3HR6A

Structure of the corynebacterium diphtheriae major pilin spaa points to a modular pilus assembly stabilizing isopeptide bonds
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
431
structure length
420
Chain Sequence
RTSIAVHALMGLPTGGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVVQELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALSEPVKTAVDPDATQPGFSVGENVKYRVATKIPEIASNTKFEGFTVADKLPAELGKPDTNKITVTLGGKPINSTDVSVQTYQVGDRTVLSVQLAGATLQSLDQHKDQELVVEFEAPVTKQPENGQLDNQAWVLPSNPTAQWDPEESGDAALRGMPSSRVSSKFGQITIEKSFDGNTPGADRTATFQLHRCEADGSLVKSDPPISLDGKQEFVTGQDGKAVLSGIHLGTLQLESNVMKYTDAWAGKGTEFCLVETATASGYELLPKPVIVKLEANESTNVLVEQKVKIDNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Corynebacterium diphtheriae shaft pilin SpaA is built of tandem Ig-like modules with stabilizing isopeptide and disulfide bonds
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Structural protein, cell adhesion
molecule keywords Putative surface-anchored fimbrial subunit
total genus 94
structure length 420
sequence length 431
ec nomenclature
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hr6A02
2P5EB 4KKLD 4Y16D 4Y4FC 4AEHH 3IXAA 2XZQH 4N0CD 3WS6C 5D2LE 1KLUA 3MUGB 2I24N 1W72A 1JNHA 4NT6B 3RGVD 1EEZB 4BZ1H 1UXSA 2NTSP 1KJ2A 3UTSE 5L0QB 2J8HA 4GO6B 4PJIB 3D1MC 3OV6A 4QRPD 4RGMC 2C7UA 1BLNA 1OTSD 1NUFA 4NM8L 3F7QA 4MJ6A 1MCCA 2QQQA 2Q20A 4P9HC 4JM2C 5TF1L 3CNKA 4S0TD 2X10A 4OM1H 4OZHF 2V5SA 1LDPH 4V2BA 3MBEA 2PTTA 4QRQB 5IJVB 4ELKA 1FJ1A 4LASL 4X6CA 4XZUB 4WHTA 4P2OD 4PB9L 1LP9B 4Q9RL 1BBJA 4M5YL 4KK5C 2XT1B 5SWQB 3H6JA 4FZEL 5CINL 4QRRD 3LQMA 5DA4A 5CGMA 4LCIH 1TMCB 1NFIA 2HFFB 2F53E 4D0DB 1HDMB 5AZ2H 2WANA 2OJEB 3JBG7 5D5MF 3JV4B 3GBLA 1JRHI 4RAVB 4HJJL 5T33H 5J11C 1AY1L 5I1LB 4DUWA 5MEPB 5IFHL 4WWKB 2P43B 2FX8L 2RCSL 1T1ZB 4P46B 3F6IA 4LASH 4LBEA 1NGPH 1H3PH 3GJFB 4GW4B 4NKOA 1A3QA 2VXSH 5HGDA 3BKCH 1IJ9A 5I8KH 4GW5A 1HCVA 4JFQB 1PYWA 3ZL4L 1N5YH 4XVSL 2CK0L 3UTPE 4ZFZB 5JHDD 4C4KO 4KQ4H 1HILB 4RWHA 3OB0H 1I7UB 5F96L 4EJ1C 3MNZB 3X3GH 5C0CB 4QT5A 2V6HA 2ADJA 1EJOH 5L2KA 5E08H 4DFHA 4PJ7E 1QRNE 3MREA 3NIDF 3WIHH 4Y1AD 1ZOXA 3F7VA 1FO0A 3QNXB 4MD5B 2GYSA 4FTVD 2VXVL 2A6DB 1YN7B 4JQIH 4DOHE 1JGVL 3KPRD 4M43L 5ICZB 2ZSVB 5GJSL 1WZLA 5DZOA 5I16A 4OZGF 2YPVL 1CFQA 4JPWL 4Y2DA 5C71A 1HNGA 3SE8L 3M17B 1WWCA 1DEDA 1BF2A 1VADA 2ZSWA 4O5LH 2FH6A 3RDTD 4FFZL 4X5LA 4QOKD 1WWBX 4KTEL 1CIDA 4YHZH 4K94H 1R6VA 3IFNL 4NN7C 1IAII 3NH7H 1UC6A 4OQTH 1S7SA 3FT2B 2RFXB 1SJEA 3W2DH 3VXRB 4F7EB 5D5ME 5HHVH 1UYWH 3VWJA 3PWUA 1RK1B 1QPXA 2CQVA 2EEBA 1JGLH 5KSAA 3AREB 4WW2C 3GHEH 4H5SA 2KZWA 4OD3H 3O2WL 4PJ9D 1YN6B 4Z6AT 2BNUA 5ID0B 4P59L 3L3KB 3HN3A 5F7DA 1QFHA 4FQQB 1DSFL 1N6VA 4FQPA 3IDIB 1D9KD 2GJ6A 5J6GA 2Z0BA 3BGFC 3CU7A 4NO0B 2DI8A 4U33A 3FB6B 3QB7C 5E4IA 3JWDH 4RRPG 4NSKA 1ZEAL 5CEZH 1T0NA 4C54A 4LCCC 1YPZB 4MMXC 1F4WH 1BFVH 5ENWB 5ISZE 5TDNA 1OGAD 5HGHB 1U3HC 1Q0YH 5EFIB 4JLRB 2D0FA 5J3HC 4N1CA 4UQ3B 1OD7A 5IHUL 5IG7A 3ULUD 1QR4A 5CLWA 1S9XA 1X5LA 4KI5C 4M61A 1SYSB 2NR6C 1E28B 2OS7A 3C5ZA 4WW2A 1B0RA 1CU4H 3QI9B 3K7UA 1I3UA 1RU9L 4AIZB 3G6JE 1T6WA 3HR5A 4UINH 2DM7A 1IAOA 3V0WL 5T3ZL 3SDDD 2PETA 4P2OB 1WQVT 4R97C 1P7KA 1S9VA 3LN4B 5FECB 2J8UF 4RMVA 4U05A 4NOBA 5JORA 1EZVX 2JK5A 4QY8B 3FN3A 4R8WL 3RVXD 4N8CL 2V5YA 1DCLA 5HYJA 1LDPL 2JB6B 1G7MA 3WMSA 3SGJA 3TIDB 1BQUA 2FX7H 4MQXD 2Y5TB 3ZT5A 1C5DA 3QIBA 4EDXA 1RI8A 1CE1L 3QXAA 1G9NH 1IBGH 1P9MA 3MUGA 1CZ8L 3HNVH 3ARDB 4ODHH 1UJ3B 3FO1B 1WGOA 3OF6A 1BFOB 1HHGB 4RMTA 3RIFK 1LK2A 4OFPA 3MOAH 3REWA 3QH3A 3VXNA 4OF3A 2BXYA 5C0EB 2XYCA 2A83A 2F5BH 3BGAA 3O0RH 5H2BB 3F7YB 5EU5A 3P77A 4JAMA 1AQDB 4LARH 5E8NA 5ACLA 3IAGC 2P4AB 3DURB 1RIUL 4KXZI 2FRGP 5AZEL 1CBVL 4P9MH 4YUEH 4HWBL 2LU7A 3U9PL 3IDJB 4HIJA 3VMOA 4LAJH 2YRLA 2X89A 4FQIL 3BJ91 4O2EB 5ELIA 2WWKT 2BCKA 4HUVB 4PJIA 4XVTH 5ISZB 2WINA 1X5FA 1JZ5A 1GH7A 4K3EL 3IAPA 5A2LH 2AKRB 1CR9H 4Z8FL 2XN9A 5F6HI 4PBXA 2ZCHH 3NZ8B 4TNWF 2AEQH 1CCZA 3DUSA 4JPWH 5JXEC 2WIIA 1I8IB 3QA3B 5I2IB 1EVTC 3DX9B 5I1JH 4YQXL 2VTFA 3U1SH 2LTQB 4JQIL 5FYLL 2VLKB 5GZOC 5IGXL 3D5OF 3BXNB 3MLTA 4PYHA 1GGCH 3TO4A 3A6BL 4IBLT 5GISH 1ADQH 1Z5LB 2YXMA 3HZVB 2OK0L 5E0QA 3CXDH 2M26A 3SDDB 4MNQD 4LPYA 4RGNC 5E00A 1GZQB 3BP4A 5DJAB 3ZT7A 5FB8B 2F8OA 4UAOB 4KHXL 1BECA 2ICWJ 1FNEA 3W11D 1CFTA 3MRHB 2JJUA 5JA9A 1EXUA 2AEIT 2YPLE 4FS0A 2ZSVA 5HBBA 4WFFD 3KNBB 4TQEL 3T08A 3WL9A 2ZPKH 4IS6A 1CDJA 2O5YL 3CVHB 4OZHE 3LPFA 4J6RH 1Z0NA 5I76B 5CSZA 4LIQH 5EZLB 1H8NA 2AGJH 1NCDL 2IANB 2VDKH 3CFEB 2BMKA 4NQVB 3UXFA 2DIBA 4K7PH 5D9SA 1B3JA 2IADB 2FL5A 2ESVD 3H7BB 3KPRA 4U1SA 4CADB 5C0JB 3DI3B 4PTUB 4KHXH 1VEOA 1Y0LA 4PJ9B 1XF1A 7FABL 2WBJA 4NGHH 5EC2B 5D7IE 1DR9A 5F3HB 4JJHA 4UZGA 3LSOB 1M7IB 2X09A 1YECL 1A21A 4G6FD 3EYOA 3F5WA 4Y19B 2C5DC 4OCSH 3OX8B 3DYOA 1A7QH 2VWEE 2A77H 2NY3C 4QO1A 4FQQA 4MYWB 4APQD 4R90H 4D0CB 1YN7A 3RDTB 3EJYC 2JCCB 4MCZA 5T1LA 2HMID 4LLAA 1H8OA 4QF1A 3ROOB 4QHMB 5TDOA 2HFTA 4X7SH 3QXDB 1N0XH 4NZUH 3MV9E 2DRUA 1FYTB 2OXHA 3I3BA 3X11A 4R2GD 1A5FL 1NEZA 3HAEA 3BZ4A 3IU3A 4GRWE 4F37K 5DJ6B 4HWUA 2ZUXA 3MODL 1ITBB 3GGWB 5FGSA 5B22A 5HGBB 1KIRA 3MRLA 4UTBH 3P3YA 3QUZC 3D85D 4PY8I 4XNZB 3Q5TA 4P9ML 4RGOL 3CZFB 4J3TA 4QRSA 5DJDB 2Q6WA 3OKEB 5SWZA 1MCWW 5C0CD 1I1RA 1MCJA 1RZ8A 2NMSA 1V3JA 4FTVA 1HYRC 4JRYD 5F1NA 4JKPH 4Q6YA 3TBWB 1IBGL 4MCYB 3G5YB 1XGYL 2WUCH 4MB4A 3HC4H 3L9RB 1ZLSL 1A4KB 3ZE0F 3TFKD 4YHMH 2YPLB 4R4FH 3QWQB 5M7QA 3E2HB 5FXCH 2VLJA 1KPVA 1EEYB 3OG6B 1KN2L 1OAZL 4RFOH 4XBGB 1T7VA 1LO3H 2F8XC 3REWB 4JZNB 3I02A 2XI9A 2AJUH 3KXFD 1BWWA 1FFPA 1FL5B 4F9PC 4ONFH 2BVYA 3CC5B 3MMEA 4WU5B 1ZT1A 4IRSC 3JTTA 3WNNA 3ZYOA 4PJDA 4HDIB 3RU8H 1KCLA 5MERA 2A6JB 4ELME 3FFCA 5HHPB 1ZLVH 4KJPC 1INQA 4MA7H 4S1DC 3WUZA 1B0WA 3NIFF 4WWKA 5GSVA 1G7MB 3HG1D 3BP7A 4P2RB 1ZLUK 2YWZA 5FYKL 4I48A 5EBMB 4PJAF 3UJTL 5B3JE 5F8RC 2AJVL 3Q2CA 5GHWL 5KSVA 4R9HA 1UKQA 1KCRH 3STZA 4HWEL 1RZGA 4Z18A 3CVHL 4XCEB 1HQRB 3BPLB 4JDVA 1M6OB 4R3SA 1EEYA 5HI3D 4QRPB 1FN4B 1VKXB 3VGAC 5KZCB 2Z91B 2P5WD 1UZ8A 4Y4KC 3WV0A 1X44A 1YJDC 3MV7A 1YMMA 2V17L 2J1KA 3DRQB 3QO0B 3V9FA 4OFDA 2A74A 2P8LA 5CD5C 1FIGL 1QBLL 3QG6A 3CDGA 3QDJD 4FG6C 3I50L 1CDCA 1T21A 1Y6NR 1RURH 3SDDA 1WFNA 3W82A 2Y6SC 1NGQH 1EMTL 5D1XD 3UZEA 2Q3AA 3RWEA 3R06B 3DMMA 3BOVA 3LH2H 4LKCA 5C70A 1XF5B 1EXUB 1KB9K 4MA1C 3UTQB 3BVNA 5IVZB 1J1PL 3RHWF 3K2UL 1Q72L 2XZZA 4TSAH 5I74B 1FZMB 1T2QL 4Z5RA 5I74C 5I1EH 4ODBD 4G6KH 4I0KA 4Q6IC 3NACH 4DCQA 3PWUB 2YD8A 4G3YH 4PP1C 4F7MB 3NGBC 2JIXA 3LKRB 3MV8E 3FQUA 3KYNB 4G80A 1R24B 4K94L 5BJTB 1HSBB 2IF7A 1G9ML 2ZP0T 1N3NA 3U9UB 1U3YA 3DVGB 3L3KA 1WAAF 1RQ5A 3F58H 3PGFH 3B43A 1NJ9A 3MLZH 1HINL 3GO1H 4BYHA 3SE4C 1U93A 1P53A 4BK4A 1MQ8A 3HPLB 1LO4H 4KROB 4YXLH 3TO4D 2ADGB 4X4XB 2DD8L 4H0IA 3MSPA 4N8VB 4P2CG 1OPGL 1I8KA 5C0FB 4HH9A 3DJ9A 4L4VD 3F58L 3D0VB 5DR5L 4M62L 4K7FB 4D9LL 3HS0A 3FHQA 4ZFFB 2V7HB 2H2SC 4ZOEA 4FRWA 4R7NA 4ZFOB 1YPZF 32C2B 1CFSB 1MFAH 3HAEH 4PJBA 3BIAX 1MWAH 3X3FL 4NQVA 2YD1A 1F5WA 4X5XB 4ZUTB 5IFHH 1HE7A 3LQAC 4O2FA 1AGDA 4D9RE 2MJWA 2NYYC 2ARWA 4IS6B 4NBYB 1HILA 1NEUA 5GGTA 5HDQL 5DJ0B 4KJYA 4AEFA 1IGFH 2ENSA 3RDTC 5J8OA 2O5XH 5HD8D 4CVZA 3LPWA 1KENL 3TT1L 1F4YL 4B7LA 3O3AA 3EOTL 3PWVA 4BH8B 3TYFB 2P46B 1NGZB 3A6OA 2XPGA 1AD0A 5DC4B 3BUTA 3LEVH 1VGEL 1EAPB 5HJ3B 3JXAA 2AJYL 1X5HA 3ULVC 3SDAB 4KK9D 4HJ0C 3EYQC 5JA8B 3P4OA 4MWFA 3O81A 1G7IB 4HUKB 3K74B 4KKNA 4PGBB 5DMGD 2V5MA 3RNQB 1AO7E 1EX0A 3O8XD 5LBSL 1IGYB 4N8VA 4UNUA 1C5CH 4MA7L 1EMTH 5LXGL 3GBNL 1KIRB 3MRLB 1FDLH 3P11H 5TPWH 3N9GH 1JUFB 3FB5A 1Q9KA 3GDBA 3IDUA 4FFWD 4V1DD 1FVCB 2PYFA 3QDGE 3MLSL 2OJZL 4X6DF 4YHIA 4QRRE 3ES6B 1BF8A 1KLFA 1AE6L 5I1IL 3DX6B 1IEHA 3WFCH 1VB9A 3WXVL 5IIEA 3C8KA 4OQ1A 1T1YA 1KXQE 4I3RH 4X5XA 1KPVB 4XPHH 3EYFB 2VE6B 1ZSDB 1FFOA 1CFNB 3VGBA 4MA8L 4KVCH 5CJXA 1A7RH 3VGEA 3QEQA 3L3HA 2DMBA 2LAAA 3LB6C 1B2WL 1BZ7A 3TCLA 5D2LF 1Q38A 1LEGA 3EYSH 2ICEB 3TBWA 4NO5B 3IRZA 3BW9B 4BZ2H 1I1YB 1INDL 1MUJB 5KS9E 4H5SB 3QUXB 4JPVL 3U4EA 4HIXH 1HZHH 3HC0B 2NW3B 1VENA 2Q76A 5INDB 4D3CL 5I1IH 1DUZA 3Q3GA 1TJIH 3MV9A 2D9QB 4RGOH 1W0WB 1NC4D 1KCKA 2GJ6B 3VFRB 2OJZH 2W0PA 5J6GB 4S1QL 4X0KB 1R3HA 4Z7UA 1AXSA 3BZEA 3OMZA 1TVHA 4G9FA 4P2OA 1P9MC 4P2QB 1S7VA 3QDAA 3OKKA 3QIUB 5TGBB 1X5KA 5K93A 5SV4A 1FGVH 2L4OA 4ZFGL 4U6HB 4OLZH 3BPCB 1A6AB 1JHKL 5SWSD 2V7NA 4V1DB 1JWMA 3BDYH 2P8MA 4FQLL 4J4PC 3OAZK 5I73B 3FFDB 3UYRL 1J8HB 4KKBD 1WAAA 3QEQB 3UPRA 5BJTA 5DRZA 3C08H 4HT1L 4ZO9A 3VXME 4CN1A 2FB4H 3T4AA 3O3EA 1HQ4A 4N0UA 1DVFD 2CLZB 2Q7YA 1IEAA 1O7SA 2G5RA 4LMQI 1XH3A 3ILPB 4KZEH 5HDOA 2XTJB 3QCTL 1CLZH 4GS7C 2ZG2A 2IEPA 3ABZA 1KB5B 4QRUB 1NBVH 2OYPA 3S37L 3H42L 4FQCL 2NTFA 5D1XB 3DV6A 4CW1A 1WC7B 4I4WB 1T7ZA 1ZTXL 2V2XA 4WFGE 3G6JA 4X6EA 3DMMB 3PP4H 1MHHB 2ITCA 3I3DA 2BERA 4JJ5A 4LP4A 4BFGA 3QNXA 4MD5A 5F7LB 1FYHB 3QHTC 3OR6A 2YR3A 1NANI 5J12B 4DTGL 1D5MB 3JWOL 5JTWA 1R3KB 2H1PL 2H3NA 3MV9B 1KBGH 1TJGH 3UTTD 1XGPA 5EA0L 3DX9A 2RJMA 1IGFL 2K1MA 3QQ9C 3TBTB 3HLAA 4YHNB 3ARRA 2R1WA 1NGZA 4OZIE 1FG2B 3O3UN 3QFDB 4RX4D 3E6FB 2GSGB 3QJFA 1V3MA 1CT8A 1NCBH 5DD3L 1YMMD 4U7KA 5E2JA 4YGVB 3CXHK 1VFBB 1IGCL 2YPKA 2N7AA 4GT7A 3VXSE 4PJAA 1YY8B 4S1RH 3ZKNC 4LSSH 3QHZL 4Y16A 4P9HL 1DQDH 5J56B 5E5RB 4BA8A 1TCRA 5K9JL 1P4IL 3CFCL 1CQYA 1BGXH 4DGYH 4J1UB 5DEFB 1EFXA 3BPNC 3WDIA 5ICZA 1LO3L 3O6LH 5E8OA 1UH2A 2CXGA 2YUXA 1HSAA 2RCSH 5ILTL 1YMME 4PB9H 5D7JA 1JV5A 4BH8A 4LSQH 1LP9E 2I60L 4O9HH 2X89D 3X13B 2A73A 3CK0L 2QSVA 5CJ8A 4FZEH 1GGCL 1N7ML 4EUPA 4S1RL 2DQFA 5FFLA 4M8VA 5JW4R 5AZ2L 3LRSB 3GB7A 4FQXC 5JPMB 5E2UH 3SY0B 4Z7UF 3OSKA 1ZHBB 3WFDH 3MLYL 1MH5A 1KFAL 4UOW0 1YYMH 3L7EB 2XTLA 1QNZH 4UOJA 1CFSA 1R3JB 4M1DH 5CP7A 5EUKA 3MOAL 3VXQB 3DV4A 3GRWL 2E7HA 4M6AA 5F7YC 4PV8B 3KPSD 4D94A 3KHOA 3VMNA 3MACH 5D2NA 2YN3A 2ZCLH 3QDJB 4PJEB 3ULUL 3P30H 1LMKA 3PDGA 5C0CE 1N2RA 4ZXBC 4RMUA 4KZEL 5EZOH 4HD9A 5CZVL 4N9GA 1FV1A 4LEOA 5CUSH 3ZKXC 3TWCL 4ONHB 4GXVH 4CRPA 4ZNCD 1SYSA 4FQIH 1LGVA 2FBJL 2FIRT 2F54E 3UYRH 3PGCB 2X40A 4RISL 1I7RB 3T0AA 5I15H 3GJFH 1ACYH 4XGZA 2C4FU 3S96A 4FQXA 3O6FA 3GUTA 4M3KB 1G9MC 5DJ6A 3IFOA 5I8CB 2XQYK 5FUZL 1CVRA 1FL3B 1DN2A 2G60H 2WBWB 4FABL 3HRZA 4FNLH 5J1AA 4P5TC 1MREL 1ZANL 2CKBH 4H1LB 5IOPA 1QR1A 5D5MB 4LCUB 1T04A 3OKKB 3QIUA 4WI2A 5LGJB 4DKEL 1CS6A 2Q8BH 1CGSH 4NO5A 5DGRA 2Q7YB 3FQWA 4UUJB 4HFUL 5DUBA 1U36A 3MXWH 1BAFL 1P6AB 2VSCA 1HXYA 1NMCB 5IR1B 4NJ9L 1SMOA 4S1DD 3MBXL 4PRIB 4HFWB 2Q76B 4KZDH 2MCG1 2WUBL 2W65A 4PJCF 2IBGA 4XP6L 2AABL 2OKMA 3V0VA 4MQ7B 4WI5A 1GIGH 2OP4L 4NKIH 4ODTL 5IJKC 1F4HA 1WV7T 5K9JH 3H7LA 2DLIA 2WMPA 3DIFB 2YA2A 1PKQE 3F7YA 1AHWC 1K3ZA 3HE6A 1TJGL 1CQKA 3P9LB 5I76A 3MGAA 1XGYH 4NJ9H 3K46A 5IQ7L 3CLEL 3GSRB 4PIRF 1CU4L 3Q0HA 1DVFA 4XPHL 1JWSB 2GITB 4K3GA 2R0WL 3FRPA 1JHLL 4OV5B 1ZHKB 1KEGL 1RJCA 5HYSA 2O61A 3OKDB 4JHZA 2X41A 3WJLC 3I75B 4OM0H 3D25A 4JO1H 3GIVA 5CIPA 3I6KA 4MAYB 1ZHNB 4OLWH 2EDDA 4P4KB 2ARJQ 2VZOA 3BT2H 1IFHL 1MHPL 4OCRL 1BQLL 2CPCA 3TBTA 4LBEB 3R0MA 5H35A 3ULVH 2HA1A 3H9SA 5E8DL 4AH2B 1IM9B 4C55A 5IM7A 1MFBL 3BMWA 3S35H 3L3IA 3F8UB 5J9PA 3ZKMD 4OD3L 3MRMA 5FCSH 4G6FB 1XIWA 2PO6A 3T0ED 2X1PA 4IMKC 4U3HA 3QXDA 1FVDA 3LS5L 1MCSA 4K55A 2LQRA 4PUBH 1FN4A 4X80H 3T3MF 4AJ0A 5L0QC 1XF3A 1YNLL 2V2XB 4JRYE 5LQBL 4G42B 4JO1L 4DKAA 2D7TH 1BQLH 5IEKA 4UI2A 4JPKH 3UZQA 5IMKB 4OFYD 1ZK9A 5EUOB 3DUHA 3MA9L 2APTA 3CSYA 4PBWD 4RA3A 1U8LA 3S98A 4JHWH 4ZOBA 1BBDH 5GGQH 1QUNA 4JO4L 3D69A 3QDMD 3B5TA 4GBXD 3WNLA 1DBBH 1RULH 3QSKB 3KLHD 1PZ5B 1LP9A 3IU3B 3FFCE 2J6EH 4N8VG 1HHIA 1VGKA 3DUUA 3GIZH 2R0ZH 3VG0L 3RAJL 2CDGB 2DI7A 1FAIH 4OIBA 1EFXD 1V7MH 5BZWB 3D25B 3I6LE 3RTQD 3H9ZA 5IMOB 3SOBH 4DVBA 4O51B 5HHXL 5D7IA 6FABH 4F80A 2VXSL 1U91A 2P1YA 4X4ZA 4YDLC 3V5HB 1AY1H 4WFFE 1N5YL 1DQLH 3TPUB 3U0PB 3V95A 4X9HA 3VXSA 5KVFL 4X4XA 2F68X 1NEZB 1B0GA 2IBZY 3QRGH 4OZ4A 1AD9A 2UVEA 1R5WA 5MEQB 5D72L 4WEMB 3UTZA 4UT6H 5EU6A 2AABH 3WLWD 1DQTA 1UACL 5SWZB 2X42A 5INCB 1NGYB 3REVB 4K2UL 1J88A 1ZWIA 3JWDC 1K4CA 2JCCF 1JBJA 1DANT 1BIHA 4QHUB 3O3DA 5KVGH 3CDYA 4MS8D 3IFOB 3HAEG 5HVHB 5F72S 3HAEB 2YN5A 5DRNA 2NNAB 1KIPA 3SQBA 1JN6A 1FCGA 4WFHE 5DURD 3BKJH 2X9YA 4JFPA 3BQUD 5JQHC 1QRKA 4CL7A 1NAKH 4GS7B 4OIIH 1QR1B 1QVOA 3V6ZB 1QACA 4LLQA 2DKSA 3U7AA 1D6VL 1RK1A 1F3DH 4IHOA 3OG4B 3O8XC 4LLWA 3LKNA 4G7YH 4N90E 1CD8A 4M6MH 2FB4L 5CBAB 2F53B 4HMCA 3PABB 5T1MB 1FV1B 4LEOB 4EDWL 3GSNL 1OP5H 1BIIA 2P48B 2W38A 4PBVC 4QRPA 4YDIL 5F7EL 3HHRB 3MACL 4P23A 5DSCB 3ZHLA 4EN3D 4ZNEE 3NBNA 2R1YB 4X4ME 1T04B 1JHKH 5D7IB 3WJJC 3ULVL 3ARDD 1MHHA 3RL1A 1EO8H 4XNMA 4MWFB 3LEVL 3E8UH 3PP4L 4NUGL 2R1XB 3RVTC 3VDBA 5DJ8A 1JFQH 3LRHA 1EPFA 1KFAH 4GAYA 3GUTB 2OR8A 3T0XA 1T0MA 3PWJA 3B9AA 4AY0A 4OFKA 4CU8A 4L3EE 5HSFA 3RWEB 1CE6B 4LSPH 3MA7B 4F37F 4WHTB 3GSOA 3VRIA 1C12B 3IS0X 3KPRE 5JHLH 1A6VL 4DUVA 1DLHB 3HZYB 4XMKH 5IBLD 2AV7A 4IMKA 5C07A 4ZG1A 2QADB 3B6SA 1YDPA 5IKCB 4QEGA 1S78D 3FZUC 4NNXA 4OBSA 1U3ZA 3G5VB 3K0WA 2FO1A 2DL2A 3WFHA 5TQ2L 4LNRA 1NPUA 2LABA 2EEDA 1ES0B 2HFEB 4POYA 1G6RA 4HIEB 3QI9D 1Z3GH 4QRRA 5I73C 1AIFB 4JRXB 4DWHA 5CSGA 1CZ8H 4EI6B 2XA3A 5EC1B 1UT9A 4Z0BH 3BSZH 1QKZL 2XZCH 1EERB 4LVEA 1HH9B 4I3SL 5SV3A 3I75A 3C9NA 4HEME 2O61B 2Y4SA 1ZLSH 1J11A 4JQXC 2AQ1A 5IIEB 5HHXH 43CAB 2FO4A 4OLEA 1JZ6A 1WBYB 1G0YR 4L5FH 1HHGA 1YNLH 4LPCA 4Z7VB 1KB9J 1DVFC 2J12B 1S7QA 1FZOB 2BHZA 2N56A 5DHYB 1U8MA 4M48H 1MWAA 3TBVB 3WFBH 3QDGA 4Z9KB 4P3WA 4Z7VF 4LSQL 2EDNA 2YK1H 1RZFL 3OKDA 3ARED 3S3SA 3RPIA 1FL6A 3L5WA 2XKUA 3LQZA 1NDMB 2GUOA 1I7ZA 3BE1L 4G9DB 5GGTH 5GSRB 1MJUL 4JCMA 3VXRD 1UJ3A 3CX5K 4XXDB 3ULUE 4IDJH 1MCOL 1HSBA 1KELH 2ADGA 2B1AH 1FQ9C 2VLMD 3ARSA 3FQUB 1DQLL 2HFGH 5D7JC 3GSUA 1JZ8A 2F19L 3Q6FA 3V79C 1EHNA 5IFJA 1A14L 1WICA 1T4KA 1FVEB 4KDWA 3VXMA 1NJ9B 3DO7A 2GK0A 3CD4A 3SJVD 4XNXL 1FH5H 3QDJE 4PJEE 3DV6B 4CW1B 2D03L 2R4RH 4YBQD 2FL5B 3H7BA 3KPRB 4CADA 2YK1L 5DEZA 3BWAB 4JB9H 4FQCH 3RWFB 2P8PA 3ZTNH 2GSGA 3QJFB 5TQ0H 3SDYH 2W91A 1ZS8A 1WZMA 2Q86A 3SDAC 2PXYA 3EOBA 3VD3A 3I9GL 2R29H 3CFJA 5FM4A 5C0AB 4ZTPH 5D6CB 4K7FA 5E8DH 4YDKH 4U1SB 1YN6A 2R9HC 3Q6GH 1WTGT 2IJ0C 2AXFA 4ODVL 4XTRD 3V6OE 2GAZA 4P23D 1R5VB 2FX9H 2IAMD 4QTIH 4O2FB 1A1OB 1GXEA 5JXAL 2YPVH 5F3HA 2DTSA 2Q8AH 3P4NB 4NZTL 5IOPB 1I85A 4MLIA 3ALXA 5FO7B 1VEMA 1MLBA 1V3LA 5K9KB 3ARFA 3QEHB 4JANA 4R26L 2YD6A 3BH9A 1MFDH 4JFXA 5DHXB 2EDHA 3RIFF 5I71C 1IC5L 4U1MA 1D6EB 2C1OB 3QWRD 5DQ9A 4FN0A 4DKEH 1R3LB 5C86A 1BOYA 5E03A 4JFPB 1KGCD 5F7WC 4D2NA 4PRBB 3T0WA 3SGJC 3G5ZB 3WIFB 4XNYL 1JFQL 2VO5A 3OKMB 4KV5F 3FOLA 3AC0A 3VD7A 1T20B 1LE9A 1Z9SA 5JHDE 3EDFA 2Z9TA 4P5TB 4LFHG 4ZS6C 5I1CL 1M7XA 4MA3B 4Q2ZB 3FJTA 4X4YB 3NIGE 1BQHA 1N64L 3B5GA 1X4YA 4EUPG 3VFUA 3I50H 3EDDA 1I3GL 3SY0A 5FGCE 3ARQA 4CAGA 3TYGH 3R1GL 4OCWH 2WINB 4M8QA 3SKOA 1FCCA 1S3KL 2VLKE 3GSVB 1K4CB 1S7XA 3LKOA 3NZHH 4I18C 4JVPA 4KQ3H 4LL9A 3WSQH 3EGSA 1KT2A 2P5ED 2FO4B 4HXAH 4Y4KB 1QOKA 1S7UB 3AGVA 1DBKL 5MEOA 1I1AB 1O0VA 3VI3E 1T22A 1MFNA 4UILH 3BI9X 5D71L 2RR3A 3WXWL 5A2FA 4NZJA 3ARDA 3CGTA 4NQEB 2DYPD 4BQ8A 4ZXBB 4HUXB 2PKDA 1ZAGA 2FDBP 3GB7B 1WEJL 4HW6A 5H2BA 3FOMA 4ODUA 2WWMD 2BNRE 4NZRL 3UP1A 4R4NC 5MI0C 3HI5H 4JGUA 1NGWB 1U8NB 1TQCB 4QHNA 1XEDA 4WGWB 3VWKD 5DYOA 5FEBA 3DX8B 2VITB 4GLRI 5CZVH 4PP2A 4NQCB 4YHPB 5I1KH 5KN5B 3KJ6L 1HYSC 4Z7UE 4EI6A 5DHYA 2VDRL 5JNYB 4G43B 4Y4FD 4G9FD 3BKYH 2I9LA 1QBAA 4M7LT 2A9NH 3GEWB 4YC2B 4EDWH 1CLYH 1KF9B 1M6OA 4ODHL 4LHUA 4PJDB 1AO7B 3QIBD 4MAUH 4ETQB 2DBLH 3LZFL 3H0TA 1K9TA 2FZ3B 1NANH 5DA0B 2YXFA 3QUML 4Q97A 4HJGA 1MRDH 2QR0B 4LSRH 4S11A 1OTSC 4YDKL 2DQCH 3BPLC 1IKFH 3I02B 4PGEB 1MIMH 1IQWH 2WSKA 5L9DH 2FJHA 2Z8RA 3FQWB 4GLRH 1MRFL 1NGWA 3L5WB 2AK4E 3HI1B 1PFCA 1OLZA 3BUYB 1YJDL 1DEEA 1XT5A 2J8UE 3ARUA 3MRKA 5BQ7B 3MLXL 1W72B 3C5SB 5ICXB 3JUZA 5ALCH 4X6BA 3CK0H 5KN5A 4OCNC 3RZCD 4R0LA 3N1GC 4GAJH 4E42B 1R0AL 1ZHKA 5D9SB 5FGCB 3PL6D 1MCHA 4WHCA 5FA3B 3G5XA 1IC5H 5EO1A 1NFDF 2W59A 1NCAL 4G5ZH 3QRFM 3RJQB 3D9AL 4LNVA 1TCMA 3EYVB 3U0TB 1TJHL 1NCCH 1FNHA 2J6EL 2VXUL 1OTUD 5D70H 5AZEH 5J6HA 1U8OA 3FAWA 3QNYB 3MC0A 4AQOA 4C56E 5C92A 3DETC 2EZ0D 4F3FB 5T1KB 4LRNH 4OCSL 3FB8A 3ZKMC 2J8OA 3DPBA 2BNRB 3THMH 2VH5L 1XCQA 3H3KA 1RJZA 5LAXA 3T0EC 1WFUA 3S88L 3PIQB 2BY0A 4RSVA 3GNML 3QFJE 5J12C 3GM8A 4UV7L 1MY7A 1RVFH 1BD2A 4Z76B 5IK3A 3JWOH 5FYJD 2NY0B 3I2CH 1GOHA 1NUNB 1W8NA 5KTEH 2EH8L 2C3HA 1M7IA 4LVOB 5DGQA 1JGLL 2MKLC 4I5BA 3CFKA 1VCAA 1T66D 2VAJA 4L3AA 1MCNA 2PNDA 3WUWA 1SVZA 2UV3A 4QNPE 2XRAL 4S0SD 4QXGL 4ENEC 5IT2H 5I16B 3IF1A 2X4UA 3B3IA 1L7IL 1NMAH 5EO9B 1VSCA 3KLHC 5C0AA 5BS0B 2CSPA 3OAYK 1OARL 2QKIB 5DRXB 1YC8A 5C9KA 1KELL 5HHOA 2VDOL 1MNUL 3QULA 1BEYL 3QFJD 4X6DB 1A22B 4XWOC 2CK2A 2DS4A 3RTQC 3VMPA 3S88H 3TN0D 4KPHH 2P8PB 3V0WH 3IDNA 1HIML 3CX5J 4FFYH 4Y2DC 4DVBB 1QO3A 1Q0XH 2BRRL 1Q9OB 4Z7NF 2YD7A 1RZJL 1PYWB 2B4CH 5DMIL 1RIVH 2BOBB 5DJ2B 1IGIH 2IFFH 3GMOB 1WZ1H 4PRPB 5J13C 4JY5L 2DDQL 3NCYS 1SM3L 3EHBC 3TPUA 3U0PA 3AROA 4K9EH 4F15C 4K7PL 2R2EB 3NCCB 1RMFL 4WW1A 2F58L 1MJJA 1CLYL 5DUPH 2JTDA 4EXKA 4Y2OA 4ODSH 2ZUQB 1A3RL 4NIKB 4PV9B 5IMKA 3SE9H 4PP2B 4YHPA 3O2DH 3EYUH 2BZDA 4WI7A 1MRDL 3MRJB 1F8TL 5BXFB 2I5YL 3WFEL 4L8BB 1CDUA 3OZ9L 2VLRB 5GHWH 3S36X 3V6FB 1TZIA 2A0LC 4LHUD 5JHLL 5T3XL 5DDHA 1RZGB 2APFA 4WEBL 1AD9B 3B9KD 1CF8H 4M61B 3PQYD 3TBSB 3BSZL 4FZ8H 4ELKB 4HUXA 1PDKA 4IJ3B 4NQEA 4NQCA 5JIHA 5EULV 4APQA 3L3GB 3QUMH 3MRDB 3FO2B 4JZNA 2VUOA 4F58L 4E41A 3JV0A 1F8TH 1FZKB 2GW5A 4D9QD 4Y4HD 4PYGA 1JVKA 5LBSH 1FPTL 2ZCLL 2P7TA 5HHQA 1C08B 1DFBH 1HHHA 2NY4D 3IDMB 4JREB 4EN3C 1E27A 3JTTB 2FECL 1CGUA 2XKSA 4I9WE 1UJ3C 1MCQA 1O5DT 4N0CC 5IF0A 2X4QA 3MLWH 1EEQA 1EFQA 2VITA 1CR9L 4X7DC 3TYGL 3BN9C 4BJLA 1R3IL 1X3DA 5D1ZA 2VLJD 5BOZG 3QWRA 3C2AL 4H25A 2E27L 5JLZA 4X7TB 4HKJB 1K6QL 1YYML 5DO2C 5DVLA 2PN5A 5BVPH 3H9HA 2DBJA 3D3VE 1CDBA 1OP3K 3LOWA 5GS0H 1IKNA 4HWBA 4Z0XB 3HPLA 5K59F 5E5MA 5I6XC 3C09B 5KVGL 2UZXB 3S6CA 12E8L 5I8KL 5ACZA 4RISH 1LK3L 1U0QA 4BKLB 5C08E 3V4PL 1JE6A 5FCUH 5DZ9A 4C56D 2X4NB 1ZVHA 5D1ZC 2VXUH 1T1WA 1FRGH 3QI9C 1G6VK 3QUKB 2P47B 3HE6B 5EN2A 1D6VH 2YKLH 4JQVC 2D7MA 4LEXH 1ZT7A 3WIHL 3TBSA 2QHRL 5DSCA 1RZIB 2KPNA 2ZPKL 2ADJB 2VDKL 1J5OL 1H3GA 3O3EB 1NLBL 1LILA 4XP5H 2R0LH 4MXQC 5E99L 3SDCD 3T0BA 1RIHL 3BEVB 4J6RL 4PRNA 4XH2A 2CK0H 3NCJH 2O5ZL 1GC1H 1A7PL 4LLMB 1EGJA 3GNMH 3O4LE 5EO0A 3VDAA 6FABL 3Q48A 4M6NH 4M93C 3BVNB 3AY4C 1U2HA 3FT4A 5DK0B 4GW5B 3ROLB 1DEEB 1PGRB 1U8OB 1MIEL 2J88L 2V7NB 3K4ZA 5JMOC 1TDQA 4ZTOL 4FQ1L 3DVNB 4WUKH 3AMKA 4X6DA 1PG7L 4ZS7H 3AXLB 2BSED 2C3WA 5AAWA 1GOGA 1OGAA 5IB2B 4O4YL 4BSJA 5L2KB 4PGEA 3AREC 4NFDA 4WNQA 1LWRA 3IDIA 5BZWA 1T1WB 3MRIA 5J1TC 1MI5E 3OKYA 2AK4A 2XV6B 4LPVA 3TBYA 4RGND 4NYLB 4DN3H 2A9NL 2B4CL 3VG9C 4OCYL 3BP4B 3CFEA 3PNWB 1RUKH 2NW2B 2R2HA 3GMNB 1L0XA 4WTWA 3VXTA 2Q8AL 4HLZG 1VHPA 3ZKQD 1QSEE 4JFDE 5DRNB 2OR9H 1ED3A 1U3HB 2GTWB 3C60B 2OZ4L 1MJ7H 1OAUH 5MI0B 1IE5A 3FT4B 3WS6A 3QZWB 3RVUC 3T0DA 1EAPA 3D2UD 4TRPL 4Y7MA 1F6AB 1YEFL 3BIKA 5HJ3A 5EDXA 4MA1B 3BGMA 2OQJB 1E4JA 4B7IA 5DJAA 2EDRA 4Z8FH 3HZKA 4OFIA 5E6IA 4OF0A 4XCFL 3DBXB 5KS9B 2A6IB 2K3TA 2OL3H 1MWAB 4V2CB 3L5XH 4E0RA 3MLTB 2H26B 3EW3B 5BW7A 2DQEH 2RBLA 3FQTB 3IFLH 4J12A 4NRZB 1F45A 1P6FA 3O3BB 5CHNB 3TZVB 5E2WH 5F1IB 4KQ3L 2GUOB 3VWJD 1ZWIB 1BMGA 4OZGB 3L7EA 2R9HD 4ZSOB 2B0SH 4BFEA 4WUUA 4APQC 4PG9B 4LVHB 1I3GH 5T3XE 2Y07H 2IAMC 2HH0L 2X4SA 1U8JA 2X4TB 1II4E 5CZKA 4A6YL 2HMIC 5EPMB 1KJMA 2H9GA 2IQAA 4U1KB 5J3HD 1EEUA 4PUBL 3FB5B 3MV01 1TQCC 4LLUB 4QF1B 2ZNWA 3IJSA 3ARGA 3BD5A 4NZRH 4XPAH 3Q1SH 4RDQF 4K3HA 3HNVL 1NFDA 3KYKH 4P48A 4HLZH 5DD1H 3VXQA 5I71B 4XNXH 1KXVC 4XPGL 3CUPB 3DARA 1MI5B 2XZCL 3GSNB 4HF5L 4LCWD 5GRWA 4NO2A 4JM2B 5ITFB 4CJ0A 2QHLA 5GRJH 3ROOA 1UVQA 3RVXC 4OZGA 5AWNL 2B8OT 2M8XA 1B0RB 3MFGB 4JG0H 2R0LL 5E99H 5TE7L 3UEZA 1J12A 4ZAKC 4KRLB 5AUMB 4I0CC 1LO0L 1OGAE 3PXJA 3BDXA 4LOUD 1N6QH 5E1AB 1UM5H 1S9KC 1A1OA 1YQVL 3GSOB 3VRIB 4YJZL 1CD1A 4U49A 3TH2T 2HG5A 1U9KA 2BOCB 3P30L 2BVOB 1T89A 4UTAL 1RZJH 5DK2B 4P59H 5C09A 4TUJB 5I1AB 1WLHA 4HKBA 2FJGA 3LHPH 5TE7H 3RWCB 2R1XA 3TO2A 1HXMB 1K4DB 1U8IB 4UIMA 3V6OA 5GS1A 5IHZA 1ZEAH 2MCPH 4NZUL 3QUYB 3NTCL 2CGRH 2OBGA 5DLMH 3GSWA 4LKXA 1F58L 1CE6A 4LDLB 4TOYH 5HYEA 5MENB 1RAMA 3FQRB 5FGRA 1J1XH 1NDGA 4JDTL 5I1GH 1PAMA 1FZJB 3TF7C 3BXNA 3SJVE 1CT8B 4POZC 4GUPB 5FF6B 1BD2E 2NQCA 2I07B 4OGXL 4MA3A 4Q2ZA 5GJTL 3X17A 5C0BA 1QFWL 2Z35B 5E00B 2BSTA 3WN5C 1U6AL 4HPYH 1P4LA 5GJSH 3BP6A 3BZFA 5E5MB 1URLA 5TFSL 1RJLB 3QCVL 1G7LB 1Z9OA 1YY9C 3SE8H 3WSQL 4C83B 1FNLA 4ZDHB 4OKVA 4ZPVB 4HEPG 2VZTA 3MCLH 4JZOB 3IF1B 4JEGB 1JGVH 1WIOA 1QSED 4JFDD 4G8EB 4U1LB 2GK0B 1CFVH 1ZA6A 2EDQA 2WQRA 1HHKA 4X4MA 1FHGA 1G9EA 2XY2A 4X6DE 3V0VB 3WO4C 3TA3B 4R0LC 4R7DA 1T7YA 3SGEH 2NY7H 3UTQA 3X3FH 3BWUC 4O5LL 3VXUA 5DK2A 3CXHJ 3MRGA 4K23H 1CICB 2KH2B 1EA9C 1HCFX 2A6KA 3ZTJG 2H6PB 1BGXL 4G8GE 4DGYL 2L7UA 2I9TA 3T3ME 3GSXA 5FHBL 2J8UA 1CL7L 3LVEA 3BKML 4N68A 3OJ2C 3UPAA 4E42A 5FHAH 4WTZA 2B5IB 5CP3H 4QRTA 5CSBA 5E1HB 2IPTL 3MCLL 4OFQA 3RX7A 4Z7QF 2DKMA 5HGDB 4QHKI 1FP5A 2VZ1A 1HEZB 1EO7A 1L6ZA 4WFED 2X9XA 2F54B 5E2UL 2EZ0C 4XVJL 3RWDB 1QFOA 2X6MA 2DL9A 4GRLA 2NY7L 5FHBH 4JY4A 3UTSB 2W9LA 1OAKL 4IGBD 1S9YA 3BZ4B 1G7JA 4MAUL 2EH7L 2IPKB 1J8KA 4OD2A 1CL7H 1K85A 4U1IB 1IM3A 3FFCD 1CGXA 3HI1A 1B4RA 3BHBA 1FFQA 3ARGB 1ZS8B 3OAUL 4MJID 1I9JL 3GBMH 3BGMB 3MA9H 3CLFH 3FO2A 4XX1E 1B9ZA 4YR6A 3RVWC 4CGTA 1RUML 2AJZB 5FO9B 3FO0H 1I7TB 4AYFA 5H94A 4EIZC 1XF2A 2X4SB 3VFSA 1EUTA 2W92A 5KVEH 5GRZA 1KTDB 4ENED 5EUKB 1M7DA 4X80L 5F1SA 5C7XH 3BO8B 3OB0K 1BZ9A 2NXYC 5CHNA 3TZVA 4JHAL 5HXMA 4TOYL 2QKIA 1DE4B 3FOMB 4F33B 4JE4B 3E3QE 5FUOL 3SKOB 4O2CB 2G9HA 5HYFA 4CVZB 3EFDH 3ARFD 5DRWA 1UWXK 4WU5A 2KBGA 2VR5A 4GMSL 5BVJA 1A6WL 1J7VR 3TLRA 3MLUL 1I1AA 2VWEC 1TIUA 3QHFL 5L8JB 5E5UB 4DJMA 2R15A 1H3VA 3FQTA 4JPVH 3OKLA 3M8OL 3VXRA 4M6OH 1OAQH 3OBAA 4M8QB 1G7QA 5DRXA 1IGJB 4ODUB 4J3WA 4U31A 4XVTL 5DS8A 3ZE0E 3PABA 5T1MA 4R4BA 3RWJB 2JF1A 5KSUA 4UU9A 2NY1C 5D1QD 5HHNA 4UT9L 5I9QB 4IOSD 1QRNB 4LPUA 2MCPL 2J4WL 5J06A 3MV8A 4L3CA 2VSDA 3LV3B 4FFWC 4CNIB 5DMJB 3KJ4B 1LHZA 2W65B 4WIQA 4PG2A 5BXFA 1AXTL 3PWPD 1IGMH 4JN2B 4F7EA 2A0LD 4LSTH 3W9DB 1AQKL 4C83A 1A4JA 5B39G 1NAKL 4OIIL 1Q94A 1R5IA 1YNTA 3P0VH 1J1OH 4KDTA 4K8RC 4YBLB 1JPSL 2PCPB 3ARYA 5F7FA 5KJRL 1HHKB 4P0DA 1A9EA 3TESA 1K4DA 4UIMB 1BFVL 3ZZ1A 5GGVY 3T1FA 4NKQB 4L8DA 2X4OB 3MJ7A 4M5YH 1N3NB 2CD0A 4XP9L 5IKCA 3MV7B 1H3XA 4MMZC 5DS8B 3MV11 1EVUA 2XA8L 4Z95H 1OCWL 2BVOA 4NCDA 3T2OA 4X99A 5ANMA 2DQUL 1PD6A 4LPTA 5ENWA 4IRJD 4CDGC 5CUSL 3WFEH 1OT2A 3VW3L 1AKJA 4YXKL 3CDGB 2UUDK 2CDEB 4XC1L 3BN9D 3M07A 2EDJA 3TO2B 4X7CC 3PNWA 5IHUH 1UWEH 3ZLQC 3INUL 1QP1A 1U8IA 5GS1B 4JFEE 4JVUA 2AJXL 3WNMA 4MA8H 3KPPA 5EOCH 2F9BT 4DZ8A 1S7TB 4OLVH 2NCMA 3MRRA 1XF5A 5H8DA 3TC9A 3WHXA 1EZVY 2EC9T 2UWEB 4W4NA 4CMMA 4LHUG 2A83B 2F5AH 2OR9L 4Z78B 1MUJA 1T1XA 4UT7L 1IGTB 2KL6A 1OL0A 2OXGA 5D71H 3OAUH 4MVBD 1MOEA 4OD1H 4DZBB 4NRYB 5HYQB 3T4YB 2VIRB 5BO1H 4YDIH 5F7EH 5DRZB 3NZHL 1CLCA 1ZHLA 2JIXB 3LKRA 5F44A 2WP3T 4HK0B 5IM7B 4JFFB 1NCUA 1Q1JH 2EYSB 2Q8BL 3EO1A 3R1GH 3H9SB 4P4KC 2FHBA 1H0DA 5D8JH 2R8SL 5C9JB 3MFFA 3DNKA 1NCWL 2O26U 5BZDA 5JO5B 5GGUA 1OARH 4NC2B 4L9LA 1FZMA 1A7QL 1G9NC 4TVPE 1FVDB 2E27H 2XN9B 2P42B 2VDNL 1RZ7L 1RZJC 3EOYG 4N90D 4MXQD 4RAUA 3DHMA 1S7QB 4NQEE 5DD0L 4GXUN 4KI5E 1S9YB 1FFNA 4Z77B 1K3IA 4L3ED 3D39B 4GQ9H 3NPSB 1AR2A 3VXNB 4HXBH 3IFPA 3O8XA 1KYOJ 3M1BA 4WENB 4GSDL 1U41A 1FL6B 3QR2A 4MLSA 1QHPA 2H6PA 3DGCR 4PLJC 1EJ6A 2AJSL 5EU6B 5IMOA 3TPKA 5F1OB 3IJSB 2YPKB 3GK8H 4IIQB 3IJHA 4U1JA 3ZDXF 2NY6D 4FTVE 5CEXB 4UIKL 2BSSB 2C26A 4YPJA 5JQ6H 4KMLB 4QRTB 1KULA 1CDHA 3DO3A 2FHFA 1T5WB 4HHAA 4JFYB 4O02L 1PLGH 1ZMYA 4OZFA 2X05A 3K3QA 3JSSA 3RA7H 3GM0A 3L5IA 2W0FA 2OMNA 1ZV5A 4O51A 4QGTA 3MRJA 2E9JA 1LK3H 2R23A 1V7NL 5IW3A 1SBBA 3NCJL 1G1YA 3SDAA 4M1DL 5BRZA 1TJHH 4LK4A 5D1QA 4YR6B 2MHAA 3WN5A 3A6BH 1YEGH 1MRFH 4ZYKA 3N50A 2HTLC 4M02A 1KN4L 4OF7A 4WW1B 2O5ZH 1MIML 3L6FA 3AU1A 4PJBB 3LD8B 2JJTA 5C07E 4F9LC 4TSBH 1J0HA 2AK4B 5IGXH 5DJ2A 3EFFB 4OGYH 3JVGC 2HTKC 4NWTL 1MHCB 4CVXA 5TQ0L 1Q9LB 3SDYL 4PJBF 5I18H 2YRPA 1IQDA 2AVGA 3LIZH 4RGMB 1J05B 5DJCB 2E3VA 1KG0A 5CSZB 5EZLA 4O02H 2A6IA 1JZ2A 4NNYA 2EECA 4UQ2B 4Q0XL 4GAGL 2AXGA 3H9SE 5E6ZA 4ZD3L 1XR8B 3CDFA 5EOQH 2OSLB 1JIBA 5JR1L 1KBGL 1J87A 1Y0LB 4MCZB 4C59B 3TWCH 5C0RH 3I6GA 5C0DB 3LEYH 3ILQD 4PLKC 1NLDH 1T89C 5HYSG 3PHQA 1RUAL 3CFJB 1MF2H 3RL1B 4NQCD 1N2RB 3D3VD 3F5WB 5F89A 4U6YB 1LEKA 3DX7A 5I1HL 3VA2C 2VAAA 1JHTB 3KDMA 3IDYB 4WTZG 2GAZB 1BJ1H 2X4PB 4M7JH 1T0MB 3PWJB 3GGWA 1KPRB 1UM6H 3UX9B 3O0RL 2EXWC 3HC3H 3LH2L 4HT1H 3VFPB 1S9XB 1VPOL 3BN3B 2QLVB 3H9YA 2AQ3A 1A2YA 4ZXBD 2YZ8A 1QVOB 1N26A 2FEDD 3RWGA 4R6UA 3QQNA 2EDKA 4PGZA 2ZJSH 1OSPL 2ED9A 3N85H 4HGWB 1C5BH 4DEPB 1S5IL 4JO2H 2HKFL 3OXRB 2VABA 3QCVH 4E5XA 4MNHB 1HOCB 4RWYL 2WQSA 4OFYA 3VA6A 2UVFA 1Z2KA 2I60H 3U7YL 4ZAKD 3PG2A 4X7TA 1E4KA 3QQ3A 2AXHA 2F5AL 4Y5VC 3WJLA 1D5ZB 1Y6KR 4MDJB 3B9EA 4ODTH 2ICEA 4PRDA 1F3JA 4P5TD 3BJLA 3BAEL 3KYAA 1P84J 4ODSL 5DF0A 4NUJA 5D2NE 5EPMA 2FSEA 1FBIH 4MDIB 3IDMA 2HLFC 3GI9L 2YWYA 4Z7VA 4YX2L 1MCFA 4Q6IA 5CMAB 1W0WA 2FHCA 3FONA 4HKJA 5D1ZB 4RA0C 1UWXH 3RJDA 4GG8A 3EYUL 2G75A 2LFGA 4JKMA 4GRWB 4DAGH 1S8DA 3C09C 3U7YH 2JJSA 1QLEH 3TNNA 4KTDL 3E2HC 4MB3A 5DTFA 5I30H 2Z93B 5T3ZH 2HG5B 1NDGB 5EU6D 2ILLA 3MJ8B 1RZKH 1UM5L 1YEKL 4BUHA 4OZFB 2C3XA 4WO4A 1REIA 1AKJD 1KCVL 3ARBA 4OI9A 5FYLE 5I19H 1UH3A 4M93B 4HS6A 3LKOB 3D39D 4RAVA 4HKZB 1A1MB 4XXCC 5ALBL 4X6BB 5A2JH 4R90L 2VXQH 3T2NH 2D0HA 3FT3B 4OJFH 1UZ8B 2WOYA 2XNAA 3OGCB 2HLAA 2AJ3A 1BBDL 1U2CA 1WBXA 2DQEL 3EZJB 1OTTD 4FNLL 3IFPB 3A67H 1XIWB 2PO6B 3BMVA 2JCCA 5FYJH 4HZLA 1X7QA 3W81A 4OF8A 3IU4H 5KSVB 3BH8B 1S8DB 2VDLL 4GW1A 2MSPA 4J23A 4AZ8A 4ETQA 4YHYC 4NRYA 5HYQA 3D2UA 4G42A 3OJMB 3OPZL 2NY3B 5I6XB 2LE9A 1VGEH 1AGCA 4PJIF 3GBML 5IWLA 3EO0A 5F9JA 3TT3H 4JFEA 4U6XA 1UENA 4OM0L 3WFDL 2EXYC 3D0VA 3LRSA 4IIQA 5E7BA 1W0VB 4GKNB 1XGTB 3HS0B 4ZFFA 4Z7OE 1YZZA 4PJFE 2P24A 5TDOB 4CKVX 4R96B 2EE3A 1SY6L 4GRMA 4ISVB 1KLGA 5T1DL 1JWUB 4G5ZL 4ZUTA 4FMFA 1EH9A 1IVLA 1G7HA 1WISA 2HT2D 4ERSL 3NA9L 5HY9A 1ZVSB 3ZDZE 1CICA 2ORBL 5L9DL 2VUYA 3MRCB 3VFUB 2J88H 4KHTL 5CIPB 4HC1A 1IEBB 3QO1B 1VEPA 3K1DA 3O6KL 2OTWA 3V7AE 5F88B 4IGBC 5F1NB 1ZA6B 4C4KT 4PJGA 1K8DB 5CJQH 4BELD 5CWSB 1LE9B 3F12A 3MRFB 1S5HB 1ITCA 1YEDB 2R69L 1JNNL 4QTHA 5EZIH 1ORQB 2R2BA 1T7XA 1HOCA 1GC1L 4JQXA 3JV5A 4E0RB 4FQ1H 3K4AA 4I3RL 2RFXA 1WAAE 4PJ8D 1NMBL 3EYVA 3U0TA 3O45B 3LEXA 2ENYA 4NDMB 5DUMH 3VH8A 1RUKL 5JPNB 4PB0H 1WCBB 1A6ZA 1XIWC 2PO6C 1GSMA 4PJHF 4YPGA 4AEHL 1GC1C 2LTQC 4S1QH 4WUUD 4DK6A 2EC9U 1DN0B 4P5TA 3NMEA 5GXBB 2BXZA 1PQZA 1C5BL 5B38A 1AR1C 2YZ1A 1XGRB 4YGAB 5L2KE 1R5WB 2ERJC 5EORH 4LVOC 4AMKL 3B2UD 4JFEB 2IGFL 2ATKB 5IROC 2EYTA 4F15B 4OUUA 4QXTA 4D0BB 3ARFC 4ZTPL 3IFLL 1MVUB 4F2MB 3GHBH 3JWOC 1I7RA 4U6YA 2P8LB 4ZD3H 1I1FA 4HKXA 5DXWA 3G9AB 1K2DB 5FDYA 1ONQA 5J0BA 5BRZD 1U3JA 4MJ4A 3AMLA 2AK1H 2JKXA 4NBXB 4PJGF 4LKCB 4HWBH 5T3XD 1WF5A 4TRPH 1OAXL 5F8QC 3OWEA 5C08A 4OLXH 5DEGA 2EO1A 3NFPB 4NHCH 5IQ7H 5SX5H 5FYJE 1B6DA 1H5BA 3LRGA 2PF6A 2GEEA 3VXUE 5LGHL 3ARDC 5CCKL 5IMLA 5FAAA 1KJ3H 2A6JA 5DFWH 3D39E 1WBXB 4P46A 4NN5C 4H8WC 2E7MA 5JNYA 2EIEA 1LEIA 3DI2B 4U7MA 5C2UB 1KC5H 1MSPA 5IEHB 1DL7L 5FUCC 1EGJH 2G75B 3MGOA 4LRIA 5L7XH 4TUOA 2KZ1B 3OZ9H 3SGKA 3NAAH 2HT3D 3GK8L 4CUCA 1W72L 5SWZD 2V2WB 4ZO7A 4IRJC 1T5WA 3QIWD 4LQFL 4YC2C 1BBJB 5DVKA 5HHMB 1GL4B 4P2OC 4ERSH 3HI6H 4PJGE 2V5RA 3RUGF 1CE1H 2FATL 3FQXB 1DZBA 5DJ8B 2QQKH 5HHQB 1B2WH 1AQKH 3VFGL 3QHZH 4UDTB 5C0IA 1A6TB 4ODXA 4YNYB 4HIEA 1GPOH 2DWEA 1FH5L 3W0WD 4Y1AA 2CLRA 4Y19E 4HIJB 3E0GA 3NGBB 4M4RA 5HYJB 3V5KA 3F65A 3L3GA 3HMXA 1PZUB 2AP2A 2I26N 3GIZL 3O9WB 2J4WH 3ZHDA 5L2JB 1CICD 2R69H 1CDYA 5C07B 4ZUWA 4TNVF 1KIUA 1UADC 4OCXH 2JCCE 1JTTA 4JFZH 4HZAA 4LGPB 1J0ZA 3B3IB 5F7HA 5M94B 1GAFH 1SYVB 3BDBA 4N0FB 3BYTA 3PJSA 3A6CL 4JZJA 1U8HB 5L88H 3S3PA 5ITBL 3UC0H 2OR7A 3OTTA 4PRHD 3ESVF 3HLAB 2H8PA 3QNZB 4M5ZH 4XC3H 2HKHH 1KTKE 4XWGL 2H32A 1G7PB 2Z8VC 5DJZB 5D7LB 3N1FC 4QGYA 2FIKA 3DROA 3OJVC 2VB5A 4KC3B 5I66B 2FX9L 2I25N 5DZLA 3NPZB 5EWIL 3INUH 1TVDA 5JOPE 5D2LB 2BY3A 2PUQT 4NSKB 3GMNA 3VXTB 2HFEA 3VXOB 3ZYZA 1H8SA 3EAKA 3PV7A 2LVCA 5F7NC 4KUCF 2X70B 5FKAB 5T5FL 1OOAA 2XG4A 1MFEH 3MNVA 1FNEB 1JP5A 2W9EL 3P73B 3T04D 1RUAH 4PRHE 5CJOL 2A77L 1RZKL 2BNQB 5ITBH 5D70L 3ILPA 1DBJL 1AGDB 1I8KB 2DM2A 1T03H 5I19L 4NDMA 2VQUA 3N0PB 2HRLA 1IAOB 3BE1H 2E7LC 2NW2A 5KVDH 4GRLD 3CVHA 2P24B 2OLDA 3ZSTA 3BWAA 3IYLW 1INEH 8FABB 1ZLWK 4QHUA 4S1SL 5I75B 2E9BA 1ZLUH 1KNOB 2OTUB 3KS0H 4UQ3A 4HX1B 1UB5B 3LS4H 3QEGL 4NNPH 2WZPD 4TPRL 1A7PH 3NN8A 4OCRH 1SJXA 1FVEA 1ADQA 3V52L 5FO8B 5F88A 3O45A 2KUTA 5BRZE 5KTEL 1NBZA 1D9KC 3S7GA 2X9ZA 1X5ZA 3WUWG 3QISA 1HKFA 4R4BB 1Q94B 1R5IB 1OPGH 1YNTB 3PP3K 3MZTA 3NPSC 4HXBL 5FA4A 4ZPTA 3ARVA 5CEZD 4FOMA 3MRFA 4OCMC 5GIRA 4BFIB 1DUZB 3Q3GB 5KSBA 5DHVH 4RNRB 5EH1A 4J3SA 4QYOA 3UAJD 2VDPH 3MBXH 3NFSH 2NR6D 3GMRA 4D8PB 2DTMH 4AEIH 4NP4H 2HKFH 1FVCA 4QHKJ 4NQSB 5EU5B 4PRID 4KPHL 1XCTA 1E6OL 3QUZB 1FLRL 2JELH 3OKNA 5FKPB 1B4JH 3KPLB 1FO0B 1YEDA 4PJ7B 4PLKD 4XPFL 3S4SA 4NOFA 4EUPB 4M1GL 4L1HA 1A7OH 1SEBA 3LV3A 4CNIA 1UCBL 4XBGA 2DQJH 3IDJA 4KZDL 2EO9A 2YC1A 1IILE 1T80A 3KJ6H 3SCMA 4ORGA 1SHMA 1I9RL 1BZ7B 3P40A 5D1QB 3QXUA 5KSUB 5B3JF 4RBPK 2NXZB 4KJQD 5KW9L 2GFBA 3G5YA 5I18L 3FTGB 1HHHB 4AMKH 1KB5L 2ZUYA 4LSPL 1VESA 1KLUB 2AJYH 1TZIB 2EXWD 4FMKA 1WBYA 5JUEH 5EOTB 1RUQH 1CYGA 4X8JA 3L3JB 2CLRB 3IKKA 4ELMF 1E0OB 3FO1A 2NZIA 3B4NA 4JFFA 3O3BA 2IQ9H 5D8JL 5T5NG 5CZXC 4YUEL 5D7LD 2BP3A 4ZUVB 2NZ9C 1C5CL 5IEHA 3QJHA 5EOQL 2CRIA 5D96C 3RQ3A 1F11A 4ODWA 2CDFA 1I9RH 2EDEA 3L95B 4HSQA 1GGUA 1RFDH 4X4YA 4ALAH 3SBWA 4MHHG 4RNRA 2M2DA 1WC7A 3CMOH 1QFWI 2I5YH 4WFHD 1ADQL 5C07D 3BRFA 1TXKA 2QQLH 3JTSB 3TVMB 3VGFA 4HC1L 5HYJD 3DLQR 3SCMC 4Y4KA 5H37G 3W0WB 1CF8L 5TH2B 4NWUH 1QZ1A 4MXWL 4PJFA 1QSZA 3MYJB 4XNYH 3LHPL 4FFVD 4ZNEA 1F4XH 4BZ2L 1EEZA 5GGQL 5ABDE 4L8CB 3C5ZD 5HHMD 5JXED 3C60A 1NCTA 1FL5A 4QCIB 4OZFH 2QADC 4KRPD 3MXVH 1BJ8A 3RUGA 4H8WL 3ZDZF 5GZOD 2ZUTA 5C08D 2F54D 5E9DB 3V7AG 2NLJB 4JKKA 3ECBA 2BRQA 3NFNA 4OZGE 1F3RB 1KJ2H 2B7DT 4YK4B 3GMMB 5DR5H 1OSZB 4ZSOE 3IXTB 2GI7A 3V6OC 3U4BH 3TJHD 4GG6E 1UWEL 2NTFB 4PPTA 1QPPA 4PJFF 1X4ZA 4PY7B 3FB7A 2Z92B 5TE4L 2IH1A 1U58B 4QTIL 3K8LA 1SMAA 4RWYH 4XAKE 5EB9A 2R1WB 2C4XA 1RZKC 1OP5K 3MFFB 3SDCB 3I3EA 3O41B 5D7JD 1X6LA 1KV3A 4L9DA 5KVDL 2FLBT 2NXYB 3UROR 1CFQB 3VH8B 3RZCC 4F7PA 3V5DB 4YH6A 3TVMD 4NCC1 4Y8AA 5K9KA 1HKLH 3PL6C 3CSGA 3KJ4C 2A1WL 1GVIA 3KPMA 1R24A 3NABL 1OTTC 4NQUA 4Y19A 4K3DL 3MODH 3FQRA 5B38B 5AD0B 1R3JA 5CP7B 4UNVA 3MLVH 3DSFL 5IESL 1JNLL 3CZJA 2R29L 3MO1A 2XFXB 2R0WH 3VW3H 1W8OA 4U1LA 2R8SH 5DMIH 4KKAC 3W9EA 1QFUL 1NEZG 4KUZH 2X4RB 5ICXA 3U1SL 1SY6A 3IXTA 5IB1A 1OT1A 5BV7C 3ARPA 5CGYD 3R06A 3JWNC 4XAWL 3F7VB 5DJYB 1BEYH 2A6DA 1IFHH 5EO1B 2F6AA 4OD1L 4OJFL 4MNGE 3O41A 2XG5A 4UT9H 3KPQA 5DHVA 5LWYH 4Q7DA 2CRMA 3NN8B 3S37H 15C8H 3W0WE 2CIKA 4MGXA 2L7JA 4WU7A 3GJFK 3EJYD 1Q9LA 2NXZD 1F2QA 2JJTC 4F9LA 5IMMB 2VR9A 1GAFL 4XCYA 2D31A 3L3OB 4X5WB 3RL2B 1JNJA 4PTTA 5SX5K 4CJ1A 1YEHL 2YEZA 3KWWB 1TTGA 1T1ZA 4DUXA 2PYED 5FHAL 1CGSL 4PRAA 3T09A 2PTUA 4ELMA 3DGGB 3S35L 3MROB 2ESVE 3FCTA 3QUZD 5J7CC 4LF3A 3VRLF 2EDFA 2XICA 5I1AA 4LLYB 2EH7H 4XBEH 5DD5H 5E8EB 3TN0C 1OAYH 5DWUH 1NSNL 4J4PA 5C6PB 5JW5B 4KMTH 3SDXB 1M4KA 3EJZC 1JPTL 4V1DE 4NKIL 4R3SB 3SKJL 3BO8A 4YX2H 1OQOA 5MERB 4U1IA 1JYNA 3S97C 3CUPA 1PJ9A 4IRSA 3HG1A 2JB6A 2BOBA 5ILTH 4ONFL 5MHSD 3P4MB 1UZ6F 4ORGB 2IFGA 1QYGH 2PYEE 1U8KA 4Y5VB 4LHQB 5DJ0A 1EGJL 3BP7B 4P2RA 4JPIB 5AUMA 4ONOA 4NQDA 1NCNA 5TDNB 1GGBL 5GS0D 2HH0H 4HFUH 4AK1A 3MXVL 1U8NA 4EUPH 2YMXL 3HA0A 5D6DC 2EIDA 4QHNB 1F13A 4KTYA 1A6TA 4YNYA 3TYFA 3R8QA 4TUKL 4G8IA 4WW2B 4YAQB 5HYJE 4OM1L 4X6CB 4EZMA 1BM3H 4S2SA 3SCMB 3AS3A 3QHFH 5IVXF 4D8PA 3I6LD 5GS0L 2A2QT 5CJBA 1I1FB 4HKXB 1RUMH 3ZHKA 3BPOB 3GKWL 4MJ6B 4YDVA 4PGBA 2WWMC 4YLQT 1HWGB 4U6TA 4ONGL 3MJ9H 2BNQD 4X6FA 3S4SB 3L1OH 1F4XL 1EHXA 5EIVA 2ATKA 5IP4A 2FSEB 2V5TA 4JKPL 4MDIA 1FDLL 4MZ2A 2ITDA 1PSKL 5HI3C 1J0JA 4LCCB 3KLDA 3U7WH 3D0LA 2Q87A 3UBXI 5D5MA 4FQHA 2NY4C 3QQ3B 5IROA 4KXZH 1NGPL 2DF3A 2PCPA 5IVOA 3OHXA 1D5XA 4QOKA 3GMLA 1NLDL 2Y23A 1RUPH 1QQDA 3E1F1 2NNAA 1S7TA 4AIOA 4PV9A 3K80A 3KGRA 5I8OL 1HH9A 3KYNA 1LO0H 1HNFA 4R7DB 3MA7A 4X7EC 1CL7I 1LEIB 1H15A 3U6RB 3T65A 4PRHB 4HWNA 5HI5C 5DI8A 1KYOK 4M7LH 2R4SL 3MJ9L 2IALA 2VL5A 4YO0B 1HWHB 1PG7H 1MHEA 4OZHA 4G8EA 2HT3C 1CD9B 1XGTA 4LNRB 1AXIB 3ZDYF 1QRNA 5T1KD 5F3BA 3NTCH 3VXRE 5EU7C 1VDGA 3RGHA 4B0MM 3H2WA 3QNYA 1IGCH 3KPMB 4E41E 3TIEB 3CAFA 3HMXL 1OSZA 3C60D 4NKMB 1RUQL 4U0RC 4OBRA 1T6VN 5J11B 4PP1D 1WIPA 3OR6B 2WWKO 1ZGLP 3MNWB 4P5MA 4X99B 4DGVH 3JTSA 3RUGB 1Z5LA 3HZVA 3KNBA 5T5NF 1P4IH 1P7QA 2VKXA 1TNNA 5GRXG 3C6LA 2GSIB 4LIQL 3W9EB 4V1DA 1KEML 2CJUL 4OTXH 2D4FA 4LLDB 4QRUA 3WS3B 3QPXH 3PL6A 4M7KL 4UT6L 2FEEI 5TQ2H 3EO0B 2VQ1A 3VXPB 1UXWB 5L2KD 3IGAA 2DMCA 5GGRB 3JUYA 2IH3B 3DSNA 1X5JA 3SKJH 4LSSL 1FAIL 1F4WL 3TO4C 2HN7B 2WP3O 3VXSD 4D9LH 4IGBA 1MNUH 5J9PB 5LVEA 3TO4B 3R0NA 5EN2B 4HIHB 4XXDA 4P46C 2DWDA 2XWJB 5DC9B 2Z91A 4UDUB 3VFVA 3MLRH 3ZKXB 4QXGH 5ACZB 4N8PA 2C3VB 3T2QA 1MFDL 1X4XA 4X9BA 2F8VA 5CFHA 1IGIL 2XXCB 3T65B 3GMPB 1P84K 1XGUB 3DTXA 5C3TA 4OD2B 4Y4FB 3FQXA 1E6JL 2IG2H 5SX4I 1Q1JL 4YIQB 1IT9L 1EO5A 4LF3B 3P0YH 5F9AC 1OVZA 3BFOA 4NC1C 3SGDI 5MP6L 4KMTL 3VU2A 4C57C 4XPTH 2A73B 2WIIB 1JV5B 5EA0H 4GOSA 5BVJB 1YEKH 3B8YA 4UIKH 1KTDA 1OF2B 5DVMA 2CMRH 2DYPA 1B88A 4AIXA 5JPMA 4GRLC 5ESVB 5JIKA 4F33A 4QOKE 3K8KA 4HG4J 4Y2DD 2UZIH 4U1JB 4QHMA 3Q1SL 4RZCB 4E41B 2DQTL 3FN9A 3U30B 1YY8A 4KJWD 3N1MC 1MJUH 3D9AH 1JGDA 2JJSC 1H5BB 5DJYA 1NGXB 3VFMA 4TVSa 1JNLH 4PRIE 4YBHA 1KIQA 1AI1H 2E7LA 1GZPA 2VLME 5FYJL 3B5HA 3O4LA 1JMXA 3S5LB 2HN7A 3S5LG 3E6FA 1NBZB 1QSFA 3RX8A 4M4PA 5L6YH 5KZCD 4ZSOA 1KJVB 3ARTA 1XZ0B 1NAML 4Y4HB 2DWDB 4UNTA 1Z3GL 1FGVL 4JFHD 1UGNA 3UJTH 3VFVB 5KANG 5E8EA 1ZLWH 3LMJH 3WFHB 4KDVA 5A16A 1FGNH 4TNWK 5HGBA 4JFOB 3O6FC 4Q9CA 4N5EC 1HZHL 2B39A 3FRUA 4P2RD 4FABH 5HGGS 2DLEA 1A64A 3HG1B 5EC1A 4LCYB 4TTDC 4WVRA 2YUVA 1IAIM 1TJIL 1F02I 1XMWA 2C7UB 3O6MH 2XQYG 2VLRD 2AW2A 4MXWH 4Z78A 4DGVL 2R0ZL 3IJYA 4ZFOA 5HPMB 1L9NA 3UJJL 12E8H 1MAMH 5CBAA 5J1AB 1YJDH 1K2DA 2PTTB 4PFEA 1FL3A 1FE8L 1EHLL 4ZFGH 5DMKB 2DN7A 4A6YB 3LZFH 1DBMH 1A1NA 1L7TL 4F9PA 2DM4A 5FUOH 2B2XL 3ME0A 3KPOA 3C8DA 1YPZA 1BLNB 2JB5L 2FWOA 1HQ4B 4N0UB 3ULUH 1MQKL 1A4JB 5IV2A 3PGFL 3KYKL 2ESVA 4NM4H 3P11L 5TPWL 1HXYB 1OAQL 4LPWA 2AEPL 3QDGD 5IG7B 4LVNC 1JNHB 4NT6A 5DO2D 4EOWL 2GIYA 4ONHA 3MPCA 4GXVL 4HF5H 4H8WH 5C0RL 5EBLB 2BVPB 4JRYB 3TN0B 5DI8B 1MIEH 1T0NB 3G08B 3U46A 3HUJE 4OKDA 2ZOLB 3DOSA 1G0DA 2JIXD 2WZAA 1Z9MA 3V4UL 2E5EA 5KBNC 1UKTA 2H45A 4DN3L 5BS0D 2ID5A 3KS0J 5GS3A 3O2DA 1FYTD 4M62H 3GSWB 5JZ7C 2WBKA 3MLVL 1I3RB 1LO2L 5A43C 3ETBF 5FB8A 4I0PB 3C6SA 1IC4H 2GK2A 4PGDA 5JOFB 3U6RA 2ED7A 4POZD 3MLRL 3H3PH 2OZ4H 4P57A 5LGKA 2DQHH 3QDGB 3Q6FB 1IZKA 4HS8L 1RUPL 3UDWC 1MRCL 4FFVC 3IETB 4N8CH 5IR1A 4HIIB 5A3ID 1I1CA 4I1NB 4U7SA 1QQDB 2ORBH 2X9WA 1P4LB 4G9DA 3C5ZC 5C0CA 2CKBA 4Q9QH 3G5XB 4Z7WB 4JREC 1T5XB 1PX4A 2G5BB 4HHAB 4MQSB 1QFUH 3QUXC 3MNVB 2Z31A 3OB8A 1MWAL 1ZGLB 2UYLA 3O6LL 3NIGF 4YDJA 5ESVA 4MJIE 3KXFE 4PJHE 2ESVB 4ETYA 4JFQA 3N06B 4NPYB 1AO7A 1RIVL 5AYUL 5I8EB 5SWZE 4ZFOL 5JO5A 4U3XA 3WO3B 3TJHC 1A0QL 4JDVB 3RIAK 1I4FA 3PHOA 3OGCA 2XNAB 1AFVL 4NNYB 1JGEA 1NMBH 4P9HH 5KAQG 3AUVA 3FQNB 4QT5B 2ADFH 2GJ6E 2HT4C 5FYJU 1OAKH 1JK8B 3CFCH 5D7LA 5IB4B 4I18A 1NSNH 3L3IB 3RZCB 4WV1B 4TSBL 1NKOA 3BH8A 1P4BL 4HS6B 5C0BE 3PWPB 3AM8C 2PYEB 1I75A 4HMEA 4JRXD 4PG2C 3SGDH 3PDOA 2OQJA 4KKCC 1E4WH 4UDUA 4QXWA 3K2MC 4I3SH 1ZVYA 1J8HE 5DK3A 1MCDA 4WI4A 4J7RA 1RIUH 5ETUB 5EZJB 1XR9A 2QSCH 4KRMB 5EUOA 3KPSA 2GHWB 3AS2A 1CI5A 5HYSB 4JGJA 4L3EA 4M7ZB 4K8RH 1T2QH 4H88H 1EBAA 4XPBH 5CGYC 5KG9B 5CAYB 1C1EH 5DD0H 4G6KL 3OAYH 4R7NB 3FT3A 1VACB 4X8XA 4DFIA 3WN5B 2K7PA 1AGBA 2H41A 3NVQA 1KXTB 3EDEA 1OF2A 1Q9OA 1ZGLA 3FRPG 3QAZC 2NXZC 2R4RL 5EWIH 1UG9A 2QL1A 3RWDA 2EICA 3FMGH 3DVIA 2J8UB 3VDCA 4XHJD 4J3XA 3U82B 1Q8MA 1XCTB 3RU8L 5IBUB 2D2OA 3G5ZA 4ZO8A 5IBUG 1UM4H 2GFBB 2NY5H 3DSFH 3BRGC 1DBKH 2NXYD 2V17H 4F57L 1FG2A 1C7TA 1JF1A 4NRXA 4MJIB 1XCQB 3T77B 3IDNB 1HI6A 1D6EA 1OLLA 4LLQB 2N1KA 1NBYB 1YEEL 5GZND 3C08L 1A2YB 2OP4H 5KJRH 1ND0B 3FB6A 4YWGH 5ADPL 1INDH 3O2VH 1U92A 4RIRA 1AP2A 3K4DA 3VXSB 4DVRL 1F97A 3TM6A 1MEXH 2DQCL 2RQ8A 3WEXA 1IL1B 2BNUB 1X5YA 5TF0A 3MXWL 5C0BB 3SO3B 4LOUC 4KRPB 2BNQE 3U0WL 3VFGH 2BVPA 4JRYA 1BZQK 2BVTA 4MQ7A 5JPNA 1JZ3A 4NFBA 5D1QC 4H0HB 3HR6A 3LN5A 3SE3A 4G8FA 2AKRA 3VCLB 5CJQL 2OL3A 1A6AA 2NLJA 1S5HA 4OCLC 1FNSL 1E4XH 3IAQA 3NFNB 3EYFA 1B4JL 2W0LA 5JW4Q 2Z35A 1DDHA 5F7UA 4K07A 3FRUB 2EDXA 4C58B 2GTZB 4XMPH 1AXSB 4KVNL 4P3CH 4YXHL 3BD4A 2CO7B 4W70A 1N8ZA 4JR9H 1OP9A 4K8RD 5LG1A 3F7PC 3LKQA 3HUJA 3LKNB 4DW2H 1M1SA 1VPOH 4XWGH 2HRPH 3TV3H 4PJFB 2VDQH 3V8OA 3VWKA 1HHJB 4KROC 1LK2B 5IW1B 1ACYL 2BVEA 2VLLA 4NHUA 3STLA 1BPVA 1A3RH 4GQPH 4PGCA 3BZDA 4PRPE 4NO0D 3W9DA 4I18B 3MLUH 4DTGH 5CEYA 4IOIA 1D5XB 4NUGH 3UTTA 1X7QB 1YY9D 3EOAA 5F6IC 3U4EB 3RGVC 1S9WB 1YEIL 1A9EB 1LP9F 5C0AE 4CU7A 3T3PE 1J86A 5TH2A 4XAWH 1UQSA 1RZIA 2AK1L 3IT8D 1DL7H 5I75C 1TVBB 2XACC 3GFUA 4PGJA 3IDYC 3WYRA 4A2MA 2D03H 1Z0MA 3TBVA 3RWIB 4HV8B 3CH1A 4RAHA 5LWYL 3F62A 4I48B 5EBMA 3L5JA 2WLZA 4N1HB 2VLKA 2DLHA 2QSCL 2VLRE 2VDOH 1I7ZB 4YDVB 4QOKB 2WLYA 4MD4A 5B4MC 4M9OA 3LQZB 4RFNC 1WT5C 4XP4H 2F54A 3C60C 2B1HH 4RZCA 4JVWA 4HS3B 4M43H 1FFNB 4PD4J 4Z77A 3GJEB 3NZ8A 5ADOH 5IF0B 4P4KD 2CMRL 2APXA 1FZOA 3HRPA 2ITDB 2W1NA 3R4DA 3PE9A 3AAZA 5E4EB 3HFML 1JPST 3S34H 2AI0L 5ISZA 1TCRB 4XPTL 5HDQH 3VGGA 2ZKHH 1S9WA 2Y06H 4OZIF 1AGEA 2O5XL 4Y5XC 43CAA 5KVEL 4WHDA 3G6DH 4MXVF 3LD8C 3P4OB 4GW1B 2Y5EA 2XIDA 3H8NA 4HQQL 1BD2D 2FYYA 4HUWA 3RWIA 2D7NA 3VGAB 5JHDB 1FORL 3L3DB 3NOIA 1V7ML 4GBXC 3SBWC 3VFWA 2C3GA 1QNZL 4PLJD 5E7FA 3RRQA 4YHLL 5AYUH 4Z5RB 5BZDB 4G7VH 4GAJL 2NY6C 1RPQA 5BMFH 1RMFH 2RIKA 4WWKD 3GMOA 2ZKHL 4FXLA 4NWTH 2D31B 3L3OA 5GPRA 1CBVH 3CXDL 5HVWA 4XAKD 3S34L 1UJTA 3CFDA 5H94B 4HV8A 4ZUUA 2LV4A 3OAZH 2VDLH 1MJJB 1J5OH 4WUKL 2BDNH 3BQUA 4QHLB 5FO8A 2OK0H 5C9JA 4U3CA 5B39B 2EYTB 3WL9B 5EC2A 3TIDA 1QRND 1CGVA 3BD3A 2AEQL 2HTLD 4LLYA 1Q72H 4TSAL 2E7BA 5C0NC 3EBAA 3QAZB 4K7PX 4OV6F 1MLBB 4LLWB 5BMFL 4KY1L 3GI8H 5F7KC 4M3JA 5IV2B 3X12A 5JIIA 1IARB 2WAHA 4HK3N 1LDSA 3D87B 4JO4H 2HTKD 4WO4D 1U95B 1BIIB 3TZVD 2G60L 4W68A 5I66A 3RZWA 3E8UL 3WE6A 4PV8A 1R3HB 4TULL 4Z7UB 3BZEB 3WDJA 2X5PA 4AL8H 3PV6A 1E4KC 4Z95L 3SKMA 3HUJB 3ARFB 2VC2L 4M7ZC 3Q5OA 2FNBA 1WFTA 4Q58C 1Z9LA 4XNZC 3NH7L 4PJDE 3QUXA 3BPCA 2BFVL 1R3IH 2NY1D 5IQ9A 2ICES 4MJIA 3RIAF 4EN3B 2W9EH 2BNQA 2EDLA 1OW0C 2YRZA 3QEUB 5KSAC 1T83A 2MKWA 5MP6H 4WY7H 3SDXF 5TFSH 3CJJA 5KSBF 5HDLA 4EOWH 3A0OA 1CXFA 4HAGA 4DN4L 4WV1C 2XXMB 4FQLH 4IJ3C 3UTPD 4AEIL 3OHXB 5D7JB 4GBXA 2UUDH 1WUNT 4LFHD 4U6HA 5E8PB 2OSLA 2HJKA 4U1HB 3FFCB 4YHOH 3BQUB 3GSNA 4OSUL 4Z0XA 4RGNB 3JWDL 5CEZL 5DURB 4LP5A 3DXAA 3RY6A 1UCTA 3PV6B 4YAQA 1MCPL 5L2JA 2FEDC 2COQA 3QCTH 5F7MC 4WTXA 4L8SA 4WRLA 4GXUM 5FK9B 1J10A 5E9DD 4TVPL 1BWMA 4XPFH 2DQIH 4Y88A 3JVGA 3TNMB 1F90L 4KV5E 1NQBA 5FYKE 1NDMA 3STZB 4TUOB 2CRZA 5AEAA 3QIWA 4S10A 1SJHB 4OLVL 4L4VA 1QTYT 2E6PA 5ALBH 4WDIA 5C2BH 1M71A 1J18A 3LMJL 1SM3H 1KJ2B 5T3XH 4G6ML 2APVA 1NAMH 4LSRL 3GJFA 4GW4A 1FSKC 1BREA 4XB7A 4BSVB 1OAYL 3W0WA 4KU1A 1AGEB 1WVZA 4R8WH 5FGBC 2HLFD 3O2DL 4GRWH 1BFOA 2MQCA 2VR4A 5C0IB 1KJ3L 3IKCB 5E56A 3P9MB 3RY4A 3G04A 4XMPL 2F19H 5B8CA 4L8CA 2NX5B 1YMMB 3RFZC 4AH2A 4JG1L 4KUZL 3VH8G 1C5DB 3TA3D 2NY1B 1QG3A 4IDJL 4EDXB 2V2WA 1D5ZA 4MDJA 2VMFA 4CN4A 5KVMC 1IGML 1VA9A 5BRZB 3X3GL 3HKFA 5F96H 2A9ML 5GRUH 3PHSA 2DLTA 4OB5L 3TEUA 1IM9A 1MJ7L 2XY1A 3T4YA 1MVFA 4TN9A 4WO4B 5E2WL 3AXLA 4TSCH 1E4WL 2VDML 1C1EL 4JB9L 3THML 4HIIA 4RFEB 1JZ4A 3KLAB 1IC7H 3I6KB 4L4TE 3T0EB 3TBYB 2OCFD 2G2RB 4NUJB 1DQMH 1NL0L 2V7HA 1TNMA 4MSWB 4WUUB 4F8QA 5J1SC 3C6SB 1JWSA 2QTEA 4OV5A 3RVVD 5EBWA 4LCIL 1GCFA 2X44D 1QLFA 3C87A 1P5VA 1TTUA 2AJVH 3QUYD 4L29A 5IVNA 5GRVK 1CGWA 1SEQL 4J3VA 4NO0A 3MGTA 5IK3B 4ZQKA 4Q0XH 5E24E 3DIFA 1TFHA 4P4KA 5I1DA 1J8HD 4PRBA 4JHAH 4AENB 5A2IH 2HT4D 2X7LA 5IW6A 1ND0A 3B9KB 4CDHA 2P8MB 3CH8A 3W11C 5SWSB 4JLRA 4JRXE 4KK6C 5K9QG 4I5BB 4PJIE 2GITA 1XR8A 4F7CA 5EIQA 2V9TA 1T3FB 5GIRB 4OCXL 3DVGA 2KKQA 2ZCKL 1NKRA 4O58H 4ZDHA 2A6KB 1S7SB 4XTRC 1EBPA 3MUY1 1BD2B 2H26A 3CX2A 5BS0A 5F71A 4O4YH 3ZYJA 4R26H 1Q9WA 1SBSL 5FUZH 1EJOL 3QXTA 5CWSA 4NJAL 5GGVL 5B8CC 3E6HA 3RWGB 2NX5E 2HYMA 3P0VL 2E8YA 4J8RA 3QA3A 4ZUSB 3FB8B 4Z7QE 2Y36L 1JGUH 4L4JA 5CGTA 4JFXB 1AFVH 1V3KA 1U58A 4BFIA 5KAQF 4NO3A 3RNKA 4KDTC 4EI5B 3L3HB 2AI0H 4NN6C 4K23L 2GTZA 1MFEL 2FWOB 3ULUF 1XF4B 1JZ7A 5AYQA 3QPQD 3KYMA 3BISA 4LLVB 3CSPA 5C1MB 3IB4A 1F4AA 1MJ8H 1OAXH 4RRPA 5EBGA 2JLLA 3HC3L 1IKNC 1MCKA 5JUEL 2AAVA 4X9IA 3TP4A 3PF2A 1KPUA 3HRZB 3D18A 3IDGA 5F21B 2EYRA 2HWZL 3EIFA 3I85A 3MLWL 4Y0GA 3WIIL 1IGJA 1PY4A 4ZQKB 4JN1L 1Q9KB 4CVWA 4IDLA 3OR7A 2BOCA 4R2GC 3WE6B 4N0YH 2Y5TA 3RY6C 5E2TL 4Y8DC 1G9NL 3HNTL 1XGQA 4R96A 2VDQL 4F58H 4PS4L 5F89B 5DLML 2WQ8A 1G7JB 5BVPL 1HXMA 4JFOA 3P4LA 4QY8A 1BJMA 1IC4L 3DX8A 2FZ3A 2VL4A 3P4MA 4FXGB 2XZQL 3VRJB 1AHWB 3Q5YA 1N5AA 4O2EA 4RMRA 1DE4A 5T1LD 4JDTH 5I1GL 2KQNA 1CLZL 2Z8SA 1UVQB 2VLRA 4XRCB 4L8BA 2P5WA 5JW5A 4LAQH 25C8L 3G5VA 5JW4N 4KGLA 4ODWB