2F53E

Directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVSVGMTDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen
publication title Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2005-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53E02
4Z7OF 1FYTD 1RZJC 1H8OA 4NN5B 2XKNB 3K0WA 4D0DB 4ZUSA 4P2RE 4RFNB 3SKOB 2PYEE 2Z8SA 4ZD3H 1DUYA 2E7LC 1FH5H 1FL3A 3KHOA 5D7LB 5JO5B 5E2JA 4Z78B 1S7QA 2CKBB 1NCCH 2HTKC 3ZKXB 3O3UN 1T22B 4PJIA 3T0XA 2CRMA 2HJLB 3FONA 4M48L 3RWIB 1SYSB 5J1AB 5I8OH 2ZSWA 3K4ZA 3BP4B 4R6UA 1YYMH 5IJVA 5C0CD 3N85H 5C2UB 5K9OA 4DZ8A 3UTTD 5ERWA 3VXTB 1PD6A 2Q7YA 2J8UB 2Z31B 3N1QC 4X6CB 4M1DH 5FUOL 4C56B 4WIQA 1AQKH 2LABA 2EE2A 4KROC 2CR3A 4NO2B 1F4XH 1X4XA 2MKWA 1WBXB 1EIBA 4POZC 2OK0H 1E0OB 1U95B 5M95B 3GGWA 4P49A 1IAMA 4X4ZA 1MY5A 1OD7A 5FA3A 3FT4A 5B4MD 3IYLW 2WINA 4M62L 4NNYA 1ADQH 1HYSD 3V4PH 3CPLB 3DRTB 2FX9H 4ORZC 4WJ5A 1KF9B 5MERA 4Q9BA 3OAYH 1A2YA 4Z8FH 1IGCH 2AI0L 5IB3A 4K8RL 3BJLA 5IV2B 1XEDA 4HWBH 5D2LA 4WU7B 3QWQB 2P5ED 1YMME 4AM0B 1K8DB 5AZEH 5LXGL 4ENED 1DLHB 4FFYH 1ZGLB 5F1KC 1KUMA 3DI3B 5BZWB 3VFNA 1T6VN 5D1ZA 1NFIA 3TA3B 3ZZ1A 2HVJA 5C2BL 4OCXH 4X7EC 3QDJA 3FN0H 1R3IH 4QYOB 1PBYA 5D5MF 2F5AH 3O3BA 4H5SB 2VLRB 3PJSA 1HSAB 5F7NC 1QHOA 4ZTOL 5E94B 1PG7H 2O5YL 3UX9B 1DUZA 4UDTA 1IT9L 1VACA 3D0LB 1KEGH 4F9LA 3DHJA 3WBDA 4O2EA 3TM6A 1QSED 2IH3B 4LCIL 1QR1B 4IEFB 4KRPD 1UB5A 4LLYA 2DICA 2HFGH 3OJDB 3MMEB 5F1OB 4H1LH 5I1GH 1MUJB 3VGBA 2FIKA 4WFEE 2BRQA 3QP3A 3I9GL 1FDLH 1DQML 3GB7B 4QOKA 2ID5A 4JFED 3IXAB 4KVNL 2HN7B 3BAEL 4IMLA 3MBEC 3QUKA 3QXTA 1KTLB 4I0PB 4ZFZA 3KVQA 5KSUB 2WW8A 2UYLA 4RMUA 1UXWA 2XZCL 2A73A 3QH3A 1MHPH 2ED7A 5IJKA 3ARTA 3FMGL 3W9EA 1MWAL 3NIFF 1U93B 1SEQL 2PF6A 2DL9A 3IXTB 4M7ZB 4ZAKA 5HYJD 2YZ8A 4XH2B 4L4TD 5C9JA 3KPOB 4PJ5B 3TYFA 4ODVH 1I1AD 1RIVL 5E1AB 4DQOH 2AS5M 2NY6D 2AI0H 4K8RH 2Z8VC 4LNRA 4JE4B 5KTEH 4MJIA 1VA9A 2PXYC 2ZCHH 4JKKA 4U6TA 4G80A 3LEYH 3TJEH 1CLZH 1VPOL 2LFGA 1WWWX 1HH9A 3T4YA 4HIJB 4MNGA 3PXHA 1AJ7L 3KYMA 3U0PB 3ZSSA 4E5XB 5I73B 5C2BH 4YAQB 2OXHA 8FABB 2OZ4H 1B4RA 1YQVH 2NXYD 4ODTH 3NA4A 2Y25A 5I19H 3BQUD 4L8SC 4MNQD 1T1ZA 3BIKB 2O5YH 5C0BA 4JZJA 1VADA 4MDIA 1QRND 1IT9H 3ARGD 5I1KL 1KULA 4WUKL 3PWLA 2HT3C 5T3XD 1LO3H 3TPUB 3MX0A 4LCIH 1ZHLA 3PDOA 5I2IB 5DF0A 2EE9A 3QIWB 5BMFL 3U1SH 3VXQA 3AREA 2NY4D 3LEXA 2ZG3A 1X9QA 3EDJA 1IGYA 5DR5L 1V05A 5FDWB 1EVTC 2NX5D 5DC0A 2O5ZL 3OAUH 1KCUL 1CQYA 3MRMA 5HHQA 1QBAA 2X1OA 1XCQA 4G8IA 3IETB 1DQMH 3CMOH 2APTA 3VA2C 1FO0L 1JPFA 3Q3GB 5IB4B 3BAEH 4JPWH 2BY3A 3EO1B 1CD1A 2NY3C 5CIPA 3BGFB 4NBYB 5FM5O 1U8PB 5I76A 3ZYZA 1OW0C 3QDME 3MJ8A 5KG9B 2XZCH 1T66D 4MNHA 2H2SC 5HYIA 1MF2H 2A6IB 5BW7C 3OGCA 4X7CC 1BIIB 4HV8B 3FMGH 5BS0B 5JQHC 1SEQH 4EBQL 4I9WD 4YEFA 4Z7WE 1DANU 1QA9B 5ADOH 4DW2H 3M8OL 1D9KC 3A0OA 1GH7A 2HG5A 1MIEL 2EYTB 4X4YB 1J10A 3MA7B 5ABDE 1NC2B 1JNHA 2E8YA 3P77A 4NUGL 3LV3B 3V5KB 2YUWA 1ZA3A 3IDJA 1C08A 2F8VA 2QQQA 1DBJH 1FNSL 3Q5YA 1AGEA 3BZ4B 1JJUA 4M6NL 5F7UA 5KAQF 4O2CB 5I6XC 1KN4L 2EECA 2B8OT 2GEEA 3MLPA 3S88H 4L1DA 3CSGA 1ZLVK 1BVLB 4ZO6A 4CMHC 2ADIA 3EDKA 2FJHA 3RVVD 2YD8A 2AJVH 3X13A 3O2VL 3QUXB 1VFMA 5JXAH 1DL7H 1W72B 3RX7A 4IRJC 1U3HC 3HTLX 1X5JA 5D7IE 4CVZB 4MJ6B 4S0SD 5AD0B 3AXLA 3TJHC 1MLCA 2XZQL 2A9MH 2PTUA 4U1KB 4OM1L 4NC1E 2NR6D 2HMIC 1M7IB 2XNAA 4R4BB 1CICC 2V7HB 5IF0A 5HDOA 3CFKB 2LVCA 2MCG1 4FXGB 1BQHB 2GY5A 3RUGA 4PGEA 4U7KA 5C0NC 4YWGL 3E0GA 1FO0H 2VAAA 3UTSE 3ZTJG 5IBLC 3K2MC 4C54A 4Y1AD 3CFCH 4JFDB 5CGMA 2BP3A 1RZIA 1KB5B 5D2NA 2A0LC 1IEBB 4XGZA 3QQ4A 2APVA 3O4LA 4TNWK 3B8SA 5EWIL 3HNTL 3TVMA 43CAA 9CGTA 4QXWA 5EFIA 1TTFA 5AYUL 1ZAGA 1PQZA 5I1AA 1EBPA 3RPIB 2OL3B 1R5WA 4S1RL 3V52H 1MIEH 2O61B 1I3RA 1JWUA 1G9NL 1S7RA 5C08B 1I1YA 1FYTB 2ICES 4H26A 3ZDZE 4BKLA 1UKTA 4I3SL 4UAOC 1QPPA 4P9MH 2DKSA 1I1FA 4NM4L 3GMNB 3OTTA 5EC1A 1FNSH 3MJ6A 3DX7B 3MNWB 4OZHE 4NN7C 2R29H 1GHFL 4LQFL 3LH2L 1KN4H 1AI1H 4F33B 1VFAB 5C0CB 5IQ9B 2BSSB 3OXSB 1BZQK 1YPZA 1PFCA 1FNGA 3UTTB 4WWKA 1A4KA 2RBLA 4N0CD 4WTZA 3I6GB 3BH9B 5GRJH 3FFCE 3PWNA 5FOBB 1QVOB 4UZGA 4D0CA 3I50L 5EUKB 5F9WC 1F11A 5DHVH 1Q94A 5C09B 2XV6B 4WTXA 1FBIL 3RIAF 1D5ZA 3BZDA 3F7QA 3ARXA 3KLSA 5TQ2L 2XZQH 4WENB 4JRXA 4MXVF 3DROA 5H8DA 2OSLA 3F58H 3G5XA 4Y2DA 4IRZL 1I8IA 2DQIH 1FVDA 2P48B 4NKIL 4HUVA 2DDQH 5SV3A 5KZCD 2DLIA 2P5EB 1S7XA 4GW4A 1YJDC 3DOSA 4PRBA 2PTTB 3B9DA 1MREL 2G9HB 4NQUA 4OZ4B 1CK0H 3QEGH 1KEML 2CIIB 2FEDD 4R9HA 3MRBA 4J4PC 4WGWB 4PJ8B 3OBAA 4OV5B 1KELL 2OLDA 4HXBL 4J8RB 4LF3B 4K7PL 5ID1A 4LPVA 1RK0A 1K8IA 1NCBH 5I15L 2HTLD 4U1JB 4Q2ZB 4EVNA 5EWIH 3V4VL 3LDBB 2XWBA 1OAXL 4FTVE 3QDGD 2FGZA 3PNWA 1EGJH 5AYUH 1NGPL 2VH5H 4LLQA 4PJ7B 4LDLB 2H2PC 2DWEB 1D6EB 1CLYL 3TYGH 5E2VH 1T4KA 3CDGA 4S1RH 4ODSH 4MB4A 4CRPA 2HRLA 1BOYA 1QSEB 4LAJH 3GJEB 3OAYK 4OBSA 5E03A 1G7QB 5L2KA 4Y16B 2F53A 2BXYA 3L6FB 3KDMB 2ZNXA 1T1WA 4ZFFB 2XFXA 1MCDA 4XPGL 3AS2A 4HIHB 2ITDB 1ZLSL 1FLTX 4WI6A 4N9GA 3IS0X 1RV6X 4NM4H 4S1QL 2YXFA 5DRNB 1U8LB 4DFHA 2HJKA 3C5ZB 1AGDB 4ONOA 1FZJB 3DSFL 1JFQL 1INQB 1ZKAA 4OIIL 1I8KA 4PIRF 2VLJD 1MCHA 4JFFD 3RKDC 4LAQL 4A2MA 2R1XA 4HS6B 3NH7H 5GGSY 1BJ1J 3UO1L 3NGBC 4KKBD 4NQED 5FYLH 3I50H 4XC3H 1LEIA 5GGRY 4H25B 3RVXD 4APQA 3CFBA 1FBIH 5HHOB 2C26A 4E0RB 3MC0A 5HYJB 4KKAC 1MCPL 2ENSA 3OKNB 2GJ6B 2XKNA 3VFTA 5GJSL 3KLDA 4D0DA 4LSRL 5JUEL 3SKOA 4Y88A 1I1AB 3RL2A 4Q9QH 4S10A 3NCJL 3OQ3B 1FPTH 3TFKC 2NY6B 4NKIH 5D7LA 5JO5A 5J06A 4Z78A 1UWEH 5IB1B 1RZJL 2CKBA 3LPWA 1T22A 1MREH 2HJLA 4K94H 3RWIA 1SYSA 3R06B 4PFEA 5J1AA 3MFGB 1J0ZA 1EBAA 1KNOB 5IFAH 3BP4A 3UTPD 1LHZA 5HYSG 1T2JA 4HXBH 4L4VE 1NANH 4K7PH 4PJEE 2J8UA 2Z31A 4JFXB 4X6CA 2V9TA 3BT2L 2ED9A 4C56A 1LK3L 2C4FU 2EE3A 1M05B 4NO2A 5I15H 4YXLL 2NXYB 1WBXA 4HZAA 4IOFD 1U95A 4KTYA 2ICWI 5C0DB 3BQUB 2DTML 4MNQB 5ITFB 1NGPH 1TLKA 2PUQT 3ARGB 3CPLA 3DRTA 4KMTL 2CDFA 1KXVC 3DARA 4GQ9H 4KUZL 4PRPD 2J4WH 1CL7I 1J87A 1A1MB 2NY1C 3F7YB 1LP9B 5IV2A 3O8XD 3S98A 1VENA 4WU7A 2H9GB 4AM0A 5I1JH 1K8DA 1DLHA 1P5UA 3QPXH 1ZGLA 2NY4B 1K5NB 3MJ9A 1FFRA 4S1QH 4CL7A 5BZWA 3KHQA 2LV4A 3V6OE 4H8WC 4NQDE 2NXZB 2B5IB 5EU5B 3TA3A 1U8HB 5DVMA 3H8NA 3IU3B 1J0YA 4XAWL 1YA5A 4OIIH 3WXVH 1F42A 4QYOA 5C7XL 4H5SA 4LAQH 1HSAA 3PWPD 5LBSL 3C9NB 5E94A 4OT1L 2JJTC 3MRDB 3EJZD 3D0LA 1T5WB 1KLFA 2IH3A 1QR1A 1HI6B 3ET9F 1NC4D 2ZUVA 4Y5VB 1VB9A 3OJDA 3AC0A 1MHCB 4TVPD 2IBZY 3MMEA 2B0SL 3NCJH 4U31A 1MRDL 1EEQA 1MUJA 3GM8A 3H3BC 1NGZB 3E2HC 5EBLB 1RZJH 1TCRB 2ZKHL 3DECA 3GB7A 3S35X 3IXAA 2HN7A 4JPKL 2ORBH 4XP5H 5C0AD 2N7AA 1H3PH 1DANT 1KTLA 4I0PA 5KSUA 4I77L 4G7VL 3SDAB 4URTB 5FM5M 4D3CL 4D9LL 4TTDD 4HJJH 1S78D 4HK0B 4CVXB 3S8WA 3QIBD 1U93A 1J8KA 2EZ0C 3C09B 4FZEL 4P23D 1FC2D 5FUCC 4YE4L 5JW4M 3IXTA 3O2WL 4XH2A 4RMTA 3KPOA 4PJ5A 1MRFH 2VL5B 2WANA 1CDYA 4U1SB 3KYAA 4GH7B 3L5JA 3G5VB 3AVEA 5E1AA 5SX5H 5E9DE 1F00I 1WK0A 4B53A 3OMZA 3T0ED 1TJIL 1Q9LB 5T5NG 3RY6A 2AEQL 2MOVA 2RCSL 4QRPD 3PGFL 4XVTL 1WIPA 1ZANL 1ZS8B 1JE6A 1MFCL 4YNYB 5ALCL 2Q86B 4Z95H 4Y0GA 2PO6D 4HIJA 4G6KL 3U0PA 2YN5A 3QHFL 4E5XA 1GGCH 3V5DB 4YAQA 1CGUA 4I0KA 8FABA 2OBGA 3E8UL 5L0QB 2V6HA 5IBTH 4U05A 4FRWA 4JY4B 3THMH 3U7WH 5F89B 4F7TB 3ROOB 1P4IH 3BIKA 5FK9B 4N90D 4OSUH 1IC4L 3SDXE 1YY9D 3TPUA 4FQQB 5I2IA 2YSSB 2NY2B 1NCAL 3LKRB 3QIWA 1H3TA 4XNYH 4PLKD 2XRAL 2B0SH 5FDWA 1BQLL 1MRDH 1I8MB 3WSQL 1CDHA 2ZKHH 1WWAX 5HD8D 3WEXB 3Q3GA 5IB4A 1WV7T 4JPKH 5D4QA 3LHPL 5HHPB 4R8WH 3EO1A 1N5YL 4ELKB 1U8IB 4I77H 3GSNL 1U8PA 5KG9A 2C4XA 3G08B 4D9LH 3BH8B 1AGCB 2EDOA 4D2NA 4C57C 5E2TH 3WKNA 2A6IA 3TCLB 1BIIA 3C2AL 5F9AC 3ARDD 1KPRB 5DI8B 5BS0A 2OTWB 1A6PA 1Z3GL 2ICWB 2VSCA 1X5ZA 4PJBE 3O2WH 1QA9A 3TWCH 3QI9D 3RWJB 15C8L 4NHUB 3UXFA 4M03A 2EYTA 3QFJE 3ULVE 4X4YA 5EU6B 2DI8A 3MA7A 4F7PB 5E1HB 3VG0H 3ULVC 1X7QB 4GXUM 3LV3A 4JKLA 3V5KA 3SOBL 2P5WB 2PW1B 4JM2C 1QKZH 4WW2B 3R0MA 2AEQH 1J05B 2IADB 2VMFA 4PRIE 3PGFH 4UTBH 4NHCL 4Z7WF 4FFWD 3BZ4A 3ZKQD 3DVGB 4XNQB 4XP4L 3TPKA 1PKQE 4G6KH 1K9TA 1INEL 1HE7A 4O2CA 4HW6A 2HA1A 4XWOC 3BP7B 2MCPH 3E8UH 3MUHL 2OI9C 4EN3C 4TPRL 5DUML 3V0AC 1BVLA 5CZXC 3LY6A 3ULSB 3MLXL 2VDRL 3QUXA 3RVTD 4FQXD 1W72A 4L3CB 4JGJA 1IC4H 2FIRT 4LDEB 3IFLL 3S36X 5KN5B 3MV7E 2WNGA 3QDGB 4CVZA 4MJ6A 3MLWL 2RGSA 5AD0A 3D3VB 2P47B 1NCAH 1JRHL 4KZDL 4GXUN 4S1SH 4ZYKB 4U1KA 2VC2L 4EQ2A 1M7IA 4HS8L 4R4BA 1BQLH 1I1CA 2A83B 2V7HA 2WMPA 2IPUK 5T5FH 4LCWD 4PB9L 3CFKA 1JGEA 1V5JA 5HHMD 4FXGA 1BQHA 4M7JH 4HIEB 3TLRA 4YGAB 5D7IF 3L9RB 4K8RD 1ZVYA 1FAKT 3RIFK 1AE6L 4IS6B 1UA6L 1N5YH 1RURH 3MGAA 3GSNH 3OR6B 4JFDA 4R7DB 4BYHA 2XZZA 1KB5A 1IEBA 4GAFB 2XQYK 1U36A 2FEEI 4N0UB 3C2AH 5AG8A 1Z3GH 3ALXA 2IBGA 5A2LH 1SMOA 1E4KC 2RB8A 5GHWL 1IEHA 1UCBL 5CGYD 5HI4D 3RPIA 2OL3A 3UBXG 1ZMYA 5I74C 5C6PB 7CGTA 1A1OB 4G7YL 3GHEL 3LS5L 1N26A 3RU8L 2FGWL 4HKJB 5C08A 2FECI 5F96L 4PJCB 1FYTA 3K8KA 5BVPL 5EUOB 2X1QA 4M1CD 5EB9A 2NZIA 1IC5H 5DD0L 3GNML 3SO3B 3FQRB 4YHZH 3GMNA 3PXJA 2V17L 4NHCH 3H9HB 3DX7A 3MNWA 4R0LC 4C4KT 1P4BH 3G6JB 4NZRL 2FHFA 1AIFB 5HGAB 1IQDB 2JCCE 4HH8A 4F33A 1VFAA 5C0CA 1N2RB 5IQ9A 2BSSA 2G5BB 3OXSA 4JVWA 5E99H 1N0LA 1Z5LB 3ZDZF 3I6GA 1OWRM 3BH9A 3MLXH 4TN9A 4MX7B 5FOBA 5IG7B 2VDRH 1QVOA 3IDUA 5EUKA 4LPWA 5BRZD 2DQEL 5C09A 3VU2A 3IFLH 5L8LB 4HG4K 4OZHF 3OZ9L 5J0BA 4WO4D 3WFDH 4M7KL 1GVIA 3MLWH 3QJFB 4G6ML 4MAUL 3Q6GH 1JRHH 5EG6C 3ARFC 2XYCA 1N64L 2NW2A 4PRPB 3HAEG 3V6BR 2BOCA 3QCTL 4HS8H 2BNRE 4LCCB 4PJ9D 4XP1L 5ALBL 5JR1L 4UBDC 3O8XB 1TTGA 1QFWM 1ZVHA 2BXZA 2MTPA 2C4FT 4R90H 5I1LB 2P5EA 1UACL 1XIWC 1AKJD 2PTTA 2G9HA 4OZ4A 5HI5C 4JQVA 4PJ8A 5I1CH 4OV5A 1AE6H 1ZSDB 5FKAB 4J8RA 4HJ0D 1ZXQA 4LF3A 5CP3A 2XY2A 3VGDA 4JVPA 1YJDL 1OT1A 3VD9A 1WQVT 2VJXA 1CF8L 4Q2ZA 2AAVA 4RGNB 3PWPB 3NABL 2X40A 4J3SA 5GHWH 4QXGL 4DN3H 1UCBH 4PJ7A 1JL8A 3EYUL 2DWEA 1D6EA 5F88B 1U2CA 1NBYB 4LEOB 1S5IL 1QSEA 3LS5H 3RU8H 3GJEA 4R26L 4C58B 3EW3B 1G7QA 5F96H 1NC4B 4Y16A 1P1ZB 3L6FA 1IJ9A 3KDMA 4GRWE 4N68A 4ONFH 4ZFFA 4P3CH 1B0WA 1I85A 1NMCB 4KHTL 5DGRA 2ITDA 5FCUL 5DMJB 2Z35B 3VG9B 5DRNA 1J18A 4YZFE 5AUMB 2ZZUT 3C5ZA 2BJML 4NT6B 1AGDA 3R0NA 5DQDL 1JHTB 1FZJA 4LFHD 4NZRH 1INQA 1K3IA 3VWJD 5IMMB 4JG1H 1OGAE 5FOJA 4HS6A 2KZWA 1Y6KR 3ZYJA 4ZFOL 4NKMB 5GGRB 3RGVD 1HNFA 3VFPB 1Z0NA 3QIBB 4J3XA 2BVPB 1BVKB 2DQEH 3RVWD 4H25A 4LLAA 1CDGA 3C60B 1U6AH 5HHOA 4E0RA 4JLRB 4P59L 3NIDE 1LDSA 5HYJA 4MS8D 4MAUH 3OKNA 3A6BH 1WZ1H 2GJ6A 5C9KA 2MQ3A 4YHLH 5DD6B 3RDTD 1JTPA 5ILTL 4V2BA 5C0EB 4PTUB 1I1AA 2R8SL 3AM8A 1FCCA 4OI9A 4PRNB 1PLGL 4QHKI 4HHAB 1HZHL 4OLWL 4XP1H 2VUOA 1L0YA 1HCVA 5IB1A 2F58H 1UACH 4DK6A 3TEUA 3QAZB 3R06A 1KIRB 5MEOB 4NCDA 1KNOA 1EMTL 1I7TB 2NY5H 4LSPL 2PO6B 3W81A 1CXEA 4PGDB 3L3DB 3ZMRA 4JFXA 3RZCD 4LEXL 3WN5C 3ZHDA 1M05A 3MV9D 3MRJA 4HJGB 3DUUB 5DT1H 4NFCA 3BKCL 5C0DA 1J88A 3VGFA 2AK1H 3PHQB 4MNQA 2J88H 5ITFA 2DQTH 3ARGA 3K3QA 4FZ8H 3IT8D 1Z9MA 5I1HL 1A1MA 1S5IH 4Y19B 3MRPB 2BY0A 4R26H 5SX5K 2LTQB 5JHDB 4OLVL 4PJEF 3F7YA 1LP9A 5F44A 2FHCA 2V7NB 3BPNB 4NN6B 5FHBL 5HHVH 2H9GA 2CLVB 3V7AG 2DYPD 1K5NA 3GMPB 3GKWL 4NKQB 3MV8E 2YUXA 5ENWB 2BJMH 3AY4A 5EU5A 5DQDH 1U8HA 3IU3A 5EZLB 4O02L 2HKFL 3RJDA 3CVHH 4MD4A 2JLLA 3VJ6B 5BJTB 4IIQC 2XI9A 4BQ8A 1WZKA 3C9NA 4K55A 4NFDA 4YDIH 3WO4C 1N6UA 3DSNA 1PZ5B 3MRDA 3D69B 3ARDB 4Y4KC 1T5WA 4P59H 1P7KB 3FB5B 5CLTA 1HI6A 4ZUUB 1KB9K 5IP4A 1U8MB 3QI9B 2QTEA 4K2UL 4Y5VA 2JB5L 3EYFB 3BW9B 5GRUL 5J6HB 1MHCA 5L9DH 1R24B 5CUSL 1PLGH 4AEHH 5JW4Q 4JKPH 1A3RL 4Z9KB 5TFSH 1LEKB 1VDGA 4PJHE 4XAKD 3T65B 1NGZA 3CZFB 5EBLA 1TCRA 1EV2E 1KLUB 2D4FA 1N6QL 1M7XA 5GISL 4X7SL 1KGCD 2ZUQB 1EMTH 2XKUA 2R4RL 5L88L 1XGYL 4QWWD 4YDVB 3SDAA 4KDTC 1K6QL 4XCYB 4H1LB 4B7LA 2WLZA 1FN4B 5DRZB 4LEXH 3OKYA 5JDJA 1EUUA 1URLA 4HK0A 4CVXA 2B20A 2GT9B 5ANME 1MFAL 1S9YB 3G04B 1FV1A 5D8JL 2DBLL 3SDYL 4FQXB 2VL5A 3B9KB 2J8HA 4OM0L 3RI5F 4U1SA 4LBEB 2FD6L 3HHRB 3G5VA 5FYLD 3OPZL 1Q9LA 3IDXL 2VXSL 3HCVB 3LPFA 1N4XL 4LSSH 4ZO7A 3BKMH 4G6AD 3GKWH 2BVOB 1U3JA 1ZS8A 4OGAD 2YD4A 3TN0C 4RWHA 4YNYA 1M1SA 2CUIA 3HNSL 2Q86A 1MVFA 2X42A 4I18B 2HLFC 2CD0A 3V5DA 5L6YL 4RFOH 3OF6D 3LRHA 1G0YR 4O02H 1WIOA 3GK8H 2J6EH 5F72S 3DV4B 4JY4A 4F7TA 5F89A 5EZOL 1BJMA 3ROOA 1FQ9C 4H8WH 4OLEA 4MA1B 3B5HA 5FK9A 4EDWL 3DUSA 1PGRB 2VKXA 4Q6IC 2R0KL 3U4AA 2CQVA 4R97C 2AK4D 1UM6L 2FO1A 4HC1L 4ZUWB 5D5MB 5FGBA 5IGXL 4FQQA 3I2CH 1CDIA 1FLRL 2YSSA 3O2DA 3BEVB 3HRZB 3LKRA 5I1EL 1QBBA 1GAFH 5ID0B 3DIFB 3BPLB 1KIUA 1B4JL 1UEYA 1EZVY 5CUSH 1V3JA 5DMKB 5FYJL 1I8MA 4LPCA 3GSWB 5ESAB 3KPRD 4L1HA 3SDXF 3WEXA 1BZ9B 4EUPH 5DMGC 3OKEB 4AY0A 4NDMB 1N6QH 4Z0XB 1HINH 5HHPA 1W0YT 2BHZA 3NZHL 1JPSH 2R4RH 4ELKA 1U8IA 1TZHB 4X9FA 3G08A 3BH8A 4Z7UE 1AGCA 1BFTA 3QXDB 2P45B 4MXWL 2XIDA 3TCLA 4ERSL 4DGYL 5IW1B 1KPRA 4WI4A 2OTWA 1ONQB 4G9FE 5FV1L 2ICWA 1EHXA 4ODWB 1MFAH 2OJEB 3VXUE 3RWJA 4NHUA 3KJ6L 3ZL4H 1S7UB 1CLOL 1OAUH 5DXWA 1Z6JT 2FD6H 5EU6A 3H9SE 4F7PA 1X7QA 3OKMB 2ZJSL 2P5WA 2PW1A 2VXSH 2CMRH 4JO1L 2PW2B 5CHNB 1J05A 2IADA 2CK2A 1VGKB 2B1AH 3O81A 4PJBF 2Z8WC 1JI2A 1FAIH 4HLJA 2D7QA 4XNQA 1G6RL 1QSFB 4UOW1 1BREA 1S3KL 1F4HA 3NOIA 4JR9H 4YFEA 5L6YH 3ULVF 3BP7A 3I6LE 4M6AA 2N7BA 3QUYB 1BEYL 1QFOA 4JM2F 1ZLWH 1CDBA 3K2UL 3ULSA 1FNFA 2HWZL 1L7TH 5HDBE 5TQ0L 2B2XL 1NH6A 4EDWH 4XBPB 5FKPB 1JF5A 1KYOJ 5IBUG 4HF5L 4LHUD 4L3CA 5C0JB 5JQ6L 5DUBA 3S96B 5IR1A 1X4ZA 3NVQA 5KN5A 1KFAH 3P0VL 4JRYB 5C71A 3RP1A 3UYPA 3X12B 3QDGA 1IKNC 4GBXB 3K80A 4FOMA 1XH3B 1FLRH 3D3VA 3IGAB 5J12C 5I1EH 3MUZ1 4ZYKA 2OMNA 4OFDA 4WI3A 2MMXA 3V9FA 1B4JH 2AKRB 4ZODA 4OB5H 1CFNB 1MCEA 3NCFB 2A83A 1OF2B 1CBVL 2BHYA 4PB0H 5ICZB 4KROD 3VFOB 3N06B 4HIEA 4JZOB 4POZD 4RA3A 3SE3A 1A7RH 3UBXI 4F9PA 3L9RA 2AJUL 5EA0H 4FXKB 4IS6A 1D7FA 3NZHH 4R7NA 5D6CB 1OSZB 3OR6A 4R7DA 1MQ8A 2XKSA 3SGKA 1WAAA 4J7RA 3GUTB 1QYGL 2NY0C 4MXWH 4LIQE 3VWJB 4ERSH 4G5ZH 3RWHA 4N0UA 1KOAA 3ES6B 2X1WL 1QBML 1XFPA 4JFQB 4P2QE 1CXKA 5DD1H 2X41A 4ZPTB 3T77B 5F97E 2W65B 4YDLC 4L9LC 5E2UL 1A9EB 4HS3B 1YMMD 3O0RL 4U3CA 5IM7B 3RGVB 3KJ6H 3DMMB 1IE5A 4EQ3A 4M43L 1A1OA 4RDQF 1FG9C 3U30B 3C08L 1TQCC 1HKLL 5F1NB 4S1DD 4HKJA 1FSKC 4PJCA 5E8EB 2FX7L 5EUOA 1UQSB 1JYVA 3Q2CA 4GQPH 3WIIL 1RZFL 3G6AB 4X7FC 3FQRA 4PBWD 4F3FB 1G7JB 5GRWA 3EUUA 3H9HA 1L0QA 3QJHB 4JFEE 1G6RH 2H32H 3G6JA 2DS4A 5EBGA 4LRNH 3ULVH 1AIFA 5HGAA 1IQDA 1GGYA 5F3HB 1F3RB 3KYOB 2HFTA 1N2RA 5IVOA 2G5BA 3D6GA 3FRPA 1Z5LA 4JHWL 2WWMD 5GQBA 5HHNB 1KCSL 4YX2L 5F8RC 1TXKA 4MX7A 5IG7A 3WYRA 4U6XB 3RA7H 4CNIB 4X6BB 1PEWA 2V5YA 4L4TE 2CJUH 3P0VH 3MRFB 2DWDB 1MCCA 2YD1A 4DVRL 3QJFA 3WJJA 5FEBA 4KKNA 2JCCF 1XT5A 1LD9B 1HNGA 1J0JA 3MBED 5K9QG 4PRPA 4KZEL 1EJ6A 1NCWL 4LCCA 1CBVH 3O8XA 5I1LA 1VEPA 2DYPB 3PE9A 4FQ2H 1J5OL 1IAOB 4JO3L 4MA3B 5J57B 4P2OB 5FHAL 3SGDI 1IKFH 1ZSDA 3GSVB 1FYHB 5FKAA 4P5TB 5DJXB 2I27N 3DYOA 3ECBA 2KZ1B 1EERB 5DO2C 4UQ2A 3O6ML 4PJXE 1FNEB 3VDBA 3PWPA 1QRNE 2K7QA 3RAJH 4XPAL 1LDPH 5E2UH 3H7BB 3UYRL 2X9YA 3HE6B 5F88A 4JREB 1Q0XH 5D93B 4LEOA 1FNLA 4M5YL 2Y36L 4ODUB 1NC4A 2FJGB 1P1ZA 2NW3B 1AD0B 1TITA 5ADPL 2HP4A 2Y06H 1W0VB 2ICCA 2NX5E 3WIIH 2VDLL 1YZZA 2Z35A 5F7YC 4UIKL 1SBBA 4AL8L 5AUMA 1BFVH 2D7OA 5D1ZC 4NT6A 4WFGD 1MJ8L 1JPTL 1JHTA 3GBNH 1A14L 1UT9A 2FO4B 5J8OA 1TZIB 1P69B 5IMMA 5DFTA 4BK4A 5GGSA 5JXEA 2VDKH 5BVJB 4GRWF 1DN2A 1KCSH 2Q7NA 1C16B 4NKMA 1DBBH 4L4JA 4RAHA 5GGRA 3VFPA 1EFXD 4K3GA 3QIBA 4I9WE 2BVPA 1BVKA 4YZFF 1T7ZA 3C60A 4F9LC 1J0HA 4JLRA 2COQA 3MRHB 3E3QC 3NCEB 3PV7A 5EU3B 3SKUD 2VZUA 2BY1A 4BZ1L 2VDML 5DD6A 1X4YA 4ZG1A 4ZPVB 2G5RA 5C0EA 1I9IL 4PTUA 4PRNA 1ZHNB 2MPAL 2NY3D 1F4WL 2BRRH 4HHAA 4O5LH 4AENB 1YEDA 1YUHB 2AXJA 4QOKE 3QDMD 1FE8L 4HMCA 2AP2A 2WWKT 1QZ1A 1LWRA 3UDWA 2BOBB 1I9EA 2J5LC 1KIRA 5MEOA 3S37L 1J5OH 3HG1D 3NIDF 4TUOB 5FHAH 3VXSE 3X3GH 3BPOC 1I7TA 2YPLE 1D9KD 1AXTH 2RJMA 2CDGB 1LEGB 2PO6A 3B43A 4PGDA 3L3DA 1Q0YL 1V3LA 4Q58C 1GGIL 5JW5B 4X5XB 2OMBA 5IJKC 1IGML 1SVCP 4NM8H 3DUUA 4XHJC 4YXHL 5CEZL 4HEME 3PHQA 4ZAKC 4XPAH 5D72L 3DNKA 3FQWB 1CZ8H 1OQOA 3MRKB 2CK0L 4NQSB 2FCBA 2AABH 4Y19A 3MRPA 5EORH 3VFSB 4JO2L 2Y36H 4XXDB 4GOSA 5JHDA 1F90L 1OL0A 2V7NA 2YKLL 4JPIB 5ADPH 2CLVA 3ETBF 2QV2A 3ARQA 1SQ2N 1JNJA 3GMPA 1H3UA 4HMDA 1KTDB 1RUPL 2ZNWA 3RX5A 4AL8H 1RJLB 1JGLL 5ENWA 4NRYA 1H9VA 1MJ8H 1JPTH 3TH3T 1A14H 3BO8B 3KPRB 1U3HD 3UJJH 2J12B 4XTRC 5EZLA 3RY4A 2W0PA 3CSYB 3DETC 5DMYA 1KCVL 3FKUS 1VSCA 4HWBA 4Y1AE 5CJ8A 3IFNH 3VJ6A 3GFUA 4GRWH 4XNZB 5BJTA 2WBKA 1RULL 2ARJQ 2AJ3B 4JFZL 4OFYA 4J3UA 4OGYL 2HMID 3VXRB 4OCYL 1CYGA 2CRYA 5FO7B 1PZ5A 1OP5K 1CICD 3AFLA 3ARDA 1EJOL 3D69A 3D0VB 3IAGC 3WDJA 2WUCL 4V1DD 3PV6B 4ZUUA 3FB5A 4WWID 1CGVA 2VZVA 4AQ1B 1U8MA 3QI9A 5C0ND 2IG2L 3EYFA 2VDMH 3BW9A 4GRLB 4FS0A 4HQQL 4AG4H 2VLKB 5IBLD 5JOPE 3AREC 1I9IH 2FL5B 5J6HA 2YPKB 1R24A 5L8JB 3O9WB 3QO1B 1LEKA 2A0LD 3T65A 3CZFA 2NLJB 1JZ4A 3QUML 3GI9L 2NY7L 1MCOL 4YPGB 4CGTA 1YEIL 1OSPH 2AGJL 2CXKA 3VXNB 1HILA 1MCIA 1U91B 1OAYL 2LQRA 2LU3A 4YDVA 3LRGA 5IQ7H 4ORGB 2X4QB 3GSOB 4XCYA 4H1LA 3E6HB 1FN4A 5DRZA 1IGMH 1NAMB 2DQHH 2K3TA 2QHRH 3B2UC 4RQQB 5F8QC 4PJHF 3T2PA 4YXHH 5CEZH 2F54D 1S9YA 5F9OH 3G04A 1KC5L 4P2RB 4FQXA 4LHUB 2PYEB 3B9KA 3BN9C 1TTUA 4LBEA 3LPGA 3GJFH 43C9B 3BKYL 3M07A 4JG0L 4Z76B 1MAJA 2E7HA 4JO2H 4L3EE 5F1SA 1F90H 2B39A 2YKLH 5KVGH 4MAYA 4HFUL 3HCVA 3NTCL 4DOHE 5JPNB 3ARRA 4HH9B 5GS1B 5TE4L 2BVOA 1RUPH 4WGVB 1YEFL 1JGLH 2BC4B 5EO9B 4KROB 4YK4B 1A7NL 1R3KB 1AR1C 4I18A 3U4BH 5C3TA 5AWNL 3LIZL 1DN0B 4J23A 4KI5E 3S35L 1EHLH 1KCVH 2D0FA 1IEAB 5D96B 4F58L 4KI5C 1BF2A 3DV4A 3TBYB 1ZLWK 1RULH 2VUYA 4ODHL 4JFZH 1EAPB 2MHAB 3FQUA 1EJOH 4ZUWA 2WUCH 3AS3A 2D9CA 5D5MA 3P3YA 1RIUL 1MAKA 3QDHA 4NO3B 4DGVL 1KJ2B 4JHAL 4Q9RL 2OZ4A 2C3HA 3Q5OA 3BEVA 3AB0C 1R3JB 1YMMB 3EYSH 3HRZA 4J4PD 1YEHL 3EFDH 5ID0A 1T1YB 4D8PB 4JQIL 3DIFA 5T1DH 4P0DA 1EDQA 1BVZA 5DMKA 3MRLB 2XTJC 1H8NA 3GSWA 1E6OL 1Q8MA 2DQGL 3STLB 5ESAA 2G75B 4LARH 3QUMH 2X70B 1JMZA 1BZ9A 1MCOH 2NY7H 3RNQB 3L7EB 6CGTA 3OKEA 4NDMA 3ARBD 4Z0XA 1TZHA 2NMSA 4FTVD 2H2PD 5J11C 1CE1L 3SE9H 5D2NC 2VLJE 3HZKB 3QXDA 4JFFE 1AY1H 3I02B 4RGMB 2CLRB 3WIHH 1AC6A 2VSDA 3D85D 3SKNB 1ONQA 5HXMA 4M4RA 5E8PB 5EIVA 5A2FA 1MVUB 4ODWA 4NQEE 3TVMC 2ZCKH 2OJEA 1Q1JH 2P49B 1G0XA 5CBEB 2VXTL 3V7MA 1S7UA 3WS6A 4LOUC 3ILQD 2G60H 4WTZG 5SWSE 2WP3O 3CMGA 1IAIL 2A6JB 4M5ZH 4Z7UF 4JCLA 4MDJB 5H37H 3UAJD 3OKMA 5EZJB 4QF1A 4XMLL 1CGSH 4HFUH 2PW2A 1ORQB 3NTCH 3RKDD 1U9KA 2W92A 3BPCB 5CHNA 3WV0A 5I75B 3GBML 5E5MB 1VGKA 5TE4H 4G3YL 3WJLA 1WBYB 1A0QH 1QSFA 5ETUB 1HYRC 1L6XA 2AJZB 5ESVB 4PS4L 4QRSB 3SGJA 2XOTA 4GUPB 3S3SA 5J9PB 4KKAD 2IGFH 3CUPB 3U9PL 3QUYA 1WC7B 3L3OB 3ARWA 5CZKA 1GL4B 4K23L 4S0TD 3IFPB 4CAGA 3CXDH 4XBPA 5FKPA 5DJ0B 5C0JA 5TPWL 3N9GH 3S96A 3OKKB 1BGXL 3TFKD 4QT5B 2P1YA 4RDQG 4JRYA 3CK0L 3X12A 3CU1A 1RIUH 3JV4B 4DGVH 4GBXA 4Q9RH 1XH3A 1OWWA 2PCPB 3IGAA 4PTTB 4FQCH 4MA7L 4Y2DC 4QRQA 1HHIB 1H5BC 2EDRA 2AKRA 3U79A 1J8HB 1CFNA 1OF2A 5HDBF 4DCQB 5ICZA 3VFOA 4JZOA 3DI2B 1DP0A 1UYWH 3EYOB 3ALPA 4L8SB 1E6JL 4FXKA 5D6CA 2YD6A 5E6IB 1OSZA 3RNKB 3FJTA 5KS9A 1SJEB 3GUTA 1GGUA 1QBLH 5GGVY 1RMFL 2NY1D 3ES6A 4JFQA 4ZPTA 4TQEL 3T77A 1T20B 3SCMC 2W65A 1A9EA 1EAJA 3K81A 4HS3A 3RGVA 5DC4B 5IM7A 2F15A 3DMMA 4NC2B 1JNLH 1HEZB 2MFNA 3B3IB 5F1NA 3S36L 3J8F7 4JZNB 1IAIH 4NQDD 5E8EA 1TVBB 1UQSA 2Y7QB 3P9MA 4KJYB 5JORB 3KLHC 2NY3B 3G6AA 4GG6E 4F3FA 1G7JA 3QJHA 1OLLA 3QDMB 4U49A 1AXSB 5F6IC 2XZAH 3TNMB 5IIEB 2GHWB 4P5KB 4PS4H 4M3KB 5DDHB 3AMKA 5DVNA 5F3HA 5K9QI 1D6VH 3N1FC 1QQDA 2XPGB 2WM0A 2E6JA 4Z7WB 5GIRB 3LKOB 5HHNA 4MXQC 4KV5E 3VRJB 4F7MB 3ZE0E 3D1MC 3D39E 1QLFA 1ZEAH 4LHQB 5JW4R 4TULH 5F7MC 4X6BA 4CNIA 1LO4L 2QQNL 4APQC 4NO5B 4OJFH 3MRFA 2DWDA 1QFWI 4U1IB 4LVOB 5TF1H 2Z92B 5TDNB 1IM3B 2EDHA 1LD9A 4XVUC 2AVGA 4RFNC 5DJCB 5CBAB 4UU9B 4DFIA 3T0EE 3SEPA 5A2JH 5I6XB 1MJJB 4WEBH 4QRPE 2YA0A 2VDOH 4P5MA 4BELD 5A40E 2EZ0D 4JJ5B 4AZ8A 4CMHB 1IAOA 5IFHL 4MA3A 4P2OA 2QR0B 4WCYL 3GSVA 4HT1H 4P5TA 5DJXA 1OP3H 1DBMH 4P4KB 4F37K 1U3HB 5DD5L 1J86A 2F5BL 3V5HB 5E70A 1RMFH 5D7IB 2IAMD 1FNEA 4QGYA 4TQEH 4N90E 5E9DD 3NA9L 4LPUA 1Q72H 3QG7L 3MBXH 5I1IL 3H7BA 3GI8H 3HE6A 5EIQA 1BMGA 1CICB 5CCKL 4TRPL 4UT7H 5FM4A 4XPHH 1A7QL 2B4CC 4ODUA 3S36H 3G5ZB 2ICWJ 4LIQH 4M7LH 2FJGA 4K7FB 2NW3A 4IDJH 1AD0A 5GGUB 4I3RL 1W0VA 4RSVA 4TVSa 1U8JB 5IBUB 3I84A 2UV3A 4PJXF 3TBWB 1YECH 5M7QA 4GO6B 2M2DA 3RPKA 3UTSB 3KXFD 1EGJA 3T1FB 1NUGA 2CRIA 1DQTA 2X4SB 4OLUL 5H2BB 1FFPB 4UOJA 3TA3C 2FO4A 1JVKA 4FFZL 1TZIA 4UOW0 5FYJD 5SWQB 4P46A 1I7ZB 5BVJA 4DN4H 3FT3B 1C16A 3NPSB 4EIGB 4HIXH 4DUXA 1Y6NR 5L2JB 3KJ4C 2QQNH 3MCLL 3S3JA 2FX8L 3MRHA 5FF6B 5I8KL 3RFZC 5EU3A 4XHQA 4KK6C 4XC1H 4ZPVA 1MRCL 4NN7B 1ZHNA 4OLXL 4QRRD 5C07D 4AENA 3LMJH 4OZHB 1YUHA 5IHZB 3C6LB 5I0DA 1MI5D 4NOFA 2W0KA 5JHLH 2EH8L 2BOBA 2PR4H 5DK0B 1T6WA 2RR3A 1BWWA 5IFHH 2Q3ZA 4I13B 4TUOA 5K9JH 1ZT4B 4I0PC 1F4AA 1A9BB 2CDGA 1LEGA 3FFCB 4M6ML 1F6FB 5DD5H 3M45A 1YC7A 5JW5A 4GW5B 4X5XA 2F5BH 5KOVC 5CJXA 1KIPB 3QFJD 3TBVB 3ULVD 2M26A 4YHIB 5IROC 3T09A 4JM2D 1Z0MA 5I1IH 3FQWA 3KS0J 2BERA 2VR5A 3SDDD 3MRKA 3NFPB 5CCKH 3L3KB 4NQSA 1NFDE 4PRID 5TE6H 1A7QH 1R5VB 3UJTH 3GJFK 4XXDA 1FIGL 4XXCA 4M6OH 4TNVK 3MSPA 3C2SA 3PIQB 4JPIA 4RA0C 4X99B 3BX7C 3S4SG 5J1TC 2IQAB 3RY6C 1DZBA 1XAUA 4BH8B 4EN3D 3DYMA 3IKCB 1JK8B 2Y6SD 4LCWE 3KR3L 5CZXD 1KTDA 1W8NA 5HHME 1RJLA 2P8PB 4ZOCA 3JTSB 1SJVA 1TDQA 3MGTB 4K3JL 3BO8A 1BLNB 3KPRA 1NLDH 4EOWH 3FFDB 5I73C 4FFZH 4I48B 3CSYA 3ARBB 1KJVB 2VERN 1WTGT 3A67H 3CFEB 5SWZE 3MV7D 4FTVB 2XT1B 2AJ3A 2EYSB 3VXRA 3CFDB 5FO7A 3ZYIA 4TSBL 4NCC1 2VL4A 3D0VA 1T5XB 5CZVH 1ZGLP 1CVSC 3MCLH 1AD9B 2BNQE 1EHAA 3PV6A 2FX8H 2CH8A 5I8KH 1IAKB 1R6VA 3CVHB 4OFPA 3WFHB 4G43B 2ZOLB 3QIWC 1UH3A 1UJ3B 1V8HA 2N56A 1NL0L 4GRLA 3MLUL 2VLKA 1P6FA 2FL5A 3O9WA 1D5BB 4L29A 2MJWA 4ZS7L 3QO1A 3VRLE 4GKZB 3ABZA 4HGMA 2NLJA 3ZE2E 4PJAE 4GSDH 1WEJL 2EH8H 4YPGA 4A2LA 5DD3L 1M4KA 3VXNA 4A6YB 1A6UH 3MACH 4ODBD 3BZEB 1U91A 3F12B 3MJGX 1RJZB 2OJZL 1M7DB 3BGFC 4ORGA 2X4QA 3GSOA 3E6HA 3PG2A 1LE5B 2EC8A 3VD7A 2QQKH 1NAMA 4RQQA 4OLZL 4XP6L 1FRGL 3OB0K 3VXOB 4L5FL 1CFQB 1PSKL 3MOAL 1RUKL 2YZ1A 5BRZE 3LRSB 4P2RA 3OSKA 2PYEA 4G6JH 4KTEH 3DVNB 43C9A 4Z76A 1WT5C 5F1IB 3FAWA 3WFZA 5CAYB 4PBVC 1MOEA 1RZ8B 4QHMB 5GS0C 4HPOL 3RY5A 1C7SA 1TQBB 4H0IA 5JPNA 4HH9A 5GS1A 2EDDA 1Y6MR 1CU4H 3HC3L 5DJZB 2VLME 4L4VB 2BC4A 5EO9A 4JDZB 4PJEB 3HS0B 1R3KA 2R0LL 1B0RB 4PUBL 4K3JH 4KJPC 1MFDL 4M4PA 4DKEL 1DN0A 1HK6A 2DM2A 1GSMA 5JIPA 2YWZA 1IEAA 5DJYB 3DXAE 1IC7L 3IS1X 3TBYA 1UFUA 3RWCB 1J0KA 3ARFD 5DZOA 1VEOA 3OXRB 1EAPA 3QUXC 2VB5A 2MHAA 1IARB 3EAKA 4UQ3B 5CLWA 4MQXC 5IESH 5MEND 4UBDD 2IH1B 4R96B 5CP7B 3Q5TA 1RIHL 1JV5B 3BRDA 1XIWD 3DVIA 4NO3A 2YD7A 1KJ2A 2BFVL 2ITCB 1R3JA 1YMMA 4KI5F 4UI2A 1KJMB 1T1YA 4D8PA 2XQBL 2N4IA 4HUWB 4ZS7H 4NQDB 7FABL 2FYYB 3MRLA 3QEUA 4U2YA 2WUBH 3SE8H 3STLA 3KPSE 5I18H 4U6VL 1WEJH 2G75A 4MZ2A 2X70A 3RNQA 1X3DA 5EU7E 5DD3H 3L7EA 3NCYP 2EXWD 2FRGP 2Q87A 5EU7C 3SN6N 3B2VH 2X4UB 3O6KH 3WFBL 4NQXB 5LJYH 2EH7H 3VMNA 3CD4A 1MFNA 4M9OA 3HZKA 4HKXB 3I02A 1B0GB 2CLRA 2A6DB 4XVSL 3SKNA 4IOIA 3NN8B 3IRZA 1OD9A 4K3EL 5E8PA 1FRGH 4BZ2L 4EUPB 4OD2B 5FXCH 2KDGA 1UKSA 3KPLB 3MOAH 4YQXH 5CIPH 5CBEA 4BSWB 5GS2H 3AROA 3SGEI 2VR4A 2R56L 2UWEE 5HHXL 5IW6B 2A6JA 4EJ1C 2J2ZA 4MDJA 5EZJA 1G6VK 4RMRA 3WIFB 3VA6A 1TVDA 1TJHH 1WCQA 1ORQA 1A7PH 4RMVA 5SX4H 3BPCA 5FV2A 3L5WB 3TP4A 5E5MA 1KJ3L 4FQIL 4TSAL 1OGAD 1WBYA 3ZKSD 2R4SL 1P9MA 3RTQD 1ORSB 4FQJH 1RZKL 5ETUA 2BHUA 2R0LH 3SDCB 2AJZA 4PUBH 3O11B 5LKNA 5ESVA 1K2DB 4QRSA 4DKEH 4GUPA 5E5RB 4Z7NE 1HHJB 5J9PA 2DMBA 3CUPA 2VDQL 1WC7A 3L3OA 3IKKA 1A7OL 1EO8L 1IBGH 2R2EB 4MJ2A 3MV9E 3IFPA 4PGJA 5C09E 2F19H 4QRUB 5DJ0A 4WHTB 4O00A 3OKKA 2IAMB 2QLVB 4QT5A 4EI5B 1OTSD 5E9DB 3BIBX 3JV4A 3O6FC 4HK3N 2BFVH 5GRVL 2PCPA 4PTTA 2ARJB 4RAVB 5LG1A 4NQVB 2DQDH 5F7KC 5CEZD 4X6DA 1HIMH 3WFCH 1HHIA 2AJXH 2YBRB 1J8HA 4LLWB 2IC2A 2V5TA 1CFVL 4UILL 3IJSB 4DCQA 3N1GC 3QXAB 4EXKA 1CT8B 4LSDA 2X7LB 4U6VH 3G6DH 4JQVC 5FFLA 3EYOA 8CGTA 4PJ8C 4L8SA 5E8NB 5I71B 1DE4B 1GGBL 2BVQB 5E6IA 3OHXB 4PV8B 5F9JB 3BN3B 3RNKA 5CMAB 2X4PB 1SJEA 2Z91B 3DHMA 1KT2B 3MOQA 3SDXB 4XVSH 4PREB 4FQPA 3LDBC 2JELH 4BZ2H 1T20A 4WV1B 3JWDH 3EYQC 3AUVA 4LSVL 1N6VA 1YN6B 3SBWA 2BDNH 1SJHB 1GPOL 1HEZA 3B3IA 4JKMA 1L9MA 3UYOD 3U0WL 4Y16C 1HHKB 4R2GB 1TVBA 3S34L 2GK0B 2Y7QA 3AS0A 3WMSA 5BV7H 4KJYA 5JORA 1WFTA 3T4AB 1OW0A 2W91A 4L8CB 1KJ3H 4FQIH 4XAKE 3T0BA 1MY7A 4NZJA 1F4YL 3KPMB 5C92A 3C5ZC 3QDMA 4N8PA 1AXSA 4LK4A 3TNMA 3QCUL 3KPTA 5IIEA 3KAAA 1G9NC 4P5KA 2HJFB 5DDHA 4TNWF 4YC2B 2CR6A 4O9HH 2XPGA 4Y2OA 5GIRA 1KV3A 1A7OH 4PJBB 1YNLL 4YHML 4JAMB 1NMAH 3VRJA 4F7MA 3PL6D 4AMKL 4GG6F 4YXKL 2H32B 4XCFL 3QFJB 2PKDA 2ESVD 1BBDL 2I60L 4NO5A 3NFSL 1AXIB 2EDBA 2GJ6E 35C8L 1MJUL 1JHLH 4ZUVB 5CSBA 4U1IA 2Z92A 5TDNA 1IM3A 2ADFH 4Y5XB 3P0GB 3SDDB 3STZA 3OV6A 3DVFA 2VDPL 4MCYB 4PRIB 3WNOA 3BRFA 5DJCA 3AM8C 5CBAA 1J0IA 4UU9A 5T33L 5FECB 4FNLH 4PV9B 4KV5F 2CXGA 3L5HA 2NY6C 1WFUA 4YO0A 3ZE0F 1MJJA 1PKQB 4HZLB 3SO5A 4QHLB 1IILE 3ZDXE 1ES0B 3SJVD 2E6QA 4JJ5A 1ZLVH 4F2MB 5IWLC 4BSJA 5D7SL 4QHKJ 2QR0A 2VXVL 1LO2H 4KXZH 2HFFB 3BXNB 1GGBH 3EOTL 4ZNEA 4K3DL 4P4KA 4IMKC 1U3HA 3U7YH 2GSIB 3JTTB 2CKBL 1JPST 4PP1C 4LSQH 3V5HA 1JZ6A 1JGVH 1QFUH 5IT2H 4JJHA 5D7IA 5MP6L 3MV7B 3GSQB 2PYFB 1RVFL 3IU4H 5L7XH 3PHOB 2C3WA 2FBJL 2AK4E 3TESA 4TTGA 2FHBA 5LWYH 4QCIB 3TN0D 3W5NA 1NGYB 3GIZL 1GPOH 2X5PA 1QTYT 3G5ZA 2HLFD 3U0WH 4K7FA 5GGUA 2Y5EA 3WXWH 3OG6B 1U8JA 2IBZX 3TBWA 3HC0B 1PG7X 3UTSA 5HVHB 3T1FA 5JOFB 1ACZA 2X4SA 1HHGB 3AMLA 5T1LD 2B4CL 2NXZC 5H2BA 1FFPA 2B5IC 3FHQA 3VMPA 1DVFD 3SY0B 3SHSA 2W0FB 3QCUH 5FAAA 3DO7B 3WKML 4KQ3H 5F70A 5SWQA 2NPLX 4LASL 3MJ9L 3RVUC 1I7ZA 3B9EA 1JWMB 3H0TB 3W5MA 3VGHA 2O5XL 3EBAA 5I74B 4F8TA 1AHWB 2KKQA 3FT3A 4JGUA 3H9ZA 1NCUA 4EEEA 2XA8H 3MQIA 4KQ4L 5D70L 4XCFH 5L2JA 3NFSH 4LU5H 1OT2A 2BNUB 5JZ7C 5FF6A 2VDNL 2KBGA 4UV7L 4IRSD 3LZFH 4WUUD 5DMGD 4G6FD 2AJYH 5CINH 2A9NL 1P4LB 2C1PB 2VXUL 1RZ7L 2VDPH 1RFDH 4D0BB 4RMWA 1FGVL 2DQCL 4NWUL 4KC3B 3O4OB 4OZHA 4QXUL 3G9VA 4ZOEA 5IHZA 3C6LA 3SKMB 3CNKA 5DK2B 5KVDH 4KK8D 1MAML 4XP9H 1FNAA 5E5UB 1T2QH 2JCCB 1RY7B 2P24B 5IK3B 4HCRA 2AQ1A 1RUQL 4G9FD 2KUTA 5EO1B 1IQWL 1ZT4A 2VXVH 1A9BA 3SDAC 3FFCA 2BCKB 2JIXD 4TOYL 1G9ML 4NWTH 4H20H 4XNXL 3FO0H 4MB5A 4GW5A 3CSBA 1GC1H 3O3DB 4PP2B 1KIPA 3BKJL 5BCAA 5KVFH 3TBVA 3MLZL 3C09C 4YHIA 3H9SD 3QNXB 3ARFB 5ISZD 4OLYL 3CLEL 3NCYS 4WHYH 4L3AA 2FBJH 4OCWL 4HWEH 4M00A 3VXPA 3NFPA 3L3KA 5INDB 3STBA 4OZFH 2BNRB 1R5VA 5GPRA 1FHGA 3BSZL 3CXHJ 4NRXB 4ZXBC 3PIQA 4K07A 3QCVH 4X99A 4E9LA 4I8DA 2IQAA 4BH8A 2VWEC 5A3IC 4YBLB 3I6LD 1C7TA 3MUGB 3IKCA 3LKPB 4KHXL 2X89D 3X14B 3K1KC 2VZ3A 2P8PA 3JTSA 4I5BB 3MGTA 1BLNA 1UM4L 3FFDA 1NFDF 4I48A 4MMZC 3VWKD 3LVEA 3ARBA 3CFEA 4FTVA 4YLQT 1U3ZA 2EYSA 1YC8A 4AEFA 3MRQB 3CFDA 4HUUB 4FABL 5D70H 4KQ4H 4XVJL 1T5XA 1AD9A 1MFEL 5FGBC 2IFFH 5B3JE 1IAKA 3CVHA 3UP1A 3WFHA 3NAAL 2NY2C 4GRWB 2ZCLL 4G43A 2ZOLA 1UJ3A 1TFHA 5EN2B 3KPNB 4YDKL 5SV4A 2VXUH 2FATH 1JTTA 1D5BA 3QUZB 1FGVH 1HXYB 5DLMH 4GKZA 4UTAH 4K9EC 2NY0D 4KGLA 1A6WL 4TUKH 3G5YA 1OGAB 4A6YA 4P2QD 3CDYA 3RTQB 3BZEA 3F12A 1IQWH 1RJZA 1KN2H 1M7DA 4AT6A 4XBEL 4XMPL 4TOYH 3R1GL 5E7BA 5DUPH 4Y4FB 3TO4B 3CLFL 1LE5A 1H0DB 1MFBL 5HVFB 2X6MA 4U7SA 3MZTA 3VRLF 2RAMA 3MLZH 3VXOA 1D3CA 4KU1A 1VFBB 2K7PA 4PJAF 3ZE2F 1CFQA 3OKOB 3K4DA 3CLEH 3LRSA 5E6ZA 3VXMB 3O41B 4DAGL 1TETL 2PTVA 2GI7A 2IANE 2I9TB 3DVNA 5DZNA 5F1IA 1H15B 3U9UB 5HYFA 5F7WC 4QTHB 4M48H 2GTZB 4QHMA 2EO1A 3S5LB 1WWBX 2EDLA 2BVUA 1CGWA 1ZHKB 5DJZA 4KMQA 4L4VA 5FUOH 4JDZA 3HS0A 2A74B 1B0RA 3GMLB 1MLBB 3P9LB 5GS0L 3T3PE 2DM3A 1OPGL 1J1PL 5DJYA 2D31B 3BUTA 5F7DB 4M62H 3RWCA 1T1XB 3OG4B 4E41E 3OXRA 2KQNA 3EDEA 4UQ3A 1VEMA 1CDUA 1J9CT 2IH1A 4R96A 5CP7A 4HLZH 1JV5A 1NAKL 1WIUA 1MFEH 2GITB 4P4RB 5LXGH 4LVEA 3K46A 3AGVA 2ITCA 4Z7VE 3ZE1E 3TH2T 1KJMA 5HGBB 1RUAL 5ICXB 1W72L 1XF2B 2K1MA 4PY8J 1WBZB 4DUWA 4HUWA 3V6OA 3MV8B 2G2RB 4NQDA 4J3WA 1MCLA 2FYYA 1U92B 1NMBL 4OD1L 1LE9B 4IIQB 3SE3C 4KAQL 4F9PC 1A6WH 4WFGE 3ZKNC 1B2WL 4ZTOH 2X4UA 3INUL 1T7YA 4NQXA 3S4SB 1ACYL 4XMPH 1PJ9A 4HG4J 3SGKC 4R4FL 4HKXA 1RHHB 3ULUC 4FFVD 4EXPX 4NUJB 1B0GA 4NQCE 4DKAA 2A6DA 3MXWL 3NN8A 4EUPA 5B3NA 4OD2A 3KPLA 4JO4L 1S7VB 3PL6B 3CX5J 1IM9B 2KQMA 1KB5L 1KACB 2I5YL 3FRPG 2XXCB 4DAGH 3RVXC 1TETH 2DLFL 5D1ZD 5EOQL 4U6YB 3HUJE 1GCFA 3I9GH 4PJHB 1N0XL 5T3ZL 5IW6A 2K9UA 2OTPA 3PF2A 2GAZB 3QDJD 4KVNH 4JPVL 3WIFA 2R69L 4PLJC 4S2SB 4Y4HD 1MJ7L 2OL3L 1NUFA 3L5WA 3QEQE 4PGBB 1P2CB 1ORSA 2JJUA 3RWFB 4ZNCD 2HH0L 2IQ9L 3SDCA 3HG1E 3O11A 1MWAH 1K2DA 4KY1L 4XCCL 4QHNB 5ANMB 1OPGH 2UWEF 1OOAA 1HHJA 3WCYA 3ME0A 1OLZA 2EDXA 3ROLA 4Q9CA 3UZEA 1ED3A 4JFOB 3BWUC 5CJOL 4QRUA 5DURD 4WHTA 1RIVH 4N5EC 3S3PA 2IAMA 4IOFC 4EI5A 5DFVD 5E9DA 2FB4L 1LO0L 4QOKD 5DJDB 3WJJC 2WBJB 4ODXB 2JB6B 2ARJA 4KTDL 4MZ3A 4RAVA 5GRVK 4Z7NF 4NQVA 1E28B 1AQDB 1RUAH 1X6NA 1VPOH 4OF5A 1W72H 2YBRA 4HIIB 4LLWA 3VXSD 2YPLD 4LCCC 1AJ7H 3IJSA 3O8XC 5K9KB 3QXAA 3AS1A 1QHPA 4JKWA 2LU4A 4XNMB 2X7LA 4KAQH 1H8SA 4ZAKD 1DE4A 1B2WH 2ILLA 1A8JH 3SKJL 4Q6IB 2BVQA 5J1SC 3OHXA 4PV8A 1DVFB 1OVZA 5F9JA 1FFOB 4R97B 5CEXB 1VGEL 5I1KH 3OAZK 4R4FH 5KSAD 2Z91A 4WUKH 4AEIL 3SDXA 3EZJB 1Q9KB 3PUCA 2OR9L 4RGNC 1P7QB 4KK5C 5BMFH 4WV1A 3PGCB 1G7PB 4PJFE 1QG3A 3ILPB 5DR5H 2I5YH 4V1DE 4QLRA 3TCXA 2FJFB 1YN6A 5EOQH 2O5ZH 1SJHA 1KCUH 2QADD 4LPYA 1N0XH 5T3ZH 1HHKA 4IRSB 4G6FB 2GK0A 4JPVH 4NJ9L 2R69H 1NMCC 3T4AA 4W81A 4N1EA 3RIFF 5IMOB 3VG9C 4L8CA 2D03L 3HC4L 4PRAB 3KPMA 2I9LB 4Z7UB 1F02I 5IVZB 1O7VA 3I75B 2HJFA 4EBQH 3FHAA 4XCCH 3TNNB 4G9FB 3PQYA 3LB6C 3FL7A 1CR9L 4IM8A 3M8OH 5ESQA 4ALAL 4AQOA 5JXEC 4PJBA 4JAMA 5J13B 3VXUB 1VCAA 5HDQL 3ARED 3QHZL 2VXQL 1DCLA 1YNTB 2H32A 5JOPD 4LSUL 2F54E 3QFJA 4Q7DA 2X1PA 5I9QB 3C60C 3H9SB 3QFDB 4FP8L 4NUGH 3F7VB 2APFA 2FB4H 4ZUVA 1BFOB 1R3HB 1G7MB 3REVB 2YD2A 2VZSA 1KTKE 4Y5XA 3SDDA 4KTDH 3JVGA 4YHOL 4MCYA 2AEWA 4PRIA 4PJDE 3T8XB 5CJ5A 2ZG1A 3UEZA 5FECA 2F9BT 2E7BA 4PV9A 4M6NH 2XWJB 5GS2D 1PKQA 3FOLB 4HZLA 2V2TB 1RI8A 4QHLA 1ES0A 3B2UD 3UDWC 5IHUL 3QAZC 4F2MA 1A3LL 3B8YA 4MVBC 3UPCA 2OM5A 2HFFA 3BXNA 3O2VH 3VE0B 4GLRI 2PO6C 1DR9A 2H8PB 1UB6B 4IHOB 3BN9D 2GSIA 3JTTA 3VWKB 1KB9J 1NUDA 1YEEL 3K4AA 3MV7A 3GSQA 1WISA 2PYFA 5B38B 1W0WB 1VESA 4L3ED 3ZDXF 3PHOA 5JOEA 3RBSA 1QFHA 3IFOB 4OM1H 3QR2A 3FOMB 2DL2A 4NC0B 1L7IL 1WWCA 1C5DB 4QCIA 3MRNB 3TH4T 1PX3A 4LGPB 1NGYA 1BZ7B 1AR1D 3HPLB 3EJYC 3FTGB 5DJ8B 2Y72A 3BPNC 4YWGH 3HC0A 4KI5D 4CJ0A 1O7SA 4W4NA 5JOFA 1UKQA 5LCVL 4ETQB 5CJBA 5DQ9B 1D5XB 2VQTA 5T3XL 4KUCF 2EC9U 4LLUB 4LGRB 2W0FA 2HKHL 3DO7A 1E4KA 1X5YA 3HNTH 2ZWLT 4P2QB 3QIUD 3IJYB 3L95B 1GIGL 1JWMA 4ALAH 3H0TA 5IHLB 1AHWA 5HDQH 4P57B 4ZDHB 4JQXA 1K85A 3V4UL 3VFUB 1FSKB 1G9NH 1KYOK 2J3SA 3ARDC 3IAQA 4KRPB 3HB3C 5BO1L 1MHHB 2XTJD 4CUCA 4H1LG 4X0KB 2BNUA 4I3SH 1ZT7B 3S37X 3QI9C 5GSRB 4P99A 1P4LA 3QULB 4YHOH 1CWVA 2C1PA 5EBMB 1GHFH 4JFEB 4LQFH 4U1HB 5MI0B 5DK2A 3LH2H 1PYWB 2JCCA 3DX6B 3GMRB 5IK3A 2P24A 4OQ1A 3TVMD 4FFWC 2WIMA 3S9DB 4BJLA 2ZUQC 5ECJE 5EO1A 5IFJB 3GMMB 4LL9A 2BCKA 1U0QA 2LVEA 4LLVB 3H3PL 3HI5L 1G1CA 5J89A 4LOUD 1IL1B 5BOZG 1QLEL 2VE6B 3GSRA 1CD9B 1TMCB 4GMTL 3TT1L 3O3DA 4PP2A 4L4TB 5FM8A 4LNVA 5SWSD 1ITBB 25C8L 3QNXA 3ARFA 5TQ2H 3NACL 4KJWC 4IRZH 1I3VA 3B9KC 1T03L 5INDA 4MJ4A 2BNRA 4XX1E 3M1BB 1G7HB 4NRXA 3GRWL 4KFZC 3HFML 1KEMH 1NEZB 4LVHB 5IUSA 4MAYC 1EZVX 3MYJB 1KELH 1TVHB 2E8ZA 3MUGA 3LKPA 4GAYB 3X14A 4YHKL 3VXTA 1YN7B 4POUB 2H1PL 2DMCA 4CU7A 3IVKB 4I5BA 1DEEB 1AO7E 1UC6A 3L7FB 4I18C 4BH7B 4CBPA 4OCRL 2HKHH 3V4VH 2GY7B 1CGXA 4PJXB 1BP3B 1OAXH 5C3LD 3D9AL 1BX2B 5CSZB 4I2XE 1QRNB 5SX4I 5C6TL 4X83A 1E4XI 4JRXD 1CLYH 2FWOB 4MA1C 3HMWL 4ZS6C 3MRQA 3MXVL 4HUUA 3EOBB 3V4UH 1AC0A 5DVKA 4XPGH 5HPMB 3VD4A 4NQTA 2DIAA 1ZLSH 3FN9A 2B7DT 5ITBL 3LN4B 2NX5B 3KPNA 3BD5A 3BPLC 4K3HA 2OXGA 2AV7B 4U1MB 3QUZA 1HXYA 5DEGB 3DSFH 4X4ME 3NIGE 3KWWB 1JFQH 1TJGL 4M1CC 1BWMA 3O2DL 4Y4HB 5F9DC 3PJSB 2VLRA 4X80L 3T0VA 1OGAA 3SCMD 3PWUB 3RTQA 1H3XA 5B3JF 3UO1H 4HFWB 3H9YA 4K9EL 2CGRL 4YUEL 4Y4FA 3GMQB 3TO4A 5KSBE 1YQ2A 1H0DA 1I3UA 3TT1H 1XGRB 3HLAB 5GGQL 5L2KD 1MCPH 4JHBA 2F53D 2J7LA 25C8H 1VFBA 5GJSH 4LSRH 3OKOA 5JUEH 4RIRB 3KLHD 5DURB 1F13A 3T1WA 3VXMA 1OTUD 3O41A 3WS6C 3WHXB 3U83A 3MOBL 4OUOA 2I9TA 3TZVD 1MCNA 1A22B 5BZDB 1T0MB 2XN9E 4QOKB 1H15A 3U9UA 3HFMH 2GTZA 4XPTL 4YBHA 3S5LA 4F7CB 3TGXA 4V2CB 1KBGL 4M7LT 3VXSB 2YR3A 4QXTB 3WJLC 1ZHKA 2YPLB 4MXQD 5JA8B 1CL7L 2H1PH 3BT2H 1LK3H 4HGWB 2A74A 3NCBB 5FUCE 1V7NL 3GMLA 1MLBA 3S6CA 4YXLH 3D39D 4LMQE 4OCRH 3P9LA 4APQD 4P3DB 1IVLA 3VDAA 5K33A 2D31A 2DTMH 3QUYC 3MROB 5F7DA 4DEPB 4XVUD 1FG2B 5C6TH 1T1XA 4KMTH 3HMWH 4KUZH 5KSAB 3JV5A 3PP3H 4N9OB 5D7LD 4LFHG 2GITA 4P4RA 4GBXC 4F57L 4DTGL 3T3PF 5ITBH 5D9SB 1CXHA 5HGBA 3MNVB 1U3YA 1NDMB 4QO1A 3B9AA 5ICXA 4XPFL 3HNVL 4MSWB 2QADB 3MV8A 2G2RA 5DZLA 1IGJB 4XAWH 5FCSH 4CVWA 2SEBB 4OFKA 2YPVL 32C2B 1TJGH 4C56D 1U92A 3KXFE 1LE9A 4IIQA 5C7XH 4Y1AB 2RFXB 4EIZC 5LBSH 1UWGL 5JW4N 3CSPA 4Z7VF 5KS9E 3ZE1F 4OT1H 3S4SA 5FYJE 4K9EH 2EXYC 1I9RL 4YUEH 1RHHA 4NUJA 1QNZL 4L9DA 5DHXB 1I3GL 2LAGB 5GGQH 1U8QB 5DJ6B 1S7VA 3PL6A 3LS4L 1FORL 1IM9A 3LQAL 4KXZI 3RGVC 4XI5D 2APBA 2MQCA 1X6LA 3DMMC 4JFHD 3RRQA 3ULUL 1KCRL 1NLBL 3X3FL 3U30C 3W9DB 4U6YA 3IDGB 3TA3D 1CDCA 4MS8C 4PJHA 3IETA 1J1XL 3WIHA 2GAZA 4LVNC 3VFRB 5KAQG 1F2XK 4YDJB 4YBQC 1RU9L 5FYKL 1HOCB 1BAFL 4DUVA 4QRRE 5C07E 4S2SA 4PRHE 4OIAA 1KBGH 5CIPB 2W59A 4G7VH 1A64A 1MI5E 4OV6F 3ZYOA 4PGBA 4D3CH 1P2CA 1CL7H 3SE4A 3RWFA 2NZ9D 4HV8A 4FZEH 4QHNA 3HUJF 4YE4H 5ANMA 1DSFL 3P4LA 4KI1A 5TE7L 5D1QC 2Z4QB 4KK6D 2IBBA 3QRGL 4JFOA 4XWGL 1X5HA 1J1OL 1NC2A 4P48A 2IWGA 4XB8A 4Y8DC 3P4OB 3BE1L 4WI7A 2EDFA 1TJIH 2IPUG 4L3EB 1ZA3B 3Q48A 5DEFB 1UGNA 4U0RB 4NGHL 5DJDA 4XMKL 2QSCL 1XR9B 2WBJA 4ODXA 2RCSH 4U1GB 4DOHB 5HYQB 4JN1L 4XVTH 1ZANH 1E28A 2O26U 1AQDA 1MFCH 4I0PD 4OCSL 1YNKL 1KENL 2D9QB 4OF6A 4YIQB 5KZCB 5ALCH 4HIIA 3OR7B 4XPFH 3HNVH 5E4EB 1BD2E 1WF5A 4CDGC 3QHFH 4HEPG 5K9KA 1XF3B 4XNMA 4N0YL 2XQYG 3WUZA 1R0AL 3D25B 4P2OC 5GRYA 1CFSB 1LK2B 4Q6IA 4P5TC 5CEXA 1DVFA 1FFOA 4UT9L 1L4IA 1NPUA 1LMKA 4G8GE 3S97C 1QNZH 3QIUB 1Q9KA 4JFPB 4AEEA 4JN2B 1I3GH 3W0WE 2ZG2A 1P7QA 2Q1EA 2W38A 4N0FB 3IDIB 3PGCA 1ZVSB 1G7PA 1E4JA 5I30L 4W68A 2HLAB 3LS4H 4KKCD 3ILPA 2XRAH 3HE6C 2F8OA 4JREC 2R0WL 1P84J 4WW1B 4RGOL 5D93C 2FJFA 2FZ3B 3ULUH 1NLBH 3X3FH 1K4DB 1X5LA 2EC9T 3MODL 3WSQH 4IOSD 5JW3L 5D1XD 2X44D 4GAGL 3P30L 4IRSA 4BQBA 5FYKH 1BAFH 3LHPH 3D5OF 4WU5B 5IMOA 5J11B 4JY5L 1ODAA 3EIFA 2R15A 3KYNB 4PJFF 4PRAA 5SWZD 2I9LA 4HUNB 4Z7UA 2VLJB 4JFFB 5IVZA 4JY6B 3I75A 4U33A 4HUMB 43CAB 3TNNA 4TVPL 4P46C 4G9FA 1YMHB 1IGIL 1QFPA 5BV7B 2AEIT 4NQEB 2BNQD 3ARYA 4GXVL 5TE7H 15C8H 3VXUA 1WCBB 2VZOA 4XWGH 2DOCA 1QLRB 4MQTB 1PY9A 2O61A 1YNTA 3FN3A 2HT2D 3Q1SL 3EOYG 5LGJB 3BEWB 3BZFB 5SWSB 3QFDA 3H9SA 4FG6D 3F7VA 2X9XA 3SOBH 2DIBA 1BFOA 4NGHH 1R3HA 1G7MA 2IALB 2QSCH 4XMKH 3REVA 4RWYL 1DQQB 1KXQE 5IVXE 1KENH 2EDTA 2JJSA 3T8XA 3B83A 4XP4H 5EZIL 2XWJA 1INEH 2Y07L 3MA9L 5ICYB 2QJDA 4UV4L 3FOLA 2V2TA 1MHEB 5T1MB 5BS0D 12E8L 4TPRH 5TGBB 3FCTB 5DUMH 4Z6AT 3UTTA 4FQLL 4IBLT 4RFEB 3BGAA 3N0PB 4DKFL 3VE0A 3WNPA 2VZTA 4CDHA 1UB6A 3PWVB 4IHOA 3WUWG 1YEKL 4UT9H 3VGAC 4PJDF 3VWKA 5I16B 1EA9C 2N1KA 3FZUC 5CJXC 4RMSA 5DS8B 1XGPB 2O93L 5IB2B 5F93C 4K94C 1QEWB 5B38A 1W0WA 4KZDH 3FB8B 5GS0D 3QT2A 1H5BB 2VC2H 3C6SB 3IFOA 5MENE 4KJQC 3FOMA 1FH5L 1JIBA 1C5DA 5EIIB 3MRNA 4PB9H 2FEEL 3DGGB 1FGNL 1NCCL 1BZ7A 2R2HB 2ZPKL 3HPLA 1WFNA 3FTGA 4KJPD 2VLMD 1GOHA 4XXCC 3NFNB 5DJ8A 2CIIA 4GAGH 5I8OL 1YYML 3PABB 3N85L 1UA6H 2DLEA 4XRCB 3DXAD 3FO9B 4ETQA 3F5WB 4JY5H 5DQ9A 1D5XA 3QUXD 1AQKL 2FECL 4NIKB 3MLRL 1F4XL 4LLUA 1F3DJ 4MQXD 2KPNA 2OK0L 1NJ9B 4U1JA 4F15B 1K4CB 3SCMB 3EGSB 2UUDK 4P2QA 1NFKA 3JUYA 3ZLQC 2DKUA 3L95A 4J2XA 4YFLF 3V4PL 1X5FA 5A2IH 4P57A 1FVCB 4ZDHA 4G7YH 3GHEH 5C0IB 3VFUA 4RZCB 1NCTA 2FGWH 3P73B 1MHHA 3OJMB 5BVPH 3CH1B 4HWBL 4X0KA 5AZEL 4FFYL 4HIHA 1OARL 5DD0H 3GNMH 3KPSD 5GSRA 2XICA 2V17H 1A1NB 4GRLC 1Z9SA 3QXVA 3QULA 1U8LA 3HMXA 4GG6B 4RBPK 2EYRB 3D48R 3TZVB 3O9WC 3BMWA 4JFDD 2X05A 1XGTB 4JFEA 4UNTA 4OCXL 4U1HA 4LHUG 3SQOL 3T3ME 3ZTJH 4DKDC 3FN0L 2Y07H 1R3IL 5C0AB 1PYWA 2HT4D 3TC9A 3DX6A 3GMRA 5T3ZD 5HPOA 4GKSB 1PG7L 4FQLH 5BXFB 1I4FB 5IFJA 1U8KB 3NBNA 3GMMA 2WP3T 5CKGA 4LLVA 2W9EL 1OCWL 2AXFB 1KEGL 3D39B 1MCBA 2AEPL 1IL1A 3BWAB 4P23B 2VLLB 2NTFB 2VE6A 5IHBA 3OZ9H 4L4TA 4M7KH 4G6MH 2D7MA 3VFTB 2PETA 4MHHG 3RHWF 4LHJB 2D3VA 2Q6WB 2HFGL 3ZT5A 1N64H 3RL2B 5I1GL 3W2DL 2UVFA 3QCTH 4MQSB 5ALBH 5JR1H 2GW5A 3T0EB 2A1WL 1FDLL 1FGNH 3M1BA 5D7KE 2ZPKH 5DJ2B 1G7HA 1L0XA 2DJSA 2OR7A 4QRPB 4ZSOE 2CUMA 5CEZE 1NEZA 4Y5YB 3MYJA 3L3JB 1T0NB 1YEJL 1TVHA 4OGXL 2VR9A 2RHEA 5GS1C 1OTTC 2W60B 4GAYA 1QP1A 1HHHB 3BP6B 1YN7A 1PKOA 4LRIC 1MHPL 1YJDH 3IVKA 2E7MA 4YK4C 3FAXA 4OZFB 2XA3A 3MLRH 1DEEA 3L7FA 4BH7A 2XWTB 1CF8H 5C09D 4MCZB 4PJXA 3BQUA 5C1MB 2UY7A 3P4NB 2YK1L 3NABH 5H35B 1BX2A 3O6FD 5D96C 4QXGH 5CSZA 2D7NA 1QRNA 4ODVL 3EYUH 5I66B 2FWOA 2CDFB 2V2XB 5LQBL 3PP3K 5ACMA 2H41A 3S7GA 4DQOL 4K7PY 3EOBA 3F7PC 5KTEL 4AK1A 5D7JC 3ISWA 5ACZB 2ZCHL 4PD4J 5F7EL 1ZWIB 3KG5A 4KHTH 5HPMA 1OARH 5FCUH 3B4NA 3LEYL 4PJ8D 3LN4A 4QY8B 2NX5A 5FA4B 3TJEL 1CLZL 4PGCB 4NYLB 2W9LA 3G9AB 4D9RD 4U1MA 2AV7A 3CFIC 3V6FB 1WICA 4S1DC 4EKXA 5DEGA 3KWWA 3TF7C 1S5HB 3SQOH 2OZ4L 1YQVL 5EOCJ 4ODTL 4Y4HA 5C0FB 5I0ZA 4ONHB 3V8OA 5I19L 5KSVB 3PWUA 4KWUA 1BQUA 2W0LA 3N1MC 4LP4A 3EYQD 4HFWA 4WDIB 1Y18B 4PBXA 2W9EH 1OCWH 3V7AE 3KJ4B 3BUYB 2AEPH 3GMQA 5DA4A 3HZYB 1LO3L 4CN6A 4RGMC 3NIGF 1XGRA 3HLAA 4Y16D 4XNUL 2WWMC 3U1SL 3BGMB 4RIRA 5ILTH 2R8SH 1T83C 3VI4E 1ZTXL 2ESVE 3H7LA 3W2DH 1HZHH 4OLWH 3OAUL 3WHXA 2GSGB 3C5ZD 1AFVL 5E2WL 2A1WH 3DYPA 3CMOL 4CN1A 5BZDA 1T0MA 3IDNB 4IJ3C 5KSBF 4JPWL 3LD8B 4JEGB 1PG7W 3U36B 4F7CA 4BQ6A 4YHYC 1UZ6E 1TPXB 1YEJH 4OGXH 5I75C 4B5EA 3VXSA 4LSPH 4QXTA 2YPLA 5GZND 1P9MC 2XG5A 1MF2L 1UVQB 3SJVE 4HGWA 1HXMB 5C0GB 1RJYB 1JTOA 4AIZB 1JNNL 4P3DA 3BKCH 5HHOD 3GRWA 5ADOL 4DW2L 5E7FA 2YK1H 4NRZB 3MROA 2GJ6D 1FG2A 5FGCE 4LCUB 1S7SB 5JNYB 3GSXB 5KSAA 5LQBH 4YR6B 5I1HH 1NFDB 2OQJB 1ETZB 4OLVH 4GKNB 4PJGE 5FHBH 4PG2C 1XF5B 5F7EH 4OZIE 3D2UD 4X6DE 1DBJL 1J8HE 5D9SA 1DBKL 4LCWB 3MNVA 1NDMA 2X4OB 4MSWA 4NP4L 3JV0A 5HHMB 2JJWA 4LKXB 1IGJA 5D1XB 4C55A 1LVEA 2SEBA 32C2A 3GHBL 2YUVA 4PP1D 3BJ91 2HKFH 3S88L 1RUML 3IF1B 1HSBB 4LLMB 4F7EB 4Y1AA 3D87B 3Q0HA 5KVMC 2RFXA 2AJVL 1CGTA 5SWZB 4KKLC 3QWOB 4X4XB 5JXAL 1DL7L 5E6IC 1OP5H 1C12B 4BUHA 4KUCD 1JMXA 4U1NB 1K3ZA 1U8OB 3B5GA 1EO5A 4WVRA 2C5DC 2EEDA 2BNQB 4RNRB 2A9ML 4HWZB 4K2UH 1XF4B 2JB5H 1U8QA 4XNUH 3U48A 5DJ6A 3WHE1 3FO2B 5GRUH 5I8CB 1ZTXH 1SYVB 3QQ3B 1A3RH 3CX2A 3SBWC 2NXZD 3W9DA 5E95B 5T5NF 1AFVH 5KS9F 3IDGA 3WD5L 5JA9A 3QZWB 5E2WH 4WUUE 4I4WB 5GS3A 1FL5B 4PJAB 3VFRA 4YDJA 1HOCA 5GISH 4X7SH 3RVUD 3H3KA 3FQXB 4PR5B 3CFCL 1XGYH 5L88H 1CN4A 3ALWA 3IDMB 1K6QH 2YRPA 3BI9X 4B41A 2C3VB 1NGWB 1A6ZB 2NQCA 5DI8A 1NBZB 1JNNH 5JZ7D 5D8JH 2DBLH 1QO3B 2Z4QA 5EBWB 3SDYH 5BRZB 3PDGA 1ERNA 3V52L 4OM0H 5D71L 2LU7A 4WO4B 4N8CL 2DRUA 2QSQA 5E4IA 1JYXA 1UADC 5ISZE 3P4OA 1MWAB 1KCLA 3OPZH 4L3EA 3HE7D 3IDXH 1E4WL 2DAVA 5DEFA 1N4XH 4P9ML 4WW2A 3P11L 4LVOC 4ELME 1XR9A 1D5MB 1AGFB 3HR5B 1OM3L 5HYQA 4OQTA 3FT2B 4PJ9B 4G42B 1DBKH 3QPQC 2R29L 3DVGA 4YIQA 5EC2B 3HNSH 1F8TL 3SDAD 3OR7A 2GK2A 4NP4H 1JWSB 1AKJB 3BFOA 3GHBH 1AI1L 1XF3A 2P7TB 4NNXB 1RUMH 5E56A 3TBTB 1ZHBB 3D25A 3DXAB 5EZOH 5GRJL 4ZNEE 4EI6B 1CFSA 1LK2A 5IOPB 3W11C 4P4KC 1ZOXA 2R0KH 1MCKA 4PY8I 5GGTA 4AH2B 4JRWA 1UM6H 2YMXL 4HC1H 5CGTA 5IGXH 2HTKD 5AG9A 3QIUA 4JFPA 2HAZA 4ZXBD 4JN2A 3EYVB 2ARWA 2IPKB 4N0FA 2Y1VA 3F58L 3IDIA 5FGRA 1ZVSA 5A3ID 5F7HA 2HLAA 3OGOE 1REIA 2DQIL 4WW1A 4NC1C 1JGEB 2FZ3A 5FYJH 2EEAA 2DDQL 4FN0A 3F65A 1K4DA 3IJHB 4HKZB 3WD5H 4K71B 2WV3A 4OZGE 1CK0L 3QEGL 3KPSB 3LCYA 3MR9B 4ISVB 4YHNB 2EIEA 1P6AB 4HKBB 4WU5A 3KYNA 3QQ9C 3MTRA 4BM7A 1FP5A 1BBJB 1NCBL 2GQHA 5EU4B 2VLJA 2D7TL 4DGYH 4JFFA 1KPVB 4JY6A 3P2TA 1FO0B 1YMHA 1EGJL 1AGBB 1SY6A 2VH5L 2Q20A 2NY2D 4NQEA 3TYGL 5E2VL 1V3KA 2VAJA 1WCBA 4ODSL 1I9JL 1QLRA 2NTSP 1NANI 5D71H 3NPSC 1CLOH 4N8CH 3WDHA 5LGJA 3BEWA 1NQBA 3BZFA 5SWSA 2UWEB 4QHUB 1JGDB 3RDTB 2ZJSH 4KRMB 1E4WH 4JO1H 2D4DA 2DQUL 3P11H 2IALA 3JSSA 4ZFGL 1DQQA 3BESR 1OM3H 4O58L 5J3HC 2E3VA 1F8TH 3BHBB 4NJAL 3C6LC 1S3KH 3HRPA 5ICYA 1MHEA 2V5SA 1NGQL 5T1MA 4DK3A 1BEYH 5TGBA 3FCTA 3IDYC 3NH7L 5T1KD 2ZUUA 2OP4L 3K2UH 4GG8B 4RFEA 2HWZH 5F71A 3RZCB 5TQ0H 5FYLL 2B2XH 3CFJB 3CIQA 3MV9B 4XC3L 1N8ZB 4HF5H 3PWVA 2YD5A 5JQ6H 4Y89A 5IVXF 2YMXH 5I16A 4GT7A 5EU6D 4C83B 3U0TB 2IAND 3O6FB 5DS8A 1XGPA 5IB2A 1QEWA 1N59B 1X5GA 3FB8A 2P5WD 2NW2B 3QA3B 4Q9QL 4NPYB 4PRDB 1BF8A 1IGFL 1H5BA 3C6SA 2AV1B 1FPTL 2NY5C 4FQHB 3GMOB 2BOCB 3V0VB 5DHVB 5EIIA 1O0VA 1UJTA 1UWEL 3DGGA 4PJIE 4I1NB 2R2HA 4X8XA 4K94L 3NFN