2F53E

Directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVSVGMTDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen
total genus 56
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2005-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53E02
3MR9B 1WFNA 3D1MC 1U8LB 3QXAB 4F7MB 1YEKH 2Z35B 4QHNA 1FV1B 1U8JB 4L3AA 2AP2A 4PJXF 4N1HB 1UB6B 4A6YH 3V6OC 4F7CB 4Q2ZA 4WEUD 3HLAB 1KJ2A 4HBQA 3SE4C 1ED3B 2BNQE 1MJ8H 2DYPB 2H1PH 3CXHJ 4PRHD 1XCTA 4M5YH 4OZHB 5I0DA 5IGXH 4KQ3L 5HSFA 1DN2A 2CMRH 3MRKA 4F15C 1EA9C 4N8VB 1QSEA 5JMRA 4RSVA 3TBVA 4GKNA 1ND0A 4KU1A 4R0LB 3FRUB 1FVEA 1QHPA 2PTUA 5SX4I 5L8LB 2AQ3A 4D0DB 3QH3A 1FO0L 5GZNC 3TNNB 1UM4H 1P4IH 1LO3H 3B4NA 4IRJC 1JTOA 4X83A 5GGRB 3DVNA 1KCVH 4M6OH 3T0DA 2A83A 4Y2DD 1JP5A 5H37G 2RR3A 1W72A 2VZOA 3BN9D 4KTYA 4G8FB 4X7EC 4LP4A 3JZ7A 4N1CA 1FSKB 2Y6SD 1F5WA 4ZUTB 4PJ9D 2QBWA 4FQQA 3GB7A 4FZEH 5KANG 1FVCB 4XPTL 5JIIA 5IEKB 1QTYT 1J1OH 3D69A 2FR4B 1JPST 5HHVH 3QFDA 3Q6GL 3QG7L 2YK1L 4OUOA 4RQQA 4WHYH 5JXAH 2XWJA 3T4AA 3PQYA 3BP4B 4E42A 2GI7A 3L9RA 3PHQA 1TZIB 3VFTA 4P9ML 1XIWA 3MRFA 1CCZA 5DQJA 3HKFA 1E27B 1IAIL 4JFPB 1U8IA 5CIPH 1P1ZB 3W0WD 2AABH 4OLZL 4PJGA 5DQDH 4QRQB 5JDSA 4NT6A 3KPNB 4RAUB 4WI7A 3CZFB 4YNYB 3UROR 3MRPB 1NLBL 4XBGA 4YFLF 4PGBA 3OJVC 3GSWA 4KUCF 3VRJA 2NXZB 5D7KD 3SDCC 2YRLA 3N85L 2EEDA 4XH2B 1WAAA 2CQVA 1MHCB 1O7SA 1V7MH 3BT2L 3WJJA 4G7VL 4LARH 1YDPB 3MBXH 3Q6FA 3R06B 3UBXI 5EU5B 3QUXD 3B9DA 4UUJB 4JY4A 4NJ9H 1OW0C 3BSZL 3KLHD 5EBGA 1PBYA 2JJVA 3QI9C 4IJ3C 5GRUL 3ULVL 3BD4A 1U8KA 3UTSD 2R2HB 2W1NA 4NQEB 8FABA 1RURH 4KUZL 1S7WA 1I1FA 2AVGA 1U8PB 3VD3A 2P5WB 5IF0B 4F2MB 4XMKL 3HNTH 5F7YC 4QXWA 4F33A 4ACPA 3ZE2E 1KLUA 1OTSD 3RDTD 1A2YA 4P23B 4G7YL 2BHUA 2R0WH 3BUTA 4MNQA 2C9AA 4TTGA 1S7TA 4WWKC 4KGLA 5IQ7H 1BBJA 3VFRA 4Z77A 4PJEE 2NY4B 3DXAD 5J12B 3GSWB 5CILH 4PPTA 4OBRA 4PJAB 1HYRC 4CMMB 4FFZL 3WFEL 4P59L 2E3VA 1D5XA 1IVLA 3MLUL 4PJHF 1EBAA 3QDHA 3OKDB 3RNQA 1S7UB 4OLYH 3VH8B 1FZKA 3RGVD 1XF5A 1MCBA 4JN2B 5BZWA 2V7NB 4HT1H 4ODTH 3C60C 5C0IA 4I0PB 2NX5A 5ISZD 4KRMB 4NN7B 5IVZB 3FFCA 4NO0B 3S37H 4UQ2B 2ADIA 4POYA 3IRPX 3OKLA 3QFJE 2QHLA 3GJFB 5BRZB 4M7ZC 4GBXD 5D7LD 4U1SB 1N6QL 3HZMA 4FABL 3QI9D 3KJ6H 5CSGA 3MOBH 4HWBH 3CDFA 5C8JB 1JWSA 3BKML 5D4QA 4OI8A 3CPLB 2IALA 2COQA 3VXMA 5DJDB 3BWAA 1OLZA 3MNVA 3U7WH 4YK4B 4OIIL 1S5IL 4WFHD 4JKMA 1OP9A 4RA3A 5B8CC 2CR3A 3E3QE 4LCWB 1CE1H 3T0ED 1UQSA 4HH9B 1NKRA 2NLJA 4HG4K 4TNVK 1YEIL 3SDDD 2N7BA 5I17B 4OZIA 3ARGA 5D96C 4M03A 1M05B 1NUNB 4NN7C 2UWEE 3ILQD 4MYWB 3H3BC 4GSDH 5SWSE 3ZKQD 1GL4B 3WXWL 1N5YL 4CMHB 1FCGA 1JPGA 4LCUB 1IGTA 3K8KA 4HBCH 4I2XB 4P2QB 3HRPA 5E70A 4IIQC 3QHZL 1UA6H 1T5XA 2D7PA 5TDOA 1JGLH 1RZIA 5D7LB 4F7TB 3D2UD 4OF8A 2ESVD 1KBGL 4Z8FH 1T0MA 4GRLB 4JFFE 2Q3ZA 4MXVF 1W8OA 1QLRB 4DTGH 3AREB 3PL6B 3CJJA 3GDBA 1NUFA 4KI5D 1QA9B 4PRID 2CDFA 2Z4QB 3VD7A 3D5OF 3HE6D 5HD8D 2HVJA 3S6CA 3LSOA 2RCSH 4JQIL 5F6HJ 3W39B 3VMPA 2A9NL 4TUKL 1MF2H 2EYRA 3KR3L 3I2CL 3B9KA 3H3PL 1AXTH 1HDMB 4PJGF 5DFVD 5MENB 3KPMB 3TNMA 2E5EA 4ZNCD 1HXYA 1T66C 2VAJA 2R23A 3BYYA 5FYKH 1NFDE 5CZXD 3HAEB 1GGCH 3T2PA 1VEPA 1A7NH 2E7LA 2VYRE 3KWWA 3WHXA 5DD3L 1OP3K 4J3UA 1WAAF 1WEJL 3F6LA 4QY8B 4ZFOB 2X40A 3RWGB 5CWSA 4X7SH 4EIGB 3GSXA 2FIKA 1FNLA 4YPGB 4D3CH 4AEIH 5D2LE 2E6JA 3BW9A 4RRPG 1CLCA 4F8TA 4HWZA 3QISA 2XWBA 4HPOH 2QSTA 4IIQA 1H15B 3PG2A 1AHWA 3LQAL 1HNFA 3GI8L 4PRIB 4XXCA 4RWYL 5FKPA 1UVQA 1KCUL 4YHLH 4V2BA 3UJJH 5AAMA 5J13C 5L9DL 1N5AA 1JZ3A 4YFDB 3DYMA 4B41A 2LV4A 2F15A 4Z18A 4LP5A 1JHKH 1AR1D 3B9KB 2J5LC 5B39B 1EUUA 3BPCA 4QRTB 5DD0L 5HYJA 5MEND 3ARGC 3GMQA 3MRFB 3SGEI 1YPZB 2HVKA 4ODXB 1A1NA 1CDCA 3BQUA 4F8QA 3QQ4A 5E94A 4XWGH 4IOIB 1U8QA 3RTQC 1A3RH 1ROWA 2YHGA 3KYAA 3QNYA 1EXUB 1P5UA 4U6TA 5B8CA 4JAMA 3FQXA 3ZDYF 1HILA 3D25B 1G0DA 3FN3A 3RVTD 1WTGT 4GQ9H 3S36L 5L6YH 2ICEA 2YUWA 4PRHE 5J1SC 3ZE1F 1Q38A 5B3JF 3FQUA 5C08D 3G5YB 4LQFH 3PV7A 3E8UH 3VXSD 4ZOAA 4Z5RB 1I3RA 1JN6A 1G6VK 3TO2A 4PJ8C 4M7JH 3WUWG 1QR1A 4NFBA 3L3GA 4OZ4A 4H88H 3MZTA 1ZHLB 3AS1A 5TE7L 2MCG1 1U42A 3ZTNH 4Y5VA 2NW2B 1AE6H 5JW5A 5GS1B 5DQ9A 5KS9F 1YUHB 4XVSH 4GKZB 4UV7H 3ZE0F 5I74B 4RGNC 3C60A 5E9DD 2NXYC 3CLEH 3QDGE 1CDBA 1E6OL 4K3EH 2XOTA 3IFLH 5C0EA 4DFHA 4MJIB 4M4PA 4PJCB 2IH3B 1UENA 3U7YH 4F2MA 3TBWA 2BY3A 4FNLL 2GSIA 3TH3T 2EZ0C 5JW3H 1WTLA 5F8QC 2I9TA 3PWLA 3OXSB 3CFEB 1XEDA 1G7QA 2BK8A 2O5ZL 3D25A 3IGAB 4Y4HA 1A1MB 3GI9L 2VE6B 1OGTA 2H6PB 3OJDB 2X42A 1JPFB 3JTSA 4IMKC 3BHBA 5BOZG 4LCCA 4RMWA 3HC4L 4M6AA 1MHPL 1KLFA 1MFBH 1R24B 4PRPA 3BZFA 1LEIB 3HC0B 3ULVF 1UXSB 3UEZA 4NNYA 1FPTL 4QLRA 2WWKO 4LSVL 3WFDH 4U6YB 5ICYB 2VXSL 3O6FD 1G7IA 5MEOB 4KI5E 5GGTL 1FC2D 4PFEA 2FEEL 1C5DA 4WO4A 4G6AD 3ARTA 1NCTA 1DSFL 1WQVT 3H6JA 3V0VB 1RZ8B 1IKNC 5L0QC 4LPWA 1M7DA 3Q2CA 4EN3A 4IRZH 1BOYA 1SM3L 3WJJC 5FUZH 4NSKA 3LPFA 2EIZB 3MA9H 4RZCA 1RJLB 1LO0H 1JF6A 3H7BA 3FB6B 1CR9L 1DANT 3MREB 2Y72A 3X3FL 2ZP0T 1LEKB 4HIXH 3DVFA 3TIEA 1FG2A 1PYWB 5FGBA 2XNAB 5B38G 1IC7H 4M9OA 5KSBE 2R15A 5BO1L 4FS0A 5DK3A 3BIBX 3CVIL 3DMMD 4YDIH 4OFYA 3TNNA 2GYSA 4M1CC 4UDUA 2R0KL 2QKIA 2V2XA 4V1DD 1NCDH 5IFAL 1IEBA 1OAZH 4HWEL 1S9XB 4MHHI 4O9HL 3TEUA 5LWYL 4OQTL 2HN7A 2OMNA 2D7TH 2P46B 3BD5A 5C86A 5EU6E 4F57H 5FYJE 4HUKB 2IFFH 1PLGH 3GBML 1DLHB 4LCUA 4EVNA 5E2TH 3RZCC 3W11D 4R97C 5HY9B 4TULL 2XY1A 2E7MA 3U9PH 5I1HL 4RZCB 3GB7B 1FNEB 1E4XH 2CK0H 1JYWA 1ZA6B 3I6KA 5HDLA 5KSVB 4JPKL 3QQ3A 4N8CL 2GTWA 3TF7C 3FONA 1ACYH 4TRPH 3GUTA 3VE0A 3TIEB 1V3MA 2C5DC 1F8TH 2CO6B 2AJUL 3WSQH 3FO2A 1ES0A 3BYTA 3T4AB 4NBXB 4BFIB 1ZLWH 5CHNB 1SY6L 1DQJA 2VTFA 5SX4H 3DX9B 1AR2A 1BFTA 4XRCB 5IVOA 2AEWA 3H3KA 1CE6A 5FCUH 3VWJA 4XHJC 2DB8A 2ZCHL 4FTVD 4X99B 4K23L 1GC1H 3V8OA 5FXCH 4BSVA 3QEQB 4LHUD 3VXRD 5C6TL 2ARJQ 3MLZL 2EYSA 4JFOB 2GITA 1AFVL 4LGRB 1SVCP 3JTTA 2H32A 3SCMC 4Z6AT 2CKBA 3EYQC 1BFVL 4ODUB 3VRJB 1OPGL 2AV7A 4YHOH 1VFBB 1NMCB 2VRAA 5HGAA 1C7TA 4HC1L 5H2BA 4G8EB 3SE4A 5FYKE 5DRNB 4OZIE 5DHYB 3QQ3B 5SWZD 1U93A 4HCRA 5SWZA 1XIWD 2ZUQB 3HG1E 2R4RL 2V2WA 2BJMH 1EO7A 3OG6B 1T0NA 5EO9B 1OAYL 4EN3C 1S7WB 1IKNA 2X6MA 1DL7H 3NIGF 2R0LL 3KYOB 1Q1JH 5DWUL 2ZNWA 5F9AC 5MI0C 4WI9A 2I24N 3OKNB 5KG9A 1HIMH 5EC1A 1JGVH 1J11A 1HH6B 5GQBA 5IKCA 2GITB 4L8SA 4U1MB 1RIUH 1WZ1L 1F6FB 3MV7A 5JHDE 4ODXA 1MQ8A 1C5CL 3WLWD 4ONFL 5EBMA 5JTWA 3UAJC 3TYFA 1QEWA 1CQKA 1IGFL 1XF4A 4M00A 2AV7B 2DI8A 2VWEE 1I8KB 2BSSB 2J8UF 5ETUB 5TFSL 1ED3A 4YR6B 2FO1A 3NCYP 2NY6B 1Z2KA 2ORBH 2OM5A 4LCCC 4RAVA 2FJGB 4OZFA 1I8MB 3B3IA 1SYVA 4M3JA 2HT3D 3LD8B 4JFXB 3CK0L 5I9QC 2OL3B 4OCWL 1TQBC 1ZMYA 4MXQC 4P2OC 3CSYB 4WWID 3FRPA 1BGXH 4LEOB 3NACL 5IJVA 4I1NB 1I9EA 3O4LB 1HKFA 4P4RB 2KKQA 4HKZB 2R69L 3OPZL 3QJHB 1PKQE 3MLYL 1XGRB 3MOAL 1EEQA 5TF0A 3VWKD 3EIFA 1CICA 2BVOA 5BRZA 4LASH 3WLBA 2DQEH 3Q5OA 1HHGA 4Y5VC 1UFUA 4I9WD 5E95B 1BLNB 2VLJA 4ELME 3GEWB 4ORGA 3BWAB 1FL6B 2YD1A 2YD6A 4PJ8D 2H2PD 4DVBA 2C4XA 4X5XB 2AXJA 2DM7A 5DVLA 4ODVH 5T33L 4LCWA 2R2EB 5BCAA 1AIFA 2PTTB 4ETQA 1KCSL 5SX5H 1LDPH 4NJAL 1IILE 1EUTA 3LEVH 3JUZA 4P9HH 5IHUL 1JVKA 4K9EH 3RTQA 3QXTA 2PO6A 2SEBA 3QCTH 3U1SL 3PHQB 1PX3A 1CDJA 3EBAA 5B4MC 3EDKA 3TN0C 1CLOH 1UB5B 1E28B 2B4CH 4Y5XA 4U31A 2VXQL 2E7HA 4ERSL 4NC2B 2DQIH 3V0VA 2GUOA 3B43A 4GG6F 2DF3A 4NM8H 4I3RL 2XKSA 3WO3B 5SWQA 2EDBA 4MWFA 3GHEH 1NC2A 5F3BB 1XT5A 5A2KH 3QUZD 2AW2A 4AY0A 1LO2H 5AUMB 1T7ZA 4GRLC 1FSKC 4KKAD 1UKTA 1J86A 3LSOB 3J7HA 4KMLB 4KROC 3MV11 43C9B 1DVFA 4GAJL 3B83A 5F7MC 1GGTA 2EYRB 3B5HA 3KNBB 1UZ6E 2DJSA 2OL3H 1S9YA 5ALBH 3F12A 1ODAA 2GHWB 1J8HE 4XPHH 4TVPE 2QKIB 2Y06H 4Y4FD 3P4OA 2NYYC 1HWHB 4FMKA 1T1XA 3SDDB 1BX2A 3MCKB 4G6JL 3UTQA 4WEMB 5GHWH 2X4UA 4LNRA 1DBKL 5ADOL 1OAQL 3VFNA 1F4YL 1INEL 4Z0BL 4EI6A 2IBZX 5KSBF 4QT5B 1OAUH 3GFUA 4Q6IA 5D1XA 3RX5A 3CIQA 3TT3H 1UCBH 1WF5A 2B7DT 4MDIA 4OGXL 1BIIB 2VLRE 4XCFH 4IIQB 1TJHL 2I5YL 4Q9QL 4AG4L 1CIDA 5C0BA 5LVEA 1HHHB 1NCBL 1A9EB 2AI0L 5A16A 2I60H 5IBUB 5MEPA 4XPAL 1A6TB 5HHXL 1SJVA 3EOBA 3T0BA 3ZKSD 3FQWA 4LLAA 5FGRA 4M43L 3P9LB 5DJAB 5BOPA 3GSNL 2VDQH 1NFDA 5C0AD 5ENWB 3V7AE 1HK6A 1B0GA 4WV1A 5TF1L 4JO3H 2ZG1A 5DEZA 4EDXB 5L2KB 2VDLL 3HE7A 4JM2A 3SJVA 3WD5H 1HH9B 1R3JB 2FCBA 3F58L 4V1DE 4PJBE 4L29B 2PYFA 5DO2C 2Y23A 4TSBH 3P0VL 1K85A 3LKOB 5FUOL 4PLNC 3MACH 5HI5D 3O0RL 4MNGB 3VXMB 4NQED 4JJHA 2VXVH 3EYOB 5H2BB 2O61B 1I1AD 5EBWA 1OM3H 2HYMA 3N1FC 2VLKB 1GGYA 5F9DC 1FIGH 2A6KB 5D5MF 4TOYL 3D6GA 1NCAL 2FHCA 3OX8B 1OSPL 5HYFA 3D3VB 3LS5L 3S88H 3VJ6A 1YPZE 1IRAY 1BQUA 5F7NC 4HUXA 5T3XH 4F7CA 5HYEA 3A6CL 2BOCA 5BS0B 4KVNL 5CZVL 4JGMA 1YEEL 4WNQA 3M45A 2C7UB 5ERWA 1C1EL 3LKSB 3MRBA 2HJFA 2GAZB 3MV7D 3S35L 5E00B 1NMBH 3SJVB 1ZLSH 1T5XB 2DLTA 2OTWB 3C5SA 2EKSA 4HSQA 4PBWD 3CSBA 4PJDA 5JW4Q 4LHQB 2NXZC 5CIPA 5FV1L 5FA4B 4XP5H 2VIRA 1A8JH 3WJLC 1RUQL 2VN7A 4F9LC 4RAVB 4NO0D 5IROA 2R29H 2AJXH 5EA0L 3DV4B 2XTJB 1YNTB 3F5WB 3MLPA 2FX9H 1NDMB 3ES6A 5I8CB 4PV9A 3UYOD 1DQML 2Y36H 3DWTA 4L9LC 3QI9B 3EOTL 3GSVA 4IJ3B 5HYSA 3NAAL 1JGEB 4G6FB 2NY7L 1IGML 1D6VL 2XQYG 3D48R 4LVHC 2DQFB 4J3VA 3ULVD 1U8OA 3TYGH 4MCYA 4NNPL 4FQQB 1D3CA 2UY6A 3S4SG 1ZT7B 2HTLD 4OZGA 3DUSA 2A1WH 3H7BB 4NC1C 3MREA 5I18H 1IGYB 1CTOA 4H1LA 1P7QA 5DMKB 4MJID 4UT7L 3PE9A 4LVEA 5F7FA 3GGWA 4PRNB 3T3ME 3VGHA 1ETZB 2DICA 1EPFA 2P24B 4BQ9A 1IFHL 1WT5A 1NANI 3FKUS 3L9RB 3X14A 1TZIA 3VFTB 4G43B 2CUHA 1MJJA 4HS6A 3WUZA 4ZD3H 1H3GA 5DXWA 1VESA 2MPAH 4MQXD 1A6ZB 1U2CA 5C2UB 3LH2L 3IDMA 1PY9A 3T3PE 1LNUA 1WGOA 1N7MH 1IZKA 4Z7VA 5I8CA 3QEHA 2ATPA 3C6LC 3D2UB 4LSRH 1ULVA 5BMFL 3BZEB 5KW9H 5MHSE 4JFZL 5E2VH 3CCHA 3SQOL 3NIFE 5IW1A 3KYNA 4N0FA 3CFCH 4YHML 1DBAH 3KPTA 3TPUB 3I85A 1U0QA 2IF7A 3LHPL 2HFFB 3LRSA 2BSTB 1U8QB 4DKAA 1E4JA 3QWOB 3RWEA 1XR9B 2K9UA 2APXA 3PXHA 3QIWA 5FHBH 4OF0A 1FFNB 4JO2L 4BM7A 4JM4H 2VLRA 5EU5A 1B2WL 1D5IL 3EOYG 2GJ6D 4P3CL 3UZQA 4QXTA 4OLUL 5GIRA 4QRRA 43CAA 1U6AL 4OLWH 3T0EA 4Q0XH 5BVPL 3IJHB 1A6VL 4U1JA 5GJTL 4JHBA 4KDWA 1DQTA 3KPRD 1TVBB 4UMGA 3ULUL 43C9A 4IRJB 4PJXA 4ZS6C 4XPGL 4X99A 3ULUC 4Y8DC 1GRWA 4R90L 5BJTA 2YPVH 2KZ1B 1OSZA 2VUOA 3F12B 5I2IB 5IB3B 3NCEB 4U05A 3CDGA 4MNQB 1U92A 4TUOA 5LG1A 1Z9MA 2LVEA 2R1WB 4XAWL 3L6FA 4TSAH 1QUNA 1T1YB 2FJHB 2OTUB 3L5XL 1NAKL 4Q2ZB 3RVUC 2IH3A 2YA1A 2Y1VA 1QACA 1MQKL 4XMPH 3SQBA 1A4KA 4MA7L 1FRGH 5DSCA 1ONQB 4JFHD 2DTML 3WDHA 3JXAA 2B0SL 4AENA 1G7QB 3QJFA 3WL9A 4PJAE 4J1UA 3WN5C 5LBSH 1R0AH 5I15H 3V7MA 1TJGH 2E27H 4DKFL 1VGEH 2YSSB 1G9ML 3O2WL 4P5MA 3ZKXB 2XKNB 3AMLA 5HPMA 2BDNL 2DD8H 1CDHA 3V6OA 3ZE2F 2DLHA 3QH3B 5KZCD 5ADPL 2P47B 4XBEL 1IAIM 3AXLA 4ZO9A 5MEPB 1T7YA 2P5WE 4PRAB 3F8UB 2WSKA 3CMOL 2IPTL 3RWJA 2JJSC 4QRPD 5D7IE 1U92B 1HH6A 1YJDC 3K74B 4X6DA 1LP9A 1JMXA 2ZJSH 3VXQA 1T7XA 4PY7A 4F37F 4OAWA 1MWAH 5DJDA 3TYFB 2CUIA 2O5YH 3STBA 5EU6A 4AIZA 4C56D 4MAUH 1A7BA 4HUUA 3ZHLA 1UQSB 4HH9A 5CINL 3B5TA 3FB6A 4ZOBA 5D1ZA 4HK3J 3RBGA 1BJ8A 2A6IB 2WBJB 3QUYC 5FGSA 3HPLB 4QYOB 3BUYA 3CZJA 2YRPA 5JQHC 3VGAB 3IVKB 1IC5H 5C08A 1GGIH 4RISL 3KHQA 2EXYD 5F7EH 5DRZA 3LMJL 1MJUL 5C09E 3V7AG 2DQGL 3SO3C 1XIWB 3NCCB 3QPXL 2EE6A 1JRHH 4OZGF 1AO7B 2YUXA 2AXFA 1VPOH 5ITBL 4JFPA 3CFDB 4HV8B 4QCIB 3IDNB 4U6VH 1JTPA 1FGVH 2HT4D 2PETA 3THML 3KPNA 4YNYA 1QLRA 2J6EH 2VZTA 4FOMA 2IBBA 4S2SA 4O5LL 4GW1A 4Y4HD 2MCPH 1JNLL 5F7DA 1S9WB 4EVNB 1YYMH 4OM0L 1K3IA 1KIPB 1AKJA 1J10A 3O6FB 1AQKH 3PGFH 1NL0L 1RUMH 1AIFB 4RX4D 2YPLE 4JFDB 2V2TB 2WBJA 3U2SA 1UM6H 1VERA 3TBYA 1CGSL 4R4ND 4UUJA 4AEHH 3W9EB 5LGHL 4WWKD 4CN1A 3LN4A 5M95B 3UBXA 5E6YA 4JO1H 1YY8A 3S8WA 1TJIH 2ZNXA 4WHCA 1KB5L 5ITFA 3VWKC 1HQ4B 3M17B 3MRQB 4OGAD 4ZFZB 5FO8B 4ZFGL 1EEZB 3TZVA 5LGKA 4NO2A 5J11C 1A6AB 5E5MA 7FABH 4MJ5A 4L8CA 3JV5A 12E8L 1YEFH 4XCYA 2BSED 2DJUA 1E4WH 1PKOA 4MWFB 1FFOB 4GW1B 1T22B 5I8OL 4S10A 4JLRA 3O45A 4I18A 2G60H 1ZANH 4N9OB 4KK5D 1RIHL 3UO1H 1H9VA 4DAGL 1CVRA 4OZHE 5F7LB 2LTQB 4EUPH 1IQDB 3G04B 3L3JA 5F96H 4PGDB 3GGWB 4PRNA 1VSCA 3DO7A 4YEFA 4K3JH 1Q72H 2FZ3A 3KYKL 3UTTD 4G9DA 3SKOA 1A1OB 4PR5B 2OJZL 4JRXB 2Y07H 3QP3A 1IQWH 2AGJL 2XN9B 3TT1H 1AY1L 4MB4A 5IBLC 1CFBA 1HZHH 4WUUD 1DBMH 5JOFB 4TUJB 2OBGA 4PJAF 3DV6B 4UQ2A 3RHWF 5ILTH 1MNUL 2GIYA 5JNYB 2CH8A 4WHTB 2QQLH 3QT2A 5C0CE 1A6AA 1P9MC 1CLZL 4MJ5B 5E7FA 5DK2B 5JMOC 3PWPB 4I13B 4XX1E 5F71A 5JXED 5D1QC 5ANME 2DKSA 3HMWL 4YDKH 4O51B 2HTKC 2XT1B 4KFZC 3PIQA 3STZA 4PRPD 3DYOA 2BSTA 4UOW1 2XTLA 3U83A 3X11B 5MHSD 3AREC 3AMKA 2FH8A 3OTTA 5DYOB 3BKYL 3VCLB 4JFFA 3KPSA 4J6RH 4TQEL 3KLDA 4Y5VB 1UM5L 3B9EA 1FDLL 3OG4B 3PWVB 4NQCA 1ITCA 1K8DB 4QXUL 5I1DB 2Z31A 4M4RA 3C60B 5FM4A 3O81A 3RHWK 4OTXL 3VXPA 1X4ZA 1NGPH 2EDEA 5ISZE 1QP1A 2ITDB 3PGDA 4KK8C 3JV6A 1F2XK 3RL2B 2M8XA 1BZ7A 5H37H 4WUUB 3KG5A 4D94A 1INQB 4WHTA 2Q8AH 3VGEA 25C8H 4X4YB 2FGWL 1IAOB 2WV3A 2F54B 2BSRB 3INUH 1OARL 1CL7H 3MV8A 5ESVA 3UTZB 5L8KB 5J12C 5I75C 4HK0B 2DQCH 2P45B 5E8PB 2DQHH 1NUGA 4MJ6B 3VFPB 1K5NB 5C7XH 5DD5L 3UYRL 1OAXH 2B2XL 5DVNA 4DUVA 4PRPB 4ORGB 3MLWL 1EHLH 4UDTB 5GGTA 4KTEL 2YS4A 1EGJH 3EFDL 2Z4QA 3QIWD 2HTKD 3V4PL 1G7IB 1JNHB 3OAZH 4KJQC 1C12A 5IB5B 3IDJA 2YPLD 3IDGA 1NAML 1D6EA 5EOCH 1ACZA 4JFEA 5J89A 3FO9B 4FZ8L 4OCNC 3VI4E 1SEQH 2MKLC 5HDQH 3RIFK 4PG9A 4BK4A 3MLTB 3QDGD 2C3XA 5TGBA 3SJVE 1WCBA 4F9PA 2V9RA 4D9LH 1D9KD 1F00I 4QHKI 3AFLA 3AC0A 1FLRH 2ZOLA 1NGQL 4X6DE 2M2DA 4K55A 3TA3D 1I9JH 3HS0B 2HLFD 5SWQB 2VDML 4PG2C 1MAMH 1VADA 5JOEA 2EH7L 3UP1A 5ICZA 4DVRH 1DQLH 3NZ8A 2X9YA 3NTCH 2V9TA 4W81A 2X7LA 5DI8A 5CCKL 4N8PA 2J8UE 4M1DH 3R8QA 4P46C 5EZLA 5IFHL 2B5IC 2H3NA 1UWEL 3I9GL 1S9XA 2OP4H 3L3KB 1OF2A 2MSPA 4JY6B 4KWUA 4ZS7L 1F90L 5MP6L 2RFXB 1J1XH 4OM1L 2JB6A 4WTXA 4G80B 3BAEH 2W38A 4NDMA 5GRJL 5HYJB 4XCNB 5GSVB 4OZFH 2PF6A 4GBXB 5GGUB 1HQRA 1QSFB 1B90A 3SDDA 3UDWC 3T04D 1JV5B 4OCXL 2M1KA 1J1PH 3ZO0A 1ZA6A 4C83B 3ZYZA 5BS0E 4OCYH 1J88A 4X9FA 4KAQH 1RUKL 1NDGB 5FAAA 2V17H 5JHLH 5F7DB 5FGCB 3HS0A 4KRPB 1LK3H 5IWLC 5FHAL 5INCB 3SKJH 4XRCA 1PQZB 4I5BB 4OD3L 3RIAF 4YDLC 1KEMH 1F58L 5EZLB 4BQ8A 2HT4C 1FVDB 3RWDB 2HWZH 3HCVA 2VDRL 2LQRA 4U1HA 5GS1A 32C2B 5DMIH 5E8EA 4K7PL 4U7MA 4MB3A 4F7MA 4I8DA 2BRRH 4JZNB 1CLYH 4RMVA 5BVJB 4HKXB 4N0FB 3MUHL 1WV7T 3TZVB 3D9AL 2GSIB 5L2KE 3D39A 4GXVL 4B53A 5K9JL 5CUSH 4XPBH 3QA3A 2DQJL 4F58H 4C83A 1W0WB 3NCFB 2NZ9D 1OGTB 4X6CF 3FT3A 3S3SA 1KC5H 3JSSA 3ARVA 2HLFC 3LEXA 3QBTB 3MGOA 4O2EB 4ZO8A 2VXTH 5EO9A 1FNGA 1VGKB 5ACZB 3BIKA 3BPOC 3MCLH 4PJCF 3ARWA 3EYOA 3UC0H 3B8YA 1AP2B 3DO7B 4K8RH 1J0HA 4JR9H 1PFCA 1QFPA 1KXTB 3RTQD 4HS8L 2IAMC 2WK2A 4Y4FA 5C0NC 2CDEB 2W65B 2BFVL 3MV9B 1BP3B 2LU7A 3IXAA 2LAAA 4NGHL 5FYLH 5HBBA 5I76B 3L6FB 3A67L 1IAKA 3LQZA 4LPUA 3MGTB 4C4KT 1QVOB 4KKCC 2W0KA 4BH8A 4ISVA 4PJIE 4KJQD 1KB9K 4ODBD 3TESA 1NC2D 5BZDB 1GHFH 1G84A 4JQVA 3N9GH 1YNKL 5JA9A 3MRCB 2QHRL 3X11A 2VAAA 1KG0A 5D1XD 2F19H 5FA4A 1IM9D 2ARWA 4M8VA 3PQYE 1S78D 1WJ3A 1JNNL 5AEAA 1NANH 1ZHKB 2BMKB 4ZUUA 3PWVA 4KTDH 4NQCB 2Q8BH 4JPIB 2Z9TA 2OZ4H 1A4JB 1X6LA 4NRZB 3C6LB 1E27A 5HI5C 4JY5L 3WIIH 2CLVB 3ESVF 3DRQA 3MV9D 1TITA 4YXLH 1M7XA 1N59A 1FJ1B 1W72L 4FQ1H 4NKDB 5D70L 1ADQA 1D9KC 5JHDB 2AXHA 1DLHA 2VQTA 4PRDB 1IGCH 1YEJL 4ONGL 3P9WB 5HY9A 4AYFA 4DZ8A 1YJDH 4PJFB 5I16B 3VXSB 2LE9A 4JHAH 2PCPA 4HK0A 2FJFA 1BAFH 4HCRL 1EJOL 2A6IA 3IAQA 1IGYA 2FHFA 3DIFA 2AQ1A 2FATL 2YPLA 3U0TB 5CGMA 1N3NA 2IG2L 4I3SL 1NEZG 5FM5M 5IW6B 1OCWL 1AGCB 1K6QL 2IMMA 4YC2B 5KTEH 3OL2A 4ZSOB 3TFKC 4EBQH 1DEEB 2F58L 1PDKA 5TQ0L 2HP4A 4JPIA 1RJZB 2P5WA 4U1IA 4Z76A 4FFYH 1KIRA 3BWUC 5FA3A 4DGIH 3AS0A 2ERJC 3DROB 2IBZY 1G7LA 1X5XA 4FFWC 1H8OA 3IF1A 3QZWG 2IGFL 5IB2A 1QBLL 1RZ7H 3WIHL 5DJ2A 1D7FA 3S35X 1RU9H 4K94L 3P77A 1QO3B 2CKBB 3NA9L 5KS9E 4PJEA 4Q6YA 1ZGLB 1QBBA 4NHUB 2A6DA 5TGBB 4PJFA 1A3LH 4CMMA 4PGEB 1CF8H 3CFJB 3GJFK 5HGAB 4IOFC 4H1LG 4Y4KC 4R6UA 1RZKC 2VUYA 2AV1A 5KVFH 3O4LE 4G3YL 5GIRB 2VLME 4KMTL 4P5KA 5D71L 4RFNC 1AGCA 3LN4B 1IT9H 1RFDL 3ULVC 2BX5A 3HNSH 2MOVA 3MCKA 4TPRH 3MRQA 1H3PH 5JW4M 2R56L 1M7IA 3PL6D 4YGAB 3ZYOA 1KCRH 5BW7A 3QFJA 3TVMC 2X1OA 3EZJB 5DMYA 3P0YH 4YGVB 2VNCA 5GSVA 3CVHA 5EC1B 3PWNA 4KRLB 1RMFL 1BPVA 1OP3H 2D0HA 2QTEA 1CFTB 5D7SL 4YE4L 1NBZA 2EDKA 3Q5YA 5GZOC 4J8RB 4ZFFB 4MMZC 5HHME 4X7TA 2J8HA 3O6KL 4M6NL 3CFJA 2DTSA 1WITA 3HR6A 1T20A 1P4BL 3DRTB 3GSUB 4OD1L 3KDMB 1JWUA 1XGPB 5EB9A 4FXGB 1BECA 3MRRB 3OKEB 4HHAB 4R96B 1QOKA 1JF5A 2R1YA 3LKRB 2EEBA 5JZ7C 3E6FA 5ISZA 3EJZC 4DUWA 1TZGL 3EO1A 2P8PB 4U1HB 1HI6B 3OMZA 9CGTA 5FECB 1YQVH 3AXLB 3QDAA 5CFHA 4XWOD 2DLFL 3B2VH 3VRLE 5TDPB 1QFHA 3EYFA 5F6IB 1BVKB 4HJ0D 4Y1AA 3FL7A 1G7MB 2P8LB 4B50A 1A9BA 5HJ3A 3VDCA 3STZB 4ZTOL 1AGBB 3W0WE 3P11L 3MRIB 5LQBL 2O61A 4S0SD 4XCEA 3VFVA 5JLZA 3QIUD 1MI5D 3JWOL 3FB5A 5HI3D 5I73B 1CDUA 3OXRA 2APWA 2VDKL 1AI1L 5I1DA 2Z31B 3ORJA 5LGJB 1Q9WA 1SBSL 3VXNB 3LV3A 4WW2C 1BOGA 1FNGB 1VGKA 1KJMA 2EO9A 1HDMA 1U41A 2WIIA 4HUXB 4RIRA 2HT2C 3UMTA 2ARJA 1BFOA 2QR0A 4S1QL 35C8H 5E4IA 5KSBB 3WS6C 4R8WH 3SBWC 5KVMC 2C7UA 2NX5D 3MRBB 2G75B 3ARYA 2H9GA 3G08B 4HXBL 3ZHKA 3GIZH 3KS0J 3LKPA 4RWHA 5TQ2H 2DQUL 4YHIA 4D8PA 3LDBB 4BH8B 3GRWL 2RIKA 4XP1L 5L7XH 3JWOC 3HB3D 3VFVB 1SJXA 5B38B 1T1WA 2XA3A 4OLVH 2JE8A 4JG1L 3U48A 5HPOA 1S7SB 4HMDA 1CFVL 4EN3D 3TBVB 2H2SC 1FBIH 4GG6B 3MRHB 4ZMAT 3UPRB 3U6RB 1MLBA 4MSWB 5DJZA 2FL5B 1A0QH 2J88L 3K2UH 4F7PA 1ERNA 3HZVA 3VU2A 3C5JA 4M48H 1MCLA 1EMTL 1KV3A 3QEGL 3DURB 5JUEL 4XMLL 4WW1A 5DMGC 5C0DB 3C2SA 4Y5YB 3JVGC 4JM2D 1IEHA 4WI4A 4HGWA 3RVXD 3SDYH 4L9DA 3HMXH 4KROD 2NPLX 2FEDC 3O9WC 3PABA 1I1YA 4HEPG 4DOHE 2O5XH 1FHGA 4X9BA 5D6CA 4JZJA 1NH6A 1MJJB 1YMME 3CX5J 1Q9KA 3LS4L 4FQXC 4YHKH 2DMKA 4HXAH 5DHVB 3MJ9A 3LY6A 5IVNA 1AO7D 3HZKA 3V79C 1NFDF 4XPTH 1HHJA 4K2UH 4APQC 4JDVA 1AD0B 4P5TD 4JY6A 3O6LL 4G9DB 3FT2A 4LSUL 4UB0H 2FL5A 5DZOA 3VWKB 3WKMH 4Y19D 1LWRA 3P9LA 4LSDA 5DJAA 3BKJH 4LCIL 2OQJB 5KVEH 3GMRA 3V6ZA 1B0GB 3T0WA 4OT1L 4GG8A 4PRHB 3EO0A 4WRLA 2H32H 4UBDC 2IMNA 3S34H 4OZHA 4JM2B 1RHFA 1F45A 2VE6A 5EG6C 4BKLA 1KF9B 3UJIH 1MFEL 5DD6B 4C56A 3CH1B 5IMOB 1KTDB 2HKFH 3AS3A 1L7IL 1LHZA 1G1YA 4XP6L 1X4YA 4PJ9A 3C5ZC 1X5IA 1L4IA 3E1F1 4OCRH 4ZS6D 5F1KC 1RZKL 4U7SA 5DT1H 5IM7A 5EU7C 4M1CD 3I3BA 3EHBD 3RWDA 15C8L 1QBAA 4U2ZA 4I48A 4YBQD 2PXYC 1UACH 1WIOA 3REWB 4FP8L 4LLMB 4I4WA 4I77L 1JUFA 3ARUA 1QSFE 3D85D 3RP1A 2GEEA 4Q9RL 4PJDF 3BSZH 4OI7A 1V5JA 3FQRA 3G5VA 3SO3B 3WN5B 8FABB 3ULSB 5BV7H 2MNUA 2BVQA 2AK1L 1IC4H 1LD9A 1RZGA 3V95A 2WWKT 2EIZA 3QXWA 4NIKB 4NUGH 3X12B 3LKSA 1A2YB 3PHSA 4P23A 2HJFB 3O2VL 1WFUA 1CXKA 5AWNH 1T2QL 4NN5C 3MUGA 1TCMA 3S7GA 2NY3D 1TVHA 2OXHA 3FT4B 3X17A 1NBZB 4JRXD 4Q74A 4NQDA 1HXMA 3WHE1 3MGOB 3MRLA 1KPVB 1MCSA 3DARA 4RDQF 1UH4A 1ZTXL 2R9HC 4TSCL 3QWRA 1SBBA 2GSGA 3T1FA 4PRIE 1FL5A 3PWPD 1X4XA 2W65A 4AQ1B 2L7JA 5IJKA 1TTUA 1P1ZA 5ESQA 2QADC 4I4WB 1MFAL 3ZSTA 1MLCA 3LKRA 1XGYH 2OSLA 3FO9A 5EH1A 3VW3H 3D85B 4KZDH 3ULSA 4JRWA 4LLQB 3SY0B 1X9QA 2RQ8A 1JYXA 3O2DH 1KJVB 2KPNA 2A74B 3QCUL 4U1SA 5A1AA 5D9SB 4WFFE 1FAIL 1XCTB 4Z7VF 1JHTB 1WCBB 1X3DA 3HPLA 3OZ9L 4O4YL 2DQDL 3K7UA 3T4YB 4KKNA 4P2QE 4LRIA 5F9OL 4PRPE 1KJ3H 1YNLL 5KANI 3X14B 4PJ7B 5C92A 5F6HI 2P8MB 3MRGA 3GNMH 5IBUG 4Z7WE 2ICWB 3D0LB 1A14L 2IQ9H 5ABDE 3FN0H 1QSZA 4MXQD 1LNUB 1EFXA 1FL5B 2H3NB 3RDTB 1B88A 4Q9BA 1X44A 1TDQA 3PDDA 4FQCH 1MHHB 1T0PB 4JG0H 3CMGA 5T3XD 3SE3A 2NY6D 4GS7C 3IU3A 2G9HA 4GAGH 1DQQB 5D2LA 2VR5A 4QHMA 4PJHA 2EECA 4KHTL 4UTBL 4HF5L 3SO5A 4GKOA 4P2QA 3T3PF 3QWRD 4JFYB 5GRVL 5T1DH 3KPSE 2PCPB 2AK4B 2GT9A 4ALAL 1SMAA 3VD9A 1U3HC 5FYJL 3PV6B 3ARGD 2YPLB 1M71A 4QRRB 3PP4H 4LLWB 1I8IB 3WMSA 2HH0L 4X0KB 4HZAA 1R3KB 3M17A 4MAYC 4OUUA 3V0WH 5CAYB 1Z3GL 1N0XH 4UINL 4MQ7B 1RHHB 4FQXD 1I7TA 2CGRL 5H35B 5CSZB 5DJZB 5I1EH 2ZCLH 4NM4H 2R23B 3BRDA 2PXYD 4DKEL 1MF2L 3C8KB 5HYIA 3C5JB 3MV7B 1BEYL 1F3JB 4PJEB 1T6WA 1ZGLA 3TGXA 4XNXL 3VXUB 4N0UB 4H8WH 4WCYH 4XH2A 3EDFA 3RVWC 5E6IA 1MHCA 5DSCB 5AZEH 3IFNH 3QCVH 2Z8VC 5JHDD 1B0RA 1HINH 1WEJH 2P43B 1I7RA 3IXTB 3ARGB 3CSYA 1A1OA 1H8NA 4PR5A 3WUWB 3W5MA 5DFVC 2N1KA 3I02B 4X6DF 2XN9A 1QFUH 4LNVA 1LVEA 2G5BB 3MJGX 4LAQH 4NQEA 1RULL 3JWDH 3DV6A 4D0CB 2EIBA 1P2CB 2QQNL 2C3GA 5IF0A 2W9EL 1T3FB 3TN0D 4NNXB 2BVOB 2EDLA 5CP3A 5L9DH 5JIPA 3F7RA 4LPVA 1CIUA 3ZE1E 5EUKA 3HG1D 3U4BL 3HI5L 1G6RA 4EI5C 5T3ZD 4PY7B 2FEEI 5FYKD 4GRWE 1EH9A 1NJ9A 4NQXB 2X10A 1UJTA 4F37K 2NNAB 4ZUSB 4J8RA 2FH6A 1AD9B 3DNKA 1AKJD 5IVXF 3C8DA 4GAYA 2K3TA 3D39D 4XNUH 4QTIH 5C0ND 1NGYA 4NQEE 1KTDA 3U0WH 4OLXL 1TETH 1HSBA 3EW3B 4FQIL 1WICA 3DX7A 3I02A 5CMAA 2W9LA 3DVGA 1MEXL 5C6PB 3DX8A 4YQXL 3MLVL 5HI4C 3BKCL 3BXNA 4QRPE 5CEXB 4HFUH 2B5IB 5LXGL 2NY1D 4LIQL 3RWHA 2GJ6A 5E9DA 4FXLA 1IM3A 1TTFA 3MR9A 1SJHB 3OKLB 5H94A 3T0AA 3QXAA 4Q97A 2Z35A 2XACC 4HG4J 5CWSB 4XVSL 3G5VB 1CD0A 3VXUE 1QLEL 1KT2B 1JI2A 2X4OA 2YWZA 4GUPB 4J4PC 4YHZL 2OR9L 5IESH 5TH2A 2WUBL 1NJ9B 4NQXA 4O2FB 4YJZL 5TPWH 1CFSA 1ZS8B 5DJXA 5EZOH 2EEAA 1UYWL 4G6ML 4XCEB 1AKJB 3QO1A 4P2RB 5I16A 4MD5A 2XWTA 1RUAH 5B4MD 3RKDC 1TVHB 3FT4A 5I66A 1KFAL 1KLGB 1INDH 4EDWL 1U91B 1A6WH 5DJCB 4NWUL 5GGQH 1KB5A 3RWCB 1FAKT 4PJ5D 3VXOB 4RIRB 3UBXB 3R1GH 2EYTB 2WUCH 4Q58C 4U3XA 3P4MB 5DJ6A 1A1NB 1MFBL 4UIKL 1BQLL 3F7YB 5D7IB 5GGVH 4X7FC 2EDXA 4L4VA 4C54A 1NLDL 1Z6JT 3NA4A 2D7OA 3ARXA 3PNWB 3NFPA 1AJ7L 3PJSA 3BZ4A 4YAQB 4UTAH 4WFGD 1CICD 3BDBA 1OD9A 1PG7L 1DSFH 4PRBB 4WUKH 4BZ2L 2ZPKL 5GGSA 5D2NA 2UUDH 5DS8A 3NGBB 2VR4A 3QIUC 4JLRB 3PL6C 1C16B 4OZ4B 5FUZL 3GK8L 2HVJB 3F7QA 4Z95L 1ZLUK 4OF5A 5DRWA 4H26A 5EUOE 1DTUA 1QLFB 3P2TA 1OAKL 4IRSC 4Z7WB 3KPOA 1GGUA 2NY5H 4NOFA 1I4FA 4HIXL 2JB6B 3WKNA 5GISH 1DLFH 1CD1B 2H1PL 3QDGA 4HJJL 3WFBL 4IOFD 1NBVH 3FZUD 4CUCA 1U8IB 2WNGA 1T4KA 4LLDB 3PNWA 5EUOF 5CBEB 4WW2B 2HN7B 1MHHA 1IAMA 1N6UA 1NCWH 3IGAA 4CU8A 5AD0B 2ICWJ 2EIEA 3CZFA 2VDOL 4OCLC 1UWXK 2VC2L 2XTJD 3HE6A 4EI5A 2ZG2A 3GKWL 3V4UL 4K7PY 2F9BT 3HUJA 3FB8A 1MCPH 1KIQB 5DK0B 1S7XB 4F57L 4XC1H 3MV8D 3MOQA 4MA1B 2MWCA 5F1OB 1C16A 3UCRA 5EBWB 2ZCKL 3PV6A 4PRIA 4UT6H 3T8XB 3VI3F 4XCCH 3NVQA 1YDPA 4QTHB 3HNVL 3GUTB 2E7CA 4CKVX 2AJZA 3LRHA 1QLFA 3GSUA 4JM2F 4XAKD 1NGXA 4C59B 2EH8L 3P9MA 1LQSR 2EDRA 1HYSC 4QHUA 1ZLWK 4CU7A 5IFJA 3IFOA 3NCJH 1VKXB 2EC8A 2VZ1A 4TYUA 3TVMD 2IPUG 5CLWA 2PUQT 3GM8A 3CDCA 4NHCL 4EN3B 1CK0H 2JJTC 2CLRA 1R6VA 4I0PC 3EO1B 4Y7MA 2AJYL 3KJ4B 2P8PA 4M61B 4HIIB 3TM6A 1JRHI 4OGYL 3ZDZF 1IAOA 4KJPD 4JFOA 2E8YA 4EXKA 3FT3B 4FG6D 2XNAA 4R2GB 5D8JH 3FAXA 4JFDD 3ALWA 4XHQA 5FFLA 4H20L 1MIMH 3CFKB 1AGEB 3I6LD 3OJ2C 4N8VG 3FOMB 4JDZA 2BVEA 2EIDA 4O02H 4DCQB 4V1DB 2AABL 4WWKB 1G6RH 4HWNA 3FB5B 1W0VB 5I1IH 3QUMH 3H8NA 2D9QB 2CDGB 2DIJA 3W2DH 1Z5LA 3TBTB 4LLMA 3H2WA 2AEPH 5LCVH 5T1MA 5AYUH 1VKXA 2W9DL 4JGJA 4V2CB 3RFZC 1YY9C 4WIQA 3MGTA 1RIVH 2DMBA 2YBRB 4PREB 1BFOB 4OB5H 5KS9A 1U3HA 3C8HA 5EIQA 5C0GA 4NNXA 4M61A 4LRNL 3MJ8B 1IBGH 4XGZA 2RJMA 3PWLB 3MLTA 3QNXA 5FOJA 1IKFL 2R0LH 3I6KB 5KSVA 4R4BA 5IQ9B 4HIEA 1BBDL 4NKOB 4XPFL 5D5ME 5DVOA 1I85A 4R2GD 1OVZA 2EDTA 3RWIA 2F53E 3SDCB 4LOUD 3DOSA 3BGFB 5CHNA 3DXAA 1KN2H 1F97A 5ICZB 4MVBC 1UXSA 1MJ8L 1RVFL 1I8MA 5CJQL 1LO5A 1T21A 5IOPB 3B3IB 4WY7H 4LPTA 3V0AC 1B6UA 3NPSB 5DC0A 2XZCH 4LHUB 3VXRB 4LEOA 3NH7L 2ERJB 1I9IH 4PP2B 1MLCB 3BZEA 3CK0H 3WS3B 5HYSG 4LRIC 2X4NB 3CX2A 3EDDA 3NFNA 3L5IA 4RGND 3FO0L 2ADJB 5FUCC 3VFUB 3HZVB 1G7JB 1LO3L 3MLUH 1MI5B 1ZEAH 4YXKL 3VRIB 3QNXB 3KLHC 5IR1B 2ZUQC 4P2OD 2VQ1B 1EJ6A 3WFCH 1WWWX 1FFNA 2VLRB 5GRVK 1QYGH 4GQPH 4HWUA 2RBLA 1NCCH 4Z78B 4RQQB 4ZPTA 5F8RC 4K07A 5KVDH 2DN7A 1PGRB 1OTUC 4ZTPH 5INCA 4XC3H 2Y4SA 3RRQA 4OIBA 3W9DA 2DBLL 4ZXBD 3DROA 3EYUL 3DBXB 5HHVL 1QRNB 1XAUA 1ZLVK 4PB9H 2ITCB 4OSUH 3QXDB 5JORA 4W6XB 1MCOL 1S9VA 4FQHB 3HAEA 2FD6H 5C0CD 5EBMB 4K9EL 4P5TC 2PYEE 4PTTA 5L88L 5SWSA 3VFUA 2P5EE 4J3XA 4X7DC 4ZQKA 3VFOA 1RY7B 2FBJL 2WINB 3OKMB 5HHOB 4X9IA 2GUOB 4QXGH 2RHEA 2YRZA 5IR1A 4DJMA 3I75A 4D0BA 1EEYA 1EO8L 1P5VA 3DX6A 5L0QB 5H8DA 4N5ED 5BXFB 4CJ1A 3MJ9H 3ZKMC 5FDWA 1I8IA 3IDUA 4M62L 3QHZH 2J7LA 4H26B 3G6JE 2BXYA 3HI6L 3W9DB 5F93C 1ZAGA 4MCZA 4PB0L 4NBYB 2JELH 4RNRB 2D31A 3C5ZA 1ZK9A 3TJHD 5FCSH 4L3CB 1DZBA 1FNSL 5CLTA 4GAJH 2H8PA 1FV1A 1U8JA 4IOSD 2VLJB 2H32B 5JQ6H 2FNBA 4PJ8B 4N90D 4LSSL 2R4SL 4KUZH 5K9OA 4X7TB 2Y9RT 3QRGL 1JF1B 4JANA 1A6UL 3P73A 3RY6A 3TJEL 1IEAB 2PW2A 2YKLL 1BVLB 2VH5H 5EORH 3MRKB 1I3GL 1MRCL 3DX6B 2LU4A 3BUYB 1F4YH 3IVKA 1QSEB 3BJLA 4HAGA 4WFEE 1OAUL 4L3EA 3I50H 2ESVA 1KACB 3QFJD 5IP4A 4P46B 1YUHA 1T7VA 4X7SL 2X4RB 2J5LB 2I5YH 5GGRA 2PTVA 4AMKL 4JEGB 2PNDA 2CLVA 4JZJC 2OS7A 5GGRY 4G6KH 4PD4J 2HT2D 4PJBF 3G6DH 4ODSH 5TE4H 3EGSA 1WWBX 1CXEA 1F4XL 5HHXH 1ZA3B 2K1MA 4S2SB 2NNAA 4FQXB 1MIEH 4AH2B 3VI3E 4EDXA 3G6AA 3JVGA 2BVPB 4QRUA 1KIPA 3VG9B 3V5DB 1MCFA 4KY1H 1FYHB 1NSNH 4Y2DA 3SE8H 1RI8A 1R3JA 5I1JH 5DD0H 1GGBH 3NZHL 1EDQA 1T83C 1BVLA 4JFXA 1FE8L 5E5RB 5I17A 4OZIB 1OGAB 4BH7B 1UC6A 3ULUD 1R24A 3IRZA 3MMEB 5I1LB 2J8UA 5I30L 5CMAB 5BV7C 4NQDD 1P84J 1WIUA 4DCQA 4EXPX 1S8DB 4GXUM 4TSBL 2BERA 3QIBC 2IH1A 2YZ1A 5BQ7B 3QWQB 3O6ML 3UTQB 4MMXC 5FO8A 2NXYB 3CU1A 1QRKA 3C2AL 2Z91B 4JB9H 3F65A 4Y19A 5E5MB 3T65B 2RB8A 4MB5A 1TPXB 4KZEL 1I9RL 1NCAH 1BHGA 3KXFD 4PJHE 1QSVA 4PJGB 1BM3H 4AT6B 1CD8A 3CLFL 4PREA 5KS9B 3TC9A 5D1QD 1FZOB 4GSDL 4MNHA 5TH2B 3EJYC 3S4SA 4PJHB 1X5FA 2X1QA 4U7KA 5T5FH 2EDJA 2A9MH 5C3LD 2BVPA 4QRUB 2A6DB 1DE4A 4P2RE 5IT2L 1D5ZB 2EDQA 5EPMA 3GHBL 4L5FL 1C1EH 1I75A 4PGDA 3UZEA 1PY4A 2VZ3A 3MNWB 2HRPL 4DWHA 4NP4H 3MRHA 5EN2B 4ZXBC 3UPRA 4Z8FL 2AV1B 5DJCA 1N64L 1NGWA 1VHPA 2A2QT 3ARFC 4R7DB 2ZUYA 3RTQB 3ZDYE 4A2LA 3DI3B 2APBA 4UDUB 1Q0XL 1LO5B 5C0AB 5K9KA 1JHLL 3E2HB 1OGAE 2VZUA 1A7PL 5CEYB 3F5WA 4XXDB 3O3EA 4P3DB 5LAXA 3LPWA 2AJXL 1YEDB 2NQCA 3NFPB 3G5ZB 2CLZB 1MFDL 4PUBH 5TDNB 4RGOL 1HOCB 1U95A 3L3OA 4YAQA 3GSXB 4PJFE 3IAGC 1T03L 3BVNB 2DKMA 3FFCD 6FABL 4Q7DA 1G9NC 5I73C 4C57C 2BNQD 3FHAA 2HKHL 4PRBA 2D9CA 3ZE0E 4N0CC 3HG1A 1YYLL 4M5ZL 1W0YT 1YPZF 3WNLA 5DRXA 4KKLD 1JZ2A 1TZHA 4XBPA 4L4JA 4YUEL 2YN5A 4EUPA 4R4FH 5JZ7D 3DRTA 2Z93B 3ZL4L 3IXTA 1XGPA 3OB0K 4DQOH 3OKDA 3ZZ1A 4NQCE 4D3CL 3EAKA 1ZHBB 1MRFH 5KSAD 2YEZB 4MA3A 4GRWF 4R96A 5D96B 2CRIA 4OV6F 2UWEA 3OAYH 5GJSL 1D5BB 5BS0D 1CG9B 4OD2A 5IHLB 2NXZD 4D9RD 1HHIB 3V52H 4J3TA 1MREL 2X89D 1BQHB 5FECA 4POZC 1FQ9C 2NTSP 4X8XA 1AR1C 1F4WH 2CLZA 1D5MA 3H9ZA 5E00A 2AJVH 4MA1C 4L8DA 4NZRL 3RI5F 4EI6B 5D7JC 4IMLB 1BVKA 4PJDB 4PLOB 2CPCA 3SQOH 5IMMA 2XQBH 2AS5M 5BW7C 4HWEH 5J11B 1S5HA 3ROOB 3LHPH 2N4IA 2D7TL 3ZKND 4NWTH 4QXTB 1FH5L 1QSFD 2VITB 5GPRA 1WBXB 3N50A 3QDJE 5DJYB 2K7QA 4M7LH 2IANB 1WFOA 3BI9X 4NRXA 2IQAA 4JM4L 1T0NB 4R0LA 2R8SL 3DX7B 2WIIB 4HIJB 3ARRA 3QUZA 4OLWL 1Q9LB 1EAJA 1UH3A 4H88L 4DW2L 5DEFA 3U9UB 1BQHA 3BISA 4A6YL 3DUSB 1IGTB 2XYCA 3ISWA 4N0YH 4YHYB 3MUGB 3IKCB 4Y4KB 2BNUA 3CSPA 3CLEL 2Q76B 4MVBD 4L29A 5K9QI 4I0PD 4LOUC 4YK4C 3HC0A 4GJTB 3VGDA 4FQ2H 2AK4E 1UT9A 1IEAA 3WFHB 3C6SB 5C6TH 3S5LA 1JE6A 4RA0C 4NKMA 1JTTA 3IDXL 4Z7VB 1UEYA 2DTMH 2EXWD 2YA0A 4I3GA 4MX7A 3D3VA 5MI0B 1IAIH 1MRDL 4K71C 1U8NA 3FOLA 3HC4H 4YHOL 1KB5B 4MAYA 4ENED 5EOCJ 1KYOJ 5E8DL 4PJ7F 3SE9L 3E2HC 1HQRB 4UILH 1G9MH 3O2WH 5D7IA 1MVUA 5FM5O 3ARFB 4YH6A 3PJSB 1CZ8H 4LLUB 1J5OL 5CEZL 4XBGB 5E6ID 4JHZA 3FZUC 1Z9OA 2ZJSL 4XVTL 4KKLC 5D1ZD 1Q1JL 2Z8RA 1QNZH 4LLVB 5A43C 4FQPA 1NKOA 5DHVA 2JB5L 3RKPA 1HCVA 3M1BB 1AXSB 3E0GA 2I26N 2BNRB 2R0ZH 5C08E 3L5JA 2NY0C 1MCQA 1FORL 2MHAA 4G42B 4Z7UF 1NDMA 3ES6B 5BJTB 2CIIB 2J8UB 4N0RA 1GH7A 1H3XA 3O3AB 3MODH 1CU4L 1MCIA 5DRZB 3WCYA 3CDGB 2VDPH 1GPOL 4GMTH 3D87B 5EO0A 3ARED 4OZHF 1YECL 4QHMB 4KQ3H 3WEXB 4JQVC 2QSCH 4UQ3B 4UNTA 5I9QB 2X4SA 1NMAL 3ZTJH 2J8OA 4Y16A 5DZLA 1J0ZA 3U0PB 2YUZA 4F33B 4LBEB 1SJEA 3GMRB 4AL8H 3L3DB 2VQ1A 1BBJB 2KBGA 5EC2B 4NQCD 5T3ZH 5DD6A 5F3BA 3OPZH 3QIUB 4O58L 4GRMA 2CO7B 3TWCL 4PJ5B 1PEZA 1U36A 3C6LD 5SV3A 4PBVC 3TO4D 1Q9OB 4QGYA 2NX5E 4J2XA 2XA8H 3JV4A 4JFDA 3RWFA 3IU4L 1DN0B 2BNRA 3DSNA 1JNJA 3S37L 3OAZK 3RNQB 1DJSA 4QWWD 2ZG3A 1P6FA 1VCAA 3P9MB 4I48B 1OTUD 1P7HL 1N0LA 1R3IL 1A7OH 5KJRL 2NX5B 4XMKH 3CCHB 1FFPA 3MSPA 1OHQA 3HN3A 2VWEC 1BD2D 4PJCA 1Q0YH 2YK1H 1GIGL 1LD9B 1RZGB 4ONHA 4RMTA 1X5KA 4ZUWA 3OR7A 1PG7X 4J3WA 3OXSA 3FHQA 4XX1G 2AEQL 5T1LD 4CW1B 3EYSL 3CFEA 5CILL 3SGKA 4X6FA 3IJSA 3U1SH 4MDIB 2A77H 1AFVH 3LEYH 3WFEH 5I6XC 4PJ5A 2D0FA 5DRXB 1YC8A 4S1RH 4K8RC 5D7LE 3TO4B 3FOMA 3O3BB 4OLZH 2IAMB 4HIHA 4U0RB 4D0DA 4HK3N 4M6MH 2V7HA 4TNWK 5C6WH 4I3RH 4ZYKB 1XGTB 1T3FA 5IG7B 2F5AH 3VA2C 5ACLA 5I2IA 3QHFH 2VISA 4TVPL 4OFVA 2NY2B 2DS4A 1JGLL 5DTFB 1XZ0B 1FFPB 5JR1L 4MDJB 1E6JH 3TT1L 3HPJA 1QRND 2H26B 3SDAB 1XCQA 5GS0L 3OR7B 1F6AB 1MSPA 5ILTL 3DSFL 3UDWA 3BRFA 4AENB 2QQLL 4N1EA 1YMMB 3HUJE 4O51A 2PYFB 1JIBA 2W60A 3VG0L 2YUVA 3I84A 1GZQA 4BUHA 2CKBL 3H42H 1Z9LA 1P7QD 2FIRT 5JW4N 3H3PH 1AGFA 1YEIH 2Y7QB 5DYOA 4E42B 1IGFH 3RA7H 5L2JB 4JO4L 3V5KA 2Y6SC 4HKZA 4JFFB 3QJHA 3HC3L 1OQXA 5FO7A 3S5LG 1OD7A 2XPGA 3Q1SH 3T2OA 3S96A 4Z7VE 1I1AC 1A7RL 4G9FA 4G8IB 5I74C 4APQA 2ZSWB 1DR9A 4OZIF 3VFSB 4I9WE 4JKPL 2A0LC 5I1CL 4PG2A 4PP2A 5IB1A 4HBCL 4FFZH 1VB9A 4LSQL 4X4XA 5DTFA 1TFHA 2FB4L 2X4NA 4WHYG 5KN5B 1GVIA 3P77B 3ARSA 1EHAA 4DZBB 1FYTD 1CFSB 4OLYL 2KL6A 3K0WA 4PP1C 4CU6A 4R7NB 3LQAH 3O9WA 4U1LB 3WFZA 4RCAA 1VDGA 4X6EA 4FQLL 1H0DB 2ICCA 3FMGL 3L1OL 1YMMA 4L1HA 2E9BA 3RNKA 1YMMD 3NPZB 3BW9B 1H3VA 1GZQB 3GSNH 5E2WL 1UWGH 2XN9D 2DQHL 2CRMA 1NEZA 2I07A 2SEBB 4BFIA 2GCYB 4PGCA 5EZJB 2VL4A 1U3YA 3S5LB 2VDLH 1FN4B 5FKPB 1DBBH 3F7YA 5KOVC 1TCRA 1R3KA 2IJ0C 3MROA 2FECL 4UAOB 4FFVD 4YC2C 4APQB 4L9LB 1OP5H 5HYSB 5F9JB 1S5IH 3BZ4B 3IDNA 5JW4R 1BWWA 4CVXB 1C5BL 2JCCA 2EYSB 3S36H 1Y6NR 5L6YL 3QG6B 2B4CC 3V5HA 1QKZH 3LQMA 4MCYB 5GGSB 4HS3A 2WP3O 3DMMB 4E5XB 4S1SH 4M93B 1FC1A 4LF3A 1F02I 4M7JL 3FQXB 4EOWH 4IEFB 2G5RA 1FZMB 1CXLA 1KELH 5CS7A 1MJ7H 4DN4H 1JWUB 4C58B 1HN1A 2XRAL 2KDGA 1JGDB 3KPOB 1JMZA 3VFGL 3BE1H 3VH8A 3PWJB 1GOHA 3VXPB 5T1KA 3SBWA 4UV4H 5C2BL 4X4ME 1PEWA 1U3ZA 2ED9A 3GSOB 3LIZH 1MAML 5IBTH 5KVGH 3PQYD 4NZTH 2P4AB 3V9FA 2HFGL 2QSQA 1PSKH 3C5ZB 5EOQL 1KEGL 4UIMB 1I8LA 1VEOA 2JCCB 5D5MA 3VFPA 4GRWB 3GMMA 1HHKB 1QFWL 2QQKH 1ZE3C 2UY7A 4QRSA 2UZYB 2ENYA 2HJKB 4GT7A 5E2JA 2DAVA 1AGDB 4LBEA 4E5XA 5EBLA 1P9MA 1R5WB 3RAJL 4RFOL 1AXTL 1JGUL 3FCTA 3KS0H 3QIWB 3SDAC 4Z7OF 4LLYA 1EK3A 2BVUA 1G9NH 4JPVL 4QTHA 3IKKA 5C0RL 1B4RA 4JANB 4R2GC 5EC2A 5D1QB 3OXRB 2QEJA 1C12B 4YWGH 3WDIA 3E6HA 2FZ3B 1NGYB 5DUMH 2JKXA 3EOBB 3BZFB 2GJJA 1T1ZA 5HHQA 4L4TA 3RWFB 5TJWK 1QFOA 2VSCA 3VXTA 4K3HA 4YHPA 4DGVH 3RWHB 2F74A 1IM3B 5ALCH 1D5MB 4MHHG 2V5RA 1CBVL 1MPAL 1MCWM 3TV3L 4UIMA 2HWZL 1RZ8A 4ODHH 3B6SA 2P48B 4IM8A 4RDQG 3EGSB 1BVZA 5E24E 3B2UC 3GO1H 4MXWH 5BO1H 1JHKL 5IGXL 3C08H 5A2LH 1JZ6A 3TZVC 1X6NA 2CDFB 5TF1H 2CMRL 4P57A 1V05A 4QRRD 2A6KA 4XT1C 3GJFH 5DUPH 3D9AH 5DMJB 2BNQB 3MJ6A 3HAEH 5E5UB 2VDNH 2VKXA 1NCDL 2ZZUT 2GQHA 3NFSL 4HQQH 4XWGL 1L7TH 2IQAB 2UZIL 1OF2B 3V6OE 1MLBB 4MSWA 2OX5A 4QRRE 3O0RH 3ULUE 1AP2A 1KGCE 4X6CA 5EZIL 3BPLB 4K3DH 4U6XB 5E2TL 4WW1B 4PRAA 3PHOB 4BUGA 3H0TA 3HTLX 1IC1A 2NY4D 4K8RL 2F54A 1P69B 1EX0A 4ZAKA 1OSPH 5ESVB 3UTZA 5IMLA 3KLAA 3O2DA 3ROLA 2VLJE 2J6EA 1QSED 4YPGA 1K2DA 3SKUD 5JA8B 3K1DA 4P4KC 3O4LD 1KCKA 1FGNL 4UV7L 1XCQB 4JFQA 2BOBB 4NZDA 2HAZA 4LEXH 4HUUB 2HLAA 1K4DA 4Z0XA 1O0VA 4KDTC 3AB0C 4KVCL 1Q94A 4X6BA 1J0IA 2IEPA 1JNHA 3QUMB 1UZ8A 5EUOA 3FONB 3QG7H 5EPMB 1DANU 1TPXC 2QV2A 1J87A 4YEEA 1NAKH 3WXVH 3P30H 2CIKA 1B6DA 1GC1C 3IDGB 5C09A 4U2YA 5TE6L 4OJFH 1OAZL 1KCLA 1BFSA 4KV5F 4QNPF 5GS0D 4LKXB 3BPCB 4QRTA 2OLDA 2O5ZH 2FYYA 2NY0B 1FO0H 3LD8C 3TZVD 3M8OH 3NN8B 1BWMA 4Q9CA 5LBSL 1R0AL 3MLRH 4LNRB 5IB1B 1HCFX 3ABZA 1CD9B 4KC3B 4DKDC 3OAUH 2Y5TB 3QUYB 1M6OA 3ILPB 4X98A 4G5ZL 3V4VH 3G9VA 2DBJA 4LVNC 3MRNB 3WYRA 3CH1A 3BDYH 5IMOA 5I1GL 2O93L 3BPNC 4YX2H 1J0YA 5E6ZA 1A64A 3CD4A 1CT8B 1I3RB 4NC1E 3MLXH 1FVCA 1N2RB 1MAJA 1T66D 5ID1A 2AJUH 4LVNB 1BQSA 3IDMB 4G8EA 5IEKA 4U1GB 2IPTH 4PY8I 5I71C 1HYSD 1N3NB 3LCYA 5JW5B 2DIBA 5FOBB 2XWJB 2ID5A 3O3AA 1ZLVH 3CVHL 2VO5A 3ARDD 4LU5H 1IM9A 3HZYB 5F3HB 2L4OA 1TCRB 4KK6D 2B20A 5DHXB 3WN5A 1OCWH 5CINH 3VWJD 1D5BA 1AQDA 4ONFH 1MCDA 4L8BB 1LDSA 2B1HL 3GSNB 3LRSB 5B3JE 5ENWA 1U58A 2D7QA 1MCHA 1RUPH 4RISH 2W0PA 3FFDB 4KI5F 3HFML 1CXHA 2XZQH 5DD1H 1QFWM 5DJ2B 1WBZB 1J8HD 2NY4C 4ELKB 3RX7A 4YHYC 2DDQH 2GY7B 1BZQK 2NY6C 5BXFA 1G9MC 3LZFH 2D7NA 3IJHA 2PW1A 3VXRE 4U1JB 3NA9H 4C56E 4TTDD 1G7HA 3HE7D 4PV8A 1KSRA 3T1FB 1CF8L 5HHNB 2M26A 3H9SD 3VMOA 2HFEB 3ARBB 3DRQB 4NRXB 3T0EC 2UVEA 5FF6B 3EO9H 3O3DA 1OB1A 1YEKL 3GIVA 4TUJA 2D4DA 1IJ9A 5D71H 5GS0C 5BS0A 1RURL 5C9KA 1Y18B 3BH8A 3DYPA 1A4KB 4WI3A 4DZ8B 1CICB 1DBJL 1VENA 1JF1A 4XGZB 2H2SD 5T33H 1F11B 3MOBL 1CDIA 1J05B 1ZSDB 4LPCA 1MI5E 2YC1B 1NUDA 4XVJL 4R97B 4WDIB 3Q6GH 1KNOA 3GBNH 3HB3C 1S7RA 4OIIH 4A6YB 5D6DA 4OQTA 2PR4H 5AYQA 3D18A 3HRZB 4K9EC 1K8IB 1MQKH 1S7VB 4XMPL 4YHNA 4MA7H 3BP6B 3TA3A 3WFHA 2GK2A 3ZYJA 4W4OC 3E6HB 4D2NA 2VXUL 5L2KD 1FFRA 1CLOL 3FB7B 4EKXA 4I0KA 5GRYA 2MTPA 4KQ4L 4TVSa 3SGDI 1N5YH 4DOHB 2G60L 4LVOC 1RD6A 3UTSA 4WFFD 1WLHA 3EOAB 2E9IA 3RX8A 2IANE 2DM3A 1K4CB 2D03H 1U8MB 3T2NH 3V2AR 5DJ8B 2BSRA 5IWLA 3C87A 3DMMC 4OZGB 5IHZB 4QHKJ 5E99H 4K8RD 1ZSDA 4LARL 4FZEL 1WVZA 4GMSL 5C07D 4DTGL 1A9BB 4FABH 2DLFH 3B2VL 3KJ6L 4LLUA 2BCKA 1NAMB 4PS4L 3MNVB 1M1SA 2I27N 2P24A 2DM2A 4P5KB 5DO2D 1UG9A 4QO1A 2YA2A 5FYJD 4KHXL 5IHUH 4WFHE 2NLJB 4BZ1L 3KR3H 1TTGA 1X5JA 4JGUA 2EDHA 4Y4KD 2ATPB 3I6LE 4U33A 2C3VA 2ITCA 3U82B 1SBSH 5I8KH 4OV5A 4QWWC 5IW1B 3L95B 4JN1L 2X5PA 3H0TB 4S0TD 2C3HA 2DM4A 2JLLA 1KTLB 4Y19E 1RJCA 2NY2D 4R7NA 3LB6D 4PGJA 4WI5A 1BD2A 2I9LB 4OCSL 1XR9A 5LKNA 4AEIL 4G8GA 1NGPL 1EEYB 1V7ML 2V9QA 4PY8J 1FGVL 5E03A 2UZXB 2XIDA 3FQNA 3TFKD 4LASL 4EZMA 3ARBC 3AY4C 1FN4A 3MXVL 5SV4A 3MBEC 5C7XL 2CIKB 4DGYH 3U4AA 5CSBA 4G6JH 5E8NB 3KPMA 3TNMB 1N6QH 1CFVH 3C9NA 5HGDA 1OTTC 4ZPVB 2AJ3B 1KPUB 2R39A 3BVNA 3MLWH 5CZKA 3QULB 4NCC2 3QG6A 2WIMA 3TPKA 4U0QB 2IALB 4MA8L 1J12A 1LE9A 1KB5H 4JM2C 3HE7C 4LF3B 5E1HB 1I8KA 1H5BC 3MYZA 4HPYL 4GAYB 2I9LA 2ZKHH 5AG9A 4NO3B 5CJ8A 1CVSC 2FBOJ 4CW1A 4JKKA 2Z31D 3RPIB 3WL9B 3H9HA 4AG4H 3LKOA 3NIGE 2W07A 3ZDZE 2AJSH 5DR5H 2VXQH 4UBDD 4BSWB 4XNQB 1FYTE 3OJMB 1ORSA 1JPGB 4CVZA 3UPCA 3SKMA 2C1OA 4RGNB 1UA6L 2GJ6E 3VJ6B 1MH5B 1JZ4A 3WLBB 5BVJA 2N7AA 4MQTB 2AJ3A 4DVRL 3NTCL 2HVKB 2ICWI 4XI5D 1XZ0A 5JW3L 1HZHL 5AZ2L 3VA6A 3AREA 4UB0L 4M1DL 3S98A 3OKOB 3QUKB 4LGPB 4ZFFA 2IPUK 3G6AB 5A3IC 2OP4L 5J1AA 4LPXA 2WLZA 3PGCB 2V5TA 1MY5A 3C09C 5D1QA 2A9NH 3T1WA 3DGGB 3IS1X 4JVPA 5IEHA 3NAAH 4J3SA 2R1YB 1RK0A 2D7MA 5JO5B 3A6BH 1KULA 1OL0A 1Q9LA 2B1AH 3UJTL 3MBEA 1A7NL 3WNKA 3DURA 3ZTNL 1A21A 1DFBH 3BH9A 4NNPH 3A6CH 5E4EC 3ARBA 4X4ZA 3IXAB 1FIEA 4YXHL 1LO4H 3MV8B 1MFNA 4KROB 2P5WD 2YD7A 5HHOD 3O11A 4X5LA 1CXIA 4AT6A 4YZFE 3S35H 5HVGB 5HJ3B 2DL2A 4JRYD 1QSEE 2CJUH 4ZUVB 5KN5A 1E4KC 4LGSB 3X3GL 4DN3H 1JFQH 4GAFB 2I9TB 2XWBB 3C5ZD 4HUWA 1J05A 3MRMB 1J8KA 1MCWW 3INUL 4JCLA 4WHDA 3BPLC 1PZ5A 2DQCL 4ZSOE 4MX7B 3MNWA 2X09A 3WE6B 2PO6C 2RCSL 4JQIH 4QRPB 1FVEB 4JQXC 1T2JA 1I4FB 3FT2B 4CL7A 1UH2A 5KW9L 3CGTA 2Y36L 4X6CB 3T77A 3MO1B 2GCYA 4PGCB 5EZJA 3FB7A 2X9WA 5LWYH 4OQTH 4M02A 1TVDA 2X4UB 2NY3C 5C0CA 4LFHG 5ESQB 2WBJD 4NO2B 2VXVL 5FO9B 1MFCL 2BY2A 5CGTA 4GRWH 3EOAA 3MV7E 5JHDA 1MVFA 1K2DB 3MCLL 3BDXA 3SY0A 3BGMA 3LKQA 4J3OC 1CI5A 7CGTA 1U6AH 4LLVA 3OB8A 2CK0L 3DMMA 2OK0H 1G7PB 5D9SA 1A5FL 3CFIC 5TE7H 4G42A 2MHAB 1VEMA 3GI8H 4GO6B 4QEGA 4RWYH 3X3FH 1PYWA 1KCUH 4ZODA 3UJJL 3VD5A 5A16B 4KJYB 2YPVL 1SY6H 4P46D 4LFHD 4HJ0C 5F7WC 4X4MA 2YMXH 2C1PA 4P2OA 2P8MA 3MRGB 1KN4L 3BJ91 1KXVC 1QSFA 1GC1L 2BVQB 4FQJH 4JFZH 3ARPA 3DI2B 3TBWB 5FA3B 3TA3C 1ZHNB 4HUNB 2HG5A 3K3QA 1SJEB 3EJZD 3RDTA 1JYNA 4OF6A 3Q3GB 3I9GH 4O9HH 1TQBB 3N1GC 1G1CA 4HKBA 1P4IL 5DURB 4AIXA 2F19L 1UKSA 4X98B 4IMLA 1NDGA 4LCCB 1ZXQA 2J4WL 1MHPH 1YZZA 5HXMA 3E8UL 2Q8BL 4Y1AD 1B2WH 4JFYA 4LSPH 1LEIA 3QDMA 4OLEA 2FX7L 3RUGA 2FX8L 2VLLA 4OFIA 4V1DA 5ADPH 4YXLL 4APQD 2JJSA 1O7VA 3KGRA 5GJTH 4TRPL 1F13A 1R5VA 4HLZH 2B8OT 4GW5B 4KKBD 1RUKH 1AD0A 4WGWB 1B4JH 1GAFH 1IGJB 5CBAB 2DMCA 1I1CA 4Z7OE 2C1PB 4P2OB 5J7CC 4ONOA 5I71B 2DI9A 1RPQA 1N8ZB 2VLRD 3IFLL 4HCRH 4AK1A 4NQSB 1LK2B 1MWAL 2ZCHH 4NSKB 5EU4A 4RMSA 3T0VA 3TIDA 5CSZA 3QEQA 3C9NB 1KPUA 4WEBH 3V0WL 3Q48A 3QXUA 3MLZH 2NY0D 3IT8D 3SCMA 4ELKA 3B9VA 3GI9H 1YEGH 4OAWB 4MJ6A 3AS2A 4PJCE 3CUPB 5CZXC 3MRJA 5MEQB 5IW3A 4PJAA 4C4KO 2ORBL 3BIKB 1VFBA 4NO3A 5F44A 5DRNA 1U93B 1VGEL 2V7HB 4Z9KB 3SKNB 2DQJH 3W82A 4TNWF 1XGQA 4Y4FB 4QYOA 3U46A 1T04A 3NBNA 2OR8A 4GW5A 2FHBA 1P7KA 3GSVB 2YXMA 4ZFOL 1KCVL 1D6EB 2IFFL 4M6OL 1QZ1A 4PJIF 3MOAH 3UTTE 3THMH 1RZJL 2E6PA 4ENEC 1P2CA 4UT9H 1QFUL 1KJ2B 2BXZA 5E2UH 3U9PL 4KI1A 3BH8B 5I1HH 3ZT7A 4RFNB 4Y1AE 5KG9B 1QBML 5EUKB 1A6VH 3PGFL 1HKLL 3W11C 3RZCD 3Q5TA 1ACYL 1CR9H 2W9EH 2GFBA 3MX0A 4NKIL 3LPGA 3QIWC 1UWXH 4QNPE 3ULUH 3HNSL 1CGSH 3QUKA 3FO2B 4POUB 4AEHL 4PJ5E 3QXVA 1IC7L 1I7ZB 3PGCA 3OKKA 5FO7B 5IQ7L 4PJFF 2X1PA 4XNMB 4LDOB 5F7EL 4K23H 2R0KH 3B8SA 1L6XA 1DQDL 1RMFH 1RJYB 2VZVA 4ZFGH 3C6LA 3VFSA 3RDTC 4QKXB 3QCTL 1QQDB 2D4FA 3RIFF 4A2MA 1VPOL 2QR0B 5FGBC 1ZT4A 3TLRA 1PLGL 5E9DB 1DUZB 1SJHA 3MFFA 3SHSA 4KDTA 4TULH 5JPMA 3PP3H 3OKMA 5HHOA 4NM8L 3MNZB 3U7AA 3DHJA 3UO1L 4DAGH 1DDHA 2NW3B 3VXMD 3DIFB 4D0BB 3K46A 1BLNA 1WAAE 4M93C 3MTRA 3FO1B 5FB8B 1MHEB 3KYKH 4J7RA 4UNUA 4E0RA 3CMOH 3MBXL 3BEVA 1DCLA 2CK2A 4XNYL 2IAND 4NJ9L 3PDGA 1O5DT 3KXFA 2ZWLT 1ITBB 3B9AA 3BP7A 1PZ5B 5DWUH 5E08L 3TH2T 4L9LA 3U7WL 1F3RB 2W91A 5JXAL 5EO1B 2O5YL 3RWCA 5E8EB 1CXFA 1FO0A 1RK1A 4X80H 5IVXA 2PO6B 1C08B 5CP7B 4S11A 3MO1A 5F1IA 5LQBH 2H8PB 1UZ6F 1NGZA 3HZYA 5F3HA 4IMKA 5DGRA 1NCUA 3GMLA 3U30C 2IADB 1DUZA 3WJLA 1UB5A 4Y4HC 4JQXA 1S3KL 4JPWL 1PX4A 1IGIL 1YEHL 3D39B 4P0DA 2DQIL 5I8OH 1NLDH 1OTSC 3SPVB 2DQGH 4OIAA 1HEZB 4WU5B 4WUUE 4OCWH 1A7QH 3Q6FB 3R06A 2NCMA 3CSGA 5KAQF 4HWZB 1JRHL 1MHEA 2NXYD 1M71B 4MGXA 1E4KA 2PN5A 3GMPB 4P4RA 1NCBH 1PG7H 2DYPD 3KXFB 1WZKA 3DO3A 5EIIB 1BREA 1WSST 4WTWA 2DQUH 5F1SA 1VFAA 5H35A 3KVQA 3QUYD 5GRUH 3ULVH 5J06A 4PYHA 4KMTH 1V7NH 1HIML 4KRPD 1LP9B 1YPZA 4WO4D 1UM6L 1ZA3A 4WUUA 4JDTL 2GW5A 2HG5B 4MDJA 1FL6A 2ZUSA 1NC4D 3ME0A 4AH2A 1NCNA 4Y0GA 3RZWA 3SDAA 4P48A 4XTRC 4NZUL 3BQUC 1BF8A 2OZ4A 2YC1A 5DLMH 3RPIA 4EI5B 5BZDA 2J88H 3NABL 3P3YA 3VD4A 4BYHA 1GZPA 4WV1C 2V5SA 3MMEA 5BZWB 4A6YA 4UOJA 4QXUH 4PJDE 1YEFL 4XI5C 1TENA 3FFCB 1A9EA 3O6KH 1PD6A 4UOW0 5F9WB 4W68A 3LS5H 3S88L 1A47A 1NGXB 3AU1B 2F74B 2OXGA 2VLMD 3JWNC 2ZCKH 4ERSH 5I1KL 4HPOL 1A4JA 2ZSWA 1P84K 3FJTA 5EU3B 1J8HB 3MLSH 4X8JB 4AEEA 4NBZB 3QEQD 4MNHB 3S4SB 3N1QC 4E41D 5KSAB 5CKAA 4NHCH 2GK0A 3G9AB 2JCCE 3HE7B 1XGUA 3WD5L 4N8VA 2V2TA 3D0VB 2WP3T 1A22B 2NZ9C 1H5BA 4UU9A 5EWIL 1NQBA 2DQTL 3CUPA 3L5HA 1MNUH 4BFEA 2X44D 1LDPL 4IRJD 3N0PB 4ZTOH 1GJIA 3B9KC 2Z92B 2HMID 3S37X 1RK0B 1CE1L 1J1XL 4OM1H 2ATKA 5C0AA 5K9KB 3BXNB 2JCCF 4U6XA 1W0VA 5IUSA 4LQFL 5GHWL 4JFDE 2G75A 1DVFD 3L3KA 3ALXA 4OCXH 3ALPA 5F9JA 2WWMC 5TDOB 3WO4C 3KPRE 5A3ID 3QZWB 3LKPB 4ZOCA 2X9XA 1C8PA 2BP3A 4GRLA 2BOCB 3TYGL 4Q6IB 2CR6A 5D1XB 3AY4A 3U79A 4WJ5A 4OV5B 1FFOA 4FA8A 4E41B 2GAZA 2WBWB 4HIEB 1KBGH 3BP5A 3GIZL 2EKSB 1FG2B 5I19H 3EUUA 5EU6D 4R26H 4XPAH 1U91A 2IAMD 3IJYB 4GS7B 1IKFH 4FMFA 4QRPA 4XP9H 3DXAB 3TN0A 4M43H 3P4NA 3RI5K 1OARH 1T5WB 3T77B 4KXZI 3QB7C 3L5WB 4D9QD 4N90E 2BC4A 5BMFH 4GXVH 4IDJL 2KQMA 4NUJB 3ZTJG 5C07B 3VFWA 4HGWB 1XH3B 3EZ8A 5FO9A 1ZT4B 3CFCL 4YHMH 3ZMRA 3KPPA 2ADJA 3IETB 4HWBA 3SDXE 1AC0A 4TSCH 1ORQB 2DOCA 1NFIB 4XVUC 3S3PA 1Q9KB 1ZT7A 3ZDXE 1EZVY 4HUVB 1OM3L 5F88A 3RPKA 3FCTB 4XCFL 4TOYH 2E9WA 3QDME 4KPHH 3UC0L 3K1KC 3KPSB 3HR5A 1QPXA 4WU7B 1SM3H 1SVZA 2AEIT 3H9SA 3OX8A 4OD3H 1CICC 2O26U 4N0UE 1KEML 3UTTA 3LN9A 4U1KB 3BEVB 2WMPA 1T1ZB 2YBRA 1U8PA 4LCWD 1LEGA 1P4LA 2P5ED 3VXSE 4K3EL 1PW3A 3L3HA 4DK3A 3DBXA 4LLDA 1INQA 5B8CB 4M5YL 1AXIB 5C70A 2APTA 1CGVA 2WM0A 3CVIH 4K2UL 1FYTB 4GLRH 4OBSA 2ADFL 3O4OC 5I76A 3EJYD 4W4OA 1WBZA 4S1DD 3B6SB 1GHFL 3FQUB 2BNRD 4M8QB 1GYAA 2ADGB 2G2RB 4NN5B 4LSTL 1DBAL 5A40E 1MCOH 1RUQH 1N26A 5D6DC 4IS6A 1JPSL 4M7KL 4UDTA 1S7QB 1R3HA 5MP6H 4P2QD 5EA0H 4NQVB 1KTKE 4L8SC 3O41B 5FUCE 2AJZB 2LVCA 5DQ9B 5T3ZE 5CJOL 1XF5B 3EOTH 2HTLC 2V7NA 3ZYIA 4LSVH 3WFDL 2F8OA 4J4PD 3QI9A 1E4XL 2VXSH 5IFJB 1JGEA 2G5BA 1RZJC 5T1LA 3GIVB 4NO0A 3QEQE 3CU7A 1E0OB 3MJ7B 5HGHB 5ANMA 4L4VE 4Y8AA 2NY1C 4XPGH 1YEEH 3X12A 1YN6A 2XY2A 1I1RA 4IRZL 1E6OH 5F21B 1NMBL 1WCQA 2MQ0A 2FGZA 4H0GA 4LHJB 4K7FA 3Q0HA 4E9LA 2ADGA 4Z78A 4FNLH 3JV0A 5K9OB 1AD9A 3CFKA 4I3SH 4PBXA 1KENH 3QYCA 2ZUWA 1SYSA 3BPNB 4JREB 1VADB 3HRZA 3LH2H 1ZKAA 5D7JB 2XICA 3L3IA 3O2VH 1AXSA 3IAPA 4IBLT 5JPNB 1BFVH 1T2QH 1UZ8B 4DKEH 3VI4F 4YZFF 1JNNH 1T04B 3ARZA 3TJEH 4DGIL 5DQDL 5IJVB 1Z5LB 3RU8L 1DQMH 3PQYB 4XPBL 2A6JA 1NLBH 2WWMD 5T1LB 2IGFH 1CQYA 3VWJC 4PLJD 5J13B 1K4CA 3TPUA 4OQ1A 4H25B 2BJML 2Y5EA 5FYKU 3CXDH 4G8GD 5C0DA <