4K3DL

Crystal structure of bovine antibody blv1h12 with ultralong cdr h3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
215
structure length
215
Chain Sequence
AVLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BOVINE ANTIBODY WITH ULTRALONG CDR H3, HEAVY CHAIN
publication title Reshaping antibody diversity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 50
structure length 215
sequence length 215
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k3dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k3dL01
3THML 4V1DD 2NY3C 1RUPH 3BIKA 4P2OD 2QSTA 3MRHA 4LEXL 1UM6L 4G9DB 1A6AA 1BLNA 5DJ8B 1X7QB 5EO9A 5L9DH 1NCTA 2R0LH 3VD4A 3CFKB 2E8YA 2PTTB 5E2UL 2AK4B 3WXVL 5F93C 5L8JB 3DOSA 4Z7VA 3GMNA 4H25A 3CC5B 3LEXA 3MUGB 5HY9A 1XGYL 5GS0D 3C87A 3OB0H 1YJDL 3WNKA 3SKOB 2VDNL 3S34L 1ND0A 2E5EA 1YMME 1KN4H 4C83A 5ESQB 1FFPA 5DK2A 1HOCB 3V4PH 3GSXA 5JPNB 2J6EL 4X6FA 2W60B 1ZHKB 2DWEA 3QXAB 2K7PA 4JO4L 3QYCA 4WEUD 4M8QB 5BRZE 3B9EA 3GJEB 4CMMB 1WBXA 3C8KB 4J2XA 1ZLWK 1YEHL 3EYQD 1QPXA 4FP8H 5DT1L 3KPTA 4L4JA 3ARFC 1UKQA 5EU3B 3HA0A 4WY7H 3M8OH 4YHIB 4NZRL 2ID5A 2AABH 5H2BA 4WFED 1J8HD 3ABZA 3PXHA 2HLAB 1A6ZA 1Z9MA 1HQ4A 5I75C 2IALA 4HUVB 3WNLA 4XCEB 4MCYB 2XTJE 3DHMA 1RHFA 1HHJB 1MEXL 1E4XL 4MS8C 5I8CB 4XRCA 1FFNB 3B6SB 1S7QA 3IFLH 1T2JA 1MCFA 4P2QA 3WYRA 4PJXB 1WSST 1EGJH 4G8FA 2HVKB 5GGSA 1YECH 1NLDH 3U7AA 2OR9L 1ITCA 2NZIA 2X10A 2YS4A 3MRRA 3MJ9A 1XH3A 4XTRD 1LO3H 1YPZB 3DX8B 1T20A 2X40A 3HHRB 1E4WH 4NHCH 3V6ZB 4TSAH 3BEWA 1BZ7B 4K3GA 1QR1B 1D5XB 1D3CA 1INEL 1G9NL 4X4XB 4N8VA 1EV2E 1ZSDA 5D2NB 1SY6H 1T66D 1DFBH 1YDPB 3WE6B 5GRXG 3NMEA 3BWAA 2YR3A 1EH9A 4GAYB 5EO1B 3BJ91 4RGNC 3TN0C 3Q6GL 2GSGA 3T4YB 1FVDA 1F3JB 2NTFB 3S35L 1G6VK 4JFYA 4FQCL 4PJFE 2PW2A 2BRQA 1LO4H 1K8DA 1QYGH 5C0EA 3ARBC 3V5HB 2LU3A 4CU8A 5EG6C 4AM0B 4OZGE 4Y19D 4K8RL 3ZKNC 3LN5B 1NCBL 1HXMB 1RUAL 3RZCB 3H0TB 4XC1L 4XPTH 4JR9L 3FTGB 4JREC 4J3XA 3MRLA 1XCQB 4ODSH 5GGSY 1AGFB 1H3PH 3CVHH 4KGLA 3DYPA 5IK3B 3I6GB 1KNOA 5DJ0A 3ZT6A 4ZUWA 1N3NB 4WEMB 5CJ5A 1S7UB 5E5RB 2FO1A 3KYNB 4YO0A 1A14H 4MA7H 3AB0B 3OGOE 3HC3L 3C09C 1CCZA 2PCPB 2WWMD 5JW3L 1NUDA 5C0FB 4MCZA 4UT9H 3VXNB 3EW3B 1N4XL 1FZJB 2BVOB 1S3KH 3T1WA 1TCRB 4O00A 2NY3D 1B4JL 5DJAB 3V6FA 4XNXH 3NACH 5IHUH 2ZUYA 3VXRE 1EVTC 1CE1H 2A6DB 1I75A 5I17B 5KTEL 2WSKA 5IQ9B 2JB6B 5L6YH 5E03A 3BX7C 3BRFA 2OMBA 3FL7A 3PQYD 5EN2B 5E08L 1G84A 4MJID 3MRDA 4NRZB 3NPSC 3FQTA 1NAML 3QIUB 4XCFL 3IDMA 4Y16A 2G9HB 1TVHA 1L7TL 1RUML 4O2EB 1T1YA 5IESH 1AGDB 5HTSA 1UCTA 5DVMA 2H8PB 5DD6B 4OJFH 4I48B 4JM2F 3P3YA 2HKHL 4I0PA 5GRWA 4PJIB 5IFHH 2VDRL 1ZANH 1AGBB 4X6BA 3UZEA 1WEJH 35C8H 3HS0A 5JORA 5I71C 2IG2L 1D5IL 2VLRA 5IBUG 3L3HA 4RNRB 1ZEAL 3GRWA 3GIZH 1N64H 3FCTB 1F4HA 4G5ZH 3TCXA 4M6NH 4E42A 3L3KB 2JK5B 1S7XA 3ARFD 3IGAB 4QXGH 3TJEL 1N6QL 3GGWB 4MB3A 1MAML 2YWZA 3LKNB 3O6KL 4KV5F 3T0EC 2VB5A 1YY8B 3F62A 4L4VB 3W39B 4HUWA 4URTB 4HGWA 4OGXL 2Q76A 5ANME 2R9HC 1XEDA 4ZOAA 4UOW1 3MV8D 1UJ3A 2HG5B 1CK0H 2X1QA 5GGTH 4RFNC 1UFUA 3ARGC 2XNAB 2FSEB 2PO6A 3J8F7 3H3KA 1ACYL 3VXSA 3AY4C 3RTQC 2VQTA 3WJJA 3VD9A 1RVFH 2VAAA 5I1CL 4TSCH 4UB0H 1N5YL 3FO1B 4YHYB 1J12A 4G43B 4Z18A 4Z7WF 2YBRB 4Y2DA 1UWXK 5IB4A 5CEYA 2AGJH 5BW7C 4JDTH 4M6AA 3V0WL 1HINH 4EOWL 1JGEB 5KVDH 1CXHA 4OLXL 1XF5A 2JTDA 3I85A 1DQML 1CG9A 1CL7L 4F9PA 4U1LB 4QYOB 5HHOD 3DRTA 1JF6A 4JQIH 5I1JL 1INQA 3CFCH 1WAAA 3TPUA 3UPRA 4K23L 4YDVB 1R6VA 2BVPA 3RWFA 4OFVA 2ZSVB 2P5WA 2EYTB 2PXYA 3BKJH 4EXPX 4RGND 2DRUA 4LSPH 3FONB 2YPKB 3TN0D 5HGHA 1OT2A 1YEEL 2WLYA 2KH2B 5FHAH 2NY6C 3BKYH 5HDOA 1XGRB 5KZCD 5C07A 1VDGA 3KPNB 2N7AA 1HK6A 3ARBD 4TNWF 1Q1JL 4EI5A 4KZDH 5IP4A 4MLSA 1A9EA 2WZPD 3ZKND 3CFBA 4RGOH 2P49B 4EKXA 1YEGL 5JMOC 5FUOH 1T1WA 4FTVD 3VFUA 4XP5L 1MIEH 5HGDB 5A40E 4I2XE 3HMWL 5GISL 3BP5B 2Q8BH 4PJ9A 3U2SB 2AKRB 3VG9C 4KK5C 3C60A 5D7JA 1G1YA 2JJSA 12E8H 4NRYB 3GKZA 5I76A 3O3UN 4WUUD 1CBVH 1A6VH 2QQKH 4Q0XH 3KLSA 1W0WB 4OSUL 5DLMH 5EIIA 5H35B 4YR6B 1OP3K 4KDTA 4I3SL 5IHLB 3UTPD 4WJ5A 3CSYB 4BKLB 4ZAKA 3PWUB 2XTLA 3NGBB 1PEZA 4EBQH 1FVEB 4NQCA 5GQBA 1NUNB 1CGWA 3MLWH 4LBEB 5CEZH 5CJBA 4ZS6C 5EUOE 1UM5H 2MQ3A 4PJGA 2P46B 5KS9E 4L8SA 3GJFH 25C8L 5EC1A 4NKOB 4A2LA 1QNZH 3VH8B 4Z7UE 4QRRA 3UYOD 3PL6B 4JJ5A 4LCIL 4NQED 4OCWH 4KUCD 4GW5B 5C08D 1JF1B 2DIAA 3MV9E 2AK1H 1J8KA 3LZFH 2A83A 3G08B 2ICWI 2BVQB 1P9MC 5AD0B 5BMFH 3MXWL 4LCYB 4N1HB 4XMPL 5JHDB 1OAQL 1I8IB 1VGEL 2D4FA 2F58L 4LSTH 1MCJA 4NC1E 4P3DA 4YX2L 5KAQF 2EDTA 2IJ0C 4ZODA 4P99A 4ZPVB 3KGRA 2XYCA 2PYFA 3IJYA 4YFDB 1G9MC 5F1OB 1UM4L 4XVTH 1QQDB 3G9AB 3T0ED 1KTDB 4J3VA 1NUFA 3WD5H 4XP4L 3SE9L 4MA1B 4LRIC 1YMMA 3SHSA 1H5BB 1OY3B 5CGTA 3LKSA 2R9HD 5IEKA 4CVXB 3N85H 2V2TA 3R06A 2FJHB 1VGKB 4TRPH 1QD0A 5BRZA 3ECBA 3JV4B 3ARGD 4JPWH 1UB5A 3UYRL 5JXAL 3RTQD 4Y4HC 1T0NA 3TT3H 3UPAA 3AXLA 1UJTA 5GGVL 4Z78A 1G7HA 5MENB 1FJ1A 3FOMA 1CTNA 1P84J 1T22A 4ZSOE 5DQ9B 2VLJE 3TBWB 3H9SB 2VISA 4YXHH 3IFPA 4RZCB 4PRDA 4PV8A 1JTOA 4DUXA 2R4RL 3OXSB 1G7JB 1UT9A 5IB1A 3N06B 5L8LB 4ZO6A 4LSQH 4D9QE 1I3RB 2AV1B 1T5XA 4OF8A 3MMEB 3P4NB 4NPYB 5DRXB 4TULH 4OCYL 4TUKL 3PWPE 4LLUA 4QEGA 3D69B 4LKXB 1NC2D 1T3FB 2ATPB 1A6WH 5I1DB 2NY6D 32C2A 4X5WB 3RI5F 5DJDB 3HC0B 1FYTB 1E4JA 1XZ0A 3ULVE 1SJVA 3Q3GA 1JYXA 2X41A 5JOFB 5F9OH 1TJGH 1UENA 2CKBA 1FLTX 3MA9H 4ACPA 4LLYA 4R0LC 3SKNB 3PJSB 2WWKO 8FABA 5L8KB 1VFAB 2VL5B 2VH5H 1II4E 4OF6A 3L7EB 4JGMA 1RD6A 4KK5D 3DROB 2DI7A 5F89A 4PJFA 3X13B 5HI4C 4HH8A 1MLBA 3EYUH 4KDWA 2MSPA 3QQ4B 1F4XL 4OZGA 1A0QL 2VXVH 5EORL 4JPVH 3MCLH 3MV11 4C4KT 4PLNC 2A9NL 2GTWB 4Z0BL 3EYOA 4PV9A 4HH9B 4RMQA 4WW2A 3KWWB 4HUXB 4MMXC 4ZUTB 3BQUB 1JNHB 2VNCA 2Y06L 4JLRB 5BJTB 4ODXA 4LKCA 3T3ME 4ZS6D 1B6UA 1EJOH 1R3IL 2VDQH 5F96H 4KJYA 2P24B 1KJ3L 4JHZA 5FYJD 1IGML 4PR5A 5F7EL 1JTPA 4WI6A 5JQHC 2LE9A 5F3BB 4PJAF 4JZNA 3LQAL 4LVNB 4X9BA 4HGMA 2KDGA 2J7LA 1TVDA 2X9WA 3TBSA 2R0WL 1FC1A 4D0BA 1CDBA 3WUZA 1WWWX 3EJYC 4EZMA 1RZ7L 1E27A 3VXRA 5HGAB 3KR3H 4GRWE 2HRPL 1S8DA 5HYQA 1PD6A 5HGBB 1CU4L 2Z8SA 4PJEF 1SJEA 5GRJH 1ZGLA 3U79A 3VD5A 1U8HB 3UTTD 1J5OL 4K71B 3DTXA 1U42A 3EDEA 3VXOA 3LSOB 3IU3B 2JE8A 4W6WB 2I60H 1MJJA 2X1OA 5TDPB 2X7LA 4C57C 2QLVB 3RY6A 5BS0D 5HHPA 3SJVE 2QSQA 3IDUA 4K94L 4OIIH 2HTLC 4U1JA 2AXGB 3L7FB 1EEZA 5GRZA 1JPSH 4F3FA 5C0AB 1GZQA 4A6YB 3BMVA 2FX7H 2XQYG 4NO5A 4PRHB 4S2SA 4PRIB 2AEPH 3ILPA 2BSSA 4FQQA 5CSZB 3Q5OA 4KTYA 4HV8A 1WTLA 3LN4A 4M6MH 4P4RA 4Y4HD 1J05B 4I8DA 3O11B 2XKNA 3ULUF 1NFIA 5D6CA 2NY1B 4QRTB 1FNEA 3AS3A 5ANMA 2YUZA 4LHUB 3A0OA 1MHCA 2Z9TA 3S88L 1A7PH 1P7QD 3QUMH 1MCNA 1MREH 3UBXB 1UXSB 1FNSH 2A77H 4X5LA 4O5LL 4KVCL 3SKMB 3BDXA 3REWA 1NBVH 4YE4H 1U8KB 3T77B 1AXTL 3AS2A 3MCG1 2H32A 2H6PA 4N5EC 1E28B 3CSBA 4J8RB 2J3SA 1Y0LA 3SQBA 4RMRA 3WN5A 4H1LA 4MD0B 3ULVL 1IGJA 3BH8B 4NBXB 5FGCE 4IIQC 1TMCB 2IH1B 3GMRB 3GSNH 1JGLL 2GTZB 3MJ6A 1XF2B 4W6XB 3T0VA 3HZYA 3NCYS 4UNUA 4OLZL 4Y16C 1AP2B 3GZKA 3GMQA 1DLHA 1Z3GH 2Z93A 4NGHL 3U36B 4YXLL 1QFWI 1HYSC 4YBLB 1PZ5B 4ZO7A 4OV5A 2F19H 2DF3A 3W11C 1QSEE 5F44A 1CIDA 1MY7A 4I0PC 3WHE1 4J6RH 3D18A 4IMLB 4OD2A 1CI5A 4FQXB 1PLGH 5HI4D 1FGNL 1HWHB 2DLIA 2GFBB 2V5RA 3QI9A 1I3GH 5DRNB 3W82A 2ICEB 2Y36L 3QCVH 4R2GC 4FXLA 1S9VA 1C16A 1OTSC 4MDIA 1A3RL 4I2XA 3JV0A 4F2MA 4YPGA 1C5CL 1TFHA 5CFHA 2MHAB 2UZYB 3V5KB 3FT2B 1DL7L 2XKSA 5FM4A 1UJ3C 5GGVY 1MNUH 3P73B 2Q3AA 2R23A 1MHHB 4Q2ZA 2IFGA 1YEIH 3EDJA 2B5IC 3LS5H 3IFOA 4UV4L 4LASL 4X7TA 2WIMA 5IW1A 1NGXB 3IF1A 1WWCA 1VADA 3GHBH 1XGPA 4R8WH 3V0VA 4DEPC 2WBWB 2LTQC 4JFPA 2CIKA 4BSVA 3FQRB 4I3GA 2F8VA 3EJYD 3OG6B 4Z77B 4UIKH 3WFDL 1BJ1J 4OD1H 1TTFA 3O9WD 4BH7B 4X83A 3F58L 5EUOA 4WW1A 3CAFA 4Z7WE 5KS9A 5CJ8A 15C8L 4DKAA 2UWEE 3Q0HA 2R2EB 1SQ2N 4X5XA 4X0KB 4TPRH 3KJ6H 2EH8L 4PP1C 4Z7UA 3SKJH 3QXDB 2P45B 2V2XA 3FB5B 4HWZA 2BDNH 2PXYC 3VWJB 4IRSA 4L9DA 3MV9A 4PRAB 2X4RB 1WLHA 2OL3H 5ETUA 5L0QB 3FO0L 2HTLD 1KCVL 4UTBH 1YN6A 3JUYA 2EIEA 3NIDF 3IDJA 1MVFA 2DQUH 3RUGE 1KEGL 3MYJB 5EO0B 5EZJA 3ZLQC 1RJLB 4PRPD 4C56D 3TBVB 1RU9L 3H8NA 5EOCH 2X4TA 5EZIL 2R2HB 1WZKA 1I1CA 3ZKSD 5DJXB 1P4BL 5AEAA 5F7HA 1JGVH 3I3BA 1TQCC 3FT3A 1R3LA 5E8EB 4DZBB 4PJXF 1A1MB 5D7JC 2MJWA 4BFGA 2XACC 4UIMA 5BV7H 5J11C 2DQEL 3CUPA 2UY7A 4QF1B 4Z6AT 1YEJH 4WO4B 2VQ1A 4XBEL 1YPZF 4JFDE 1ZS8B 4Y1AB 5K59F 4TOYL 2VN4A 2J4WL 3G5ZA 4KDTC 3N1MC 2GJJA 1JYNA 4I9WE 5EIVA 1P4IH 5EFIA 2NY2D 5C09E 1BIIB 4RRPG 4HSQA 3EO0A 2QR0B 2NZ9C 1WITA 3DWTA 7FABH 4N5ED 5F1KC 3B2UC 3GSOB 5GRVK 1VFBA 4TQEH 2UZXB 4GRMB 5EBLB 1V3LA 2BVTA 1TJIH 4ZSOA 4OZIB 1UWEH 2VLJA 3JV5A 3MGTA 3WIHH 4OCRH 3WNMA 4G3YH 4MJ5A 3BT2H 4M1GH 2GT9B 1U92B 2RHEA 5IMKB 1HIMH 3QNZA 5CBEA 1HYSD 5DI8A 1MCPL 1IQDB 3QJHB 1RIHH 3W11D 1JMXA 1A7RH 4I0PD 4YHPA 4PP2A 4QCIA 3FQWB 4OB5H 3H9YA 5HGGS 3PWPA 2Q8AL 5JUEL 4HJGA 4DZ8B 5ESVA 1T04A 1LK2B 3KPPB 4HK3N 2X4NA 4P5MA 2CUHA 5DUBB 1TDQA 1J1XH 4YH6A 1FG2A 5JW5B 1I1AC 4R2GD 4ODUA 5E5UB 3T0WA 1OTSD 2AQ3A 2I25N 3JUZA 1QACA 1RZGB 4KHXH 3MRFB 4ELKA 4GAJH 1CGSH 1J1PL 4D0DB 4H0HB 1WJ3A 4DAGH 4JFFE 3VXQA 3KPSB 3TZVB 3VFOA 2IAMC 1W72B 1NEUA 2BSRB 3JWDL 5C0GB 5ALCH 2AI0L 3HB3C 4GLRI 3H3PL 3S3JA 3MLYH 2WINA 4RMUA 3LRSA 3OAYK 3X14A 3L5HA 1N0LA 1NCWH 3DVGA 5JNYA 4LLQB 3QEUB 3U4BH 1U0QA 3QEGL 4O51B 1HKLL 2XTJC 4AIZA 4NCC2 2XA3A 4BK5A 3O4LE 2IPKB 3ARZA 1N5AA 2VR9A 5ACZA 1F4AA 1GIGH 2ENYA 3OKKB 3DETC 5JIPA 3HE6B 4YDLC 1HDMA 4Y8DC 3SDAC 4LQFH 1BFOB 2EKSA 4LSVL 5EOQH 5HYFA 4JDVB 1C08A 4YDKL 4PP1D 1P5VA 3U6RA 4Z7OF 1FO0B 2CUIA 4M7ZB 5C0JB 3STBA 3K8MA 1A7NL 2PXYD 3FT4B 3DIFB 5F71A 1FH5H 5KG9B 1ZTXL 2YC1A 2A73A 1S9KC 1FV1A 1L7IH 5J06A 3P9MB 3PUCA 3S36X 1KN2L 1WIOA 5C07D 3RGVB 4XPGL 5HYSB 1K5NA 4WI8A 1ORSB 2A6IA 2W9EL 1KPVA 5K9JH 2ITCB 1RFDH 5SWZE 1BBDH 5TF1L 5BZDB 1MRDL 1FORL 2ZJSL 4ZUSB 5IVOA 1HH9B 4I4WA 3RWJA 2BK8A 4JQVC 4NDMB 4XPBH 2MFNA 5C71A 2YXFA 3BUYB 2NXZC 2Z31B 4LIQH 2NW2A 1BD2D 1FL5B 3SJVA 1P6FA 1RZKH 5IMLA 2YUWA 2VN7A 5SWQB 5ID1B 5KVMC 5CD3B 5D7JD 2IH3A 5E4EB 3IKCB 1QEWA 4NWUL 3O3EB 4OLEA 4NNXB 4HIIB 3BZ4B 4KAQH 1FL6A 2FGWH 4X99B 3DXAB 4YGAB 1ACZA 4NKDB 1BZ9A 5CJQH 1CGUA 4F7EB 1WTGT 1Z9SA 1TTUA 3L5XL 2OTPA 4WW2C 4OLYH 2OI9C 3KPLA 4RDQG 1EMTL 4NQCD 2DQFB 2NZ9D 1Z5LA 4Q74A 3T0AA 1H9VA 3QQNA 3B2UD 4U2YA 4ETQA 3KYKH 4EUPA 1BM3L 5CMAA 4DCQA 3LKPB 4KKNA 1BEYH 1BQUA 5IGXL 3RBGA 1YQVH 5T3XE 4LSRH 3RKPA 3WS3A 3MQIA 2V5MA 1T5WA 4WEBH 5FUZL 4PJAE 1QFOA 2H3NB 3SKUD 2D9QB 5EBWA 2ADGA 4UQ3A 1FZOA 4TNWK 1IC7H 4QT5B 3ARDA 5CSGA 2WP3O 2GCYA 2ADFH 4U1KA 4FFZL 3VGHA 4IMKC 1KBGH 4XHQA 2Y6SC 3HG1E 3IB4A 4ALAH 1HILB 3PIQB 4KTDL 4P9ML 3ME0A 5JLZB 4PJEE 1R24B 1UA6L 3P9WB 4PTUB 1I1AD 3E8UL 4YK4B 4YQXH 3VCLA 1AE6L 3PP4L 5E7FA 4JO1L 1QSEA 5MEPB 3I2CH 1DQTA 4WWKA 2W0LA 5T1KB 5FB8B 1M1SA 3LEVL 2YXMA 4ZXBA 3BGAA 1MI5B 3MLRL 5BRZD 4ZUUB 2IAMD 1YC7A 5E8DL 3HB3D 5M95B 3QUYB 2AXFA 4OZFB 1NGWB 3TIEB 5HPOA 1ADQL 5SWSB 2BNRE 2I26N 4U6XA 2F74B 2NX5D 3T0XA 4AIOA 2IPTL 3QH3A 1XF3B 1CZ8L 4NM8H 4XBGB 4FQHA 3ULUE 1IEAA 2ZSWA 2UYLB 5I1GL 3S37L 3W5MA 4LU5H 2RAMA 3BSZL 4PB9L 3BD4A 3BISA 1MUJA 3MLVH 3DETD 3MRBB 1WCBB 1AQDB 2O5XL 5D93C 5BXFA 2AQ2A 1QA9B 3IDIA 1CD0A 3SDAD 3U7WH 2VDLH 2GSIA 2X70B 1S7VA 1NC4D 1MJ7H 2YD7A 1FIEA 4NFBA 2QQLL 2B20A 2DS4A 5FYLH 3VU2A 3WN5C 1AD0A 1RMFL 1HI6A 2FO4B 4G7YL 3OJDB 2E27H 5GS1B 1CLOL 4OUOA 4DKFH 5DTFB 4FMFA 4Q58C 4HIJA 4Z7WA 3BRDA 1MPAH 2UWEA 3NCJH 4K55A 4KY1H 3QB7C 3V9FA 3RRQA 3MGOB 1EFXB 2O5ZL 3HPLA 3U4EA 4K2UL 3LH2L 3MACL 4CNIA 1XGTB 4JRYE 1GVIA 2Q1EA 3IJHA 2NY7H 3CVHB 2NXZD 2C3XA 4PJ8A 3C08H 5T3ZE 1A5FH 1A6UL 4PJ5B 4R26L 1UACH 3ZL4H 1S7WB 1F00I 3BH9A 2Y1VA 2FATL 2DM2A 1O5DT 4HJJL 3BAEL 3RUGA 3QUZA 5JR1H 2VABB 1DQQB 2ZG1A 3QI9C 5LWYL 1W72L 2P47B 4UDTA 4XPHL 2DQDH 1JWMB 4UAOB 5DHVA 1CXEA 1T2QL 2NY0C 5DHYA 4OD3H 5E5MA 1T4KA 4UILL 4ZD3H 4E9LA 4Y4KB 3FB8B 3LMJL 1BVLB 5HPMA 3C5SA 3O2DH 1VFUA 4NN6B 2CH8A 3G6AB 3DSFH 1A1NB 5ELIA 4JCLA 4JFDA 1P84K 4HBCL 1OCWH 4Y8AA 3DUUA 1OT1A 2ICES 2M2DA 5E9DE 5EA0L 4KZEL 1CS6A 2GUOB 5HHME 5C09A 4CRPA 2HFFA 2FWOA 3RI5K 4HWEH 1J86A 4I18A 1A7OH 3NABL 1FO0L 5CKAA 4NM4H 3E0GA 3T1FA 2ESVB 3VXRD 4FQLH 5E2TL 3U48A 5EUKB 5SV4A 3MOAH 5B39A 1PY4A 1PDKA 4RAUA 2F5AL 3FRPG 2JJUA 2Y6SD 1ES0A 1X5YA 3D0LB 1I8MA 2FEEL 4N0UE 5D7KE 1UGNA 3QDAA 3MRGB 4OQTH 3AROA 4GMSH 4YHNA 5FDWA 2BY3A 3QUXC 3WHXA 2PR4L 3N9GH 2X44D 1X5LA 4QRUB 5F9WC 3EO1A 4PGZA 1OGTB 3HZVB 1RZKC 3L1OL 3B83A 4LSDA 1PX4A 1CXLA 1QLEL 2FGZA 5IFJB 4AT6A 1T7VA 4H20L 2RB8A 1CICA 1YN7A 2FLBT 4WNQA 3FN0L 3CFIC 3NIDE 4BZYA 5DD3H 5DYOA 4N9GB 3CXDH 1JHTA 1RZ8A 1CR9L 1U8PB 2J88L 3BMWA 1LP9B 4JRXB 3HZMB 4Z8FL 3EZ8A 1LE9B 3VRJA 3CJJA 5ACLA 4DUWA 2MMXA 4WHTA 4ODWA 2R0KH 4JFFA 5JXEA 5DRWA 3IJSB 4PJXE 1F02I 3IAGC 5I8KL 3K46A 5DD0L 1EEYA 3V4UH 3IU4L 5DD1H 1YPZE 4L4TB 2VDOL 4M43H 4L8BA 5LGHL 4CVWA 2BERA 3MJ8A 3QPQC 3SY0A 3U46A 3RDTA 3M1BA 1IC4H 3BE1H 2XXCB 3KXFE 1GC1C 1IJ9A 4WHCA 4UNTA 4R7NA 4W81A 2ATKB 3I75B 1HNGA 1S9WB 5E8OA 3L5IA 3O4LA 4XZUA 1X44A 3TF7C 2OMNA 1AC6A 3HE7B 3UTSE 3SE8L 1B0WA 3TEUA 4NUJA 1MQKL 4LLDB 1DSFL 2QKIA 1Q72H 3L3OB 3FB7A 3G6DL 3Q5YA 1Q94A 1Q9WA 1RZFL 3UJTL 2ZCHL 4PD4J 3ULSA 1DBJL 3V4VH 3E6HA 4U3CA 4XH2B 3Q6FA 1WT5A 3HNSH 1DE4B 3D48R 4XXCA 1H3GA 1NGQH 1KJ2B 5E6IC 2C1PA 3NIGE 4FHBD 4P2RD 2F54E 5GGUA 5L2JA 3VFWB 1UEYA 5SWZA 3QI9D 5D7LD 4U7KA 3O3BB 4JFXA 3INUL 1I1FB 3C8HA 3R4DA 1EGJL 2NY0D 4TVSa 2E9BA 1F3RB 3SGEI 2MNUA 5GJTH 5CUSH 4LL9A 2CUMA 5D9SA 4X4YA 4DFIA 3MFFB 3OJVC 1U2HA 5EB9A 5IFAL 1PY9A 5D72H 3B8YA 4N0FA 2EEAA 3N0PB 5IMOA 1FPTH 5ADPL 1MWAB 1NLBH 1DFBL 4AQOA 3P0YL 2VSCA 1QZ1A 3SDXE 4F57L 5ID0A 5TDOB 1U8OB 1P7KB 4ODHL 5DMIL 4ZDHA 1FE8H 5AZEL 1CF8H 3O0RL 2LFGA 3EIFA 3EJZC 4PLOB 3FAXA 5J6HB 4R6UA 4OZ4A 1SYVA 1MFDH 1JZ5A 5JHLH 4OUUA 1OM3L 4JKPL 2COQA 2OR8A 4JFZL 1XF1A 4ZMAT 4G42A 2YSSA 4OZHB 1FZKB 1IKNA 2MKWA 4B41A 2DD8H 2XRAH 4PJAA 4K9EL 4X4ZA 5CP7B 1DEEB 2Z35A 3DI2B 3QUXD 4JB9H 3CVHL 1SYSB 3MV9D 4JY6A 1RZJC 4Z7OE 3S7GA 5I1AA 1I8KB 4Y5VA 3BGMA 4YHKH 5SX5K 1GOFA 1IBGH 1OSPH 4QRPB 1U8NA 4KVNL 4GMTL 4BH8A 3L3IB 3HG1A 2NY4C 3U0PA 1KLGB 4OGZA 1J0YA 2VDKH 5I73C 4F9LA 5AYQA 1J11A 4JKMA 1T6WA 1G7MA 1LO5A 4KQ3L 4PJEA 3QFJD 2JF1A 4JN2B 1UADC 1IM9D 4APQB 3VJ6A 4D0CA 1U9KA 2ARJB 2FYYA 3TVMC 4NQTA 1K2DB 5DD5L 3E6FA 2VRAA 3QZWB 2O26U 3EO9H 1ORQA 5IROA 5F70A 2DKUA 4HBQA 2Y5TA 4YWGH 5L6YL 4XNZC 2I5YH 1HSBB 4JVUA 2OX5A 3QXUA 4RDQF 5TQ0H 3GBMH 3U30C 3FOLA 4MVBC 1UKSA 3OR7B 4U0RC 2D03L 4BUGA 3HMXA 1MJ8H 1I7UA 2BNRA 4P57B 5EIQA 3OMZA 1CFSA 4OJFL 2ILLA 2OP4H 1L4IA 4NZUH 5FA4B 1MRCL 7CGTA 1AFVL 4TUOA 4XCYA 3PDOA 5J12B 3BYTA 1S9YB 4ESKA 3RIAF 3VW3L 1P69B 2VLJD 3HAEH 5EZLB 1Z9OA 1TVBB 1FBIH 3CU7A 2A74B 2ZWLT 1VPOH 3QNYB 1QSZA 2FZ3A 5IEHA 4XMLL 4XVSL 4XVUC 4D9QD 1A6PA 3MLXH 1LO0H 3MROA 1T83A 1DQDH 3LKRB 5L2KE 3THMH 1UH4A 3ARDC 4O9HL 1NBZB 2P4AB 2IADA 5HYEA 2W38A 3VDBA 4LEXH 2VDML 1UM6H 5CGYC 1AXSB 5E6ID 5ITBL 4P4KA 1NGYB 3RWCA 3O2WL 4YFLF 4P59L 4KROC 3V8CA 2CLVB 5E2UH 3AFLA 3FFDB 3D39D 3WXVH 4JRYA 1A6TB 3K4ZA 2R69L 2MCPL 5LAXA 3QG7H 4RBPH 4UNVA 4X7SL 1FYHB 1DVFA 1DQLL 1YJDH 4JM2C 1GRWA 2OCFD 2YD6A 1U58A 2VDNH 3S34H 3ESVF 5HYIA 3NN8B 2EXYC 2HWZH 3HI1A 2FECI 3QR2A 1U93A 4K7PL 3TYFA 4AY0A 4HC1L 3MYZA 4LLMA 1YEHH 2GY7B 4QHLA 4HFWB 2EYSA 4MXQC 5DT1H 1F4YH 1IGYB 4FRWA 3BKJL 4MHHI 4NZRH 4NO2A 4NT6B 3SDDA 3EJZD 1MQ8A 2L0DA 5FYLD 3HLAA 4LPWA 2XG4A 1HH6B 3GKWL 2GIYA 1LHZA 3BKYL 4PJCF 1NCAL 3NZHL 1C8PA 1JK8B 3GHEL 4Q6IA 2AQ1A 2YUXA 4XP1L 4JVPA 3BKML 3SBWA 4MX7B 5E9DA 4TVPE 1E4XH 1BOYA 2V9TA 3P4OA 1FDLL 1T1ZB 2EDXA 2HJKB 3G5YB 2FIKA 4G80A 4QHKJ 2K1MA 3NFPA 4G8GD 3D85A 3U82B 4NN5B 2OK0L 2OR9H 1OGAE 4LHQB 1MCKA 4XVJL 3CC5A 3C6LB 4QWWC 3KYAA 1KJ2L 1CBVL 1U8MA 2ADIA 1HE7A 5DLML 5JZ7C 2NY4D 5D1ZB 1SBSL 1BBJA 1ZK9A 3MR9A 3MV01 3SKOA 1CFQA 1KTRL 1INEH 1EAPB 1G9NH 4N0UA 4ZUVB 1NSNL 1NEZB 4LPCA 1T21B 3TVMD 4Z0XB 3GJEA 5CJXC 4QOKB 1DLFL 4HZLA 3OX8A 3IYLW 5EU3A 4CVUA 3Q6GH 5DSCA 3S35H 1QOKA 5DMKB 1CFBA 5IVZA 3MO1A 4FQCH 3RWEB 4F15C 4OF3A 4KI5F 4W4OA 4JZOB 3SCMA 4MXVF 4MVBD 4MJ6A 1MWAL 4NO0A 1BQHB 5DMGC 5GRUL 3WDJA 1RUAH 1L6ZA 1OTUC 3DMMA 5GIRA 3U7YL 3RGHA 4XC1H 1NKRA 4JR9H 5E94A 3K8KA 3B6SA 5H37H 2Y23A 3P0GB 4JKWA 2X05A 1UZ6E 1B4RA 5IVXB 4FZEL 3GSNB 4NZDA 4KJQC 4WUKL 1NDGA 3TCLA 4PJXA 5JDSA 2DM4A 5ABDE 1VACB 1I7TB 3ZHDA 3VFVA 3HC3H 3VD7A 1YPZA 2V7NA 3EYSL 1TZIB 3K0WA 1Q0YL 3GI9L 3AAZA 4X9IA 4XVUD 3HRPA 1SM3L 2G60H 1N4XH 3QUKA 1JPTL 4GH7B 4U6YB 1FYTE 4U1HA 1I9JL 3OKEA 1MCBA 3QHZL 4FNLL 3KXFA 3GBNH 3ARDD 3KYMB 1P53A 1B4JH 1YDPA 3SDCB 43CAA 5C6TL 2H9GB 1KCKA 4NQUA 3IRPX 3WS6C 3WKNA 3UO1L 4LCCB 5KTEH 5CGYD 4JY5L 5CGMA 4ZFZB 1TQBB 5JIIA 5K93A 2ZOLA 3UTSA 5E08H 4KROD 4ZTPL 4GKNA 2DYPD 2C1OB 4JANB 4ZO9A 3IXAA 1NAMH 1BFTA 3SE3A 5AAWA 1L7TH 4QO1A 4PG2C 5B22A 4U1GB 1RUMH 4NBZB 1LILA 1G7IA 5CILL 4H8WH 5FA3B 5DJCA 4EVNB 3BJLA 1HXMA 3RZCA 3OKDB 2VITA 2HKHH 1X5FA 4JM2D 4NKMA 1CICC 2B39A 2MTPA 2VDRH 3B43A 4MB4A 1QSVA 1XCQA 2EXYD 2F54A 4EDXA 4GRLC 4E41B 4YXKL 3BPCB 2IG2H 4J3OC 1D5IH 2WBJC 2HFEA 3GNMH 1ZEAH 1MCRA 1S7UA 5F7MC 4JFHE 4NQXB 5T1LD 2P8MA 3QDMB 5F7UA 5IOPB 4MXQD 5EBGA 1U3HB 3S96B 3TJEH 1N6QH 5ISZE 1MAMH 4I77H 3O6KH 4V1DE 4OCXL 5JXEC 3VXNA 3R0MA 1ITBB 3BXNB 3KPMB 2Y7QB 2VERN 1DTUA 4O2FA 4RCAA 1ZLVH 5D96B 2E7HA 1JRHL 2A6DA 5F6HI 4MJ4A 5I17A 1TZHB 3SDXA 3PGDB 5IQ9A 1ACYH 1FRGL 1P1ZB 3RDTC 3C5ZA 1HXYB 4Z5RA 3QO0B 2OL3B 1ZE3C 4NRZA 4ZFOB 1N5YH 4C58B 3QA3B 1H8SA 4NHUA 4LEOB 4Y19B 3B3IB 4QWWD 5FYKE 3T65B 3KJ4B 1VEOA 3V0WH 4EOWH 2XQYK 4OLXH 3MCLL 3GSWA 1DQMH 1NCDL 1CL7H 3G6JB 1G6RA 4QGYA 5CZXC 5C0AE 5I1JH 5FXCH 4B7IA 4JHWL 4K23H 4PRHE 1FVCB 1EHLL 4RQQB 4AH2B 1WT5C 4R7DA 5BV7B 4WFEE 1J8HE 4LVEA 2JK5A 5D2LF 1YEEH 4NWTL 3LKNA 2APVA 3FRUB 3EOAB 4BFEA 1PG7L 2O61B 3ZYIA 1Q1JH 4NKIL 4KWUA 2CD0A 5FCSH 4M7JH 2HYMA 4D9RE 1S9XB 5IBLD 5DMGD 1YEGH 4HK3J 1OTUD 1BJ1H 4UV7L 4XP5H 3TA3A 3FO9B 2FSEA 3ARSA 4OKVA 3H9HB 3KR3L 1EBAA 4DW2L 4MJIB 1I9IL 2YEZB 3UP1A 2OQJA 3DGGB 4KJQD 3VXTB 2LV4A 4MQ7B 1XT5A 2GJZB 2Z8WC 1CT8B 3MRIA 5DZNA 5CHNB 4G43A 2EE6A 2Y72A 2YBRA 3T04D 2I60L 4UZGA 4GAFB 1XIWA 3OAZK 4I3SH 3CVIL 1RI8A 1LK3L 1YYLL 4U1LA 2NPLX 3BEVA 3O41B 4AJ0A 1PGRB 2QADB 4JFED 4HJ0D 1JPSL 2FX7L 3V52L 3KPRD 4KXZI 3B9KB 1H3UA 3ORJA 3ARFB 3BP4B 2DL9A 25C8H 4RGMB 3TIDB 1IKNC 1MH5A 1KB5A 2YPKA 2DMKA 2EYRA 4M6ML 3MBEC 1G9NC 3TBTB 5KBNC 2W65B 3BD3A 4LCIH 1F97A 5I6XB 5L2KA 5FUCE 2NXYC 3MV8B 3B8SA 1OWRM 1KPRB 4GBXA 1EX0A 2NTSP 1B88A 5DMYA 5DJ2B 1CICD 1A7PL 3BP5A 1MREL 3LRGA 4ZFFA 4GRLD 4F9LC 2A77L 3MXWH 1BVKB 4XMPH 3PNWB 2WBJD 1JBJA 1KPUB 1OAQH 1VGEH 2F58H 4YE4L 4YX2H 3T0BA 1DQJB 5IBTL 4K8RC 4UUJB 2G75B 3MRKB 1UM4H 1RK0B 5JXED 3AM8A 3QPXL 4XP4H 3PWUA 3UZVB 4CU7A 5HHNB 4HUUA 5EPMA 4JJHA 1FVEA 3HUJB 3PQYE 1GCFA 2H32H 3UYRH 3MRJA 5JXAH 4FFYL 3TN0B 2P5ED 1D6EA 4AENA 5GGVH 5KZCB 3WUWG 3ULUC 4PJ7E 4ONHB 3VA2C 3O4LD 3ELAT 5CINL 5C9JA 2OXGA 4RAHA 4UDUA 2E7BA 4XNQB 2DQCL 1U8LA 1KIUA 2I9TA 1A4JB 4XXDA 2B0SL 2J8UB 3OR6B 3OXRA 1GGBL 3S37X 2BVQA 1ZA3A 3QCVL 2R4RH 1C7TA 5CZXD 1T83C 1QRNE 3IETB 3K7UA 3PHOA 5DS8A 3V5DA 4XWGH 1LP9F 1NMCC 1OGAA 4ONGL 2IQ9L 1BF2A 2IPUG 4WFFE 3K80A 1JHKL 4NQDB 2RR3A 1I7ZA 1H3VA 3QULB 2OM5A 3O8XC 3I02B 5SWZD 2HRLA 4N68A 5KSVB 4X9FA 5F97E 3WFZA 4HKJA 4P23A 4PJBE 4NO3B 4KRPB 2R29L 1I7RA 1H5BA 1JP5A 1NL0L 4ZG1A 1QVOA 3MCKB 3N1QC 4BFIB 1XGUB 3AU1B 2FJHA 1DVFC 4Y1AE 5C0DB 5IB5B 2BCKA 4Y4FC 1D9KC 1R3HA 3ZDYE 4RA0C 1IILE 5D1QC 2FHFA 5KVGL 2NY5L 3VG0L 2DWDA 4L5FL 4OGYL 4HG4J 3O6FA 1F4XH 1A0QH 3QEQE 5EORH 4OFYA 1H0DB 5HHOE 2A9NH 4EI6B 2BNUB 4XP6L 2AJSH 4Z0BH 3TBWA 5FCUL 5JPMA 3SDDC 5IW6B 5C0IB 4ZFOL 4NCDA 2IBGA 2Y06H 1I4FB 4RGNE 4HK0A 1EPFA 1L0YA 3RIFF 1JZ4A 4OI8A 1H15A 4MDJA 4L9LA 2WV3A 3RWHB 4PJCE 3LKOB 1KJ3H 5IB3A 3D3VB 1T0PB 5DRXA 4JM4L 1IGMH 1MF2L 2FJGB 1IVLA 4HF5H 3BPLB 3LQAH 3T0EB 4QHNB 4GG6E 3MNVB 3VFGL 3MBED 2W9DL 5J4MA 2R0WH 1FYTA 2VXQL 3RHWF 5GS2H 3EBAA 2NXYD 1JV5A 4D3CL 2RFXB 4RFNB 1VSCA 1YNTB 3ZE2F 1QBML 4PD4K 2PYED 4BYHA 1YEJL 3MJ7A 4IM8A 3SKNA 3VFRA 1AKJB 2HRPH 3QEHA 3RTQB 1CU4H 3NFSL 3VWKA 3MOBL 1CGVA 2FCBA 4WUUE 3L7EA 4XI5C 3UTZB 5J1AA 4D8PA 1J5OH 3BYYA 5IJVA 3X13A 5BCAA 1XR9B 4K8RD 4K3HA 5BVJB 4I13B 1EXUA 3VA6A 1IAII 2XWTB 1D5MA 1U36A 2VIRA 4K94H 2C5DC 3VGBA 5JW4M 3RWDB 3EOBA 2M26A 4C59B 4BQCA 3PWLA 1RZIB 4G3YL 4W4OC 4XHJC 3SGJC 4ORGB 1G7LB 4PY7B 4FQ1L 4NNYB 2OLDA 4G6ML 3SOBL 1ONQA 4OZHF 1MCCA 4KI5E 2ZOKA 4RMWA 5HVHB 1NC2B 4NQEE 1YA5A 5F3BA 3FFCE 5FFLA 5ISZA 4OB5L 1KG0A 4V1DA 3ULUD 4G9FD 5C08E 1BWMA 4P2OA 2VE6A 3DV4A 4F7TA 2MPAL 2HH0L 2D9CA 1FNGB 3KDMB 2VLKB 3FO2A 4KRMB 3T2PA 1EZVX 5FM8A 1SMOA 1J1XL 3S88H 2MQCA 4P2CG 1NFDB 1FNAA 5E1AB 4RRPA 4OIBA 1BJMA 4R96B 5J6GB 1RJYA 2ICWB 3PABA 4KVCH 3NA9H 4O5LH 1BJ8A 3QDGE 3G5VA 5D2NC 1EUUA 1AXTH 3B5HA 2BX5A 3RZWA 2EDBA 4RWYL 1FSKB 2DIJA 5TDPA 3ULVH 2XKUA 3MUJA 4NQSB 5C0CD 3O8XD 1VENA 1JGLH 2C4FU 3SE3C 1RJZA 5LGKA 4OLZH 3MLYL 1HQRA 4F7CB 3PHQA 4JRYD 2NR6C 4RX4D 3TNMA 5IIEA 5C0AA 4NGHH 4A6YA 2DLGA 4TSBL 3F5WB 4YXLH 5DDHA 4PRHA 1BHGA 3DXAE 1AY1L 2Y25A 1DVFD 2QJDA 5MI0B 3Q5TA 1TIUA 5KANG 4Y4FD 3RZCC 1D9KD 2CLZB 4MA3B 4P46A 4YEFA 5FO8A 5KJRL 1J8HA 3MV7B 2WWKT 4JDZB 3TYGL 5T1MA 2AJ3B 5D1QD 1YNKL 2C4FT 5I1EL 2YD9A 3CCHB 4PY8I 3CLFL 4GXUM 3AS0A 3IT8D 4BA8A 2IFFL 1FGNH 1DR9A 1FNFA 3DX9A 4L8DA 3WFBL 1DDHA 4H0GA 5I66A 1AO7B 5I15L 3RIAK 5CEXA 3AB0C 2BNQD 3PP3K 3OTTA 5CIPB 2OZ4A 3MRMA 2HA1A 2Y36H 1IGTB 1FH5L 1M6OA 1A3RH 4FABL 1C5CH 4QRQB 3SKMA 4TUJB 1ZA6A 1U91B 3LHPL 3UTTB 3NCMA 1DL7H 1QBAA 3WO4B 1Q9KB 1RFDL 2HJLB 1LD9B 2EIZB 3TO2A 3OJMB 4UV4H 4LASH 4GSDL 3GMRA 3C5ZC 3D85D 1CGXA 5E24E 3QIUC 4MWFA 4GRWH 2R1WB 1ODAA 1IAKB 3RNQB 1AP2A 1KJMB 4GG8B 4WGWB 3BOVA 4ISVB 3MRNB 3S6CA 4LGPB 3WFDH 4KAQL 4P3CL 3F58H 4MNGE 5BZWB 3SPVB 5IF0A 2W59A 4Y4HB 15C8H 2DQJL 3GSUA 4WI3A 4S0SD 3K8LA 1INDL 2F8OA 4XI5D 4QLRA 5D7KD 5F6IB 4OLYL 2I24N 1MCIA 3F7VB 4MNQB 2QQNL 2EH8H 4PGBA 3UCRA 3HKFA 4UU9B 4QY8B 1U95B 4HKXA 2CDGA 5CD5C 3CX2A 4OM1L 4U7MA 5C70A 1PYWA 5T5FL 1BEYL 2ED7A 1KCVH 3OGCB 1OP9A 1YQVL 4KKCD 4GKZA 1GYAA 1KEGH 4F7MB 1R5IB 5GIRB 4GUPB 3H7BB 1FGVL 5D2LE 4S1SL 4XHJD 5F1SA 5FYJE 2CRYA 3BPNB 1KCUL 3BIKB 5EZIH 4K3EL 3MRHB 4GW1A 5INDA 5I16A 1A6AB 1BLNB 2F53B 3VFPA 5EO9B 4EUPH 2A9MH 3TH3T 1Z0MA 2VZ1A 3P40A 1HN1A 4Z7VB 4YHYC 3GMNB 4H25B 3LPGA 2DQEH 5HY9B 3PQYA 4XBEH 5HHVL 2J4WH 1XIWC 4M1DL 4Q9CA 3QG6B 1U8JA 1ND0B 4C83B 1FFPB 1P5UA 4RAVA 5DK2B 3GSXB 2X4UA 2X6MA 4X6FB 5BS0E 2AEQH 2DWEB 5EWIL 1WFNA 4PJ7A 3F7YB 1WBXB 3DURB 1IM3A 3CDFA 1CDGA 4PJ5E 5IWLC 5HHXL 2X4RA 4G8EA 1A6ZB 1HQ4B 3MYJA 2NR6D 1QRNA 4MA8H 4FN0A 4HCRA 2BSTB 3LAFA 2Z92A 5T1DL 2XI9A 1MCPH 2W91A 1F3DH 4X7EC 3RZCD 3RNKA 5IMMA 2EDYA 2FLRT 3OSKA 4XRCB 3EGSA 4N0RA 3A67L 4O4YH 1S7QB 2D0FA 1JIBA 4L3EB 4H26A 5IVXF 2Q8AH 4P2QB 1J0KA 1HCVA 3MNWA 3TBYA 4PJBA 5GGSB 2BC4A 2XT1B 5FV2A 3NAAH 5LJYH 3MRRB 1XH3B 4U2ZA 1CDUA 5KSBE 2DLHA 3VGAB 4Y1AA 1UEMA 2J8OA 3HRZA 1ZLSL 4C55A 3BEWB 1MVUA 4RWHA 3AM8C 3C8DA 3ARXA 3O3DB 5KW9L 4FOMA 1BIIA 4G6FB 4N8VB 2H45A 3NGBC 1J1PH 4W6YB 5IW3A 3ZSTA 2IMMA 3OHXA 3QWRD 3BWAB 4U6VL 2I27N 3GSOA 3VFNA 3JWDH 3UC0L 3QEQA 5EBLA 3RFZC 5DGQA 2AI0H 3RVXC 3S9DB 5HHOA 1OLZA 3H3PH 2AXHA 3E3QE 4HXAL 3C5ZD 2GSGB 5C8JA 1FVDB 4NC2B 3QIUD 4Z76B 2PW2B 5D6DA 1O0VA 2GT9A 1UACL 3ZL4L 1K8DB 5C0EB 3PL6C 3WLBA 1ZT4A 3QEGH 2B1HL 4I3RL 3TNNA 4Y0GA 1JGDA 1RY7B 4ZS7L 4PJCA 4GQPH 3ARBA 4NSKA 1KNOB 5DJ0B 4GG6A 4LSVH 4JAMB 1YMHA 4ZUWB 4YDKH 2H26A 4LVOB 3VXUB 3RU8H 4YO0B 1A7NH 4R90H 3CXHJ 5CD5D 2X89A 3H3BC 4OLVL 1CVRA 1UC6A 2OJZL 4YDIL 1IC1A 4MCZB 2DQGL 1MHEA 1A1OA 1KN2H 3DX7A 2QSVA 4M3JA 2IQAA 2Q6WA 4DJMA 1C5BL 5EULV 3OB0K 5B8CA 4MA1C 2W9EH 1AD9B 5DHVH 2A0LC 4L4VD 4WUUA 3PV6A 3DSNA 4IJ3B 2L7JA 5TF1H 1H5BC 2CXGA 1OPGL 1MRDH 1FORH 2ZJSH 3V6FB 2YD3A 2QHRL 1EFQA 1A7OL 2IC2A 4IDLA 3TZVA 1G1CA 4HWNA 1T7WA 5E00A 1P2CA 1IAOA 1HHIA 2FRGP 4L4TE 3MRDB 3HAEB 3FQTB 3P77A 2X5PA 3RL2B 4HX1A 4NWUH 4Y16B 1T6VN 1TVHB 3GDBA 4WI2A 1T1YB 2KQMA 4HWUA 2BY1A 3CZFB 2X4OB 2YD1A 5T5NF 1G9ML 1KCSH 4CJ0A 1XIWD 2IPKA 4OQTL 5B21A 1TPXC 3F6IA 4GMSL 2VYRE 1J0ZA 3N9GL 3L5XH 3G6JF 1NGZA 4NQEA 4HUMB 4X6BB 5DA0B 3FFCA 5EU7E 1ZAGA 2H2SC 1EMTH 4YHOH 1SEBB 4H5SA 2VLRB 3LKQB 3L3HB 5C08A 2I07A 3EYVB 1JJUA 2HFGL 5ENWA 5GS2D 5FKAA 4L9LC 5D5ME 4MYWB 2XZAL 1BM3H 4E42B 5ITFA 1S7XB 1GPOL 5IGXH 4EN3A 4PRPE 4C56E 2VXTL 4R2GB 5I74B 4PJDF 3G04A 1MFCH 1OD9A 4POZC 3P9MA 4AMKL 3DYMA 4HUWB 1KTLA 4HGWB 1JZ8A 2Q76B 3QDGA 3T09A 1R5VA 1UJ3B 2LVEA 1HH9A 3ET9F 2X1XR 2VC2L 2CO6B 4NDMA 3GMPA 1PKOA 1FIGH 2B5IB 2PO6B 3QJFA 1JFQL 3UTOA 3VXSB 3FRPA 1D5BA 2EDWA 3UEZA 1FAIH 1X5KA 5SWQA 4X6CE 4FFZH 2YWYA 5ID1A 5T33L 4JY4A 5CD3A 3NCFB 5F88B 5DD1L 3SDYL 3G5XB 1JPFA 1TTGA 3BZ4A 4KTDH 4P9MH 1OF2A 4Y2DB 5IB4B 3PWNA 5CEYB 3HC4L 5E6ZA 1IC4L 3DXAA 2GHWB 1UA6H 2XZCL 3E8UH 1AE6H 1NFKA 4JO1H 1XF5B 1CG9B 2WAHA 1OD7A 2B4CH 3LEVH 3DRTB 4I0CC 4U1MB 2EDDA 1JGUL 3BQUC 1INQB 4Y2OA 3TPUB 3UPRB 4HKZB 2P5WB 5E8DH 4M61A 1LQSR 2WUCL 1ZVYA 5CSBA 3RVXD 5HYJB 5HGHB 4D94A 3JWOL 1ADQH 4LVNC 4MQSB 2IPTH 3PL6D 1CZ8H 4S10A 4EI5B 1A9EB 3TM6A 2PUQT 3CFBB 5I1GH 5DEGA 1KOAA 3BSZH 4CN4A 1SVCP 4PB9H 3VFUB 4TVPD 1NAKL 2GAZA 4PJ9B 3VI3F 4R9HA 2O5XH 3RX7A 3C60B 5D7JB 4ZYKA 5CUSL 4S1QL 3S4SG 5GS0C 5JHDD 2H1PL 4K71C 1OGAD 2QQLH 5J11B 3VI4F 2YPLE 1RMFH 2Z8VC 4G7YH 5FKPA 2HKFL 4MNGA 1PG7W 2DKSA 4DKDC 4WJ5B 4ZAKB 1IEBB 4JQXC 5EU6E 3GUTA 2A0LD 4EQ2A 4GKOA 3HUJF 1F8TL 5DVLA 2O5ZH 3GSQA 4K2UH 3LH2H 3MACH 3MJ9L 3CMOL 4ZUUA 5D1XB 3MJGX 1A4KA 2DBJA 4PJGB 5ERWA 4P46C 2Q86B 1KLUA 4L8SB 5EC1B 1UVQA 2V5YA 1A6UH 1NGWA 3IRZA 4R26H 3TIEA 3C5JA 4KK8C 2KKQA 1B0RB 2I9LA 3EZJB 2FATH 1EHXA 4QRRB 5JW4N 3K3QA 4HJJH 4JJ5B 2NY1C 3BAEH 3PV7A 3U9PL 1XF3A 5D2LA 5HJ3A 4FZ8L 1KUMA 5LWYH 1W72H 2XRAL 4XPHH 3OZ9L 5L88H 3JWDC 4RFEA 1MLCA 2J8UF 4PJHB 3RPIA 2A83B 3H9SD 3S3PA 4YBHA 1T2QH 2DJ4A 1SY6A 1WCBA 2PW1A 3MRBA 2H2SD 4UILH 2KPNA 4P3DB 5C7XL 4MMZC 3LMJH 3D0VA 1QFWL 4JVWA 2PYFB 1EJ6A 2FO4A 1ZLUH 3OJDA 1NAMB 4HBCH 1H3XA 1UB6B 4POZD 2CSPA 3G9VA 3HZKA 3OQ3B 1JI2A 1YMMB 1ZWIB 1KEMH 1CD1A 1FYTD 4PGDA 4X7FC 1IGFL 4M5YL 3LKSB 4Q9QL 1BD2E 5IEKB 5BS0A 3NABH 1FO0H 2V2TB 5DO2C 2FHBA 2LU7A 3C2AL 1WZ1L 2CXKA 3ECBB 1IZKA 4P5TA 4YBLC 4YWGL 5E2TH 5LVEA 1FCGA 2WP3T 1T0NB 4YLQT 5EOTA 1ZHLB 4PJ5A 4Q6YA 1HZHL 1Q8MA 4Z78B 2F5AH 5GGRA 5DFTA 1G7HB 4JO2H 2XN9E 3FOMB 4A2MA 3QP3A 3HAEG 4MZ2A 3UYPA 1T22B 1KELL 5FUCC 1S7TA 1KT2A 2XTJB 2OP4L 3ROLA 4LDEB 3P30L 1PKQE 2VISB 4OFPA 3IFPB 4RMSA 4PRDB 3UDWA 3OKMA 3L1OH 4PV8B 2GK0A 1VKXA 1QLEH 3BQUD 3O45A 1HCFX 4H20H 4GXUN 1FFOA 2DQIL 1P7QA 1N2RB 3GSVA 1T5XB 5FGBA 1BVLA 2UY6A 3RIFK 3DUSA 1ULVA 3U83A 1A1NA 3ARTA 5KSBA 4LLUB 5J1TC 1CR9H 1IGCL 1I9RL 1YEKL 1DQDL 4N90E 1TCMA 2AJUH 2ITDB 1CD9B 3AMKA 3CLEL 1GGIL 5C2UB 5ISZD 4MJ2A 4Z8FH 4M48L 5DRZB 1XZ0B 3Q3GB 5IUSA 2SEBA 3GRWL 5F3HA 2APXA 2CKBB 4JKLA 5HD8C 3RHWK 8FABB 2NXZB 3T8XB 5I8KH 3S8WA 5GGRY 5DD0H 5EUKA 2EC8A 3IU4H 4AEIL 4WU5A 3AUVA 3MLSL 2VDOH 2KZ1B 3QG7L 1S7RA 5LGHH 3GJFK 3DO7A 5F89B 4R0LA 2CK2A 5I19L 4PJFB 5DJYA 4M7LT 3IVKA 1MLBB 2OXHA 3ZMRA 2XPGA 5ALBL 4OZGB 3W2DL 2R8SH 4QHUA 4MD4A 2HWZL 5FYKD 3QHFH 4F80A 4M3KB 4PV9B 3BDYL 4U1IA 1OGTA 2V9RA 5L0QC 2OI9B 5GPRA 1X4XA 3GMMB 2DL2A 5GGTA 5SV3A 3SE8H 5C0AD 4LKCB 1F4YL 1MQKH 5CWSA 1DSFH 4PRHD 5ILTL 4PRID 3G6DH 3QDJE 4KJYB 1W8NA 2BY0A 4P46D 3UJTH 1RZFH 2NX5E 4IRJA 3CFJA 4PR5B 2ZCHH 4P9HC 4Y5XA 1DBJH 2ICWJ 5JO5A 1U8PA 2AW2A 4JZNB 4KK8D 2O93L 5DXWA 5D7IE 3KPOA 3TBSB 2R1XA 3SGDH 3NOIA 2NY1D 4D0BB 3BZEA 5FO9A 4YZFE 2X1WL 2W1NA 4LHUD 4D9RD 4WO4C 1E27B 3VXRB 3INUH 4D9LL 1NFDF 3M17A 2FD6L 1S8DB 5HYQB 4OZFH 4F58L 4KKLC 3MZTA 1ZGLB 1B0GA 1SJEB 4L4TA 1A9BA 1C1EL 3RAJH 2J1KA 3O9WA 1EO5A 3DTXB 3VXOB 5IFAH 4HPOL 2F9BT 1AGCA 1GGCL 1MJJB 4J4PA 2X7LB 2ZNWA 4U49A 4FXKA 3W0WB 2XXMB 4F37K 1I1YA 1A64A 2NYYC 6CGTA 5FK9A 1OOAA 1IFHL 5ADPH 1LO2L 1ZVSA 3KS0J 3P0YH 4F57H 2BJMH 5D6DC 3VGGA 3ZKXC 1KLFA 1EEZB 4ODHH 3FQXA 5DMIH 4F3FB 1GZQB 5KOVC 5AZEH 4Q97A 1CFTA 3O0RH 4NO5B 5DO2D 1JUFA 1FCCA 4LLDA 4S2SB 3MZGB 4IHOB 2W0FA 3ILPB 4FQQB 1SJHB 5D5MA 4HV8B 1OM3H 3LN4B 4JKPH 3OPZL 4P4RB 4S1RL 4JFZH 4PRPA 4C56A 2XKNB 4XH2A 5F7WC 1NFIB 2OSLA 3O4OB 5H37G 5D6CB 4YGVA 3HR5A 4UINL 5LXGL 4U6HA 4YFLI 1FNEB 5ANMB 1J88A 1MHCB 5B4MC 4K9EH 1MCLA 3P11L 4LFHG 4X4ME 4HQQL 4KGJA 1I1FA 3ILQC 3QDME 5I1IL 4WI7A 3S3SA 4BK4A 5B8CC 4X6CA 3REWB 5E99L 1CE6A 4KVNH 4GMTH 1OARL 3RPKA 3RWGB 2H32B 2H6PB 5D7SL 5GSVA 2NW3A 3GJFA 1Y0LB 2X4QA 5GJSH 3IDGB 2BOCA 3TZVC 3H9ZA 4H1LB 5E95B 4KQ3H 2G60L 4HPYL 4F8QA 1IGJB 3SO3B 1M7DA 3GBNL 4GS7B 5DD5H 4OCNC 3HZYB 5I1LA 4LVHB 3GMQB 1DLHB 2Z93B 3CFEA 4JFOA 4IIQA 2K7QA 5HD8D 2CJUL 4OV5B 1NANH 1NCCL 3GSRA 2QSCL 3IS1X 4KI5C 4WI4A 4OD2B 2D03H 2YZ8A 5E2VH 2M1KA 4H8WL 2Z4QA 1FZKA 4X6DE 4OCSH 3G6JE 4HIXL 1MRCH 5EU4A 3QI9B 4M7ZC 1AFVH 3PWJA 3VW3H 2AS5M 4EN3C 1S9VB 1C16B 2N7BA 4MDIB 2G2RA 2NY0B 2R39A 4I2XB 4OTXL 3GNML 1DN2A 2VLME 4YPGB 4CN6A 2YMXH 4DFHA 1UWGL 4H0IA 5JMRA 1QRND 5HVWA 4PJDE 4P48A 4XMLH 4XVSH 4PG9A 3AGVA 4QHKI 2EO1A 2B8OT 2R23B 4I77L 4Q2ZB 1G0XA 4WFFD 3KPQA 2E6PA 2YPLA 5MEOA 4O9HH 2LU4A 4LRNH 4P3WA 5E8PA 4X7TB 5IW1B 1OP5H 4M02A 3IF1B 1TJHH 2E3VA 1VADB 2VDMH 1XGPB 4Z7VF 5ITBH 5EU6A 5BQ7A 2ZUUA 3O2WH 2CIKB 1IAIM 4BSVB 3QRGL 4P59H 1JHLL 5LBSL 3IXTA 4WO4D 5EUOB 4KMQA 4Y1AD 4WW1B 4CADA 3TH4T 1C5DA 2MCPH 1DBMH 2R69H 4KKLD 2VLLA 4K7FA 2VAJA 4X7SH 5TGBB 1A3LL 1DQLH 2ADJA 4CL7A 4X5XB 3DGCR 4P57A 4Z7UB 3GM8A 3KLHC 2E7MA 2CKBL 2ZUWA 2V2XB 4HWZB 3ZE0F 1ZKAA 1Y6NR 3QEQD 4IRSB 4K7PH 3FZUC 5GSRA 4TN9A 3DVNA 5F9WB 2NYYD 4HC1H 5ETUB 3OL2A 1YN6B 1CXIA 1NBYA 3IDJB 3MBXL 5EZJB 4JO3L 3CPLA 2FEEI 5CP3H 1BX2A 4GW4A 4BJLA 5CLTA 1MHPL 4X8JA 4XP9L 5B38A 3GKWH 4OBSA 1NCAH 3E2HB 3NZHH 5DC9B 5IB2A 3GHEH 4P2RE 5E70A 4XP1H 5D7LE 3BKMH 3FT3B 4M7JL 1R3LB 5CJOL 5INCA 1AXSA 1FDLH 4UIMB 1T1XA 3VI3E 1IMHC 3DX6B 3CUPB 1BD2A 2C9AA 4ONFL 2VQ1B 2OK0H 5B4MD 3FFDA 2X89D 3PGFL 1PJ9A 3MRCA 1M05A 1T0MB 4UTAL 4YK4C 3IKKA 4KJPD 3ILQD 4MQXD 4DVBB 4XVJH 3VI4E 5EFIB 1JNLL 1JWSA 2GYSA 2XWJA 3QNXA 4CW1A 1KJ2H 3EO0B 3GM0A 3PGCA 2XN9A 1SBSH 4B5EA 1VFBB 3GMLA 3KPSD 3TZVD 1NSNH 4PREA 3HUJE 4ZSOB 5EU5A 2VLJB 1PKQA 3MGTB 4MJ5B 4NZTL 2HN7A 3V79C 5ESAA 4EJ1C 1DLFH 5F1NA 1AR1D 3IS0X 5LCVL 3QNZB 5TE4H 3RVVC 3JTSA 4S1DC 5DI8B 3WKML 3L5WA 1MCQA 4NC0B 1ZHBA 4YHPB 4PP2B 4KI5D 4QCIB 1JK8A 3BIAX 4M6OL 3PWPB 1MWAH 5GRUH 1N26A 1FL3A 3FFCD 3U7YH 4HJGB 1IGIH 5ESVB 1T04B 4G8IA 1MFBL 1RSFA 2X4NB 4P5MB 4LIQE 1NMAH 1URLA 1QFHA 3GBLA 2IPUK 1FG2B 2VZUA 4ODVL 4FZEH 4WUKH 3IDXL 3J7HA 3EHBC 1BVZA 4EN3D 5ADOL 2UUDK 4ODUB 4XC3L 5GS1C 3OB8A 4B0MM 2XQBL 3MLZL 4PRBA 2N4IA 3RJQB 3I3DA 4XAKD 3QXTA 3C6LA 1BFVL 4ELKB 4EDWH 3EYSH 4LAQL 1OAZH 3F65A 3FQNA 3QDGD 3QFJE 3MA7A 4QXUL 1Q0YH 3GI9H 5L7XL 1QO3B 2R56L 1SM3H 1I1AA 1JPTH 3VFOB 4P5TC 1I9JH 1HEZA 1EAPA 3QHZH 4FNLH 4J1UA 1B2WL 8CGTA 1J1OL 1T21A 3CXHK 5C6TH 4NUGL 4HW6A 4Z0XA 2ZUVA 4HS6A 1P4LA 2WINB 3UO1H 1R3KB 3LRSB 4LQ1A 4HIHA 3QFDA 3X14B 4JY5H 2IAMA 4NP4L 3JV6B 1MFEL 2NMSA 4WFHE 4ZTPH 2LVCA 3BD5A 4G6JH 4PYGA 3QUMA 4AIZB 1XR8A 3DXAD 4I1NB 3SQOH 1QLFA 3QDJA 1LDPL 1N5AB 2DMBA 4HZAA 2NX5A 5ACZB 2RBLA 3UDWC 4UAOC 3P4MA 5CILH 1ZMYA 3MREA 5D7IA 2EKSB 3KLHD 3U6RB 1RIVL 3DLQR 1AGEB 5FGBC 1A22B 4NN6C 4YXKH 3GSNA 4R97B 4UI2A 4BQ6A 3FZUD 2YC1B 2A73B 3MLTB 3SDAA 4GRWB 3X12A 5DURB 3SGKA 3OKLA 4DKEH 1X4YA 1NC4A 4KPHL 4XWGL 1K5NB 1A47A 1M71A 4R3SA 4HD9A 1RUQL 4OCXH 4I4WB 4PPTA 3RWJB 1T7ZA 5TE7L 2NW2B 3SJVB 5IMLB 3R8QA 3CNKA 2CDFB 2H9GA 3E3QC 5I0ZA 1JRHH 2IH3B 2EDJA 3D39E 5F21B 1QEWB 4NJ9L 1RHHB 3LD8C 3WJLA 4JQVA 4WIQA 3WUWA 1FRGH 4QHMB 2R2CA 4X98B 1BZ9B 1JZ7A 1UG9A 3ES6A 4HS3A 2F5BL 3L6FA 4I5BA 3FQUA 5E8NA 1NJ9A 3KPLB 4NQVA 5T1KD 2BVYA 4XPFL 1Z5LB 3WL9A 2BOBA 4ETQB 1NCDH 1MI5D 2AJSL 1LNUA 4PS4L 4EUPB 4HGKC 4IRJC 5IKCA 4JHWH 4Y5XC 4X4MA 1TETL 5C3TA 3X11A 1BMGA 1EHLH 3ROOB 3WS3B 1IKFL 3QDMA 5FYLE 2D3VA 5IOPA 4E5XA 2ZKHL 3U4AA 3S96A 1T5WB 5ICZA 3RVVD 1JTTA 4NWTH 1NH6A 4S1DD 2ADGB 5EBWB 4UQ3B 1FZOB 4HF5L 1PG7H 3UZQA 1KF9B 3BXNA 2QTEA 2Y7QA 2P43B 3OKOA 1QTYT 4JHAL 3MUY1 1EVUA 4NKIH 3TWCH 3CK0L 5FGCB 5HSFA 4U1KB 3EJJX 4G8GE 5HVGB 5MHSD 4UV7H 3O9WC 1IEHA 4XB8A 4DW2H 1I9IH 4HUKB 3L3JA 4J4PC 5I2IA 1Z6JT 3EHBD 3ZTNH 3I3EA 4IMKA 3VCLB 1QSEB 5LG1A 4DTGL 1REIA 1DUZA 4WWKB 4LEOA 5DVNA 4ZXBB 2KL6A 3BKCL 5EU7C 3HE7C 3LPWA 3DPBA 1LEIA 3CVIH 5J0BA 4RIRA 1LK3H 4X6DA 4P5TD 4TTDC 3G6JA 1YYLH 4PJGF 2AXFB 1AIFA 1LE5A 1K9TA 1J0HA 2DLFL 4PJ5D 1HHKA 3V52H 4AH2A 2YK1L 4LF3A 4U6XB 1T2XA 5KN5A 6FABL 1D7FA 5J9PA 4PJDA 4FQHB 4XGZA 1IEAB 1U41A 3EOAA 1GC1L 4JGUA 2ED8A 1MUJB 4PJHF 5I8EA 4HT1L 5FYKU 4PGCB 3N1FC 1AO7E 4POUB 3FMGL 2VR4A 5BXFB 3IDIB 3F7QA 3VH8G 2CK0L 2GSIB 2PTUA 1YUHB 1V8HA 3ALWA 1AD0B 5C86A 1HI6B 3DGGA 3NA9L 3WIHA 3VXTA 1CFNA 2NY2C 4MD5A 5KSAA 3RKDC 1I85C 2FB4L 4HIJB 5IBTH 4Z7WB 2ICCA 2YA0A 1X5AA 1RULL 1R3JA 4LLWB 4CBPA 2UWEB 2YKLL 2AVGA 2CQVA 2AEIT 1I3VA 3U4EB 4KMLB 2ZCLL 3QPXH 3LDBB 4CNIB 4YDJA 4PGEA 2ESVD 3IJHB 3KNBA 4MNHA 4ZPTA 4M9PA 4PJ8B 2W0PA 4KDVA 4X7DC 1D5ZA 3ALXA 4M5ZH 1XCTA 2HLFC 3B9KA 4NFCA 4JFQA 3ZT7A 1OSZB 4FFYH 3RUGB 3GI8H 3QUZB 1DN0A 3TIDA 2EEBA 4JG0L 3UMTA 1RUKL 1IE5A 4B50A 4UDTB 1CDJA 2GITA 5EC2A 1RJCA 2JB5L 3VFTA 5CINH 5DHVB 5TDNA 1UQSB 1KIRA 2CDEA 5DHYB 9CGTA 4HHAA 4P2RA 5TE6L 1U3ZA 2DQCH 5DEFA 5D7LA 1T4KB 1PX3A 3ZYJA 2B0SH 3M07A 2Z91A 1GGBH 2WIIA 4FQ2L 4ODTL 3C5SB 2RGSA 2RCSH 2EKJA 4QRSA 4IRJD 1XGQB 4JFDB 4R4FL 2XFXA 4APQC 3DUUB 1QHOA 4FFWC 3VDCA 4ONGH 1AQKL 1DQJA 2IQ9H 4KV5E 3A6BL 2D7TL 3S97C 1JHKH 4LARH 5GRYA 2F53E 1MCWW 1JNNL 2HFFB 3CFDA 5C09B 2FWOB 3MRKA 4I18B 1V5JA 3CD4A 2OTUB 1UXWA 3T1FB 3VRLF 5ACMA 2KQNA 2R29H 1F6AA 4FQIL 4HDIB 1NL0H 3HUJA 4U7SA 3TFKC 5B39B 2UUDH 4RAUB 4L4TD 3QAZB 3FB6A 1ES0B 4PJFF 1I8MB 4LNVA 4YHLL 4J4PD 1LEGA 5FDWB 4YHNB 4YNYA 5KVGH 2NY5H 5DK0A 5J12C 3VG0H 1WZMA 2E7CA 4L5FH 4OGYH 2DN7A 2ZPKL 5F9AC 4LPUA 5GGQL 3UJJL 4BQBA 2ARJQ 3HE7D 4XP6H 3TO4B 1RAMA 3QUXA 4AT6B 5FCUH 1YN7B 4GO6B 4WNQB 1GH7A 2X9XA 4CDHA 4TTDD 3ZE1F 5DYOB 1RURL 5E7BA 1RZ8B 1BECA 2Q7YA 1GJIA 1KENL 5AUMA 5H94A 3AC0A 4JM4H 4IS6A 1MF2H 3S5LB 5I30H 5ICXA 3BW9A 1XMWA 4N0YL 3QFJA 4L3EE 4WHTB 5DC4B 4ODWB 1IM9A 4JFFB 5DRWB 3VFGH 5KSVA 2C3VA 2A9ML 2FH8A 2W9DH 4HKBA 2FECL 1WFOA 4JPKH 2VXQH 4ELMB 1TZGL 1EEYB 4D3CH 1OAXL 5GZOC 1KXVC 1QBMH 4N9OB 5CEZD 4L8BB 3WLWC 5IB5A 3MJ8B 4HMDA 1DUYA 3SY0B 3U46B 2BP3A 1K8IB 1QSFB 3NFSH 3RDTB 2X1PA 3M1BB 4DVRL 3MOBH 1CXKA 1MCEA 3DARA 4Q9RL 4R7NB 5E8OB 3RKDD 4XZUB 4LDLB 2AEQL 2BXZA 3RVUD 4YIQA 4EI6A 4NUJB 4JFEE 2QKIB 3FB7B 3D2UA 3KPRE 1Q94B 1X6NA 4AL8L 4FQ1H 3E6HB 2X9YA 3Q6FB 4MA8L 4WTZG 1I8LA 4G6MH 3SOBH 1VA9A 1PW3A 4RSVA 2HLFD 2MKLC 1N6UA 5GGUB 2CLRA 5L2JB 3P4LA 5SWZB 3B2VL 4O4YL 4JFXB 4NN5C 1SVZA 2FNBA 2MPAH 3X3FL 2HH0H 1GZPB 2YOCA 3VXMB 3VXUE 5E6IA 1R5WA 5DFWH 3NAAL 3C6LC 1YNTA 4UQ2A 1MCOL 1PEWA 2P7TA 2V17L 4EEEA 5K9KA 4QRPD 3D39A 3H2WA 4PTTA 3RL1B 4LHUG 1WC7B 1MAKA 4LDOB 3CDYA 1ETZA 4N0FB 2YPLD 3R0NA 2D7MA 4YFEA 3UBXG 4APQD 5IMOB 4RWYH 1A7QL 4FFWD 5ID0B 4DOHE 4HULB 5EU6D 4ZDHB 2W0KA 2XWTA 3HNTL 3C9NB 4G7VL 3QWOA 4OZ4B 1SYVB 5C0BE 2CGRL 4OI9A 1X5ZA 4M03A 4OUUB 3NZ8A 5IM7A 4TSBH 2P5EE 3TFKD 2P8LA 1AY1H 1XFPA 2X4PA 4G42B 2YSSB 5EZOH 5KJRH 2IANE 3TYGH 4YUEL 1YNKH 5I1EH 4PJIF 2B2XL 1FC2D 5EDXA 2A6JA 3CLFH 4KK9C 2Z35B 4WHYH 3I9GL 3TJHC 1Q9OA 2IFFH 1EA9C 4JY6B 5FOBA 3WFBH 2D2OA 3SGKC 5I1AB 5I15H 3TGXA 2APTA 4Y5VB 3ARQA 3BGMB 5FEBA 3RU8L 4R90L 4G8GA 2R1YA 1U8NB 1KJVA 3HG1B 4FABH 3U0PB 3OG4B 2WNGA 3U1SL 3W9DA 2J2ZA 1QKZL 3JTTA 3T2NL 1G7MB 3CH1B 4PJEB 5CBAA 3LHPH 4LOUC 2FJFA 3VJ6B 2F15A 2UZIL 3SDCC 2GKIA 4UMGA 3E6FB 1V7NL 5FGSA 2XICA 2BHUA 3WJLC 1JPGA 2HVJB 3NTCL 1ORQB 1VEPA 4GSDH 1TQBC 4DGYL 2HJFA 1CLZL 3MRQB 3TVMA 4U1SA 3OF6A 2V7HA 3ZYZA 1IL1A 1Q38A 3JZ7A 4LMQE 3FOLB 5GZOD 4P3CH 3WLWD 1I7UB 1OW0A 2BNRB 2XIDA 4MA3A 1PQZA 3O2DA 2XN9D 3HPJA 1KCSL 2DQJH 1INDH 3S35X 4XCYB 2QQNH 4YHOL 4L29A 3HR6A 1AO7A 3VRIA 3HCVA 4OM1H 5J7CC 2C7UA 5HYJE 1U3HC 2FZ3B 4BSJA 2X2YA 5IEHB 3BP7A 5T5FH 4OV6F 3T2QA 4I0KA 1JE6A 3MROB 5IR1A 1MFCL 1F11A 4DGIL 1FGVH 1U91A 2NY5C 4S1SH 2JIXA 2DTML 5JA8B 1KCUH 1PSKL 2IADB 4K3EH 4N90D 5D96C 2IMNA 5GZNC 1K4CA 3P2TA 4P4KB 5DJZB 3RWCB 3MLUL 2AJYL 1FIGL 1FAIL 3S5LG 2PYEE 3FKUS 5I1HL 5IG7A 3MRPA 3RNQA 3GIVA 5LAXB 3QIBA 1X6LA 1HWGB 4ISVA 1S7SA 5MEQA 3C6LD 1WIUA 1F58L 5HHVH 2DYPA 2JJTA 3KJ4C 4M1DH 3T4AA 1U58B 2EDNA 4MSWB 2AP2A 3B9DA 2FIRT 1Q0XL 2LQRA 2IF7A 1ZXQA 4JKKA 5EWIH 2B4CL 3OV6A 3F7VA 2RJMA 4L1DA 3TYFB 2XV6B 2FR4A 3L3GA 5F9JA 1C7SA 4W70A 4LLMB 4NRXA 4JM2A 1CQKA 4QHLB 1U95A 2EYSB 5BV7C 3MUZ1 4QOKD 2JJVA 3PWVB 5JIHA 4DGVH 1GOGA 1ED3A 4ZOEA 4NO2B 5HHXH 1TITA 5FECA 3SDDB 3WXWL 3HLAB 5T1LA 4F7PA 3QDJD 1Q9LA 1BOGA 4GUPA 3BVNA 2A2QT 1N0XL 4Q6IB 5J57B 3UAJC 5T1DH 2DQTL 5J1SC 2YRZA 5E9DB 1BIHA 4G9FE 4PJHE 5HHMB 3P4OB 2F53A 3ULVF 5ICYA 3A67H 2FIKB 3H42L 4G80B 3QIWB 3AREB 3NFPB 5DWUL 3D85B 4KK9D 1HSAA 4DWHA 1EHNA 3TJHD 5KSAC 4KQ4L 3NH7L 5EBMA 3LEYL 2P48B 3DRQA 1YEFH 3LRHA 4P5KA 4KMTL 1U8MB 2ADIB 5TPWL 1ZLSH 4F33A 1F45A 1BBJB 3MR9B 3LIZL 3RWIA 3QG6A 3L3DA 1CFQB 5FYJU 5KW9H 1EUTA 4TNVF 2FX8H 4N0UB 4LSUL 5D71L 3O3AA 4UOJA 4LOUD 2QADC 5C0CE 1DBKL 2B7DT 3SDCD 2G5BA 3F7YA 4U6VH 3MLPA 3GMOB 3DURA 3UC0H 1OLLA 3B9KC 4HZLB 3OX8B 3WSQL 4U0QB 5FF6A 4RGMC 1S5IL 4HXAH 3VE0A 5DSCB 3T3MF 5HHQB 5GHWH 3STLA 5IVZB 3MO1B 2APBA 2Q3ZA 4DK3A 5CJXA 5I6XC 3SCMB 2P1YA 2B1HH 4I3RH 4XNMA 4MJ6B 2BSTA 4NO0B 2A38A 3DMMB 4WV1A 4ZS7H 1OAKH 3HTLX 1NUGA 5E94B 5L88L 3S4SA 3WO3B 4WWID 5FM5M 4L3EA 3BHBB 2JCCB 3S36L 1NDGB 3TCLB 2BNQE 4E41D 4LLVA 5JDSB 4GRWF 3I6KB 3LQZA 3QCUL 5T3XL 3QDMD 1UCBL 3D25A 3VFVB 1QLRA 2GW5A 3QQ3A 1U3HD 2V7NB 3EOTL 4OLVH 5FYJH 4ENEC 2OJZH 5F7DB 4YDIH 1U2CA 4RBPK 2EE3A 3AAZB 2DQGH 1S78C 1IC5L 3BPOB 3QUKB 3X3GL 1C5BH 3O3DA 3KS0H 4U1HB 2V2WA 3OKEB 2ARWA 3KXFB 1OPGH 3VFMB 1KEML 2J12B 5F1IA 43CAB 1XF4B 2DM3A 2QHRH 4RA3A 4U3XA 3VRLE 5HYSG 2AK4E 5CIPH 5GZND 3WEXA 1W0VA 3MSPA 5TQ2L 2ZOLB 3UTSB 1JN6A 1N59A 3KLAB 4GKNB 4GKSA 3T08A 4JFEA 3CZJA 3IXAB 3C6SA 2WUBL 5E6YA 1SEQL 4Z76A 3WS6A 4MQTB 3WIIL 3KPRA 4F8TA 4JO2L 2FL5A 4NOFA 4U4BA 4YHZL 1G7IB 4O2CB 5DJCB 1G9MH 2VITB 4NKMB 4KKBC 4PBXA 2CRZA 1I9EA 4Z7QF 3CH8A 4PG2A 2F54B 4G6KL 4EDXB 1G7QA 4XB7A 1ZHNA 2HFEB 4JAMA 2HFGH 4HIEA 5B3JF 4L3CB 4LP4A 3VXUA 1KC5L 2P8MB 3ZE1E 3HMXL 2XZAH 2VLMD 2DB8A 4WDIA 1GPOH 4GRLA 4JZJA 5HI3C 2FBOJ 2VXTH 3L5JA 3T3PF 2WBJA 4XNUH 4AMKH 2AJUL 2FX9L 3ULUL 1EEQA 5KANI 3UJIL 1AD9A 4KRPC 4ZNEE 4O2FB 4KUZL 2MWCA 3UAJD 4RISL 1QPPA 2VC2H 5IQ7L 1F3DJ 2CIIA 1JFQH 4Z95L 3SDXB 3OAUL 3C5ZB 4Z5RB 5T33H 3HAEA 3MXVL 1OB1A 3RL2A 2OYPA 1NMBL 5C0BA 3SDYH 5DUML 4AEEA 5KSAD 5K59E 2NNAA 2VZSA 2YD4A 4NHUB 4YC2C 3NFNA 1KB9J 1VESA 2P5EA 3HC4H 1NDMA 3W0WE 1ROWA 2ERJB 3CZFA 2X4OA 3ARVA 5A16A 2R8SL 2XZCH 5D2NE 3GSWB 2IANA 1DCLA 4OLWL 3QHFL 5KSUA 4EQ3A 1G6RB 3BGFB 2FHCA 2GY5A 3REVA 1JGUH 1KACB 1S5HA 1SEBA 2P8PA 3O6ML 2QADD 3LKQA 3NPZB 3EYVA 2Q20A 3L95A 1ZT7A 3BZFA 4R7DB 1I8LC 5T3ZL 2WUCH 1A2YB 4DQOL 3B9KD 1EHAA 4QTHA 3IDNA 3JWOH 3NCEB 4G6AC 3BPLC 1IAMA 2AV7A 3U0TB 5I0DA 4R4BA 4M7LL 1B90A 5MERA 4WI9A 4OZFG 3KYOA 4ODBD 1BAFL 3D9AL 3CSGA 4MAYB 1IRAY 4FXGB 1MCSA 4RMTA 3EFFA 3TA3B 5A1AA 4MS8D 4OKVB 5DK3A 1NAKH 4XBPB 2J6EA 1IAIL 3PF2A 3OBAA 2OQJB 4S1QH 5F88A 3MRIB 5JDJA 2H1PH 1BF8A 3G5XA 1HHGA 1U6AH 3RAJL 1MIMH 5TH2A 2OJEA 5F7KC 2UWEF 1WBYA 2HKFH 4ENED 1XIWB 5IHZA 2VDPL 1S78D 4CMHB 3BEVB 4KJWC 4U1MA 1KCLA 2BJML 4E0RA 1F8TH 4HKZA 3D1MC 3MJ9H 3CMOH 1B3JA 4QNPF 4KH2A 3RUGF 1MH5B 1KB5B 2A6KA 5HYJA 5HVHC 1CD8A 2EYRB 1KFAH 5K9OA 4MAUL 3V7MA 2ZUXA 1LGVA 4X9GA 3U9PH 5L2KB 4PJIE 4FZ8H 1WF5A 3WFHA 2BMKB 2GJ6B 1E0OB 3OZ9H 4NNPL 4GBXB 4KKBD 3MBEA 1ZLVK 1MCDA 3PG2A 4O58L 3WFEH 4KRNA 3MNZA 4ZFFB 4DN3L 3SE4C 1N8ZA 2PYEA 3EUUA 5C7XH 2NCMA 3B9AA 5DUPH 1QFWH 5F8RC 3W5NA 1FSKC 4ZQKA 4NQDD 5F6HJ 5GJSL 5HI3D 1ZV5A 4L4VE 4LCUA 2DMCA 2E9WA 1IEBA 4M00A 2LAGB 5I18L 4HUUB 5EPMB 4KRPD 1IGFH 4M5YH 4Q9QH 3W9EA 4L8CB 3JVGC 3C2AH 1WZ1H 5BVPL 5MI0C 3F12A 2FH6A 5D1XA 1OW0C 1F13A 2Q86A 4M7KL 1CFVL 3MRJB 4JPIA 1NCUA 2BY2A 1D6EB 4WFHD 4WU7A 2VR5A 2JLLA 4AENB 1HZHH 4U1NA 1HHHB 1B0RA 1KIQA 1G0DA 5FO7A 4FQJL 2MCG1 5E2VL 1U8IA 4IDJL 5C9JB 2ZCKL 2AJZA 1KELH 3MOQA 4OCSL 4UDUB 1U8LB 2I9TB 1Y18A 3P30H 5TFSL 4XXDB 1ZLWH 2E7LA 4G9FA 4PJHA 3OXRB 1FQ9C 2IWGA 1ZA3B 4YAQA 3D2UD 2DQHH 1E6JH 2J5LB 2YMXL 4OLUL 3PHOB 5DS8B 4OIAA 2DQIH 1V3KA 3STZA 3V5DB 4X6EA 3WO4C 1OGAB 2Y07L 1KTKE 4IRZL 1I7ZB 3D3VD 3LV3A 2MQ0A 2EDHA 1IGCH 1I9RH 2BZDA 1NAMA 1YEKH 2UV3A 3K2UL 1N7ML 5DQJA 2IBZX 3CLEH 4G6AD 1GGIH 3UTQA 1UB6A 4LRNL 4HKJB 3DI3B 1JVKA 4P23B 2V6HA 4M48H 1EBPA 2XY2A 1TJHL 4ZTOL 1YYML 1ZWIA 3DUHA 1I7RB 3GRWH 4ELMF 1QVOB 3QIBC 4UOW0 5C0CA 3RA7L 3EFDL 3O8XA 5DZOA 1C12B 1JWUA 5LGJA 2BCKB 5E2JA 4WVRA 2VXSL 2JJTC 4NCC1 1WV7T 1GOHA 5I9QB 1R3HB 1AKJD 1X3DA 4JE4B 3V7AG 4RX4A 4AEIH 1JCKA 1DBML 1ZHLA 3MLSH 4LCWB 5F6IC 5I19H 2DWDB 3MGAA 1EO8L 4Y4FA 1D9KA 3O6FB 5ALBH 5IV2A 3W2DH 4P49A 4BZ2L 2N56A 4RFOL 5D1QA 1K3ZA 4Y5YA 5D8JL 5DJ6A 3DBXB 1TPXB 1FAKT 5JTWA 3BDYH 4IOIB 5JPMB 4OZIF 4OAWB 1ZT1A 4KJWD 2EE9A