3HR6A

Structure of the corynebacterium diphtheriae major pilin spaa points to a modular pilus assembly stabilizing isopeptide bonds
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
431
structure length
420
Chain Sequence
RTSIAVHALMGLPTGGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVVQELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALSEPVKTAVDPDATQPGFSVGENVKYRVATKIPEIASNTKFEGFTVADKLPAELGKPDTNKITVTLGGKPINSTDVSVQTYQVGDRTVLSVQLAGATLQSLDQHKDQELVVEFEAPVTKQPENGQLDNQAWVLPSNPTAQWDPEESGDAALRGMPSSRVSSKFGQITIEKSFDGNTPGADRTATFQLHRCEADGSLVKSDPPISLDGKQEFVTGQDGKAVLSGIHLGTLQLESNVMKYTDAWAGKGTEFCLVETATASGYELLPKPVIVKLEANESTNVLVEQKVKIDNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein, cell adhesion
molecule keywords Putative surface-anchored fimbrial subunit
publication title The Corynebacterium diphtheriae shaft pilin SpaA is built of tandem Ig-like modules with stabilizing isopeptide and disulfide bonds
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 94
structure length 420
sequence length 431
ec nomenclature
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hr6A02
4QHNA 3QI9A 4D3CL 1S7RA 1CS6A 5DJ8B 5H2BB 3GUTB 2IBGA 3HKFA 2E9BA 4YGVB 4H26B 3VRIA 3FO9A 2EZ0C 1BECA 3BZDA 2NY4B 4F37F 1I7RB 3HCVB 1IGCH 3GHBH 1DSFL 1G6VK 1Q94A 3L3HA 3QUXB 4PLKC 1FGVL 5JNYA 3FT2A 5KSVA 2V17L 1MCOL 2XT1B 2DQTL 4MJ6A 4MWFA 2IGFH 3TT1H 4FQ2L 3QWOA 4JZNB 3OZ9L 4X9FA 3SPVA 5IB4A 1Y0LA 2IEPA 2WINA 2W9EL 4YHPA 2F15A 3CDYA 4I18C 4F15B 4KJYA 1ONQA 5I1LA 2DLTA 1KG0A 4XCYB 2D31B 4FRWA 1VFAB 1ZLSH 5GSVA 3ZE2F 4DZBA 1XCTB 2WIIA 3UTTB 2FX9L 2GCYB 1BBDH 3VCLA 1U2HA 1RSFA 5C7XH 1ZANH 1LDPH 25C8L 5DA0B 3CJJA 3QQ3B 4XCFL 5DK2A 1J8KA 1T7XA 2F53E 4XNMB 3BSZH 1RMFH 4RZCA 3U0PB 3RL1B 2HFTA 3OKLB 4AG4H 2LAAA 1UFUA 2I60L 4ZPVA 5K9OA 1R5WB 2A6IA 2NY7L 5KVEL 4CVUA 1B6UA 4NKIH 1MJJA 2PW2B 5ESAB 5C0CE 3RNQB 3M17A 3TO4B 1RVFL 4MQXC 2X4NA 3KYOB 3GIZH 4PRPA 3MRFB 1XF1A 5I1GL 3GSRA 3SY0B 4I9WD 4M43L 4KRNA 4HUVA 3QZWA 4TN9A 2ITDB 3B9KB 5DURD 4PJ9A 4I2XB 5JIKA 2XWJB 4ONFL 1C5DA 1N26A 3GMOB 4JPWH 5DJZB 4U6HB 1KPVB 3PWUA 1P1ZB 4LIQH 4TSAH 3NBNA 1IGYA 3FFCA 3ZKMD 3NABL 2AJZB 3BHBA 3KDMA 2GIYA 3MCLL 3JV6B 3JWOH 4Y8DC 5JIIA 1BQSA 4JREC 2X6MA 1MIMH 3F7YB 1MFCH 4JRXA 1FP5A 4RMWA 5DRXA 5GS2D 1S7XB 1FNEB 3RVTC 4Y16B 5HD8C 1K9TA 4PJHE 3VXMA 4XNZC 1JWMB 2Z0BA 3QQ9C 5C07A 3MRHA 4PJIA 1AGCB 4ZQKA 4OKVA 3VMNA 3DIFA 4GG6E 2BNQE 3GKWH 4R90L 4HS8H 3IXTB 3ALXA 4PS4H 4X6DB 3FB6A 5L6YL 3T3MF 3UTPE 3IFOB 1JFQL 1DN0B 1QPPA 4UT7L 4CU8A 4HBCL 4KJPD 2P5ED 2FHCA 4XP5L 4QHMA 1J1PH 4N9GA 3EJYD 4PJGA 1OP3K 1U93A 3KJ6L 4CNIA 3QEHA 3HNVL 4LCCA 4PJCA 2FBJL 5TE7L 3EO9L 5EUOF 3RWEB 1P53A 4YHNA 2A6JB 4FZ8L 2BOBA 3BEVA 1EPFA 1LO2L 1DN2A 4JFQA 4LNRA 3BEWA 5E5MA 5GHWL 3MODH 1VACA 3L5JA 1H0DA 3QUMB 2VWEC 1EEZB 3KPRE 2XKNA 1F4YL 4IIQB 3GMLB 5C0FA 4X9IA 4PJFE 5F70A 2J2ZA 5INDB 3KLHD 3JWDC 5C0RH 1DJSA 4G6FB 3G6JF 3L95B 3V0WH 2IBZY 1S7WB 3O3DA 3LRSB 5F1NA 5JZ7C 3O45B 3LEXA 4N0CC 2XZZA 5JLZA 2LE9A 1WEJL 2JK5B 2ITCA 4HT1L 3O6LH 5FGCE 4Z8FL 1P2CA 2DWDB 3S35X 4R26H 4QCIA 2PXYB 4KQ3L 1RZKL 4XPAL 4OCYH 1XF5A 5ITFA 1CICC 2XTJC 3GHEL 5EU6B 4K8RD 4PTTB 5IMLB 3P30H 2JJVA 1EX0A 4KUCD 1MPAL 4HW6A 4HUNB 3V4PL 4HCRL 4M00A 4UOW1 1H3PL 5DC0A 3IRPX 2J6EL 2Z31B 3MC0A 4G6MH 5CCKH 4MVBD 5I1EL 4K55A 3KYNB 2Z9TA 2DTSA 4POZD 1U8KB 3AS3A 3GSUB 3MUZ1 2XN9D 2UWEE 4APQD 2NY5H 3EDEA 4IMLB 4XX1E 1AD9B 4FMKA 5MERB 4OLEA 8FABB 1NDGA 2JJSC 4KXZI 3ZYOA 2PYEA 2PCPA 4LHJB 2HFEB 1JV5A 3K46A 2VOTA 3HUJE 4JPIB 5KS9E 4KTEH 4NFBA 1CD1A 4ODTH 4OF3A 2R1XB 2OI9C 3TWCH 3IGAB 1T0NB 5HPOA 4JFDA 1OAYH 1T2QL 1QFWH 1KJ2L 4G43B 3WJLC 2LFGA 5J3HC 1RIHL 5DVMA 4F3FB 2SEBA 5JXEA 1T89C 3PV7A 2MQCA 1KEML 3TJEL 4PD4J 5GRZA 3TBVA 3W9EB 3W0WE 4YFLF 3OPUA 4Y19E 4IOFC 4NQEA 4KUCF 4X6FB 4P3CH 3FN0L 3NCJH 3C8HA 2FDBP 3E6HB 3K2UL 2EDFA 4LARL 4YK4B 1K8IB 5TFSH 4XGZB 4I3GA 4UOW0 3NFSL 3H8NA 4I4WA 3I6LE 1CZ8L 3DYOA 1A7PL 5ISZB 2VE6B 3QI9C 3SE8L 4NNPL 3L3KA 4U1MA 1A1MB 1ZK9A 2CDGB 4S1QL 2F53A 2OR9H 4P2RE 3QXDA 3TH3T 3G5XA 4NC2B 2VAAB 1MRCH 3V0VB 1BVLA 4FQHA 5GRJL 4X6CF 3S5LA 4HULB 4OCSH 2DMBA 1RHFA 2D0HA 5IW3A 5SV3A 2I9TA 5CWSA 5ESVB 3MRNB 4OQTA 5IFHL 2QKIB 1BFVL 1MNUH 5AYQA 5FO8A 4K23L 1C16B 4FQJH 1AMXA 2WP3T 3TYFA 2HTKC 3WFHB 4Z7NF 2NY2D 4N0FB 3WN5A 1MCHA 1KCUL 1R3LA 3C08L 4JANA 4E9LA 1LGVA 3PWJA 5J12C 1HHHB 4HF5L 3V4UL 2DI8A 1NLDH 3N9GL 4JFYA 1CGSL 2WWKT 4IGBD 4NQCE 4JJHA 1DSFH 2PF6A 1IM9B 3VFWA 1FL3B 1FGVH 4M61A 1MLBB 2VL4A 5AWNH 1RZ7L 4UTBH 3OAUL 43CAB 3MGTB 3P11L 4UBDD 3S35L 1FZKB 2HJFA 4JEGB 2Q8AL 4HKXA 4OZIE 5HVWA 2F8VA 1KTDB 4P4RB 4YC2B 2LQRA 2I25N 1JGVH 3TBSB 3BI9X 1KGCE 4OIIL 5IHLB 2BNQA 2DMKA 4KROD 1T6WA 1BVZA 5I1HL 5DQ9A 2Q87A 2IQAA 3EOTL 1U36A 1VGEH 4OZFG 2BNUA 4WHTB 1OB1A 5J6HA 2X1OA 3NACH 1ZA3A 4L9LB 4I0KA 4ZSOB 3BT2L 3WIIL 5TGBB 3TBYB 3H9SE 1B0GA 1DLHA 4U31A 1FO0H 1KLGA 2OSLA 2VXQL 2I9LA 2X9ZA 5EC1B 3DMMC 1G6RB 3FMGH 3RBGA 1NCBL 2NXYD 4X83A 1A1NA 1MI5A 5BV7C 4HH8A 4U6YB 4XI5D 2OL3L 4U7MA 2E9WA 3NA9H 5DEFB 4U1GC 4U1JB 3B5HA 2IFGA 5FV1L 1EAPB 1RVFH 1U8QB 1U6AL 4DKDC 5F6IB 2GTWA 1MJUL 3DBXB 3A67H 3DX7A 4HUXB 5MHSD 1CBVL 4PJFA 5KSUB 2V2XB 3MUY1 4JKWA 3W9DB 4F7CB 2H3NA 4P2OA 2W0KA 2DLEA 4PV9A 3S96A 5KVGL 3Q48A 3W5MA 4YPGB 1BM3H 1KIPB 4DEPB 2PW1B 3CSBA 4MQ7B 1CGWA 2GEEA 3FB7A 4WNQB 4Y4HB 2NZIA 1NJ9B 2EKSA 3UBXI 3JV5A 2X4OB 4UTAH 5I74B 3B8YA 5MEQA 3MCLH 4Y4KD 5ITBL 3PUCA 2DQJL 4KI5E 1ZLUK 1IC7L 5F72S 1ZXQA 5FM5O 2VZSA 5I1AA 1NL0H 2OK0H 1LO3H 3BD3A 3SCMA 1U8JB 3GSOA 3K1KC 1EVUA 2CJUL 2DLHA 4R90H 5J13B 4NRXB 2P8MA 2ADGB 4KDWA 1ZWIB 4LCCC 3I02A 3QNXA 1A1OB 5DD6B 5CEXA 1KELL 2MWCA 4JLRA 3GKZA 4NN6C 2DQUH 4PGDA 4AMKL 2VXUH 3R0NA 4MAUL 5J1TC 1D6EB 2GT9A 3VMOA 5CEZH 5E8PA 2D7NA 1INEL 4M62L 5I0DA 4HX1A 2YBRA 3C9NA 2DBLL 4ZS6D 3MV7B 2A6DA 5D96C 4HPOL 4FZ8H 1KCRL 4NQXA 2YK1H 4QHLA 2H45A 5D5MB 2ZSVB 1UWGH 4LQ1A 3VFGL 1TZGL 1U8LA 3N85H 1T66C 1RFDH 5GHWH 4NP4L 4P5TB 5JORB 1RAMA 5MP6L 1EHLH 4OAWB 4OIBA 4GJTB 4GRLA 5IBUB 5D1QC 2Z91B 4OD3H 2W59A 2O93L 4IS6A 1JK8A 2NW2B 3W0WA 2P5WB 3QNZA 5C0CD 4OCRH 5EU7C 2E8ZA 3KXFA 1YEHH 1S7VA 3DSFH 3GO1L 1U41A 5DT1H 4TUOB 1IC4H 1CF8H 2HFFB 3BPOB 1ZLWH 1I1YA 2EEBA 5AUMA 4JG0H 3UTTE 2CKBL 4JKPL 4P2RA 4Y7MA 3VA2C 3WJJC 4GOSA 4MGXA 2IQ9L 2JIXA 4QKXB 2EE9A 4BFGA 4NQUA 5IJKA 3GMQA 1H3PH 5LQBH 3TVMD 3ULUH 3TA3A 1V05A 3REWB 1X5YA 3W39A 3JUYA 4L9DA 4ZUTB 4J8RA 4XBGB 5I1EH 4KY1L 5SWSE 5ANMA 3OXRA 3OB0K 3QUYA 4PJDB 1KCVH 3VFOA 3MGOB 1FE8H 1JWUB 3KYMB 3MBXL 3W11D 1XEDA 1IAMA 4QLRA 5J7CC 4R4ND 2NLJA 1A7OL 3EYVA 4LPTA 1KOAA 4I3SH 4G8FA 5JXEC 1ZHLB 3QIBC 1FPTL 1BQHA 3UTPD 1JTTA 3GRWH 1AXSA 1Q1JH 4NIKB 1INDL 3F58L 3T1FB 1AHWC 1T1XA 1HCFX 1EUUA 4I2XE 1RZJH 3ZE0E 3U7WH 4BSVA 2KUTA 5BMFH 3IETB 3BDYL 1BFTA 2OQJA 2NXZD 2WBWB 4KAQL 4XB8A 3EOAB 3SBWC 1V3JA 4Z7UF 4KXZH 1F4AA 1WBXA 3NPZB 5D1XA 3LH2L 3TJEH 1G7MA 4PJAE 2IANA 3FL7A 3MV11 3S37X 4U1IA 4ZYKB 5CSZB 2A83B 4X8XA 3PGDA 1Z0MA 3HR5A 2BFVL 3LKSA 5HGAA 1G0XA 4OLZL 3KPRD 3L5XL 3SJVD 1W2KT 2DJSA 5HJ3B 2GK0B 2VDLH 1RUAL 4CMMB 1DQJB 4Z0BL 1CTOA 5D7IA 3X3FH 1KXVC 3MJGX 5T33H 2EIDA 3QEUB 4PGCA 3H9SA 1P7QD 3FRPG 1TVDA 1P84K 2OJEB 4NNPH 1F90L 3V4VL 3BN3B 1FYTE 4U2YA 4H8WL 1S7TA 3WDHA 4HK0A 3GMMA 4OCNC 3CLFH 3WN5C 4HEME 5IMMA 2HT2C 2BVUA 4GMSL 1D5MA 1V3KA 4M1GH 4BELD 1XGTB 3VH8A 4QO1A 5IFHH 1NMCC 2DYPA 4LSRL 2X44D 4LLDA 1KTLA 2B2XL 3WS3B 5D7LB 2FR4A 4HLJA 1TJGH 3PWPA 1EFXB 1RUPL 3ARDA 3WIHA 2XWTB 2R23B 5CGYD 3LS5H 3P4NB 4LVHB 4MD5B 4HZLB 3MXWH 3CFKB 3KPSE 3C08H 3GSWB 4HXAH 2CQVA 4Z7QF 4MDJA 5FEBA 5FYLE 4X6EB 4QHKI 1GZQB 3N9GH 1CVRA 3ARFD 4OJFH 5F21B 2H2SC 1IAIL 4HJGB 5EFIA 4LLMB 1KIRA 4GT7A 3O0RH 4N8CL 4ODUA 2AK4A 1VGKA 3P4OB 4R2GC 1R3KB 1G7IA 1RZ7H 2DQFB 5EA0H 3SDCA 2ARJQ 1S7UB 4U6XA 2WUBH 4NO0B 1ZHNA 2UVFA 2Q8AH 1JWSB 5E00B 12E8L 1MQKL 4Y88A 1XGQB 5TDPA 3KPMB 4XBPA 3HC3L 4Z1PA 5HGBB 4NT6A 4ELMB 1H3GA 5EU6E 1TZIA 1YMMB 1LEIB 1UXWB 5EO0A 1MWAL 4YXHH 3E8UL 3Q3GA 3LQAC 5F97E 4JFHE 2IALB 1YUHB 3BT2H 1AY1H 3PIQB 2WZPD 1BREA 1PEZA 3TESA 5IV2B 2BRQA 3U0WL 3MOQA 3WUZA 3ULVC 4AT6A 4PJ8A 1F97A 4QXTA 5JOFB 5D93B 1X5IA 4R97B 5LXGL 4Y19D 5A1AA 5IMOB 1NCBH 3IRZA 3BKYL 3RWHA 4JRYD 4NZRL 3U9UB 4ACPA 5E4IA 1KB5L 2AJXL 4R0LB 2NW3B 1EEUA 3FTGB 3E3QE 4PUBH 1M7IB 3I6LD 5E8NA 4QTIL 4GAJH 5KSAB 1UH2A 1VKXA 1H8NA 4J7RA 1MJUH 4KQ4L 5IGXH 4NRYB 1T21B 1H9VA 1CBVH 3VWJB 3C2SA 3HZYB 2UWEF 2DQGH 1TQCC 3TNMB 5E2UH 3GMNB 1LNUB 5ACZA 1J10A 3BIAX 2OMBA 1NFIA 3D25B 3S37L 1KFAH 2FL5A 5BS0D 5C9KA 3HUJF 5KS9F 4LDEB 1BZ7A 2EDKA 4P99A 3C6LD 4RGOH 3OMZA 4XX1G 1YEJH 1Z9OA 2BSED 2DQJH 4HIHA 3HMWH 1WC7B 2B20A 2OX5A 4PY8J 3CAFA 2Y6SC 4LMQE 2HJKB 4NQCD 1YPZB 1G9NC 1HHGA 3EJZC 1UZ8A 2NX5A 1FORL 2VDML 5HHQA 3MNZB 5BW7A 5ISZE 3GGWB 4F9LA 4U2ZA 5IHUH 3P0VH 1SYVB 1QLRA 5KAQF 3QG7L 1BFOA 1OM3H 4P3WA 4K3DH 1KJ2B 4LIQE 4M93C 4F8QA 3GK8L 1H5BA 1KELH 3DXAB 3BGMB 4R7DA 4XH2B 4Z78A 5GGUB 5EUKA 3RWJA 2BXYA 5JHDA 1YQVH 1BQLL 1ZVSB 4H25B 4JFPA 1NAMH 4OLVL 4RAHA 1KGCD 4QT5A 1S5IL 2F9BT 3LKQB 2CLVB 4HD9A 5F89A 5TQ2L 2V2TB 2X1PA 2Y5EA 2DBLH 1YEGL 4YDVB 3IS1X 1KCRH 4OM0L 1LE9B 3VFGH 2PTVA 4O2CA 1TVBB 2OR8A 5JW4N 1H15B 2C4FU 3G5ZB 5BRZB 3B2VH 3G04B 1WBZB 4ODWA 2E6PA 1XIWB 5TE4H 1CFNB 4IHOB 1P9MA 5GZOC 1EERB 4N1EA 4S0SD 2P7TB 3ARGC 4HIXH 1IFHL 5IOPB 1CFQA 32C2B 2QQQA 1MAMH 5E70A 4ELKB 3DRTA 3VFMB 3PQYB 4LMQI 4J4PC 1I7UA 4XMPL 1CWVA 4DTGL 5IJKC 1CXFA 4RMTA 5JW4Q 4JM4H 3TA3C 1CFSA 4LHUB 4TPRH 1HNFA 4ZD3H 3DURB 1UB6A 4QWWC 4OZIF 4G9FA 1LP9B 2GTZA 2Y36H 2VNCA 3EW3B 4Z7OE 4LEOA 4UV7L 5E5RB 3JWNC 3S88L 1HKFA 3CMGA 2LVCA 3U4EA 5JW3L 1AE6H 3CLEL 5DMGD 4XC3L 4XWGH 3O2DL 4POUB 3RI5F 4KI5D 4PJBB 1BEYL 4PY7A 4LKXA 4Y5VA 4BKLA 1TPXC 4A2LA 1XGPA 4TNWF 3ZSSA 4LLQA 5DJAB 5E94A 2ORBL 4QF1A 1U8MB 3X12A 5INCA 1S9WB 1U92B 3WFEH 1RK1A 3MACH 1WZ1L 3MBXH 4ZFGH 5LVEA 2UZIH 1ULVA 2XQYK 3V6FA 1X5HA 4ONOA 3MRQA 4NPYB 3QRGL 2XG4A 1YJDC 3P0YL 2F5BL 4YBHA 3TM6A 3FN9A 5D1XC 3UROR 1INDH 3P73B 3GB7B 3UEZA 1BZQK 4RFNB 4JFFE 1N0XH 4P49A 2N56A 1D5ZA 5F7YC 5T5FL 5F6HI 2MPAH 4PRHD 3MRIB 1SEBB 4BH7A 1KN4L 5KW9L 3DX9B 2GJ6B 1MHPL 4KAQH 2AABL 5IBLD 3R06B 2OL3B 3DOSA 3SDYL 2OJZH 3VWKC 3LH2H 3MLYL 4Y5XB 1EJOH 3EO1B 1FH5H 3U1SL 1GC1L 1H8OA 3VFSA 3QUXD 2BP3A 4NC1C 3MLTB 4YXKL 1I1AC 1PDKA 3X14B 3AU1A 4UZGA 1NC4B 3CSYA 4PP1D 3CUPA 3SKUD 1WAAF 4CU6A 3RZCA 2GAZA 5IHBA 3ZKSD 1U3HB 1F90H 3ARDC 4PJ7A 4H8WH 5ENWB 3C2AL 2FGWH 2GFBA 4WW2F 3SKOB 1HOCB 5T3XH 4HMCA 4JFXB 2FX8L 2VLLB 4F33A 5BO1H 1SJHB 3M8OL 2P1YA 2AW2A 3MV7E 43C9B 2BDNH 3UTTD 4Z5RB 1CL7I 4N5EC 5D5ME 3HI6L 4OBSA 3MNVB 4PD4K 1S78C 4XHJD 4XPHL 5B8CB 2W60B 1VFBB 1G84A 5B38B 1JPFA 4WEBH 2VXTL 5BJTB 3O9WA 5F1IA 1OWWA 2P4AB 1E27A 5LGJA 4WHCA 1LK3L 2Q8BH 3UTSA 5DGRA 1OAZL 2CH8A 4P9HL 3VXTA 2C1PB 3EFDL 3UTZB 3TO4D 1WLHA 5CBEB 3QEGH 5ERWB 2KH2B 5DSCA 4P3DB 4WWID 4JHWH 3QHFH 5MENA 12E8H 3RFZC 4OB5H 4X98B 3B9KD 4PJ8C 1QFPA 3IF1B 1PYWA 1S9YB 4QEGA 4TTGA 3AY4C 2VIRA 4GRWB 2HKFH 4WFGE 1QBBA 1B3JA 4POYA 4IMKA 4KUZL 5DUPL 4NNYA 4MCYA 4M7KH 4LLUB 1G9MH 2QV2A 1XH3A 2VL5B 2V5MA 5DRNA 2Y07L 5LXGH 4Y16D 4M7JL 4RRPG 1LO5B 2G9HB 3F5WB 4I5BB 1K3ZA 3ZKNC 1YY9C 5DYOB 4L29A 4NZRH 5EU5A 4Q9CA 1IGJB 4ENEC 4ETQB 1RJZA 4FQLH 5C0BB 4P4KC 5IM7A 4UDTA 5T3ZD 2D4DA 1A3RL 4PRIE 1G9EA 2CIKA 2EC8A 5F9OL 3QQ4A 3AM8A 4MX7A 2DDQL 2ED7A 4ZFZB 4U1LA 5FK9A 5D2NA 2PTTB 2CKBB 3VFUA 5KZCB 3ETBF 3TPUB 2I26N 3I6KB 4FQXB 4G7VL 5HDOA 2H26A 3DETC 3QUMH 4E41E 5BVPH 2CGRL 2IFFL 4U3CA 2VJXA 3O41A 1RZGA 3KPOA 4LU5H 3TN0A 1YEDA 2WBKA 3VXQB 2DIAA 4FN0A 2P48B 4ZO6A 5C08A 3IS0X 4WFEE 4K7PH 5DJDA 4LCIL 3ZE0F 4KKAC 5DQJA 5FYLD 1NGXB 1W0WA 4OFIA 2OXGA 1H5BC 3QEQA 2VABA 3CXHK 3HPJA 2A1WH 3FT3B 1I9IH 3P3YA 4G6FD 1I4FB 1WBYB 4MB4A 3V5HA 5AG9A 2FJFA 3QG7H 4O2FB 1ADQL 2R0WL 1NAKL 4I77L 2R0KH 3OR7B 2HFGH 1FFOB 3CDGA 3DVFA 3MA9H 4NQVA 2B4CL 3Q5YA 4X6DF 2PXYD 1IAOB 4OLVH 4WGWB 3ZHLA 1QZ1A 1S5HB 3PDOB 5D7LE 5D7SH 5AD0A 5EU6D 3BESR 4XVJL 3P4LA 2W9DH 3DX6A 3VI4F 4OFPA 1YEGH 4X6CA 5J9PA 4JFHD 3MFFB 5GPRA 2Z31D 3DVGA 4ZUVB 2Y7QB 1GGIL 5IB3B 5IQ9B 4KRPB 5TF0A 4NJAH 4QGTA 5GS1B 1YEFH 2ZJSH 1ZOXA 4RGNB 2VC2L 2OTUA 2CUIA 3C5SA 3RGVA 5GS0C 4X99A 4X7DC 4UB0H 4GXVH 5TE6H 3VG0L 3ZYIA 1OAXL 1FV1B 2EEAA 3ARBB 5ICXA 2NY6B 4DTGH 4XP4L 1RULL 2DKSA 1T4KA 1WJ3A 5DI8B 4G80B 3WXWL 3S8WA 1MCQA 3UZQA 4ELME 2ZG1A 1I9JH 3MRMB 1HHIA 1ZE3C 4FFVD 5DTFB 3DYMA 4S1SH 3MRPA 1S8DA 5KJRL 4UV7H 4NZDA 5GZNC 2ZPKH 5IIEA 3FQNA 5JW3H 5C09A 5HPMB 3SDXB 3O2DH 2AEPL 4LVOC 4HPYL 3AXLA 1BEYH 2XACC 1Q9OA 2A77L 3N06B 1T5XA 2X10A 2WWMD 4QRRB 3OKOA 3ZDXE 4M8QA 4Z7VB 2VLME 3U4BH 3Q6GL 1WZ1H 5ISZD 2DF3A 1EMTH 3KWWB 5IR1B 3S34H 5IQ7L 5A43C 3OQ3B 4LEXL 3OKEB 1UQSA 4K3HA 2MQ3A 3MRGA 1FL6A 3T2OA 3EYSL 3T0EB 4UV4L 3U0TA 3P0YH 3GNML 3L3DB 4OTXL 4WUUA 3IXAA 5DD3L 2DKUA 5FUZH 4FHBD 3GI9H 2D2OA 1IGFH 4YHOL 3S4SA 3IDIB 4S11A 2CDEA 3AMLA 3SGDI 3WV0A 3HE6A 2IADB 3NFPB 1WICA 5FUCE 1MCPL 1J0KA 5FXCH 3RKDD 4IGBA 3HAEH 2DBJA 3RDTB 4PYGA 4U1NB 1GIGH 3Q6FB 5IMKA 3SDYH 2JCCB 1T7ZA 1IEBB 6FABH 3V2AR 2W65B 3U1SH 5FGBC 4L4VB 5CP7B 3IFLH 1IM9D 2DQHL 5D1ZA 4WO4A 1ZVYA 1JGEA 1XR9B 2YRLA 5J1AA 5JDSB 1D7FA 4M5YL 5D7JB 1W0YT 5T1DL 5D8JH 5LBSL 5LAXB 2IPKA 4NHUA 4YX2H 3U4AA 3DXAE 1K8DA 5L9DL 4LLWA 3IFPB 3WO4B 1FHGA 4BZ1L 1TVHA 3SO3C 2HKHL 3WUWB 3TJHD 3RVVD 7FABL 4LCYB 4GBXA 1R5IB 2FX8H 2F74A 3GJFB 1U58A 3V6OE 3M8OH 1AD0B 4JQXA 3RIAF 3U9PH 2P46B 3S36X 1OSZB 1J8HB 4JFEB 4O5LL 3HI6H 1KXTB 4XZUB 3VGAC 1F3DH 1T0MA 5FV2A 5C2UB 4QXGL 1FO0A 1JP5A 4NQSA 4RX4D 3QWRD 5HGGS 2R8SH 2QHLA 1W0VB 3ZKMC 3WHE1 3KPLA 3EYUH 5ICYA 3SQBA 5FHBH 1N5AB 2XRAH 4JZJA 3EFDH 3PQYE 4O58H 3SO5A 3PG2A 5CBAA 4UNTA 3NH7L 4K3EH 4QHKJ 1P4LB 2R2EB 4D0DA 4HAFA 3NIFE 4HAGA 4YEFA 4PGBB 4ZS7H 3JWOC 3C60B 3IJHA 1RD6A 4Y4KA 1A4JB 2R2HB 4HKJB 3SN6N 2FB4L 1VSCA 5SWQA 1UCBH 2BHYA 3QO0A 3ZSTA 4IDJL 3KHQA 1KPRB 3TIDA 3PGCA 3QFJE 4Y4HD 4KJPC 1WITA 3B83A 2GUOA 1A7NL 1KNOA 5DUPH 3P9MB 1TQBB 4FFYL 4PJBE 3EJYC 4Q6IA 4I0PA 4M3JA 3AM8C 1DQQB 3QIWA 5E7BA 5EOCJ 2VITA 5D2NC 2HAZA 2HRPL 1IKFL 5C8JB 3T2QA 5CSBA 4M1DH 3S9DB 4Z6AT 4X7CC 3TO2A 4ODVL 3WFCL 5JO5B 1J12A 3T65A 2CMRL 4Q0XL 4FA8A 4HIEB 2YR3A 4Y5YB 2CR3A 3I9GH 3L3IA 4WFFE 1A3RH 3TN0C 4OCMC 1YN7A 4HUMB 4KK8C 5F7EH 1G1YA 3WHE0 3KLHC 4JM2F 5HSFA 3B43A 5FA4B 4HLZH 4G7VH 5FA3A 1DUYA 4PR5B 5JOEA 2HH0L 2FO4A 4OSUL 5F1SA 3I2CH 2NQCA 4JVWA 5JUEL 2GJ6E 3C5ZA 3NAAL 4UAOB 5CZVL 4KPHL 2YSSA 2AJYL 3MV7D 3QDJB 1FVEA 4LP4A 4AL8L 5JHLH 2R4SL 4IDLA 5F3HB 5E9DE 3V6ZA 3WXVL 3ZDYF 4P5TD 4OF7A 4M4PA 3WNKA 4TRPL 5DJYB 1TZHB 4JPVL 1HSBA 3CZFA 4K8RC 3DO7B 2D7TH 4YHLH 3CXDL 3LHPL 1KBGH 3FFDA 5A16B 1BGXL 4YHZH 4MA3A 1QRNE 2QL1A 2AEIT 5H8DA 1S7SA 2L7JA 4MVBC 4PRBB 4KZDH 3JWDL 3VI3E 3HS0B 2YMXL 3UYRH 1T6VN 4JO1H 2QSTA 4POZC 1NGZB 1XR8A 2H2PD 4AQ1B 3QPXH 1ADQH 2R0WH 4RFEB 5JMOC 1CXHA 1SHMA 5EULV 4APQC 3S36L 5HHOB 5EZJA 1AP2B 3TVMA 1TNMA 5L2JA 2XNAA 3NCYP 4OCXH 2XV6B 3X3GL 3BKJL 1Z5LB 2RFXB 4TUJA 4MD4A 2PYFA 3JXAA 2E7CA 1PAMA 4N90E 4DN4L 1I1FA 4A6YH 1QBML 5HDBE 1L7TL 1G7PB 1T1YB 2YKLH 1G7HA 1A14L 4H0HB 3P40A 5ADOL 1M1SA 1ZS8B 3STLB 4H20H 4OV6F 5GRUL 1EHAA 4GUPB 4OD1L 2XY2A 2FD6H 1A6ZB 3VFPA 3NVQA 1Y6KR 3CFEA 3PP3H 3VGGA 2DM3A 1GOHA 3UPRA 5IBTH 1MRDH 4HUWB 1NANH 5EIIB 4PRID 2FIRT 3IJYB 5FCSH 3GRWA 1MFDH 5FOBA 1RULH 1RUQL 2X4PA 4R9HA 4HWZB 4LPWA 3BP5B 2KBGA 1MRFL 3MRRA 1I1RA 3NTCH 5FYJL 3WXWH 5IW1B 3RRQA 4IRZH 5ALBL 4X4XB 5IBUG 3QO1B 5DC9B 4GRWE 1U8NA 5TH2A 3K4DA 1VADA 4FOMA 4RMSA 2XQBL 4GKSB 4R4BB 1AQKL 3A6CH 5KJRH 5ID0B 3F7PC 4Y4FB 4KKBD 1SVCP 3NIGE 4EDXA 5EBLB 3RWFA 5C9JB 4OV5A 1GVIA 1CLOH 2AEPH 4G7YL 3BPLB 5CP3H 5D70L 2WOYA 2BSTA 2VDPL 3IU4H 2NY2C 1N7MH 4EUPB 3ME0A 1WTLA 2VSDA 2Q7YA 2VH5L 4YEEA 5FKAB 3I50H 3KJ4B 1A6VH 1NEZG 1IGMH 5IFAL 3NN8B 1DL7L 4X5XB 4EI5A 2XPGB 2CO7B 4IGBC 5IQ7H 3QULA 4N8VB 1BFSA 5FGSA 2CK2A 1ZMYA 4PJDF 1TJHL 1I8MA 4O51A 4UV4H 4G9DA 4LSPL 3GNMH 3RWCA 2Y9RT 5M94B 3OKDB 1JF5A 4OTXH 2XKUA 4NO3B 1ZLWK 1E6JH 1FZJB 3CMOL 4UBDC 4PBXA 3T77A 4L4TB 1CR9H 3MREA 5D7LD 4DN3L 3BZFB 3VXNA 2YZ8A 4LPVA 1EFXD 3EYOA 4I3RL 5TDNA 1C08A 3FONB 3OJ2C 4L8SA 1NQBA 4Y2DB 3O4LB 3OB8A 4KROC 4KH2A 3CC5B 4YHIB 3EJJX 4GKZA 1EBAA 1YYLL 1JMXA 5KSBB 5F6HJ 5LWYL 4LRNL 3EYQD 1BHGA 3H3PH 4FFZL 1JF1B 3SDDB 3H0TA 1DEDA 1OY3B 2CXKA 1AQDA 5DRWA 2EDOA 1RJLA 2JB6A 4MMZC 1DBJH 4MNQA 3FN3A 5LBSH 4LKCA 1QHPA 4NO0D 2NXYC 4XI5C 4EQ2A 2WNGA 4JQVA 2QR0A 1XGYH 4H1LB 3ECBB 4QTHA 3ZTJH 5JR1L 3O8XA 2HLAB 2MCPL 4OUUB 3WLWD 4UIKH 2IPTH 4JN2B 4KKCD 5I6XC 2FJHB 4HDIA 3RHWF 1S7QA 3CCHB 4TQEH 1YMMD 2XWBA 5F71A 3H9HB 3C8KA 3D0LB 4KDTC 4YR6B 4CVXB 2DQEL 3LKOB 3ZL4L 3G5YA 4IRJA 4OCWL 5EZLB 4ZDHB 5HY9B 1BIIA 1OPGL 2EDHA 2DQCL 5IJVA 5C0EB 2V5TA 1HEZA 5CSGA 4BSJA 4K71C 4WI8A 5E99L 1MH5B 4X4YA 3R1GL 2DQIH 2VQ1A 2O5YL 4NKDA 3H3KA 1CLYH 4Y4KC 4ZFOL 4WTZA 1EO7A 3LN4B 4L3EE 5E9DA 2VLMD 4OZHA 5H94A 3VFRB 4DVRL 4J3XA 4ZNEA 5KSAD 4DGYL 4LGPB 4NO2A 2ZCHL 3NH7H 4AEIL 3RWGB 1U0QA 4WI6A 3VE0B 4LF3B 2IMMA 4LOUD 5BS0A 3V6BR 3VWJD 3OXSB 1YNKH 2HVJA 2Z35A 5B39A 2XXMB 2BMKB 3T4AA 1ZT1A 2GSGA 4IOIB 2O26U 4FTVA 1RURL 3N1MC 3BP7A 3QXAB 1OARH 4JQIH 4RWYL 1YNTA 4QRPA 1A6PA 3DHMA 4JPKH 2QLVB 3VJ6A 5F3BB 4ELMF 4Y89A 3MUGB 3VW3H 1J0JA 3LZFL 4M7ZB 4LPXA 3CFDB 3D18A 5DC4B 3P2TA 4ZS6C 2E7LA 4QRRE 4P2QB 3IU3B 2HRPH 1HQRB 3FB5B 1JN6B 3WEXB 4Z7VE 2BSRA 2J4WL 3P77A 3LPFA 1TCMA 1UVQA 4X4MA 4YWGL 2H9GA 3EOBA 3UBXA 3ZZ1A 4JDTH 3VGFA 1IL1A 2G2RA 5KANI 3C5ZC 2APTA 3QJFB 3GSXB 3T0EE 2BRRL 4D8PA 3SGKA 3DUSB 4P57A 3VXUA 3DXAD 3WIFB 5GJTH 3PABA 5DQDL 3BPNB 2P24B 1TFHA 1CU4L 1NAMA 1BD2B 4D0BB 2FX7H 4JVUA 3RUGB 3MJ8B 3G5VB 3AFLA 3QXTA 3ARRA 4CRPA 1F4WL 4R7NA 2ZKHH 4XPFH 3NZHL 1HI6A 3NAAH 3HC0B 1DBBH 4XPGH 2JCCE 4JFOB 3PL6B 4FP8L 5E6YA 5FGRA 1RU9H 4Q2ZB 3INUH 4M7LL 4ESKA 4NO5A 4TRPH 5D7KE 3MCKA 5BRZD 3LS4H 3MFGB 2NR6D 3L3GA 1XIWD 1PLGL 4TTDD 3OKYA 3K1DA 1BZ9A 2R1WB 3TVMC 4K9EC 1OSPL 2YZ1A 1E28A 4XAKD 4WFHD 5IVZB 2HJLA 4Z7WB 1B4RA 1MCNA 3HG1E 3TV3H 4ONHA 3JWDH 3PQYD 4CAGA 1C5CH 1IRAY 1T83A 1A0QL 1YPZF 2CLZA 5C92A 1OAKL 3UX9B 4LQFL 1MAKA 1ED3B 3O3BB 2FZ3A 1J0YA 3W11C 3EFFA 1GAFL 1AJ7L 5EIQA 1IE5A 4R4NC 5AZEH 2ZCLH 1HHKB 4LHUD 4P0DA 4QOKB 1NFDA 1XZ0A 1CVSC 4ZNCD 3FQXA 2AXGB 2OR7A 3EAKA 4JFEE 1CIDA 2ATPB 4WW2A 4X7SH 3O3EB 3MBEB 1R3IL 2MFNA 3STZA 5AG8A 4DN4H 2IAMA 1QBMH 2NXZC 1L7TH 4U7KA 3VMPA 5GQBA 1D6VL 1I9RH 4Y1AE 4MAYB 4ZOBA 3OPZL 1R0AH 2DTML 1RZJC 4OD1H 2ADIB 3CFBB 1N59A 1TNNA 3RI5K 2ADJB 1PZ5A 3BZ4B 1H3TA 3WKML 4NC0B 3B3IB 5EBMB 4PRHA 1S9XA 4WFFD 4XC1H 3KAAA 1NBYA 4TNWK 3GUTA 3LV3A 1F11A 2DD8L 4H26A 4LASH 5ADPH 2O61B 2B1AL 5FDYA 4OLWL 2VLRA 4YFDB 1I7RA 5ALBH 4XPBL 1YA5A 2DQDL 5HYQB 2QADD 3D0VA 3E2HC 2GJ6D 3LD8B 3I3DA 1GHFL 4FG6D 1MCRA 4K7PY 1K5NA 2I07A 1AQKH 5KN5B 1IJ9A 2A9ML 1EUTA 1MREL 3U2SA 3OHXB 1A6UL 4JZNA 5D70H 1I3RA 1JCKA 1LP9F 3OX8A 5CGYC 1YEEH 4P2CG 3C6SB 4LHUG 5FF6B 4ZTOL 1HH6B 3V8CA 1QRND 3VXSB 5IFAH 3GMPA 1NC4D 1FFQA 1JNLL 1OF2B 3T3PE 1RZIB 4PBVC 3ZHDA 4QHUB 4OQTL 4XCYA 3ARFC 4G6JH 1DL7H 4JHZA 1U3HD 2YC1B 4L8SC 3TEUA 4V2CB 1XCTA 5I71C 1NH6A 2VDRL 1UCTA 2Z8SA 4J3SA 5GRVL 4E5XB 5F1KC 1D5BA 3NGBC 2DOCA 4PGEA 4LCUB 5L8LB 3T0DA 3J7HA 3D2UA 1HKLL 3SQOH 3H7BA 3X11B 3U0PA 4OGXH 3OKLA 3I6GA 3ARTA 3QDMB 5EORL 1L7IL 3IDUA 4NQDB 1MJ8L 4BQBA 1PGRB 2PW2A 5ESAA 3IDJB 3RNQA 3FHAA 4L5FL 2KKQA 5EU3B 5DS8A 4NQTA 3MUJA 3QPQD 1Q9LB 5CHNB 4LSVH 2VLJB 4GS7B 3X13B 4M4RA 5DJZA 4NUJA 3MYJB 4HQQH 2AJZA 4TSCL 2ZSWA 5HHOE 1YNLL 4F7EA 1FZOB 5KOVC 1GOFA 4GG8A 3JV6A 5JQ6L 2W9LA 5HVGB 2NMSA 5JIHA 1S7XA 5SWZB 1UM6L 3UO1L 4K7FB 4JDZA 1JWMA 1TIUA 3RBSA 4ZFFB 1EHXA 3D69A 3MPCA 1AGCA 1X4XA 3LQAL 5F88B 3FAXA 3ZT5A 3MRCB 4OCWH 3C8DA 4XVSH 4WI4A 1OPGH 5MEOA 1PG7W 4X6DA 1AGDB 4M5ZL 3ULVL 1ZTXL 3LN9A 1GGUA 4ZXBB 4XCNB 1D9KB 5DD0L 2NY1C 3C6LC 3MNWA 2EE3A 4EZMA 1WVZA 2KQNA 2X4SB 1TJIH 2DM2A 3HNTH 5C0BD 5BV7H 4N0UA 3D5OF 4ONGL 4DVRH 3FO2B 2BCKB 3I85A 1UACH 2ZCHH 3MLWL 5CJOL 4AEIH 5I8KH 3DX8B 3RWEA 3QISA 3BUYB 5J6GB 1GSMA 4O4YL 5KZCD 1FFNA 5B38G 2AEQL 4YLQT 3FT4A 1U8IB 4MLSA 4FQXD 1GZPB 3DVNB 3DV6A 5FM4A 3RWIA 3QUMA 1GPOL 1HN1A 5DHYB 5DWUH 1LO0H 2F54E 1E0OB 2EDDA 3NFNA 4RNRA 5FYKL 2BX5A 3LB6D 3QFDA 4HGKC 2E7LC 4IIQA 1N64L 2B0SL 3SDAB 2EDWA 4JJ5B 3N1FC 3RX7A 4U1KA 2R4RH 3QH3B 4RAUA 3CDCA 2APFA 5I1CL 5ACLA 1AGFB 4NGHH 5B22A 3HI1A 5BVJB 1UB5B 1QACA 3BWUC 4DUVA 1IILE 4X8JB 4U1SB 1UJTA 1HWHB 3O45A 5GRYA 5LKNA 1CTNA 4QRSB 1WCBB 1UH3A 1G9NL 2Z8VC 3NIGF 2DWDA 3S6CA 3FCTA 4DGIL 3BN9D 2R29L 1LEGA 3DWTA 3TBWA 4GMTL 3LIZL 3HFML 3TYGH 5DQDH 5L8JB 4NOBA 5EZOL 4I48B 2R1YB 2MJWA 2WK2A 5IESL 2ID5A 3BP4A 1U8KA 1RIUL 3O4LE 2E7HA 1MJ7L 1NPUA 4YQXL 5FKPB 1CE1L 4HGMA 2FYYA 1BOGB 2HG5B 2E27L 1T83C 4ZUWA 4V1DA 4M7LH 3T8XB 3PWLA 4KRPD 8FABA 5C0AA 2VZVA 3QI9B 3WHXA 4JPIA 1S7RB 3RVWD 5JW4M 3MOAL 5CINH 2R1XA 4IRSB 5DMGC 4WDIA 2WM0A 3VD4A 3FO1A 3IGAA 4KI5C 2R2BA 3VRIB 1UM4H 1W72B 3FO9B 1S9KC 3BO8B 5F8QC 4G43A 4AENA 4K3JH 5EWIL 1ACYL 1OAKH 3L3HB 3G6DH 1Q94B 3D85D 4WW2C 1UKTA 1KLUA 2IG2H 2ZCKH 5JNYB 2QSVA 1O5DT 2ILLA 3BW9B 5KSVB 5ILTL 4MJ6B 3O2VL 4HFWA 3QWOB 5HVHB 4X6FA 3MV8B 1JPSH 2GITA 4TSBH 3SPVB 5IB4B 3E6HA 1Y0LB 1C1EL 3MTRA 4FNLL 3ZT7A 4JO2H 1BPVA 1R3IH 5JXAL 2VQTA 4G8GE 1A1MA 1ONQB 4KJYB 5L7XL 2CDGA 4XHQA 2ERJB 4UQ3B 3LMJL 1MY5A 5IBLC 1RIVH 3IDMB 3V0VA 3FRUB 5AZ2L 4QRRD 4YHKL 2WIIB 2NY4C 4LSTH 2Q3AA 5ESVA 3JUZA 4MA1B 3AVEA 5ACMA 5IVXB 2L7UA 3VCLB 2QKIA 4TVPD 1F13A 3QUXC 4PJEA 5FHAL 1BWWA 4PV8A 4M03A 1C16A 4PRNA 3T0ED 3PF2A 2KZ1B 2ZP0T 4PP1C 2B1AH 5JIPA 5DZ9A 5K9OB 4KMLB 4M9OA 4OLWH 5I76A 2RJMA 2DQDH 1Q72L 1MJJB 2A38A 2IPUK 1I3VA 3RDTD 3BGFB 3K3QA 1PVHA 3D3VA 3PE9A 1FL3A 4NOFA 1KJ3L 2X4NB 2CRZA 4OZFB 4F15C 5DUBB 4PRPB 3RTQA 4LSUL 3GSRB 1KCSH 2X42A 3QZWB 3LOWA 2ZWLT 4L4VD 4PJ9B 5IF0B 5E0QA 5D7KD 4P2QE 1WV7T 1F58L 4KTYA 5I73B 1KTDA 4P4RA 4XMKH 5TQ0H 4XHJC 3KR3L 4DQOH 2AJ3A 1IGYB 3TBSA 3FFCB 5D7JD 1FAIH 3SDXF 1OLZA 3BHBB 3KDMB 2V5RA 1JNLH 1FIGH 5CS7A 2ARJB 2BVYA 3GJFH 4GLRH 3OWEA 1CDYA 4JRXB 5D6CB 4XVUD 4L9LA 4WENB 5DRXB 2FIKA 3WIHL 4ZSOA 1QEWA 5TGBA 2VDRH 2PO6A 5C07B 3QSKB 3OAYH 4WVRA 3TO4C 3AREA 4RX4A 3PHQA 5EC1A 4G3YH 2O5ZH 1RZ8A 1J8HD 2EH7L 1QTYT 4JFED 2ZUTA 3KLDA 4U6YA 4ZAKA 1JHLL 4WI9A 3B9KC 1L7IH 3GM0A 4JM2A 1A5FH 1JPTH 4J6RL 3ILPA 4ZODA 3LKNB 4NBZB 4QHMB 3RIAK 2J3SA 4N9GB 2JE8A 1U8QA 1EO8L 4KZEL 1NCTA 4HK3J 3DBXA 1U93B 4CNIB 3QEHB 3HE7B 4L8CB 4PJCB 3T4YB 4AIXA 3TZVB 4Z7WE 4F7CA 4MJIA 4LNRB 3BEWB 4GAGH 1VACB 4Y16C 3HB3D 1H0DB 1G7QB 3RA7H 4YPGA 1AI1H 1ES0B 1LWRA 5D72L 3H42H 1OAUL 5F7NC 4RMVA 4WY7H 2XKNB 4Y4HA 2XIDA 1NJ9A 5TJWK 4TSCH 2X4OA 4QOKE 3C60D 3MJ6A 4WU5A 1RZFH 3QB7C 1WFTA 1C5BL 1V7NL 4EKXA 5ALCL 2H41A 3O3DB 3S7GA 4OF5A 5F1NB 1XF3A 1G0DA 3LEXB 5GGTH 5JLZB 1I85A 2ITCB 3CU7A 4NRXA 1P2CB 1ZWIA 5JA9A 4QNPF 4QCIB 1T2JA 5FIEA 3ULVH 1A1OA 5DD6A 2ZNWA 1XF5B 5ITFB 2D0FA 4KTDL 4JY4B 3WUWG 5ID1A 3N1QC 4D0CA 4UU9A 1XMWA 3GMRA 1D6EA 4NN5B 4HKZB 4ONGH 2AVGA 1DBML 1PKQE 2ESVE 4IIQC 4J3WA 5EH1A 3ZMRA 2JB5L 1SQ2N 4GAYB 3RL2B 1N6UA 2ZSVA 3JTSA 4Q7DA 5CKGA 3BH8B 5E4EB 1AXTH 5FYKH 2AV1B 4OAWA 4YHYB 4KHTL 4OI7A 5M95B 4TULL 1N64H 2B0SH 3QDJD 3IJSA 1QFUH 2Z91A 2PCPB 4KKNA 1JV5B 1WF5A 2X4RA 2HT4D 4W68A 5DDHA 4HJJL 2PXYC 3HZMA 1FN4A 3MJ9H 1CD1B 2NW2A 4MXVF 3VRLE 5I1CH 5I1KH 1ZEAH 2P5WA 4OIAA 2BY1A 5I2IA 4EI6A 1RUKL 1B90A 2BY2A 1EVTC 4NKOB 2F8XC 2Z31C 4HGWB 3MLXH 5DHVB 4AQOA 4DGIH 2R56H 2R29H 2IMNA 2WUCH 5EOQH 5FO7A 1DUZB 2CPCA 1TCRA 1ADQA 1MIEL 4NSKA 4GMTH 3OJDA 5HHOD 4FQCH 5L2KE 4GSDH 1U9KA 5ABDE 5IG7B 5EZOH 4HG4J 5LGHL 4ZUTA 4XBGA 2DI7A 4NHCL 4U1MB 2J8UE 4RISH 3WFDH 3MJ7B 4NQDE 2F53B 4PJDA 1MJ7H 3G5XB 3MGOA 4YQXH 1BVLB 3KYMA 2FECL 2EC9T 3S5LB 3T09A 1NLBL 1Z3GH 4A6YA 1NMBL 2H8PB 2E27H 4FFVC 2AJSL 4OZGF 4AM0A 4TVSa 1YECL 5IT2H 2ICWB 2K7QA 3AGVA 3T1FA 3TYFB 4Z77B 1JRHL 4PJXE 4JANB 5GS0L 2ENSA 3IETA 4HWNA 3OF6D 1UZ6F 4U6TA 2WWMC 1F42A 4JFYB 1SVZA 4YK4C 4OFQA 3VFWB 1DQDH 4M61B 5CUSL 3HTLX 5DUML 5ILTH 4Q74A 2WLZA 35C8L 2KZWA 2A83A 5T1MB 2VWEE 1PSKH 1FLTX 2DJ4A 5HJ3A 2GK0A 5D71H 4XBEL 4CMMA 1DQJA 1DBKH 2F19L 2R0LH 3QDAA 3MRLB 4Y4FD 4PJHB 1A6WL 1C1EH 3QEUA 3ARQA 4JAMB 3RPIA 3D87B 5I75B 2XZQL 4JY6A 1KSRA 3VXOB 3HAEG 5CP3A 3RKDC 2BNQB 5GRWA 4GG6B 1PKOA 4R4FH 5DQ9B 2IQAB 3LMJH 5I66B 1JYXA 1ETZA 1OB1B 5AZ2H 1ZA3B 2FWOA 3PWNA 4MZ3A 2R9HC 4PB9L 4ALAL 3BQUB 3NPSB 1MHCA 2BK8A 2AEWA 4IJ3B 3T0XA 3TH2T 1DLHB 4OLYL 1J5OH 2OSLB 3N1GC 3ROOB 2XTJE 2R23A 4MD5A 3QHTC 4HZLA 3CFKA 1MI5B 1YJDH 5C6PB 5CJXC 3U7YH 4UILH 4X6EA 5IB2A 4L4TD 1T7VA 1CD9B 1T5WB 1IGCL 3GHBL 1NGPH 4YC2C 1HCVA 1AR1D 1FJ1A 4PB0H 5FUOH 5H35A 3I75B 4Y2DD 3GSNL 3O4LD 3DARA 3TJHC 1Q9WB 1LDSA 3P4OA 3RVVC 4KK6D 4PJFB 2IGFL 2H3NB 4P2OB 1A3LH 3KGRA 4L9LC 4NO0A 5CGMA 2DWEA 1CDHA 1F58H 3SDDD 3PP3K 3ELAT 4H1LH 1AO7E 2EXYD 4UT6L 5FCUL 3FB7B 3R8BB 3MRKB 5FYJE 2J7LA 1XGQA 15C8L 5HGBA 3KPNA 5ECJE 5E6ZA 1PQZB 1B2WH 1LEIA 1UXWA 3MRBA 1ZLSL 1LILA 4JFZL 3IB4A 1YUHA 5E8DH 3PIQA 3SCMB 4U33A 1FG2A 3GSOB 2Z1PA 2Y5TA 3S3SA 5C7XL 1LDPL 4S2SA 1M71B 4EUPG 4I18A 1FFPB 1VERA 1NGWA 1V7MH 5F6IC 2P8MB 2K7PA 1U3ZA 3BSZL 3QNXB 5D2LA 5CEXB 1H3WM 3PGFH 4JLRB 4MS8D 3SKMA 4X7EC 4P46B 3RHWK 4NKIL 3HRZB 2GT9B 5E1HB 4DEPC 2X4TB 1PY9A 4XPTH 4Y4HC 5E8PB 4D94A 3VRJA 5I74C 1T21A 3HZYA 3F7QA 3C9NB 1HINH 2A6DB 5KSBF 4QHLB 3I3BA 4DAGL 1EIBA 3GMNA 1U8LB 1AKJA 1MFAH 4P5MA 3ZDZF 1XF4B 3D25A 3T2NH 5D72H 1DEEB 1OAUH 4U05A 4TSAL 5DVNA 4KV5E 4YGAB 1R3JA 4GRLB 4ZO9A 4PLJD 2OCFD 5J13C 5HI3D 3RKPA 3TCLB 3JWOL 1FSKB 4IS6B 1MFCL 4HHAA 5EBGA 4CMHB 5ALCH 1U3YA 3W0WB 4LLVB 3SE3A 5JA8B 3GFUA 1FNSH 3QNZB 2HJKA 2ZNXA 1CK0H 1YPZA 2BC4B 1OLLA 4JHBA 3SKNB 4FXKA 1QRKA 4EXKA 1JMZA 5L2KA 3GKWL 5DJCB 4X9BA 1TENA 2NZ9C 1SYVA 4HS8L 4PS4L 5C0JA 1JGLH 1HHJA 3W2DH 5CD5C 1A9EB 1JVKA 4DVBB 4P2QD 1I1YB 5GGUA 2VZUA 4P2RB 4ORZC 2JIXB 4P5TC 4CL7A 4MA8H 1NMAH 3GMQB 1JUFA 5C3LD 1J1PL 5I17B 3LKQA 5JPNA 4NDMA 1FC2D 5I9QB 1UA6H 4CJ1A 3VGHA 3W39B 4LBEB 2V2TA 4QRTB 4J8RB 1DQLH 1JZ3A 5ICZA 1KB9K 2EYSB 3PDDA 4BSWA 3OXRB 3QUYB 5JOPD 3DLQR 1BD2D 3MODL 3MLPA 4X80H 5K33A 1QA9B 4EQ3A 1TVBA 3EOYG 3G08A 2H2PC 3GZKA 2NLJB 4YDIH 2YPKB 1H15A 3EYVB 3G5ZA 5BRZA 2BY0A 4MNGA 4JY5H 3T0WA 1XIWA 4PRPE 1CFNA 4G8FB 1RUMH 3K0WA 4IHOA 1BQHB 3IYLW 4O9HL 2P7TA 3PL6D 3TBTA 5IOPA 5C0RL 32C2A 3BPOC 1GOGA 4ELKA 3VFMA 3V0WL 5EO1B 1LE5A 2ED9A 1RUKH 4XP1L 2J8OA 2OQJB 4MHHI 4YUEH 1U8OB 3O6LL 3DUUA 1X3DA 1WBXB 3QCUH 4HH9A 4R8WH 4R26L 4OD2A 5EBWB 1G7MB 1XGUA 1GGBL 2EH8L 4JRXE 5DJXB 5J8OA 4P23B 4M6OH 4U1IB 1P69B 2R69H 3VG9B 3IDXH 4UT9H 3VXME 3P30L 4KJQD 5L88H 5HGAB 5C07E 4PJIE 1KIQB 4QOKD 1N2RA 1AXIB 1F6AA 5D7IB 4G6ML 4PGCB 3H9SB 5LGHH 1NDMA 3B2UD 4YHMH 3MLUL 4MSWA 3K8LA 4X6BA 5C86A 1S7TB 4BFIB 4HK0B 4YDKH 3GMMB 1S9WA 4F80A 2AGJH 3MBED 1BWMA 3RUGF 1NLBH 4X0KA 1D5MB 4PJGE 4NPYA 2DYPB 4LLDB 1KTLB 1UC6A 1MFEH 4MAYD 4Q9RH 1YECH 5HHNB 3PWPB 4KKBC 3GB7A 1VPOH 4KTEL 4ODTL 1WFNA 1JRHH 1OGTB 4MDJB 1E4XI 3MRIA 1OAYL 1QFWL 3MLRL 4ODSL 1FCGA 3DX9A 3SKJH 1IQDA 1VENA 3BE1H 3R06A 1AO7A 1NC2A 2J88H 4Z7WF 4HUKB 4ODUB 4NM8H 1L0QA 3BVNB 4JGUA 2ZUXA 4Y5XA 5DUMH 1JPGA 1G7IB 4X9GA 3SDCB 1NCDH 4XCCH 4XTRD 4HIJB 4P3CL 1ZHNB 3NCJL 3JV0A 4OGZA 1J1XH 2BJML 2YPLA 5TFSL 2ADFH 1NC4A 1T89A 3TFKD 3GBMH 4L3CA 5DR5L 5TDPB 4XBPB 2HWZH 1CD0A 1U3HA 4NRZA 3KHOA 5EPMA 1HZHH 2OR9L 1EDQA 4LVHC 5EO0B 1MRCL 5AYUH 2M8XA 4GRMB 3VXSD 1AFVH 1RJYA 2IH1B 5C1MB 2QSCH 1HXMA 1N3NB 4P9MH 2FRGP 4ZOCA 1SJHA 3QG6B 3EYQC 5I1DA 4PPTA 4AT6B 2OTPA 1URLA 4OLYH 4U1HA 4FQJL 4Z5RA 2X4QB 1IQWH 3F12B 1IGIH 1CDJA 1JGDB 3RWHB 1QQDA 1BIHA 3D48R 5BJTA 3NCEB 4WGVB 2A9NL 2AXFB 1BVKA 1NLDL 4D9RE 1JPST 3PJSA 2PYEE 4YZFF 4M1CD 1VKXB 3QDMD 5KG9B 5GJSH 1KULA 4GKOA 4NQDD 2H1PH 3EUUA 1VEMA 3GSNH 5AWNL 3BZEA 1B4JH 2X2YA 4HUUA 4UTBL 2G5BA 1MFBH 5CLTA 4JFDE 5J56B 4KRMB 5ACZB 4P3DA 1NFIB 5EOTB 3L3OA 3DRQA 5IB1B 2VLJD 2FL5B 4UT6H 1JGVL 5FCUH 4X98A 5IW6B 2C1OA 4JE4B 5D93C 1WT5C 4R97C 15C8H 1I8KA 3IF1A 1VGEL 2B5IB 1S9YA 4HIHB 4NQEE 2DL9A 4R3SA 3NACL 4UDUA 4JFZH 4PG2A 1U42A 1YZZA 4R0LC 1KJVB 3ARSA 5K59E 2NX5B 4LLUA 5HHQB 3CSGA 1RZKC 2FGZA 3EDJA 3FOLB 5KSAC 1FO0L 2VL5A 4OFKA 1BJMA 2X1XR 1W8NA 5SWZD 3FOMB 1LO5A 4LOUC 1L0YA 2MTPA 3FMGL 3F5WA 5SWSB 3VWJC 4W6WB 1CE6B 2R2CA 1QR1B 1GJIA 5IROC 2BVQB 3AAZA 4R7DB 3NA9L 4ETQA 4GQPH 5C0BA 4MZ2A 5EUKB 3VFNA 4M6MH 2A74B 5FUCC 5E2TH 4JR9L 4ZXBD 3GBNH 4U6VH 1TTFA 3JSSA 1D9KD 1F3RB 3A67L 1Q8MA 2OTWB 3TPUA 3DMMA 1LEKB 3K8KA 5JZ7D 4IBLT 4ZFOA 3H9YA 4DAGH 4GW1A 1FLRH 3SE3C 1NCUA 1IC5H 5GS2H 3KNBA 2XZAH 1BM3L 4LFHG 4Z18A 5JPMA 4V2BA 3ESVF 1YDPA 3HLAA 2JF1A 4UTAL 1QNZH 1FNGB 1U8PA 4EIGB 4MJ5A 2EDTA 4PJAB 3DRTB 5D4QA 4B0MM 1NL0L 3SDAD 4QRUB 2OK0L 1NCWH 1LO3L 1I7UB 3HC4L 2D0GA 4EVNA 1WBYA 1FGNH 1ND0A 3L7EB 4O2FA 5IEHB 5J11B 3OR7A 1FYTB 4G9FB 1SYSA 3FKUS 4NCDA 2GTZB 2YUXA 3ILQD 2DQUL 4LEOB 2W0PA 2VXUL 3U4EB 1S5HA 1T80A 4DZ8B 2PNDA 5CEZL 1T1WB 2NR6C 3BKMH 2VRAA 5E2WH 2ICWI 3GSQA 1XIWC 4PY7B 4TTDC 4BKLB 4Y5VB 1OHQA 1B0RA 1MI5E 4BUHA 4FFWC 1A64A 4H0IA 1MCJA 3BUTA 1M6OA 4LLQB 2YK1L 5E94B 2CUHA 1UWGL 4ZUVA 1EZVY 1CD8A 5INCB 4P59H 1AGBA 3VDBA 3N85L 1UT9A 2Y7QA 1RFDL 3KPSB 4K94H 1RK1B 3NCFB 4N0YH 3ZE1F 5IB3A 3ULVE 2VLKA 3V6FB 1EHLL 1OGAE 5GS1A 3MRQB 3L7FA 2RAMA 5DD5L 5SX4H 1X9QA 4O9HH 4OD3L 4XP9H 3DO3A 1B6DA 1RPQA 1JHTB 1JI2A 3OR6B 3QIUB 1D5ZB 3ARBA 2YA1A 4F57H 4OCRL 1SM3H 2AK1H 3PHOA 1IARB 3QI9D 4XP1H 1YEHL 4K8RH 4IRSD 3KPTA 3KYKH 3E0GA 5D1QA 4M6AA 3DSFL 5FYKE 5DT1L 1IC4L 1GGBH 1CF8L 5DTFA 2EH8H 2CKNA 4JG0L 3VFSB 1U95A 3JZ7A 1IC1A 1H3XA 1HWGB 3NIDE 5EU4A 3WS6A 1VHPA 5LQBL 3ULUL 2MSPA 3SDXA 4FQPA 5BCAA 3AU1B 3CSYB 1ZHKA 3CUPB 5F96H 3RZCB 3MLUH 3MV8D 1NFKA 4PJ7B 4RFNC 5HYEA 1KCVL 2GFBB 1FE8L 3WJJA 5E8OB 1A7BA 5C0DA 4AEHL 5IKCB 4UI2A 3OKEA 4F33B 3D39A 2Q86A 4I3SL 4FG6C 3QE5A 1BF2A 5HI4C 3GRWL 1Q1JL 2QQLL 4GFTB 5HYJA 2YPVL 4LPYA 5D9SB 1VB9A 4Y5XC 3QUKA 5IHZB 1I8IB 4X5WA 4RMRA 4HMEA 1QSEA 1RZJL 4C56A 3IDIA 5I15H 3MV9A 3U7WL 2QJDA 1CQYA 1JPFB 2IADA 5BMFL 1F8TH 3O9WB 5HGDB 3MLRH 4LCWA 5F1IB 4ODSH 1UYWH 1UXSB 4U1NA 1E27B 5HDQH 1DDHA 3QIBA 4WJ5B 3JV4A 4WI5A 3UTSB 5E2VL 4CADA 4HG4K 5EN2B 3VXTB 1AHWA 5I19L 1U3HC 1IEBA 2UY7A 4G5ZH 4L4VA 3O6MH 4F7TB 3SGEI 1UWXH 5CP7A 2QQNH 1IKNC 3KXFE 4Y2OA 2VDLL 3BD5A 4G6KH 4PRPD 3QP3A 2NYYD 3X3FL 3SBWA 5T33L 5D7JA 2BJMH 2FEEL 4K3GA 5MENB 2D7MA 3MR9B 1PJ9A 1R3HB 1OCWH 1ORSA 5DR5H 4PJ9D 2FJGA 4MNHA 3CLFL 5B8CC 1MCCA 4HS3A 3IFPA 2VIRB 5D6DA 5T1KA 4NJ9H 4P5KB 3FFCD 4Q97A 1AIFB 4M1GL 4NNYB 1R5IA 3GJFA 3WNNA 3HMXH 1S3KH 1JHKH 2FH8A 3O2WL 3PP4H 3HHRB 1AD0A 2YEZB 1XH3B 4JRXD 3QPQC 1TJGL 1OSZA 3EGSB 5DRNB 1J8HA 4MHHG 5ANME 3VXMD 3LS5L 5DLMH 1KF9B 5IVXF 4XZUA 5C07D 3MXWL 5MEPA 2HT3D 4M8VA 4HXAL 3FAWA 2A9NH 3JTTA 4W6YB 4WWKB 3RPKA 1BJ8A 5IM7B 4OJFL 4UDTB 1HYSD 2CIKB 3FZUD 4LPUA 4MX7B 3O0RL 4U1LB 5FK9B 5D2NB 3VFUB 1N4XH 1JGUH 5B21A 9CGTA 3CFCL 3ZYJA 5EA0L 2BVOA 2D9QB 2WUBL 4PG2C 3MOBL 4JKMA 3HE7D 3O41B 2EDYA 1RZGB 3KPOB 3TN0B 4PGBA 5CMAA 3TZVD 4UNVA 2YHGA 2LU4A 4DGVH 1A4JA 2R2HA 2X09A 5CJQL 5C08B 2IANE 4QXUL 2XG5A 3WNMA 1OVZA 4BUGA 2UZXB 1OTSC 1QPXA 4YXHL 5GISH 3QEQB 5J1SC 1WSST 4LVNB 3QZWG 5CJ8A 4OFYA 1AY1L 4JDVA 5D7IE 2QQKH 3P9MA 1F3JA 5EZIL 2EXWD 3CU1A 3U7AA 2R0ZH 4PJ5A 5F7MC 3BP6B 2ZUUA 2NNAB 3N0PB 4NC1E 2BNRA 4FQXC 3PWVB 5GGTA 1A47A 5JO5A 1WWBX 3DGGB 2VDQL 4NQVB 4HIEA 3LB6C 4Y5YA 3CH1A 4PUBL 1UM5H 4MQSB 1K4DB 4GAJL 1A9BB 4JR9H 3V7MA 4BFBD 1AGEA 1OGAA 3F6LA 3QXUA 4NYLA 3PWPE 5AD0B 1G7LA 5LCVL 5B3NA 4XNYH 1YQ2A 5IGXL 2MKWA 3CZJA 2EIEA 3DX6B 3PHSA 3GJFK 2DQGL 3UCRA 1T7WA 5J9PB 3JVGC 3OKNB 5F7DB 4JFFB 4PR5A 3LAFA 3DVGB 5E2UL 1XAUA 1P5UA 2UUDK 1T20A 4PJCF 5K93A 5C71A 1KFAL 4OZGA 3IKCB 1KTRL 3OAYK 1ZSDA 3UPAA 1JYWA 2AK4E 1HIML 2CRIA 4RGOL 4ZPTA 5F3HA 5MI0B 3TLRA 1YEJL 2MCG1 1OAQH 3BN9C 1P4IL 3RGVB 5KTEH 3C5SB 5EB9A 5CILH 5DJYA 4EOWH 3HMWL 5IB5A 2X4UA 3DO7A 4D9RD 1KJMA 5HYSA 5A16A 2VDKH 2PYED 2GK2A 3HC4H 3LSOB 3NZ8B 1UH4A 1T04A 3DI2B 2VYRE 3MJ9A 5DHVH 2PR4H 4PRBA 2YXMA 1T4KB 5IHUL 1KPUA 3P0VL 2VERN 4MDIA 3HS0A 4S1RH 2VXSL 1HHIB 1OM3L 4K3DL 4Z95H 2XOTA 4DW2L 4NN7B 1PBYA 5JXED 1XGRA 1AP2A 2JJWA 1YQVL 5E56A 1NAML 4KRPC 2VAJA 4WU7A 5IIEB 5GS1C 3LQZB 1WISA 5C09B 4RGNC 3OKMA 1P7KA 2XA3A 3L5IA 3QDGA 3RVWC 4CDHA 2XKSA 1DLFL 2B7DT 3DGCR 1INQA 3WFZA 3B6SA 3WL9A 1E4WH 3ARBC 4M8QB 2Z8WC 1WZMA 3FQTB 1KC5L 1T1YA 2NY6C 3R8QA 3B2VL 4F2MA 5A3ID 5BQ7B 2F53D 3DV4A 4GUPA 3MRGB 1FL6B 5TE4L 2Z93A 1A6ZA 3V52H 2PETA 2ZG3A 5DD5H 4HIXL 5LJYH 2AQ3A 4WUUB 5E08L 1MAML 1L9NA 2YRPA 3MLVH 3RY5A 1K6QL 2E9JA 2CDEB 5EIIA 4FXGA 3HE6B 4NNXB 1BF8A 3IJYA 2VSCA 3UZVB 3WS6C 5HBBA 4HWZA 4BQ8A 3L5WB 2P47B 4LGRB 4JM4L 1ODAA 5IMKB 2HT2D 4OKDA 1CFTB 4TPRL 2L0DA 3ARGA 4K9EH 1PD6A 1G1CA 2FO1A 1P4BH 3QO1A 1ZGLP 2DAVA 1NEZB 4ZD3L 3MMEA 5CEYA 2P43B 4J4PA 2Y36L 1JIBA 3SE4A 5ID0A 2NX5E 5D1ZB 4WO4B 1JGEB 1LO4H 4YXLH 5EBLA 1TDQA 3MXVL 5J1AB 5K9JH 1AE6L 5C9JA 4XWGL 3UC0H 4RAVA 2HN7B 4N1HB 3T0EC 5L0QB 3C5JA 3UAJD 4EUPA 2IPKB 1K8DB 4Z76A 4LLWB 3WFEL 3MACL 5JHDE 4ZFGL 5JW5B 2UZIL 4X5XA 2BNQD 2XPGA 4AEHH 4N8VA 4FABH 3RDTC 4GBXB 4PRIB 1U58B 4QY8B 3GSVA 1Q0XH 2QQLH 1A2YA 2YPVH 4NO3A 4NCC2 1N0XL 2MOVA 3BQUD 4L4TA 3ZTNL 2MPAL 2YN3A 4E41B 2VZ3A 4NQSB 4QYOA 3FONA 3S5LG 2F58H 1MI5D 5D7JC 2OJZL 1G0YR 2C3XA 5E2VH 3MCG1 1EJOL 5I19H 5KSBA 4JZJB 1FH5L 2LTQC 4XVUC 4NKMA 5CBAB 3OAZH 5D6DC 3WO4C 1DANU 4K7PX 4D0DB 3VXPB 3OG4B 5CZKA 3IJHB 4P2OD 3DJ9A 3VWKA 4K2UH 5GSRB 4WV1B 4HC1A 5SWQB 4G9FE 3QO0B 2GI7A 3TIDB 1QKZH 4PJHF 2FGWL 4H1LA 3ECBA 3PGCB 5T3XL 1SBSL 4JN2A 1KNOB 3BXNA 4GG6F 2IH3A 4F7PB 1I1AA 4C83A 3CCHA 5BO1L 4DCQA 4Q6IB 3O2WH 3H9HA 1J86A 4I0PB 3QIWB 4JHAH 4CVXA 2VITB 3U6RA 2BDNL 1W8OA 1CLCA 4KRLB 3ZE2E 1DFBL 2JELH 3SCMD 2FATL 5EZLA 3UJJH 3WE6B 5IK3A 5I8CA 4NUGH 5HY9A 3TO2B 4WEBL 3HB3C 4PIRF 3T65B 3UPCA 3A6BL 1YC7A 1ZAGA 1EFQA 2LU3A 3L3IB 1XT5A 5IWLC 1OTTD 1Q9KA 1WGOA 3C60C 2Q8BL 2FECI 1YN7B 3WDIA 4CN1A 4UNUA 3LN4A 4P46D 3GEWB 5DZOA 5J06A 3CFCH 1JZ7A 1DUYB 1I7ZB 3QEGL 3CFJB 2FO4B 4RQQA 4LF3A 3MOBH 2G60H 4JHWL 1TQBC 3QHFL 4PJFF 4C58B 1FVEB 3PV6B 4XXDB 4OB5L 4NWUL 2UZYB 4MA7L 5CJQH 2XXCB 1R24B 4QXUH 3V6ZB 1C7SA 1KYOJ 1HSBB 2HKFL 4FXLA 4PRAB 4GRLD 2ZOLB 4MA3B 4OM1H 2JJTC 5EZIH 5F3BA 1T03H 1RJCA 4Y5YC 4M7KL 1G9ML 2JTDA 5T3ZL 3OGOE 3W0WD 3CFDA 4PJ7E 1ORQB 3TIEB 5EOCL 3IU3A 1XR8B 1DCLA 3UTQB 3AY4A 1YEKL 4CW1A 5DK0B 1ZA6A 3DVIA 3MROA 4BFEA 2BVTA 3O4OB 4FQLL 3Q0HA 2VDQH 4UAOC 3MRJA 5L2JB 4LLYA 2XNAB 4RWHA 3MO1B 1ZGLA 5IEKA 3T3ME 3WIFA 4D9LH 2B1HL 2HT4C 5LCVH 1T22B 4P2RD 4WUKH 4IOSD 4TNVF 2JIXD 4HS6A 2P24A 4TUJB 4MD4B 2NTSP 3VGEA 4D0BA 3Q1SH 3QUML 5BVPL 4Q58C 3MJ8A 3BJ91 3G5VA 1I1FB 5J0BA 4P4KA 1SJXA 4LU5L 3RY6C 1P5VA 3HC0A 4E42A 3QCTH 3UTSE 3QUYD 1QR4A 4JFOA 3PL6A 1HIMH 1OQXA 1MCSA 4K7PL 1P4IH 3RX8A 3CFEB 4ODXB 2BOCB 5HHMB 1GXEA 1JNNH 4I1NB 2YUZA 2A1WL 1I9IL 1NUNB 3OTTA 5DMKB 5MENE 5FOBB 4L8BA 3UJIL 4OZ4B 3P9LA 1UJ3B 3MRRB 4AJ0A 1NCCH 3G6JE 5ETUA 4O02H 2VXSH 1SEQL 3IAPA 1U8NB 2R0KL 2GJZA 2WV3A 4JB9H 4YH6A 3UTOA 3O3BA 4DW2H 1VADB 2HFGL 5BZDB 1A7QH 1I7TA 4LSQL 3MA9L 1OP9A 2FH6A 1KN2H 3WO3B 3O6KH 5DRZB 4KJWD 4EDXB 1QSFA 4P23D 5D7SL 4RFOH 1XF2B 5CD3B 2CK0H 1HNGA 2WQSA 2W9DL 2ATPA 1DLFH 2Q7YB 3HA0A 3CH8A 3H9SD 1LD9B 4UINL 1D5IH 1KC5H 3VXRA 3WDJA 2ZUSA 4EI5B 4NJAL 4YFEA 2ICWJ 1YEFL 5DEGB 2ZJSL 1N8ZA 5D2NE 1WFUA 4ISVA 2DLFL 4O51B 3T04D 4G9DB 2ICEA 2WP3O 2VN7A 4JN1H 3BZ4A 5E08H 2X89D 4JG1H 4UB0L 4GXVL 5TE6L 2H32B 3B5TA 3MLZL 2DYPD 1K6QH 5EC2A 3T77B 3IDGA 3OJVC 4Z0XA 3SE4C 3CVHH 4D9QE 3PWPD 4XVTL 4P9HC 1HYRC 2V5SA 5TDNB 4GXUN 1RQ5A 5C08E 1QVOA 4ZTPH 3BPLC 2X70A 1I9JL 3MV01 1P6FA 3F7VA 4GKZB 1BQHG 3QEQE 2VMFA 4S1SL 3KJ4C 4LHQB 3RAJH 4HJ0D 1II4E 1MVUA 3H0TB 1JYNA 3QFJB 2ZPKL 4FQQB 4PRDB 2OZ4H 3MXVH 3QT2A 1Y18B 5DRWB 1S78D 3SDCD 1RJLB 1LK2A 2JB6B 2BY3A 4MNQB 2H6PB 4LKCB 1QYGH 3ISWA 1UWEH 3C6SA 1YN6B 5FF6A 3EHBD 3GIVB 1HH6A 1TITA 2QR0B 5IP4A 1UKSA 5I8EB 4QTHB 3UJTH 3WKNA 3O8XB 3U4BL 3LDBB 1EMTL 4J12A 3S34L 4NZJA 5T1LA 1AR1C 1S7QB 2XWBB 1NCAH 3AS1A 3C8KB 4Y2DC 1IAIM 4HKBB 4KK6C 1CN4A 2VUOA 4X6CE 5E7FA 3MA7B 3L5HA 5FUZL 3G5YB 3GI9L 4IRJB 1IGFL 5I18H 3ZTNH 3L3JB 1HQ4A 4XWOD 3SDDC 4HWEL 3X11A 5IJVB 5GGRB 2QADB 1CG9B 1HEZB 3QDMA 4EN3B 1GIGL 4PG9A 3C09B 2AV7B 4Z7NE 1I3GL 3M07A 3VH8G 4O00A 1WWWX 1PG7H 4TOYH 4NFDA 5E9DB 2X9XA 5SX5H 6FABL 4OI8A 4OZHB 2AJUH 3LKRA 3IFLL 2F6AA 5BZWB 5CHNA 2EIZB 4RIRA 5AEAA 3GSNA 2MQ0A 4FQ1H 2NY1B 1QRNB 4F37K 4KI5F 2HVJB 2IBBA 5D8JL 4N68A 4CUCA 2BHUA 5KVFH 3E6FB 2DS4A 4UMGA 4OGYL 1FVDB 3T4AB 4AYFA 3ALWA 1ZT1B 2GSGB 4YX2L 4FTVB 4OLUH 5FGBA 3MYJA 1QBLL 2F8OA 4MS8C 2M1KA 1YNTB 1SBSH 4QRPB 1T3FA 1KLFA 1U91A 1M7XA 3CK0L 3LN5B 5C09E 3VJ6B 1JZ4A 4PREA 3T0VA 5SWZA 4WIQA 5E24E 3U9PL 5GGQH 5H37G 3D18B 4TUKH 1EEQA 3V5KB 1DFBH 2FATH 1EH9A 5F88A 2GKIA 4WHYG 3MRCA 2B4CC 2NX5D 3KS0J 2BSRB 4H5SA 4XMLH 1DBAH 1UVQB 5I1JH 2EEDA 4KI1A 3EOBB 4YBQD 1IL1B 2E8YA 1N5YH 4KVNH 2R8SL 3A6BH 5SWSD 1QO3A 1OP5K 2D7PA 1ZVHA 3HNSH 3EYUL 4PLJC 5F9JA 5EUOA 5HI3C 3VXUB 1K2DA 4WUUE 1CLZH 5FHBL 3PABB 2XRAL 1CL7L 3G6AA 3LEYH 4O58L 4Q6YA 5IFJA 1NAMB 3ULSB 4K3EL 3RVUC 3DX8A 3IDYB 4R7NB 2WBJB 1HI6B 1U8IA 2YD5A 4HXBH 3V9FA 1GZPA 4ZS7L 1WIOA 2HP4A 2R39A 4NWUH 5DHYA 4MA7H 4M7ZC 1GGTA 3REVA 1UCBL 3G6JA 2C7UA 4NO5B 1T2XA 4DWHA 3MCKB 3CSPA 4G42B 4MB5A 3JBG7 3L3GB 3F7RA 4LSSH 1FAKT 5C0IA 3TCXA 4BZYA 3QH3A 2NTFA 1AGFA 1BZ9B 3FQUB 2GYSA 2EDLA 2QSQA 2HJLB 4XNQA 4BQCA 5T3ZH 4X8JA 1F00I 5TF1L 1FDLH 5EOCH 3BPNC 2BVPA 3P0GB 4M1DL 3K2MC 1WCBA 1YEKH 1LMKA 2P5EA 2FZ3B 5FECA 3EFFB 5GS0D 1NFDB 3I9GL 5GGSY 1NBZB 1XZ0B 1TXKA 3FQXB 3PXJA 1FYTD 4G9FD 3L6FA 1I1CA 4KMTH 3PL6C 2B1HH 5F7EL 2ZUQB 2IC2A 3PNWB 1UEMA 4PBWD 2Y23A 4MD0B 4YBLB 3U36B 5CZXD 3STZB 1A02N 2XQYG 2R1YA 1IVLA 5FYLH 3I2CL 2VKWA 1F6FB 2IAMB 2DL2A 2DM4A 3O6FB 5HGHA 5DJ2A 2YD4A 3L1OH 5JHLL 2EKJA 2FNBA 4UIMA 1BOGA 1N59B 3QHZH 3KPSD 2VUYA 4YIQA 1SMOA 4CVZA 4NZUL 2D7TL 4YHLL 4KJQC 1S9XB 1KBGL 1MCIA 5GGVH 1EEYB 1WFOA 4YHZL 1NBYB 4N1CA 2RCSH 4IRSA 4F7MB 4YJZL 3W5NA 4LGSB 3LV3B 1F11B 4OUOA 3UJIH 1IT9H 3OSKA 4PJAF 1W72A 3QIUD 3B2UC 3BO8A 4KZDL 3EDKA 3BIKA 2VLRB 1QG3A 3NCYS 3UYRL 4JO1L 3H2WA 1KV3A 1SEQH 3QPXL 1F2XK 4XP6L 3D0VB 3MBEC 4NBXB 3BW9A 4LSQH 3D9AH 4MXWH 1K5NB 2I07B 5HHPA 2EDQA 2UY6A 2VB5A 4LDOB 4P48A 1CDGA 3U46A 4MAYC 4OCXL 1HDMB 3U2SB 3MV8A 2J12B 1I3RB 3OX8B 4XRCB 1CIUA 4M9PA 4HIIA 2DICA 3TT3H 1J0IA 5I16B 2XN9A 5DVLA 4APQA 1YYMH 4A6YL 3CX5J 2LVEA 3GMPB 4UINH 3RZCD 2DLIA 2YKLL 4UQ3A 4AH2A 3DUHA 3IDMA 3FRUA 4H20L 2FBOJ 2FD6L 4LP5A 2KQMA 5AAWA 1CQKA 2DLFH 5IVXA 4U3HA 2YD6A 4EDWH 5CEZE 1D5BB 5IBTL 1H8SA 1MRDL 3MLZH 4L3EB 1SJEA 4PGEB 3LD8C 4XTRC 3S97C 3D2UB 2G75A 3H7BB 1MFDL 3IT8D 4XVTH 3D85B 1WUNT 3I6GB 3TFKC 1PEWA 2VXVH 1MF2H 3NTCL 1GGYA 3IVKA 3BKCH 4IRZL 5BOZG 3O9WD 4ZUSA 1XCQB 2C3GA 1BBJB 4FZEH 1V3LA 4XNUL 1DE4A 5EDXA 4ZUUA 4RMUA 4W70A 4OZFA 3UXFA 3A6CL 5DUBA 4QRQA 5DS8B 3UTSD 4Z7UE 1IBGL 5T5NF 1CLOL 4PY8I 5IF0A 3IU4L 3H7LA 1N7ML 3IFNH 4HWBH 3EO0B 4NUJB 1NBVH 3I50L 4D2NA 1A6VL 1IGML 2ZSWB 4YAQB 5MEND 2VISB 3K80A 4F7EB 1X5LA 4S10A 4GG8B 5T5NG 2ARJA 3WD5H 1A22B 4CN6A 2J5LB 4M1CC 5D6CA 4PJ7F 4BJLA 1M7DA 3MGAA 1NSNL 1MWAB 3VD5A 5GGSA 4JDZB 3IAGC 3D69B 3ULUE 1E6JL 1KCLA 2ATKA 2AKRB 5B4MD 3NA4A 3HMXA 1CR9L 5MEOB 4ORGA 3HZVB 4P2YA 4HWEH 3B9AA 2E9IA 4S1DD 3W81A 3I84A 4GS7C 1O7VA 3MNWB 1I3GH 2P44B 4Q9QH 3DTXB 1MUJB 2CDFB 3SE9L 1AC0A 1KB5B 3LKNA 4WWKD 5HHME 4Z7QE 4N0UB 4CU7A 5CJ5A 4BQ9A 2Y06H 1BX2A 3H3PL 2VR4A 3HE7A 4L8CA 3T4YA 1N0LA 5J57B 1CGVA 3K4AA 1C12B 1L0XA 3TZVA 1FFNB 4J3UA 1HSAA 3FT4B 1A7RH 2P8PA 4YDJB 3KPQA 1B88A 3WLBA 1DBJL 1EGJH 3DV6B 3KLAB 3RWIB 3FQRA 1G7QA 3NFNB 3HG1B 1ES0A 3KPPA 4OGYH 4RNRB 2I27N 1PZUB 1GL4B 3QFDB 3SJVE 1HXYB 3TN0D 2XA8H 4D9QD 1QBLH 1K4CA 1XGYL 2AXJA 2GSIB 4XCEA 4KK8D 4U1KB 4UIKL 2IPTL 2XI9A 5C08D 3HI5L 3CK0H 4L8DA 4RAUB 3M45A 2GY7B 3Q5TA 4ZXBC 3CIQA 4H88H 4TQEL 3HI1B 1E4KA 5HHXL 1D9KC 4NWTH 3QEQD 1V5JA 1G6RH 1YMHA 2I5YL 5KOMC 1DR9A 4LRIC 1UWXK 2JKXA 1KT2B 2AP2A 3FCTB 4U4BA 1LEGB 3RU8H 1NKRA 4JY4A 3QXWA 3TBWB 4OT1H 4KDTA 4Y1AB 3SOBL 2DQIL 2V9TA 4JO4H 1CLYL 2Z92A 3GI8H 1CL7H 1FBIH 3ORJA 2AI0L 4OF0A 4HKZA 5F44A 5DXWA 1DVFB 3SDAC 4NM4H 5HXMA 2HLFD 4GQ9H 4GAYA 4XNXL 3RL2A 5F7LB 1VFMA 2A2QT 3BP4B 1X5FA 3H6JA 3BPCA 1YNKL 1Q0YH 4JFFD 3BH8A 3FB8B 2FYYB 1HILB 2AV1A 1T1ZA 4ZUWB 4V1DB 1ZHBA 3PWLB 2YD2A 1IGTA 3VFTB 3ILQC 1JBJA 1OARL 4JQIL 5C0AB 1RK0B 3EZJB 3WHXB 2PKDA 1Z9MA 2P8LB 1R6VA 4JPKL 3RGVD 3MYZA 4WDIB 1SBBA 3FO1B 4KKLD 4MNQE 3VW3L 4N5UA 2R2BB 2Q3ZA 2A6KA 3ROLB 4M48L 5TF1H 4AENB 4NKOA 4Z7OF 2FEEI 4HGWA 1BJ1J 5DHVA 1KLUB 4LDLB 1G7JB 4R96B 4JDTL 3IDNA 5JDJA 1DUZA 2V2WB 4DK6A 1CFBA 4HFWB 3O11A 5ELIA 4XAWH 1D5XA 3QUZB 1E6OL 5GJTL 1SY6L 2GITB 4JRYE 4XT1C 2NY3B 4K94C 4O2EB 5IG7A 2GY5A 5E8EB 2QTEA 2FX7L 1KYOK 5DVKA 5C09D 1MAJA 4RGMB 4AIZB 2ZKHL 4MXQD 4XPFL 2Q76B 1EBPA 4BH8B 3MJ7A 4IRSC 1YY8B 2LU7A 1DBBL 1TETH 2P42B 4X7TA 4XPGL 3RY4A 5K9KA 1RU9L 2H8PA 3INUL 4KC3B 4OZHE 3B4NA 3QCVL 4ZNEE 4NZUH 3CVIH 4PJEB 3RJQB 3LS4L 5C0CA 4PV8B 2W38A 5FOJA 4D3CH 2ICWA 1A6TA 5BS0E 4PRNB 1FC1A 2YA0A 4Z77A 4YO0B 4Z7UA 5HVFB 4WUUD 4M6NL 3V95A 4W4NA 2Q20A 1JE6A 2V7NB 3TV3L 2DJUA 5HVHC 1C5CL 4FTVE 3HE6D 4CJ0A 5I76B 3S3PA 1ROWA 3FRPA 1EK3A 3HAEB 4XP6H 3VFVA 4QRPE 4IEFB 3D3VB 2W07A 5AZEL 2ZCLL 4I0CC 2V17H 3RTQB 1MCOH 3MRDB 5BXFA 2DQTH 2ERJC 5T1MA 5DJ0A 4OGAD 4FQ2H 2NY0B 4UUJB 1QHOA 3OZ9H 1J0HA 3MRLA 5D1ZD 4PJHA 4MA1C 4WO4D 4WFGD 2Q6WB 4X4ME 4JAMA 4X7SL 2AJ3B 2VR9A 1QLFB 2W9EH 3VXOA 4GG6A 1IAKA 1HK6A 5FDWB 1I9RL 5I66A 3VXUE 4JGMA 4OI9A 1JZ5A 1R0AL 5D5MF 2FIKB 1QEWB 4ETYA 3U30B 4JZOB 2FX9H 1J87A 3BQUA 1U2CA 2PO6B 25C8H 3BGFC 4GBXD 2UYLB 4XCFH 1FNAA 5E95B 1OWRM 4XC1L 3AREB 3ROOA