3HR6A

Structure of the corynebacterium diphtheriae major pilin spaa points to a modular pilus assembly stabilizing isopeptide bonds
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
431
structure length
420
Chain Sequence
b'RTSIAVHALMGLPTGGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVVQELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALSEPVKTAVDPDATQPGFSVGENVKYRVATKIPEIASNTKFEGFTVADKLPAELGKPDTNKITVTLGGKPINSTDVSVQTYQVGDRTVLSVQLAGATLQSLDQHKDQELVVEFEAPVTKQPENGQLDNQAWVLPSNPTAQWDPEESGDAALRGMPSSRVSSKFGQITIEKSFDGNTPGADRTATFQLHRCEADGSLVKSDPPISLDGKQEFVTGQDGKAVLSGIHLGTLQLESNVMKYTDAWAGKGTEFCLVETATASGYELLPKPVIVKLEANESTNVLVEQKVKIDNKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative surface-anchored fimbrial subunit
publication title The Corynebacterium diphtheriae shaft pilin SpaA is built of tandem Ig-like modules with stabilizing isopeptide and disulfide bonds
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Structural protein, cell adhesion
total genus 94
structure length 420
sequence length 431
ec nomenclature
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hr6A02
5DMKB 3BPLC 4NHUB 2HFEA 2DQHL 5IQ7H 3DBXA 1GGCH 5D1ZD 4PBVC 3MLVL 4TOYH 2FWOA 4DUVA 1A5FL 5D7LD 6FABL 1GPOL 1T0MA 2EKSB 1NFDF 3BEVB 1FO0A 4GG8B 3SEPA 4OCSH 1JK8A 3C87A 2BFVH 2HVJB 4X8JA 3WXVL 1KCVH 5I8CA 1BAFL 4S1QL 3TEUA 4JDTL 3EJYD 2WUBL 4JRWA 3CFJB 3I3EA 2QQNH 3HZVA 1XIWB 3QI9C 4LIQH 2HRLA 5DJAB 5IMOA 1F3JB 1QLEH 3ARBA 2B4CH 3MODH 3DPBA 1GOFA 1U8PB 2C4FU 2P43B 5HHXH 5MEPB 3T0XA 3FZUC 4YHPB 4LHQB 2DYPD 2OR8A 4H1LG 4C83A 3PHOA 3QYCA 3QIWB 3C6LC 1MHPH 5ICYB 1FAIH 1RUMH 1MJ7H 1B88A 4Z78B 1BVKA 4B7LA 1U3YA 1Q9WB 5FHBH 1HHKB 3VI3E 4S11A 1CGUA 1Z2KA 2X4UB 5F21B 3SPVA 2XI9A 4EDWH 5HVWA 3L5XL 3HPLB 2DM3A 3ULUF 3PQYB 4M5YL 2H3NA 1HH9A 3WJJA 3SDDD 2B1AH 2XOTA 1XZ0B 2EIDA 5FKAB 1N8ZB 1IFHH 4AEFA 3RDTB 2DF3A 3MRQB 3GIZL 2N1KA 1TVDA 4XCCH 4Z0XB 3PDOA 2PN5A 1T6WA 5T3ZL 3ZE0F 1D6VH 3VMOA 2I9TB 4PR5A 5DD3H 4ZDHA 1UM5H 1JPFA 5J57B 1JPTL 4P3WA 5C0AB 1JTOA 5ENWB 1UXWA 2ATKA 2M26A 3LQZB 5JW5A 2WM0A 2DQTH 4UV7L 2VQUA 3KPQB 6CGTA 4HJGA 2B5IB 1RZIA 2BCKA 4I3RL 4P23C 4Y5XA 4NQDD 2PO6B 4PY7A 4XNMA 1NLDL 5DXWA 3TA3A 2OTUA 4UNVA 3VI3F 2YPKA 4A6YL 4OZGA 1U92B 2GY5A 1NEZG 3GIVA 1DLFH 2AV1B 3NFPA 4X7TA 1YMHB 3QUML 4PJAA 1RZ8B 4WU7A 3VXRA 4NHCH 4YAQA 1KJ2L 2VZSA 2NNAA 5C0CD 5F89B 1M7IB 3UJTH 2PO6C 4XP6L 2QSTA 1KGCD 4U6YA 3B9KA 1EZVX 3CD4A 4JGJA 4JPWL 4BA8A 3LCYA 1WFNA 4XXDA 1WZ1H 1TZHB 1PY4A 3RX7A 4N8PA 1KJVA 5FA3B 5AYUH 5BOPA 3WLWD 5H35B 3IJSA 2BMKB 5DUBA 4L9LA 1ZT1A 5AZEH 1ZLVK 3D2UA 4XVJH 1UVQB 4K3JL 1JWUA 5I15L 5ALBL 3Q6GL 1KLUB 3OJVC 1F3DJ 3WFCH 3G6JA 5F3HB 5EZOH 3SE9H 1YN7A 3RTQA 3QIBD 4FXLA 4QT5A 3VDBA 2XFXA 3MPCA 5J11B 4MVBC 4U05A 1P7QD 5EIVA 5ERWA 4LPXA 3G5XB 2YPVH 5HYJB 4YBQD 2ICES 4Q6IA 4PGBB 1QOKA 4MXWL 3HZYB 1T80A 3T2OA 3RWIA 4FNLL 5E08L 3GSNH 5HD8C 3O3UN 3RZCB 1I7UA 3MUGB 3LEXA 4RGNC 1FO0L 4IEFB 1F42A 3QCTL 1I3GH 2D31B 4Y4FB 1OGTA 1W0WB 1ED3B 4PY8I 2B1HH 4OLVL 3JWOC 3HE7D 3KNBA 3A6OA 4PP1D 5E6IA 2BRRL 2E7MA 4YXHH 2D9CA 3FO2B 4UB0H 3NH7L 2OJEA 4ZUWB 3RGVC 3W82A 1PG7L 4Y5VB 5ALCH 1OAYH 1PKQE 3B9VA 1FIGH 2V17L 3UZVB 3ARYA 1HH6B 3LN9A 4WNQA 5ESAA 5HGDA 3F12B 4ZUVA 5DD0L 4PJHB 2NY6D 3GSXA 3UDWC 2JB5H 4GAYB 3MRPB 4KKBD 4FFZL 4BZ1H 3T4YB 4Y5VC 2VL4A 3TC9A 2R8SL 4K07A 2GSIA 5KVFL 3HLAA 4LCYA 5SWZA 1R5IA 5C07B 1YEEL 1DE4B 3K1KC 2MQ3A 5L9DH 4X6DB 3L1OL 3S88H 1A9EA 1T21A 2EDYA 2A83A 3TCLB 5C0GA 5IFAH 3L3JA 3QXAA 5JMRA 4HZLA 4XCYB 3H6JA 3TJHD 1WJ3A 3MV7E 2DMKA 3JWDL 5JIPA 1AI1L 4UT9H 4ZPTB 2A38A 1F13A 1JNJA 4RAVA 3JBG7 3PGFH 32C2A 4PV9B 4MNQA 4Z7UA 3CK0L 5JQ6L 5DMJB 5B38B 1SJHB 5C0FA 1D9KC 4QOKD 5J9PB 1IGTA 4LNRB 3L7FA 1IGJB 1URLA 1YEDA 1OAXH 5I75B 5C70A 2BOCA 4G9FD 1ZLUK 4EI5C 1N5AB 4NQSB 3VGFA 3MFFB 3VXOB 1XF4B 3AC0A 4D0CB 5FYLL 3UTTD 2J8HA 3BQUD 3BYTA 3RY6C 1A6TA 5D1ZA 3VG0H 1A3LH 4X7FC 3SQBA 1NGZB 1MIEH 4U1LB 5EFIB 1SYVB 3ZE2E 2R23A 3O0RH 3OKLB 1HXMA 5I75C 2X4QA 4KK5C 4OTXH 1FPTH 1NCTA 4HULB 1AXSA 2Y1VA 2DDQL 3ARGB 5BZWB 3H7BA 2XNAA 4J12A 2HTLD 2ZUVA 3STLB 3RKPA 4G6FD 2BHUA 3GSOA 3DUUB 3FTGA 1AQKH 4D9QD 1CLZH 3U4EA 1I1YB 1J8HD 1FN4B 3G9AB 4LRIC 1I7RA 1OTTC 5GGQH 3KPMA 3UO1L 3V10A 2FL5B 4L4VD 3VXQA 2DYPA 3DTXB 3P0VL 5E8EA 3ARGC 3SGJC 4S0TD 3QZWA 4PB9H 5IVXE 2P7TA 3CCHB 3SJVB 5FUZL 2CRZA 1CIUA 2C7UB 2RBLA 3MCKA 4KJWC 4CBPA 4Q2ZB 3ULVL 3FO0H 5JNYB 1KF9B 2X4TB 3TJEH 4N8VA 3DX9B 4Z77B 1YEHH 1QQDB 1U8OB 5DO2D 5ACZB 3B2UD 4UINL 1W8NA 3D48R 4OZHB 4LLYB 2EDKA 3QISA 4J3SA 4ZNEA 3ZE2F 4GKNA 4H0HB 3W11D 5JTWA 3NZ8A 1FG2A 2EDFA 2AJSH 4MHHG 2E8ZA 1IGCL 1XGUB 1JZ5A 3DI2B 2YRZA 3LKRB 3NVQA 3OHXA 5FUCE 4MDJB 4PGEB 4DGYL 4K7PX 5J13C 1KCLA 1AJ7L 3KPSB 2X4OA 3X13A 2DQCH 4E0RB 4PRHD 1KXQE 3EJZD 4XBEL 5IB4A 1S8DB 2Z8RA 5A3IC 3RUGE 1WITA 3KYAA 3OJ2C 1H15B 2HN7B 1FNEA 4NQED 5IMKA 3SQOH 5EIIB 4GG8A 1MY7A 2YBRA 4KC3B 4M1GH 4NQDA 1YY8B 5D70L 1FL6B 5KAQF 1CK0L 3MV9E 1LO4L 2R4SH 3MA9L 5K9QG 2HVJA 1A6VL 4FFYH 4PJ8D 5D7SH 3CLEH 4LLVA 3ZTNH 1KB5B 2JB6A 2VITA 4Q7DA 4J3OC 2LVCA 4TULL 4OI8A 1U8IA 1XIWA 2L0DA 4NT6B 1NGYB 2GI7A 1F3JA 3HAEH 1KIRB 5HDBF 4UDUA 5K9OA 5MEPA 4JM4L 2OX5A 3UYRL 3T0BA 1QUNA 5B21A 3TBTA 3VXMD 5ICYA 3GSQB 3AS2A 2R56H 3QUXA 4O2CA 5EU6D 3WFBL 3WIFB 1OPGH 3B5HA 4PP2A 1A6ZA 1AO7B 1L7IL 4R6UA 2ZOLA 2HH0H 3L3GB 4JPIA 15C8H 3RUGF 4CU7A 4MQXC 4U1KA 5B4MD 3HPLA 2ATPA 5HI3D 3DYMA 1RUPH 5EBWB 1O7SA 2VZ1A 4K2UH 1VADA 2R2EB 1FC2D 2EECA 3EYOA 2R9HC 3HI5H 2Q8AH 2KBGA 2PCPB 3TT3H 2DMCA 2WUCL 2KPNA 4KGLA 4YHYC 1J5OH 1F02I 4PJGB 2D0FA 5EOQL 4HC1A 3PG2A 4OCXL 5SWSD 4POZC 1RJZA 4M7JH 3MSPA 2WQRA 2JCCA 2VE6A 5I18L 3U7WL 2KQMA 4ZQKA 4GAFB 4Z7NE 1SEBB 3M45A 1NH6A 4GJTB 3F6IA 2PW2B 2BVQB 4K94H 4ELMB 2VIRB 5TE4L 2XKSA 4PRID 5KOVC 3P77B 3HE7A 1BQLH 1FE8L 1KPVA 3VFPA 3AREB 2D2OA 2FBJL 2VDQL 3QAZC 3LKNB 5F1NA 2X9WA 2M8XA 3QG6B 3W0WE 1JN6B 4UV4L 3V6FB 4XHQA 3S4SG 5CKGA 4OKDA 1LP9B 2XTJE 3CXDL 4PPTA 4HZAA 1E4KA 4W6YB 1T89A 3KPRD 4OD2A 5IBTH 5IVOA 3AREC 3HC4L 2YN5A 4MB5A 4UQ3A 3HTLX 3BDXA 2DQGL 1YY9C 4PS4H 2RHEA 3BUYA 5IB2B 1LDSA 3BP7B 3LEVL 1ZEAH 1FYTA 2A6JA 5L2KB 5TDNB 1KENH 1TJHH 3P0YL 2R2BA 4Z76B 4KHTL 1QVOB 3F7RA 5D2LF 4F9PC 4Z7NF 1I1AB 2P5WB 1S7QA 2C4FT 1J9CT 3BIBX 1RUKL 1PLGL 3U46A 1I75A 1E4WH 3ARRA 5IHZB 4WUUD 2YXFA 3B2VH 1IARB 1CFVH 4HWUA 4WO4B 1M6OA 5IW6B 2C3XA 1CTOA 1S7TB 1IQDB 1U93B 4OCWH 4XHJD 1EJOH 4QGTA 5ACLA 4M1CD 1P6AB 5HYEA 4R9HA 3SDAC 2OM5A 5JPNB 4N1HB 2F54E 3B43A 1UB5A 5HYJA 3TFKC 2NY4D 4ODXA 4ELKA 1IZKA 2NZIA 1YPZB 4U7MA 2FSEA 3VD3A 3HCVB 4QOKA 4KQ3L 1Z5LA 4U6VL 4HUNB 3WHE0 3VFSB 4X6CF 1QSEB 3GHEH 4XWOD 1LEIA 4P3CH 4Y4FA 4G9FA 4YHLH 4LSVL 5KTEL 3LRGA 5HVFB 3GMQB 4O51B 5C9KA 3UTTA 3JUYA 4PJDB 3BQUA 4RAHA 4LFHG 1MVFA 3LV3B 1ZAGA 5DEFB 3U0TA 4FXKB 4LPCA 4LOUD 1CQKA 3D85D 4YLQT 4ONHB 5HVHC 5CJ8A 1XF2A 2J6EA 4C56D 1CF8H 3UTSE 3V6OA 2X4NB 4U3CA 4NCC1 1SHMA 2DIAA 1HH6A 1MJ8H 1N7MH 4KJQD 1N6QH 1EFXB 5DMIL 3K74B 1MCKA 4OZ4B 3ZKND 3T04D 4OD1L 1FLTX 1BD2E 5I66B 1AFVH 1VGKA 5EA0H 4RDQF 3CPLB 1DBAH 2GTZB 4PRDA 3UBXB 4FFVC 4LFHD 4EN3C 1MOEA 1J8HA 1QFUH 5EUKB 1ZT4A 3EAKA 1BZ9B 4ZUSA 3FQUA 3ARZA 2YMXH 4NQVA 4LHUB 1U3ZA 4XVSL 3IFOA 4OFKA 3PP4H 4L4VA 1REIA 4JZOA 5GGRY 2NTFA 3O6ML 4WI8A 4LSQH 5GRWA 1ZWIB 4JQXC 1CU4H 5E9DA 2X70A 1S7UA 4HC1L 1WCBA 4TVPH 2ZUSA 3A6BH 2Q76A 3ARUA 4Y19B 3GBNL 4OSUL 5C0BE 4CVXB 2C1PA 4I4WA 1HDMB 5SV4A 1MWAB 5T1LB 1NMAL 4HUVA 1GVIA 3FOLB 2IGFH 4G6JL 4PV9A 3QHTC 3C9NB 5B38A 1PYWA 1SJHA 5CEZD 3VW3L 3IKKA 3OR6A 4M61B 1J05B 5J9PA 2NCMA 3I9GH 1KIPB 4LNRA 4QEGA 2CKBA 5F8QC 1D5XB 4W70A 1FCCA 4ENED 3V0WH 4NGHL 3MFFA 5DRNB 3VXOA 1EHXA 1DBBH 3GMNB 2Z0BA 5IVNA 3I84A 4M1DL 4L4JA 4LP4A 4LLUA 2KZ1B 3X3FH 1RIUH 2EDQA 3EO9H 3GRWH 1CFNA 1JZ6A 4GUPA 2HG5A 4O5LH 4JM2C 2PTUA 1X7QB 4H26B 3H3BC 2JLLA 4PB0L 3TWCH 4LSPL 5EZIL 1MRCH 1T1XA 2CLZB 2P8LA 2X09A 2ADJB 3GMPA 1L0YA 2VLRD 5KVMC 4QHKI 1F4XL 3ARDB 3THML 2YSSA 5JORA 1DLHA 4NN6C 4TQEL 3U83A 2X4RB 5L88H 3IFNH 2FO4A 3DTXA 5F44A 3VG9B 3QDGE 4KRPB 4C57C 1OAQL 5IMMA 4KY1H 1KJ3H 3VXMA 4IGBB 1A21A 1A64A 1U3HA 4JR9H 4CJ1A 5IKCB 5EU6A 3BP6B 1KSRA 5HI5D 2XIDA 4AENB 4PLKD 3ARFA 4OF5A 4Z77A 5DC4B 1PGRB 3ARDC 3CDGA 3J8F7 3VWJD 3ARBC 4QRTB 1MEXL 4R96A 3NCFB 4W6WB 4LLYA 5DUPL 4OLWH 3U4BL 3IF1B 1NCCH 3IDGB 1OGAD 4HIHB 1ZGLP 5IW1B 2AEPL 3BN9D 1I8MA 3FHAA 5SWSA 1HWGB 2IH1B 2W9EL 2GJJA 1S5HA 1EO5A 5GSVB 4MJ6B 2A0LD 4LCCC 1T4KA 1XCQA 2AGJH 3FB6A 3RBSA 1Z6JT 3WJJC 5CJOL 1J7VR 4HAGA 3OR7A 2J6EL 4KJPC 4MD0B 5DA4A 2F19H 1DQML 4DVBB 2AXGB 5TDPA 2CDEB 3IRZA 4WY7L 1EMTL 2VLLA 5E6ZA 4TRPH 4W6XB 5EIQA 3LB6C 1L6XA 3O9WD 4MWFA 3VGHA 3JWDC 1UENA 4XPHL 5LGJB 1A3RH 2WQ8A 3MNVB 3PABA 3S35H 2DM2A 5F9DC 5FK9B 4RIRB 1AGFB 3S9DB 3R06A 1CZ8L 5E70A 3RI5K 2BVPA 3NTCL 1JJUA 3BWAB 4UIMB 3ZHDA 5DK0B 5D1XB 3JV4A 2QKIA 1AC6A 1NGYA 4MAYC 1NMCB 1CICB 1EO7A 4LDLB 5DJ6B 2CUHA 5EWIL 3VXNB 1FVEA 1CD8A 3EFFB 1TLKA 2BY0A 4DEPC 2F5AL 4FMFA 4UT6H 3C09B 1UQSB 2CDFB 4QTIL 5BVJB 1XH3B 4PREB 1A14H 4LGRB 5ID0A 2Z8WC 1AO7A 3B9EA 4FQIL 3G9VA 3K3QA 3LY6A 4OIAA 1HEZA 3L7EB 2HKHL 3ZLQC 1AQDA 4WUUA 3QRGH 1NMCC 3VRJB 3A6CH 5L8JB 5IFJB 3DARA 1I8IB 3UJJL 1OTUC 2HFFA 2R2EA 4RFOH 2C1OB 4M6ML 5FKPA 2PCPA 4LSUL 1FZOB 4JFZL 2LV4A 5GRJH 1BF2A 2PXYB 1T04B 2Y36L 1A7QH 4XTRD 5HI4C 1D6EB 4L9LC 4NM4H 4NWUL 1A6AA 4UTBL 1Y6KR 4LU5L 2DRUA 3C08L 1NCDH 4M8QB 1I1FA 3VFTA 3KYNA 1Q0YL 1K5NA 1Y6NR 5BQ7B 4O2EA 3RTQC 5E2VH 2BVQA 4PLJC 5C0NC 1NC4B 3UPRA 4X9BA 2XT1B 3V4VH 2SEBA 1GZQB 5CIPB 5EOTB 4M6NL 1WTGT 2EO1A 5E2UH 4IMLB 2PXYC 3V5KA 4Q6IC 3P73B 5EORL 4X80L 3ULVC 4XXCC 1TQBB 4GSDH 1E27A 4YBLB 2G60H 3HMXA 3QG6A 3FB7B 1JN6A 3FONB 3D85A 5MENE 4OGYL 2CDGB 2CRMA 5CINH 3CH8A 4DKFH 4U1NA 4C56A 5IM7A 4G8IA 3GBML 3RVWD 1AE6H 1YEKH 3S5LB 3GJFA 5GGSB 1QFWM 1DQLL 2CRIA 4BSVA 1K8DB 5AZ2L 4XP1L 1KEGL 2CLRA 3DVFA 3GKWL 4XNXH 3I75A 1KCRL 4BQ8A 2Q20A 3E6FB 5ITFB 1GGTA 4IOFC 5IT2L 1IC1A 1QVOA 2BSSB 1FBIL 3O2VL 3T65B 2D7TL 4JG1L 1XCTA 4PV8A 1F6AA 2VLKE 4MNGB 3MUJA 4QCIA 1MSPA 3MRMA 4NC1E 4QXGL 3RWFA 2J8OA 1AY1H 2MHAB 2J8UA 3GGWB 5JPMB 4RMWA 1G9NH 4UIKL 1U93A 4JDVB 3MBEB 5CUSH 2XN9D 1I8LC 5E2TH 1WV7T 4OIIL 3WIIL 4F57L 4R4BA 5DQ9B 3ROLA 1HIMH 2AJZA 3HCVA 4NN7C 1PW3A 2MKWA 1A7BA 4X6EA 3SGKA 1V5JA 3WFEL 4F7EA 1RAMA 1YUHB 3EDEA 2Y07L 1CE6B 4YUEH 4HK0B 2D0GA 3GMLA 2NXZC 2FEEL 3DGGB 4JFFD 4NO5A 4UAOB 3ES6A 2DQEH 4P2OD 2K1MA 4O51A 3F6LA 1FL5B 3QUKB 5GHWH 5ISZE 3DROB 3QIUB 4BK4A 5EO0B 2ZPKH 3GSRB 3QUZD 1QFWL 4WEMB 1OAZL 4FXKA 3GMMB 1PBYA 3D1MC 1OSZA 2ID5A 1KN2L 2BNQE 5KS9A 1ZHKA 3VGDA 1KIQB 4RX4D 5T1DL 1OOAA 4P9ML 4M7KH 1OHQA 4MNHA 4OV5A 3KYOB 4N0UB 5E2WH 5HGHA 4QRRD 5J3HD 5KSBF 1LO2L 5D1ZC 2DQIL 3H9SB 2XXMB 2X9YA 4GH7B 2X5PA 4OCLC 4XPAH 4G7VH 4HMDA 4ZFGL 3JWOH 2VLRA 4LDEB 1IJ9A 4ODWA 5D7IF 3H7LA 4NZTL 1NMBH 1X3DA 1BZ9A 5IHUH 2GCYB 1S7XA 5IWLA 3D18B 3IT8D 1T6VN 1C08A 4ZD3L 2UZIH 3RNQA 3UROR 2FGWL 1UM6H 3U1SH 2ICWJ 2OQJB 3V7AE 4DAGH 1CFTA 4KH2A 4LLWA 3WNNA 4JJHA 3GJFK 4YWGH 1MLCB 2BP3A 1C7TA 2VAAB 4K3DL 2BC4B 1M7XA 1IEBA 3SDDB 3NAAL 4APQB 1CYGA 3VMNA 4S0SD 1OGAA 5KVEH 3HB3D 3C9NA 4XMKH 5E03A 3WNKA 4BSWA 4R2GB 1NGWA 2ZNXA 3EOTL 4H1LB 4HS8H 4ORZC 1ZOXA 1RUAH 5KW9H 1GGIH 43CAB 3MR9B 1Y18B 5MHSE 1RMFL 2MQCA 4JJ5B 4TNVK 3MRKB 1YNLL 2PYFA 3SDDC 4N5ED 4DOHB 4P3DA 4YHIB 4GQ9H 3WMSA 2H45A 5ESVA 4XCEB 4HWBA 3BX7C 2L7JA 4GLRH 4HCRH 4YDLB 5EOCJ 2CR6A 1QR1B 5HDLA 4G7YL 1F4WH 3O9WA 2Q87A 4MJ5A 3V0VA 3EDKA 1MCQA 1FFOA 2FJHB 5DGQA 4PGCB 1S9WA 2AP2A 5TE7H 1J0HA 4U7SA 5J8OA 5I1JL 2ICEA 1G7IB 1A1MA 4I0KA 3ALWA 1ZHLB 1P7HL 3ROOA 4AEHH 4D3CL 2CRYA 1WWAX 5C0CB 4NPYB 1Z0NA 1H3PL 1MVUB 4C4KO 3O8XA 2APWA 3FFCE 1KLFA 1FZJB 1HILA 2H26A 2X4RA 3U6RB 3MZTA 2OL3A 3CFEA 3RWHA 4U7KA 1IC5H 5F8RC 5FDWB 1Z3GH 3RIAK 2UWEE 3OKDA 5FYJE 5GXBB 1UADC 2BOBB 1Q9KB 2OSLA 2P5EE 3NA9L 5CSGA 1NEZB 3G08A 4NDMB 2LU4A 4NQXA 4NUJB 1AIFA 4OAWB 1C5DB 3LDBC 3OAUH 5C0EB 4NJAL 5KZCB 5IFHH 3QIBB 3CFDA 4YDIL 2X89D 2QQKH 4HPYL 1AD9B 1FGNH 5HYSG 2HFGL 3KLHD 1N2RB 3WLWC 1INEL 4XNUH 1BM3H 4OBRA 4D9RE 1QBML 3IDXL 1II4E 5DD6B 4AG4L 4MD0A 3QIBC 1BBJA 4OFYA 5FO9B 1EJ6A 4L3EE 3FT3B 1M05A 3VXSE 3MNZA 4YBQC 2IAMD 5DRXA 3SKMA 4WI2A 4TSCH 3K8MA 2HJLA 2NY5L 1WBZB 4Z95L 2UWEF 5F3BB 1NGQH 5GGRB 1AGFA 3FB5A 3W0WD 5AYQA 2VL5B 1NGPL 3LPFA 3V52H 2IANB 4PGZA 4IHOB 3WFDH 4PP1C 4WTWA 5TE6L 4R90L 4ZAKD 3ZKXB 2UY6A 4KAQL 1RZ7H 3VRIB 1MH5B 2W0PA 2W9LA 4PJCB 4MZ2A 1EFQA 4P5KA 5DEGA 5I1AA 2KL6A 3VXNA 5CCKH 4OZIA 2MNUA 5D8JH 2IBGA 4ISVB 5I8KH 3QWRD 4G5ZH 4HFWA 3WSQH 1N4XH 4JN1L 3PJSA 4RGNE 3RWDA 2X42A 1XH3A 5FV1L 2CSPA 1FNSL 1IAII 1FJ1B 1E4KC 2HWZL 2Z93A 3WEXB 3ZTJH 1KYOJ 3LSOA 4BFEA 3QFJB 4MCYA 1FVDA 2NY6C 5JW3L 5DJXB 3CUPB 4NFBA 4NJ9L 2YD2A 4K71C 2ESVD 4KKBC 2OZ4H 5TH2A 4OD3L 5MERB 4XVTH 3O41A 1BZ7B 3FQRA 2K7QA 3LQMA 2XN9A 4YDJA 1CXKA 1K4CA 4DVRL 4BKLA 4POYA 3QQ4B 1KULA 3D0VB 2IPUK 2W0LA 4KQ4H 5IQ9B 4KZEL 1D6EA 4HFUL 3SDXA 3PIQB 1AH1A 4YZFF 2DQUL 4I0PB 4IDJH 4HWBL 1MY5A 3NFNB 4L3AA 2WP3O 1JVKA 4YIQB 1KB5H 4HEPG 5BQ7A 3FO9A 1D5BA 4QHMB 4WEBL 3L3OA 3QG7L 3TJHC 2PUQT 3MV8E 3UZEA 4DZBB 2YD4A 1TPXC 4I77L 4JFFA 3RKDD 1P2CB 2W91A 4P2RB 3PDGA 4P2OA 1AGCA 3P73A 1YYML 5JHLL 1A1OB 1RUQH 2G9HB 3LH2H 3AB0B 3QUZA 5CILH 3LRHA 1XR8A 5IR1B 2Q86A 4PJBA 5HHQB 2QSCL 2EO9A 5KVDL 5A43C 3TBSA 3UX9B 1EGJL 4H5SB 3ECBB 2GUOB 4NQCB 4TYUA 3X3GL 2OI9B 4X99B 4DGVL 3M07A 1CFSB 3MRBA 3VXPA 3SGEH 2DQDL 5ADPL 1X5IA 3UTSD 3EYVA 3S5LA 4R8WL 3BQUC 4QRRA 5C08D 1UCTA 1NGXB 3AB0C 1H5BA 2Y7QB 3S36L 2WBKA 5CD3B 5ELIA 2DLGA 3I50L 1WFUA 2YD7A 4NN5C 2A9NL 1KTKE 3K80A 3CVHB 3V6OC 5KSVA 2R1WB 4QHLB 4WFHD 1QLRA 2X05A 1U0QA 2OBGA 3LZFH 4EBQH 1NBYB 4ZTOH 2HTLC 4YXKL 4OLEA 2MCPL 3A67H 2AJUL 3W9EB 3LEYL 5DQDL 1CGWA 4LF3A 2YUVA 4HS3B 4KHXL 3O2WL 4L4TE 4OGXL 3TESA 1JWSA 2MHAA 4J3TA 2FX7L 4PJ7A 4Y8AA 3GGWA 5JPMA 2YUXA 3U30B 3MLZH 5C09D 3WIHA 8FABB 1UXSB 3BIAX 1AXTL 1EH9A 4BJLA 4GW4A 1EEYB 4OM1L 2RQ8A 4Z7WE 1LK3L 4ZPVA 4MGXA 5F72S 3TIEA 3KYKL 4KMLB 3KYMB 1EEQA 3LN4B 3TLRA 4UTAH 5FO7A 2DQHH 2BDNL 3HZKA 1JWMA 1LEKB 5CLWA 3MRIB 4PRAA 1XT5A 1BJ1H 1E28B 2VDML 1CE6A 1Q94B 2XKNB 3U30C 4KKNA 4ETQA 1E6OH 2IBBA 1GPOH 1J0ZA 1MUJA 3L3IA 1GH7A 2Z35A 5LWYL 5DO2C 1LDPL 3SDCB 3B2UC 4X6DF 1R0AL 5H37H 1NCWH 1YECL 2YZ1A 4Y4KD 1FL5A 4KI5D 1MHHA 1BX2B 2FNBA 1HE7A 5GRVK 4JG0H 1HNFA 3W11C 1BAFH 3F7VB 1M71B 4S1QH 4UBDD 1KNOA 1WQVT 4JDTH 2WUBH 4NQEB 3NFSH 3V5HB 3CDYA 2VJXA 5ID1B 3RY4A 2I5YL 1S5IL 3O4LD 4YEFA 4EDXB 1BLNA 2FEEI 5BS0D 4N0UA 4PJ8B 2X7LB 5CJXC 4CW1B 2PYED 4JQVA 1KUMA 3EJZC 4AEIH 2ED7A 1HKLL 4Z7WF 5GQBA 1PZ5A 5DQJA 4ZFFA 4IM8A 1MNUL 4LQ1A 3D39D 1HOCA 5F7YC 3PWVB 1VGEL 1ZHBA 2CPCA 1MF2L 3O3AB 4JFHD 5BRZE 1WBXB 4BQ6A 2DQFB 3L5XH 3IFLH 3TVMD 5C9JA 4PJ8C 3UTQB 3HS0B 1SMOA 2V6HA 3SBWA 4KTDH 5IB1B 2UYLA 3SY0B 3P4OA 4HWEL 4MCZB 5GRVL 1I7ZA 4Y16D 5KSAB 4JO2H 2UZXB 1EK3A 5F1IB 5HHOA 3C8HA 5MEQA 1N3NB 3GIZH 3CFKA 4NNPH 3O2DA 4EIZC 3VFOA 1D5MB 3I6GB 4JFXB 4J3XA 4GS7C 4UMGA 3JWNC 3VCLA 3D9AL 2FYYB 3KG5A 1RZGB 3LMJH 2PTVA 1ZXQA 3CFIC 1A6PA 3U0WL 3U2SB 3BIKB 3L5HA 5HXMA 2GJ6E 5L8KB 4QRSB 1JF6A 1JPTH 4TPRL 1DUYA 2R1XB 4PBWD 4URTB 1MAJA 4UZGA 1CDYA 4GG6B 3MR9A 1Z9LA 1U8KB 4UV7H 5B4MC 2F53B 4I3RH 4V2CB 1ZMYA 2D0HA 2IG2L 2EYSB 4YHIA 5EU4A 3ESUF 5FECA 2LABA 1QEWA 4DW2H 2NY3D 3NIGE 4PRIB 3P9MA 1T20B 5TQ0L 4FN0A 2MSPA 2B39A 3WN5B 2EC8A 4L8CB 3DVNA 2IAMA 3HG1B 4W4NA 3QWOB 3GNML 5GRYA 5HYSA 1U2CA 4MXVE 2XRAH 3ESVF 3OG4B 4PGCA 1AKJD 2WBJB 4EZMA 3KPTA 3IETA 4NC2B 3X12A 4OGAD 2YRLA 5KANG 4X4XA 3KPRB 1FFPB 3WN5C 1QYGL 1E0OB 1MWAH 3QNYA 4UQ2B 3LKSB 1VCAA 2Q6WB 4ZAKA 5BJTB 1IILE 4JRYB 4F7MA 3FT4B 3FT2B 4HXBH 1FZJA 4K3JH 4EI6A 3SKUD 4F7TA 5I15H 5BXFB 4J4PD 3CLFL 3Q6GH 2R0LL 5SX4H 3QWRA 4PYGA 4X0KA 4AY0A 4OJFH 2EE2A 2XWTA 1OARH 1HINH 4ALAH 2R2CA 4E9LA 3S4SB 1KEMH 4LEXL 1MJUL 1CT8A 3PWPE 4X83A 1V7NL 1JI1A 4P57B 1H8NA 3WNLA 3NIGF 4NUJA 2X4SB 1T2XA 5HHME 1JTPA 3BP4B 1YQVL 3RWGB 1KELL 4MXWH 2ESVA 1JRHI 4FNLH 1K9TA 5E08H 1JGEA 1RHHB 3HPJA 3VRLE 4GAJH 4JB9H 3VH8B 3LD8B 2ZUQC 4LNVA 3MMEB 3G5YB 2GT9A 1N2RA 4PG2A 1SVCP 2IQAB 4PJFE 1X5YA 4NRXA 3C8KB 3U0PA 1P4IH 2QHRL 4PJ9B 1JNHB 4PJIB 4PBXA 3LIZH 2BHYA 4ONOA 5KG9A 2BRRH 1FDLL 2NXYD 1NL0H 4XHJC 4L1DA 5T3XD 3FQTB 1BIIA 5GIRA 3NH7H 5CGYD 3WUZA 2VXTL 1PG7H 3TBWA 4M1CC 2GTWA 3TBVA 4CVZA 4FXGA 4JANA 5DHVA 5DDHA 1E4XL 4YR6B 1JHTB 2JIXB 3BHBB 1UZ6E 1L9NA 4NKMB 5ETUB 5DD0H 4K23L 4Z5RB 2HJKA 1MQ8A 5GGRA 3PWNA 5MI0C 4Q0XL 5DJYA 4G6MH 1T0NB 2ZCHL 3EOYG 5HTSA 3WE6B 3TNMB 4YPGA 3IFPA 4XWOC 4OZFB 4WGWB 4HHAA 2R8SH 1F00I 3ARSA 4IHOA 2FIKA 3K1DA 5H94B 5LG1A 5KVFH 3VRLF 5HGAB 1JHLH 3AS0A 1I85A 1YEEH 5C08A 4F3FB 5GS2D 1ZHNA 4MD5A 4U6HB 5IBLD 1PD6A 4O2FA 5F9AC 1HHIB 3L1OH 1UJ3A 4V1DB 3B8SA 4QRPD 4N9GA 2JK5A 1G7QB 2DICA 2OXHA 3QT2A 4KXZH 5D2NB 4H88L 5IV2B 1AI1H 4YNYB 1JCKA 5D72H 2ZG2A 4GFTB 3P11L 3ZKNC 1OLLA 2AV7B 3HNSL 4ODTL 5F7HA 4PTTB 4MJIE 3IDNA 5FYKH 1NFDB 5TPWL 1YN6B 1MCCA 2BY2A 1LO5B 3CK0H 4GMTH 4F15B 5JQ6H 1UZ6F 5C09A 5EB9A 1QRKA 4QF1B 1GIGH 3BXNA 1R3HB 4K7FB 3KGRA 1WFOA 1N6UA 2XXCB 3DRTB 4H20H 5IQ9A 5EC2A 1NCBL 3OV6A 3QH3B 2FX9L 3QHZL 3TBYB 4I0PA 2BNRB 4NKOB 5FYLH 3KWWB 5I6XB 1CL7I 2ERJB 2YR3A 4HQQL 4Y4HB 5HGGS 5T3ZE 4QHMA 4I2XA 4F15C 5SX4I 2DWDA 1WUNT 1ES0B 4QRQB 1DBML 4R26L 3QFDA 4P2RA 1YMMB 1OW0A 3P4MA 1MFAH 4Y4KA 5CBAA 3N9GH 2G9HA 4IDLA 2DDQH 1MPAL 3QUYA 3BE1H 5ISZD 1INQA 3TM6A 3P9LA 3SGKC 1I3UA 2P1YA 5I6XC 3O3DB 4PJ5E 4FQLH 3DX8B 2DKSA 3OJDB 5FA4A 2BNQD 3O4LA 5EUOA 5C3TA 4ENEC 4LP5A 5A2KH 5BS0A 1QRNA 3U4AA 3EO1B 3UO1H 5DLML 5DJCA 3V7AG 5MEOB 3TYGL 1F4HA 2PYEA 3WNPA 3T77B 3JUZA 3S3PA 5DJ2B 1PJ9A 3P0VH 2I60L 5E00B 5CD3A 1OM3H 4S1RL 5IIEA 2NX5A 4RISL 4RMQA 5FUZH 3D39A 4NZRL 3CVHA 3I02A 3ULVH 1OTSD 4HAFA 3TVMA 4KRNA 3T0ED 3DJ9A 3NN8B 2J2ZA 4UINH 5IW3A 2NZ9C 3ZZ1A 3ZT7A 4QXTB 3JXAA 3EOAA 3LKOB 4LCIL 2NY5C 4Y16A 3UEZA 3W2DL 4CU8A 2NPLX 5CIPH 3C60D 1TQCB 2PW1B 8FABA 3VD9A 1C8PA 1UA6H 3NOIA 3VWJB 3CFBB 3D0LA 3LN4A 1P53A 2ADIB 3HRPA 3RL1B 3WUWG 3LKPA 4GXUM 2KUTA 3D69A 3FQXA 1K6QL 4LLDB 3MRIA 1DQDL 4KV5F 3HC0A 1RJYA 1WZKA 2V5RA 1WC7B 5LCVH 3I6KB 1TQCC 5T33H 4PLKC 3UTPD 3PL6D 3VWJC 1IAKB 5FV2A 4QO1A 5DC0A 5HY9A 5MHSD 4XP9L 4WEUD 3FOMA 1CK0H 5DFVD 1A7PL 2VSCA 1NKRA 3AMLA 3MA9H 1A6VH 3NCYS 3QJFB 4KKAD 2ILLA 1UWGH 3BN9C 2BHZA 2N7BA 4GBXD 4FQCL 2EDNA 4S2SA 4KVNL 2R0KH 4PRPD 4MLIA 3X11B 4X5XB 4EDXA 5C0RL 5KVGL 1DUZA 1PSKL 1MI5D 2VLMD 3RIFF 3SKOB 3TN0A 2DQJL 5CSZB 3P4NB 5IF0A 5F7EL 2XG5A 4GW1A 4IOSD 3NIFF 2NW2B 4LVHC 4MMXC 5DJ0B 4MXQD 4WHTA 3AU1B 3O9WC 4JY4B 5EBMA 1JE6A 1IGYA 1BOYA 4JFQB 4MD4A 4R4FL 5CBEB 3HR5B 3OPZL 4HIEA 5J56B 2Y06L 2A9MH 4XAWL 5IB1A 3TH3T 2EH7H 3T3MF 1U41A 2Y25A 2EDHA 5J0BA 1WK0A 5DSCA 3U7AA 5KBNC 4JFED 2V7HB 5FF6A 2WUCH 1N3NA 3OXRA 4QKXB 4OCXH 3MRNB 4GOSA 1MAKA 2P5ED 3VWKD 2FYYA 3C5ZD 2BJML 1QNZH 1XGQA 2ADGB 5I18H 5JR1L 2DWEB 3TH2T 1IMHC 2FD6L 5K9KA 2O61A 4IIQA 4Z8FL 4S1SH 2W0FB 5CAYB 3GSUB 3L95B 4F2MB 4O9HL 1GSMA 4OT1L 2PTTB 2L7UA 2VDQH 4HLZH 1CD0A 4J1UA 1HQRB 3K4DA 4UV4H 3MROA 1T5XA 1HSAB 4OZGE 1HQ4A 2NY2B 3G5ZA 3LHPL 5DI8B 4HWZB 2P8PB 3IXTB 2BERA 2AK4A 4JZNB 3L3DA 4XTRC 1VFAB 4XPTH 3BUTA 1DQQA 4PJAE 3VXRE 3D5OF 4HGWA 4JLRA 2AW2A 4HJJL 3JSSA 4HX1B 5F96L 1JGLH 4FQ2L 1MFCL 2DQGH 1J11A 3SDYL 4HV8B 3PF2A 5I8EB 1PKQB 1ITCA 1JIBA 4QNPF 5F6HI 5A2JH 1R24B 2NY2C 4KHTH 4DGIL 4N68A 2VLJD 2C4XA 1MCPL 1FFRA 1ZTXL 4TUKL 4UOW1 3OGOE 4JRYA 4G8FA 2HVKA 1PLGH 1XEDA 1ZA6B 3FT2A 1T5WA 1ZSDB 3FAXA 3KPNA 4QRPA 1KTDA 5CD5D 4H1LH 3LKQB 1KPRB 3G6JE 3DVGA 2ARWA 3CSYA 3BT2L 1C16A 3RVWC 5IBUB 4M43L 4P99A 1BFOB 1VESA 2JTDA 2FJFA 5CFHA 5GRUL 1PAMA 4HXAH 5IUSA 4OZGF 3O6FB 4ZUTB 5GS1A 5GGTH 4PJAF 4Y89A 2FLRT 4KQ3H 4L8DA 2FB4L 1D5ZB 4U6VH 1C12B 1FORH 1I7TB 4F37K 3MV7B 1QLFB 2BX5A 4DFHA 2BY3A 3DSNA 1CD1A 3HE6D 2GFBB 3QEGL 4LSVH 3HRZB 4YC2C 1Q1JL 5KTEH 1A4JB 4WW2B 1UJTA 4PJ9A 4MQ7B 2EXYD 4MS8D 3G6AA 1UEMA 3O6FC 4ETYA 3KLAA 5T1MB 5DZ9A 2WW8A 5EN2B 3MOQA 1RULL 3D25B 1AP2A 3O45A 1LO0L 4PFEA 3MV8D 1CGXA 2B8OT 2IPTL 3GSWA 4XH2A 4LEOA 2JIXA 2VDOH 4FQJH 3M8OL 1CDHA 4WW2C 1R5WB 5DMIH 4IRSD 4ZYKB 3RVTD 1LNUB 2E9IA 4Z5RA 2JELL 1JV5A 4J8RA 4B7IA 2GHWB 1JNNL 2NLJB 3ULVF 3EGSB 1OT1A 3ELAT 4G8GD 3OMZA 4XCNB 3MJ9L 3RVUD 4P2OC 4L29B 4U3HA 5SWZE 4TSBL 4U1HA 4XVSH 1IEAA 5FGCE 4F3FA 3QUZC 4NYLA 1HHIA 5DD5L 3VGAB 4L8SB 4YFLI 1EA9C 2BVOB 3BWUC 3T8XA 3CVIL 1G7LB 3GBNH 4X6FA 4OSUH 4NRYA 4NWTL 4GKSB 3IDIB 4NBYB 3ZYZA 3T0EA 2AJXL 2DLFL 5J3HC 1PQZB 3BKCH 1T1WA 2AV7A 3T1FB 3WKNA 1H5BC 4QHKJ 4MNQE 1U8MA 4Z7UE 5IVXB 4HUXA 3C60A 1OWRM 3DUHA 1MCDA 3FN0L 3M1BB 3VW3H 2R1YB 1ADQL 3BMVA 5D93C 5E5MA 1SM3L 3F5WB 2CXGA 5T3XL 3GFUA 4NGHH 3C6SB 3TBYA 4NO2A 3VD4A 2W92A 2E27L 1CGVA 1EAPB 2V7NB 2HRPL 1RHFA 2QJDA 1U8LB 1ACZA 4Y4HA 5CEYA 1FAKT 2GK0B 1WBYB 5J6HA 3A0OA 2EZ0D 3CX5K 1MCNA 4M62H 1IM9B 3JTSA 5F93C 2H8PA 5FYKU 4PB0H 4HSQA 4YDVB 3X14A 5EZIH 1H0DB 1JPGB 1T1YA 4RBPH 2DMBA 3HB3C 5I1EH 4LCWD 5I9QC 3RUGB 3CXHK 4U0RB 4GBXA 5EZLB 4EOWL 4OQTA 4KUCF 1GXEA 2EE6A 4XNZB 4PRPA 35C8H 4ZS6C 5F1SA 4YX2H 1F4XH 4Z7UF 5IK3A 5C6TH 3ZHKA 4YQXL 1MI5A 5FUCC 5EBGA 3MV9B 4JO3L 2MFNA 4N5EC 5FCUH 1ZA3B 3NACL 1GGYA 1MCRA 2CIKA 4JFDD 4EUPG 4TVSa 1OAQH 3MC0A 3H2WA 3QCVL 3BGAA 3AS3A 3QDHA 3EYSL 5ICXB 5JXEA 1WWBX 4U0RC 5DK3A 3MLRH 5I1DB 4QXUL 1TJIL 3MO1B 3DURB 4XNZC 1NAMB 3PGCA 4LKCA 1WT5A 3NZHL 2IF7A 4GXUN 4OQ1A 5CEXA 5CJQL 3P30L 4I3GA 1MEXH 2W1NA 2GSGB 5BRZD 3MX0A 1QO3B 4ZNEE 3U4BH 3CX2A 2CIIB 2JJSC 4ZFZB 4AM0B 4JFEA 3CMOL 4WCYL 4J3UA 1KTLA 1MLBA 2PW1A 3MBXH 4QWWD 5AUMB 3VWKA 2AEWA 4L1HA 1YC8A 1U8QA 3ZDZF 2FATH 3HFMH 2QHLA 4IBLT 4B53A 2F58H 2RCSH 4QYOA 1T83A 4AT6B 1YEJL 5C8JB 1MFNA 3OSKA 4WWKD 1DQMH 3VFMA 1MREL 4WY7H 4PUBH 4NFCA 1ND0B 7FABH 4P5TD 1EEZB 2ZOKB 3UXFA 12E8L 4NQDE 2HLFD 4XPHH 1FV1B 3MRGA 4HH9A 2ZUYA 3I2CL 3SE3A 5HYQA 3MRHB 4P9HL 5HHPA 4OGZA 3QJFA 2QQQA 2VR4A 3MTRA 3OBAA 1IAOB 5F7LB 3NTCH 2FZ3A 2ENYA 2RJMA 1FRGL 3KPLB 1LEGA 3IGAB 3QULB 4JN2A 3SO5A 1ETZB 4X5XA 3OL2A 1RK1A 1V3JA 2Y5TB 3DUSB 3FJTA 3W0WB 2AI0L 2PKDA 1KGCE 5EWIH 3U9UA 2E9WA 5D71L 3D6GA 4ZXBA 3EO0B 4WU5A 1I9IL 2XTJB 5DJ0A 3K8KA 2IPKA 3BDYL 2VLJA 3IKCA 4I9WD 3AU1A 1KBGH 4ZS7H 5FB8A 2X1QA 4JZJA 1NFIB 1NSNL 4I0CC 1OVZA 5E94A 3RA7L 1CFQA 1DFBL 1RZJH 4IRJD 3VFGL 4NIKB 4M6MH 5HHNB 4IS6B 3DX7B 1SY6A 2VH5H 4LSUH 4JFZH 2XTJC 3BGMB 3TPKA 2Y36H 4JY5L 4ZAKC 1X5HA 5DHYA 4P46B 3M17A 2R0WH 2D03L 4M02A 4UTBH 2DJ4A 2JCCE 1S9KC 4P4KA 4RZCA 1Q0YH 4Y5YA 2ZCLL 1CE1H 2W0FA 5HDQL 3HE6A 1RZKH 2ARJQ 4G42A 4KRMB 3SN6N 4L3CA 2VDPH 3L95A 2F54B 3BOVA 4KK9D 2PETA 1C5BH 2VERN 4P46C 2UV3A 2J5LC 1QSFD 3MOBH 2IH3A 4OQTL 2W65A 5D96C 5E8DL 2VABB 1VPOH 4AMKH 4N90D 4OGYH 5I1KH 1EBAA 4PGDB 3F7YB 1QA9B 2DLTA 4E5XB 4E41D 1F6FB 1V8HA 4LCUA 2X1XR 3GBMH 3K4ZA 1G6VK 4PG2C 4N0CD 3N1MC 1H3GA 2XTLA 3UC0L 4HIXL 4IRSA 4FQ1L 1I4FA 5AZ2H 1K8IA 1UCBL 3G5VB 1FYTE 4UUJB 1UWEL 3GKWH 4YHOL 3BJ91 5DEZA 3E2HC 3JV0A 4G8GA 1Q9LA 1KCRH 5DK2A 2JCCF 3J7HA 4GAGL 3UTSB 1T2QL 5IT2H 3W39B 3O2VH 2H1PL 3O3BB 2R4RL 1BFVL 5E5RB 2D7TH 3MQIA 4JG1H 1VACA 1A7RH 4D0BA 1BD2B 1DDHB 4G9DB 2F74A 1G7JB 5DWUH 2L4OA 1ORQA 1T7YA 3PDDA 4QXGH 5FYJL 3UAJD 5AG8A 3RX5A 1FL3B 4UIKH 1ZVSB 4BH8B 1Q9OB 4QTHA 5CZVL 2Z4QB 2WWKO 3WKML 1ZT7A 2AJYL 1H3UA 3OKMB 5DRWA 1U91A 2JF1A 2UUDH 5BV7L 4F57H 5HYJE 4WV1B 4WGVB 3DWTA 2ZUTA 1AGBB 5D5MA 4BZYA 5F1KC 5KN5B 3GUTA 1IAMA 4G3YL 4MB4A 4TN9A 2JJTA 2I07A 3WFEH 4QOKE 3L5IA 3NCBB 4HPOL 1D5ZA 1Y0LB 4WRLA 5EPMA 5E99L 1QLFA 5C0BB 2RFXB 4Z7OF 5JOFB 4G9FE 3H3PL 2GFBA 3BH9A 3DMMD 2DB8A 5HJ3B 4R0LB 2D7OA 3UTTE 1O5DT 2EDTA 3ORJA 4CKVX 1QFWH 1OAZH 5F9JB 3ZO0A 1SEQH 2BNUB 1JGUH 1KN2H 3VU2A 3MYJA 1NDMA 3AS1A 3BH8B 3O4OB 3ZHLA 1UZ8B 5CZXD 3V6OE 4YHNB 4OFIA 5INDB 4KROB 2A6KB 3NABL 4Z0BL 5EC1B 5JDSB 1PZUB 1KT2B 5I71C 1LNUA 4LCWA 1LO2H 4WDIA 5I17B 5T1KA 4YE4L 3MRFA 3QDJD 5FUOL 5IMLA 5D1QB 2XYCA 4ZFGH 4MA8L 4PJXA 1PKOA 1J8HE 1OW0C 4N1CA 1YEIL 4Y4KC 4JKWA 1PEZA 4KI5C 4ZSOA 3JTTA 43C9A 2XZCL 1HCVA 4L4VE 3BGFB 1G7MB 3FAWA 1MJJB 4JFDA 1YYLL 4NO0B 2VSDA 5FHAH 2FGWH 4UBDC 3H42L 3MOAH 2WP3T 3VGEA 2W07A 5E9DE 1NPUA 4L8SA 2BVOA 1AHWA 1L9MA 5B3NA 4PIRF 3QXTA 3SCMD 1RIHL 4X9HA 3KPPB 4K3DH 3IDIA 1GC1L 1L7TL 4F80A 3VFRB 3OKOA 3QQ3A 5DJZA 5F7FA 2VDRH 1JZ8A 2R69H 3QDGB 1V3MA 3SHSA 2H32B 1FG9C 1UKSA 3BW9B 1BQHB 3OZ9H 1AGDB 2A77L 4HBQA 3NPSC 5LQBL 4M93B 3REWB 1WVZA 3PGDA 2CK0L 3QCUL 3HI6H 3TVMC 1W0YT 5GISL 3T08A 1BMGA 4KUZL 4YEEA 4Y2DD 2LFGA 4Y16C 5TQ2L 2HT2D 3V95A 4O4YH 2F5BH 4WWKA 4OZFH 1WBYA 4HS6A 1TITA 2DLHA 2IFGA 3DETD 3EHBD 4C55A 3G6DL 5HYIA 1CXLA 4P2QB 4GO6B 1RD6A 3K2UH 2VTFA 5F6IB 1Y6MR 5I1IH 1AR1D 1CS6A 2C5DC 4W68A 2NY3B 3ULSB 2MKLC 5I73B 4MJ2A 4U49A 1JBJA 5I1JH 1L0QA 4TOYL 2PNDA 1G0XA 3VDAA 3TO4B 2YEZA 4BZ2L 1VSCA 3GSNA 4Z7VA 4WJ5B 4D3CH 1RJLB 5HVGB 3P9WB 1XF3B 1H3PH 1BVLB 1F2QA 3BEWA 4HUWB 1ZA3A 1RZFH 4JFOB 1CGSL 2NY3C 5ANMB 3BKYL 3HZMA 3RI5F 1N59B 3VXME 2VZ3A 4AH2B 2EEAA 5JW4M 2AABH 5EU6E 3S6CA 4YGVA 3N85H 3C5SB 4FTVD 4F58H 1NAMA 2J12B 3TZVA 3KPOA 5IGXH 1QLEL 5JUEL 5F7DB 1MHEB 1JTTA 3N06B 5HHXL 5D7JD 5HDOA 3S34H 2GSGA 4ODHL 3VE0A 3BKJH 4IRJA 4NJAH 1U8JA 1UM4L 3FRUA 3N1FC 3Q1SH 4NO3B 5J12B 4EKXA 2IALB 4HIJA 4JO4H 1MHPL 4OGAC 4CNIB 4QGYA 5IJVA 5E2JA 1RUML 4ODSL 3GI9H 4KPHH 5DUML 5FHBL 2ZNWA 2HFGH 3AAZA 4FMKA 5SWSE 5F71A 5IEHA 1S7SB 5AUMA 5AG9A 5CS7A 2R2HA 4EDWL 2AJ3A 5IHBA 1JHKH 1TNNA 3S37X 1HSBB 1X5GA 4J4PC 3QHFH 4AG4H 1DANT 4DZ8A 1HHGB 4ODUB 2QSVA 1IFHL 2BSRB 4UU9A 4PJEF 4R7NB 2EXWD 2XICA 4RGOL 2X4PA 3REVB 4XCCL 1KJMA 4FQXD 3IJHB 1U8NB 1KCKA 1QSFA 2NXYB 1R3KB 5DD3L 2G5BB 5D2LA 2P8MA 4N1EA 2D7NA 5EU7C 1P1ZA 3SGDH 3STBA 1MFEH 1YEFL 4KTYA 1ONQA 4E41A 1NGPH 4MSWA 2VDLH 5L0QB 4BQBA 4WI6A 3WS3B 3BYYA 1LK2B 4M6OL 2ICWB 3EYUH 1L6ZA 1VDGA 3AFLA 1UG9A 2VISB 2NXYC 5MENB 5CGYC 1R3LB 2BY1A 2Y6SD 3UPCA 3IJYB 3QE5A 3EO0A 1VA9A 3B9KD 3RJDA 4GXVL 5DYOA 4XWGH 5EO1A 3IDJA 1AO7E 1AD0A 4NHCL 1NANI 3ZMRA 4X6CA 4WUUE 4HKZA 4JFPB 4F33B 5C0IA 3DO7A 2HLAA 1CDIA 3VXTA 4Y1AD 5GSRB 3T1WA 3BZ4A 1J1OL 3PWUB 1I8KA 3QWQB 5AYUL 2I24N 2ZSVA 2ZJSH 3KDMB 4KZEH 1TCRA 4HFUH 2EKJA 5IBLC 3RNKB 2DQUH 4XVJL 4XBPB 2VLKB 5BOZG 4Y8DC 5ICZB 1RU9L 5DT1L 3HUJA 3WFCL 2IADA 4HF5H 5EZOL 3SE9L 3VJ6B 1RK0B 3CH1B 3WO4B 1FNGB 5EU3A 1R5VA 1T22A 5KSBB 4I77H 1HHJB 2WWMD 2AK1L 4GRLB 2A6IB 4TVPD 3FFDA 3V79C 1A1NB 3OKKB 1YYMH 5EU5B 2ZP0T 4JVUA 8CGTA 3BP5A 3QA3A 1TVHB 5E6ID 3EIFA 3DXAD 2E7HA 2QSCH 1WSST 4X6BA 3E3QE 1EGJH 3OB8A 4C56E 2WINA 1FHGA 3X3GH 2ARJB 2VQTA 4DGVH 3ZSTA 4NKDB 3E1F1 3OB0K 2EDXA 3E6HB 3BPCA 1DVFA 4R8WH 3MLTA 2Z31B 4YXHL 4Y88A 3G5VA 3QDJA 5DTFB 2BNQB 5ALCL 1OAYL 1YQ2A 4ZFOL 1KG0B 2A9NH 1OB1A 3R1GL 5I76B 1FIGL 3LRSB 4OKVA 2XACC 1AGEA 4LBEB 4M7ZB 3O3BA 3INUL 2ITDA 4JKPH 5SWZD 4HDIB 2DN7A 3NCCB 3BZEA 2QADD 2MCPH 2AJUH 3LEYH 5DQDH 4QHUB 3ETBF 4KHXH 1A0QH 4OGXH 5DD1L 2J8UE 3WHXB 4RQQA 2ITCB 5GS3A 4BZ1L 3OWEA 1Q9OA 2NW3B 4P9HC 1HHHA 2QLVB 2Z4QA 4M00A 4OM1H 4OLUH 4DN4H 3H0TA 3H9YA 4M7ZC 3KHOA 4IOIA 3EYFB 5A40E 1LK3H 2VWEE 1NUGA 5L9DL 3TCXA 5I1HL 3HAEA 2BDNH 3S88L 1S7WB 3T0WA 5CEZE 5CWSA 4YO0B 4GMSL 5IFAL 1EUTA 3QP3A 2VDMH 3DSFL 4LVEA 3WO3B 1OTSC 4UT9L 5ESQA 4RMSA 1UYWL 5LWYH 5ECJE 1LDPH 5HJ3A 3T0EC 1R0AH 5EG6C 1JPSH 3PGFL 5CGMA 1YECH 4L5FL 4YJZL 4K7PH 1DEDA 4Y2DA 5J1AB 1W72L 5AAMA 4RMVA 3R4DA 4AL8H 5F9JA 1K2DA 3C60C 1F8TH 1IGFL 5KS9E 2DLIA 3Q5TA 4OM0H 3PV6A 3WLBA 5I1GH 1OAXL 1OP5H 1UZ8A 2FIRT 2I5YH 3QI9B 1S5IH 4YHNA 2J8UF 4Z18A 5INDA 4TNVF 3D3VD 2C3VB 1AC0A 4TUJB 4TTDD 3QZWG 5LJYH 1XGPA 4U0QB 2UY7A 4KK6D 1A3LL 1HKLH 4AJ0A 3C6LB 1MIEL 4JCMA 3WUWB 4N8VG 3LN5B 1MNUH 1N5YL 1C1EH 2VLRE 1JF1B 4PTUB 5DRZB 3IU3B 1VFOA 3PL6C 4BH7A 1VGEH 5I30H 1MF2H 1FPTL 2J3SA 5DFVC 5C2BH 3RY5A 1G6RL 3PXJA 3UCRA 1T2JA 5LAXA 4NO0A 5C92A 4KKAC 3PHQA 4HWEH 2KQNA 4P59L 3MRRB 4JY6B 4DUXA 1AQKL 1CLZL 4FTVA 4Z23A 2EYTA 3FKUS 3W5MA 2VNCA 5GGQL 3MGTA 2WBWB 4UOJA 3FFCB 3D9AH 1B0GB 5D7JA 5JHDD 1LO3L 1MCFA 1OGAE 4PB9L 3V6ZB 3U0WH 3BZFA 4HGKC 4TPRH 4XGZB 3BW9A 1F5WA 1C7SA 2UWEB 1BQHA 3RIAF 3I6LE 4DN3H 4MXQC 4G43B 3FO0L 1EDQA 3RL2B 3TJEL 3BRGC 3MA7B 4BFIB 1WT5C 1YEHL 3C5ZB 2FJGB 4OCRH 5EBLB 2ZUWA 3TNNA 1VEPA 4P23B 4D0DB 4HUUB 4W4OA 5A16B 5BV7B 1HZHH 5AD0B 2IG2H 3VXUD 5J4MA 4S10A 3QEHB 1NQBA 1ZGLM 5IB3A 2HJFA 4FABL 5D6CA 1B4JH 1V3LA 5TQ0H 1IM3A 2ORBL 1TTFA 2V2XB 4JAMB 1QACA 2O5ZL 4P2QA 4FQXA 3CMGA 3VWKC 5SWQA 3C5ZC 1QKZH 5C0JB 1HXYA 4K9EL 4UNTA 1E4JA 2XPGB 1M4KA 4HG4K 3DV4B 5BV7C 5DJ8B 2WIIB 1T83C 1J0JA 3QEUA 5F88B 2EIZB 4L3EB 2AXJA 5I1LB 3MRJB 3CJJA 3VXSB 4WJ5A 4DWHA 5JIHA 2W60B 3SQOL 4HH8A 3OKEB 3OX8B 1MCOH 2MQ0A 4H0IA 3ME0A 1F58L 1XIWD 5DHXB 2R4SL 5E8NA 1NJ9B 1NC2B 3D87B 5AWNH 5H2BB 3DV6B 4JFOA 5D7SL 2P24A 3ZTNL 3CLFH 2V2TB 4OF0A 3QIWD 3ILPB 4LEXH 1TVBA 1W2KT 5DJDB 1V7NH 4O00A 3QUXD 4CADB 4F7CA 4NZJA 1BBDL 4X5WB 2DTMH 1LD9A 1YQVH 5C71A 1KELH 2G2RA 5IROC 3QXUA 4NO3A 3AM8A 3CFCL 4Y1AA 1RSFA 3V5DA 2YPLA 3FQNA 4GRWE 4RGNB 4ZOCA 4P0DA 2EIBA 4QY8B 2R56L 1S9VB 4YPJA 1OPGL 1SBSL 3OKNB 5GS0H 3RDTD 1S7SA 4DJMA 15C8L 2VQ1B 3RZWA 1DEEB 1P7KB 4JZJC 3RAJH 3T2NL 1RUPL 5CD5C 2WANA 1FDLH 5E1AB 4KU1A 3TIDB 1HHGA 5B3JE 4LK4A 3HI5L 4HEME 2BSRA 5FYKE 2MMXA 1V7MH 3RGVB 4LPUA 3TT3L 1TZIA 1KLGB 1UB6A 3WFZA 5C0AD 1CFBA 1M7DB 4P48A 2DM4A 4M7JL 1E4XH 3QEQB 1KIUA 3RWEB 1S9YB 1FFNA 1U8NA 2CH8A 3L3HB 4R4ND 3RX8A 4XZUB 1IEHA 4K23H 4JRXB 1GC1C 3DXAA 5CP7B 4Q0XH 1S7VB 4Y5YC 2ZCHH 4K94L 4G6AD 4NBXB 2CKNA 1R3JB 1NAMH 3V9FA 5BZDB 1BQLL 3DOSA 4XPBL 2YA0A 3HR6A 2EXYC 4GRWF 4MS8C 4LGPB 4GKZA 1FZKB 3SKNB 5MP6H 5J1SC 1DN0A 5C0DB 4OZIE 3PWLB 2BSED 1JP5A 1FYTD 1FP5A 2GJZB 5I0ZA 4WFEE 3MJ7B 4H88H 3GRWA 4UDTB 4PRNB 4HGMA 2ZSWB 3O11B 5IBTL 1B0RB 3EFDH 3RWJB 5JXAL 5KSUA 3B6SB 3P11H 1NCNA 3QNZA 4PS4L 1XGTA 4HK3N 4JFPA 3V7MA 5DC9B 3N0PB 5TPWH 2XWJA 1BOGB 1KENL 1C5CH 1TJHL 1D9KB 1BJ8A 4JGMA 5HPMB 2XN9E 1HYSD 1T1ZA 3RVUC 4X5LA 1CIDA 5FDYA 4EI5B 1NCBH 3SDXE 4Q9RH 2FX9H 3QHZH 4OFDA 2OXGA 4KKCD 5HYJD 3I3BA 4LARL 5LKNA 4FQHA 4L4TB 2V2WB 4NM8L 3LPGA 1BJMA 4EJ1C 4W81A 1T66D 1FQ9C 3VD5A 4N8CH 3H9HA 4JFFE 3RZCD 5KSBA 2Z1PA 1DBMH 1K3ZA 1S3KL 5EDXA 4Z7WB 4GRLA 5JZ7D 5FM5O 4Y4FD 3MRCB 4XB7A 1A1NA 4LLQB 1U58A 2E7BA 3OKKA 3T3PE 2BSTB 5D7IA 2HT3D 1XGRB 5TGBB 1MPAH 1U6AH 3MGOB 3OAYK 4UT7H 2B4CC 3IDMB 3QO1B 4PJBE 1WWWX 4NNYA 2IFFH 4MX7B 1ZV5A 1VFMA 4NNXA 2CLVB 4KJYA 3FQWB 4PG9A 1X4XA 4NKDA 4RMRA 2BVUA 4R7DB 2Q7YB 3D3VA 4JE4B 3HC3H 4U31A 5IB5B 2DIJA 2ZZUT 3TYGH 4QRRE 3W5NA 1TIUA 4QRUB 3PHSA 2I60H 3S36X 5EULV 4S1RH 4YDKL 2EZ0C 3SDXF 5DTFA 3QDMB 2PR4L 3NCJL 1I3RA 4WI9A 4WW2F 4NZRH 3MRDA 2YKLH 4XBGB 4L8BA 1DL7H 4N0FB 3VFUA 3R8QA 1MJ8L 1N7ML 4NRZA 2XY1A 2HAZA 4DKAA 1PVHA 5B38G 2R39A 5C07D 2FBOJ 4ZMAT 5IOPB 4XPFL 4LCIH 3W2DH 2NR6D 1IKFL 1JUFB 1T3FA 1LE9A 1DBAL 1XR9A 4PJ7E 4U1JB 2ITCA 3T3PF 5E9DD 4XNQB 1QFUL 3VFVB 4OB5H 5JHDA 5J13B 5GGSY 3L6FB 4OCMC 2K7PA 4RFEA 3Q3GA 2BRQA 4LSQL 1CU4L 1GHFL 1IL1B 1S7WA 4TVPL 1K6QH 3A6BL 4FQQB 3QNXB 1AHWC 2X40A 4EUPB 3TPUA 4ESKA 4R3SA 5FO8A 3ZYOA 5FGBC 1A7NH 5BMFL 4XP9H 3OF6D 2PF6A 2IGFL 1WAAA 3VXUA 5JLZB 3QQ9D 1TJGH 2FX8L 1A7PH 5DMKA 2XA8H 2GJ6B 2VXUH 4NHUA 1NDGB 2EDOA 3I9GL 4QWWC 3MLWH 3Q6FB 4XMPH 1FYHB 4P5TB 4O02H 4HD9A 1A9BB 2OR7A 3ZSSA 2NY1D 2VZVA 2EKSA 4PJ7F 3BEVA 5FXCH 5IVXF 5C0RH 5ITBH 1Q38A 5KVGH 1KCUH 1DBBL 1PSKH 1QTYT 4N0UE 2DQJH 1FZMB 4GW5B 1IT9L 5F7EH 1A2YB 4X7DC 3ARGD 4WWKC 3GRWL 3E8UH 3C6LA 1Q0XH 4X4ZA 4O5LL 5DFTA 3CFJA 3ZT6A 4NZDA 4P5TC 4X9GA 2QR0B 3Q48A 3BVNB 2CXKA 2HLFC 3QPXL 2OTWB 4R4FH 5DJAA 2LAAA 2ADFL 4MA7H 3OPZH 3QXDB 2WLZA 3W9DB 1WIPA 1U8PA 1GZPB 4XAWH 4KRLB 1WF5A 4YHPA 3QJHB 4UILL 3MLUH 3QIWA 1BPVA 5HHOE 4U1MB 4YHYB 3SJVD 1U3HD 4Z78A 3AGVA 4AK1A 1Q9WA 2B20A 3FO1B 1HHKA 1CG9B 3BPOC 2AXFB 3N50A 3K4AA 2X4UA 3QO0B 3ARFD 1B0GA 5F6HJ 4WHYH 3ZE1E 5L88L 1QBLH 4LPVA 3IFNL 5F1OB 3MV01 5JR1H 3PQYA 4KY1L 4OLYL 4XGZA 1YNTB 1XZ0A 5FKAA 4Z8FH 1N8ZA 2AJVL 1RFDH 3RDTA 3PWPB 3MRQA 2MCG1 1S9XB 5I74C 3EOBB 3QAZB 5HHMB 4Z0XA 1OP3H 5AD0A 4OLWL 3NMEA 3QEHA 2I9TA 1NCCL 5E4IA 5F7WC 1Q72H 4X98B 1F90H 3KPSD 3UJIH 1G9ML 1U95B 4P5MB 1KPUB 4LQFL 5C0AA 3LHPH 4PRBB 5ENWA 1OAUL 4ZTPL 3LQZA 4PJFB 1FLRL 4OLZL 4WW1B 2CGRH 3KPQA 1HI6B 5F96H 4HJJH 5L7XH 1H3WM 5D6DC 5B8CB 3DV4A 2OK0H 2PO6A 1T03H 4RCAA 1IKNA 1W72B 1BWWA 3WL9B 5I1LA 4HKJB 3ZE1F 2NQCA 1U92A 1CDBA 4DGIH 2AV1A 4KK9C 2ED8A 1KC5H 4WIQA 1YMHA 1B0WA 1RZ8A 1ZTXH 1F6LL 3S96B 1A3RL 2LTQB 3OG6B 2H32H 5I16B 1NC2A 5L6YL 5F89A 5B8CC 1M7IA 1DQJB 2J88H 3NBNA 2QTEA 1SQ2N 3BT2H 2J4WH 2CUMA 1TZHA 4M43H 4N0CC 2D3VA 3SDAB 4FRWA 2ZG3A 5FA3A 3FCTB 5H35A 1SJEB 1AO7D 2BMKA 2E5EA 5TDOB 1EO8H 1UVQA 2ESVE 2LTQC 1G6RB 1KLUA 5F3HA 4HKBB 1A14L 4E42B 3QEGH 1Q1JH 2RIKA 3QRGL 3G5XA 5LBSH 1TFHA 4RNRB 3A6CL 4PGBA 1NUNB 4MJIB 4CMMB 3UAJC 1GAFH 3HZYA 1MRDH 4RFOL 4WHDA 1JI2A 2E9BA 5HVHB 1N0XL 4JHZA 3RZCA 3MUGA 1BECA 3DMMB 5GRJL 1EVTC 2IPTH 4GRMB 2D31A 1A7QL 1W0WA 1ED3A 4NM4L 1KB9K 4DCQB 3IXAB 4JCLA 5L2JB 3M8OH 4DKEH 3ARED 1NCDL 4JRXA 2JELH 5FOBB 2ZG1A 4FQPA 2V5MA 4TUOB 1YJDH 3N1GC 3FO2A 1JNNH 4TNWK 3GSVB 2KDGA 5CHNB 1INDH 4ZUWA 2AQ1A 3V4VL 4EN3B 3L9RB 3IB4A 4Y5VA 3DMMC 3MJ9H 4I18B 1G9EA 5B22A 5CZKA 3PWJB 4OFPA 1CLCA 5A2LH 4GSDL 4MDIB 2A73B 1BGXL 5C08E 3F12A 5T5FH 5FEBA 4PJHA 4FG6D 4PJ5B 4K8RH 4GAYA 5BVPH 4DKFL 2HP4A 3MRPA 2I26N 5B39B 5L2KD 5CZXC 3T4YA 3B5GA 1AE6L 4A6YB 3SE4A 2EYRB 4WFHE 3RPIB 4B5EA 3UTZB 1GYAA 1YEKL 4HCRA 2I9LB 4I18C 3U36B 2F8VA 4JO1H 3RWJA 1I1AD 2P5WD 1OSPL 4U6XB 5INCB 1JYVA 3TFKD 2AJXH 3QUMB 5C07A 1DE4A 2Z91B 3VFWB 4H25B 4MA3B 3AUVA 1KJ2B 4K9EC 3VMPA 4MAUL 3TO2B 1J1XL 2VN7A 4X6DA 4H8WL 5C09E 1D9KA 4WO4D 2D7QA 5HPMA 3TCLA 5DVOA 3B3IB 2DKMA 1ADQH 4XCYA 3DIFB 4Q9QL 1MAMH 4ZPTA 4LRNH 1WIUA 2Z9TA 1MQKH 1IZJA 1CR9H 3UMTA 3RY6A 1G9NL 4FHBD 4I2XE 4F7PB 3SCMC 4LKXB 3FB8B 5CUSL 1VKXB 5E2TL 4JM2B 4I3SH 1QSED 1P4BH 1IGJA 1ZGLB 5CSBA 4P2RE 4KKLD 1TETH 3OF6A 1XF5B 1KCSH 3KJ4C 4KI5E 1N5AA 4NQSA 2BSTA 5FIEA 1XF4A 2HFEB 1HIML 4D0CA 3DBXB 1W0VB 3DHMA 3H9ZA 1V3KA 1X5XA 4EOWH 2FWOB 4YUEL 1NGZA 2CLVA 5GS2H 3O4LE 1F4YL 4U1LA 5EUOE 4KTEL 3WJLC 5EFIA 1FH5H 1KTRL 1FO0B 1SYVA 2GITB 5BS0E 1QRNE 4LRIA 1A7OH 4YQXH 1ROWA 1FSKB 3OKLA 1I9RL 4NN6B 4JO3H 2PYEE 4YHMH 3NACH 3NGBC 1EFXD 4X8JB 4RWHA 5BZWA 3ARGA 3SGJA 3DETC 3EHBC 3PP3H 2DIBA 2NX5E 3STLA 5GGVL 3EYSH 3QDMA 3DYOA 3RFZC 3D39E 3DUUA 3HZVB 1EHAA 4ACPA 1TJIH 1KN4H 1I1YA 1YEGL 2G5RA 4M7KL 4JFHE 3NZHH 2N4IA 1AR1C 5E2WL 1FN4A 4WUKL 3ARBB 5EOCH 3T0DA 2ZUUA 5IESL 1FSKC 1WFTA 4LHUD 2FL5A 4JKLA 4JQIL 4GQPH 1CI5A 5IOPA 4C83B 3PHOB 4NOFA 1IAIM 2ENSA 3NCYP 4KI5F 4U1JA 4XPAL 3U79A 3CCHA 1BVKB 3SJVA 2GIYA 4OLXL 4HUKB 5CJ5A 4K94C 4XNQA 4U6TA 2C7UA 2IQ9H 5IHUL 4Y19D 2IBZY 4Q2ZA 5JNYA 3IVKB 4RFNB 2X4TA 3DX9A 2CK2A 1QQDA 1U8OA 3FMGL 4LCCB 5ACZA 1PX4A 3L6FA 2H3NB 1HH9B 5T1LD 3U1SL 4OZHA 4DAGL 3ZDXE 1P6FA 2H6PB 4NSKB 5JDJA 1MREH 3I6LD 1XGUA 4JPKH 3LKRA 3PDOB 4RFNC 12E8H 4MDJA 4PGEA 4Z6AT 3GMOB 3S37L 4ZDHB 3I2CH 4P9HH 4XMKL 3KPSA 1RIVH 4E0RA 1S8DA 1UXWB 2ATKB 2DLEA 2OZ4A 5KW9L 5JW5B 1A9BA 3NA4A 1FRGH 1H15A 5LVEA 3S3SA 2HN7A 4MAYB 1H3XA 4HJGB 1RZIB 2BCKB 5EIIA 2IPUG 4Y5XB 5DMYA 4W4OC 4PY7B 1YY8A 4XNMB 1FL6A 3TA3B 3U9PL 2OTUB 5HGBB 2YPKB 4YHKH 4WI7A 1R6VA 4DEPB 4JHWH 4OZGB 2EXWC 1KB5A 1I9IH 3NFPB 1IAIL 4X7TB 4B0MM 1BHGA 4FQXC 5LGHH 2ICWI 3BDYH 4PJAB 1WCQA 4WU7B 3VXRB 4YAQB 4NT6A 3JV6B 1T7XA 2NNAB 3ARDD 2OTWA 4M7LT 5M7QA 4YBHA 4Y5XC 1NSNH 1KIRA 3TA3C 5D9SB 4NUGH 3O8XD 4U6YB 3RA7H 5TE7L 1G1YA 4ODVH 4KRPD 1J0IA 3OPUA 4IGBD 3GSQA 1KJVB 1J88A 1G0DA 3HMWH 2YA2A 3WIFA 2VZTA 3H8NA 4JY5H 1CG9A 1GL4B 5DUBB 4L9LB 3L3GA 3D2UB 1JWUB 4WWID 2Y6SC 3PUCA 3G6JB 5EBWA 5EU7E 1KACB 1YN7B 3RTQB 3B9KC 4LSTH 2CKBL 3BFOA 4QT5B 2Y23A 2XFXB 3R0MA 4PJGA 5ERWB 1OF2B 3WDJA 4Q6IB 1S9XA 3EZJB 2OLDA 1J10A 3OAUL 4LASH 3RWIB 3ET9F 3WCYA 3GKZA 5T3XE 4NP4L 3I3DA 4JFYB 1SEBA 1I7UB 2QQKL 3LEXB 1FGNL 4HW6A 2PW2A 4ELMA 4IRZH 4KMQA 2VIRA 5FYKD 4PRBA 4OFYD 2AK4E 1H3VA 4XNUL 3P77A 3KNBB 2DL2A 1BM3L 4Y0GA 3MV11 3UC0H 3AREA 1QFHA 1HI6A 1SBBA 4FQ1H 3LKNA 2P42B 4J6RL 3MLXL 1U8HB 2OJEB 3V6FA 1UWEH 2GKIA 5FCSH 4YHOH 5FYLD 4U2YA 2WWMC 1LP9A 4GAGH 1A4KB 1TNMA 1LHZA 4KVCH 4RMTA 4WNQB 4XNYH 5ESAB 5HGDB 2H2SD 2VYRE 1BFVH 3HN3A 5D1XD 4ZUVB 4CVUA 3MZGB 4JRYE 5E6IC 1NGQL 4LPYA 3GSXB 4JREC 1JNLH 3DYPA 1CICD 4QRPE 5IB2A 3BP7A 5FYJH 1TTGA 5L2KA 5TDNA 1JPST 2AEQL 4G8EB 5CZVH 4Z76A 2P46B 2GSIB 3WKMH 1RURL 3FN9A 4LCYB 2AJYH 4WFED 2A6DB 1I1AA 2P5WA 5FGCB 3FCTA 2EDJA 5BV7H 3TV3L 3BJLA 4KDVA 3SOBH 2OR9H 5IHZA 5CCKL 5C6WH 4G3YH 1PDKA 4NN7B 1A9EB 4WO4A 5D8JL 2HT4D 1T21B 2A83B 3L3JB 3QXAB 1XGYL 4HZLB 5IW6A 2O5YH 2WQSA 1S7TA 1IQDA 4KZDL 3QRFM 4KFZC 2NXZB 4XB8A 3K7UA 4E42A 3IU4H 2PXYD 4RAVB 5JPNA 2QADC 32C2B 3ULVD 3V8CA 1IRAY 4MNQB 2OZ4L 1YPZA 4Z7UB 1LMKA 1KXTB 4DTGL 5C0FB 1N64L 1B9ZA 3AVEA 3HNVH 1IGTB 3L7FB 3VFSA 1QSEA 2EE9A 3KXFB 3S5LG 2BOCB 1TTUA 2B2XL 4NKQB 4YGAB 5K9JL 3NABH 3GMQA 2YC1B 4PJDA 3LV3A 5D1ZB 1O7VA 5DEFA 4YE4H 4YFDB 5E7BA 3F58H 5D7LB 4ONHA 3ZDYE 4MA8H 4Y7MA 1T7VA 4J23A 2X4NA 1YEIH 3PWJA 2F9BT 1NAKL 1RV6X 3WV0A 1AXSB 1EFXA 5CILL 5CP3H 3H7BB 4OZ4A 2XNAB 3WD5H 3H42H 3GSOB 2FEDD 1LILA 5I66A 3FTGB 5E6YA 3CSGA 3CPLA 2GTZA 3U4EB 4S1DD 3CC5B 3UBXA 2EDWA 1G9MC 3S98A 5EUKA 5I8OL 1I7RB 4TTDC 3T0EE 1L7TH 4LHUA 1EHNA 5HYFA 5F7UA 4X9IA 3VXQB 2DYPB 4JHAL 4KK6C 5E8EB 5M94B 2QQLL 4OUUB 3QZWB 2P7TB 3EJYC 3BSZL 2FH8A 1JGDB 1ZWIA 2BVTA 3GK8H 1UH3A 2A77H 3MCKB 2XZQL 2WZAA 4Y19A 4MA1C 1UKQA 1GGBL 1J1PL 1ACYH 4N8VB 4CVXA 5T5NG 2CK0H 1CLOH 3MBED 5GJTL 3S7GA 1HDMA 3LZFL 4UOW0 1MWAA 5T1LA 4ZTOL 2W9DH 3FOLA 5TQ2H 1IC7H 4GKNB 4YXLH 3BI9X 3VI4E 3MLZL 3NZ8B 1FG2B 5FM8A 4M61A 3G6DH 1J05A 3UTPE 1KIPA 1J8KA 3T2QA 3OHXB 1D5XA 3HMXL 4M5ZH 1OD9A 4HLZG 1GJIA 4BFGA 5DRNA 4UTAL 3WDHA 2X4OB 1WGOA 3GMNA 3X13B 3QIUD 5E1HB 1W0VA 3JVGA 5IB4B 4QHNB 2VDNH 2R0ZH 3CX5J 2VC2H 4FP8L 3ULUE 4BZ2H 1E6OL 1FNEB 1EZVY 4PRPE 5IMKB 4CMHB 3SO3C 2YBRB 2GITA 5SX5H 4NQDB 3ZKMD 1NCWL 1MI5E 1X7QA 2VLME 4H26A 5HPOA 4JG0L 2WZPD 4LHJB 1CGSH 4LLVB 1UFUA 2B0SH 3CXHJ 3BKYH 2CLZA 2JB6B 2VITB 1VEMA 1YNKH 5BW7A 3NFSL 2ADJA 3H9SD 3MACH 3ZE0E 1IGIH 1U8IB 4CMHC 3ARDA 3VI4F 5JUEH 1JRHL 4UDUB 3LDBB 5K9OB 4ODHH 4AEIL 3RVXD 1UM4H 4XPGH 3TBTB 4JFEE 4IGBA 4D9LL 4ODSH 2X1OA 5DUMH 3QUXB 5IKCA 4O2CB 4PP2B 3BP6A 5HHOD 1A6ZB 2ZOLB 4AENA 1XIWC 4JPIB 3IVKA 4LSSH 4U1KB 1MIMH 2VXQH 3IFLL 2ATPB 4PD4K 4LCCA 5K33A 5CEZL 4QRTA 4CUCA 4KTDL 1VADB 1XF1A 4APQD 3MXWL 2FECL 4JO2L 3EYOB 3IDGA 3IF1A 4RWYH 3QIWC 4HIHA 1FC1A 2H6PA 4NSKA 4Q9CA 5IW1A 1P7QB 4R2GD 4NNPL 3CDCA 3QUXC 4RGOH 1RJZB 4XMLH 2IH1A 3PNWB 3V2AR 3LMJL 2JCCB 5GSVA 5EZJB 2VE6B 4MJ6A 4ZQKB 3GMOA 2ZKHH 2D9QB 1EAJA 4N9OB 1NKOA 2XZAH 1YEFH 5D7KE 1U3JA 4DVBA 2AXGA 3RDTC 2CDEA 4H8WC 3HE7B 1LWRA 2IC2A 1KPVB 4M6OH 3IRPX 3VFPB 4MAYA 5F1NB 3RIFK 4OI9A 1UACH 5HGBA 5LGJA 1F45A 3MNVA 4DW2L 5FK9A 4RIRA 1DBJL 1WWCA 4GXVH 1UKTA 2QEJA 3BWAA 1G9NC 4UIMA 3BD5A 2VLJE 3HE7C 5DK0A 5D1XA 4OD2B 4K3EL 5GZOD 3JV6A 4R4NC 2NY6B 4UQ3B 2B5IC 2XRAL 2Q8BH 3BUYB 1CICA 2FGZA 5D9SA 4K71B 5DJ6A 2A6JB 1FYTB 4G6AC 4EUPH 3EFFA 1IKNC 1U9KA 1DTUA 2R2BB 4FZEL 1ZLWH 1J1OH 1UQSA 2CDFA 1MWAL 5BVJA 2A74B 1S7QB 4GLRI 4PREA 3EYQD 4JEGB 1UWXK 1T89C 3U46B 3L7EA 4HXBL 1JMXA 1CL7L 1CBVH 3CZJA 3VRJA 5IFJA 1RU9H 1M6OB 4X7EC 5DT1H 5IP4A 5KZCD 4OJFL 3UPAA 1I8IA 1OARL 4DK3A 1HINL 4ALAL 2C1OA 1KEML 2JKXA 1TPXB 1MRFL 4WFFD 1FZOA 2AK1H 1OF2A 2PXYA 1T04A 1UB5B 4GT7A 4ODXB 4ELKB 4XXCA 2AEIT 2DBLL 1FNHA 2FRGP 1MCJA 2FSEB 4M8QA 1DSFH 4QOKB 1CLYL 5C86A 1Z5LB 2BZDA 2W38A 4GAJL 4JFYA 4XC1H 4HT1L 1HYSC 4JB9L 4TSAH 3S8WA 1ZE3C 1NC4A 1LEIB 1CTNA 1VFBB 4G9FB 5J11C 1GZQA 5CIPA 5EOTA 1XAUA 4IMLA 1P4IL 4KKCC 2O5XH 2H9GB 3UTTB 1RI8A 3BQUB 3LIZL 3RP1A 3O6KH 4AQ1B 3U0TB 1NL0L 3FB7A 4X4MA 1U8HA 1T66C 2XWBB 3FONA 1A47A 4NN5B 1NBQA 1XF2B 5GRXG 2CDGA 4G8GE 3RZCC 1GRWA 1NUDA 3R1GH 5JZ7C 1JFQL 1A4KA 4Y4FC 2IAND 3MLYL 5LXGH 3INUH 2VXSH 3SKJL 1HYRC 2HT3C 2OL3L 1BP3B 5GGSA 1K8DA 1RQ5A 4G6FB 4G6ML 2C26A 1VGKB 2DI7A 5DD1H 2VN4A 4PRDB 2OJZH 1NCAH 2VR9A 4WFGD 4G8EA 1I8LA 1J8HB 3E6FA 1ZT4B 5ITFA 4ZUSB 3FQUB 4NQVB 5ILTH 2BSSA 5HBBA 1JHLL 2A6DA 4U2ZA 3IFOB 3OB0H 2UZYB 4L4VB 3X17A 3T65A 4JZOB 1QPXA 4LIQE 5D5ME 3QFJD 2NTFB 1M1SA 4MNGA 5I1HH 1OCWH 3LVEA 5E9DB 2X70B 1S7UB 2ZCKH 1WCBB 4K7PY 4MJ4A 5H8DA 4GMSH 1IGMH 2Q76B 4XC3H 3L5JA 2V9TA 1WEJL 2HKFH 3DSFH 4JDVA 3ZL4H 2C1PB 3MBEA 3SE4C 1OQXA 4I4WB 1UYWH 5D72L 2DOCA 2IJ0C 1OQOA 4HUVB 2LE9A 5FYJU 4L5FH 3P0GB 2NR6C 5FYKL 1NBVL 1OD7A 4I0PD 5DQ9A 1T7ZA 1W72H 4GMTL 1D3CA 1PYWB 1OY3B 1U36A 3OR6B 1GIGL 4XX1E 1YUHA 1IGFH 3MLVH 2CKBB 2FDBP 3KXFA 1A5FH 4HK0A 3DGGA 6FABH 4H20L 4HMEA 1EHLL 4P2RD 5TF1L 2RAMA 2YC1A 1CVRA 3QUKA 3DROA 3QIUA 3MLSL 1QHOA 4PRHB 2VR5A 4LCWE 4LLUB 5EO0A 4EXKA 3QUYD 3GSRA 3WXVH 3GMMA 1CFNB 2YN3A 4GUPB 2HG5B 3BKML 5D7LA 2J1KA 2NY1B 5D5MF 1N5YH 4PJXE 2CJUL 4IMKA 1KIQA 4NQCD 1MFAL 4JVWA 3N9GL 3VDCA 4F9LA 2EDBA 3QQ9C 4ZSOE 1QRND 3B9DA 3KYOA 1G6RH 3BE1L 1ZKAA 1T1XB 4JFDE 2P8LB 3MGAA 5DZNA 4FQLL 2QSQA 3DO3A 3H9SA 1JGVL 1ULVA 4P59H 3GMPB 3KHQA 3MXVL 2NX5D 3CC5A 2NY1C 2YSSB 5JORB 1DLHB 1WICA 4GS7B 4BFBD 4PJEB 2GCYA 3D18A 1J0KA 1LO3H 2FO4B 3MCLL 5TJWK 4OUUA 4XP5L 1OM3L 3TT1L 5IMMB 4M5YH 2P45B 3VXMB 3WFHB 2OQJA 1U3HB 1JGDA 5EU6B 2EIEA 3RHWK 1BWMA 1J86A 1MLCA 3ARFB 2VAAA 3EBAA 3CDGB 5AAWA 2BC4A 3SGEI 4R96B 1LE5B 5T3ZH 3SDDA 4PJXF 4APQA 2APBA 4QLRA 4FABH 1U3HC 1I8MB 5HDBE 2ORBH 1UA6L 3WS6A 5SWSB 4H1LA 2O5ZH 4LGSB 1S5HB 1AMXA 3ARFC 43CAA 1Y18A 1FNFA 2DD8L 5F9OL 4JJ5A 4K9EH 3SDCD 1T4KB 1XCQB 3MRKA 3FB6B 5HI3C 4M48L 1P69B 4FOMA 3HA0A 1NLDH 3OR7B 5HHVL 3HHRB 4QHNA 5JOPD 4PGJA 4XCEA 5GGTA 5TDPB 1CGYA 5LCVL 4A6YH 5T33L 2VLLB 1IQWL 4Z7VE 4A2MA 5GRZA 2YUZA 3BN3B 1QR1A 3QUMH 4MWFB 4ZOAA 3V8OA 3VGBA 1F58<