3KNBA

Crystal structure of the titin c-terminus in complex with obscurin-like 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
PGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the head-to-tail assembly of giant muscle proteins obscurin-like 1 and titin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/structural protein
molecule keywords Titin
total genus 21
structure length 98
sequence length 98
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3knbA00
4L4TB 3FONB 5IOPA 2AEPH 5LXGL 3ARGB 3GSRA 2V17L 4UV7H 2Q6WA 1ZLVH 5LGJB 3EYVB 4C56B 4MMXC 3C2AL 1A1OA 2AJVH 1X6LA 1NCBH 3P4NA 2FX9H 4ZSOB 2QQNH 1OAKH 5GSVA 3D0LB 2EH8H 2FHCA 4CUCA 4GXVL 3FCTB 5ELIA 1U8JA 2Q3ZA 1QEWA 2Z8VC 1EERB 4TVPE 3KR3H 1XGPA 5HDLA 2AQ1A 5D2NB 1MH5A 2GTZB 3D39D 1WICA 3MYJA 4KRMB 1FBIL 1JNHB 4EIGB 4PB0H 1EV2E 2F58H 3B2VH 3V5HB 5IF0B 4XP1H 4PB9H 1R3KA 5HHME 5I1JL 3F5WA 2JE8A 5C07E 4HG4K 1A8JH 1NBVH 4H1LG 1L4IA 4LSPL 1T0MB 3ZL4H 2WW8A 2BRQA 2BOBA 4TUJA 3WNPA 5FA3A 4KQ3L 1IAOA 3ZKMD 3CH1B 3NOIA 1OAYH 3EOTH 5IUSA 2CIKA 2R2CA 1BM3H 1UM4H 3BPLB 4PYHA 2CDEA 2NY1B 1LMKA 4DN3H 2Z35B 2FNBA 1M7IB 1S8DB 3IXTA 4PJBF 3OAUL 3BGAA 1PX4A 2WIIB 1NC4B 4HCRH 2GT9A 3MLSL 1RAMA 1UM5H 4XBEH 4HQQL 5BRZB 1QFUH 4OJFH 4AENA 3VRLF 3DX6B 4U1MB 2AGJH 5ISZD 2SEBA 3FOMA 2OZ4A 2W9LA 2X1XR 3QCVH 4N8PA 3C9NA 3CMOH 3WFCL 2H6PB 5AZ2L 4UTAH 3UJJH 4JRXD 2ZKHL 1ES0B 2DLHA 1X5FA 4HPOL 3TJEH 5GGQH 2AK4A 3QUZA 1CFQB 5EN2B 4OGXH 1JZ8A 4JFEA 4NZUL 5IT2H 3RWCA 1B0RA 3FL7A 3GMLB 1A7RH 5GGUB 2GEEA 1YDPB 4U6HB 1FNEB 1JFQL 1ODAA 3G6AA 4X7FC 2FEDD 3O2DH 5FV2A 3KLHC 1YMMA 4GSDL 4U2YA 2DQGH 1UWGL 1XGPB 1EX0A 2R0WL 3OKKA 4JDTL 3F7QA 3KPLB 3IF1A 3Q5YA 1F6LL 5D1ZD 4MNQD 2A2QT 3IU3B 1FCCA 1VFUA 2XFXB 1MHCB 4I18B 2BNUB 2C1PA 2F5AL 3HMXL 3SQOH 4PD4K 5IF0A 5KVDL 1HZHL 1JZ5A 1X7QA 1UM6H 2I07B 1T4KA 4L8DA 1DUZA 1KLFA 1I85A 3KPSA 4HGWA 3RUGF 1CF8L 3L3GB 1T5XB 5TDPA 4OM0L 2BVOA 4PJAB 3QXAB 1CE1L 2GCYB 3NIFF 4TOYL 1OM3L 3CLEL 3VGAC 2WK2A 3EYOB 2XKSA 4MQXC 1IC1A 4I2XE 1HDMA 4PJXE 4F58L 1KB5H 2C3VA 4YHKL 3CXDH 2CIIA 2WBKA 1T3FA 4CMHC 2EC9U 3PQYD 4QRPB 3F7YB 4PJIF 1UT9A 4NOFA 4XH2B 5DVNA 1FVEA 4M4PA 5DURD 1XGQB 1OAKL 1T22A 4EXPX 4P2QB 3KYMB 3P77A 2EEBA 2XTJD 1TIUA 3FQUB 3N06B 3GSOA 4DZ8A 2PW2A 3C08L 5EZOH 2F8VA 3VXMD 2YWYA 5AYQA 3KR3L 3KYOA 4S1QH 1JGUL 1HWGB 4R90L 4CU7A 1F13A 3P0VL 3EIFA 3IXAB 5KZCD 3MC0A 4FZEL 5I2IA 5J1AA 3QULB 4K9EL 1QFWM 4TPRH 3O0RL 3B2UD 3VMOA 2AS5M 3ULVD 3F6LA 3P0YH 3ULVH 5I16B 4P57A 5J6HB 3RUGE 4WW2C 1N5YH 4YK4B 4YXKL 2Q1EA 1YEDA 5D7JB 2BY0A 1ERNA 3O11B 3ARGD 4RQQA 4Y4KD 1YMMB 4ODWB 3MREB 4LKXA 1S7RB 2BXYA 4RFNB 4YE4L 3QDGB 3SN6N 2K7QA 3U4AA 4DN3L 2FEDC 1T66D 1S7VB 4V1DA 1DQMH 4HIIA 1E27B 3ULSB 2ICWI 3CCHB 3MRGB 4PUBH 1YN6A 4HCRL 5FO9A 1DQQB 4QTHA 1XF3A 5EUKB 1UM5L 2Z91B 4GS7B 2AK4D 3HZVB 1W2KT 2AGJL 3B2UC 2L7UA 1Y6MR 1WAAE 3EHBD 4WO4D 3E6FA 5ACZA 4D0CA 5HHQB 5CSZA 1G7LA 2WQRA 5E94B 4EVNA 2X4RA 3CMOL 2AJZA 5D4QA 4C56A 2OI9B 4XPHL 4PFEA 5F9OL 1JPFB 2FO4A 2LAGB 2VABA 5EU6D 4HPOH 3TJEL 5GRZA 2VZSA 1TXKA 5MEPB 5E2JA 3OJDB 2M8XA 1X4YA 1FG2A 2CDGB 1T66C 4MJ4A 5E00B 5HYFA 1ADQL 5F88B 4N1CA 4PJHA 1OPGL 2FECI 5ACMA 5DTFB 2HFGL 1MAKA 2YMXH 4GMTH 4P59H 4LHUB 1OCWL 4OZIA 1Q1JH 4WRLA 3TM6A 4OD3L 2IGFL 5HI5C 5J13C 5B3JE 2W9DL 4P2RE 1MQ8A 2AXJA 3CC5A 3LQAH 1FAKT 4IDJH 4XTRC 3EYSL 5D1QB 4LLYA 1QA9B 2B2XH 3WJJA 3VXQB 4LU5L 1IEAA 5BV7H 2EDQA 2BDNH 4JO1L 2H3NA 1QTYT 3GNMH 3BKMH 3C60D 3M17B 1VKXA 4MVBC 2EDNA 5C9JA 5GQBA 5JIIA 5C08B 4N90D 3K0WA 3DRQB 3C60B 1CE1H 5CIPB 4TOYH 4H0HB 4R7DA 4ZPTB 1WWAX 3NPZB 5C7XH 4JZOB 4P4KA 1CVRA 5T1DL 1JNJA 4PJGB 3MTRA 2X4TA 4ODVH 2A6JB 1F6AA 5F6HI 1TVHB 3VXUB 5CGMA 2GTWA 1R24B 2EIZB 1CGUA 3EFFA 4K71B 3MJ8B 4M6NL 3HG1E 4D0CB 3C08H 4OLXL 2AJ3A 5EZOL 4MXWH 2JB5L 2YRPA 4LCIL 3RBSA 3UCRA 3B8SA 3ROOB 1INQA 3E0GA 1V3LA 5GRJL 2IJ0C 1UENA 2ESVE 2PXYD 1NKRA 1PSKL 3W11D 1I3GL 5C0CD 1B90A 3H3KA 1UQSB 2R23A 4WWID 1E6JL 4HFWB 5D5ME 4JGJA 4JFYA 5GS2D 3ULVL 1T04B 1UB6A 1LP9E 4YX2L 1JWUA 3GMNB 4U1KA 3TA3D 1BFOA 1BVLA 2N7BA 5ADPL 5F6IB 1JP5A 2OQJA 2AV7B 2F15A 2GY5A 3LY6A 4M62L 1PG7H 4Y8AA 4JDZA 5IGXH 1D5MB 4HJJL 5L2JA 2UUDK 2BMKB 5CCKL 4X6BA 2OMBA 4J12A 4MDIA 2Y6SD 5DR5L 1A7PH 1M7IA 1AP2A 3FN9A 1NDMB 1I9IH 4XCYA 2VR4A 3K81A 4Y2DB 4OLZH 1KT2A 1H3PL 5GGSY 1CGVA 3HTLX 5DO2C 1TQBB 2R2EB 5D7LD 4N5EC 2ADGA 3TYGL 5F9OH 5BXFB 1PQZA 4F15B 5FKAB 3RA7H 3SE3C 3VGFA 3WD5H 5EIIA 4BSWB 3FO2A 1KNOB 3DRTB 3KPOB 3BP5A 1A5FH 5FO8A 5LQBH 2BHZA 5E8OB 4K7PX 1CYGA 1TCRA 2Q7NA 4JE4B 1IM3A 1E4WL 2BJMH 3SKNA 1AR2A 5C07A 5MENB 1CXEA 4AEIL 2BVUA 1WSST 5KVFH 4PJBE 1DCLA 3DUUA 4WUUE 3UYRH 1C16B 1QG3A 3SKOA 4L8SC 4IDJL 1C08B 3HRPA 2X05A 1UADC 2J6EL 9CGTA 3DVGB 5I18H 2Z8RA 3C5SB 1NGQL 4JO1H 5JMOC 1DE4A 2N4IA 3VI3E 5JPNB 4K7PY 3GIVA 3ZKQD 3W2DH 2APTA 1RK0A 5BS0B 1HXMA 2Y07L 5C0EA 2R1XA 4PRHE 3RWJA 4PRDA 3X11A 2NZ9D 3N85L 1MWAL 1Z9LA 4KUCF 2PYEA 3HI1B 5FYLL 2I07A 4JANA 2IAND 4UDTB 1ZSDA 4E41E 2ZCHL 4QRRD 1R3JA 4NC1E 5BV7B 2CXKA 3DYOA 2A9NH 3HPLA 5E9DE 2E6PA 5DEFB 1J1PH 4PGEA 3BO8A 4PRPA 3HR5B 3LQZB 4MXQD 1CIUA 2FCBA 4POZD 2NTFB 5TH2B 3W82A 3P2TA 3TIEB 2E5EA 4CMMB 4LLUA 5JXED 2NY5C 1HSAB 4GXVH 1RI8A 5D6DA 2ZJSL 4M7ZB 4MXVF 4U0RC 4MJIE 4MXWL 5J7CC 2HVKA 3S35X 4WFGD 4XVUD 4BH7B 4JY6B 1S5HA 3LCYA 3WNKA 4PRNB 4BELD 1HSAA 4LLVA 3U0TA 4GAFB 3MUJA 4MXVE 1LO0H 1LEGB 5DWUH 2PW2B 4EN3C 3CC5B 3GI9H 5IEKB 4NJAL 3VDCA 5C0GB 1NC2D 1IAMA 1RJZB 5GSRA 4ZTOL 4PJ9D 2F58L 3B2VL 4ZO6A 3SE4C 4UT9H 1MCFA 2HFFA 5TFSH 3BDXA 4JPWH 4JGUA 1XCQB 5CUSL 5B22A 2AKRB 1GAFL 1LEIA 2W60B 3GRWL 1LEKA 3CSGA 1QFWH 3ARBC 4W70A 4PRBB 2VLLA 1XIWB 3NFNB 2XQYG 3QFJB 4RZCB 5EBLB 4ELMF 2ADFH 3DLQR 3HA0A 1HYRC 1OAYL 1RSFA 2R1XB 5DRNA 3UPAA 5IGXL 5KVGH 2BVOB 2ZWLT 1BECA 1MCEA 3WEXA 4I2XA 5IHBA 1YY8B 3C5SA 5JPMB 5HY9A 2GJ6E 3FQXB 3QHFH 4DTGL 2JLLA 4XBEL 1HINH 1OOAA 3RIFK 4NUGL 3TN0C 1NCAH 5EC1B 4Y5VB 1GRWA 5KG9A 2CLRB 4JG1L 1XCTA 2B5IC 4WIQA 3QCVL 1X6NA 4NC0B 3WFCH 3K1KC 3UTSD 2D4FA 1S9XB 3UJJL 2AI0H 2QSQA 3LKPA 2YWZA 1KEGH 3ARXA 5INDA 3L9RB 3RA7L 5DFTA 3NH7H 1MIML 4MNGE 4EDXB 3ZTJG 3CPLA 5SWQB 1SYSA 4OGXL 2ITDA 2R4RL 5K59E 1KJ3L 3VXMB 3RVXD 5CGYC 4LF3A 3G5ZA 3BZFB 1H3UA 1MF2H 3SGEH 4O9HH 1E4WH 4YIQB 5I71C 4LSSL 3LV3B 3HPJB 1FO0B 4IOSD 4NQXA 5SX5K 1FG9C 2JK5B 3T4YB 1KCLA 4GSDH 3SDCB 2NXYB 1EAPB 3L7FA 4PRIB 4JDTH 4HCRA 4KKAC 4U1GC 4JRYD 3VFWB 1SJEA 3QUMB 3PGCA 4YBQC 5D2LF 1KB5B 2DD8H 2V2WB 3KPSD 4RGND 4HEPG 4B50A 8FABA 5KVDH 5CEZH 3VFMA 3S4SB 3S3JA 3IU4L 1QBBA 4ESKA 3NBNA 1IC7H 5JW4M 4LCUB 2C1OA 4Z6AT 4Y4KB 3PGDB 3CVHA 5F93C 1XIWA 3NFNA 1FIGH 5DD1H 2H9GA 3H0TB 4H25B 3BH9A 4XI5D 1NMBL 1YMHA 2JIXD 1T21B 5DZNA 4NO2B 3MLYH 4F7TB 4F58H 3NMEA 3PHQB 1Q38A 1J1PL 1ZHLA 1PZUB 2EICA 4M1DL 3RNQB 4P23A 4ODHL 2BP3A 1LO5A 5ITFA 4JHZA 2LTQC 3QNZB 3Q6FA 4XP9H 1CDBA 5KN5B 3O8XB 3N9GL 5BQ7B 4OBRA 1VGEL 1LO5B 3BZFA 3OL2A 5GGTL 3D2UB 3W5NA 3NFPB 3RY5A 3FQRA 12E8H 4YGVB 1TJHL 1F11A 3ZKNC 2CKBA 1BD2B 4KXZH 4K9EH 3BP4A 3BPNC 2JCCB 3BJ91 4TPRL 3TZVA 2QR0A 5D72L 4HWZA 1CG9A 4I3RH 1R3LA 3JTTA 4JFXA 5FB8A 3WFDH 1N5YL 3QZWG 5FUCC 5CUSH 2C3WA 1PYWB 4U1IA 2VLJA 1OGTA 1T89C 3F7RA 32C2B 3QUXD 4JO3H 3F8UB 4GKOA 4OCXH 3UTSB 1ZVSA 4KH2A 1RZKC 4KU1A 5EULV 3UXFA 1BREA 2CJUH 5KVGL 3O6FC 5D1ZC 3VWKA 1DQML 3BX7C 1DVFA 4X9GA 4BQCA 4APQB 1OTTC 5HDQL 3MRQB 1XFPA 2X1WL 3KLHD 4NUGH 1JHLL 2HWZL 1J7VR 4JG1H 4YHZL 15C8L 2ADIB 1P69B 2NY1C 5BRZA 3TFKD 1P53A 4YHPB 3MRPB 2GYSA 2ATPA 2WBWB 4LNRA 4Y2DA 4L1DA 35C8H 2GK0B 1UWEH 4XPBH 1U8KB 2CMRL 1H15B 5I8EA 4UU9B 1B4JL 3GSOB 4NWUH 4DZ8B 4B0MM 1ADQH 5IFJB 4BUHA 2DQCL 1OTUC 4WWKC 3FO2B 1EEUA 1RD6A 3UTQB 5JOEA 1PDKA 2F5BH 4LSUL 2QL1A 5I1HL 1U8HB 1QFHA 4NNPL 3D3VB 5KAQF 3FQNB 3MLZL 1HH9B 4CNIB 3T09A 1JNLL 5SX4H 2G2RB 3K4DA 4H1LA 5I74B 4N5UA 5IB4A 5FUOL 4JDZB 3HZKB 3BKML 5D7IF 4DOHE 4NQVB 2FYYA 4HV8A 3QUYA 1QACA 2HRLA 1OGTB 4U7SA 4U3HA 2IADB 1U3HB 3WO4B 4FABH 4Z7NE 1IZJA 1OT1A 5DD1L 1RK0B 5C2BH 5E70A 1V7ML 5DVMA 2NQCA 3IF1B 1QR4A 3MLYL 4HUWA 1C12B 3UTPE 3S37H 2XXMB 5JORA 2GHWB 2V9QA 2AAVA 1FGVL 1UC6A 4XNXH 1N7MH 4YWGH 4KK9C 3E6FB 4M1DH 3PGFH 3VWJC 4S1DD 2DWEA 3DUSA 4Z7VE 5IW6B 4MCZA 3VXME 3O9WD 4OSUH 4PJXA 3MRFB 1NCUA 1GOFA 3P30L 2LABA 1Z6JT 4L3ED 1YQVL 1NGPH 4M6NH 3N9GH 1B0RB 1ZVYA 5JO5B 2GSGA 3QIWC 1VGEH 3VA2C 5E8DH 3I2CH 1GOHA 2NX5D 3QSKB 3VFRA 4YPGB 1U8PB 4QNPE 1XF2A 3LN4A 3ZZ1A 4B41A 5IFHL 2MOVA 1KXQE 3IDXL 1PJ9A 4DGYL 1U8HA 3QCUL 3BUYA 2EKJA 3FFCA 1M1SA 2JJUA 4LLVB 4XCFL 1ZHKB 4HXBL 1CGTA 3SDCA 3VD4A 1ZEAL 3K7UA 4YR6B 2MQCA 4TVPL 5D7SL 2D0HA 1ZVHA 1X9QA 3CDGA 2A73A 2AABH 4ZO8A 5CFHA 4JY4B 1CT8B 4MD4A 2B1AL 3MYZA 1NLBH 3I50H 3PWNA 2VAAA 3BN9D 1DUZB 4HGWB 3MLVH 2PYEE 4LHUG 2CJUL 4JPIA 4J8RB 4HJJH 2X70A 4OCMC 5DLMH 2ZSWA 3WUWB 1NAML 1N0LA 1ETZB 1BEYL 2R8SL 25C8H 3QHZH 5JORB 3RX8A 5CAYB 4QY8A 5KOVC 2AV7A 4MAYD 3AMKA 4ODSH 4OLZL 3HS0B 4AEEA 2A74A 3JVGA 5I1DA 1IC4L 3G08B 1R5IA 4GRMA 4H5SA 1BJ8A 5DC9B 2DDQL 5GGVH 1G7IB 4NFBA 1DBML 3X12A 1JF6A 5T1LB 1N0XL 2AV1B 2ARJA 3DROA 2R29L 3CDCA 1SBSH 3P9LB 3ES6A 5CWSA 3BYYA 1A5FL 1B4JH 4NWUL 1LE5B 5EO9A 2FECL 1PYWA 3QWRA 4P5MA 5TJWK 4XHJC 1DLHA 5CSZB 4CKVX 5MHSD 2J1KA 4YEFA 3BPCA 3NCEB 2F5BL 1YY9C 3UTTB 5I1HH 4HMDA 4RMQA 5KVFL 1OHQA 4P2YA 1RK1A 3SDAC 1PZ5B 4XGZB 4HULB 4J3OC 4KROB 5HXMA 4PJEB 4HS3B 2J6EH 5EZLA 4ODTL 2JJTA 1Y18A 4I0PC 5LWYH 4OGAC 5C0AB 2NXZC 4XHQA 5JW5B 1E4XI 4LPVA 4GAYA 3C6LB 5DVLA 1T83C 2BSTA 2JB6A 1NSNH 2Y07H 1LEIB 2J12B 3PDDA 5AYUH 1MWAH 1EEZB 4JY4A 5IVOA 2RIKA 4UTBL 5C2BL 1SY6L 3H42H 2PO6A 1V7MH 5DYOB 4MDIB 1S7RA 5C08D 5DT1L 3MOQA 5TQ2L 2HMIC 4RX4A 5E2VL 3DYPA 4ZD3H 4LLYB 1FGVH 4JREB 3BH9B 3T77B 4EI5A 3LRSA 3KJ6L 3ARFA 2UWEA 3MROB 3H7BA 4O02H 4HDIA 3QUXA 5IB2A 2PYEB 3HI1A 3IVKA 4NRXA 1V7NH 5C0BE 3P30H 3OF6D 2R39A 3T1FB 2I5YL 2ZJSH 3QEQB 1EBAA 4OUUA 3T8XB 3DV4B 1R5WA 5E2UL 4LHUD 2FDBP 4PJHB 3AU1A 3NIDF 4KK6C 4KK8D 4F7EB 1FVEB 1G9MC 2BVPA 3UBXG 3BPCB 3HG1A 5HVHB 3BMVA 5KSVB 1IGIL 4ZTOH 1FYTA 4Z18A 1PG7X 1K8IB 4WW2A 1F11B 4ORGB 3D39E 4DCQB 4DOHB 4WU7A 5D7SH 3CFDA 4QT5A 3UPCA 1HQ4B 3MJ8A 4PGBA 2KUTA 1G7HB 4MA1B 5TE4H 4QGTA 2B1AH 4JFDA 1NLBL 5HPOA 3HRZB 4PY8I 3H9ZA 5IW1B 1MCIA 4X5WA 3UDWC 1X5LA 4OFPA 3SKMB 3V4UL 4BQBA 1HOCA 3MLUL 2VXQH 4QHLB 1RV6X 1G7PB 1IGYA 2R56H 3EOAB 2OS7A 4KK6D 2DJSA 3MRMB 3K2UL 3W9EB 4P2RB 1NMAH 2R8SH 3QRGH 5J6GB 3MV9A 5DJAA 1I1CA 4BKLB 1Z5LB 3QA3A 3NA9H 2VQTA 4BA8A 3I6LE 1WZ1L 5TPWL 3VFSA 3B5GA 4X9BA 2DDQH 1DBKH 4QOKE 5GGVL 5EUOE 3UROR 1I8LA 4YHPA 1RIVL 4NM8L 4JFZH 3NH7L 1MIMH 1SBSL 5DK0A 1MHHA 3FB5B 2OR7A 3GSQA 4JFFB 2UWEB 3MROA 1INEL 1QLRB 4RBPH 3FT4A 2YD8A 1UYWH 4LSSH 3ARED 5BMFH 3ROLB 3BD3A 3OKLA 1T04A 2F9BT 5MEOA 3JSSA 3WS6A 1P4IH 4MQ7A 5DJYA 1FH5L 3GO1L 2NMSA 3ULUD 3I84A 2FSEB 3RPIB 2DD8L 4ODTH 1LO2L 5DD6B 2YOCA 4C56D 3VFTA 2J8UA 1GGTA 5DXWA 3S96A 3LSOA 4JFXB 3AS1A 4NUJA 7CGTA 3O8XD 1IC7L 5DVOA 3MA9H 4U1HA 3VWJA 1F3RB 2BSRA 5IR1B 1MHCA 4X80L 1GGUA 1M6OB 2D7TL 4WW2F 3FTGA 2G60H 4L4VA 1QLEH 3AM8A 3QUMA 5DRWA 4IRSC 4F7CA 1C16A 4FFWD 3GMRB 5MERB 3KPPB 4O2CB 2R9HC 4UDTA 3AXLB 2BXZA 3I6KB 1T7YA 2GITB 3LPFA 1G0YR 4LIQL 2F53D 3NIDE 3PUCA 2B4CL 1G7JB 3VFGH 3MV7A 4RGMC 1QZ1A 1CFQA 2NLJB 2ZUSA 1E4KA 4F9PC 4HK3N 4P2QA 5GS0C 4Y5XC 3LB6D 1MCPL 5JHLH 3MA7A 4P4RB 4EDWH 12E8L 1PQZB 3LKOB 3MRCA 3HE6A 5ICYA 2FEEI 5FIEA 1F5WA 4NNYB 3V6ZA 5C09D 1Y6KR 2X1OA 2I24N 4X7TA 1T7ZA 2DWDB 5C6WH 3H9SE 3PGCB 2VISB 4OT1L 5CEYA 4NOBA 3VD7A 3VXQA 4NHUB 4XP5L 4X6EB 2CUHA 1TFHA 3HR6A 2HRPH 5J3HD 5B8CB 4LCCB 4ZAKC 1UB6B 4Z7OF 3EFDH 2Y7QB 2FJHA 5I0DA 3QDMA 3O6KH 5CJXC 4UOJA 1MJ8L 1NMAL 4HF5L 4P2CG 3RDTD 3LEXA 4M9PA 5ETUB 1DQDH 2O5YH 2AJSL 3CH1A 2CGRL 4HKXB 5KBNC 1UWXK 1P2CA 1PY9A 3MXVH 1WZ1H 4UINH 5B4MC 3PG2A 5ENWB 3QG7H 1D6VL 35C8L 1DBKL 4KDTC 3C8HA 2IPUG 1CK0L 4ZUWB 2EIZA 3HNVL 4NM8H 2Q76B 4K94C 4MD5A 1Y6NR 2Z8WC 1A7QL 2E9IA 4Y8DC 3DIFA 1JZ6A 1INEH 5TF1L 4DGVL 2JJTC 4I0PA 2DQCH 5TF0A 3C9NB 4QT5B 4JFDD 1EEYB 4FQHA 2XKNA 1NUFA 4YHMH 5EO9B 1RIHL 1XF4A 2HLFD 4M6OL 5JOPD 4N0FA 4PJ9B 2UVFA 1AGBA 1NFDF 4OZ4B 4QHMB 1P4IL 4HUKB 5EN2A 1HOCB 3GO1H 3K8LA 4QXUH 4JZNA 2BX5A 4AH2B 3V4VH 4BJLA 3BRFA 2A9ML 2EDTA 2GUOA 3VMPA 3MREA 3IJHA 4MA8L 1CLYL 2IPTL 1BQSA 1YEKL 3TZVD 4OKDA 1BBDH 3B6SA 3EAKA 3S36X 1K4DB 2NXYC 3CDGB 3NTCL 5A2LH 2YD9A 5IMMA 1HH9A 3GBMH 4CNIA 2OXGA 1I7UB 3W0WE 4N0UB 1FVDA 3W9DA 4OZGB 2BOCA 1KCRH 2PTUA 3HS0A 5HYIA 3S37L 1D6EA 5CJ8A 1BX2A 1HHIB 1R5VA 4Z7UF 5JW3H 1N7ML 1WJ3A 3CMGA 4BZ1H 1ETZA 2L0DA 3PGFL 4LIQH 1L9NA 3S4SA 1NPUA 3QWRD 1A3RH 4ZOBA 4F7PB 4GRWH 4M7LT 1IGJB 2YPLE 4L3EE 3ARWA 1YQVH 4G8EB 2X9WA 3RU8L 1WCBB 1RUQL 1A4JB 1X7QB 5DEFA 3GSNH 1I8MB 1I1YB 1RUKL 1ZT7A 5HHPA 5F7WC 4Z7VF 2Y5TB 3JWNC 3O41B 2VLRA 5L9DL 1IM9B 4H26A 3QCUH 3M1BB 3BZEB 4JKPH 3I9GL 2CO6B 3RWIA 4GKNA 3FQRB 1VERA 2PR4H 3VXRD 1ZEAH 4DN4L 2B1HL 4M43L 4P5MB 3W81A 1U8JB 1LD9A 2DI9A 1FYTB 2NX5E 5C0AA 1M4KA 2NY3D 3MOAL 4NRYA 4ACPA 3V6OC 4AMKL 2BNUA 2C1PB 3OG4B 1AGBB 4OZ4A 3GK8H 4ZFOA 3ZTNL 4KAQH 1S7TB 3QAZC 5E6YA 1K8DA 2HMID 1YPZE 4NQDA 5IG7A 3OKNA 1JWMB 4LAQH 3UTTE 3SPVB 1AXIB 4YHYC 4MZ3A 3MLXH 3O6KL 1AO7D 3VD3A 2GI7A 3MRNB 2Y4SA 25C8L 2RCSL 2PN5A 4M00A 4NQSB 4RNRB 4JO2L 4HMCA 3WIIL 3WLWC 3TZVC 5IJKC 4HH9A 4V2CB 2Q8BH 3TO4C 2YBRA 1IC4H 4OF0A 5CIPA 4F7PA 3ULSA 4ZG1A 3SEPA 1HQRB 5J11C 2W9EL 1CK0H 3ECBB 1N0XH 3H6JA 4FHBD 3WS6C 2DB8A 1UFUA 4UNTA 3HE6B 1H0DA 4KK9D 2XACC 4IRJB 4XVSL 1HILA 4MD0A 1OQXA 2A74B 2EXWD 2BRRH 2VQ1B 1HHKB 2VLRB 4OZFH 2A6KA 3S35H 3RVWD 2OCFD 4GAJH 5E7BA 1MCWM 2UZIL 2HYMA 1ND0B 4EN3A 1I1YA 4UQ3B 3VGEA 3FFCB 3QXDA 2X4UB 4WEBL 4RSVA 3WXWL 1IQDA 4X8JB 2Z92B 1CDGA 3RVTC 5EBMA 3MODH 3QXWA 4UU9A 3UTSA 1YEKH 1DLHB 4QTIL 3QEUA 2CSPA 2QKIA 3OHXB 1YEGH 3W11C 4Y19D 1NEZB 4JY5H 4K07A 2ADJA 3MPCA 1KOAA 2BNRA 3R0MA 4WFHE 4UTBH 3TNMA 1KPVA 3C6SB 2GIYA 2VZUA 2ICCA 4YDJB 4KKLD 4X5WB 5DT1H 1C5DB 3IDYC 5F71A 5E2VH 3JV6B 2FIKB 2NY0D 4KZDH 4C4KT 3L95B 5EU3B 3H8NA 2NY6B 5GZND 4BZ1L 1FNSL 5JPNA 1MFEL 5DHVH 2K9UA 2FIKA 3O3UN 1OD7A 4JM2B 3GMMB 1FLTX 3CZJA 4U0QB 3MUHL 1JWSA 5KSBF 1NJ9A 2I5YH 2P7TA 2DWEB 1HYSC 4X4ME 4TRPH 1IAII 2EDJA 3ARBA 3QWOA 3A6BL 5FDWA 2VDQL 2VH5H 5ADOH 5J13B 4HJ0D 4W6WB 4GRLA 4HH8A 4MJ2A 5L2KE 5F1OB 1S9VA 2HFEB 5BVJA 4Y4HA 1XAUA 3I9GH 3OXRA 1RJYB 3O81A 4PRHB 5D2NC 1TZGL 3IDNA 4PJ7F 2CDFB 5FUZL 4MB5A 3U9UA 4M9OA 4IS6A 2B1HH 4M43H 1FNEA 2MJWA 2QQKL 1VFMA 3ARYA 4PV9B 2EXWC 3DX8A 3OR7B 4JPKH 3VRJB 3C87A 2ZNXA 4MJID 4L8BB 1VGKB 4PRPD 3DMMA 2O93L 4KAQL 1U8PA 5I30H 3MLUH 2VXQL 5D7LE 5DQ9B 2R56L 1UB5B 3DX7B 1HE7A 5JUEH 3S34H 1MUJB 2FLBT 2ITCA 3LD8C 5DJZA 3TCLA 3BISA 2WP3T 3G6DH 3V52H 4LDOB 3NA9L 1CLOH 4JQVA 3E8UH 4GT7A 3CUPA 5F9WB 3CK0L 1G7JA 3MSPA 5DHVA 5F9JA 3DUHA 1U8MB 4OQTA 2W1NA 4HUNB 1Q8MA 5T1MB 4ETYA 1XF5B 4S0TD 3K2MC 1A3LH 4X5XA 1BFOB 1EO5A 2NYYD 1FV1A 1RIVH 1I1AA 3KPTA 4PJGE 4JRYA 4MQTB 3EOYG 4JG0L 4PP1C 1YMMD 4G3YL 1JYVA 3MRBB 4JKLA 4GRLB 3HZVA 3KPQB 3MR9A 4K9EC 3I6LD 4ELME 3G6JB 2ICEB 3ARDB 3U46A 3MRKA 3O3EB 2CO7B 1N6QL 4GAJL 1KJVA 5EWIH 2X4RB 3HG1B 2HG5B 1FE8H 2PKDA 1M7DA 2J3SA 4NFDA 3HRZA 5IW1A 1Q9OB 4KJQD 3HPJA 4F33A 2ZUXA 3KPOA 4KMQA 5I76B 2HAZA 2HG5A 5KSAB 3MODL 1BMGA 2ATKA 1LO2H 3OPZH 4MX7B 5C92A 4C55A 4K3JH 2VO5A 5I76A 3ULUH 4OZHA 4AIXA 2OXHA 3HMWL 5AUMA 1EGJA 1NGZA 2XG5A 4PR5A 2IG2L 4LHUA 1BZQK 4MAYA 5ALBH 5GJTL 4DVBB 2WP3O 4GG6E 5FHAH 1VSCA 1X4ZA 4GW4A 5F9DC 3QISA 1IEHA 2OMNA 2CRZA 4JFHD 4U6TA 4RAVA 1AC6A 3Q1SH 2E8YA 4LCCA 3ZE0F 3CUPB 4N1HB 5T5FH 1ZGLM 1M7XA 1UXSA 2BNQA 1PKOA 4A6YH 1HHGB 2ADIA 1XF5A 4B7LA 1I7ZB 1D7FA 4LKCB 4Y4KA 3LRSB 1AY1H 1HHGA 1A7NH 4D0BA 4G5ZH 1J1XL 5BOPA 5HHQA 2OL3A 5E1HB 3WKML 4RWHA 5C0CA 4KROC 5DYOA 4CU6A 3I3BA 3LH2H 5C0ND 2Z9TA 2MNUA 4KTDL 4HC1A 5D6DC 3WLBB 4QF1A 1R3JB 1BOGB 4Q6IA 5C08E 3ZMRA 1I4FB 5CD5D 1HHHA 1AGDB 4N8VA 5B3NA 5FUZH 4PGJA 4GW1B 5DEGA 3CX5J 3S6CA 1UA6L 3HE7A 3N1MC 1WTGT 2NTFA 4YZFF 5IROC 1MHEB 3WDIA 3UZQA 4YK4C 2NZIA 3C5JA 3ZO0A 5I30L 5CHNA 2WQ8A 4OM1H 4JRXB 4XNQA 4N1EA 4OZHB 2DICA 1NDGB 1EHLH 1QUNA 3FQTA 3P3YA 5SWSE 3V5DB 5I66B 1G7PA 3G6DL 3I3EA 1ZWIA 3V52L 1F2QA 1BGXL 4MSWB 4FTVB 1ZLUH 1H5BC 3T0EC 3CK0H 3FN0H 2X70B 3VRIA 1ZA3B 3MXVL 5IQ7L 1JGDA 1F6FB 2KL6A 4PJ5D 4CN6A 1D5IH 1FJ1A 1J5OL 4ODUA 4RQQB 2ZCLL 4GLRI 1NGYA 2MPAH 1EAJA 3JWDC 1GHFL 3THML 4GG8B 4RGNB 4XWOC 1KJ2L 2Q8AH 1Z9SA 4G3YH 1K4CA 1XCTB 3WS3B 3O2WH 4YDIL 5ID0A 2PF6A 5GSVB 4FQCL 1Y0LB 5A1AA 1TZIA 1CU4L 3F6IA 1KT2B 2QADB 1HILB 4MD0B 4QO1A 5EDXA 1RIHH 1IVLA 4Z7QE 4GRLC 4C4KO 1YNLH 4QHUA 2FL5B 5GS0D 2DAVA 3DMMB 3MBXL 4DK6A 5DQDL 5IKCB 4QHKI 2ZUTA 4K8RC 3TH3T 5I1GL 3DTXA 3GUTB 5ICZA 6CGTA 4E0RA 1JPFA 3QFJA 5EBLA 4LVHC 3TCLB 3VDAA 4BH8A 2O5ZL 3KAAA 4ONHA 3U0PB 3L5XH 3UTTA 4J7RA 2P42B 2R0LH 1GH7A 5C3TA 2ITDB 1LO4L 3GSVB 5ALBL 5F1IB 4XMLL 4NO0B 1OTTD 4RIRA 1ZLWH 1JYWA 3RWHB 3Q1SL 2HTLC 5MI0B 5E5RB 3BHBA 4WHCA 3UJIL 2NY7H 4RIRB 5FYKD 4GRWF 4GOSA 1BHGA 2EDWA 5FYKH 1A3RL 3GMRA 5MERA 5EZIL 2OTUB 4NYLA 4M7JH 1ZGLA 1OF2B 1KLGB 4ISVA 3MLTA 3PV6A 4JFED 2YBRB 3RU8H 4O2FB 1RUQH 1SJHA 3ZLQC 5J3HC 3GSNL 2BVEA 1DQTA 5KS9F 1ZGLB 3REVA 3N1QC 5T3ZH 1YN7A 1U42A 1CLZH 3MRHA 3P4NB 1X44A 2YXMA 4WI4A 5EPMB 5SV4A 1NCCH 3O3EA 3F62A 2GJJA 3QNZA 1YZZA 1MLBB 4GAGH 4V1DE 1CE6A 3DO7A 1V3KA 3PWJA 1IGFH 4M1CC 1Q9WA 1UA6H 3F58L 3RY6A 1GGIH 2RR3A 3OKEB 1J87A 4YXHH 3AVEA 1OGAE 3OKYA 3ZTNH 1CGXA 3NIGF 3O11A 4NZTL 1R3KB 1JGVH 4P46C 4F9LC 1A9BA 2OL3H 2EDYA 3A67L 4Z7WF 3OKMA 5JQHC 1BIHA 3QUZD 2CK0H 2X4PB 4YFLF 4D9QD 3STLB 1KCSL 1U93B 3EKCA 3MV8A 1XR9B 2DLEA 3RWFA 4JO2H 4DUVA 3AS3A 1UB5A 3K4ZA 5GRUH 3CLFH 3L3GA 1ZANH 3GMOA 2VLKE 3H9YA 3HB3D 5F6IC 2ICWJ 5KS9E 1R5VB 1MRFL 3BW9A 4OLWL 5IMOA 1L7IH 1NL0L 3L3HB 4N9GA 2IBBA 4ZQKB 2W9EH 5DD3L 5JOFB 1MEXL 4BSVA 5FA3B 2BSED 4E41B 1QBLH 1OY3B 4Y0GA 1WFUA 5IJKA 3MACL 2V5TA 3R1GH 2DL2A 4AG4L 1H8OA 2IFFL 3IDGB 4KTYA 4YDIH 1Z2KA 5I15H 4U1JB 4Y2DC 2XYCA 3TYFA 3VXSD 3HE7B 1Z9OA 4EBQL 1GC1C 1TQBC 1Q94A 4HK0A 4YFEA 4M8QB 4YAQA 4M8VA 3H7LA 4GQ9H 3LOWA 1UJ3B 2QADC 3CFEB 3O2VH 2H26B 4CRPA 4WY7L 5FO7A 5EBGA 1NBYB 1G6RL 3T65B 4AM0A 1DN0A 3BE1H 3FT3A 5D7LA 1I85C 5EOQH 3MRDB 4APQC 3LS5L 1YEGL 1XCQA 2PCPA 3L5XL 4L8SB 5GGRB 5K33A 4JY5L 2CQVA 3U7WH 4IRZL 3QDMB 5FO8B 4LCWB 1MCRA 2Y6SC 2FWOB 4WFHD 3T2PA 5GS1C 4KRPC 4LCUA 1KB9J 1T2QH 3J7HA 4G6FB 1O5DT 2Z4QB 1F90L 2H41A 4HBQA 1OAXL 4HJGA 3QUYB 2BC4B 1G9NH 4HZLB 5CZVL 5FO9B 4NQUA 4P9MH 2WUCH 3LEXB 5EZIH 2F74A 2EE3A 1DBJL 4WUUD 3WUZA 3V8OA 4FFZH 3VXUA 5GRXG 2LVCA 3RNKA 5I1EH 1P9MC 3S8WA 1K6QH 3BD5A 1AGCA 4NCDA 4RMTA 2GJZB 3TYFB 1YMHB 2BNRD 4GBXC 4FQXB 2J88L 1JI2A 2ED8A 3FRPG 4JB9L 4P3CL 5HDBF 1QLRA 3O3BA 5ERWA 3R8BB 1EH9A 1AH1A 4JM2A 3DTXB 3DARA 3NCFB 1RMFL 2CUIA 5CZXC 2GSGB 5CSBA 1IGFL 1T1XB 1FFNB 1MAJA 4MJ6B 1S7XB 3LQZA 4LCWE 4IJ3B 4ENED 3O6MH 5C2UB 4FQIH 3WO4C 3SE9H 4PRIA 3QH3B 4GMSL 3FQUA 4GG6A 5IMMB 2Y36H 4LVNB 5IB1B 3CGTA 5EZJB 5JUEL 1PBYA 2EIEA 2VDNL 4EKXA 3Q48A 3U4BH 2QBWA 4PGDA 2DKUA 5GIRB 2A1WL 3L3JB 1H8SA 5DSCB 4NQDE 2Y25A 4PJCB 1C5DA 1TZHB 1IILE 4EZMA 3PIQA 1JHKH 3EO9L 3KPPA 3JWDL 4KI1A 1KUMA 1KXTB 1JZ2A 2V5MA 2AJXL 1F00I 3WFBL 1ZWIB 4M48H 4ODBD 3H9HA 1GCFA 4PD4J 4PJIB 3RNKB 3BKCL 5L2KB 1X5HA 3ZYJA 4D94A 4UIMB 4MLIA 4Y5VA 5AEAA 4ZNEA 5D1QD 4CVXB 2E6JA 5ESVA 1S7WB 5ACZB 3FFDB 4XCYB 4EN3D 5C3LD 1EZVX 1CZ8H 3TEUA 4H26B 4WU5B 1KNOA 5CJOL 5EWIL 2Z8SA 5KANG 5H37G 5IFJA 4KMTH 2ZUWA 2XQBH 5HHPB 1XH3A 2FRGP 1FO0L 2KH2B 5GZNC 3PWPA 5FYKU 4HC1H 1P84J 4CBPA 5CBAB 4L9DA 4U1LA 4WY7H 2WWMC 3QG6B 1WEJL 1L9MA 2F54A 2I60H 5F1NB 2ID5A 5IHUH 3S97C 3LHPH 3RTQD 5SWSB 1YNTB 2JCCE 1QQDB 4RFEA 3HMWH 1ZLSH 4NQCB 2AK1H 2P5EB 3VE0A 2IG2H 1HSBA 3GKWH 3RY4A 1MELA 5J11B 5SWSA 2FHBA 4P49A 4PLOB 1W8NA 4KHTH 5BS0A 1CL7H 5E5MB 4IM8A 2DYPB 4S1RL 2D03L 2UZYB 2CRIA 1JF5A 2CK2A 2VDLL 3LKQA 3QO0B 5JW5A 3VWKB 5T5FL 4AIZA 4PLJD 4YDJA 4A6YL 1R3HA 3VGBA 1T0NB 1KBGH 1N26A 3G08A 1TDQA 4P9ML 3QXTA 1ZLWK 3C09C 2E8ZA 2EIBA 2XY1A 3I6KA 4ERSL 3WNOA 2IANA 1I9EA 4FFZL 4XX1G 3T3MF 2AJUH 3MFFB 1WBXB 2X44D 2YD1A 5D7JD 1DN2A 1N6UA 4KQ4L 5DJDB 4OFDA 1D9KC 3CVIL 5HYJE 1SJHB 5EU4A 3JV0A 3DETD 1JHTA 4KTDH 1RZ8B 5J56B 1DSFL 4XC3L 4YDLB 5ISZA 1MVFA 5EU4B 3MOBL 4LVEA 3WDHA 3O8XC 1KEML 5K9OA 1F6AB 5B8CC 3ARFB 2RB8A 2Y5TA 1IT9H 4IIQC 5C0DA 5C6TL 1AD0A 2X4SB 4AZ8A 4Q6IC 3UPRA 3IXAA 4HSQA 5AG8A 5J12B 5IVXA 4WI7A 3B43A 2Y36L 4ZMAT 5JZ7C 3GSVA 1H3GA 1K4DA 1CFNA 2OK0H 4RAUA 2FO1A 1QYGL 1U3JA 3L5WA 3SO3C 1EHLL 3O6FB 5I1LA 5IESH 2OR9L 4G9DA 4F3FA 2HN7B 3QIBC 3WSQL 3FAXA 5J9PA 3S3SA 2FEEL 1NMCB 3FB8A 3JWDH 5E08L 5L2JB 3TIDB 1QSFD 1XGUB 2FD6L 2JIXB 2WIIA 1YEFH 2ZOLA 3H7BB 1S5IL 1EBPA 1C12A 2PTVA 3CU7A 1HHJB 5ERWB 1PW3A 3STZB 1IKFH 2F74B 4NQSA 4DUXA 5JNYB 2DS4A 4KWUA 5LKNA 3ZTJH 5DMKB 2Q8AL 1QRND 1KJ2H 2OR8A 1JMXA 3BWUC 1T5XA 4NO3B 3KPMA 5IM7A 4HIXH 5D5MF 1LO3H 3VRIB 3ZKND 2YN5A 4EQ2A 3MRMA 2ZOKB 3GB7B 5KSUB 3IFOA 4LF3B 1JIBA 1C5BH 5A3IC 4TUKL 2XQBL 3RWIB 1OAUL 1JN6B 3U7YL 4TQEH 4LRIA 4U1SA 4CJ0A 1ULVA 4LSVH 3L9RA 1EO7A 1OGAA 2IH1B 1M7DB 4JRXA 4CMMA 3VG9B 1AGFB 4UUJB 1U8IA 1UKSA 5HYSG 5JHDE 2JELL 4XGZA 4LSRH 2E6QA 1W0VA 1NDGA 2PTTB 3EYUL 1N2RA 4P5KB 4L4TE 3D0LA 4Q0XL 4MZ2A 3WHE0 1U92A 1A21A 4QRQB 1AD0B 5IKCA 1HIML 3QULA 5C9JB 1F58L 4NRZA 4S1RH 5EOTA 5F7HA 4F8QA 2A77L 2DQIH 2VN7A 1F8TH 3D18B 2ATKB 1QA9A 1KN4H 2C4FU 3QQNA 4OKVB 3VWJB 5EC2B 5AZEL 1KBGL 5F3BB 2D7QA 3NVQA 1JPSH 5FYKL 5FYJL 4JFFE 4FP8H 4J3SA 5A2IH 3ILPA 3GGWA 3RL2A 3P4LA 1RFDL 5L6YL 2EE9A 1MREL 3O6FD 4XCCH 3L3HA 4KUCD 4G6ML 4LKCA 4N9GB 1PVHA 3DVFA 4OGYL 3PQYE 5FOJA 5I73B 4BSVB 3CZFB 1RZIB 4LFHG 3FT4B 5DDHB 5E4EB 1BF8A 2F54B 1URLA 2YD4A 3ULVE 1QFOA 2R0ZH 4ELKA 2UWEE 1IQWL 2EDBA 3BPLC 3P11H 2CLZB 2OJEA 1CLCA 1KIQA 4PY7A 5DHYB 3F7YA 4XAKD 4P4RA 1R3LB 2BCKB 4KUZL 5E7FA 4YXHL 3DYMA 3VFPB 3MUZ1 5MENE 4WV1A 2R69H 1J05A 4HIHB 3QJHA 4KDTA 1J0JA 2P45B 4PJFE 2BSRB 5IR1A 3SDXB 2OK0L 1I8KA 4H8WH 4NP4H 1XF2B 4N8VB 2XNAB 2BZDA 4M03A 2YS4A 1FZJB 1DL7H 5CSGA 2HKHL 3X13B 4Z77A 3TWCH 2EDDA 3EOBA 1NCNA 2BY3A 5GRUL 3RWHA 4CJ1A 1YYLH 4OIBA 1MRFH 2FWOA 5E08H 1L7IL 1NL0H 3V2AR 4BFGA 4N0YL 5AWNH 3TVMA 4JFDE 4X7EC 1S9WA 4PJCA 5CILH 3TLRA 4QNPF 3VGDA 1DJSA 4FFVC 2OTUA 1I1AC 2B20A 3HNTH 3MACH 2X4NB 3SPVA 1I8MA 1D5ZA 1MHPH 4PREB 3QHTC 2V7HB 4U1MA 1T5WA 5ENWA 5I8EB 3A6CH 3T3PE 2FBJL 4KDVA 2Q86B 1AXSA 2X89D 1XR8A 4FXLA 4OLYL 5BZWB 4LSVL 4L3AA 3BAEL 3PWUB 1EXUB 1DEEA 4FN0A 3EFFB 3H2WA 7FABL 1J05B 2X4PA 3BE1L 3FQWB 4M3KB 3VXSE 2JELH 1IGCL 4NQXB 3QEHB 1IZKA 2D7OA 4FNLL 4TNVF 2CUMA 1ZMYA 4RFOH 3QDJA 3V9FA 2YKLL 5F1NA 2D31B 1GC1L 2X41A 3VXMA 3WL9B 3TO4D 4NSKB 3BW9B 2FL5A 4P9HL 4L8DB 3SDAB 1WC7A 2XA8L 1DR9A 5DUMH 5MEQA 3P4OB 2DQIL 1JVKA 4LIQE 1XR9A 2GW5A 4JREC 2GCYA 5DJ6B 3VFVB 2XFXA 4N0FB 4ZUVB 3NCJH 1I7RB 5CZVH 32C2A 2R1YA 4PJIA 4JQVC 3C5ZC 4NCC1 2WUBH 1J18A 1NGYB 4EIZC 3OX8A 3KPNB 2V2TB 1AFVL 3TA3A 2J8HA 4U7MA 3PIQB 5BV7C 3ZKSD 1MREH 3WS3A 1UEYA 2I26N 1CICA 1RULL 2B0SH 1ZA3A 4AY0A 4X9IA 3QBTB 2NLJA 4JB9H 5D9SB 4CL7A 1HCFX 3QFDB 4D9QE 3IVKB 4MA7H 4QRSB 2CRYA 4X6CA 1C1EL 4MNQA 4FXGB 2OX5A 2AJ3B 2IAMA 4G8IA 5EO0B 3V8CA 4QHMA 2VLKD 3LIZL 3RHWF 4P23B 3OG6B 2C3GA 2QKIB 2YUWA 2G5BA 3BPOB 1GPOL 2R69L 4XWGH 5E6IB 4BFIB 1FRGL 2YRZA 4Z78B 4U6YA 3SJVB 4Q9BA 4N0UE 1UEMA 4P23D 4PYGA 4M6MH 1J0IA 3NCYS 2BNRB 3LN5A 1T80A 4YUEL 4BQ9A 4I0PD 2O26U 4GW5A 3HAEA 5E03A 2XWJA 1VADA 2VDNH 4NQCE 3HC4H 3QEUB 4KKLC 3CCHA 3CSYA 5HGAA 1NH6A 4RAVB 1XMWA 1MFNA 1G1YA 1S8DA 3IXTB 4P46B 5ID1B 1MCOL 1FFOA 5CILL 4GUPB 4L29A 1ITCA 3FHQA 1X5IA 5SWZA 1T1ZB 4BFBD 2XG4A 1VA9A 5KW9L 1SEQH 4JCLA 1CGSL 3ZDXE 3ZDYE 4Z7QF 1WAAF 1AE6L 2ICES 5JXAL 3OKDB 4I5BB 1P7KA 3FO1A 4MQSB 4NQDD 5D71L 5FM5M 3SCMD 4K7FA 5BVPL 1JJUA 3ALWA 1BFVH 3IETB 3IDJA 1A1NA 3SY0B 4NM4L 3DNKA 3WV0A 3C5ZD 2H8PA 1T4KB 1RIUL 3KXFE 3I02B 2JCCF 5D96C 5E8PB 3VJ6A 3CAFA 4LSQH 5TH2A 4O2EB 1A6WH 1YPZB 1FYHB 1LE5A 3WIFB 3MRBA 1IGCH 3HE6D 4DWHA 5TDNA 2IAMB 4QRPA 3BQUC 4RFOL 3UAJC 1DN0B 2YRLA 4HK0B 1GC1H 4O58H 4YHIB 3D85D 2NY3C 4IMKC 1KCVL 2Z92A 5IBUB 1J0HA 3IRPX 3L3OB 4NKIH 5L0QC 2RQ8A 3RPIA 3FKUS 4EI6B 2D03H 4X99A 2X89A 1GZQA 1KSRA 1DEDA 4JFQB 2NY4C 1UH3A 3RIFF 1AO7B 3GSNA 3BT2L 5FYLE 4EOWH 3MLPA 5BO1L 3DX9B 1K9TA 2DQJL 4OAWA 5SWZB 2WUBL 3LZFH 1K3IA 2XZZA 5IB4B 3T0EE 1J8HE 1QP1A 5HGGS 4X98B 3RVVD 2D0GA 1RULH 2B0SL 3ALPA 4Y16B 5A16A 2Z4QA 2J8UF 3MGOA 4PP2B 5BQ7A 4KI5C 4YBHA 4D9LH 1MPAL 2IBGA 2YZ8A 1KJMB 3MV8D 3D3VD 1KPUB 3KLAA 4NKDA 1K2DA 4K7FB 1BVZA 4NBYB 3NCYP 1CXIA 2XKUA 3TT1L 1V3MA 3VE0B 4AM0B 2Z93B 4L3EA 4ZFZA 4HFWA 4PP1D 3ZHKA 5DMJB 2XTLA 3IJSB 4MS8D 2MFNA 5JMRA 2E9WA 5DUPH 1YUHA 5GGRA 3MZGB 1L7TH 5DJCA 4BH8B 2IWGA 2R15A 1FL6A 1U6AL 5F72S 4YUEH 1NBYA 3Q5TA 1FDLH 5ANMB 3T65A 1A6AA 2V5SA 4IIQA 4WO4B 3LV3A 3NCCB 3QI9A 2YPLB 4R4BB 1OTSC 4OI7A 2X1QA 4PRIE 2VMFA 3HC4L 5E9DD 5IJVB 2VXUL 2DQTH 5C0BD 1MFAL 2D2OA 3BDYL 3BGFC 4HK3J 4KK5C 4YGAB 4RNRA 4DVBA 4ZYKA 1Z9MA 1KJ2A 4M93B 4XNZB 3AUVA 1CFNB 2P24A 4UB0H 3S88H 2ZG3A 4KJPC 1I7TB 5D1XA 4I4WB 4ZFGL 1SVCP 3W0WB 5SV3A 3KPRD 4RA0C 4X9FA 3RGVD 1F45A 4DKEH 1QRNE 3MLTB 1S7QB 4G6FD 4G6KH 4HIXL 1LO3L 2NTSP 1R3IL 1IGMH 4LNVA 1YC7A 4EUPA 1BFVL 3S3PA 4NIKB 5EUOF 3RGHA 1XGYH 4NM4H 4PG2A 4NNXA 1OWWA 1C5BL 3SKJL 2XPGB 3EDKA 3CFBB 3IJYB 1OAUH 3RGVA 3WIHA 4TQEL 2DM3A 4Y5YC 4L4VE 2HT4D 3DWTA 2CKBH 3GBLA 5MENA 5FGBC 1A6WL 3VFPA 3UJTL 2LU4A 4PJDF 1E4XL 3ZDZE 4JFHE 5BZDA 1KC5L 2WBJD 3ZHLA 3V0WH 2YZ1A 3PWPE 4NN6B 4P9HC 4KI5D 4Z0BH 3X17A 3MJ9A 3WFEL 2Q7YA 3ARBD 4OQTH 1S7XA 4E0RB 2Z93A 5HBBA 5CS7A 5IMLB 1KIRA 4WWKB 4O4YL 1JPTL 3PWPD 2XRAH 4U1HB 1F58H 2VL5A 5M7QA 1HKLL 4R3SB 3ZE2F 4G8GA 4URTB 2H3NB 1FZKB 2A0LD 2J4WL 1VHPA 5E5MA 2C1OB 2MWCA 4XBPB 1ORSB 4OZIF 2FR4B 3G5XA 3UTSE 1ITBB 2AEQH 2VXSL 4P46A 5I74C 4PS4L 4ZODA 5E4IA 4F9LA 3LZFL 5F1KC 4RGOL 3WN5B 1RFDH 1ZVSB 5F89A 5B39G 3CDFA 1YEIH 1YJDL 4PIRF 1QBML 2V2XB 4MYWB 4QHLA 3MV7B 1LVEA 5IFAL 4KVCH 1DBBL 1U3HC 1BLNB 1KELH 3HFMH 2X7LA 3SBWA 3BGMB 1QR1A 5C6PB 2FGWL 1CFVH 5D9SA 4KZEH 4TUOB 4HT1L 5H37H 5DZOA 3UC0L 3U1SH 2DM7A 4F7MB 1AQDB 4NHCL 3U36B 2O61A 4JEGB 5GS0H 1E28A 4N68A 4RGNE 5GRVL 1FC1A 1G7LB 3KHQA 5E94A 4X4MA 3R4DA 3PP3H 1FIEA 4ZUTA 1B88A 2Y9RT 3ARFD 5ESAA 5F7NC 1WCBA 2OYPA 1UQSA 2R23B 4EI5D 3WNLA 4XT1C 3RVXC 4Y4FA 3HI6L 3NN8B 1T1XA 4E42B 1MRCH 2DJUA 2DQUH 3NCMA 1FNLA 3NZ8B 3VXNA 2VWEC 3LSOB 2NY2D 4XX1E 4IRSD 3O41A 2PNDA 3GJFH 3OKMB 4JVPA 2FJGB 3FQNA 1BOGA 4Q6IB 5D8JH 2AJYH 4OV5B 2FR4A 4PJEE 3UYPA 4JN2B 3QJHB 1NAMB 1DVFB 2B39A 4ZXBA 4LLMB 4LPTA 4Y1AE 1ED3A 4YDLC 1XGUA 3SO3B 1U8NB 5HHMD 2WM0A 5DQJB 3RDTA 4M93C 4JM4H 4MSWA 1U9KA 4GBXD 5EOCJ 4X5XB 3QIBB 2NR6C 1RU9L 4PJHF 4YFLI 3NZHH 3AFLA 4QHNB 1RZIA 1H3VA 5I1AB 1P7QA 3MV9B 1QHPA 4RMRA 1MLCA 1XZ0B 5EOCH 4PPTA 1O7VA 3L3DB 2BVYA 2O61B 3BSZL 2XKNB 4MDJB 4JVUA 4OIIH 4XTRD 2VQ1A 1TVBB 3BAEH 3UJTH 2HKFL 2JJSC 4PJ8C 1KTDB 7FABH 1WK0A 3LMJH 3V0WL 4Z0BL 2XWTA 1W72H 3HR5A 5ITFB 4HIEB 4YDKH 1NEUA 1VACB 4LBEB 4NKMA 3OR7A 1U36A 1FC2D 4FOMA 5I1IL 4P9HH 3VXOA 1YECH 2DBJA 4H1LB 5JR1L 4F33B 4UILL 3ROOA 5A43C 4KY1H 1JNNL 1P84K 4I4WA 3B9DA 5CJBA 4PGDB 5GIRA 3VXTB 2NY6C 3QCTH 3PWVA 3NCJL 4LDEB 4X99B 5GISL 1J10A 1QRNB 2PUQT 4LQFH 1HHJA 4PJHE 1R0AL 4Z8FL 4K23H 3K1DA 1NBQA 4Q9RH 5I1KH 5DRNB 3OV6A 5BS0D 1X5JA 3H0TA 4H25A 4U4BA 2EE6A 4QXGL 3QXVA 2VLLB 1OAZL 1A1NB 2GJ6A 1R5WB 4HUVB 5JNYA 4UZGA 4MA7L 1Z3GH 5A16B 1IAIM 4R96B 1P7KB 3IB4A 4TSBH 1P2CB 1WUNT 4HT1H 2R2BB 4OLVL 2HJKB 4FQ1L 1IGTB 3KDMB 4TTDD 4PGEB 5E99L 5ITBH 1AGEA 2WSKA 4F57H 1RZFL 5GS0L 1CQYA 1MJ7H 4X6DA 1QLFB 1F4WL 4KJYA 4TULL 1AGCB 3QG6A 4MA3B 3O9WA 4ZUUB 4AEHH 4YHLL 2QSCH 3CPLB 5SWQA 3C2AH 3L3DA 1Q9OA 1PLGL 4PJBA 5E4EC 4PJXF 4M6ML 3GSUA 5CINH 2FX9L 2QQNL 4KV5F 3O4LD 3HI6H 2EH8L 1MRCL 2DQUL 4F2MB 4EI6A 5HTSA 1L6XA 1QVOA 2NNAA 4WW2B 4YZFE 1N59B 2RJMA 1J0ZA 3DHMA 3PDOA 4MNHB 4PRHA 5D8JL 2NXZD 4QRQA 3LKNA 2VAJA 4EQ3A 3OB0H 5FK9B 3KPRB 3EUUA 3ILPB 4MWFA 4RFNC 5IEHB 4PB0L 3HAEB 1ONQA 4YH6A 5E2WH 5DK3A 5I1JH 5E9DA 2NY0C 3D69B 3B6SB 3MBEA 1SEQL 3SO5A 1FJ1B 3QWQB 1AE6H 5JXAH 1A2YA 1RJLB 4YPJA 2K3TA 5E8EB 2KQMA 2I9TA 4WEUD 3VWKD 4W6XB 5HGHB 5F9WC 2O5XL 1EFXD 5EOCL 2MQ0A 4ZUTB 5E24E 1U3ZA 4HQQH 5E6ID 2RGSA 5D7KE 4UI2A 2QSVA 2HT2C 4KVNH 5H94A 2ENYA 1WVZA 3SY0A 3DBXB 5ALCL 1G9NC 1T6WA 5DJ2A 2XIDA 4R2GD 3MBEC 5FCUH 5HGAB 1EHNA 1B0WA 4Y4HC 4PJ8B 1BAFH 1FL3A 5GJSL 5MP6L 4J23A 4O58L 2DLIA 3S96B 4D8PB 4LASH 2XNAA 4X8XA 4JJHA 1BQLL 4J3WA 4Q2ZA 1ZLUK 5JR1H 1B0GB 3VXUD 1JNNH 3OF6A 1FLRH 1A7RL 4KJPD 3RAJL 5I8OL 3QCTL 3B3IA 5F96H 3SJVE 2M26A 4WFFD 5GISH 3RRQA 1YJDC 1DQLH 2VSCA 4HKJB 4RMWA 2VC2L 4Q9CA 2DQJH 1MCQA 1CDUA 2AEIT 4JDVA 3F12A 1X5AA 1OARL 1PGRB 4GKSA 4ZPVB 4Q9RL 2OTPA 1B9ZA 3M8OH 4OZGA 4ZXBC 2R4SL 2VLJD 3QEGL 2WINA 3GMQB 4GAYB 1EA9C 4MLSA 3MRFA 4X7CC 1IAKB 1M05A 2BNQB 1HZHH 1UJ3C 1RZJC 2YD5A 4D9LL 1OP9A 1QNZH 1KACB 1CF8H 2Z35A 1A6TB 3QDAA 1LDPH 3LKOA 1ACYH 1NFIB 3RWDA 2C4FT 3TV3H 4JR9H 1BZ7B 2P7TB 4IRSB 3P9MA 4UQ2B 1F4WH 4YHKH 1FZOB 3PNWB 1PY4A 3HI5H 3MLWL 2VN4A 5DO2D 4F7MA 3C5ZA 5C8JA 3SGDH 2UZXB 3MX0A 3D9AH 1U6AH 5E1AB 3X12B 3VXTA 1F4YL 4ORGA 2YA2A 3C5ZB 5C8JB 1FDLL 3SDAA 4FZ8L 4OD1L 1WBZA 1ZTXL 4OTXH 1G7HA 1QO3A 2RBLA 2VIRA 4G6JL 3VXOB 3DSFL 4XCEA 2AKRA 4K55A 4G6AD 1MQKH 4MQ7B 2XV6B 4X6DF 2ERJB 5B39A 1K8IA 2ICWA 4ZS7L 4NQEE 3ARZA 2KDGA 3RWGB 4U1IB 1FFNA 4LKXB 1F3DH 2QHRL 5D70H 3S5LB 1A7OL 4UB0L 3S88L 2ZSVA 4NC1C 4WENB 4GBXB 4HUVA 1W0YT 2MQ3A 2NY4D 3PV7A 4YXKH 4I2XB 3LEVL 4UT6H 5F21B 3PP3K 4HS6A 5C0RL 3BPNB 3WKNA 1NLDH 5C0IB 4KRLB 5EORL 1KPRA 1EO8L 2ATPB 3SGJA 1EMTL 1UKQA 1A3QA 3MRLB 4X0KB 1T03H 2ADGB 2X1PA 4L5FH 1N8ZA 3L7EB 3ULUC 2VZ3A 1MFBH 1SJVA 2DIJA 2NW2A 4M61B 4MA3A 4L8CA 4NWTH 2NXZB 43CAB 2X4NA 3MLRL 4UNVA 1OSZA 3IFLL 2VE6A 3T0WA 1DLFH 4EI5C 2NY5L 4M61A 4W6YB 2UUDH 2VXTL 2VLKB 3CIQA 2H26A 2RHEA 3DHJA 1MJUL 5FCUL 4Y4FB 4Y5YA 3JZ7A 2F54D 2Z31C 3ZT5A 5CLWA 1T1YA 3MJ9L 2VDPH 2DL9A 1P7HL 3OXRB 3MNVA 4NKOB 1FLRL 5AAWA 3RAJH 2IC2A 2JJVA 5DK2B 2V2WA 5DC0A 2CKBB 2J4WH 2B8OT 4Q6YA 3NFSL 4EUPH 5IP4A 4P59L 4JJ5A 3U4EB 4D9RD 3PABA 1Q9KB 4C83B 5MI0C 2PETA 2H1PH 2IPKB 5C08A 1I1AD 1S3KH 4K7PH 3WIHH 3NACH 4K94H 1BD2E 3QEGH 4UIKL 4TSAH 4HV8B 5BRZE 3QPXL 4NC2B 5IFAH 4Z7UA 3CFBA 1HXMB 1DBBH 3IJYA 4KVCL 3NGBC 1KELL 3HFML 5CP3A 1VFAA 3GNML 1BJMA 1EPFA 5HHOE 3TBSB 2DLFL 4Z76B 4FQJL 2KPNA 5DI8B 1WISA 4JRWA 1MFDH 4PTUB 4ZAKD 3U2SB 2FGWH 1IJ9A 3KPMB 3L3KB 1JL8A 3GHEH 3MFFA 2ZSWB 4YC2B 1UACL 1TVBA 5FYJE 3U46B 4NHCH 2EO1A 4ELKB 4YPGA 1IEBA 5T1DH 5JXEA 5GHWH 5EC1A 4HAFA 4E5XB 3RWEA 4JZJB 2DYPD 4ODVL 4DEPB 1J8HD 3I6GB 1S7SB 4MAUL 1IEBB 2IH3A 4A2MA 1F4YH 1UJTA 2AERT 2Q7YB 2L7JA 4NRZB 1MHHB 2D31A 4OD1H 5J06A 1AI1L 3EO1B 3JTTB 1Q0XH 3MRHB 4G6JH 2OLDA 1EJOL 4PY8J 2JB5H 4LCIH 1F4XH 4PJ9A 4G42A 2B5IB 5INCB 1IRAY 4X6FA 4GLRH 4LCWA 2NW3A 3U0WH 2RAMA 3CFJA 2CD0A 2WMPA 1TTFA 4FXKA 4XP1L 4WO4C 1FVCB 3DV6B 5EO1B 4BK5A 4X5LA 5C0DB 1D9KB 1WT5C 5D1ZA 4YBQD 4HKXA 3H9HB 5KSBB 3WNNA 5AG9A 4K2UH 5C0FA 4HIIB 3EOTL 2ZUVA 3U36A 2FJHB 3PHQA 2H32H 3OAUH 4Y1AD 1TETH 1F2XK 1MNUH 1F97A 5CCKH 5DR5H 3QIUC 1ZT1B 3IDGA 3PHOB 1QFUL 4OJFL 2NY2C 3UP1A 4U3CA 3KPQA 3MR9B 5TGBA 3TP4A 4QCIB 1TMCB 3QRFM 3P9MB 3PF2A 1F42A 1JPGA 4DQOL 1CD9B 1IARB 2VXTH 3QIWD 1TCRB 4YAQB 4CADA 5LCVL 4LRIC 4FQQB 1MJJA 2EIDA 3ROLA 3G9AB 5GGQL 2VDPL 5IW3A 5I1IH 2AXGB 1NMCC 3W5MA 1A1MA 5DJYB 4R2GB 4H8WC 4NCC2 2H2PD 1LHZA 2JK5A 4RAHA 5FK9A 2IQ9L 2LU7A 2VL5B 5J1TC 1OLZA 3OJVC 4Y5XB 1KIPA 5KVEH 3U9PL 2D7PA 1CS6A 4XZUB 3TNNA 1I7RA 4ZO9A 5I1KL 4FFVD 2UVEA 5D2LA 4DAGH 2AK4E 1W0WB 2UV3A 4PLKC 3RDTB 2F5AH 3HMXH 1XIWD 1NGQH 3SQOL 5C0IA 1OAZH 3TBTA 3V4PL 2C3XA 1RVFH 2WINB 3GMQA 3V6BR 4QHKJ 3VXPA 4QYOB 3AXLA 5BCAA 1MFDL 4KHXL 3DVNA 5ESVB 1YN7B 3NGBB 3BPOC 4R0LB 5I17B 4CMHB 5DVKA 4OLVH 1OM3H 4Z7WA 3VXRE 3EYVA 1GVIA 3C6LC 4EUPB 5F44A 3BESR 4L9LB 5H94B 2GK2A 3WLWD 5A2JH 1D3CA 3CXDL 4FQXC 2FZ3A 4K8RH 5B38G 3CDYA 4AEHL 4KFZC 2FIRT 3LS4H 3FT2B 1A6UH 1KG0B 4FQQA 1YQ2A 4LVNC 2X7LB 4WGWB 2EYSA 5CP7B 2P5WA 3ZKXB 3E1F1 5L88H 5LGKA 3ZSSA 3EJZD 2WBJB 3T4AA 1U92B 1ROWA 1T0PB 1A14L 5DRZA 1EHXA 2P1YA 1H5BA 1MY5A 2XN9D 1AQDA 1IM9A 2XZAL 2Y06H 2H45A 3U0WL 5DWUL 5EH1A 1UCTA 4NJAH 2JJWA 4Z78A 1CCZA 3O0RH 3S98A 1JWMA 5IBLC 5ANMA 3UTQA 4UDUB 3SE4A 2FGZA 1MCNA 2NNAB 4UT7L 3OHXA 2DI7A 3FB7A 4ONFL 2OSLB 3QA3B 5JOFA 1KTLB 3IDMB 4RCAA 2G2RA 4Y16A 1JUFA 4Z0XB 2JF1A 4V1DD 4M5YL 3BWAA 4NPYA 3DOSA 1N3NA 3GMOB 3LD8B 4OGZA 2VERN 4X4ZA 3T0XA 3DURB 1U91B 5E9DB 4ZSOE 1HN1A 4TNWF 1TETL 4JPVL 5C0BB 3T08A 1ED3B 2R2BA 3IT8D 2GQHA 2ZCKH 4ENEC 3ZE1E 3AB0C 5E2TH 4G7VH 4OCRH 3BP6B 4XVJL 2YA0A 4MVBD 3TT3H 4CVZB 4IRSA 5GJSH 3DXAB 4WVRA 1S7WA 1OTSD 5JDSA 4LASL 1EAPA 2E27L 1S9VB 2HFEA 5A40E 3VXUE 1FQ9C 4OZFB 2P8LA 5LAXA 3SQBA 3FRUA 4OZHF 3LN5B 1OW0A 1MF2L 2QV2A 2EDXA 5KSVA 2HFGH 3HB3C 1CDIA 4XPFH 4HBCL 1N5AB 1SYVA 4ZO7A 4ZYKB 3B83A 5ESQB 5KVEL 1CD1B 4OD3H 1WF5A 3H9SA 1OARH 3MV9E 5FM8A 5EC2A 1IKNA 3M8OL 3QUZC 3QIWB 4TVSa 3LQAL 3GIVB 5F7EL 3EYSH 2HJLA 2B2XL 1LILA 2VKWA 4LU5H 4AJ0A 3KGRA 3CVHH 1G84A 3BN9C 3IU4H 3WFHA 3TNMB 4LRNH 3T77A 5ETUA 3DPBA 1A7BA 1QNZL 4LCWD 5FGCE 1KGCD 5JW4R 4OZIE 2ZG2A 4YDVA 1FIGL 1CICB 2Y7QA 3TV3L 3QI9C 3DX6A 5IK3A 4XNUH 3RTQB 2EDLA 4X0KA 3QEQA 3UAJD 1FL3B 3EYFA 2AEPL 4G9FA 3O4OB 2V17H 4UV7L 1FV1B 3HI5L 3MLWH 4GW1A 3LKRB 3H3PL 4BZYA 5FGBA 1HXYB 3VFSB 1JN6A 3LS4L 2AJVL 3A0OA 3O3BB 1MI5D 1PD6A 1UH4A 3BQUD 4ODHH 3PQYA 3TH2T 3KYOB 2V5YA 3MRRB 4X6DE 5DDHA 3QDJB 3L5JA 1WGOA 3V6ZB 1G0XA 3EZJB 1SMOA 1ZTXH 4OTXL 2G75B 3VXSB 3GJFA 4OIAA 4XZUA 2R1WB 3SDXA 4Y4HD 5HGBA 4WW1A 3H3BC 1PSKH 1FBIH 3O3DA 1ZHBB 4FRWA 3L1OL 4GRWB 4PB9L 4ZTPH 1E6JH 4DZBB 3RHWK 1CTOA 1H3XA 3TESA 4X7SL 5FGCB 2DKMA 3LEVH 4UT6L 4ONFH 4Z7UB 2X10A 4LSPH 1OP5K 1NLDL 5EORH 3CFKB 4PGZA 5A2FA 4GRMB 4M62H 4RAUB 3VFNB 2ESVA 2YEZB 5ID0B 5DUBA 1KYOJ 3TBVA 4JN1L 5M95B 2EYTA 3RJDA 5LGJA 4P2QE 1BQUA 3HAEH 4NWTL 4QRSA 4FFYL 5C0AD 2VDOL 4DKAA 2VDKL 1A7PL 3VFUA 4Z7VB 5HDQH 3V5KA 4HWEH 1DLFL 2DQFA 2NY5H 1E27A 4I0PB 1CIDA 2JJSA 4FTVD 2WIMA 2XICA 4L9LA 4PTUA 3SGDI 3U2SA 2OBGA 1QOKA 4M02A 1H3PH 15C8H 4OCRL 3ZYZA 5INDB 4WJ5A 2PXYA 1JZ7A 4RGNC 3O45B 3BP7B 5K9QG 1JPGB 1VPOH 3T0VA 3ESUF 4IOIB 1BFSA 2ED9A 3BD4A 3O4LB 4MDJA 1QBAA 4KI5E 3TVMC 3WCYA 3BEWB 4MJ5A 3AMLA 4NZUH 5IT2L 4LEOA 3TJHC 1OB1A 5LQBL 1G9MH 5HSFA 1JTPA 3PWUA 4QKXB 5J1AB 3WN5C 3DMMC 3NFSH 4XPFL 1NBZA 4IMKA 4XXCC 4IRJD 4YGVA 4G8GB 2G75A 4LSUH 1FNGA 3VXSA 4Z0XA 4J4PD 3VFVA 2R0WH 1AGFA 4UUJA 4K7PL 3WIHL 4K94L 3UYRL 4PV9A 1JNLH 1EVUA 4FQ2H 4HKZB 3QPXH 4YXLL 4KKCD 3TNNB 4OI9A 1JGEB 3PGDA 4R3SA 2LE9A 1X5XA 4QXTA 4U1KB 1SMAA 3EZ8A 5HVHC 4PRAB 4H0IA 3EDDA 4M6AA 2VITB 1N3NB 3X3GL 2MHAB 4Y1AB 4YHOH 4OM0H 3N85H 2IBZY 3GHEL 3GZKA 1N64L 1FPTL 4LCYB 1UACH 4N0CC 5B4MD 4JHBA 1T6VN 4YNYB 1T5WB 5KZCB 4WUUA 2QLVB 3NAAL 5FEBA 5L8LB 1MCBA 3TCXA 4NJ9L 3ECBA 3RPKA 1HCVA 5GHWL 4RMSA 1CBVH 2NY3B 3MGTA 5DI8A 4CADB 5DK0B 4H1LH 3KYNA 1BIIA 3MJ6A 4MAUH 4PJ8A 5HDBE 5BVJB 4OSUL 2G5BB 4BFIA 4LLAA 1S78D 4WU5A 1W72B 4YHIA 2YXFA 3M45A 1Q0XL 3X14A 1CDHA 5C09A 2AXFB 1DVFC 1JGUH 2IPKA 3I2CL 3T4AB 1IBGL 4KJWD 5IWLC 1GGBH 4KV5E 3IDIB 3X14B 4JFYB 5FECA 3MCKB 2APFA 1AIFB 4PLJC 3IDUA 4X4YB 1FGNL 4F2MA 5K9JL 3P0YL 4HXBH 4L1HA 1AJ7H 1NCWL 4H88L 4XAKE 1AC0A 3EJYC 4G42B 5INCA 1QFWL 5T1MA 3GJEB 2WV3A 1BWMA 3OB8A 1WAAA 2ADFL 4K2UL 1U3HD 5HHVL 5FOBA 4QEGA 4C56E 1WZLA 4YE4H 5DJ8A 2YPLA 3MLVL 4R4BA 5FV1L 2DQEH 3QQ3A 2C3VB 2N1KA 5GRVK 3T0DA 4JN1H 4R7DB 2JIXA 4ZPTA 4PUBL 1I9RL 3G5VA 4OLUH 1MNUL 3GKZA 1NAMH 4KJWC 5C0NC 1I1FB 3TBWA 4NKDB 4HWEL 1RZKL 2KQNA 1CR9H 3E2HC 1OLLA 3K8MA 2WANA 2QQLH 3C60A 3ARUA 3V0AC 5FKAA 4P3DA 4JZJA 4GH7B 2G9HA 1EUUA 4F80A 3QIUA 4Z7NF 3REVB 1VPOL 1YYMH 4TYUA 1K4CB 4LP4A 1XF4B 2NX5A 1MCSA 3TC9A 1KEGL 2YK1H 5I71B 2ILLA 3EO0A 4EI5B 5CJXA 1M71A 4FQLH 4NO5B 2R4RH 1WIPA 3S7GA 5BW7C 1ZS8A 5B3JF 2IH1A 2DJ4A 2IQ9H 4HW6A 3BP4B 5EOTB 3CSBA 3Q6FB 3BUTA 3Q3GB 4GMTL 2OTWB 3LKSB 3O6LL 5D93B 3VXNB 5IEKA 5HVGB 2YD3A 4M1GH 3SKUD 2IGFH 4HZLA 4Q2ZB 3RVUD 3EYQC 4HS6B 2NY1D 5FECB 2CDFA 1D9KA 1A0QL 4L4VD 4NDMB 3K4AA 4O2CA 4TTGA 5FXCH 2UYLB 4XPAL 1J0KA 1CG9B 3QIWA 5CEZL 3V4PH 4PJ5A 3V5KB 6FABH 2VWEE 1SEBB 4HHAA 4LPXA 4NQDB 3L3IB 5CBEA 4NQEB 3X3GH 2R0KH 3JWOL 3MMEA 4KHXH 3QFJD 3RBGA 3OAYH 4Z7UE 5AYUL 1KLGA 4WNQB 5B8CA 3MO1A 5C0JA 5C7XL 4WDIA 1NMBH 4QOKB 3W39A 4JFPB 3T0EA 4CDHA 4P46D 3P9LA 2J6EA 1A6UL 3ARVA 1I1FA 5DFVC 2DN7A 1VB9A 4G8GD 2GAZA 4PJCE 4WWKD 1RUPL 4Y89A 3ISWA 1J8HB 5DJCB 1A14H 3BP6A 4OFYA 1RZ7H 4XMPL 1K2DB 3BKJH 5E2UH 5H2BA 3OKOA 1KIQB 4PY7B 3L7FB 5GGTH 2IALB 5E0QA 3I75B 2X40A 3UTTD 1T1WB 3PL6B 4Y7MA 3B4NA 1FFQA 3B3IB 1QRKA 1A9EB 5F7MC 5GPRA 2APXA 4MNHA 4FTVA 1FGNH 3DX7A 5K9JH 4I3RL 1HKFA 3VA6A 3CNKA 1QEWB 2VLRE 4OFYD 4UT7H 1AJ7L 1NCWH 4FG6C 4H88H 1LE9B 4F9PA 3UPRB 4N90E 5F7DB 4PBXA 3G04B 4JO3L 5TE4L 4KQ3H 5ADPH 4UV4H 2D3VA 4HS3A 1I7UA 4M5YH 4XB7A 3RWGA 3AAZA 1BM3L 1UM4L 2XWBB 5HHVH 3RVWC 3V6FB 5JPMA 5HHXL 2H2PC 4UDUA 2E7LA 3ARGA 3GSRB 4DGIH 2ZUQB 3D1MC 2HVJA 3IS0X 3QEQE 3RL1B 4JPVH 3K2UH 1AGEB 1NUNB 1BIIB 2BNQE 1C7TA 1RZKH 4QXWA 1CR9L 5L2KA 1I9IL 4S1SH 5F7YC 3JTSA 1XEDA 1IE5A 4FMKA 3RWJB 1DQQA 3LKPB 4YHZH 2VR9A 5DRZB 4XVJH 3ALXA 4QCIA 5TPWH 2XA3A 5AZ2H 3TYGH 3VFOB 3KXFD 5ESAB 1YYML 3F7VB 3BFOA 5CZXD 4D2NA 3FJTA 3V7MA 5J0BA 2IAMC 4EUPG 5D96B 4WEMB 4PRNA 1G6RA 4HIHA 4CDGC 1MI5A 1S9YB 4MWFB 3GUTA 2DYPA 4C58B 1JFQH 2EEAA 3O6LH 5CEXB 1MRDH 3BQUB 5GRWA 3ORJA 1P4BH 4AIZB 4R97C 1UWGH 3QQ9C 5L8JB 4AEIH 4M1GL 4X6CE 3HE7D 2VZ1A 1DANT 4FMFA 2Y72A 4JKKA 3CFIC 4X7TB 1QSEA 1KIPB 5F7EH 2I9LA 2VLME 3NIFE 1WC7B 2HTKD 5F89B 4TUJB 4E41D 4WHYH 4P57B 2NY4B 5D5MB 1I1RA 3W2DL 5D2LE 3PE9A 5EBWB 3MRLA 3QNYB 2DMKA 5DJ8B 1NCDL 3MV9D 2BERA 4D0BB 3DURA 4KK8C 4RBPK 3UBXA 4FABL 1QLEL 3CLEH 4JFOB 3JBG7 5EBWA 1QSED 4OF8A 4ELMA 3CVHB 1C5CH 3QDMD 2A9NL 2BNRE 1CN4A 2YD7A 4CN1A 3QQ9D 1Z5LA 1Q9WB 4L3CB 4UIMA 4ZFOL 2J5LC 1AXSB 4YDVB 3D3VE 3MRCB 4R0LC 1RUPH 2HTKC 1RJCA 1J8KA 1RZ7L 1OB1B 4XMPH 1E4KC 1U58B 1K3ZA 4ONOA 2YSSB 5DC4B 5I19H 2Q87A 4R90H 1FN4B 2YUXA 3TZVB 2EH7H 4HUUA 1ZE3C 1MCPH 4EDWL 3P0VH 4CN4A 1S7TA 1MVUB 1VFBB 3DROB 2DLTA 3IDXH 1WIUA 4WU7B 2FJGA 4IIQB 4WO4A 4UT9L 4XCFH 4ZTPL 3VFTB 2P5WB 3HN3A 5TFSL 4JPWL 4JZNB 1CICD 5I8CA 3BVNB 2X4UA 3QH3A 1QD0A 3GRWH 1AR1C 1FNHA 4ZFOB 4XNZC 3PDOB 1I75A 4WW1B 4WNQA 1I3RA 3KWWB 3CSPA 2P4AB 3UX9B 3KXFB 3WFZA 4OT1H 5I8KH 2OP4H 2MSPA 2VLJB 4QRRE 4JFPA 3OR6A 5IIEA 2W65B 4DGIL 1EEZA 1KENH 5DLML 3FFCE 5C0CE 2H9GB 1IAKA 4MNGA 1BEYH 2VDKH 4ZS6C 3R8QA 1HINL 3QHZL 5C0FB 4R7NA 1NCAL 4PJFB 4ODSL 4JKMA 2X6MA 4HJ0C 3VCLB 3BZ4B 1MCJA 4W68A 5C71A 4KROD 4WFFE 2IALA 2AI0L 4PRHD 3TA3C 1KXVC 3BEVA 3MJ7B 2HT3D 2CR6A 3HNVH 4LGSB 5IBUG 4L8CB 1A9EA 1F3JA 3C2SA 1FAIL 1INQB 1A7QH 3LVEA 3DXAD 1KJ3H 2DRUA 5FO7B 2X4OB 2GY7B 2G5RA 5JXEC 4JRYE 4QWWD 3U0TB 2YMXL 5I6XB 5BZWA 1U3YA 2XWJB 4YHML 1Q1JL 2W9DH 4WUKL 1MH5B 2P43B 4MXQC 3DGGB 4NNYA 4FQ2L 1Q9KA 4C83A 3V4VL 1RZGA 4YXLH 3MJGX 3BZEA 3IDYB 4G6AC 1CLYH 2IPTH 2BDNL 4Q74A 1MY7A 1WTLA 4U1GB 5DK2A 3QZWA 3REWB 2FX8H 3PWVB 2C5DC 4N0RA 4NYLB 1A4KB 3VFNA 1A64A 4QOKD 1TJGL 3OZ9H 1AHWC 4XNMA 3WEXB 4D9RE 3L3IA 1K5NA 5CBEB 4Q9QH 1IGJA 5FOBB 4QTHB 2VB5A 5IVZA 3NAAH 5SX4I 1C5CL 4PJAA 2F53A 3QIBD 3T3ME 5T1LA 4NBXB 3WDJA 2DTSA 1K5NB 4Q97A 3JWOC 1A22B 2DM4A 4ZFFA 3TO2B 1G7MB 2VE6B 1NANI 4OCYH 3CFCH 1S9XA 1D5BB 1TENA 3VGAB 4TNVK 3N1GC 4XP9L 3RTQC 3AS0A 2MKLC 3SHSA 1NGWA 1XGTB 4OLXH 3ULUE 5LG1A 4MB3A 3OKEA 5AAMA 5I19L 1KYOK 1IBGH 1HQRA 1GGBL 3GSXB 5E8PA 3VJ6B 5GRJH 4HFUL 3VD5A 3BEVB 5JO5A 2V7NA 4ETQA 3QUKB 4BH7A 3C5JB 2LAAA 4JKPL 3I75A 4HPYH 5HI4C 3E6HA 5T3XD 2UY6A 3T04D 3WFDL 3AREB 4GKSB 4ZPVA 4KRNA 5T3XH 3QNYA 4CU8A 4YX2H 1G0DA 4PJ5E 4LARL 5DJXB 3OKLB 1CXHA 3MOAH 1A9BB 2EDRA 1QQDA 5I8KL 4HHAB 2J2ZA 5ABDE 3GK8L 3V95A 1PG7L 1LP9F 1VFOA 3PJSA 3MRDA 1U8OB 3L3KA 1KENL 3STZA 2H32B 4M7LH 5E8NB 4NDMA 5AUMB 1RZJL 4LVOC 1I9RH 4JLRB 4OLUL 2ZP0T 4A6YB 1KTLA 3TBSA 3FB8B 3QR2A 1JGLH 4XRCA 3WIIH 1JHLH 1Z0MA 2HWZH 4ZOEA 1G7IA 2ZUYA 1ZK9A 3QUMH 1Q94B 5IW6A 5EU5B 2A6JA 4HLJA 5ICXB 2B4CC 1WZMA 4R26H 1UVQB 1X5ZA 4LOUD 4WTXA 2VR5A 1UWEL 4LPWA 5F7KC 3WD5L 4XPBL 4JFZL 4X4YA 3G6JA 2YK1L 2CMRH 2ZNWA 1U58A 3C09B 3ZYIA 3IFOB 2ARJB 2AV1A 1YMME 5I8CB 4M1CD 2GFBB 3HLAB 4U1SB 1ES0A 3N1PC 5ISZB 1A6ZB 4LMQI 2X2YA 3D0VB 1M71B 4JFEB 2VLKA 3CFJB 5DEGB 5JZ7D 5IEHA 5I18L 1ZHBA 5ICYB 1S78C 3KPSE 4XPAH 2XTJE 4I77H 5F3BA 1ZHKA 5FUOH 4DVRH 4G7YH 3WNMA 1WBXA 5HHMB 3OGCA 2FX8L 3ARFC 3JWOH 1JGEA 3QFJE 1TJGH 2R1YB 4CVWA 3OZ9L 2BY2A 2GSIA 2V6HA 4Q9QL 1NEZG 3P9WB 2EKSA 3E3QE 5I66A 1Q0YH 5HJ3B 1AHWB 4KZDL 4J4PA 2Z31B 1O7SA 1VDGA 4XNXL 4GG8A 1IEAB 5JQ6H 1YPZF 1KB9K 3RGVB 1T83A 2DIBA 5DJ0A 5EPMA 2X4SA 4E9LA 3CFCL 1Y0LA 3RX7A 3KDMA 3UYOD 4MD5B 1NGPL 5A2KH 3BKJL 3JUYA 1MCLA 5CLTA 4K8RD 3F7PC 3K46A 1BD2D 3G5ZB 4WHTA 1NAKH 3K3QA 5JHLL 1LO0L 2QADD 1FFPA 3GI9L 1GGYA 5IFHH 4OD2B 4R6UA 3LRGA 3GFUA 3RUGA 4DGYH 1VGKA 4GRLD 3FT2A 4XNQB 1FG2B 4HPYL 4R4ND 1UJ3A 1LWRA 2W07A 3FQTB 3V5DA 2JCCA 2ICEA 1GAFH 1W72A 3HCVA 3BIKA 2AABL 5IJVA 3FTGB 4LARH 4GG6B 2A6IA 4P2OA 1RZGB 4ZAKB 2A0LC