4K3DL

Crystal structure of bovine antibody blv1h12 with ultralong cdr h3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
215
structure length
215
Chain Sequence
AVLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BOVINE ANTIBODY WITH ULTRALONG CDR H3, HEAVY CHAIN
publication title Reshaping antibody diversity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 50
structure length 215
sequence length 215
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k3dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k3dL01
2VZVA 4ETYA 4CADB 4CJ1A 2Z9TA 5EBWB 4XWOD 2AJYL 1JNNH 2YK1L 4GKSB 4NO2B 2VQTA 3DHMA 3IFNL 3UTTA 3GMQA 3VMPA 4WWKD 4FQQB 5ADPL 3I84A 1MCPH 2DMBA 3NCJH 1IAII 4WV1A 3AVEA 3MJ9L 2ITCB 2YPVH 5D6DA 4HUVB 1BMGA 4EXKA 4BA8A 5EZLB 6FABL 3T1FA 3MR9A 1MRCH 3PQYE 3MTRA 3RAJL 3HMWH 3P0GB 2C3VB 1A7RH 2DQCL 2G9HA 1IGCL 4S1DC 5DJYB 1OARH 2FJHA 1MPAH 2CDFB 2BRRL 4IIQC 5B38G 2FD6L 4J2XA 5GRVL 3MUY1 4M5ZL 5HPMA 4F2MB 3ULSB 3UJIH 1FCCA 4UV4H 1FL3A 1B2WL 1MI5B 4N8CL 4JY4A 3QUML 3V9FA 4ZS6C 2BNRB 1NUDA 4R97C 4NUJA 4F9LA 1T21A 3D39B 5LG1A 3EO1B 4DQOL 4YJZL 4QOKD 2GIYA 4ZS6D 5CKAA 4WJ5A 1INDL 1DBMH 1PKQA 4AIZA 3BIBX 2JJTA 1EMTL 2XWJA 4JFOA 1INQB 3D5OF 3CIQA 3HZMA 4QHNB 1R3KA 2VLKA 2ESVE 3U0TB 4UT6L 2BVOB 5K9KB 1RUQH 4MMXC 4LBEB 1ZHKB 4DEPC 5C0JB 1LO5A 5E4EB 4J3XA 4LLQA 3V4PH 3LMJH 2C4FU 1A4KB 1RZ7L 2LV4A 2PXYD 4JRYE 4J3UA 4ZDHA 4M3JA 1VACA 1WIPA 3PWNA 4YIQA 5C71A 3O2VL 4G9DB 4DGIL 2CGRH 1C7TA 1YJDL 4JG0L 4ONHA 1XGUB 3BKJL 2GJ6A 1UJ3B 2FDBP 4ZSOA 4F15C 1XR9B 4YHYB 5EORL 4FQCL 4CMMB 3RBSA 1NBVL 3UTZA 2A0LD 3O8XD 5IBTH 3DV6B 2JIXB 2ADFL 5J6GB 3AREA 2VUYA 4YR6B 1UXWA 1EXUB 4RGMB 4IRZL 3QO1B 1GZQB 4PJ5A 5DT1H 1S9WA 4WEUD 4WHYG 1OGAB 1UQSA 1A6UH 1G9MC 4F7CB 3PWUB 5IR1B 2HKFL 1NFDE 5I76A 4FFYL 3HMXH 3MLVL 2BSSB 1KJMA 4U1MB 4UTAL 1NGXB 2BHUA 2CXGA 2D2OA 4E5XA 4A2LA 4ZG1A 4KK6D 2CJUH 1NC2B 1PLGH 2E8YA 3N50A 2EYTB 3PWLA 2UWEB 3IT8D 2MJWA 3W39A 2JCCA 1CGWA 3QAZC 1YECL 3D48R 5GZOD 3S36L 5CEXB 4FXLA 4JVPA 1UWGL 5I2IB 3HAEB 3F7VB 4NQCD 3BDXA 2AEPH 2Q8AH 3IVKA 4P2RE 4MNGE 4YBLB 1FHGA 5IWLA 4XMLL 1T0NA 5T1LD 3CLEH 4ZO8A 4APQD 5HDQL 1BX2B 2FEDC 4KMTH 2XZAL 3RNKA 3KJ6H 1CWVA 2A38A 3LN4A 3Q5YA 4KV5F 3FB7A 4R4BB 4NBZB 3WNNA 4PY8J 1G9NH 1YNTA 3QIUC 1FZJB 4I3SH 1BQHA 4URTB 2FR4A 4HZAA 1NCDL 5F6HI 1AIFB 3EW3B 3V7MA 5CCKL 1IAOA 1ZEAL 1S7SA 5FV2A 2YPLA 4JFQA 1YY8B 1UA6L 3EYOA 3TT1L 1JNHA 5EOCH 2Z4QA 5KG9A 1K5NB 4GRLD 2E7CA 3H0TB 4WHTA 3MRFB 2NW3B 4GG6B 3F62A 5GZNC 4OQTH 3ULUH 1NBZB 1VGEH 4ZFZA 1KYOJ 3CSBA 1EPFA 3K0WA 3QUMB 2FATL 1ADQH 1J1OL 5I8EA 2GK0A 2GCYA 1IQWL 1F3DH 1MHPL 3QXTA 3UMTA 1NGYB 5DI8A 4BYHA 1QLFA 4GLRI 5KVGH 3IFPA 5KANI 4FTVD 1NL0L 4MDJB 4XBPA 3ARFB 5EUKA 4CVXA 3O2DH 4MJ5A 4RDQF 2CKNA 2H2SD 4KVNH 2OP4H 5DMIH 3IDUA 2K7QA 4BH7A 3QDJE 1TNMA 4TNWF 4FZEH 3O3UN 4PJBF 2ZKHL 1DL7H 3WN5C 2Y6SD 3HR5A 4GKNA 4OIIH 1ZHNA 2CD0A 3PUCA 4OF7A 3SGKA 3PWPE 3H7BB 3OB8A 3MSPA 3EYSL 4J8RA 3TA3A 1CGXA 3VXUB 3FQTA 3MXVL 3DWTA 1WWCA 1Y6KR 3SJVB 1UJTA 2DTML 3D69B 3CLFH 5EZJA 3QRGH 1QUNA 2NTFA 3BP5B 4N90E 3SKNA 1P4LA 1NFIB 4JKPH 1QSEA 3NABL 2ICWA 3LOWA 1NGZA 5I8OL 4M6NH 1JE6A 5D2NE 5F9DC 1A1OA 5FYJH 1RZJL 1HXYB 5MERA 3DX9B 1P4IL 5ENWA 2L0DA 4PJHA 3BW9A 1A9BA 1KOAA 3HE6B 4YBHA 5IMKA 5F7DA 4HK0A 5IVZA 3MLZL 1RJYA 5D6CA 2IPUG 4M1DL 4PJCB 5FA4A 1C5CL 4CN1A 1RUKL 4LEXL 4W6WB 4Q7DA 3B5HA 1QP1A 1RY7B 5ECJE 4N0FB 2Y72A 3B9KA 3X13B 5HHQA 2X10A 3V5HA 1LDSA 3DX6A 4KV5E 4U6TA 3RGVB 5KSBE 5D2NC 2ZJSL 1A7PH 3C09B 3M8OL 5AD0B 3FO2B 5E2UL 1MJUL 1Q9KA 3QQ3B 3NIDE 3CDYA 3D3VD 1EEQA 4JFPB 4I4WB 3GSQB 3ZDYF 4NQEE 5L8LB 1OT1A 5DQDH 3MUGA 3ZLQC 4C83B 3MV8B 1E28A 2A6IB 3G6DL 4F37K 5B3NA 1LNUA 2BRQA 4YHZH 1IAKB 4P0DA 1J7VR 1UACH 4L3EE 2Y23A 3GMQB 3RWIA 3V7AG 1RZIA 1Q9WA 4GXVL 3JWNC 1MFBL 4O5LL 3UTSE 2AXGA 1M7DB 2BOCB 1J87A 3QCTH 2AERT 3IF1A 3OTTA 1IEHA 5D4QA 4PJBE 2LVEA 2FJHB 3DNKA 3BD4A 2R1WA 4CL7A 2B1AL 3SGEI 2EECA 1BJ8A 1WBZA 5HPMB 1JI1A 3K8LA 4AL8H 5C07A 3L5JA 5DUPL 5I30H 4GS7C 4JY4B 5D9SA 4E41B 3KPMA 4NUJB 4MB4A 3RHWK 2Q1EA 3O3AA 5GXBB 2HYMA 1TCRB 3JVGA 3RDTC 4JQXA 5DFWH 2K1MA 4WJ5B 4OCMC 5AUMA 4AIZB 2HRPL 2ORBH 3CVIH 2XWJB 2XN9A 1MI5D 2OS7A 3ARYA 3DGGA 2B8OT 4PY7A 1R3KB 1YEGH 4JB9L 3T0AA 5I8CA 2VLKB 1NAKL 1KIQA 5FCUH 1JF1B 4OCNC 4XPBL 4GAJH 4D0BA 4HKBA 3JV5A 3MFGB 4ZDHB 3UDWA 1CFSA 2R56L 1MUJA 3HC0A 5FXCH 1VACB 2BY3A 3PWNB 4YIQB 5FA3A 4MZ2A 4ELMA 1HXMA 4ONHB 2BXYA 3FQUB 3VXSA 4ZSOB 2GJ6B 4WFFE 1I8LC 4LLMB 5D71H 3ZSSA 1BQLH 3HG1D 3LKNA 1GGCH 5A2KH 2OMNA 5EZOH 4HKZA 4Y16A 1XIWC 1A2YB 1MOEA 3AREB 1IM3A 2ZSVA 5EOTA 1UXWB 5B4MC 1U3HC 3EYVA 3WLWD 2EH8L 4XRCA 5JOFA 3K81A 5H35B 3LD8C 1JTPA 4HXBH 1XIWD 3GSRA 4A6YA 2Z8VC 1U3HD 1AD9A 1JBJA 1Q72L 3FO0L 5IQ9A 5C3TA 5I76B 2JIXD 4ZMAT 4ZS7H 2J88H 1C7SA 4M6MH 2A6JA 4JZJA 3RWCA 3UBXI 5FB8A 4AMKH 5CJOH 3O6KL 4Y1AB 2P8PB 1OGAD 4E5XB 1AD0A 3S3JA 5CBEA 5E2VH 2OL3H 3FKUS 4FQ2H 3U30C 3FB8A 1H3WM 3TYGL 1N8ZA 3TWCH 4ZXBA 5IKCA 3SDAB 4LIQL 3U7YH 3MRHA 4JG1H 5CBAB 5FEBA 3U9UB 5ITBH 1NC2D 4NKDA 2DQUL 3WKNA 4BSVA 3IVKB 3C8KB 4JDVA 2XYCA 3ECBA 2IANE 2X4RA 3V4UH 5J12C 2G2RA 4Q97A 1T0NB 4YDLC 1TJGL 3S37L 5J6HA 4DKFL 3LN4B 3MOAL 4GBXC 1XMWA 1YC7A 4JJ5A 1DDHB 3DMMA 3FB7B 3WNKA 3GO1H 5ISZE 1YNTB 4RX4D 4L3CA 3BX7C 1ZS8B 2EDDA 5IHLB 4GBXD 1FVCA 4HLZG 1J5OL 5E2TL 4RRPG 3FONA 2FR4B 4DFHA 4I9WD 1CTOA 2AJZB 2P5EE 1KTDB 4HQQH 3EYOB 4JREC 1M7XA 1FN4A 1JNHB 3BZEA 2Z4QB 3KNBA 3O4LE 1GAFH 2VSCA 3TT3L 3QUZA 4ZFZB 4LHQB 4XP6H 3F58H 4PRHD 2FWOB 1BIHA 1J0IA 4NO5A 4LRIA 1FSKC 5EBGA 4YHLL 2YD3A 2I9TA 3O41A 5DI8B 2P8MA 4DFIA 4BQCA 4RFOH 1QLFB 4H25B 3IFPB 5F93C 6CGTA 1FIGH 4XBPB 5EUKB 4CVXB 1TZHA 3QPXH 4KTEL 3C6LB 4JHWH 3RX8A 3O9WC 1F4XH 1N64L 2FL5A 1IT9H 3HR5B 4U05A 5C6WH 3TH2T 1UWEH 1JFQL 4YXLL 3O9WD 2A2QT 2LABA 5LGJA 3B5GA 1BAFH 4NCDA 1HQRB 3MRKA 5DA0B 2WWKO 2M1KA 3Q5TA 4J8RB 4U1GB 3TA3B 3WUWB 4JN1L 1CFTA 3FN0L 3FQTB 4MNHA 3REVA 4YEFA 1M7IB 4HBQA 3TN0A 3QNZA 3QDHA 5EU7C 1HCVA 3MOBL 1EUUA 1CIDA 4A2MA 5E03A 1A6AA 3QULA 1QFPA 5D7LE 4IRSA 5EZJB 1BPVA 1S8DB 3WXWH 2NTFB 3OF6D 3SKNB 3MRBA 3EDKA 3MODL 3PE9A 3SCMA 3G08A 1DR9A 3UROR 2ICWB 1NGZB 4QXGL 1KELL 1GGTA 2V5RA 1ACZA 2DD8L 5CILL 4KGJA 3SJVD 4LLVB 4R4FL 1A1OB 1HH9A 2AABH 5JLZA 2NY0B 5DEGB 2FIKB 4ZAKA 1VB9A 2DIAA 1T22A 3W0WA 4K3HA 4ODUB 4PJHB 1AR2A 3BW9B 4KUZL 5HHME 4HK0B 5IVZB 4ISVA 5T1KD 3U82B 3KLAA 2DQDL 1RJYB 5D6CB 1IBGL 3OB0K 4GW4B 2RJMA 4NC0B 5T1DH 5FA4B 2V17H 3E6FA 4UTBL 4AYFA 3CK0L 4P46A 3V6OC 1L6XA 2K3TA 5EIQA 3B9KB 3MCLL 3HE6D 4FQIH 4GAGH 5HHQB 4NC2B 3GSOB 2DM3A 5AZEL 4P3WA 2J5LB 3V5HB 3S3PA 1N26A 1IZJA 4FQLH 2OSLA 3UAJC 2JJVA 3BD3A 4K8RL 1O5DT 3THMH 1CDIA 1OD7A 1PG7L 4P2YA 1MRFH 1RURL 1GRWA 2R69H 2EXWC 2IFGA 5SV3A 2Z92A 5GS1A 5IOPA 1Q9KB 1I3VA 2D9QB 1FORH 1ZLWH 2R2CA 3KLHD 5D1QC 3MNVA 3GK8H 5HHPA 3DXAE 1QBML 2C3HA 3D1MC 1QA9A 4LLUA 1LNUB 5D1QD 1F8TH 3HMXA 4UV7L 4Z7QF 4JJHA 1CDJA 3GI8H 1JPTL 1BBJB 1NJ9A 2FGWL 3A67L 4OM0L 1HI6A 3MROB 4FP8H 4Y0GA 4AEHL 3MV8D 1I7TA 4LVHC 3C60D 3FFCE 5D72L 3TV3L 2YUZA 1FNSL 1Q9WB 3CUPA 5IW6A 1PEWA 1BFVH 1IEAA 1KFAH 2AXGB 1JZ3A 1ZTXH 2FH6A 3HRZA 2JJSA 1YMHA 4JZOB 1AFVL 4PJ9C 1FYTE 3VH8A 3TPUA 4M6OH 3TBWA 1KJ2H 4LSTH 3NA9L 3UO1H 4KAQL 3DROA 5E00B 1TZIA 4OI8A 2DOCA 2NY1B 2R1WB 2NX5D 1SJVA 2B4CC 1MY7A 5M7QA 4JCLA 3CFCL 5KS9A 4MS8C 3BN9C 3HHRB 2E6PA 5DSCA 1KCKA 5C07B 3R06A 4MQ7A 2HT3C 4X4MA 5IB2B 1BFSA 4N0YL 5D9SB 4LCWA 3BP6B 3KPMB 2XRAL 3VG9C 3RVTD 4EUPG 2ATPB 3O3AB 3WFBL 4DGYH 1N3NA 2HT3D 1Y0LA 4U6VH 4F7PB 3SE3C 1QFWL 4PB9L 5IBLC 2YRPA 2EDJA 3PL6C 3PGCB 1KB5H 1XGRA 4PY7B 4U3XA 4E41D 5IBLD 3HUJF 3WKMH 5KVMC 1KIQB 3PL6D 1MCPL 1KEML 3CDCA 3CFJA 3W2DL 4FXKB 5I1GH 3SPVA 4AENA 2YPVL 3I6LD 1X5YA 5F7HA 5I73C 1LP9B 4HKBB 4WEBH 2CRYA 1MRCL 1MRDH 4RISL 1OB1A 4HKXA 3A6CH 1A7RL 4D8PB 4S1QL 4WIQA 4EI6B 4OQTA 5FA3B 3SDXE 5ILTL 4ELMB 4BZ2L 1HXMB 1KCLA 3HR6A 5C7XL 3CSYB 2IPTH 5TF1H 2PYEE 3VGFA 3VXSB 4YGVB 3SHSA 4F7TA 2FSEB 1ADQA 4HF5H 3L7EA 3UJIL 1F2QA 3EOTH 5JXEA 4ZUSB 3LKNB 5DUMH 1A9EA 4YXKH 3DSNA 2AKRA 1FLTX 4HKZB 5DRNB 2MPAH 2CR6A 1IM3B 4JM2F 5EOTB 1OAUL 4RBPH 4XRCB 5T33H 3O2DA 1VA9A 4MXVF 3HLAB 4RGNB 1DBML 2YMXL 3GSRB 5AZ2H 2YR3A 4N0CD 2PO6C 5L6YH 3SDCC 5IQ9B 2APFA 5DRXA 1NGQL 4J6RL 4HV8A 3VGDA 2A6JB 4JZJB 3TJEL 4BJLA 3VI3E 4C56E 5FB8B 3FO1A 4ZUUA 5E7BA 3EDDA 1J18A 4YUEH 2CO6B 3MPCA 5FM8A 3QXAA 1ZLVK 4NN5C 4X80L 3V4PL 1AD0B 5IGXL 4Z7QE 4KFZC 5CGTA 3NN8B 3EDFA 1IQDA 1N8ZB 2AXJA 1MF2H 4ZXBB 3VXPA 3NCMA 4HPOH 3I9GH 4X7FC 4Y1AD 2HLFC 2DQTH 5C09B 3PABB 3MO1A 5E8NA 4NKDB 2YZ1A 1KB9J 3F65A 4B5EA 4NRYA 5DLMH 3QDMA 3F5WA 2PW2A 3SDAD 2G2RB 3TP4A 5HHOA 1HHHB 1P4BL 1I8KA 4XX1G 3MV9A 4LPVA 4F33B 4K94C 2YC1A 2P24A 3ZKXB 1EV2E 4TSCL 4K9EH 5J6HB 1A6UL 1LK2A 1MJJA 4KVCH 3ZHKA 4TVPL 3HMXL 2XPGA 1N0LA 4MD4A 3DMMB 3GBMH 3F7YB 1JGVH 3KDMB 4V1DA 4Q9CA 1AO7D 1FVCB 1PAMA 4MD0B 3IFLH 4OD3L 1JPGB 5DD5H 1UZ8A 4ODHL 3SDYH 3SO5A 1PLGL 3BIAX 3NVQA 3BRFA 2B20A 2NXZB 3BKMH 3RWGB 3TVMB 2C1OA 1F6AA 1UG9A 3HUJE 4M7ZC 1FNGA 3KNBB 4XC1H 2EDKA 3SKMB 1YYLH 1P5UA 5BZWA 1BD2E 2VZUA 1CL7H 1FDLL 3EOBB 3QUZB 2EEBA 3I3BA 2AEPL 1MHEA 2R0ZH 2APTA 3IAGC 3GRWH 5BO1L 4NO5B 3T0XA 1OLLA 4S2SA 4KJYA 2I9TB 5T1MB 3HA0A 3O41B 2P8MB 3CLEL 4G80A 3X11A 1TJHH 4MAUL 1UVQA 3PJSA 8FABA 4JFZH 4OCYL 2FX8L 3MYJA 3WE6B 1BOGB 3KJ6L 1TZHB 2VXTH 5ETUA 2Z31C 3P0YH 3AS0A 3B6SA 5BS0A 1VFAA 3MNZA 1CN4A 1KCRH 2FL5B 1KIRB 2I60L 2DB8A 1G7MB 1CLZL 3MLUH 5T3XL 4OLYH 4PLKC 5DC4B 3MRKB 1CZ8H 3OR6B 3KHOA 3H42L 3GNMH 3C6LD 1CFTB 1E6OH 5EN2A 3REVB 4JO2L 4ODSL 4K3JH 3TN0B 5EOCL 5F88A 3GUTA 1O0VA 1TQBC 2CSPA 4X7SH 4I0CC 1A6AB 2YSSB 3SE9L 4IRSB 4O02L 5DMGC 4OQTL 1VGEL 4U0RB 1LO0H 3MRBB 1VKXB 2WIIB 1SMOA 3G08B 5J13C 3X17A 2ARJA 3RL1A 1Q1JL 3P9LA 1RZKC 1T6WA 1FLRH 1HH9B 3C8DA 4OUUA 4ZNEA 5JLZB 2QADB 2R8SH 3VRIA 3WJLC 1XF1A 5JHDE 5KVGL 4JM2C 2QSVA 4PPTA 4IRJA 1T22B 3W0WB 4L1HA 3O2DL 3LRGA 4ISVB 4KVNL 3JV0A 3KLAB 4U33A 4KQ3H 1JGEA 2WW8A 4FZEL 5C0AE 1OL0A 4I3GA 2AQ2A 4GMSH 1G7QA 5DVKA 3E6FB 3HPJA 1RUPH 4G8IB 4HC1H 4OIIL 4Y2DD 2QTEA 4P46B 1FO0L 4OBSA 2KQMA 1TJIL 2DMKA 2P43B 1S9YB 5ADOH 5J89A 5FYLH 2OSLB 3UEZA 1P1ZA 5BQ7B 3U4EB 4JFDA 1G9EA 1G7IA 5DS8A 3CLFL 5GRYA 3FAXA 4O51B 5GS1B 2Z92B 2OTUA 3GGWA 1LO3H 4JKPL 4MJIA 3MRCB 5IOPB 2ZUQC 4X5WA 4M6NL 2CDEB 4O2CB 4Y4KA 4ZOBA 2E8ZA 1WITA 3BP4A 3QR2A 3FL7A 1N6QL 4K7PY 2D31B 4CGTA 5HHPB 4Z6AT 5J7CC 3VXOB 4FQXA 4LLWA 4NZUL 1G1YA 1QA9B 5I1HH 2NY2B 2NY4B 3JXAA 4ERSL 3QFDA 5C08E 4GAFB 2APXA 4RZCA 1AXSB 3U36A 5D1ZA 2X4NA 1TFHA 1N4XH 1JNLL 4JFXA 1HKLH 1NJ9B 3VDBA 4G9FE 1HI6B 3M17A 4P4KA 4XX1E 1I7TB 3U4BL 2OL3A 4NWTL 3IS0X 1N0XH 2YBRA 3IXAA 5IW6B 3F12B 4HWNA 1T5XA 5E8EA 5F9OL 4DK3A 2E5EA 5DMJB 5ESAB 2QSCL 5IROA 2WSKA 4BH8A 3SKJH 3VH8B 3I6GA 3TBWB 3R1GH 1P7QB 3DROB 4S1RH 4WI2A 1UZ6F 5EC1A 4XB7A 2AK1L 5E8DH 3OKEA 1MLBB 3DRTB 4MQ7B 4LHJB 5DQDL 3UC0H 2X9YA 4LCWB 5KSAD 4Y19A 1K8IA 3O4OC 1NC4A 3UTPD 4O2FB 2NY1D 5FO8A 4Z95L 1N3NB 1Y0LB 3LS5H 2EC9T 4EQ3A 4XTRC 2XKSA 3B2UD 1UACL 3S37X 1OHQA 3B9EA 5FHAH 3CZFA 4LASL 4P57A 3IKCA 3CFJB 4TTGA 3SPVB 2D3VA 4AENB 3X3GH 3QUKA 3HCVB 4KUCF 3FQNA 4LMQE 4P2OC 3WXVL 3S97C 2QLVB 1OB1B 4HKXB 5BMFL 3ROOA 5TE6H 3LKOB 2ZCKH 4U1SA 3HFML 4Y4FC 2P5WA 3TNNA 1AP2A 1I4FA 3GB7A 3NCCB 5E8PA 4DKEL 2WIMA 4X9IA 4JFFA 4KQ4L 4LNRB 1VDGA 5I30L 2F9BT 5ANMA 4D0CA 5I75C 1QNZL 1FBIH 1T2JA 1T0MB 35C8L 5F8RC 1XCQA 1MIML 1T80A 3LDBC 4LPXA 5BVJA 3MV11 1R5VB 1FZKA 25C8H 4M03A 2ORBL 2BMKB 3U0WH 3VWKA 3T09A 4LU5L 4OLWL 1YEGL 2VITB 4XCYA 1FO0B 1CLOL 3MBEA 4HV8B 4Y5YC 1MCCA 3VDCA 4ZUUB 4RGND 3QXAB 5JA9A 4NPYA 4GOSA 3TJHC 1T1XA 3LEVH 1CICA 4KRPC 3TIDA 2IC2A 3T0WA 1K4CA 2BVTA 4F57H 4LPWA 3I2CH 1IQDB 1UWXK 2UY7A 4UIKL 5JIIA 5E7FA 2D7QA 3QO0A 3DTXA 5DO2C 1IAIH 5D71L 3DIFA 3MO1B 4K8RD 1G7HA 4F58H 4UB0L 1NUNB 3QDMB 4V2BA 3MACH 2VDQH 3AC0A 1IGTA 3ES6A 4R0LC 4XHQA 1I8KB 3MV9B 3FQWA 5JMRA 1EGJH 4J4PD 1R5WA 4XNUH 5C09D 4HXBL 2X5PA 2YC1B 4OFIA 4Z77B 2P24B 4XNZB 5HYJA 1F4WH 4LVOC 4OLZL 1LK2B 3K8MA 1MJJB 1NBYB 3DX8B 4JO3H 5GRWA 2XPGB 4MD4B 4O58L 5IEKA 2J88L 1PBYA 4M6ML 1CXHA 1RIUL 5IV2A 3TYFA 4OKDA 2QQNH 2D7PA 1MFDH 4N9GA 3BDYH 15C8H 4KJQC 1DN0B 2UZXB 5DDHA 5E2VL 4MWFA 1I9RH 1JPSH 2C1OB 4KJQD 4Y4HD 1CI5A 2V7HA 1F6AB 2JB5L 3BI9X 3UCRA 3P77A 4IMKA 4LFHG 5L8KB 4TTDD 4DVBA 5BZWB 3PXJA 1KPRA 1R24A 3KPRE 1L4IA 3RHWF 1J86A 3IJYA 1WSST 2WQRA 1PG7X 3HC3L 4MJ6A 4ORZC 1TVHA 1CVSC 3ZE2F 1U58A 3NH7H 3TVMD 3ZYJA 2Q8BL 3BPNB 3VG0L 1QLEH 4JPWH 1BWWA 2EXYC 1RIHH 5B38A 2F53A 5A16B 4G7VL 4MA3A 4S2SB 4KJYB 1U92A 3VE0A 2JK5A 3PWVA 4CAGA 3X11B 1BF8A 3H9YA 3EYUH 4P23C 4LAQL 1UVQB 3PJSB 4DUXA 4E0RA 4WW1A 4CDHA 5CSZB 3ZZ1A 3B6SB 4HFUL 1VFAB 5DA4A 2VKWA 4NC1E 4HG4K 4I0KA 1RJZA 3VI4F 1MFEH 4KDVA 1YYML 4KTDL 5HYQB 5E9DA 4LRNH 3NFPB 4ZQKA 4RGOL 4HQQL 4U49A 4QF1A 5J06A 3EFFA 2O5YH 3WFDH 1KJ2A 5DGQA 4XAWL 3ZO0A 4J1UA 2LFGA 3MRGB 4RMQA 3GUTB 1MCNA 4J3TA 3MLYH 2CLVA 1IRAY 1GAFL 3EIFA 2IWGA 4HEPG 5JQ6H 4XP6L 1IL1A 5IB1A 2WMPA 2BNQA 2ARJB 3P9LB 5BV7L 3ARDA 3X14A 4WU5A 3LQAH 5TE7L 1JPFA 4QRQA 1BLNA 1ND0A 4OUUB 2EDLA 3BGFB 3V5KB 4G8GD 2VDLH 4RFOL 3GJFH 1JZ4A 4IRJB 4OLUL 3P11H 1FL6A 1BJMA 1FIGL 1NGPH 4GW5A 3MOQA 1KB5A 4YC2C 3RZCB 5BZDB 5HD8D 1F4XL 5D7JB 1IC4H 2XACC 1LWRA 3HPJB 1IT9L 1MHCA 5DJ8B 2OR9H 3W0WD 1JHKH 3LAFA 1CE1H 1T1WA 2OZ4L 4FQJL 1TVBA 1D6EA 1VFBA 4D0DB 1LD9A 3WD5H 3E6HA 3B8YA 4WRLA 4P2QA 1P1ZB 2W65A 5DRWA 1G7IB 1I1AA 3QHTC 3A6BL 3RTQC 3I75B 4CMHB 2YWYA 2NZ9D 3QDGA 3LS4L 5MHSE 2OTUB 3GGWB 1XF2B 1JGLH 1KNOB 1W2KT 3RKDC 4X7DC 1RHHA 3RTQD 1GC1H 4PG9A 3OKNB 4Y4KB 3ZKMC 3NTCL 3HAEG 3P3YA 2VZTA 2AJXL 3RKDD 2C7UB 3BP4B 3DUUA 3OWEA 4RFNC 2WLYA 1Q0YH 2I9LA 5E1AA 4I18A 3ZKMD 3O0RL 4ENED 5IT2H 5DR5L 4FQXB 4PRIE 4PV9A 3SOBL 3ZE2E 4RZCB 1NMCB 5D1ZB 4GRWH 3CVHH 4PP1C 5DRZB 4JFXB 3QUYA 1NAMA 3M17B 4P4KB 3WLBA 2G60H 4KZDH 3BYYA 4XVTH 1I7RA 1GOFA 2OL3B 3O6LL 5BRZD 1CK0H 4GLRH 2NY2D 4HH9A 4TVPD 1SHMA 1MFAH 3VFMA 2NYYC 5FGRA 2F8XC 1T5XB 5JTWA 4WI4A 4WUUA 5E8EB 4POZC 2DDQH 4R90H 4J3OC 1CG9A 4U6HB 3Q3GA 5IMLA 4GUPA 1MRFL 2ADJA 3L6FA 2UWEF 2R69L 4N5EC 3VI4E 4X99B 1UT9A 1ZA6A 2VLLB 5IW1A 2W07A 4JRXE 5EC1B 2RGSA 1CXEA 3MLWH 2VXVH 3OKEB 3WS6C 4B41A 1FORL 1T7WA 1B4JH 1MNUH 1YUHA 3TNMA 1CGSH 2P4AB 3D25A 1JWUA 3GK8L 3RX5A 1P7QD 5CAYB 4Y19B 3MLPA 5A1AA 1NC4B 5FO8B 1WT5C 3NAAL 3DYMA 2GT9B 1G7PA 4EI5C 4LSVH 3SGJA 1JHTB 3GMRA 4HJJL 4FP8L 4IOFD 1J8HA 3VXQA 4X6EA 2VLRD 3CZFB 3NCFB 4P57B 3IKCB 2BNRE 1VEMA 1DFBH 3W82A 5I1JH 1C12A 3D39E 3LHPH 4L4VD 4Z0XB 1KBGH 3RVXC 4YHKL 5KOVC 2VZOA 2AI0L 3STBA 1KJ2L 4JFHD 5T3XD 4YFLF 2MQCA 4M62H 4X5XA 4U1SB 5IHZA 1WZ1H 2P5WB 3TNNB 1AP2B 5C0NC 2J12B 1WUNT 4GG6F 5TE4L 3L3KA 4H20L 3PGDA 2HT4D 4EDWH 3TH3T 5ANMB 2GUOA 4D0CB 2OR7A 1MCLA 5GJSH 4CRPA 1OWWA 4DGYL 1XCQB 1QBLH 2YA0A 3P4NA 5E2WL 3ROLA 2R4SL 4NCC1 1C5BH 1FPTH 4WUKL 2AJSL 5IBUB 3KPSD 2FIRT 3WKML 3HTLX 3S35L 1FIEA 3OJDA 5INCA 5EPMA 4OF0A 4IOSD 3OJMB 3O81A 2E27H 3H9SB 1A1NA 3B5TA 4Q9QL 5D5MB 4WEBL 5DJ2A 4XPAH 5CUSL 1CICB 2BY0A 1JP5A 1OGAE 4D94A 3GKWH 3BP7B 5DJAA 3AAZA 3ARGB 3E1F1 4BQBA 4PGDA 2X1WL 3QEQE 2VZ3A 3DTXB 4D9LH 4J3VA 1FZOB 1A6ZB 1IARB 4OBRA 3EOTL 1E4KC 4YXKL 2BERA 3MRMA 5IFJA 2MPAL 2AK4A 1JGUH 1IGTB 3ES6B 3U0PA 2UWEE 1R3JB 5SWSB 1OP5H 5T33L 1ORQA 4P9HC 3GSNL 3JV6A 1ZLUH 1OLZA 4RWYH 3PP3H 5HYJB 3S96A 4IJ3B 5SX4I 4OJFL 3SGEH 1NBQA 1T6VN 1BQSA 4HC1A 1HYSC 3NOIA 2VDNH 4P59L 3FMGH 3MV9D 2WWMC 2IPKB 1KYOK 1L7IH 5EA0H 2P5EA 2Y36L 3NZHL 1NAML 5IJVA 1CBVL 3CX2A 5F1NB 2H9GA 1IJ9A 1UKSA 3HZVA 2WWMD 4MWFB 5F97E 2Z91A 4JPIA 4NDMA 1OGTB 4QRPB 1T89A 2V7HB 3P77B 3MRQA 2H6PA 1AGFA 2FBJH 4HPOL 4DVBB 2GY5A 2IBZY 4NM4H 1ZHLA 1KPRB 1R24B 2FGZA 1U8NB 4EKXA 3TF7C 1ACYL 4PJFA 1Z3GH 4G6KH 1TVHB 2CPCA 4Z8FH 1L7TH 4ODVL 5D7IA 4YE4L 1B3JA 4QHKI 3LKRB 2GK2A 2F53B 1W8OA 4MA3B 1U92B 3VE0B 1MCSA 4Y8AA 2JK5B 1QFWI 1CDGA 4RMWA 2R0WH 5K59F 4E0RB 2W38A 5F1IA 4GG6E 1IC7H 1INEH 4KVCL 4PG2C 4NKIH 2EYRB 4L4TB 3SKOA 2RB8A 4QRUA 1RIVL 5HVGB 3GBML 4OFYA 1F4YL 1JGVL 4XNXL 2Y4SA 2DYPD 1IKNC 3ZTNL 1G9MH 5E9DB 1X9QA 5DD5L 4U1LB 3BRDA 3MV7B 2EKJA 4ZQKB 4XC3L 4QF1B 3VMNA 3QWOB 4OTXH 1HH6B 1KJ2B 5KW9H 3EDJA 3QEGH 4LLYA 1OM3H 2IALA 5DEZA 4U7SA 3IDXH 43CAB 5A3IC 3B83A 2PKDA 5ALBL 1CL7L 1T3FA 4PRAA 5TPWL 1GOGA 3S34H 2VSDA 3BMVA 1W0YT 1F58H 1CU4H 5IB1B 4N8VA 1SBSL 5TDNA 2BNQB 3C2AH 2ZPKH 3X14B 1MCHA 1S78C 1JPFB 1ULVA 4L9LA 4QRQB 1BLNB 4M9PA 2FEEL 4PR5A 2HMIC 1IKFL 4M00A 2Y9RT 3VXUE 5C2UB 4XH2A 1P84K 1B9ZA 5CZVL 1TJHL 3WIIH 2CLRA 3AY4C 1S78D 4NP4L 5I1KH 4C55A 1FL6B 3WFZA 4GW5B 3L5HA 3G9AB 4HULB 4KJWD 5IEHA 3OG4B 4L5FH 2BSTB 3X12B 1U8KA 2FZ3A 4QXWA 3MX0A 2X4QA 3ARFC 4LPUA 4YX2H 1MHCB 4MLSA 3EZ8A 1WFOA 5J11C 3BKYL 1H3XA 4JDTL 4QTIL 1D5IL 4OLYL 5E99H 4EBQH 4EN3C 1T1WB 2EE6A 4M8QB 3G5ZB 3VRJA 1TVBB 1VFBB 3RZCD 1LD9B 4UDTA 2GSIA 3E6HB 4D9RE 1QSFB 2E9WA 4PLJC 4K3JL 4OB5H 4KY1H 5D7JD 2W65B 5EO1A 3MV01 5DRWB 3TPKA 4X7SL 1I1AB 3Q1SH 2GTWA 4LCCC 1MH5B 2E7MA 2EIEA 3QDGB 4FNLH 2NY3B 4K23L 1LO0L 2HG5B 1JZ8A 3K7UA 1SYSA 4XP9H 1CF8H 4J23A 1OP3H 1IILE 1ONQB 5KJRH 1FNLA 3SDDC 3SGDI 1VERA 1JTOA 3I3EA 3GSNB 4LSQL 1OAXL 5E1AB 4H8WH 4I18B 2VLJA 4KKCC 3MBXL 5DHVH 2I27N 4Z18A 1CDHA 5IB4A 4PJDF 4DJMA 3P4MA 4H1LH 4KQ3L 5IJKA 4KKCD 5HXMA 3WSQH 2VZSA 1RUPL 2WBJA 5GRZA 3QUYB 1NAMB 2XWTA 1WBYB 1I7RB 3K4AA 4Z7VA 3T1WA 4UINL 1BQHG 2KUTA 3MV8E 2L7UA 3VFMB 2WK2A 5E5UB 4WUUB 1SJEA 2OXGA 4HHAA 3VXME 5E1HB 3OPZL 1S9VA 4JFEA 4OSUL 4RRPA 1CG9B 3Q3GB 1NSNH 3DVNA 5IMLB 4GUPB 3L6FB 4R2GB 4X9BA 1X5LA 3UTTE 2JCCF 4N0UA 1LO3L 1EBAA 2OI9B 4P49A 3RGVC 1X5ZA 3QG7H 4PUBL 4XBEH 4BSWA 4WHDA 1GPOH 1RQ5A 1YUHB 4OLXH 1XGYH 3W9EB 1EGJA 2HT2D 3D25B 3OGCB 1DLHA 4HUXB 3C5ZC 5FGBC 2NY7L 4NSKA 3EYFA 3U2SA 3GMRB 5IHBA 2WUBL 1SEQL 4MVBD 1J8HB 2VQ1A 3VXQB 3RWHA 1A6VL 4HW6A 5JDSA 4QHMA 1LHZA 1C12B 4G8FA 1LE5B 2YS4A 3KR3H 4KK9D 2VTFA 5DJCA 1PKQE 3QCVL 4WV1C 5MEOA 1EH9A 3ET9F 3MLXL 3WUWG 5D6DC 4MQSB 4YFEA 3MUHL 1N7MH 4L4JA 4X5XB 3IU4H 4YWGL 5IHZB 2VLKE 1OAYL 3VXRD 5E8DL 3GMPA 2QQLH 3L3KB 3KWWA 4BFEA 3PGDB 1OAQL 5GRJL 1BEYH 3UC0L 5HGHA 5A2LH 2VLME 1LEGA 4S1SL 1CFBA 2VL4A 2IAMD 3P4NB 1T66C 3BRGC 3ROLB 4TPRL 4UZGA 4ZSOE 2GJ6E 4C56A 3ZYIA 5JPNB 3PHOA 1T66D 4Z9KB 4QHLB 5CHNA 2BSRB 2JJTC 3OJDB 5INCB 1BF2A 2VABA 2R1XA 1R5IB 4ZPVA 4BQ6A 5EU6A 5ICZA 5DJ2B 2DLTA 4MXWL 5F1SA 5I71B 4V2CB 5DJAB 3KG5A 1HEZA 4OM1H 4LSUH 4XWGH 3HI5H 5L2KA 5I8KL 4PGDB 3H9SD 4P3CH 4UIMB 5DUBA 1FNHA 2V7NA 3L5IA 1T03L 3HC4L 2B2XH 1OTTD 4X6FA 4Y1AE 2B1HL 3EYQC 4FABH 4UILH 3ARGD 3ALPA 4LP4A 3GJFA 2AK4B 1FBIL 3U0PB 5ICXB 4YPGB 4ETQA 3H9ZA 1ORQB 2JCCE 3JV6B 1A7QH 3AREC 3BJ91 3S96B 1GHFL 1T5WA 4PJHF 4PRBA 4JVWA 2NY5L 4HIJA 3DRQB 5KSVA 4GG8B 2N4IA 5SWSD 1CFNB 1UM6H 1E27A 5CGMA 2ARJQ 5IJVB 1HNGA 2H9GB 2X44D 3HZVB 3JWOL 3LEVL 5EWIH 1YNKH 1BECA 4ORGB 4NJ9L 1CGVA 4NDMB 1GCFA 4QRRA 1QO3B 1SMAA 2H6PB 1AGFB 3T4YA 1FVDA 1J1XH 1ZHLB 5DD6A 5IMMA 4PJFB 3DGCR 4K7FA 5BVPH 3BZ4A 4HDIB 3QQ4A 32C2A 2X4OA 4EZMA 5D7IB 4H26B 4RNRA 4QRPD 4CU6A 2B0SL 3P73B 3IGAA 5C0EB 1FNAA 3MACL 2X1QA 2YPLE 4C4KT 3EUUA 1VPOL 2V2TB 1EGJL 1PSKH 3ARBA 1MCEA 3BKCL 1QRND 4OFDA 4X5LA 1JRHL 2EH7H 2NR6C 4WI7A 3ULVF 3CVHA 5F1IB 1MCRA 2XIDA 4DUVA 5IWLC 4JO3L 2HH0H 5HI5D 1RJLB 4MB3A 4QRUB 3DJ9A 2NR6D 5TF0A 5LKNA 2NY6B 1IZKA 1MFDL 1I3GH 3BDYL 4RAVA 5TFSH 4YBQD 1OP9A 4OZ4A 2D7TH 4ZFOA 2VAJA 9CGTA 1A6WL 1KC5L 4U2ZA 5I17A 4L4TD 4GQ9L 1JV5B 2XQYG 1U8PB 4M1GL 4LLYB 2IALB 5E6IA 5BW7A 4R9HA 1YEJH 1EVTC 2H26A 3T0EC 1KN2H 1T3FB 4PRAB 3WO4B 3ZHLA 3MV7D 2DKUA 4JY5H 4N8VB 5TDNB 3T0ED 2P48B 4G8EA 4JPWL 1GZPB 4XPFH 4L9LB 1G0DA 1CXFA 4PR5B 1KLGA 4XH2B 2EICA 2BC4A 4PJGA 5IB3A 2UYLA 3S9DB 3EYUL 3UYRL 3QXDA 4YQXH 5HVWA 2ICEA 1D6VL 1TPXB 3E3QE 2EO9A 4NQVA 4UBDD 1XF3A 2UVFA 5I19H 1ZLWK 2IBBA 5I18L 4DKDC 1QSEE 2DLFH 4C54A 3GBNH 3FQXA 3LH2H 1KV3A 1U8KB 5EU3B 2FZ3B 1O7VA 3FJTA 4K7PL 5IVXA 1MFEL 3I50H 5J9PB 1AXTL 4UT7L 4I3RH 4IDJL 4LRNL 3LY6A 5D93C 1IC1A 3LKPB 4TUOA 3QIBA 4YHIB 4QYOA 3VRJB 4LVNC 4PJHE 4UDTB 3X3FL 2AJYH 2GSIB 1AHWC 3SGKC 4W68A 2YK1H 4G6AC 2EZ0D 5EO1B 3IFNH 1OCWH 5ADPH 2VXUL 4OZGA 4MNQA 3U48A 4L8SA 3TA3C 2DLIA 4CUCA 4ZTOL 5JQ6L 6FABH 5LQBH 1QSFD 3E3QC 2DQCH 5DEFA 4DTGL 2BCKA 3VXTA 3BT2H 4LIQE 5SX5H 2UZYB 1FH5L 2NY3D 3FFDA 2FD6H 2KL6A 4LOUC 3P11L 3IAPA 1NGPL 2R2BA 3QQ9C 4M5ZH 2AW2A 2NY0C 1W0VA 5IB4B 5HVHC 3FCTA 1H9VA 2X6MA 3LB6C 4QRSA 3P4MB 4HJ0C 4N8CH 3BHBA 4LDEB 4GQPH 3L3HB 3MRDB 5HVFB 3IDJA 3DOSA 4XNYL 4WWKA 1CFVL 2XWTB 2OR9L 4DQOH 5MP6L 5EU5A 2J7LA 2R2HA 4Y5XB 4H88H 2JLLA 4Z7VB 2HTKC 1INDH 1YPZA 5F7MC 2A1WL 4X6DA 1EMTH 2GQHA 1JWSA 5F9WC 1SJEB 4YAQB 4HHAB 5B21A 1BJ1H 4JFEB 3B9KC 4GXUN 3DVNB 4UT6H 1NCCH 4WFEE 3HB3C 4KWUA 1V7ML 4PJIA 4N0UB 3EHBC 3O6FC 3MJGX 2E7BA 4R7NA 3RVUD 1I9IL 4Z0BL 4XVJH 1RZ7H 2X7LB 1VFOA 2W0KA 3O2WH 5DF0A 4BSWB 1QKZL 3EHBD 4XAKD 4R2GD 3O2VH 1X44A 4DGIH 1BBDH 1DLHB 4OKVA 4JG0H 1D9KC 3TO4B 4NSKB 4QOKA 1WISA 5I9QC 5HI3C 1NBVH 3ARVA 1D9KD 3SQOL 2CUHA 3U2SB 3ULVC 3CVHL 3FT2A 4PJAB 4S0TD 2CKBL 5JOPE 2VQ1B 1TETL 4RBPK 5C07E 3RWHB 4X83A 4NQSA 1R0AL 2OLDA 5JDSB 1CYGA 4TSBL 3RPIA 4PGBA 1CK0L 4M3KB 1FC1A 3KJ4B 4G8FB 5EO9B 5L0QC 2PXYA 3O6ML 4FFYH 5DJCB 3T2QA 3MLVH 4R90L 2IH1B 3VWJC 5MEOB 3R0MA 3WIFA 1J8HD 2XN9E 3ZYOA 2DLGA 4AEFA 3VWJD 1BVLA 1H5BB 5FK9A 3MLWL 4N1HB 4TNWK 1G84A 3O8XA 1MNUL 3KWWB 1U91A 2K7PA 2YUXA 2GI7A 5KVEL 5B39B 4WDIA 5EH1A 4JLRB 1YECH 3ZKQD 1ZWIA 1EX0A 1KPUB 3S36H 4QTHA 3TO2A 1LQSR 1LEGB 3RJDA 1UWGH 4ELME 1H8NA 4LSVL 2Y06L 3MXWL 3VXSE 5E0QA 4ZO7A 2V5SA 4G3YL 3JVGC 3G5VA 2IG2L 4JQXC 3T8XA 5CHNB 4RIRA 4XMLH 1F5WA 4PFEA 5HDQH 1JJUA 1DFBL 5EU4A 1KB9K 3MGOB 4G6FD 3DSFH 2VABB 2R1XB 3IDYB 3K4ZA 2XZAH 3AMKA 3MLRH 4U1JB 5EU6B 5ICZB 3IETA 5ITFB 1DQJA 1J8KA 1GSMA 3G6JA 4M1CC 3UBXA 4JHAL 1HEZB 1FP5A 1GGBL 5L2KB 5GGSY 3QFJA 2G75B 3UDWC 1NCDH 2V7NB 5CEYA 3KVQA 4M1CD 3REWA 1ZEAH 4U1KA 4JY6A 5C0BB 5CCKH 1QBBA 4X6FB 4NQCA 1UA6H 4RMTA 3TT1H 1HSAA 3DECA 4K07A 4EDWL 1X7QA 1W0WA 1REIA 4OZHB 5EC2A 3QEUB 5T1LA 2ZUVA 4HGMA 1DP0A 4APQA 4ETQB 4KGLA 4KPHH 1SBBA 3QEHA 1MJ8H 3Q5OA 4Y16C 1RUAL 1T5WB 4PRBB 2KZWA 5GGVL 1J1OH 4YHOL 1IQWH 3IXTA 1CFQA 1MHPH 4M7LH 5MEND 3MRIA 1DBJL 1NUGA 1FJ1A 1KJVB 1UCBH 4UDUA 1QHOA 2ZOKA 3BZDA 1NL0H 5M94B 3KYAA 4XPAL 2Q7YA 1YMMD 4U6YA 3IJHA 4R8WL 5SWZD 3CNKA 2X9WA 4QRRB 2ZKHH 1BREA 1M71A 2ZG1A 1MELA 4GKZA 1K3ZA 4GRLA 3DO3A 3RA7H 1FVDB 3VH8G 4L8BA 5DD6B 4D9LL 5IMMB 2BVEA 2IBGA 4K7FB 1EZVY 2IPUK 5JA8B 3TCLA 3BZ4B 4ZXBC 3QQ4B 5GRUH 1K8DA 1YDPB 4CU8A 4RNRB 4AQOA 2CLZA 2HJLB 3IGAB 4G5ZL 3WCYA 4HX1A 1JGUL 2J4WH 3BAEL 4XXCA 1RVFH 2KDGA 5DHVA 2DL2A 2N56A 4HPYH 4F9PC 2XTJE 5DD0L 4EOWL 4FTVA 1XGQA 4H1LA 4HUNB 3NABH 4GRWB 3CVHB 4AK1A 2CKBB 3H8NA 1FVEA 3UPRA 3WFEL 3RY6A 1RZJH 4CDGC 2JE8A 3FMGL 3ZKXC 1DQQA 5IF0B 3DPBA 1SQ2N 1P4IH 5D8JL 1L7IL 3QQNA 1SYVA 1A21A 3BVNA 2O5XL 3D85B 1P7KA 3VFOB 4OZ4B 3ZYZA 4JRWA 4ZFOB 3CDGA 1A22B 4GAYA 3WBDA 4OF6A 3QUXC 1RUKH 2NY6D 5E6IB 2HP4A 2QHRL 2H26B 2FECL 3KYNA 3QUXD 3GM8A 4M7LT 5I0DA 2EO1A 1L7TL 5GS0C 5DURB 5EOQL 4OV6F 5DD1L 2XTJC 3EKCA 5FDWA 4KK5C 3FQRA 5K9JH 5KS9F 5GS0D 2ZJSH 1KLGB 2WQ8A 4K3GA 2HLAA 2BC4B 4KK5D 5I1DB 2MNUA 5IB3B 2UYLB 3M8OH 5E2UH 3WEXA 5E6YA 5C0CD 1I7UA 2ICEB 1XZ0A 4P3DA 1H3VA 5HI4C 1XF3B 3RFZC 3FQXB 1A3LL 3E8UL 4B0MM 5IVXB 2P46B 5HI4D 1GJIA 3G6DH 4HWEL 1G9ML 3HNVL 5BJTA 1MAMH 2OK0L 3QIBB 1DUYA 3WNMA 1I1RA 1RI8A 4HFWB 5DXWA 2DS4A 3W0WE 1X6NA 3BGAA 3DLQR 5C0IB 1G7LA 4X9HA 2M8XA 5HYSA 3C08H 4K71C 4MNQB 5HHXL 4LAJH 1G6RL 4GXVH 1MFBH 3KS0J 2DQEL 3TN0C 4CU7A 3ULUF 4O5LH 3JV4A 3D3VA 5TGBA 2V5YA 3O45A 3M45A 3BWAA 4IRSC 2BCKB 4U0RC 4GT7A 1IVLA 3SCMC 3VXTB 1LO2L 3WIIL 3FRUA 3FFDB 3M07A 2BJML 3P0VH 2DMCA 4MHHI 3FCTB 4QRSB 5DUPH 5JW5A 3BHBB 4ZAKC 4QXUL 4JFYA 4R26H 4ZUWB 3IDJB 1YA5A 4G42A 1WF5A 4LK4A 1CCZA 4GW1A 1AI1L 5EU5B 1DVFC 2HRPH 1A7NL 4CADA 1JWSB 4P46C 4PRPD 1DVFD 4X8JB 1MAJA 4JB9H 4DZ8A 1NAKH 3Q1SL 4BSJA 2DM2A 4HUVA 4XPBH 2FRGP 3F7PC 4LHUB 4XP9L 1CF8L 5KJRL 2R56H 5GS1C 4IIQB 4XPTL 5JW4R 5DJYA 1X5HA 3NCYS 1NCAL 2ICWJ 4NZJA 4OKVB 4HH8A 4QOKB 4PRNB 4WW2A 1RZKH 1C5DA 1HHKA 2Y07L 3ULSA 4F2MA 3BUTA 4Z7WA 3MCG1 1BFOB 1MI5A 2R0KL 1JYXA 2CIIB 3QIWC 3FT2B 3WSQL 5KS9E 3BQUC 4MAYC 4ODXA 2NY4C 3EO1A 2EH8H 3LZFL 2AQ3A 3QIWD 4NQSB 4LGPB 4X4ME 3TO4D 3RPIB 4LCWE 1S7VA 1MEXL 3BQUD 4MAYD 5F44A 4PJ8D 1JVKA 5DK3A 1OF2A 4DEPB 1FNEA 7FABL 4L8CA 4BZ1L 1T7YA 2BVOA 4C57C 5K9KA 4LBEA 3VD4A 1CGTA 1O7SA 4NQDB 1A4KA 5FIEA 5FK9B 3HG1A 4NYLA 2XA8L 3LKQB 2FEEI 5LXGL 1QRKA 2C26A 1F3JA 4C58B 4F15B 4ZYKB 4UQ2A 5ID1A 4M61A 1KENL 4LIQH 3VD3A 4G9DA 4WDIB 3H9HB 4MA8L 5K9OB 5K33A 5KN5A 3OKLB 1XIWA 4QTHB 4NO0B 1A47A 3ULUE 1C08B 1U3HA 2DQUH 1MVFA 3DETC 3VFRA 1HINL 2ZCLL 3DV6A 3MZGB 2JIXA 5J6GA 5CD5D 3T8XB 2WBWB 4WFHE 5CZXC 3FN3A 1G9NC 3BIKA 1ETZB 3MJ7B 5EU4B 1WGOA 1OGAA 1QZ1A 1TJGH 2XTLA 3EJJX 4YDJA 3KR3L 1KTRL 1X5FA 4DKFH 2NNAB 5IQ7L 2KH2B 2BVQA 3BGMB 2GY7B 1F4AA 2Y7QA 3VD7A 3UBXB 3IU4L 4AIXA 1J5OH 1FE8L 3QFJB 3GSUA 3GM0A 1EJ6A 4HBCL 1NC2A 5CEYB 4U1KB 4JY6B 3QAZB 1ED3A 2F8OA 2QQLL 4XVSL 4NQCB 3ULUC 2A83B 3BDBA 4XCFH 2ATKB 1HSAB 5T5NF 1BEYL 4D3CL 4ZO9A 5EC2B 5T1LB 5JXEC 3TT3H 3QEHB 5I2IA 5C0BD 4M48L 3F7VA 4KJPC 2Q3ZA 3WHE1 3MRLA 1RZFH 5FYJE 4RX4A 1ZGLM 3SO3C 4OCLC 2P7TA 3MRIB 5GRXG 2O5ZL 4GBXA 1BX2A 3QDME 3KXFB 1FJ1B 4UDUB 2ZOKB 2QSQA 3DHJA 3QIUB 3MV9E 4NCC2 1WBXA 1ZVHA 5FM4A 4KTEH 5FKPA 3FOLB 3IJHB 4R4BA 4S0SD 1N64H 3GJEA 1FZJA 1M71B 43C9A 4LSUL 2RBLA 3UYOD 1Z6JT 4YNYA 4P3CL 1V3KA 4L8BB 3MQIA 1NDGA 4V1DE 1F90L 5L7XH 4P2RB 1QFHA 5IHUL 4PRHA 4JN1H 4MNGB 1K8DB 4O4YL 5TH2A 3VRLF 3FN0H 4HWUA 1S9XA 4U1NA 5JDJA 2CLZB 3QWRD 4HX1B 5E08L 5DHVB 2X89D 1NBZA 3CH8A 4FTVB 5CLWA 1XGQB 4H1LB 1JUFA 3T77A 1KELH 1KPVA 5ERWA 4OUOA 4OLVL 5CILH 3UPRB 4R4FH 2EKSA 2YXMA 2W9EH 4L3AA 1NGYA 1DQQB 2XFXA 1UM6L 3GJFK 3O9WA 1SYVB 1IAIM 4KUZH 1P7KB 1LEIB 3VFTB 3CDGB 1IBGH 1I8IA 5F9JA 4QGTA 3S88L 4GAYB 2J6EH 3QG6B 2EDHA 2HJFA 2VZ1A 4UTBH 1AGBA 3CK0H 5BS0E 3D85D 3OF6A 3KYNB 3RIFF 4N1CA 3GMNB 3KYKH 2XT1B 2IJ0C 1A7OL 3FQRB 3SJVA 4K8RH 4JKKA 4KXZI 3D69A 5GHWH 1F00I 2HLAB 1NFIA 4HG4J 1YZZA 2EH7L 4W4NA 3WEXB 1XFPA 3QDJB 8CGTA 2VISA 5T1KA 1XZ0B 4P3DB 3P4OA 3QI9D 5JW4Q 1YEDA 4RAUA 1NCBH 4OD2B 1HXYA 4JQVA 1AKJB 3PWPB 3DX9A 1I3GL 4RFEB 2A6KA 5IBUG 5TFSL 4OT1L 5KTEL 4ZNEE 3HE6A 3K1KC 2D7TL 3WFHB 4UV7H 3V6OA 1XF5A 4NT6B 4P4RA 5GGUA 4PJCA 5ABDE 3MUZ1 3GIZL 3QNXB 5CLTA 2ZUSA 5SX4H 5C8JB 3GHBL 3QT2A 4HS8L 3A67H 2DQJL 4NHCH 4FFVD 4AEHH 2ENYA 5HYSB 3D9AH 1YEJL 4WI3A 5EIIB 1CD1A 3TV3H 1FNSH 5D2NB 5D7KD 5TGBB 4UOW0 5T3ZD 5FHBL 3BWAB 1AFVH 3CMGA 2CRZA 1DBBL 3NA9H 4KAQH 5IP4A 4X9GA 4Q6IC 5D1QA 4YHML 4JFPA 3GSQA 5J57B 4UNTA 1NFDF 4P2CG 4JFYB 4U3HA 5I1EL 1FFOA 2I25N 3AS1A 2XRAH 3MV8A 5GQBA 2P1YA 3C60A 5FYJU 3K1DA 3WFBH 1ITCA 4X98A 4ZOAA 1QFWH 4EVNB 2QJDA 4KKAD 2PR4L 2E9BA 5A43C 2AS5M 1MVUB 2QR0B 1OCWL 5CJ8A 1LO4L 4DZ8B 1QVOB 3T2PA 1KEMH 3W2DH 4TSAH 1JMZA 3QJHB 1DCLA 1X5JA 2NX5A 1M7DA 2BOCA 2VB5A 1U0QA 5LQBL 2YHGA 2PTUA 4RISH 4RMRA 2VN7A 3ZSTA 2AQ1A 1HZHH 3PV6A 4OFVA 2XICA 4LF3A 4S1QH 3BT2L 5ILTH 4BZ2H 2CRMA 2H8PA 4NZDA 5C7XH 1JRHI 3T2OA 4Y4KC 4GS7B 4S1DD 4LHUD 3LSOA 4WW2B 1C5DB 1HHKB 5DJ6A 1FFNA 3IU3A 4XVUC 4Z7WB 4EJ1C 2HWZH 5I16B 3RDTB 3SE3A 4FQXC 4E41A 4XVUD 3PL6A 1OAUH 3P40A 4ODXB 2Z8RA 2FLBT 1TCRA 5ACZA 4H88L 5D1ZC 2UUDH 1YQVL 2YMXH 2FX9L 1S5HB 1S7VB 3HZYB 4Y19E 2FJGA 4XI5C 4PGJA 1OF2B 4QKXB 1U8LA 4P4KC 1EHLL 1ZT1B 1FNEB 1NGQH 4L8CB 4J6RH 4LGSB 2NTSP 4UT9L 4LKXB 1NMBL 4CNIB 1NCCL 2LU3A 1JF1A 3TJEH 5F71A 1KN4H 5IROC 3PQYD 4X80H 5IGXH 4XVJL 2JB6A 3HG1B 3O2WL 4NYLB 2DI8A 3W11C 1EERB 1F3JB 2D0FA 5FCSH 4UQ2B 1NEZB 5ID1B 4M61B 1UEMA 1BBDL 2YD5A 3W11D 5I1AA 1J05A 1I75A 2AEIT 3FQUA 5KN5B 1XIWB 1YEHH 4KRNA 4LLMA 4NQDD 2C5DC 2P5WE 4P5MB 3FTGA 1U3HB 3VFRB 3VU2A 1UM5L 3OG6B 5GISL 2YPKA 4DVRL 3LD8B 3LVEA 3V0VB 4JFFE 1A2YA 4JKLA 2VR4A 2X42A 3PNWA 1P4BH 5AG8A 1EBPA 1OP5K 3SGDH 5H35A 4NO0D 3BIKB 5ANME 1ZLUK 3DYPA 3PP3K 4TSCH 4PY8I 3PXHA 4YDJB 5C1MB 5EDXA 4TVPH 3U1SL 5B8CC 1WJ3A 1C16A 2ERJC 2BVQB 5EO0A 2Y7QB 3PP4L 1HSBB 4Y1AA 1KIUA 3U30B 1FYHB 2Q86B 4JRYD 4OD3H 2P8PA 3PDOA 3GSUB 4ODHH 4JQIL 1ED3B 4WTWA 5D5ME 3BE1H 4N68A 3SDAA 5CWSA 3SY0A 3V0AC 4IS6A 1FDLH 5CBAA 3QFJD 3F6IA 3U9UA 4X6CA 5J12B 3B9AA 5J1AB 1RZGB 4KDWA 3C8KA 4YDLB 4CBPA 2PW1B 1OVZA 5BO1H 3DARA 2Z93B 3MRLB 3RIAK 4MHHG 4ZNCD 2P7TB 3PDDA 1HDMA 1QLRB 3V79C 1AO7A 2NXYC 4GBXB 4MAUH 3WHXB 2DI7A 4HMEA 3DSFL 4OCYH 3VWKC 4OGYL 3W9DB 1XH3B 3MLRL 2FX8H 3RWJB 1K4DB 1WBXB 3MBEC 2NXYD 5FKPB 1DDHA 2FEDD 5HYJE 5KSBF 1U8IB 3GJEB 1ZS8A 43C9B 2I60H 5EOCJ 4DWHA 3KXFD 1CLZH 3INUL 1CICC 4YNYB 4FQ1L 4JREB 5T3XH 3QIUD 3NIDF 1NDGB 1ZGLP 2AJZA 1KTKE 5BXFA 5JZ7C 1KTDA 2IANB 3H42H 4PRHB 2SEBA 3FO9A 5TH2B 1JZ2A 1S9XB 4JO2H 4U1NB 4ODSH 3OHXA 4WGVB 5JZ7D 1RFDH 1NLBL 2B4CL 3SE9H 4QRPE 1EEYA 1F3DJ 1T4KA 4O02H 4KPHL 5T5FL 3KPNA 1FSKB 1MJ8L 4P2RD 1JUFB 4JVUA 3T77B 1ZK9A 1Q1JH 1KPVB 2FWOA 5ERWB 5I1LB 3L95A 5GZND 5GSVB 4Y2OA 2EKSB 5D96B 4M7LL 1A6PA 3N06B 5KVFL 2XFXB 1UCBL 2WM0A 4H25A 2GJZB 2YXFA 3O9WB 5L9DH 2F53E 1KCUL 5J4MA 1CXKA 1CD8A 1PZ5B 3C6LA 4E9LA 1I8IB 5F9JB 5I6XB 2D9CA 2HJFB 4MQXC 3I6KB 1AGBB 2FNBA 3RA7L 1GXEA 1FO0H 2FHCA 3UZVB 1HQRA 1TJIH 1BFTA 3WUWA 4IMKC 5GRUL 5E9DE 2JF1A 4HGWB 1MJ7H 1M7IA 3H3BC 2HFGL 4WFGE 2J4WL 1BM3L 1RVFL 1JHLL 1QBAA 4HPYL 1S8DA 5ACMA 2VL5A 3KYOA 3O3DB 1OP3K 2VISB 4Y7MA 3C8HA 5T1KB 4KRLB 3WJLA 3IKKA 3P4OB 5TQ2H 4LLVA 2F58L 1YEDB 4TRPL 4EQ2A 4RAUB 1N6QH 2BNQE 4Y2DA 5DEGA 5TDPA 2FIKA 3OBAA 2A6KB 4ODUA 4NZUH 3QDJD 2XG4A 4ERSH 4FG6C 1XF5B 4P4RB 4GW4A 1FGVL 5GGUB 4I1NB 4KZEL 1JNLH 5D7LB 5F1OB 3TZVC 1AKJD 5I15H 3PWPD 4FG6D 5FGCB 4XPHL 1RULH 3U4BH 4NWTH 1CD1B 1P84J 3TZVD 1MIEH 3GSOA 2X4TA 3HI1A 4Y88A 3PHSA 5F9OH 4OGAC 4JKWA 2QSCH 2XNAA 1IEBB 1EO7A 3IJSB 5K9JL 5KAQG 1J0ZA 3VGAC 4P2QE 1CT8A 1CDUA 3SEPA 1V05A 3D18B 3RJQB 3ARDC 1Q38A 2AK1H 5D1QB 2R4RH 1I7ZB 3QDGE 1DUZA 4UAOC 4LP5A 4OCXH 1ZXQA 4CVWA 3IYLW 5J0BA 4K94L 2EDXA 1FFOB 4Z95H 3C60B 1ZAGA 1MAML 3VFSA 4X98B 1T7VA 3FRPA 4UOW1 4LVHB 5DZLA 3LKSA 3UTQB 1BBJA 3MROA 4HCRH 1ZKAA 4QO1A 4LASH 1K9TA 1ZANH 3C08L 5FUCE 2ARWA 3MRNA 4UUJA 3OKKA 3DO7B 4PJ9B 2NX5B 1NCTA 1I1AC 3G5XA 4JZOA 3WXVH 5BMFH 3GMMA 3U7WL 1TQCC 1U93A 3PV6B 4WUUE 4LF3B 4X4XB 3HFMH 5E00A 5KSAA 1DQML 2H8PB 3HRPA 1Q94A 3AGVA 3OQ3B 4MCZB 4DKEH 3LSOB 4NQED 5DJ6B 3P0VL 1FFNB 3VG9B 4KQ4H 3IU3B 4ODTH 4E42A 3JUZA 4I18C 5IB2A 2X05A 1QACA 4R26L 3FFCB 3BP6A 1QNZH 3PL6B 2ATPA 35C8H 1EAPB 1MIMH 5K9QG 5ACZB 5I1CL 4F7PA 5FUCC 4IOIB 2YZ8A 2FJGB 1FYTB 3CXHJ 3PGCA 1U8LB 3S3SA 1OAZL 3RDTD 4LU5H 2VAAA 5I73B 4OLWH 1CVRA 3CFBB 1CLOH 2WLZA 5DZOA 2VNCA 2FECI 3UTSD 4FXKA 1GGIH 2AVGA 3MLTA 3OAZK 1ZA3A 1VESA 1J8HE 2LTQC 1LP9A 1BZ9B 4Z76A 4PBVC 2Q6WA 2JB6B 1YEFL 4K55A 4PJFF 2VDKL 3GSXA 2X4PB 1F6LL 2M2DA 4N8VG 4D8PA 4EI6A 5D7IF 4UIKH 3MFFB 3CSYA 2CMRL 5I1AB 1J05B 1BHGA 4YK4B 1WVZA 4YGVA 5DK0A 4AY0A 1RZKL 5A2IH 2FSEA 4X4YB 5IG7A 1I3UA 4ZUSA 3FTGB 1UYWL 4WI6A 4DK6A 4UB0H 4HS3A 2YPKB 4K9EC 5DRNA 1L0QA 3PNWB 3NCYP 2PO6B 1JGDA 2ZZUT 2E7LA 3HLAA 3EAKA 4TNVK 3DV4A 1XGTB 2I26N 2CK0L 4LCUB 3OXSA 5B4MD 3OGOE 4OLZH 4Y5YA 2J6EA 3S8WA 4U0QB 3DUSA 2DQFA 1C16B 4GSDL 5IFHH 4O58H 2UV3A 3QH3A 1RIUH 2BSED 5EO0B 2W91A 1FFPA 5C92A 3PV7A 1ZLSL 1MCWM 2AJ3A 3PDOB 5EBLA 2CH8A 5EUOA 3NN8A 2QV2A 3DVIA 2YEZA 1Z0MA 2JB5H 5CWSB 3SY0B 2C1PB 4WFFD 4IS6B 3PWJA 1B6UA 1JZ6A 4J4PA 5C09A 3PABA 3HC3H 4X6CB 1IGIL 2Q8BH 1NUFA 2VYRE 1OQXA 2YA2A 3VG0H 2AJVH 5EBMB 2OTPA 1HHHA 3EBAA 5E5RB 4G7VH 5CD3A 3CX5K 4F33A 1HDMB 1IC5L 1AO7B 2AK4E 4LAQH 4M7JL 1ZT4B 1VENA 4EIZC 1XF4A 4Y4HA 1WQVT 2KQNA 4HFUH 4ZD3L 3ARSA 3F7YA 3KDMA 1QPXA 1EHNA 4KHTL 3DX7A 2F5BL 5HHVH 4OAWB 4MD0A 1FCGA 1YYMH 4KTDH 3VCLB 2BY1A 1WFNA 2FO4A 1JPGA 2W9DL 4M7ZB 5HGBA 4RGOH 5BXFB 5E8OB 3RWGA 3TVMA 2SEBB 3FO9B 5FYLE 4XCFL 4XAWH 3JSSA 5CFHA 4KI5F 3OHXB 3OSKA 4JZNA 3SKMA 4QWWC 4ZTPL 3V7AE 2X70A 1EEYB 5DWUL 1T4KB 4MA7L 3EOBA 4BQ8A 1F13A 3KPNB 1SY6H 2OYPA 1AR1C 3MMEA 2IAND 4HIEA 2VRAA 3KGRA 1ERNA 5LCVL 2DKMA 4PJFE 5BV7H 3L95B 5TE7H 5FYKL 3VW3L 1L9MA 1RZFL 3S98A 1Q9OB 5T1MA 5D7IE 5E5MB 1YC8A 2Z31B 4OLUH 2Q76B 3WE6A 1ZLVH 1BOGA 4POUB 5ALCH 5ISZD 4HS6B 2L4OA 1H8SA 1RZ8B 1V3JA 1KIRA 1WAAA 1S7UB 1G7MA 1G0XA 4WWID 1QFOA 5EZIH 1TQBB 5L7XL 2OZ4H 4FQJH 3OR6A 1HWHB 3HE7C 1FC2D 3O4LD 4PJEA 5J13B 3A6BH 4WVRA 2YSSA 4G8GA 1F45A 5C0GB 1MCJA 3LS4H 5JO5B 1VKXA 2WIIA 2VL5B 3KYOB 1IGFL 3N1MC 1R3IL 3C87A 1I85A 4JM2B 3NTCH 1P9MA 4YGAB 2OXHA 5GGQL 2AJXH 2W9EL 4LQFL 3ARPA 1OSZA 1UH2A 5SX5K 3V2AR 3ZT7A 4Y2DB 2HJKA 5TDPB 3O0RH 2GHWB 2X09A 5DR5H 1S9KC 5GRVK 1A1MA 5CGYC 3QPQC 3K2MC 3SOBH 4BM7A 5BOZG 2CDGB 3VFNA 2J6EL 2MCG1 4G8IA 2J8UA 1J1PH 3HKFA 4LSPL 3ESUF 3SDXF 3WV0A 2EC8A 3T65A 3ZDXF 5DD3L 2XZZA 1SEBB 3O6LH 4OF5A 2LAGB 4HIIA 4LQ1A 3KYKL 3VDAA 1S9YA 2X4TB 3HI1B 3RTQA 3V6BR 5BQ7A 3EJZC 2F15A 1WFUA 3U4EA 3O3EA 2XNAB 3QDAA 2GKIA 5D7LD 2P8LB 3UTOA 2ZUQB 5GHWL 3RWFA 4O51A 1CT8B 3UAJD 1E4WL 2CR3A 3N1PC 3MRCA 1UKQA 4LDOB 3T4AB 3G04A 1JCKA 4PIRF 2RIKA 3TM6A 1H0DA 2CDEA 2EXWD 3MGAA 4O2CA 4ZUTB 5I66A 1DUZB 5J1TC 4BQ9A 5GGTL 1NCBL 4KI5E 3KPOA 2D31A 2R29H 4GFTB 5H37H 3QXVA 5HHMD 5GGRA 3VI3F 3VXOA 3ZKNC 5LVEA 3NAAH 5BRZA 3VFSB 2EE3A 3QCUH 1CXIA 3LEYH 4WCYL 1AXSA 2VLJE 5FF6A 1QTYT 2OJEA 4JO1L 3LKSB 4HJJH 3BXNB 2BXZA 2EDWA 4NHCL 3D9AL 4B50A 3NFSL 5DHYB 2MOVA 3MRNB 4UUJB 3OKKB 2C3XA 3BMWA 3F12A 4U7KA 2FHFA 1OW0A 4YHKH 5ESAA 2RFXA 4Z7VE 3G5XB 2AI0H 4M5YH 3GMMB 4R6UA 1PYWA 1U93B 1PQZB 4NKMB 1P7QA 3W5NA 3WS6A 2Q87A 5KSAB 4JFEE 4KI5C 5ELIA 4PJ9D 1Q94B 1ZHBA 4WHCA 1WZMA 2EC9U 3S36X 4AEEA 5TE4H 3O4OB 5HGAA 4H20H 4G9FB 4N0UE 4E42B 1MLBA 5FOJA 3DRTA 3DXAD 4I77L 4X6BA 2G5RA 3GI9L 4MS8D 2VLRA 3BN9D 4O2FA 5GJTL 4XBGB 5E6ZA 5IJKC 1TVDA 3L3DA 2PCPB 3RZWA 4L4VA 5E2WH 3MC0A 4FS0A 2R4SH 2KKQA 2W59A 5KANG 3IFOA 1P2CB 2WBJC 4OGZA 4HT1L 3SQBA 4WUKH 5FO9A 4ELKA 2VAAB 1U6AL 2AJSH 3FFCD 1YEEL 1KXTB 3BISA 1RK1A 3S35H 1NQBA 4TSAL 4P2OB 1T83A 3CC5B 3MLTB 1ZA3B 2VDPL 1KGCE 3EO9H 4Q9QH 3B43A 4Z76B 1FYTD 3HCVA 4JPVL 2Q6WB 5CUSH 3S7GA 3GSXB 1HZHL 2GSGB 1MFCH 3UJJL 1PX4A 2VXSL 3LKOA 4HK3J 5K93A 3ZDXE 3NA4A 2BY2A 1XGPA 5DK0B 1LE9A 2YRLA 5IG7B 4LNRA 5I75B 5IUSA 3O11B 2Y25A 2HFFA 2HWZL 3W5MA 1KIPB 1EEZA 2F54A 4HS3B 1KF9B 4GRWF 2X1OA 1W72L 3KPSA 4DZBA 1T0MA 1JGDB 5C0FB 1OT2A 3GSNH 1R5VA 2EDNA 3DV4B 4GRMB 3UZQA 3KPQA 2BMKA 3OXSB 4M93C 4Y5YB 4OJFH 4ONFH 2EDYA 3CXDL 2CIKA 2MKWA 2XZQL 2ZG3A 3DUSB 4HWBL 2DQFB 2VITA 1FO0A 4P59H 4BFBD 4AH2A 2PO6D 5F7WC 3KJ4C 3QH3B 5CKGA 3OJ2C 3SDCD 2N7AA 4KRPB 1FFPB 5LWYH 2Y36H 3NZHH 1NAMH 1KN4L 1MLCA 1CBVH 2AJ3B 3MRJB 5EBLB 2YN3A 4Q0XL 5EUOB 3T08A 2YEZB 5EU6E 3HNTL 1A3QA 2VJXA 1RUML 4AT6A 4NUGL 1GL4B 3PWJB 4FA8A 1ACYH 1YEHL 2F5AL 4AIOA 1CLYH 4XCEB 4PJGF 2J3SA 4LVEA 4NN6C 4R0LB 1E6JH 5L2KE 3C2SA 4ODVH 1FL5A 1P7HL 4YE4H 2HLFD 4XCNA 5EULV 2X1PA 1QPPA 2OMBA 2OCFD 1ES0A 2HKHL 4LVOB 4MA1C 5CD3B 2W92A 3OKMB 1EUTA 2HVKA 4XCCH 4Z77A 5IVXF 1IGYA 5EB9A 2QQKL 1U8HB 5AWNL 1NBYA 3DX8A 1XF4B 4Y4HB 1RIVH 1F4YH 1JWMB 3E2HC 4XNXH 4AEIL 4DKAA 4PREB 3DX7B 3ZTNH 1DN0A 2FO4B 3EGSB 4OZGF 3HI6L 3WIHL 5HGBB 4XC3H 1CDYA 2NPLX 1ZSDA 4LHUG 4G7YL 1RHFA 3BE1L 2APWA 4TUKL 1DJSA 5HDBF 4JZNB 2VIRA 3ZL4L 1FG2B 3AM8A 3LQAC 2X70B 5ALBH 4QRRE 5D7SL 4G43B 5SV4A 1UB6B 5TPWH 5F6IC 3MMEB 5H94B 1SBSH 4HIEB 1A64A 1D5MA 3LQMA 5C0DA 4P23B 5FOBA 2AGJH 5A16A 1IKFH 3JWDC 4ESKA 2RR3A 1AQKL 4PG2A 4XP4H 2DYPA 5CZVH 5F3HA 3R0NA 2IQAB 2VO5A 4NP4H 4RMVA 1EEUA 4MJ2A 1M6OB 1R3LB 1IKNA 4HCRA 5CSZA 2BDNH 1YPZF 2VR9A 3QHZL 1Z2KA 4X6DF 1NFKA 4GRWE 3KPRB 3QZWA 1UWXH 3CFIC 5HYQA 2Z31D 3NBNA 5ESQA 3BKYH 3NFPA 4JDTH 4JHBA 4QTIH 1D5IH 2R1YB 3QHFH 1OTUC 4XZUA 1YQ2A 4PJIF 4W6XB 1JIBA 4BKLB 5IMOB 1BD2D 4PLKD 4JPKL 3MRGA 1DBAL 3ZMRA 2RAMA 1HIMH 1KTLB 1RFDL 1GC1C 1OTUD 4PJEB 4G8GB 1DE4A 1V8HA 3VFVA 3B2VH 4AZ8A 2Y5TA 4K23H 2MCPH 2XI9A 3T2NL 5LAXB 4HAGA 3H3PL 3KLSA 3AY4A 5DMGD 1W72B 2BOBB 3J8F7 4ZFGL 3ARBC 3IDGB 3V5KA 2EDOA 1OSZB 4LSQH 1OAXH 4YC2B 2HJKB 5L9DL 1WC7B 3MBXH 1A1MB 3BO8A 4PJGE 3I02B 1IFHL 2NLJB 4H0GA 4RCAA 4NNPH 3RZCA 5BZDA 3FZUC 4JM2D 4Z5RA 2D4FA 4I0PC 3VFNB 2ITDB 5D7JA 1OQOA 4HXAH 1QHPA 2XQBL 2J8UB 4PV8A 5DJ8A 3T65B 3BH8B 4I0PD 3UBXG 3QYCA 4HIIB 2A74A 1VGKB 4GMTL 4UINH 5EIVA 5IVXE 4D0DA 2H2PC 3MZTA 2J8HA 3RTQB 4LCCA 2WNGA 1MJ7L 5E6IC 3OPZH 1WCBA 3O3EB 2XG5A 4OSUH 4I5BB 3NZ8A 3RIAF 2LU4A 3I75A 3RWFB 2XWBA 3TLRA 4LLAA 3V52L 1XF2A 1KNOA 1N6VA 4OZGE 4MNQE 3G04B 4LPYA 1H0DB 4PUBH 1YEKL 4RFNB 4IBLT 3OKNA 5TQ2L 1U8OA 2IGFL 5I66B 1T2QL 2C7UA 5JHDD 5HDBE 4RMUA 3KPOB 4P9HL 5GGRB 1NLDL 5C0RL 4L8DA 2NY7H 4KKLC 3C6SB 5BRZB 4CN6A 5C0AD 4GJTB 4HUWB 4KKLD 5FF6B 5MI0C 2OJEB 3EJYC 5DRZA 5I15L 3RWDA 1B0WA 2WUBH 3AXLA 5DFVC 1SEQH 3TGXA 3BUYB 1A6VH 1RULL 2DM4A 2Y5EA 3QRFM 3G6JF 3WO3B 3AFLA 1MIEL 3DURB 2GEEA 3V6ZB 1YEIH 4HJGB 5ID0B 2RFXB 4L8SC 2ILLA 3QCVH 4U6HA 1KJ3L 1YPZE 3MLXH 4PYGA 4X6DE 1PYWB 1C8PA 3HZKB 1MSPA 2X4UA 4X99A 4YWGH 3TBVB 2VLLA 4ONGH 5GS0H 1WZKA 1YNLL 2XKNA 1ZHBB 1OAYH 2R4RL 4PJIE 5HGAB 5FGBA 4OCXL 4H1LG 4YDKL 2A9MH 1OAQH 4X6BB 5GRJH 1LEKB 5F96H 1NANI 1J12A 2VLRB 4EI5B 4HZLB 5JUEL 3JZ7A 4KXZH 5C08D 4ALAL 4XWOC 4S1SH 3LIZH 2GT9A 3L3DB 2FO1A 4L4VB 5FYKD 4WWKC 4G9FD 3IFOB 4TPRH 2NW2B 4QOKE 1X5IA 1JHTA 1QQDA 2C9AA 5FO9B 4ELKB 2W0LA 2V2XA 4HCRL 4P9ML 4XTRD 1ZANL 4JRXB 1RK1B 4K3EL 4Z0XA 5GPRA 4KK8C 1UEYA 1MQKH 3VXRA 4MXWH 3CFKA 2OX5A 3BZFB 1BZ7A 2YKLL 4KK8D 2R9HC 1P6FA 1SY6A 3IDNB 4P2OD 5I8KH 1QR1A 1KCSL 2R9HD 4J7RA 1XGPB 2IAMA 1LE9B 4KROC 12E8H 1T03H 4Y4FD 1EJOH 3HC4H 4OF3A 1BZQK 2PYFA 4ODTL 2HFFB 2B1HH 3LV3B 2O26U 4OI9A 5CEZL 3BPLB 4NQDE 5D1XC 1EEZB 2DQHH 2F54B 2MQ3A 4KROD 3KPSB 3FT4B 3NFNB 4DZBB 3RVVC 4YO0A 5D1XD 2CK2A 4IEFB 3KPQB 5CIPA 3RVVD 1GHFH 2NY5H 4OCWH 2OQJA 2CIKB 2ZG2A 4NWUH 2WP3O 1MCFA 5TQ0L 4AH2B 1T2XA 3RQ3A 3AU1A 2C3GA 1GGIL 2OZ4A 2PXYC 1DEEB 3H9SA 3MREB 4JAMA 1MLCB 5HYSG 2W0FB 5D5MA 3KHQA 3JWOH 3GMLB 4HKJA 1L0YA 1EFXB 4NJ9H 3OKDA 4PRDA 3BP7A 4Y89A 3TJHD 3ARGA 4KRPD 4AT6B 1B88A 3KPLA 2A0LC 3G6JE 4IM8A 3O8XC 1FZOA 4DN3H 1JZ7A 1A6ZA 1KCVL 4QEGA 3RUGA 1FL5B 5DTFA 3QFJE 2XQYK 1A8JH 4XCNB 4KU1A 5DO2D 2B0SH 3T3MF 1ES0B 3BPCA 4NQCE 1VPOH 5JIKA 4DUWA 1R3JA 5SWSA 3CD4A 4W6YB 2EIZB 4PJDA 3BKCH 2HVKB 4NM8L 2E6QA 1JRHH 1IGYB 2AJUL 4U1IA 1TENA 4U7MA 3F8UB 5IFHL 3QEQB 4I48A 2IPKA 2P49B 4KK6C 1KLUA 4F7EB 3S5LA 3ALXA 5F1NA 4NZRH 3MJ6A 3KXFE 1A6WH 1KC5H 2IH3A 3S4SA 3K3QA 4QGYA 3STLB 3D6GA 1OGTA 1ZSDB 4QRPA 4GQ9H 5GZOC 4HEME 2DTSA 4M1GH 4QXTA 3VGEA 3ME0A 4PYHA 3N9GH 5F89A 2VIRB 2D03L 5F7KC 4DN4L 1N2RB 1U8NA 4ZOCA 2I07A 4Y8DC 4DOHE 1QRNA 1ROWA 2V2WA 1A5FL 1K2DB 4YXHL 4FXGB 4XP1L 3WMSA 2DRUA 1U3YA 1D5MB 3LRHA 2AJVL 4APQC 5C0DB 5FOBB 3LKRA 1HKFA 3L7FA 3LPWA 2IFFL 1R6VA 2DYPB 5F3HB 3MRPA 2EXYD 2B5IB 5ESVA 3UYRH 3AUVA 5IESL 1B0GA 1D6VH 4YDIL 4RDQG 4JE4B 2EYRA 4L4TA 4FTVE 4P23D 5DJ0A 5I18H 3DVFA 5JW3L 5JR1L 3QZWB 1AQDA 4K7PH 4WTZG 1I8MA 5HHVL 1AXTH 1D5XA 2CQVA 4UT7H 4IDJH 2E7HA 5ESQB 3V4VH 1FGNL 4U1LA 3MV7A 1D5BA 3TBSB 5DJXB 4P48A 4XZUB 1SM3L 4QHUA 4GRLC 3LEXA 3QWOA 3X3FH 3T0EA 1HH6A 1E4XL 4NOFA 3HPLB 1L0XA 4NN7C 4EXPX 3KPRD 1IAMA 1K6QH 43CAA 1ZT7A 2VXUH 1J0HA 1DSFL 1DE4B 4BUGA 3VFVB 1LMKA 1NEZG 2Y5TB 1SY6L 4KUCD 4ZTOH 4TNVF 2ADIA 4H8WC 2O93L 4XXCC 4WW2F 4HAFA 3GSWA 4NQUA 2ZCHL 5HHNB 2R2EB 4DTGH 4Z7WF 2WUCL 2NQCA 1NDMA 2H2SC 1FH5H 4S11A 4NC1C 4P5TC 3BO8B 3RY6C 1CD0A 5ALCL 2Y6SC 4Z5RB 1DBKL 5J11B 2BSTA 3X12A 4P5TD 5C6TL 3MNWB 4EN3B 3T3ME 4XNYH 3NGBB 2WZPD 1CFVH 4FOMA 1F6FB 2ED7A 4PV8B 1AHWA 5MP6H 3LRSA 2VDOH 5EZIL 4M8QA 4OZFB 3G5ZA 2A74B 4P5KA 5F7EH 5FM5M 5MEQA 2A1WH 1KT2A 4LCCB 1QSFA 4WO4C 2IQ9H 3B9VA 1WCBB 3P9WB 5F6HJ 4TULL 3NZ8B 1MH5A 4WO4D 2XWBB 1NMAL 1V7MH 2HG5A 3SDDB 3BFOA 2I5YH 1I9IH 4Z0BH 1QR4A 1ONQA 2XY1A 4PJ7A 1U8OB 1QKZH 4FQPA 3D3VE 2KZ1B 4XP5L 2BP3A 3GSNA 2IEPA 4LPCA 1WZLA 1H3GA 5HGGS 4L8DB 1Y18B 4OD1L 1I1CA 1OAKL 2CUIA 3AB0C 3RU8L 2V5TA 3FHQA 1JYVA 1T1YA 5L8JB 3SQOH 4I2XA 1I9JL 2CKBH 3RWDB 3AXLB 1J1PL 1WBYA 1TETH 3EO0B 1R0AH 3OAUH 4TSBH 4PP1D 4OGXL 2UUDK 3D2UD 3BD5A 1U95A 4LEOA 4LSRH 3N1FC 1CQYA 3O6MH 1U3ZA 1QYGH 4U6XA 3O6FA 3ZKSD 2JELL 3OKYA 5MHSD 1D5ZA 2NYYD 3CMOH 1DQLH 4POZD 3T04D 2X4UB 5B3JF 2VR5A 3HN3A 5H2BB 2XKNB 2ZSWB 4N5ED 5AAMA 5LBSH 1D9KA 3C5ZB 1H3PL 3W9EA 5KVEH 4MD5B 2R29L 4PRID 3UX9B 3OGCA 2DLHA 4HSQA 4HUXA 3U9PL 3BPOC 1JN6A 3VXMB 4F7MA 3QCUL 3LEYL 2Y06H 3MXWH 1LILA 1QQDB 3LN5A 3N0PB 4G3YH 3SE4C 4Z7WE 2V2XB 1V5JA 4YEEA 5HDOA 2IG2H 1KUMA 1MI5E 3UTTB 4EI5D 1BP3B 2J8OA 3VWJA 4WV1B 1LE5A 1J0YA 5F70A 3MRRA 3VXRB 3BEWA 3T1FB 3MR9B 1MREL 3CFKB 4M5YL 1BZ7B 5KVDH 3MA9H 3H2WA 2G9HB 5T3ZH 3RVXD 3Q6FA 4JHAH 4JRXD 5FUZL 1GGBH 1G7JA 1QR1B 4ZODA 4UI2A 4MMZC 1QFWM 2IAMB 1S5IL 5BV7B 2PYFB 3Q0HA 3MGTA 4LFHD 1FL3B 5C0ND 3HG1E 1YY9C 4WW2C 4AQ1B 5HYIA 1T21B 4DAGH 1AY1H 4YO0B 1YY9D 4LMQI 1PKQB 5CIPB 1RU9L 3PGFH 1RUAH 4JFOB 5JPNA 5GGVH 4JN2A 2F54D 4YHOH 2OQJB 4JM4L 4QHLA 3HZMB 2BNRD 4LKCA 2BSRA 3ARTA 3D39D 2DI9A 1DBJH 4LDLB 1A14L 3AU1B 4KHXL 5HJ3A 1LO5B 1R5IA 2V6HA 4JAMB 5FM5O 2DBLH 4OIBA 3EO9L 4LLQB 4HKJB 4R8WH 5E4EC 3OKDB 4PRDB 1MFCL 4PTUA 4X7EC 1KSRA 2MFNA 3OXRA 4UIMA