A 3NZUA 2VLJA 3H54A 3S88L 4H8UA 1KFGA 1YNLH 5GGUA 3CX5K 1Z9NA 2OSYA 1NCBL 4PQXA 2AK1H 5L2KE 2ZUUA 1CIDA 2X70A 3LDBC 4X8CA 4Z95L 2IQAB 4U6VH 5GZOD 3UZEA 4HWEL 2OMUB 4FFZH 3KNBA 5GGRA 4J3BA 3OKNB 3MCLH 1ZTXE 3JV5A 4JZOA 4PY7B 4OM0H 5DD5H 4Y5XB 3UYPA 2WJ7A 4NRZA 3MREA 4H0LC 5JW4M 5K9KA 3HMXL 1H15A 4OFPA 4U1KB 2DQIH 3EH2A 4PGEB 1S78C 1V7NH 2OR7A 4DQOL 1CE1H 1TR7A 3KWVA 4LLDB 3SGJA 5L8JB 3ZMEA 5DZLA 3WIHH 3K71B 2IAMB 3LXUX 1DFBH 1I85C 2RBLA 5KSAB 5HPMA 4FX5A 5I6OA 4PJDB 1TDQA 3QS3A 4WFHE 4GY4A 1SVCP 5D2NA 1UT9A 4QO1A 4P2QE 1HYRC 5CEZH 5TF1L 2IPUK 1JI1A 3ESPA 2L04A 3OKMB 2V6HA 4U7MA 4NKDB 5HHOB 4KTDH 3SE9H 2MHAB 4Z76A 1CFSA 2J2ZB 3RRQA 2LV4A 3BZFB 3MLPA 4WNJA 2A4CA 4M5TA 5KVGL 1SYVA 3IMBA 4GP5B 3FUMA 3BIBX 4U1IB 2RCSH 4GRMA 4PJHA 3LN9A 4E9RA 3N40P 4GMSH 4YFLF 3EYFB 3LNGA 4G7SB 2X4PB 4A2GA 3TBYA 2OR9L 4WCYL 3C60B 2WXHA 1U8KA 4NBYB 4PJEA 4MD5B 4I2XE 2X12A 1GS8A 5FYJU 1KCKA 5EOQL 2XVBA 1R5IB 4YHYB 4XHQA 3FU9A 4FQLH 1Q9LA 3QA3B 1EZLA 4H0GA 3VXRE 4ZPVA 4B27A 4DKEH 4FA7B 2WQRA 1ZGLB 4CGUB 3UAJD 1KCSH 3S36L 1U9KA 2ADGB 3ZBMA 4OFIA 2BOCB 4N8PA 5TPWL 4GAYB 4CJ0A 3CU1A 2R69H 4GMTL 4LAQH 3F7QA 2X4SB 4B9GA 4N5ED 4YO0A 3RNKB 3KLHD 5D71H 2CJ3A 4PV8B 1WA1X 3ECVA 1RJYA 2DQEL 5GGSY 3IAQA 3CV5A 4MQXC 1L9OA 1LHZA 4Z5RB 2C3HA 2F8VA 2ZXQA 3AFLA 1E28A 1VGKA 1Y0LA 2IAMD 3T3ME 4PJXE 3TFKC 1NL0H 2A99A 2NY5L 3BW9A 3I3DA 1AQ8A 3ZE0F 1F5WA 2PP7A 3BP4B 3CHOA 4N85A 5EN3A 2IG2L 5D1QE 4BBWA 2XCMC 3E3QC 2FJSA 1PMYA 4NT6A 5HGBA 2BNRD 5F0MB 1SHWA 8FABB 3HS0B 5ADPH 4UAOB 4HFWA 1NC2A 4XPHH 2OJZL 1M05A 4PJ7F 4UZUA 5AOJA 2A9MH 4XZ4A 5JW5B 1R1CA 5JMOC 3D2TA 2OZ4A 5DVOA 1IFRA 2WQAA 1IAMA 4BZ1H 1MRFH 2EKSB 4G7YH 1K4CA 4QNPE 3T0VA 2R0LH 3RWGA 3WJJC 3UTZB 4P5TB 3MLUH 1HH6A 2KLSA 4R97B 4F9LA 5C1MB 4JRFA 2HA1A 1IQWH 3BUPA 1Z3GL 2CK0H 1W8OA 4BM7A 4I87A 1ORSB 4H88L 5D96B 3ZZ1A 4ODVH 2O5NA 5DRNB 5B7FA 2XYCA 2NW3B 3UZVB 3Q06A 5SX5K 1YMHB 3I75B 1GMIA 3MACL 3HB3B 4PJCB 4AIEA 4ZNCD 2HT2D 3MJ9L 1B0WA 4R4BA 4HEME 2ATPA 2IOMA 5IMLB 3QWOA 4WEBH 4ES8A 2XACC 2MCMA 2X9ZA 3IE9A 4W9DC 4XP4L 5MEOA 3AQDA 4IS6A 2AS5M 3DOHA 4Q9RL 3PJLA 1QR1A 4UINH 3GBEA 1EK3A 3IU4H 1JWSB 2Z65C 4ZT1A 2X44D 3TFBA 5EN2A 4P06A 3SDAA 3SY0A 4FTVD 1P5UA 3TJHD 4LCWA 2AQPA 2W0PA 4XN1A 3S9DB 5C86A 2YPLE 4P49A 3CZGA 1HYSC 4XBEL 4L1SA 4Q89A 2H8PB 2MJWA 5E1GA 3BQUB 2NSMA 2FGWL 5HVHB 4XE5B 3F5WB 4I1NB 4X7TA 4F5CE 2VQTA 1TZOA 4G5ZH 1B4JH 5DO2C 5KYXA 1GCYA 3CDGB 3QB7C 3IJYA 3KH3A 4FJYA 1MLBB 1J12A 2Y6SC 3VFMA 3AZUA 3GI9L 3I6GA 3C5JA 5H2BA 2XZCL 1LO4H 3AT0A 4A6YB 3MA7A 1N5YH 4YDZA 2E7LC 4R0LC 4DO6A 3KWWB 2O6PA 1CTNA 3LKSB 1TEYA 2YAOA 5EU5A 4L4TE 3O2DH 4UV7H 4OSUL 4ZX4A 1F6AB 1I9IH 2ZUXA 1ZLWH 5C6TL 3EHBB 5IVZB 1Q4NX 1A7PH 3TNNA 1SJHB 2NNAB 3S5ZA 2HB0A 4RBPK 3EDJA 4K3EL 4U7SA 1QYGH 3WIFA 2DKSA 4ODUB 2BH0A 4U05A 3C5ZB 1S5IL 4EXKA 4GB9A 4PJ9D 1OGAE 4LVOC 4H1LB 2NY1B 2Z31B 3VI3B 2OBGA 1EQWA 3GSNH 3VVVA 1N6VA 4I7ZC 1AR1C 3BUTA 1N2RA 3WY1A 3NJLA 3C6LD 1ZWIB 1NIFA 2KH2B 1FZOA 4L29B 1AMYA 1TF4A 4C56A 2CBMA 3MV7D 2EEXA 4MA8L 4YHLL 3WEBA 3L16A 2DMCA 4EN3A 4KZEH 1PZUB 1XGQB 3PQYE 4QOKA 4OJAA 1ZJAA 1CE6B 3ZSSA 4LMQI 4C58B 2I9TA 4MCMA 4QRUB 5I6NA 1R5VA 4NQDA 3WFCL 4J27A 2DIBA 1CICC 2MRYA 3HPJA 4HJJH 3K2UL 4P9MH 2LW3A 3ULAB 3L3KB 4BA0A 2JE8A 3KLSA 3E6FB 4XP9L 2JLPA 5FX3A 1U6AL 3UAEA 2G9HA 3IE4A 5F6HJ 1NEZG 3UYRH 2XWTB 1XB3A 3UTTB 1FNHA 5FIEA 3FL7A 5AW6B 1ZLUK 3T4AA 5E2TH 2ORBL 2BSSA 1QOKA 1T2QL 1HXYB 4HIHB 3CZSA 3TCLA 3SPJA 1OAZL 1RURL 3K2IA 1FF5A 7PCYA 2BCKA 2PTUA 4OBRA 3HE6C 3DA0A 4N90E 1P4IL 1K5NA 3PL6B 2BY2A 4I3RL 2AJYL 1VADB 1KGJA 4HBCH 4Y7MA 1ZTXH 4I3SL 1PCSA 4JKKA 3QVAA 1E8XA 1KPRB 3MLTA 4V1DA 5HHVH 5HGHB 1UACH 3L5XL 5D93B 1NUFA 4IGBA 5I1LA 1E67A 3D6GA 2DBLL 3BPNB 3SOBL 2OP4H 1GZQA 2Z31D 3H53A 3S34H 3CFKA 4MAUH 4YFLI 3OVUB 1K8DA 1UKSA 3VJ6A 3NP4A 4JCWA 3HTLX 5LNDA 5DJ2A 3O8XA 5F6IC 3F6IA 3U0WH 2BHZA 2EADA 4PM1A 1RJCA 4U1HB 1FNAA 2AXFA 5EDXA 3V4UL 1J9TA 2EH7H 4S11A 2BDNH 3AXIA 2DLTA 4MVBD 3ZKXB 4WI0A 2N7SA 1D5XB 1QKZL 1NOFA 1RZ7L 2ID5A 4HZAA 1JGEB 1F2QA 3QAZC 1ZV2A 3KPRB 4AVHA 2JCCE 1GJUA 4M5SA 4JQVC 2FQDA 1TO4A 1IC4L 3IDMB 2UY7B 1Q0YL 3FU3A 3NSJA 2Z4QA 5CU9A 5CGTA 5ANME 4OI9A 3HAEA 5DU7A 1MH5A 5EZOL 4JUSA 4XPGL 4XX1E 3SO3B 1JF1B 3LKRA 1DJSA 3NJGA 4JDZA 4NAQA 2WXJA 1E0OB 3QNZB 3P11L 3U7AA 3MOBL 4D94A 2KYIA 4C4KO 4KX7A 3HZKB 2VE6B 3VCLB 3WLWD 3F85A 2R83A 3UTTD 4A7TA 4ONHB 5L9DH 2CHNA 3L9YA 4JE4B 4U4IA 1IC1A 4XP1H 3LZPA 3D06A 3TBTA 4NN7C 2WNGA 4IW4C 4TOYH 3CCHA 1MEXH 1XF4B 4ETQB 4TLKA 4K8RD 2VDKL 3TGXA 1EMTH 5C8JB 1XH3B 1F4XL 3P73B 5SWQA 4LVHC 3WS3B 1HVXA 1WWBX 4NM4H 3RUGE 4BA8A 4RA3A 4E9LA 2R0ZL 1J0KA 1U8PA 4UB0H 3KMDA 1TJIH 4OGZA 1F1AA 3QEQD 3IK2A 3L8QA 4U6XB 4H8PA 4PY8I 4L1HA 5AL0A 1XO8A 2EILB 2XQYG 3F62A 3ZL4L 1MCQA 2CSPA 3L48A 1NCTA 5JPMA 4OV6F 3D69B 4UF7C 2IIJA 2KQMA 2X0VA 4NQEB 3I9IA 3PNWA 4U0RC 1U36A 4AQAA 2ZUQC 1TQVA 4Q58C 2ITEA 3LIZH 3MYJB 4PRHD 1XIWA 2EE6A 1FG2B 3GQFA 1EJOL 1MIEH 4GG8B 5KBDA 1BQLL 5CHNA 5GRWA 3WGVB 1UURA 4GIAA 1KWKA 2RMNA 3JV4B 3KPRD 5MENA 5E1IA 5L7XL 3L3JA 1CCZA 1WC7A 4U1LA 1HX0A 3NA9H 2AXGA 1C12B 2A1WL 3RX7A 1H5BB 3DC0A 3DV6A 4FGMA 4LHUD 1NWPA 2MEJB 2WO3B 3T4YA 3NJKA 5G4OA 3I84A 1JV2B 1NKOA 1TG8A 4WTQA 3TBVA 1RP9A 1U95A 5CSZA 1KB5H 3T1FA 3NFPA 4JY6B 2I60L 2VLKA 4GI6A 4NNYA 4FULA 4N8VG 2OL3H 3FB6A 4FQCL 4L1DA 4DK3A 4HGMA 5TTRA 4LGRB 4NIYE 3E1F1 4YN3A 5AVYB 1FL5A 3I02A 2BLFA 2WZPD 2GTZB 1ILSA 1CLOL 3WNKA 4YXLL 5ITFB 5E6IB 2OMYB 4QRPE 1QAWA 1WT5A 2ZKHH 3FOLB 1MW2A 1HL4A 3WTXA 3BE1H 4ONFH 1OOAA 2BSRB 3EZJB 4ZTOL 4EIZC 4BK5A 1UZ8A 4UDTB 2WN2A 5EFIB 5IEKB 4Y5YB 3L2LA 4N5EC 3KLHC 2OTUA 4DWHA 3U2SB 3L1OL 3QXVA 4E9WA 3CN4A 1A9BA 4HPOL 4WV1C 2ZSWA 3DBXA 4A37A 2CALA 3AITA 3M07A 4XRCA 2PYFB 1HL9A 5T33H 4XVTH 2FRGP 3IFLH 2DJMA 2IAMC 3ZQXA 3L9RB 4ZOCA 4P23D 3I9GL 4RGOL 5FCSH 5BW7C 5JW3H 1OLLA 3QWRA 5AWNL 1ZA6A 3EUDA 1KIRA 4L8BA 4N2HA 4XBMA 2P5EA 3RIFK 4PW4A 5CZXD 1TJGL 2GITB 3ROOB 4NX0A 4JRLA 4Z7IA 3HCVA 3H85A 1X6NA 2BNUB 1RZFL 4TSCL 1A6PA 2P52A 4BH7B 2B8OT 5IMMA 1OT2A 5DMKB 2OLDA 4X7FC 3KBHE 1E6OH 25C8H 4ES9A 1PLAA 4XN9A 3R8QA 2WINB 3FKUS 1J10A 1G9MC 3AG2B 3IDJA 4HK0A 1N19A 3ASWA 3JWDL 4G6JL 5D7HA 5IV2A 3D50A 4XXDA 1G6RL 4TPRH 2BNRE 4ZMAT 3WFDL 2GEEA 1DZ0A 2EEFA 3TP4A 1OF2B 2R4RL 3Q2CA 1I3VA 1AC0A 2QSCL 1RUAH 4WGVB 4X5RA 4HJTA 3LXCA 5JTWA 3V0WH 4FFTA 4FS0A 5JPNC 3D12B 4G7RB 4UMSA 1IC5L 3FRPB 1JPSL 1BYNA 1X5HA 2XUWA 2ATKA 4JRYD 4K71B 4MDJA 4MX7B 2HT2C 3P4MA 4FA8A 3E8UL 5FR3A 4LHQB 5H37G 1AR2A 4Z7OF 3KPMB 4HUKB 3MJ8B 4HS8H 5GISL 5LDUA 5LBVA 1C16A 4FLQA 1INEL 4RRPM 3ESUF 1ZT7A 3TJEL 1P4LA 3PDGA 1F6LL 5E2JA 3UBXG 2VXVL 5KJ7E 3MODH 3X11A 3QK0A 4CN1A 4BQCA 1YECL 4HPYL 3L3DB 1ITBB 4JM2B 1KBVA 3STBA 1QBMH 1GY2A 4PIBA 1ACYH 3BIKA 3OKDA 1JS4A 3IYLW 4F7PB 2X7LA 1U8NB 1ETZB 2JV6A 4AL8H 1U3JA 4J3OH 3BSZH 4OJYA 1MJUH 3PIQB 5E6RB 4QCIB 1F3JB 4G6FD 4GQ9H 1WEJL 3JTSA 2X42A 2J1XA 4UAOC 3FU0A 4KXDA 1PU0A 4QRTB 4WTXA 4QRRB 1TZAA 2NZ9D 5DMJB 5IREA 2B1AH 1EHXA 4X98A 3X3GL 3ZE1F 4F33A 5JHLH 3DSFL 3HUJF 3MPCA 5I30H 1BBDH 3GXIA 4FI8A 4DK5A 2WV3A 3FOMA 4JFED 5FFOA 5MP6L 3RGBA 1UHVA 2ZG1A 4MAZA 3LRMA 5C0AA 3VH8B 1SBSH 3INUH 4KTYA 1T03L 1SBBA 3LY6A 3A23A 4MJ5A 2F8IA 4RQQA 3TWCL 3P3RA 4AH2A 1G7PA 1HINL 2FZ3B 1NCUA 4YSPA 5CEYB 1H9DA 1QSEE 4G80B 1BPLB 1FGVH 3ZDXF 3BWAA 2OMTB 2YQBA 3MROA 5JMRA 2IEPA 3U7YH 4Z7WA 3BH8A 2I5YL 4CW1B 1FI8C 2G3XA 2BWDA 2P7TA 1OP9A 4OBSA 3ME0A 2XIBA 3C6LC 4UOQA 4NCC1 1X6LA 3OWEA 4W9JC 2R0KH 3VGDA 4CA4A 2WYZA 3BD4A 3VO0A 2DM3A 3WS6A 3S35L 3TYFB 4AMXA 1MUJB 2Y24A 4NHUB 3VD4A 2ZWYA 4KFMA 4NGHH 1PS3A 3GIZH 2YSSA 3VRIA 2JTYA 1AXSA 4LVNC 5MERB 3L4UA 3TO2A 3O0RL 1MFCL 1KCLA 3DURB 3K7UA 1E5UI 3Q2LA 4MNQD 4ZUWA 5C08E 5MEQA 3O3EB 1KNOB 2PW1A 4PTUA 5HVHC 4UQ3B 5I1JH 4JFWA 1S7UA 3WD5L 1L5GA 2WLHA 1UWXH 3GSNB 4YSUA 4JG5A 3BPCB 3HG1A 5TJWK 3VI4B 3RWIB 4OD1L 4PIRF 4YPGA 4P4KA 5CS7A 4N2KA 3LD8B 1VACB 2TAAA 2R8SH 4IKIA 1AYOA 4XCYA 1EEZA 3FHEA 5TGBB 4LQ1A 5T3ZD 4ZSOE 5HHXH 4N2OA 2ADIB 4JG1H 1MFBH 1N5AB 3KLAB 3EHBC 5EZPA 1YEGL 1C08B 3MDJA 2QSVA 3MFGB 5BXFB 5GRUH 5BS0B 5C7XL 4OFYD 5MENE 1WBZB 2X28A 4X5QA 4Z7UA 4NJ9L 3V5HB 1GYAA 4PB9L 1O0VA 3CVCA 5JORA 3TOPA 2CPCA 5IBTL 4LEXL 3UGEA 3K6NA 2LAGB 4FXGC 1PSKL 3GINA 1U2CA 2F6AA 3CQPA 2WXGA 1BIHA 2Z31C 4IOIB 4MZIA 3R06B 5IJVB 1DDTA 1JHTA 5J12B 5EO1A 2C9QA 1UG9A 1L0QA 4AXWA 3NRQA 3NEXA 3R18A 2X4RB 4MVBC 1I3UA 3FPXA 1QX1A 2QGDA 3FT3A 2ADYA 3EG9B 1CYXA 3TCXA 4H40A 1XBRA 2FX9H 2K9FB 2XPGB 5SV3A 2X38A 3PP3K 5L88H 3HC0B 3IKCA 4L3AA 4ZO9A 1O6VA 2VSKB 4J6IA 3S2AA 3TIEB 2ED9A 1INQA 4JPVL 5DDHA 3PHQA 4D3CL 2IH3A 1UVQB 1OSZB 3QI9D 4KBPA 5EV7A 1QW8A 4XN4A 1JGLH 3HMWH 2C3VA 1UC6A 1XGTA 4KJYB 1A14H 2FJFA 3IDIB 2C9RA 2VL5A 1NGWB 3UACA 3WLWC 3SDCA 4EJ1C 3LNHA 1A4KA 4RAVB 3N3EA 4WWID 1BXUA 3GHBL 2ESVD 2J8UA 3X3FH 1KYDA 2XNAB 3RZWA 4IBYA 3RIAK 3GBNL 4ZPTB 3NCJL 4F3FB 4P2QB 4ZQKA 3CBRA 1CFNA 3X14A 1D5ZA 2R29L 2VABA 4M6NH 5MI0C 1M6UA 3KDMA 3QQXA 1JHLL 4GKNB 1B2WL 4XODA 3LPWA 1HU8A 1K4DA 1EAJA 3KL3A 5C0DB 2ZP8A 4ZO6A 3VW3L 1CVRA 4FCHA 1MNNA 3V6ZB 4J1UA 5T1LB 3ALWA 1QLFB 5CD3A 4BFJA 1T7XA 2A9DA 3APCA 3KR3L 4NLHA 3JTTB 1YY8A 5ECJE 5I75B 3FCTA 4H0IA 3S4SG 4AEIH 2XTSA 4AMKH 3BWSA 3IMUA 3HZVB 5HI5D 3GKWH 3LZNA 3MRKA 1E42A 3V4PA 4JO3L 5E00A 4HS3B 4YEFA 1FFNA 3RQ3A 4DZ8A 7TAAA 4XT1C 2X4OB 2X2HA 1KIPA 3IU3B 1N9PA 4RGNB 5DHVH 3VGAC 3OKLB 3QQNA 3BPOB 1YEJH 4YAQB 3VXRB 4UCFA 4XNDA 1JPGB 3MNVA 3DTUB 2R56H 4U3SB 3V6OC 1NFDF 4V2CB 4HIQA 1NOLA 2JF1A 3L5JA 3PWUB 3CVBA 3L7FA 2WO4A 2L8AA 2AERT 2ALAA 5C0FB 2BFVH 2DTML 1J11A 5CJOH 3QORD 4PG2C 5F7HA 3K6SB 4K7PX