3KNBA

Crystal structure of the titin c-terminus in complex with obscurin-like 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
PGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/structural protein
molecule keywords Titin
publication title Molecular basis of the head-to-tail assembly of giant muscle proteins obscurin-like 1 and titin.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 98
sequence length 98
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3knbA00
2BNQE 3C2SA 3IRZA 3F7RA 1B2WH 2HT2D 5GISL 1GJIA 1T83C 5I1AB 2X41A 1MLCA 3LN4A 5IG7A 4U1NA 1CXKA 3ARGD 1BJ8A 4PRIE 4U1IA 2WINA 4J3UA 1V7NH 1QR4A 4LMQI 1MPAL 3B8SA 4S2SB 1RUML 1D5IH 3KPRE 4PRNB 2NTFB 2R4RL 5E70A 2BSED 4JVUA 3BIKB 1JYXA 2OSLA 3K4ZA 4C83A 5I30H 5TDPB 2KZ1B 3IXTA 4NJ9H 5DMGC 1B4JL 4HK0A 1UH4A 1E0OB 4JM2D 4ORGA 5I1KH 2JJVA 4HJGB 1P7QD 1PW3A 3B9KD 1TJIH 5BS0B 5FYKH 4GBXD 3MOAL 4LHUG 1NANH 1S9KC 4KJWC 1TNNA 2BNUB 4JKKA 4Y5XC 5IVXF 2CDFA 4PJFB 2CK0H 1OP5K 5HHVH 2J6EL 1GGBH 4NM4H 4NJAH 1KJ3H 4YNYA 1YMMD 5F7MC 1QBLH 5KVGH 5D9SB 1QFPA 1RZ8A 1YNTB 2NYYD 3V4PH 1VFBA 4XH2B 2KDGA 4KV5E 1U8OA 3O6KL 2N56A 4QYOA 1A9BB 1DQTA 4AEHH 1KENL 1BEYL 1CQYA 3DARA 5EU5B 4P2QD 3HC4L 3QUXC 1MRDH 1BJMA 2P47B 4WFFD 1U8NA 4EI5D 2ZNWA 1IKFL 3MRMB 4G42A 4HUUA 4MXWL 1DDHB 4F3FA 3G5XB 4G9DA 2W9DH 3OR6B 1D9KC 3KJ4C 1GGCL 1MCLA 3E6HB 5J1SC 4KGLA 4YHKL 4XCNB 1PEWA 2H9GA 2R29L 4MJIB 5ID0B 1ITBB 1IGYA 4ODSH 1X5XA 3RDTA 3O3AB 5FYJL 1YEDA 4AEEA 3CFKB 1OTSD 3FQTB 1ES0B 1WIUA 3H9SD 4TVSa 5IM7A 3G6JA 5HHMB 5MENB 3DGGB 2MHAB 3EYVA 1JZ7A 3EGSA 3O9WC 3V6FA 2PXYB 3D0LA 2VDQL 5FO8A 1A3LL 3CMOH 5AD0B 3V0VB 4OSUL 2ITDB 4ZODA 3O45B 2VAAA 1U8IB 3L3GB 3TYGL 4UT7L 1KB9K 1I7TA 5EBWB 1J0JA 4F9LC 4PJAF 3T2OA 2QADD 1MFDH 3V4VH 5EOCL 5MEPA 3KPQB 5IROA 3RUGF 1FE8L 2I60L 1YECH 5GGTL 3MO1A 3KDMA 2F54D 2J8UA 2UZIL 5GRUH 1JVKA 3VRIA 5J1TC 4XVSL 2ZZUT 5BS0D 1Q9OA 2A6DA 1F02I 5TH2A 1U3HA 2VH5H 1MCIA 4DEPC 4JRYB 3VFUB 1C8PA 1CFVL 3A67H 3MV9A 5HHQA 3QXAA 5IHBA 3BZEB 4FXGB 4LCIH 4P46A 1JGDB 4X9BA 2R1WB 2D4DA 2Z31B 3D3VE 1T3FB 3SOBL 1OT2A 4G8FA 1JN6B 1S9VB 2HJFB 4WFHE 2W0KA 5ALBL 3RTQC 2ZUQB 2GJ6B 3G5VB 4S11A 4JE4B 5C6TH 4LVHB 4PREB 1H3TA 1EERB 1FBIH 3OXSB 1JPSH 4XBEH 1RZKC 2XZAH 1TLKA 3NFNB 4QRQA 3T3MF 2VB5A 3S36H 4M5ZL 3ARWA 4F33A 3QH3A 4YAQB 1A7RL 4GAGL 1IGIH 3VMPA 1NKRA 1U3YA 3UPAA 1I75A 3RVWD 1LDPL 1A14L 5BMFL 3CSGA 1HQ4B 1N7MH 1IC1A 3G6AB 3MNZB 4X6EA 4KV5F 1G7MA 5D6CB 3RQ3A 3QCTL 3F7QA 2VN7A 4ZSOA 2VQUA 4WW2B 3AFLA 5BJTA 2XFXB 3SDYH 3GJFK 4PJCB 3VFNA 2HFEB 4MJID 2BK8A 4JQXC 4WU7B 2FX9H 2VLJA 3C6LD 1KJVA 4R0LC 3BEVA 1IEBB 4ZAKB 2QSTA 5I19H 4GXVH 3RIFK 5JOPD 2IANB 1OAYL 3R1GH 5INDA 5I1HL 1MY5A 2ICWB 2WWKO 4MHHG 4P9HL 2P8PB 4IRSD 1RIUL 4P57A 2XI9A 2PXYD 4LL9A 5GRXG 4G3YL 5K9JH 4POYA 4M61B 1AC6A 1NC4A 1J1XH 3HG1A 3FT4B 2X5PA 5ISZE 2ZSVA 1F90L 1BD2A 1I9JL 5I15H 5K9QI 5D7KD 4OLVH 5D8JL 2H26A 1UM6L 4LBEA 1AKJB 3JUZA 2NY0B 4PJHE 3S36X 1KULA 1BIIA 2DTML 3JWDL 5I1CL 5LQBL 3W5NA 2W0FA 2EE3A 1K5NB 8FABA 4XWGL 5EO9A 4MS8C 4Q9CA 3JV6B 5JZ7C 2VZ1A 2XQYG 1AGDA 5D1QA 3DXAE 2RGSA 5D1ZC 4N0UA 5CBEA 1WSST 1KCVH 3MROB 1QSFE 1P53A 1A1MB 3TH2T 3IAQA 3IETA 3UYRL 4ZTOL 4GKSA 4Y4HD 3VE0A 5EO1A 4M43L 4ZXBD 3AMLA 4JY4A 1NMCB 2GJ6D 3WE6A 4CL7A 3PL6A 1TZHA 3GJFB 4XPGH 1DEDA 5CUSL 4JLRA 1YYMH 3VJ6A 4CADA 3S7GA 3KWWA 2NQCA 4PBXA 5HYJB 4HPYH 4RMRA 5HHXH 5FKPB 1J10A 1JTPA 4XP6H 3U6RA 1H3XA 1O7SA 1R3JA 2VZUA 5L2KE 4JN2B 4KJYA 5BQ7B 2XY2A 4G9FB 3DI3B 3BKJL 2F53D 5CIPB 4PRDB 1JWUA 4PGCA 5CLWA 5LWYL 4HD9A 2QQNL 4HDIA 1OTUC 1Q94B 3G08A 5DUBB 5HGAA 1KLGA 2F58L 4NHCL 5EZOH 2FEEL 5DZLA 1U2HA 4P2OA 2QTEA 1WEJL 2VLKA 3ZYZA 4DTGH 1MAJA 2EXYD 3I75A 1RQ5A 4R3SA 4CVXA 3RPIB 1KTRL 1P4BL 4KVNL 3M45A 4PLKC 1H3VA 2OJEB 2VMFA 4YHOL 3GI8H 5L8LB 1WAAF 5A3IC 3I50H 1FLRH 1SJEA 2O5YH 4ZAKD 3CVHB 3K46A 4ZFZA 4OUUB 2V2TA 2AXFA 2QV2A 4OCYH 4BZ1L 2OJZL 2IAND 1FL6A 1G6RL 3FFDA 2G60H 4P4RA 1PX4A 4ZMAT 3MMEB 5EC1A 1I9RH 1NLDH 5DJCA 4J12A 4R8WH 3GSVA 3MXVL 5ESAA 4PJGB 5C07D 1LD9B 2ZUWA 3WHXA 5E08H 2NY0D 4Y19E 5SWSE 1C08B 3RKDC 3HUJA 4C56A 4K94H 3NH7H 1HSAA 5T3XL 3VA2C 1XF2A 4B7IA 4DW2H 3UTZA 1RULH 1FGNL 3MUJA 5KVFL 1EFXA 1MY7A 2WSKA 1MHEA 4YHIB 4D8PB 1HHGA 4KQ4H 5JPMB 1B0WA 4KROD 4P59L 4JN1L 3RX7A 1JPTH 5F70A 1JGUL 1UXSA 1MWAA 3PJSA 1VHPA 4Q6IB 4FRWA 4FHBD 4PJHF 3GMPA 1OAZL 3GSUB 5AWNH 2UUDK 4YR6B 5BRZD 1S9WA 2GCYA 2GITB 4RGMC 4LSRL 3GNML 4PRHE 5HYJD 1TCRB 3SY0A 4AM0B 4V1DB 1IM9A 1ZT1A 2VXUL 4ZO9A 1Q0YL 5C0JA 5DD3L 5EFIB 1FG2A 4LPUA 1CF8L 2G2RB 3GI9H 3QDME 4HBQA 4L4TE 3JVGC 4ESKA 4NQCE 5D71L 2Q8BL 3DSNA 1S7QA 4PJBE 3QXTA 2XA8H 1MCCA 2FIRT 1MCWM 1N2RB 5FB8A 5IBUG 4HHAB 1E27A 1FFNA 1K4DB 3GSOA 4R7DB 5A16B 3GSNH 3TWCH 5I18L 1RZJC 3PDDA 4FQHA 2OTUB 5DRZB 2OR9H 1DVFB 1MIML 2Z8VC 2ARJQ 3QCUH 3MA9L 4PP2A 1NCDH 1HI6A 1Q9WA 2R0KL 2E6PA 2B2XH 3KPSE 4WHTB 3O4LE 4TUKH 3JWOL 1K2DB 5FUOL 2Y5TB 5CJQH 1T03H 3C8HA 3SBWC 4LSVH 4M5YH 2IGFH 2IF7A 3MC0A 3MZGB 1QR1A 2APVA 4G8EB 2H3NA 4X4YB 3E0GA 6FABH 4L8CB 2DQHL 4G7YL 4XBPA 4XMKH 3B2UC 3DVGA 4IJ3B 4MJ5B 1ZHLB 4OQTA 4FXKA 5F7EH 2YRZA 1ORSA 4MD5A 4KDTC 4S1RH 5I9QB 4OCSL 4NKIL 4O58L 4LNVA 1VFMA 3MV8A 1N6VA 4UV7H 3STBA 3D18B 1Y0LB 2V9RA 4P2RA 5D70L 1SVCP 5T1LA 4J1UA 4XNXL 4IS6B 4IMLB 2I9LA 1CE6B 4ETQB 2UWEB 2RFXB 4KK8D 1CFNB 3WIIH 1FV1B 1NGZA 2GT9B 2CD0A 2YPLB 3QZWG 4AT6B 3L3KA 1JGEA 2BJML 3ZSSA 4Z77A 1R0AH 1N5YL 4XAWL 5IV2A 3ZE2E 2LV4A 3VWKC 2GJJA 1JFQH 1B0RB 3GSNA 4OB5L 3ZKSD 1Q38A 1TVHB 4P3CL 1CZ8L 2IPKA 4RBPH 3CFJB 4LOUC 4XCFL 4ENED 1LO4L 4V1DD 5D7LB 5E2UL 1U8JA 4NBXB 2VC2H 1HILB 1QVOB 2P42B 4PRPA 8CGTA 2FEDC 5KTEH 3MBXH 5BV7B 1PYWB 1FPTL 4E0RA 4E41E 5I8EB 2GHWB 1R5VA 4AG4H 3I6KA 5LVEA 3WD5L 3C60C 4KI1A 4LEXH 4K9EH 2ERJB 3I9GL 1RURH 2G9HB 2HA1A 3A6CL 5BZDB 2WUBL 3KPPA 5EUKA 1UGNA 3HE6A 1EPFA 5F88A 4I0PA 4LCCB 4XI5D 2C26A 2Z8RA 1WITA 4ZQKA 1FAIL 3FOMB 1CU4L 1F13A 1DE4B 5JQ6L 4LF3A 1JRHH 1G7LA 3VFWB 3IDXH 3BRGC 4LQFH 2C9AA 3OGCA 5MP6L 4XHJD 1XIWA 5DRWB 4GG6A 1TVBB 1NCNA 2PTUA 4LKCA 1ETZB 1TIUA 1TZIA 5KSAC 3KPOB 4PS4L 1JRHI 4KI5D 2O5ZH 3WIHL 1CD1A 2LQRA 4IRJB 5JHDD 2GW5A 4IIQB 4OBRA 3U1SL 5C2BL 5I8CA 1MVUB 3F7VA 4DKEH 2NXZB 5HHOA 5ERWA 2Y7QA 3IU4L 2UY7A 3ARUA 3MV7B 1SBBA 4DQOH 3OKOB 4F7EA 4P23D 1Q9KA 3T2NL 4XNUL 5HVGB 4HIHB 1NGWA 3NIFE 1PY4A 4OKVA 1T2JA 3BPLB 3MACH 3NABL 3U79A 4JHWL 3IF1B 1MCQA 4QF1A 5DJ8A 4ZS7H 4JFEA 5CEZE 1FL3B 1NC2B 1VB9A 1EHLL 3DYPA 2LU3A 5L8KB 1QBML 3FN3A 3GK8L 2DD8L 3UZEA 4K3HA 1A4JB 1EEZB 5IFJA 1A1NB 4ODXA 1IQDA 5MERA 4TULH 2FGWH 2BY2A 1N0LA 4Q2ZA 3P9MB 2ZSWA 3V7MA 3HNSH 5BVPH 1Z3GH 3GIVA 3EOTL 4X5XA 1NKOA 5JDSA 4O9HH 5C0CB 1WCBB 3ZE2F 4NKOA 3QIBD 15C8L 1RJYA 2FWOA 1T89C 3MRKB 2DBLL 7CGTA 1CWVA 4XNZB 3V7AE 4XNMA 4TRPH 1AO7B 4Y5YB 4HUNB 3SHSA 4QRRB 1WISA 1RZFL 3ZHLA 4O2FB 4NKDB 5ESVA 4JANA 3D85A 1V3MA 2L4OA 1J05A 1LEKA 3NPSC 2V2WA 4N8VG 5FOJA 3KLAA 4NBYB 4MNQE 2BOBA 1T22A 1ZTXL 2VQTA 3RI5F 1D3CA 5B38B 1U8LA 5C1MB 5GSRB 1YNLH 4JR9L 1XGPB 3S37L 1DLFH 2V5TA 3BP4B 3RHWF 5DJ0A 3RVUC 3QPQD 2GYSA 4LEOB 4OD2B 3TIEB 2IALB 4ZOBA 1NFIB 1NGXA 1A22B 2K1MA 3ARED 2NXZD 2IADB 3FRPG 5FDYA 4XTRC 1L7TH 3NFSH 4YHMH 3T09A 4LHJB 1G1YA 1J5OL 4JFXA 3G6DH 4A2MA 5IVXB 2VDKL 5JXED 2E8YA 3QXDA 3RZCB 4YBQD 1PG7H 4Y2DA 4NOFA 5T1KB 1T7VA 2M2DA 4WWID 5JW4N 2VJXA 3DPBA 2F5AL 5A43C 3I3EA 4Z7WA 2ED9A 5B4MC 3QXWA 2MKWA 1DFBH 1D5BB 2JJTA 3V5DA 1GOHA 3NCYS 4LHUB 3FRUA 3C6SA 4LLDA 4RNRA 1K9TA 2EYRA 1A2YA 3MRDB 3TV3H 1MLBB 3ZZ1A 2O5XH 4CGTA 4J8RB 4NQDA 5C7XH 1BOGB 4XVUD 3S96B 1LO3H 2OLDA 5C0AB 4OD1H 4X4ZA 4QHNA 4JG1H 5HYSA 4RFNB 1BREA 4XCEB 3DX8B 3T0WA 2A74B 2UYLB 3EUUA 3MLUL 5ITBL 3NIFF 5IB1B 4OLYL 3MRFA 5I1DA 4X6BA 5C0GB 1KG0B 1INDH 3O6FD 4FP8H 3VFOB 5TE7H 2GSIA 2BSRB 2YRLA 4FABH 2APFA 4TSAL 4FA8A 2NLJA 2WAHA 3ARZA 1IGJA 1UT9A 1G6VK 5E2WH 2XPGB 1AO7D 4P3DB 1KB5B 1QQDB 2KPNA 1ZHNA 1WBZB 2W9EH 2CDGB 1IEHA 2XTLA 3MJ9L 2XNAA 1I8MA 1EJOH 1HEZB 5CINH 3ZKXB 1H0DB 1TFHA 2B0SL 3BPNB 3SKOA 2EYTA 2O61B 3G5ZA 4ELMA 5ACZA 1H5BA 3D87B 1XT5A 1LEIA 4UV4L 5DMGD 4XPAH 2V7HB 5FM5O 1P2CB 4L8BB 4UOW0 4PJAB 3AGVA 2PR4H 1RUQL 3CH1B 3UTTD 3IDYB 3SJVD 3BGMA 3OKKA 3RUGB 2BMKB 1OGAE 3HC3H 4NQXA 4ZO8A 1C1EL 4O2EA 4NFDA 4R97B 3TESA 1OOAA 1EEUA 4ZUSA 2BSTB 5DTFA 3MJGX 1J8HD 5CJOL 1N5AA 1MFCL 3PHOA 2FHFA 2YC1B 5DEZA 3IDNB 4HIXH 4M1DH 2Z92A 1YY8A 2FB4L 3RL1A 3IS1X 3BDYH 1EFQA 3RBSA 4Y4KC 2AV1A 1IAIM 4PB0H 4OFKA 5HPOA 2X9XA 4P4KA 2AEWA 4XB8A 3M07A 2J88H 4LVNC 4PJ7A 4MCZB 3SO3B 3D39A 5DD1L 3H42L 1V5JA 2R2HA 3GMNB 4LLVB 3V6OA 3QUXD 4MJ4A 3X13B 3MLWH 3GMLA 2J4WH 2BNRD 3MRQB 3U4EA 4HUVB 2W1NA 4L8SA 3R8QA 4BK5A 5EZIH 4JFFE 2GK2A 4WUUA 3FO9A 1IGCH 5FAAA 2ZCHL 1D9KD 2AV7A 2YN5A 4GXUM 4L4VB 1BLNA 3UO1H 5IJKC 2DIJA 2XQYK 3W5MA 3L5XL 1LILA 1X5LA 3CJJA 1XCTB 1UM5L 4KZDL 1DQJA 2FH6A 1TZGH 3NZ8B 3PV6A 3QI9B 4KRLB 4ELKB 3ARFA 4KKCC 4XPTH 3QA3A 2BVTA 2AK4D 3SE8L 4YGVB 3FMGH 3O9WD 3WHE1 3D0VA 2NW2B 1MCBA 5DLML 1ZLUH 1E4WL 5DI8A 3D69A 3B5TA 3AM8C 4G6KL 3T0AA 5GGRA 1KJ2H 4MAYA 2CGRH 2EIBA 2BNQD 3RAJL 3V0AC 3C09B 4K7PH 5E8NB 2QKIA 4OI7A 2BVYA 5FK9A 1LNUA 3ILPA 3K8MA 3IU3B 1AP2A 1JNNL 4GW4B 3W39A 2C4FT 3H0TA 1E28B 1VGKA 4HS8H 3EYOA 5IB5B 5D1ZB 5IR1A 4RWYH 3EAKA 2KL6A 3KPRD 1YJDC 1N6QL 4RZCB 4ISVA 3FN0H 4OFIA 4JZJB 3TEUA 3GMQB 1UFUA 5H37H 2MWCA 3VFGL 4D2NA 4QRPB 1RZ7L 3TVMA 1DUYA 1FZKA 3E2HC 1DQDH 1S7WA 4PJIB 4JGUA 1JK8B 3ROOA 1OB1A 2EDXA 2Q86B 4X7TA 3RTQD 3SE3C 3GMOB 4WUKL 2Y07H 4KH2A 4JFZH 2X4QB 4WW1A 3CXHK 1S9YA 1B9ZA 5DVKA 1U0QA 4EXPX 2XQBH 1IQWH 1T0PB 4HS3B 1GZPB 4NKQB 3QCVH 5JNYB 2AABH 1VDGA 1MCSA 4U1JB 4XCYA 3S6CA 3LQMA 3L6FB 3TBTA 4I5BB 1KJ2A 1JHKL 3ARRA 3QT2A 4HAFA 4OZGA 1NMAH 1R3KB 5HYQA 1CLZH 2IH1A 4N68A 5ANME 1FVEB 3DHMA 3QEHB 2OK0H 4DZ8B 4ALAH 5DK0A 1MF2H 1OARH 1BFVH 3T0EA 5JQHC 2D7TL 3HI5H 4NN7B 3AB0C 4M00A 1WIOA 5D4QA 4MQSB 5KSBE 1KC5L 4KHTH 3HI6L 5JIPA 4BKLA 4P48A 1YNKL 3Q2CA 4WI4A 3ALPA 4Z7OE 3DMMC 4O2CA 3QULA 3KNBB 3D9AL 3V8OA 1GOGA 2Y36L 3MRLA 4HT1H 4DVRH 5HDQH 1AIFB 3BPOB 1XH3B 5SX5H 1AHWA 1T1ZB 1IZJA 4PJ9C 4KUZL 2ZWLT 4KRNA 1AGFB 3V0WL 5ALCL 1OAQH 1MCOH 4DAGH 1JP5A 5FGRA 2A9ML 3B9EA 4LHQB 3BP5A 4QHUA 1IAII 1BX2B 5D96C 4MS8D 1C5CH 1B3JA 4HX1A 4DGIH 2VO5A 5D1ZD 5J9PA 2NZ9C 3W0WB 3BO8A 1CBVH 5I1IL 5E8PA 2VZTA 2NY2B 3VH8A 5ISZB 1T6VN 3D6GA 2DQIL 2VABA 1WIPA 4YWGH 2VDLH 4YEEA 4EN3A 4M7JL 4PJHB 3AUVA 3O6ML 4JZOB 4M7ZC 4W68A 1AXTH 4X80H 5GS0C 5I75C 5I74B 1F11A 2J2ZA 1OF2B 1UJ3C 1YEIH 5DYOB 3CIQA 4YZFE 3Q6GH 4S1QL 5E8EB 4YHPB 2AVGA 1BAFH 4H1LB 1T0NA 2E7LC 5CBAB 3S5LA 5A2LH 3EO9L 3D3VD 1AD9B 5E2TL 4IMKC 4M93C 5C9JA 4PJDA 1OTUD 2NXYB 1C12A 5HI5C 1FFQA 4M4RA 4MXQC 5BV7L 2R1YB 2HH0H 3TJEH 2CKBB 4BA8A 4WFHD 1L6XA 1WK0A 2VSCA 2QSCL 3FB8A 4NRXB 5EU3A 1CL7L 1UWXH 3LN5A 4NNPL 5E9DB 5LGKA 4PLKD 2WBKA 2ZCKH 2QJDA 1K8IB 5AG8A 1IMHC 2YEZB 3HLAA 4TUJA 4D0BB 1G0XA 3ULVH 4MB3A 4JM4H 2EH7H 3DROB 1JPFB 3L1OH 4Z18A 5A3ID 5EOCJ 3RY6C 4EDWL 3NTCL 3O3DA 4TSCH 3CDCA 4U6XA 5HYIA 1KEML 2DOCA 1AQDB 1U6AH 2ADIA 5IBTL 2NNAA 1D6VL 1JYNA 4EBQL 5IBUB 2FDBP 1MRFH 1WVZA 4U4BA 3E8UH 1ZHBA 4P9ML 5A2FA 1EEYA 5IW3A 1H15B 4I3SL 5GGRY 1LWRA 4OZIA 3RKDD 1WUNT 3PWPE 3OKDA 3IAPA 5ADOH 1HH6A 5BW7A 4AEIL 3P2TA 2JB5L 3QUZA 2VDML 3P73A 2NCMA 4XVJL 5IGXL 5KSUB 5HHPA 2WM0A 1MEXH 5C3LD 1IEAB 3HMXL 1T1XB 2A0LC 3WFBH 3QG6B 4D0DA 4GRWH 2A83A 5GHWL 3VMOA 3DO7A 4M7LT 2VXSH 1S7SB 1H8SA 3PWJA 5ISZD 4JHAL 4F7PA 1XR9B 3O2VL 1CGXA 2GAZA 4LSTL 3MRNA 4GRLC 1M7IA 1QFHA 4LU5L 1IFHL 2PCPA 4FFZH 2LAAA 1GGIH 1RHFA 3Q0HA 4M6ML 4OI8A 2A77H 2JK5A 4YHNA 3QHFL 3ROLB 1GC1H 3AS2A 3UPRB 3OF6A 3LKNB 1CICB 3DXAD 4ONGL 4OFPA 2OX5A 1C5DA 3O3UN 3QZWB 1J87A 2D31B 2X40A 1ZT7B 3GMRA 1L9MA 1QSFD 5GJTH 2B1HH 1CLYH 4B53A 1REIA 2HJLB 1C16A 4J6RH 1BBDH 3FCTA 1MH5A 1TITA 4YHYC 1JF5A 5I76A 4PD4K 3C87A 4YE4L 4LMQE 1A3QA 1MPAH 3CFBA 2DLFL 1HOCB 5CILL 5DDHB 4M62L 2R4RH 3C5SA 5FO9A 3HMWL 3IJYA 1PZUB 1ACYL 4NZTL 2ENSA 2IFFH 5L2KD 3LEVL 2PYEA 4FFWC 1AY1H 3SPVA 5F9WB 3N0PB 1X4YA 3M17B 2EO9A 4ZFOA 4J4PC 4OLEA 1R3LB 4QOKB 3O3BB 4L1DA 5FM5M 3S3SA 3PIQB 5FOBB 3MJ8B 4E5XA 1B4RA 3B8YA 3KPNB 5CJXC 3BUYA 2OQJB 3QUMB 2Y5EA 1R24B 3MBEC 2MSPA 2EIZA 3N1QC 3TO4B 1T1YA 3VXQB 5F7UA 3JBG7 3MOAH 3B2UD 4JKPL 3B6SA 3IDIA 4YO0B 5D1XC 5IOPA 3V4UH 3HFML 3VFRA 5CP3H 4XNQA 5FYKE 4I48B 4MNHB 5D2NA 3QUYB 2DF3A 3OXRA 2Q8AL 5CLTA 4ZD3H 5AYUH 2GUOA 2L7UA 3EYQC 3RI5K 5EORL 5TGBB 5FF6A 3HA0A 4U0QB 4JO4L 3G6JE 2FZ3A 2R0WH 4NQSA 3BZFB 2HAZA 3O6KH 3RHWK 1G9NL 2QHLA 4IDJL 3VWKD 1DEEB 3QJFB 4HK3J 4Y19D 5SWSD 5KS9B 3FQWB 3ME0A 3HC4H 5HGBA 3UTSA 4GW1A 3PDOB 1DLHB 2NPLX 4WY7L 2IEPA 4QRTA 4I9WE 1CI5A 2OI9B 2PTTB 4MXWH 1ZLWH 3X14B 1FZMB 2J8UE 2FEDD 3MUY1 2AJXH 1GGCH 1XF5A 3D1MC 4D9QE 3MV9E 5IKCB 2MCPH 3VU2A 2AXGB 3C60D 2P43B 2R29H 4Z0BH 1IM3B 3OPZL 3K2MC 2R56L 1UWGL 3H2WA 2LABA 2R2BA 1ZHKB 3SDAC 5E24E 3IFOA 2VE6A 5FYJH 1GRWA 1AFVL 4PRHD 1HHHB 3MRIA 5CP3A 5JDJA 5KVDL 1EHXA 4JPWH 2QL1A 2UZYB 4RGNE 2VDQH 1A3LH 4BK4A 1P84J 3QDMD 4OSUH 5E00A 1KIPB 4CMMA 4MA7H 5C6WH 1JUFB 2X89D 4L4TD 2V9TA 4UT7H 3W82A 5C0EA 1ZS8A 3CLFH 5KSAD 4NQCD 1DSFL 3CZFB 5F3HB 3I6GB 5INCA 5EOCH 1J12A 3NN8A 3HNTL 4WFEE 4AL8L 5GRJH 1RHHB 1FE8H 2F74A 2AQ3A 1WCQA 3VXMA 2UZIH 5CGYC 4XBGA 2LTQC 4N8VB 1U8PA 4RQQB 3CFIC 1ITCA 1CFVH 5D7IA 4ZSOE 1FGVL 4B41A 3BHBA 3DOSA 1D6EA 1I8IA 1EX0A 4F15B 5FEBA 3B43A 2DKUA 2X70A 5C0DA 2VR9A 4R2GC 2E27H 3KPSD 4OZFA 2J1KA 2VLJE 2FJFA 5DK2A 3O4LD 3MA7A 2VL5A 5DHVH 5KW9L 5ALBH 4U2YA 1NAMB 2V6HA 4OM0H 4WDIA 4U3HA 1S5HA 2AJSL 2R2EA 4JFDA 1RMFL 5GGSB 2BY1A 3QQ3B 1A6VL 5EIIB 2W65A 1WTGT 4UIMA 4BFIB 4M5ZH 3TT3L 2IAMB 3HG1E 1BD2E 2HFTA 2E7CA 4QRUB 2AGJL 5DR5L 3DHJA 5HY9B 1A7RH 3MXWL 4GAGH 4HV8A 1IC7L 2P5EA 1LDPH 4IOIB 1A14H 3K80A 2D03H 3RDTC 4OCWH 4Q0XH 2VITB 1AQKL 3EKCA 4XB7A 3FFCA 1XGQB 3CK0L 4F7MA 3G6JF 4UAOB 3U83A 2W07A 4UQ3A 3T77A 5GGTA 4N0UE 3FB7A 2ORBL 1P6FA 1Y18B 4G5ZL 3RL2B 3UX9B 5JLZA 4N9GB 4Z7UB 2XRAL 4I2XB 1YPZB 4HEME 2B1AL 3MNVA 3BWUC 5DJAB 2XACC 3ARPA 3C5JB 1GAFL 4MQ7B 2XWBA 2GEEA 2J8UF 4TSBL 5HTSA 3HPJB 4P9HH 1ORQB 2DMKA 5DHVA 4G3YH 1NBYB 2EEAA 1F90H 1U3HC 4Z9KB 3ESVF 1I9JH 5D8JH 1YMHA 1J86A 1SQ2N 1UM6H 3OAYK 3TCLA 4P46C 4KUCF 3UTQA 3RVUD 3HI1A 3T0XA 1X6NA 3IKKA 1I8KB 5F1NA 1G7PA 3ZDYE 4XWGH 1FH5L 4EOWL 3U48A 1CIUA 2NY6B 3SDDB 5HJ3A 3VCLA 5EB9A 5SWZA 3GMMA 3KYNA 2VLKE 4XTRD 4X98B 3VGAC 4D0CB 2FO4A 4RGNC 2HVKA 1G7IB 2P49B 2H2PC 3UYRH 1S9XB 2ATKA 4MNQB 2C5DC 4ZTOH 4KTEL 1ZWIA 3CGTA 3EO1B 4RMTA 4RWHA 4M43H 3LKPB 3CSYB 4UDTB 3D2UD 2KKQA 1J7VR 1R3IL 4ZNEA 5B4MD 3VXRB 1RFDL 1JPGA 4HK3N 5IMKB 2Y72A 1IZKA 1C5BL 3LD8C 1MCDA 4MDJA 5H35A 5C8JA 3BE1H 1S8DB 4PTUB 4K3EL 4RGOL 4L8DB 4UOW1 5HDBE 5E03A 5FECA 3QNYB 2ZUXA 3FQUA 1KPVA 4NOBA 1JWMA 2VAJA 5KG9B 1FNGB 4OAWA 2P5WA 3IVKA 3MNWA 3HUJE 4C56E 3BMVA 5LWYH 3P0YL 2QQNH 2ZJSL 5C92A 2F58H 3HZKA 1LMKA 4UQ2B 4NHCH 5ABDE 4NT6A 3HC0B 5IB4A 4L3EA 1PKQB 1WEJH 3VD3A 2MFNA 3FQXB 3MJ7A 1W0WA 1RZKH 2D9CA 4AMKL 3UBXI 1J1OL 3AAZA 4EIGB 5CEZD 1P4BH 2FNBA 3WNPA 1AE6L 1JHLH 3E6FB 2NY4C 4ZUWA 2FEEI 2XTJE 4M03A 4PBWD 5LG1A 3UJIL 3QPXH 4LDLB 5A1AA 1KGCE 3O3EA 4BZ1H 5GZOC 2OJZH 1G6RH 3RJDA 2EO1A 4LLAA 1LO0H 4N1HB 3OAUL 3STLB 3GHEL 1IGTA 2I9TA 2HVJA 4LVOB 4Y89A 2FIKA 5D1QC 2EKSB 4Y16B 4FQJL 4LQ1A 4JFOA 1PSKL 5BVJA 5EU6B 3EFDH 2CR3A 4FQLL 4ODVH 4WV1A 4F7TA 3H7BA 4U05A 5EIQA 3DTXB 5CWSB 4U6TA 4HPOL 1FGNH 2X1WL 3KJ6H 2BP3A 4HIJB 3EOBA 3TPUA 5DFVC 3PL6C 5E56A 3UBXA 2DLEA 2W0PA 1EIBA 4JN1H 1LVEA 3PQYA 3BKCL 3CDYA 1JGUH 3MFFA 2DLGA 2LU7A 3L3DA 3MR9B 4FQQB 4MNQD 2DWDA 2ZOKA 1IAOA 3B4NA 1RI8A 1IL1B 4KC3B 5DRXA 2PW2A 2FYYB 3H3PL 2AJ3B 5FYKU 1M7XA 1OAZH 1KN2L 3ZTNH 4K23H 4WI3A 3ZDYF 2QSVA 4LSRH 3GNMH 2NY1C 5D7JA 1J88A 4HZAA 2C3GA 4Y2OA 2EDQA 3JTSA 2APBA 2BC4A 5IMLB 1MHHB 1CFQA 4HKXA 4PR5A 3VFVA 1FLTX 2XN9B 1G6RA 3BW9A 4P2OC 2V5YA 1KJMA 3FHAA 4KK9C 4Z95L 1FSKB 3FZUC 2YRPA 2JIXD 4K3GA 3U9UA 1BQUA 3TYFB 1NGPL 5KVMC 2Q8BH 1ZANL 1DBAL 3VMNA 3W9DA 3NGBB 3TF7C 1TJHL 1BVKA 3MV8E 4P2RE 5EOTB 3OB0K 3ABZA 5IEKB 3LEXB 3P4OA 4HQQL 3AB0B 3QDHA 2CKBL 4P5MB 5I18H 3P77B 4NWTL 2XZCL 1MIMH 5HDBF 1QRNB 2ZG3A 4QRSA 3VGEA 5K9OB 2BVOA 4FQXB 2R0KH 2WW8A 3IFNL 4OGAC 3HUJF 1Z5LA 4HS6B 1QLEH 4I77L 4KKCD 3JWOH 5FUOH 4LCYA 1TQCC 1HXYA 3V6ZB 4OLZL 1NCAL 1U91B 2IPTL 5HVWA 4OT1H 4EZMA 3TBSA 5KANG 1FNSL 3U7WH 4GUPB 4YHLL 4Q74A 4PJ9B 1NL0L 2DQEL 3O0RL 3GGWB 4BZ2L 3I2CL 4PRPE 4AJ0A 2VDPH 3O8XB 3RX8A 1A9EA 2DQHH 4NP4L 3V5HA 4G7YH 3VXUA 4Z7NE 3QO1A 1ZAGA 5JOEA 3OBAA 1A7PH 2JJWA 5D96B 5AUMA 2XTJC 3CDGB 5D7SL 4BUHA 1F58H 1SY6H 4O58H 1MCNA 4J2XA 2EE6A 1HYRC 1PZ5B 4XNXH 2PYFB 4L29B 3WJJA 3IXAB 5AZEL 3LMJL 3MV11 3WO3B 4QO1A 3WFCL 1G7QB 4HUMB 5DSCA 1SYSA 3RNKA 2MOVA 3CPLA 4JKLA 2YKLL 1FYTB 1KV3A 1UZ8B 3T3PE 5I16B 4YXHL 3MUGB 3JTTA 1FZOA 3PWNA 1KLUA 4EUPH 3C5ZB 4LLMA 2AJVL 2DQFA 3NZHL 4GG6E 1CZ8H 5A40E 2IPUG 1X7QB 1X3DA 1DBBH 1FZJA 4HIIA 1OGAD 4NN5C 2WZPD 3L5JA 3U0WL 5E2UH 3Q3GA 2X4TB 5ADPL 4K94C 3BQUB 3L3HA 3KXFB 1W0YT 3LAFA 4LGRB 5I6XC 4XRCB 5HHOE 4M93B 43C9B 4LLQB 5KSVA 1J1PL 3WD5H 5TDOA 3OJDA 3Q1SL 3C08L 4OF0A 3LKQA 4DZBA 3A6CH 4HUXB 1P7QA 5DJ6A 3C8KA 1RVFH 4JDVA 5E5MA 5BZWA 3S88H 2DYPA 1NMBL 3AXLB 2HRPL 4AH2B 4AENA 3R4DA 3QIUB 1SY6A 4PV9B 3NA9H 3G04B 3MSPA 4HFWA 2ICWJ 5KN5A 1FAIH 2HTKC 1NUGA 1CU4H 1UXWB 4R6UA 5JQ6H 4GKZB 4JFEE 2FX7L 2EZ0C 1X5AA 4G6ML 3FB6A 1JF1A 5GIRB 5MP6H 1MRCL 3DMMD 3NCFB 3G5YA 4YFDB 3F7PC 4JFFD 3W9EB 4PS4H 2E3VA 3IJSB 4EUPA 3A6BH 3QQNA 4XX1E 5DURB 4OIIL 4PJXF 3SDCA 5DD0L 2MCG1 3ZDXE 4PJ9D 3O6LH 1DQLL 1IAKA 1V05A 5HYEA 5JR1L 1XEDA 2AI0L 3LEYH 3S34L 1NSNL 3IU4H 3Q6FB 4OM1L 1ZVSB 3FT2B 4EKXA 4WIQA 5E94B 4NRZA 3UEZA 1RZGB 4JAMA 1FO0H 5E6IA 1TPXC 2VLRE 3C9NB 1QHPA 2NZ9D 5H2BB 1CXIA 3T2NH 4XNUH 4TOYL 3MUHL 1K4CA 1Q72L 4U0RB 2QSQA 1HXMB 1T04B 3NABH 1LP9A 4JHWH 1BJ1J 3L5WA 5T1MB 5KZCB 3TBYB 4HWBL 4GRLB 4Z7NF 5F7DB 1EHLH 5I1JH 4W6YB 4J3TA 4Y1AB 5I1AA 1QBMH 4NN6C 4WI6A 4MA8H 2ATPB 4X9GA 4S2SA 4NZJA 2BFVL 3JV5A 5CP7B 2YK1L 2AQ2A 4TVPL 4PRNA 2NTFA 1F5WA 3BT2H 5J4MA 5F1KC 3S97C 2AEQL 2CH8A 5T1DH 5KBNC 3AC0A 3HE6C 4D3CH 3KXFD 4I0PC 1JHTB 3ARBB 3X17A 2FX8L 5D5MF 3T3PF 3RWHA 3WIHA 1A6AB 4MX7B 5TDPA 4XWOC 3AROA 15C8H 2E7MA 5HI5D 4MXQD 1T5WB 3BFOA 2DBLH 2EDWA 2H1PL 4YHYB 3P9LB 1OM3L 1IGFL 3OSKA 4HJGA 4NUGH 1RZIB 5JW5B 1XIWC 1VFUA 4Y88A 5DJZA 5DJXB 3MGOA 5BS0A 1RZFH 5DHYB 4TPRH 3QIUD 4JFYB 5EH1A 4Z7WE 1FO0A 2IH3B 3NACL 2HWZH 3NVQA 2NTSP 2BNUA 4UBDD 2A73B 2YUZA 3MLZL 3VW3L 3FAWA 1ZTXH 4MYWB 4NQDE 4X6DB 2VWEE 3QEUB 3EDDA 5AZ2L 3MCLL 4RRPA 2VDNH 4JR9H 4WI5A 1OP5H 1U41A 3W2DL 5D9SA 1YNTA 1MCHA 1VFAB 2R0LL 4XH2A 3QYCA 2ED7A 1UVQB 4ZTPL 1KXTB 1A9BA 3O2DL 5CJ5A 4LVEA 4WJ5B 4UDUB 4ZUVB 4TTGA 3JXAA 4K9EC 3EJJX 4X99B 4BQ9A 5D6DA 5EU5A 3PXJA 4FTVB 5BXFB 2VDOL 2HLFC 1J5OH 2V9QA 1SEQL 3KR3L 5L2JB 2VDKH 3MQIA 3MRMA 1HHIB 1DDHA 4PB9L 3G5XA 2A0LD 3OR6A 1YEEL 4XP4H 1U95B 4ZNCD 3BH8B 4XCNA 1ZA6B 2WMPA 1T21B 1MCFA 4E9LA 3GO1L 3IS0X 4GRLD 1NAML 5ID0A 5EIVA 4ELME 5TE4L 3BZDA 3O3AA 4PP1D 4Z7VA 3CFKA 3FQTA 1ES0A 3LKOB 3UYOD 4Z76B 3MLUH 3QRGH 5MENA 5BO1L 3DGGA 1QBBA 3ZDZE 1MLCB 2MHAA 3LN4B 3OR7B 4U1NB 3D48R 4JO2L 3HS0A 1XGTB 3V0VA 2ITDA 1ZGLB 3O45A 1U8IA 3L3GA 2NX5B 1O0VA 3STZB 4TSAH 2BVUA 5EBWA 3SKUD 5IBLC 1KYOK 1FYHB 1BQSA 3U0TB 3GBLA 4JM2F 4B5EA 3PABB 5ID1B 3SDAB 4LASH 2NY7H 4C83B 2W60B 4G7VL 3QQ9C 5FA4B 2P7TB 4MA1B 1EO8L 2VLME 4JRYA 1HYSC 4B7LA 3MJ9H 5TPWL 2P8LB 3K74B 5DUPL 3AU1B 3QNZB 3BZEA 4M6AA 4FXGA 1OL0A 1P6AB 1JGDA 4KGJA 2R1WA 2Z31A 4RAUB 4FFWD 4YDKH 4HWEL 2YMXL 1S9VA 4PJ7E 4J4PD 1NDMA 5DC9B 4Z0XB 4UV4H 3D39E 2HJFA 3T04D 3V6OE 4AY0A 3LQAL 4ZFGL 4HLJA 3G5VA 1RUQH 4PREA 2FL5B 2QHRL 1BQHB 2VDRL 3OXSA 2ICWI 3MBED 4WUUE 4Y2DC 2BRRH 4PJ8B 3NFNA 1C1EH 5KJRL 4Z7WF 3BAEH 1XZ0B 1RZ8B 1P7KB 4ODTL 5F7LB 4XMLL 1CDHA 5J06A 5DMKB 2JJTC 5D1XD 1CK0L 3EFFB 4KDWA 4QYOB 4NO2B 3ZYJA 4XXDB 4AK1A 3UYPA 1EA9C 4N0YL 4CW1B 3HRZB 4N0FB 3GSQB 2VWEC 1HQ4A 1AC0A 3EYQD 3G6AA 5JPNB 1ZXQA 5D6CA 5C0IB 4YDJA 4WW2A 1YQ2A 2XFXA 1NBQA 4LP4A 4PJCA 4HKBB 4G9DB 1QKZH 5E5UB 4WU7A 5ETUA 4FZEL 3GJFH 3MJ9A 5DD1H 1BJ1H 3PWPD 5M95B 5E4EB 1DR9A 1IEBA 4GAJH 1AGEB 1I7RB 2ICWA 3ETBF 2P8PA 5DJ2B 2ZCHH 2NW3A 3P40A 4M61A 4H5SB 4KJQC 1K8DB 5CIPH 2OR7A 4G6FB 2YD4A 3FT4A 2OS7A 2Y4SA 5FYLL 2PNDA 4QWWC 3REVB 3SEPA 3V6FB 3D0LB 4ELMF 1AKJA 3AY4A 5JA8B 3L5XH 2G5RA 4F57L 3TZVB 4KTDH 1WGOA 2X7LB 1H5BC 1NCCL 1UM5H 4FQ1L 3SDAD 4KZDH 1CGUA 1U3ZA 1K5NA 1I7TB 2CRYA 3JV6A 3BIBX 2PO6B 5F1IA 2IJ0C 3SE8H 3WXWH 3PWUB 3MROA 5LAXA 3VRIB 5DLMH 3CVHH 4MDIB 1E4WH 1A1MA 32C2B 4Z6AT 4XPFL 3VD9A 4NM8L 4H88L 4G6KH 3LPGA 5EU4B 3OJVC 3MX0A 3F5WB 7FABL 1VSCA 1N59B 1WZ1H 3GKWL 5FCUL 4EQ2A 1OTTC 3N9GL 1HDMB 1KSRA 2DN7A 2D7NA 2V2XA 2VTFA 3GJFA 4LSDA 1YYLL 4OLWH 4Y5VB 2RBLA 5CGYD 4OZGE 4CU7A 5FKPA 2EE2A 3P0GB 1VGEH 1N6QH 4N1CA 4JN2A 3NIDF 3T0EE 4L9DA 3Q5YA 4PTTA 4G9FA 1T7YA 2A2QT 4WEBL 4P4KC 5CIPA 4PRDA 4PJ7F 4R2GD 4P2CG 1TETL 4MQXC 4OZHA 3NCJL 5C70A 2BVPB 4PY8J 1QSVA 2ESVB 5CEYB 2B4CH 1Q94A 5HDOA 1F97A 5DUBA 4OFYA 3V6OC 2Z93B 4L8SC 3ARXA 1EUTA 1ZT4B 3RPIA 4JO1L 4WWKB 4PLNC 5EZLB 1ZA3B 3MRGB 3Q5TA 4KRPB 3RVTC 1CYGA 2YD6A 1FNHA 2Z35B 2WBJB 3CVHA 4MD0B 1W0VB 4NCC2 4HGKC 4OUUA 2IMNA 5FYKD 5EG6C 3RDTD 1DBKL 4M7KH 1MI5B 2DQCL 1S5IL 3MMEA 1WBXB 4DUWA 3ARFC 4ODHH 4TUOB 4PIRF 3GHBL 4PJGA 4RDQG 1XR8B 4GS7C 1LD9A 1C08A 1KC5H 3FONB 4JY6B 1QLRB 4HKZB 4MAYC 1OLZA 4CN4A 3BIAX 3QFJB 3OZ9H 4YHIA 4D8PA 4LSPH 4I9WD 4RDQF 4DN3H 5JPMA 1X5IA 3SQOL 3OWEA 4F9PA 5SX4H 4GLRH 2VXTL 4EI6B 4X7FC 1U3HD 2CRIA 4IHOB 2FJGB 1OWRM 4Q6IA 4D9QD 4KUZH 4OTXL 2FECL 3MV9D 1D5ZB 1UYWL 4AIZB 5ALCH 3GSUA 4P46D 1J0YA 5SX4I 2GTZB 4CVZB 3VGGA 1UG9A 3N85H 4GKSB 2A9MH 4KUCD 3F12A 3TVMC 2GITA 4PJDE 4MA3B 1S7TB 2GKIA 1TCRA 2XWJB 4AM0A 4TQEH 2I07B 5EFIA 1CFTB 1G7JB 4QXUL 5IEHB 4FFYL 5I1IH 4RGND 5IQ7L 4YX2L 5LXGL 3UZVB 5JUEL 4WCYL 1BWWA 4HBCL 2DQIH 1NQBA 4PV8A 2DJUA 2Z9TA 1QA9B 4WFED 2JCCF 1N2RA 1KCRL 4OZGF 2KZWA 4IRZL 5T5FL 1CDCA 4HHAA 5J12B 4HCRL 1K4DA 4R7DA 5A16A 2BVQB 4S1QH 4H0HB 5DD5L 1ZSDB 2OTUA 5DRZA 3WFDL 2BXYA 4LRIA 3W11C 1DVFA 4P2OB 1YJDH 1EO7A 4GKOA 2E9JA 3EO9H 3T0EC 4XT1C 5FCSH 4OZIE 1MAMH 1OAKL 3CXDL 1K2DA 3VXNB 1AI1L 1F8TL 2VLJD 4YXKL 2Y5TA 3TN0B 5BV7H 5IMMB 4LDEB 5EO0B 2DQJL 3U30C 2CLRB 4HJ0C 3QJHB 2QSCH 5FA3B 1WFTA 1FL6B 3WO4B 3LDBC 4NNPH 2DJ4A 3KYKL 4G8EA 4X4YA 4L8CA 2QQLL 5EC1B 2NY4D 1NC4D 1AHWC 4MJ5A 1ZHLA 3HG1D 3MRPB 1BD2D 1T5XB 4KK5C 4ZDHB 1CL7I 1NDGB 3GBNL 5JHLL 1W2KT 4EDWH 2V5MA 3D18A 1Y0LA 5GZOD 4RFEA 1D5MB 3QB7C 5IBTH 5L0QB 4IS6A 3ULVE 4IMLA 4PJ5B 4O4YH 1CE6A 2APXA 4ETQA 2UWEA 1CFNA 1RUKL 5FUZL 2IPUK 1FV1A 3TH3T 2GT9A 3SKMB 2YPLA 5EOQL 5CJBA 4WNQB 3DUUB 1ROWA 4AT6A 4P9MH 5D1QD 1FDLL 2CO7B 4YEFA 4I3SH 1B0RA 1IT9L 4D94A 4OD3L 1NEZG 3RA7L 3S5LG 2W38A 1TVHA 3FO0L 4AEIH 2HKHH 5L7XH 1IBGH 2JB5H 2YPVH 2VDMH 3CFJA 4L1HA 4XVJH 5IGXH 1P9MA 6CGTA 5GS3A 4U33A 5D7LA 5D2LB 4EN3C 1URLA 1IC5H 2OMNA 3PL6D 1HILA 3HMXH 5F9JB 3BSZH 4EVNB 1MELA 1PYWA 3PWVB 3TBWB 3AS1A 3D5OF 5GHWH 1HHKB 4MSWB 1NFDA 1X5ZA 1CXLA 5I8EA 5I71C 4JHAH 5C0JB 1Z0NA 3Q5OA 4FZ8L 1UB5A 2PYEE 1A02N 4LU5H 4GRWE 1IFHH 2MJWA 2G9HA 4KQ3H 5BZDA 4LSUH 2NY1D 2R1XA 4LCCA 5ECJE 3MOQA 2ZKHL 3FOMA 1DE4A 3DX9B 1FCGA 4P2OD 1UA6H 4I3RH 2VLKD 2N1KA 4UB0L 2YWZA 4KK9D 4K7FA 3INUL 5I6XB 1HK6A 1Y6KR 1EV2E 3GJEB 5DRWA 1TVBA 1ETZA 4MVBC 3KPOA 3F58H 2CO6B 1ZV5A 3H3KA 4NCDA 4GRMB 4NRYB 5GS0H 2BCKB 5D2NE 5J89A 4YE4H 4IRJA 4IIQA 1G7HA 2X1PA 4KMLB 3MLSH 1MVUA 4OBSA 3PNWB 4M62H 3HMWH 1CDUA 1WTLA 3OKLB 4NZTH 5M7QA 2YD1A 3HMXA 4M4PA 4OZIF 4OGAD 4S1DC 1JI2A 1MJ7L 3MV7A 3OKOA 5I17A 1P7HL 4C56D 1HIML 4GMTL 4POZC 4FQIL 4XZUB 5BW7C 1ORSB 4MD5B 1DN0B 5EUOB 3UTSE 3QUZC 1U2CA 1QYGH 1XGRB 1EFXD 1BOYA 1CLOL 4J1UB 4PJXB 4L5FH 1FL3A 4V2CB 5C0BB 3NIGE 1NC2A 3P0VL 2GIYA 4ERSL 1E4JA 2WIMA 4JKPH 2XOTA 2ED8A 4RIRB 2QQQA 2XTJD 3L3KB 1EUUA 1DBML 1A4JA 1EEZA 1KTKE 1S7VB 3L3IB 4HKJB 1A1NA 5FO7A 1KGCD 2WQRA 4RSVA 5IW6B 2MNUA 2AP2A 2HG5A 5FGCE 3P9MA 3ULVC 3EZJB 2XA3A 1A7OL 5D93C 3FOLB 2F8OA 5F21B 3QIWB 5F97E 1T1WB 4C58B 1IM9D 1FNFA 5C0CA 1UH3A 1G9NH 3QDJB 5DWUH 1JE6A 5GRWA 3MRKA 3WSQL 2MQ3A 4YFLF 1VEMA 4Y5YA 4KTYA 4QRRA 5DS8B 3TT1L 2UZXB 2PKDA 5DJYB 5L88L 5HHNB 4H8WH 4O2FA 3QWQB 4NKDA 4WY7H 3VXME 4P5TB 1MCPL 5EUKB 3QP3A 4I0PB 3WDJA 5J8OA 3O2WL 1BGXL 5D5MB 5D7IE 5B38A 1NUFA 4NO0B 1JGVH 2VXVL 4AZ8A 4OCRH 3T1WA 1XGPA 3TA3B 5GJSH 2R56H 4PYHA 3BP4A 3RWCB 4HMEA 1HCFX 1UWGH 4XVTL 1X4ZA 2CR6A 1YN7B 4OD2A 2DQGL 2IALA 1E4XL 1AFVH 1RJZB 1AGBB 3P4MB 3GIZL 3V52H 2HTKD 5LGJB 2IADA 1KB5H 4JFDE 1PBYA 5FYJE 2EZ0D 3WS6A 3SKJL 4OUOA 1DANU 5IVXA 4DOHE 3RZCA 3HE7A 3VRLE 3LRSB 5T1KA 4X6CB 1GC1C 4A6YB 2WUCH 3QEQB 1DSFH 1FFRA 3MLPA 4G8GB 4AL8H 2P5EE 3HNTH 1SEBB 3OAZH 3MRHB 2DKSA 5D2NC 4U6YB 2IBBA 4P2RD 5E2VH 4LHUA 5T1LD 3VXSA 1MFNA 3FFCE 3BDXA 3MRDA 1MJUH 2HFFB 2JELH 4J8RA 3VWJB 1BOGA 4M1GL 4U1MB 5GGQL 3S96A 5E5RB 1FGVH 1IVLA 3PGFL 5C0AA 3U36A 4MWFB 4XCEA 4E42A 4H25B 4MJ6B 4HEPG 3DX8A 2A74A 2UYLA 5DQ9A 1B2WL 3JZ7A 4JGJA 4JREC 2D7OA 5IB1A 1I3VA 3VGDA 3L7EB 1KG0A 1V7NL 3S98A 3BZ4B 3VFOA 5EBMB 3LQZB 2BSRA 5C08B 4ODXB 2AJSH 1T20B 1DJSA 1RMFH 2E7BA 3NIGF 3QDGB 2VLLB 2ZSWB 4PRPD 1Y6NR 1SJHA 4WEMB 4BZYA 4HGWB 3GIVB 2XPGA 2AGJH 1EH9A 5HGGS 3RWIB 4KRMB 5DZNA 4P3DA 1KB5A 1LGVA 1QQDA 3MXWH 5I30L 4OIAA 1WBZA 3ARGB 2CDGA 4QHMB 2K7PA 1TQBC 4R96B 2APTA 2VLRB 1HEZA 1AQKH 1H0DA 1S7UB 4Q9QL 3I02B 1TJIL 3HE6D 4I0PD 1XGYL 2V5RA 3T4YB 5SWZE 5ENWB 3D85B 4U31A 2VR5A 4XWOD 2CLZB 2ORBH 4G5ZH 1UWEL 1P2CA 4L8BA 1EK3A 5I73B 3TNNB 3DBXB 1XMWA 4F8TA 4PJAA 4BH7B 2CK0L 5HHVL 3CH1A 4JM2B 3EYFB 4FQ2L 3RUGA 1XIWD 2BMKA 3B9KB 1GAFH 4L3CB 4ZNEE 1KPRB 4PY7B 4TSBH 1HKFA 1K3ZA 2YC1A 3FN9A 4QNPE 5IW1B 4HH8A 2C3HA 3KPMB 4K71C 3DJ9A 5DC4B 5E8OB 3SDXB 3SGJA 1QSZA 4W81A 5D7IF 4Q97A 1FNEB 2Y1VA 5HHOD 1QFOA 4F37F 3BGFB 1YMMB 4NGHH 4U1SA 2P5WE 1MRDL 3RZWA 4JFXB 3QAZB 1FH5H 4X4XB 1N0XL 2B7DT 3BEWA 4MXVE 5TF0A 3DVFA 4R90L 4MCZA 4L3EE 4DKAA 4AYFA 3OG6B 4RMUA 5JO5B 3GMNA 4LLVA 2HLFD 4JFED 4P2QB 3X13A 5KVEL 4ZUTB 3WFHB 4ODUB 4ODSL 3DUHA 4KTEH 4OZ4B 3ZTJH 4EI5B 1NGYB 2X1XR 2P8MB 4JJ5B 1R3IH 2ICEB 4MHHI 3LPWA 4L4VA 1RFDH 1YC8A 1C5BH 4PGBB 5C0RL 1XCTA 4K3EH 4RGOH 4OF3A 5DJDB 3OHXB 2NLJB 1WFOA 1H8OA 3QI9A 4ELKA 1MFDL 1G9MH 3H8NA 3H9SB 2VLRD 1A4KB 1YECL 4YGVA 4MNGB 2ZJSH 3M1BB 4W4OA 3MLVL 3DV6B 4OV5B 3A67L 3D85D 3HZMB 3WYRA 1I8MB 1J1OH 5IBLD 2X44D 3RX5A 5F96H 1AE6H 3GB7B 4I3GA 4GKNB 3PQYE 5E8NA 2QADB 1JI1A 4ELMB 4UTAL 1VFOA 4JPIB 1HINL 3DURB 3IU3A 3UJIH 4GW4A 2F54B 3QQ9D 4M48H 1HYSD 3K8KA 4LLWB 5IB5A 5E2JA 1TJGL 4RZCA 3BGMB 3B3IB 3CFDB 1U8HB 4JZJA 4Y4FB 4XBEL 5EWIH 4HWZB 1ND0A 2XZAL 3GMQA 3GHEH 3LOWA 3S36L 5IESH 4Z8FH 1BIHA 4QRPA 2XY1A 1MFAH 4BSVB 1DL7L 4PJIA 3BRFA 2XZQL 4FQJH 1T66C 1IGIL 1H3UA 4HFUH 4J7RA 3GMOA 1FHGA 1PSKH 1WZKA 4FQLH 1YY8B 2X4QA 4Y2DD 3KPLB 1KCKA 5FM4A 2F19L 4HPOH 1YUHA 4YC2C 1R5WB 2NY3C 5JTWA 3O41B 3HN3A 1GZPA 2EKJA 2CMRL 4K8RL 4QNPF 5JNYA 3T4AB 3MOBH 2D9QB 4L4JA 3VFSB 4D9LH 4DGYL 1MJ8L 1Q8MA 4NQDD 4I5BA 1MUJB 3OX8B 1R3KA 1YEFH 3WFEL 4TTDC 3CDFA 4P9HC 1KN2H 3ZKNC 1JZ5A 2OXHA 3EZ8A 4YDLC 2FLBT 1FVEA 4JCMA 2X1QA 5I19L 5CGMA 4DZ8A 4JPKH 1BBJB 1U92B 1NCWL 1X9QA 4MXVF 2X4PB 4ZPTA 2C1OB 3U4AA 1J1XL 2YA2A 2KUTA 3DV4B 3JWDC 3C6LB 1DP0A 4GMSL 2CSPA 4DFHA 1WAAA 4RA0C 5B8CB 3VXUE 3LSOB 4H1LH 3KNBA 3LRHA 3GSWB 2GQHA 5GS1B 1CQKA 5F7FA 1KXQE 1ZANH 1ZK9A 4IRSB 1AIFA 1XH3A 4C54A 4KJQD 4OQ1A 1EVUA 1ZLUK 4PGDB 5DEFB 3VG9B 4BFGA 3QA3B 3IDGA 4HQQH 4QWWD 1AGFA 1HQRB 4HZLB 2X4OA 5DI8B 4I1NB 4NWTH 2IQAA 1Q9LB 2ADFH 5IMOB 5FGBA 3K81A 5GGRB 1SHMA 3I3DA 1BX2A 1F4YL 3UZQA 4LSQL 3IFNH 4I77H 3N1FC 4WHYG 3W0WA 3VDBA 5FK9B 4HXAH 4OLZH 4XPGL 1NCAH 4WV1C 2FJHA 1CFSB 1YYML 4Y4FD 3H9HB 2VRAA 4DKDC 4PG9B 1CGSH 4HPYL 1FNSH 4YHLH 2OL3B 3MLTB 4XP6L 2DQEH 3O0RH 2LE9A 4Y4HB 4BZ2H 3I2CH 4ETYA 1OTTD 2WIIB 3ZLQC 4ZXBB 4JZOA 5J11B 1T6WA 1OF2A 1DUYB 1A6ZB 1KLFA 3BYYA 3MLRH 1FZKB 5DYOA 5GSVB 4LKXB 1S7WB 3MCG1 2BXZA 1I7UB 3M8OL 2YR3A 5E8EA 4YHPA 2VLMD 2DL2A 4H1LA 5CBAA 1MIEL 3LMJH 4DTGL 4QCIA 2DMBA 5D7JC 4P4KD 1JNHB 5J13B 3LKSA 1AD9A 4GW5B 4MQXD 2F53B 2YKLH 3MFGB 4RCAA 4YXHH 2VZ3A 3D39D 5I1LA 2R1YA 5F6IC 3I50L 1FLRL 4JFQA 2O5YL 2AJVH 2E7HA 3NZHH 5HBBA 4OCYL 5E9DA 2JCCB 1DN2A 4WUUD 5HYQB 1K8IA 2YEZA 4D0BA 5BOPA 1Q0XL 3DROA 1JPFA 2X9WA 2R69H 1FL5B 3GUTA 4UIKL 4KMQA 5E08L 2AW2A 1AQDA 5CS7A 3F6LA 4M7LH 3MRCB 1P4IL 4DW2L 4YBLC 1VPOH 1H9VA 2X4SB 1A6TB 4JQVA 5SX5K 1NMBH 2FBOJ 2D2OA 2HRPH 2VZVA 3ARFD 4YPJA 1H15A 4KQ4L 2XT1B 4FG6C 5DT1L 3THML 5C07B 3SN6N 2P24B 1LP9E 4OF8A 3EDKA 1OPGH 2FX7H 4MAYD 4X6FA 3PGCA 3BKMH 4G6MH 3ZE0E 1XF1A 1LQSR 5KSUA 1KTDB 1MRCH 3L95A 4F2MB 1P5UA 1T1XA 3BP5B 1ULVA 3CX2A 3QG6A 5E99L 1U42A 1MFEL 1QTYT 4KROB 4LIQL 1T7ZA 5DD0H 1S7SA 5GGVH 4M02A 3KLDA 4UTBH 1DQLH 5DMIL 5IHZA 1XR9A 3GM0A 3WJJC 3DETC 4YK4B 2ARJA 4WENB 1XF3B 2ENYA 4F58L 12E8L 2AI0H 3QUMH 4X5WB 3LS5L 5CKAA 1NSNH 2X10A 4ZYKB 4G80B 2HLAB 5IFAL 4JY5L 3TVMD 5BRZB 5LGHH 2J3SA 4XC1H 4U1GC 2Q6WB 1AD0B 3BP7B 3MRRB 3UPRA 5FIEA 3LKNA 4TOYH 1CICA 3JWNC 1PG7W 1YEJL 3L3JB 3QZWA 2D31A 5C9KA 5IP4A 1ZT7A 4U6VL 4S10A 2A6JB 1WFUA 5DA4A 3TWCL 4CDGC 1NEZB 2OR9L 4MAUL 2JE8A 2C3XA 3JWOC 5FGSA 2HJLA 2Q1EA 5CFHA 4WTXA 5FFLA 1NBVL 3QHZH 4NUJA 1MWAH 4JO3L 2NR6C 3OKNB 3CLEL 4J3SA 5CAYB 2A6IB 5CJQL 2YZ1A 1HOCA 5L9DL 5DDHA 3U4BL 3KYAA 4TVPH 4I4WB 4M5YL 3RGVA 3W11D 3RGHA 4BQ6A 2IGFL 2XKNB 2AEQH 1RK1B 1OSPH 5IVNA 5EU3B 1RAMA 3T0ED 2XICA 3HNVL 5KOMC 6FABL 4XMKL 3M17A 1SBSL 5K59E 1R3LA 4QOKA 5L8JB 5F7EL 3O3BA 4DUVA 2MPAH 1N4XH 1CD8A 5FOBA 2H1PH 3MJ8A 2BERA 1LEGA 3KPNA 1I9IH 1OM3H 1IGFH 1JZ2A 3O3DB 4HJ0D 2OQJA 4ZUUB 3QUMA 4MZ2A 3S3PA 1R24A 2Y6SC 5HVHC 5JORB 3TO4A 4KHXL 2VYRE 2FR4B 4I18B 3NACH 4YO0A 3SDCC 4XGZB 2EDHA 4KK5D 3JSSA 3BX7C 2C1PB 4ZOAA 3VW3H 4I48A 3BKYH 1JFQL 2DM7A 3QFDB 3QUYA 4MNHA 1BHGA 1DQQB 1KXVC 3MCLH 4Z7VE 3VFMB 3W2DH 3P73B 2R0LH 5TGBA 2MQCA 3L5IA 5E6IC 5HHME 4QXTB 1RV6X 5MENE 3BZFA 4YDVB 1FORH 5ICZB 4ZTPH 4A6YL 5C6PB 1A47A 5DQJB 2VC2L 4M8QB 3MCKB 4HG4K 3V9FA 4W6XB 1DEEA 3MBXL 1FN4B 4FQPA 3IJHB 2J8HA 3P4NB 5KS9A 2OR8A 4DCQB 2AXJA 4AG4L 3KR3H 4WO4A 4LEXL 4EN3D 3PDOA 1I85A 3QWRA 1RURL 3K4DA 2PTTA 3LH2H 4YH6A 3X14A 1FZMA 2VUYA 5C09E 4PB9H 4OQTH 4XP5H 1B88A 1YEEH 4DK3A 4NNYA 1QLFA 4JRYE 1OW0A 3SE4A 4YIQB 5E1AB 5IKCA 2AXGA 1N26A 1IM3A 3SGKA 1NAMH 4LAJH 1ZEAH 3IDXL 4KKLC 1CIDA 1HNGA 5F7NC 3RWEB 1LK2A 1ZHKA 3EYSL 3O4OB 2YSSB 3FO1A 4URTB 1HHHA 4JZNA 5BO1H 3IFLH 5MEQB 2EYSB 2BX5A 4JO2H 1KIPA 5LBSH 1X5FA 5H94B 4F7CB 1JUFA 1DUZB 4DKEL 1ZLSL 5HYFA 4MVBD 2DM2A 3CZFA 3O2DA 3I6GA 2DDQL 3P30H 1NBZB 4NC1E 5K33A 2QQKL 1RHHA 4QY8B 1G9EA 4BQBA 3RWFB 5I1GL 4G7VH 5JHDB 4N8VA 4YPGA 3T65B 1A3RH 4RQQA 1I3RB 5TPWH 3MACL 2QLVB 3X12B 5MEOB 4PJCE 5DFWH 1NFKA 3F7YB 1G1CA 5B3NA 5GQBA 4S1DD 3IAGC 4HWEH 4KXZI 4XP1H 3SO5A 2YMXH 3ZYOA 1GH7A 2AJUL 4IOSD 4ZG1A 3BESR 4XC3L 4P23B 4POZD 5D6DC 3S4SG 3LQAH 1UEYA 1CGTA 1NAMA 2QR0B 2JB6B 3QUZD 4ZFGH 3ARYA 5J1AB 4TULL 3RWDB 1B0GB 2FGWL 4HULB 5GGSA 3QQ3A 5IVZB 3ARDB 3K7UA 5KJRH 5EIIA 3FRPA 4PJEB 1DCLA 3BWAA 1PDKA 4PRBB 4ODTH 2IAMA 3HNSL 4XMLH 5BVPL 1Z3GL 4QRUA 5HY9A 5IF0B 1CK0H 3O11B 4IOIA 2VOTA 4N8CL 4Z7VF 2HT3D 4TRPL 2VITA 1E6OL 2B5IB 3ULVD 1XGQA 1ZLWK 4YXLH 5ITFA 3OF6D 4KJPC 1Y18A 3RL2A 1RPQA 3N50A 1FVCB 3QIBB 4N9GA 4Z7UA 4I2XA 1YPZA 1MHPL 2DL9A 5DVNA 4R9HA 3WN5B 1P69B 1LO2L 5DJAA 2Y06L 2DI8A 1JNLH 1YNLL 3C5JA 2FSEB 3DX7B 1PJ9A 4MQ7A 3ET9F 4GAYB 2R2BB 3HPJA 3FO2A 1ORQA 3QEGH 4P5KB 2XWTB 1EHAA 1QP1A 2OTPA 3ALWA 1F4WH 1WBYB 4WGVB 5FYLH 2ZUYA 4CMHB 4Z78B 4G9FE 4PJBF 4F57H 3LV3A 5GGVY 2Z31C 2PYED 4OZHE 2GSGB 1NCCH 3FL7A 3OAYH 1I8KA 2YA0A 3U2SB 5IFHL 3ULUH 5INCB 3SDDA 2ZPKL 2AS5M 2ZUQC 3CMGA 4LVHC 2APWA 3AREB 3B2VL 4X98A 4D0CA 1YEGL 4K71B 3RP1A 1GZQB 1G7IA 3FT3B 4NM8H 1S9XA 3MPCA 5HGDB 3TV3L 2W92A 2V5SA 3FQRB 1LE9A 5D7IB 1LO3L 7FABH 3B9AA 3EO1A 1JMXA 1UJTA 3LKPA 3CSYA 3GKWH 2B8OT 3QQ4B 2X70B 5CD3B 2ZG1A 4NC1C 3VXRA 1GOFA 1FFOB 5AEAA 5IMKA 5DK2B 4KU1A 3IDJA 2VQ1B 3ARDD 4KMTL 1INDL 5LCVH 1I3GH 4MCYB 4FP8L 3RWJB 1IKNA 4WW2F 5TE7L 1S8DA 4QXGL 1HZHH 4PJCF 4FABL 4L8DA 1QSEA 4PJGE 4WW2C 3QNYA 3BVNB 4WEBH 5KG9A 2W65B 3GSXB 4UIMB 1FNGA 3NCJH 1PQZB 4XP9H 2CDEB 4HLZG 3Q48A 2VL4A 1FJ1B 4BJLA 1W8NA 4XMPL 1F4HA 4UQ2A 2W9EL 4X7CC 3O6FB 1DQMH 3HC0A 4L9LB 1PKQA 2VISA 3FQXA 2IMMA 4Q6YA 2HT4C 1EJOL 4JO1H 5CINL 1VACB 2A9NL 3VGBA 1KELL 3E6FA 4UILH 3IDUA 3VG0H 3B9VA 3DYOA 1GCFA 3AY4C 2NY0C 1DBKH 2J5LC 3K1KC 3WLBA 1PY9A 3NFPB 1S5IH 4MB5A 3STLA 3HC3L 4JFPB 1UH2A 2BHUA 1BVLB 5C86A 5CEXB 2Q3ZA 3GHBH 1M7DA 2EKSA 5EN2B 2DQTL 2A1WH 1OP9A 4Y16A 4EIZC 1OAXH 4HIXL 4M1DL 5EU6A 2E9IA 2G75A 5I1EL 3CFEB 1WZLA 3UTTB 3SJVB 4RFOH 3BDYL 3DTXA 5CWSA 3WUWG 4YUEL 4HIJA 1NMCC 4EQ3A 4JPVL 3VXMD 2DB8A 1J8HB 3MTRA 3ULSA 5DO2C 1F45A 2VXTH 5T5NG 4Y5XB 1MREH 1F6AB 3HCVA 3MR9A 4FQQA 4WFGE 2J88L 4HMDA 4ORZC 1IL1A 2FYYA 3RIFF 2AJ3A 4R26H 4OZHF 3MLWL 1U9KA 1UM4L 2J4WL 2OL3L 3A0OA 4QKXB 1LDSA 3CSPA 2FECI 2CLVB 5I2IB 1IGCL 5T5NF 2DI9A 1MHHA 4ONOA 4NO5B 1BM3L 2XN9A 5GS2H 4QXUH 3SCMA 4KZEL 4FFYH 4JFDD 4JVPA 5F44A 5JUEH 1NEUA 3QUXB 2HKFL 4MDJB 4KVCL 4WCYH 5F9AC 4RMVA 2BNRB 4V2BA 4HBCH 1QNZL 3T2PA 1MFBL 2X4UB 3MGTB 3QG7H 5FECB 2CUHA 4B0MM 2M1KA 4YDLB 1JWMB 1RIHL 1D9KB 4LP5A 3KJ4B 2P5WB 1GXEA 2P5ED 3UJTL 5EOTA 1S78C 4XPTL 5IEKA 3LEXA 5T5FH 2UWEE 4P5MA 3FFCD 4YDIH 5DD5H 3BP6B 3P77A 4P0DA 2AQ1A 2YPLE 5BOZG 4FNLL 1QRNA 5IB4B 5K9OA 2YD3A 4APQC 2FHCA 1KJ2L 5JIKA 4FQXA 5DGRA 5DFTA 4X83A 4LCWA 5DMYA 4HS6A 1OAKH 3CXDH 5DRNB 4M6NH 1X6LA 1BF8A 1AI1H 1F8TH 3V7AG 3V6ZA 1PG7X 1MQKH 2AK4B 4FOMA 3HZVB 1U91A 4HSQA 3O9WB 2DQJH 4HS8L 4GUPA 4HH9B 4W6WB 5D7LE 5F89A 5ICXB 3GGWA 3GBML 2Y9RT 1RK0B 2BNQB 3O8XA 3OV6A 2QQLH 2B4CC 4F9PC 2I9TB 1NFDE 5E7BA 5FKAB 1II4E 3QUKA 2X09A 4IDLA 1P84K 3CDGA 4Q6IC 1CTNA 1UENA 4Z5RB 5JHLH 4NIKB 4RX4A 2Q76B 4PRIB 2EH8H 5E8DL 5F6HJ 3BN3B 1PZ5A 3WJLA 4DEPB 2PYFA 4IEFB 3IXAA 5ILTH 2Y07L 3KPRB 4HIEB 1RUKH 3G9VA 5FUZH 1G7QA 2OCFD 2EDKA 4KJWD 4ENEC 1NCBH 3ZL4L 1PLGL 5EOQH 4PUBH 1FYTA 4ZPVB 1UZ8A 1FDLH 5SWZD 4R4BA 2ADJA 5I16A 3KVQA 1EGJL 3QCVL 3EDJA 1ZGLM 1T66D 2WLZA 4HCRA 2K3TA 4LRNL 3PQYB 3C5ZA 3RTQB 3RA7H 4KWUA 3T08A 4NYLB 2R23B 2ZOKB 1X7QA 4CDHA 1A5FH 2AJYH 1NMAL 4MLSA 2NY3D 1CLZL 3CVIL 2X4TA 2FCBA 4CRPA 3KYOB 4LGPB 3BQUA 4HJJL 1BFVL 3DVIA 3KXFA 1KYOJ 4NWUH 4XRCA 2E8ZA 43C9A 4LRIC 2H32B 4LLQA 4X0KB 1DVFC 1OD9A 1AJ7H 4TTDD 3ZKND 2Q7YA 1CLCA 4CNIB 3MV7E 4NQTA 3DUSB 2P5WD 4JRWA 3T8XB 2IG2H 3PP3K 3AXLA 3QIUA 4LLYB 4HT1L 4PV9A 4UT6L 4DVRL 3G04A 4RISL 2RCSL 4KK6C 2EC8A 1UXWA 4GKZA 4ONFL 5HVFB 2G5BB 4L3ED 4R0LB 4OGXH 5GIRA 4LPXA 1OAQL 5B39G 4QT5B 4IJ3C 4QRSB 4DAGL 3W9EA 1QZ1A 4NO3B 5I9QC 3TBVB 2WWMC 4JCLA 1C5CL 1RY7B 4DGIL 1N3NB 5FHBH 3WEXB 1MCRA 1F4XH 2VSDA 5T3ZH 1CBVL 2WQ8A 1VKXB 3Q6FA 1ZVSA 3FT2A 5C0CE 3MLXH 5E94A 1ADQH 3LB6C 1RZGA 1BFTA 1A9EB 4PRID 3C9NA 2XYCA 4CBPA 5EPMB 5CCKL 5H2BA 2WBWB 4GMTH 1OSZA 2C4XA 4QRRE 5AUMB 2CJUL 2GFBB 4DJMA 2DLHA 1U36A 1KCUL 1T04A 1P9MC 2J12B 3CU7A 4ONHA 5T1MA 1BAFL 4JB9L 3TBYA 1FRGH 3UAJC 1NFDF 25C8H 3PQYD 4Y1AA 5BV7C 5DSCB 1P1ZB 3RRQA 1GHFH 3ZSTA 1MHCB 1DBMH 1KF9B 2ATPA 3DVNB 3JTTB 3PWNB 1KLUB 2HH0L 2HFGH 5CP7A 3DI2B 5IHUL 2ERJC 1U8MB 2Z8WC 3VD5A 3IKCB 5D7JD 1SM3L 3TNMB 1J18A 1JHTA 3ARBA 4LCCC 4LFHD 3A6OA 5F9OL 1A6AA 4MX7A 3D3VB 5E6ZA 4TYUA 5FV2A 5HI4C 3L1OL 1NCTA 3LKRB 1T5WA 5EBLB 1P4LB 2R0ZH 3WSQH 4J3XA 3F8UB 5IVXE 3P9LA 2IBGA 4K7PX 1UC6A 1FIEA 2HN7B 1RZIA 1U6AL 5L88H 3JUYA 5DJXA 1U58B 3IT8D 5DHYA 1ADQA 3FQNB 2IH3A 1MRFL 3L3OA 4NQVB 5DJ6B 4JDVB 1N64L 5BZWB 5SWQA 3VXSE 3JV4B 2A73A 4IRJC 4IIQC 5F8RC 3RIAF 4BFEA 4X6DA 2UVEA 1ZLVH 3IYLW 3O2WH 3QEUA 1BGXH 3F65A 2VXVH 5C0AE 1FP5A 3FAXA 5ADOL 3CUPB 3UJJL 1VFAA 1JF1B 4PG2A 1OCWL 4XVTH 1UVQA 1X5JA 2DQGH 1MCEA 3EOAB 4X7EC 1E4XH 1IAIH 4FG6D 3GDBA 4WJ5A 4UDUA 3GIZH 1I4FA 4ZUVA 4NNXB 4CKVX 4XCCL 3SDCB 4X99A 2VXSL 3BD3A 4FTVA 1VADA 3SKJH 1E4XI 2HMIC 5L2JA 4GXUN 4KAQH 2BHYA 5JZ7D 3VXUD 1DBJH 1KTLB 1HHIA 4FFZL 4X8JB 1WLHA 2A77L 1U95A 1B6DA 3BH8A 1INQB 5E6IB 4RMWA 1JGLH 4XPHL 1IILE 1ZA6A 1T21A 5J3HC 3DETD 3SE9L 2X6MA 4YQXL 1V7MH 3OKEB 2CK2A 1VESA 1BZ9B 1I1YB 5ESQA 5GJTL 2F9BT 2B1HL 4FXLA 5GGQH 5I8OL 4Q9RL 3PGFH 1CLYL 5F6HI 3UDWA 3K2UH 1F3RB 3S9DB 3NAAL 4RGMB 1FIGH 2EICA 4XHQA 4GG8A 1I8LA 3LKOA 4Z76A 4J6RL 1BBDL 1KIQB 3BDBA 4PJAE 2FBJL 5B38G 3PWLB 2H45A 4XNZC 3HPLB 3RUGE 3OR7A 4Y5YC 1YZZA 2O26U 4H0GA 4WEUD 3DXAB 4KPHL 4NQEA 5TF1L 3SGDH 1EAPB 4HF5H 3REWB 1XGTA 1ZGLA 2JJSA 1QSFB 2NX5A 4PRAB 3STZA 1GIGH 2IFFL 3U0TA 3LHPL 3PABA 3SGDI 5ID1A 4DUXA 1AY1L 1QPXA 3SDAA 3RWHB 4ODWB 5E1HB 2NR6D 2W60A 5FA4A 3VGHA 2P7TA 1ACZA 2Z91B 2P8LA 3AU1A 3QNZA 4P3WA 2JKXA 3MODH 1L0QA 2DYPD 4Q9QH 5DJZB 3MGOB 1UQSB 5L2KB 4RAUA 1XGYH 1VERA 1FO0B 3T3ME 3QNXB 4Z0XA 4G43A 2AJZB 1CN4A 1UWEH 5E4IA 1LO5A 1T4KB 3V4UL 3WS6C 4K3JL 1JV5A 2FL5A 1BQHA 2Y6SD 4KKAC 3RZCC 4FQ2H 3HE7C 4OGYL 2ID5A 4PJ8A 4ZD3L 5AYUL 1NANI 1BZ7B 1CD9B 1XZ0A 1P7KA 1G9NC 5E6YA 5KSBF 2Z4QB 2KQNA 4L4VE 3SDCD 5DMKA 2R0WL 3PP4L 5ICYB 3N1GC 3EFFA 5IIEB 2P48B 2KQMA 4NO2A 4XXDA 4DGVL 4CW1A 4HXBH 4H8WC 4Z7OF 3HRZA 4N0FA 3GSQA 5TDNB 1OT1A 1J0KA 3PG2A 3DIFB 3IGAB 2OYPA 1QO3B 4RFNC 5JOFB 5JPNA 5CSGA 1JZ6A 5C0IA 5E6ID 5AAMA 2B20A 5DUML 1F2QA 2NY5H 4HKBA 4EEEA 1N0XH 3V5KB 1EHNA 3DX6B 3GM8A 3VWKB 2AJXL 4R90H 3LIZH 1AR1C 4Y19B 4DVBB 5SWSB 3MRBB 5C0NC 3V95A 2MCPL 2AEPL 1MJJB 2XG4A 3I6LE 5KVEH 4Z0BL 5HGHB 2XXMB 5F3BA 1RJLB 1OGTB 3S4SB 1AGEA 1NGQH 4HUWB 4G6JH 4CJ1A 1I7RA 4XXCC 1CT8B 4OKDA 4U1HB 2DWEB 5E95B 4Z7VB 5DJ2A 4H5SA 5I66B 1K8DA 1KFAH 4UT9L 1B6UA 1RUAH 2DMCA 4JPWL 3REVA 3ZKXC 2YPKB 3BPNC 3C60B 3DGCR 4KKLD 3HS0B 3WCYA 3TZVA 5C0RH 4MA7L 4QRPE 2X7LA 1U8KB 5GISH 2ADGB 3BD5A 4N5EC 4PJIE 1JYVA 3CLFL 1GGUA 2PO6A 4K7PY 4K2UL 3WIFB 1UZ6E 1OAUL 4U1KB 3WXVL 4YZFF 4PRHB 1INEL 4K3DL 1RUMH 5GRJL 3HZYB 2XG5A 2O93L 1BZQK 3IDYC 3PWUA 2YXMA 5C09B 2PW1B 4MDIA 32C2A 3MLVH 3QDMB 5EU4A 1M71B 2CIKB 4R97C 2X9YA 3F5WA 4L4TB 2EDOA 1QPPA 1GL4B 1N59A 2ZUTA 5KSAB 4NQCB 1B4JH 1A7NL 1HDMA 4UTAH 4PJBB 3SGJC 3MRJB 2E27L 4Y5VA 1HINH 1NDMB 2X4NB 1UACL 4WVRA 3EBAA 4OM0L 1TJGH 3VXOB 5MHSE 4BYHA 3KLSA 4P2YA 5CZXC 3WHE0 3PHQB 1XFPA 2BVPA 2DTSA 2J6EH 2L0DA 2XZZA 3KPSB 1DL7H 3SO3C 2ESVA 5CEYA 2XZQH 3O4LB 1HWHB 2YS4A 5TQ2L 1WAAE 4WU5B 5K9KB 3IDMB 4ZOEA 2YBRB 2Z93A 1YN6B 1JNJA 2D03L 1ZT4A 2OTWB 4OCWL 4WWKA 4Q0XL 2F19H 5EZLA 1CXFA 1ZA3A 3MRGA 4QTHB 3U46B 4WI7A 1KENH 1BEYH 2CMRH 4GOSA 4K8RH 4YDJB 3CU1A 2YN3A 3LZFL 1M1SA 2Z35A 5CSZA 3J7HA 2WBJA 4MD0A 1W0VA 4LOUD 4EDXB 4DGYH 1MJ8H 5ETUB 4BSJA 3GSRB 1IKFH 3WFEH 4R4FL 1MI5A 2YUXA 5D72L 1WBXA 4CN1A 1KCSL 3R0NA 4QHLB 1OQXA 3QI9C 4NPYB 4KFZC 3W0WE 1G84A 5HHMD 4OZFH 4TUOA 4YHKH 4K07A 5MEND 4KJPD 1NCWH 1XR8A 1X5GA 1LE5B 1A8JH 4DN4L 2NW3B 5HPMB 4U3CA 3RWGB 4W4OC 2IFGA 3ZTJG 3FONA 2GTWB 4JY6A 1QLRA 4HKZA 4GMSH 3WL9B 4WRLA 1D5XB 1TXKA 3C09C 3QFJA 2DLIA 2J5LB 1NUDA 2J6EA 3NPSB 2JLLA 5F93C 5C09D 5DQDL 3PWPA 1GYAA 2E5EA 4EI6A 1K6QL 4IHOA 2FJGA 4NC2B 5F1IB 4JRYD 1D5ZA 1I7ZB 3TYGH 1OQOA 4E41B 4AIZA 5LAXB 4JZJC 2Z31D 2GTZA 4CVZA 3FB5B 4PJIF 2I60H 4LDOB 3ZHKA 5GGTH 1F4YH 4LSQH 1UZ6F 3UTOA 4MA3A 1S7TA 1A64A 2XWJA 4JDZB 4XVSH 4JG0L 4PPTA 5DA0B 2I07A 4LNRB 4FQCL 1CFTA 2V2XB 1G7JA 2V7NB 5IEHA 5E9DE 4BH8B 2ZP0T 2SEBB 3RVVC 4UOJA 3SOBH 3BE1L 4UINL 1G9MC 2CRZA 3AMKA 1U8QB 4G8IB 2BRQA 4PTTB 4LPWA 3D2UB 2GJZB 3WUWB 4N8PA 1QA9A 4OZHB 1CVSC 4J23A 5IK3B 4TNWF 1AXIB 5C0FB 2BVQA 3M8OH 4MD4A 2ICCA 3WKNA 1ZSDA 3PGDB 4N0CC 1MIEH 4IBLT 4LPYA 1A0QL 5CHNA 4XPBL 1RZKL 2BOCB 1JHLL 1NH6A 4NN7C 1U3JA 3VXNA 2X05A 5BMFH 3TN0A 1V3KA 1U93A 4LARL 3QPXL 3X3GL 5IMMA 5EO0A 2CLRA 5IJVB 3QJHA 3R8BB 5FA3A 1KT2B 5KANI 3QCTH 2HT4D 4JHBA 5I8KL 2CIIA 2W91A 1A6WL 1LO0L 1ZGLP 5HXMA 3BPOC 1FC1A 3FJTA 1Q0XH 3MRPA 4APQB 1T5XA 1Y6MR 4ZDHA 3VFTB 1TCMA 1NDGA 4QTIL 4UIKH 1AKJD 3QWOB 1J0ZA 3HR5A 1D5MA 3BI9X 4PJ5A 3EFDL 4Q7DA 1P4IH 4ODVL 1OAYH 5FGBC 5I1HH 1RU9L 5IROC 4X7DC 1OD7A 2Y25A 2DQDL 1RIUH 1BF2A 2DKMA 3SKMA 5ACMA 2DIAA 2YHGA 3KJ6L 4UUJB 4WNQA 3DUUA 1F3DJ 4KY1L 5DT1H 3THMH 4E41D 3DRTB 1N6UA 3BN9C 4H1LG 3RVXC 3KHQA 5I1CH 2DTMH 2NY2C 1X5YA 3JWDH 5LQBH 3BRDA 3EO0B 1OP3K 3J8F7 1CR9L 4ACPA 3ZTNL 4K23L 5D2LA 5F71A 1UKQA 5I74C 3BYTA 3F12B 4OLUL 5F9JA 1XCQB 4EVNA 5E99H 3PWVA 5DO2D 3TBWA 1MFEH 1WZMA 2RIKA 4U6HB 4LIQH 1HHKA 4MSWA 5FHAL 5DMIH 3VRJB 3IFPB 1ONQB 4F58H 1IC4L 4QLRA 12E8H 5EDXA 4G9FD 5EC2B 3RNQA 4Y4KB 1S3KL 2A38A 3LS5H 5J6HB 5IFAH 4JY5H 4QOKE 4JJHA 2ZCLL 5CUSH 4PV8B 5J57B 2NXYC 5EULV 4OFYD 4LGSB 3QXVA 1TENA 3DX9A 4JRXA 4LVNB 1YEJH 5F9DC 2E6QA 4GH7B 4U6VH 2DJSA 3BKJH 4H26B 2OBGA 3SKNB 3GJEA 3HAEH 1HHJB 2JIXB 4MAUH 2RJMA 1JZ4A 5T33L 3T0VA 1NBVH 4GRMA 4NRYA 2BCKA 5SV4A 1S78D 1JZ8A 1QLEL 4JO3H 3CLEH 5F1OB 3SGEH 5L9DH 4KVNH 3U4BH 3TIDB 4OT1L 3PNWA 2MMXA 3U7WL 1J11A 1KIRB 1R3HB 2ZOLB 3OKLA 4JQVC 4APQD 1MSPA 4YHOH 3CC5B 2E9WA 4BQCA 3HNVH 2H8PB 3SGEI 2VDPL 4LLUB 1SBSH 4TVPE 2CKNA 5KS9E 2OZ4L 3BPCB 1A7PL 4XZUA 1UB6A 1DN0A 1F58L 2C4FU 5EUOA 1QACA 1SY6L 3MREB 5DD6B 3HB3C 1L9NA 2K9UA 1XGRA 4U1LB 1T2QL 4RFEB 1JWSB 4PJXA 3MXVH 1A6PA 4KHXH 5C0BA 4NC0B