3HR6A

Structure of the corynebacterium diphtheriae major pilin spaa points to a modular pilus assembly stabilizing isopeptide bonds
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
431
structure length
420
Chain Sequence
RTSIAVHALMGLPTGGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVVQELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALSEPVKTAVDPDATQPGFSVGENVKYRVATKIPEIASNTKFEGFTVADKLPAELGKPDTNKITVTLGGKPINSTDVSVQTYQVGDRTVLSVQLAGATLQSLDQHKDQELVVEFEAPVTKQPENGQLDNQAWVLPSNPTAQWDPEESGDAALRGMPSSRVSSKFGQITIEKSFDGNTPGADRTATFQLHRCEADGSLVKSDPPISLDGKQEFVTGQDGKAVLSGIHLGTLQLESNVMKYTDAWAGKGTEFCLVETATASGYELLPKPVIVKLEANESTNVLVEQKVKIDNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative surface-anchored fimbrial subunit
publication title The Corynebacterium diphtheriae shaft pilin SpaA is built of tandem Ig-like modules with stabilizing isopeptide and disulfide bonds
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Structural protein, cell adhesion
total genus 94
structure length 420
sequence length 431
ec nomenclature
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hr6A02
4FQ2L 3G6JF 1T04B 4TUJB 3EYOB 3ESVF 3E3QE 4ELME 3Q6FB 2VDPH 4KROB 4MB4A 1EH9A 3B9KC 3FQTB 5ELIA 1OP3H 5I66A 3UBXG 4AIXA 2NY3C 4KTEL 4D3CL 3HPJB 2BP3A 4ISVB 4HKJA 5DRXB 4YHYC 4NO0D 4RGNE 1NL0L 3WNPA 1OWWA 1BQSA 1FYTB 1C08A 4XMPL 1N3NB 3THMH 5ESQA 4XVJL 2NPLX 3ES6B 3S36H 4P2OB 3C6LB 4XBPB 1XCQB 5J6GB 1IEHA 1ORQA 5DT1L 5EU4B 5FGBC 3OJVC 3TYFB 2AS5M 4KMTL 5HHNB 3MV8D 1KPVB 4X98A 3VD3A 4QWWD 4GS7C 4G6JL 5TDNA 1A7QH 1PY4A 4OIAA 3BEVA 4KK9C 2QHLA 3X3GH 2I26N 2R4SL 1BQLH 3VFGL 5HI4D 1ZVYA 4KK8C 3U82B 4PJIF 2ATPB 1MFCL 3Q5OA 1UM4H 3I6KB 3WFCH 3M17A 1EEUA 4ELMF 4C83A 5HSFA 3P0GB 3SDAD 5J0BA 5C0JB 3O6FB 3GIZL 4HKZA 4P46A 2MKWA 5BZDB 1ZGLP 5IM7B 2CDFA 2X41A 5ADOL 1QFWH 4I13B 1FFPA 2GJ6B 1F45A 3G5YB 5D5MB 3SCMD 1JGDB 5I1AA 3SE4A 4OZIE 5F3BA 1KCUH 3CJJA 1BIHA 4RQQB 1JPGB 1K4CB 1NC4A 3TIEA 4GBXA 1IEAA 4HKXA 3AROA 3BH9A 1UWEH 5A16A 3PWJB 1SBSH 5FYKD 2JJSC 1DLFL 2HKHH 5I1JL 3WHE0 3RWEB 2APFA 4XCFL 1TTFA 5AWNH 3DECA 4LAJH 5KSBF 4Y5VA 1OP3K 1VGKB 3MYZA 3KPPB 3U0TB 3D3VD 4F9LA 5F89A 2A6DB 3WIIL 4U1HB 1NLBL 3QCTL 3TLRA 2I9TA 3G08A 3B9DA 4LCYA 4MNQE 1X5KA 4OCWL 1Q8MA 5MHSE 4JDTH 1MCRA 3ARDD 1BAFH 3CD4A 4GAGH 5J6HB 3SPVA 1GVIA 4LSUH 5DVLA 3O6LH 4ZG1A 1EGJL 1WFNA 4FQHA 4M1DL 1JCKA 2OK0L 1N6VA 4QRSB 1EUUA 1VEPA 3QDGA 1ZHLB 4HJJH 3LV3A 2RGSA 5DI8A 3V5DB 4PREA 5CGYD 3MJ9A 3QFJD 4HZLA 1I3UA 4WI7A 3T1FA 3UTQA 4HUMB 1R5IA 4HIJB 3VGHA 1JHKL 1R3KB 1DUYB 4Q6IA 1ZK9A 4P59L 1MCJA 4PB0H 1OAUH 3LB6C 1HHKB 4MCZA 1V05A 1F4XL 3IDNB 3OKOB 1E6JL 1FO0B 5D1XC 2QKIB 3MRDB 3S88H 3HZYB 2GIYA 4YHLH 1AE6L 2VXTL 4W70A 3P0VH 5C09A 3QI9D 3C5ZD 3QHFH 4LFHD 4BUHA 1EAPA 3UTSB 5EIVA 4HLZH 3IAPA 1XGQA 1CXHA 4PJEA 5I73C 1VACB 2ESVA 1JPST 1QFWM 1H8NA 1P5VA 4HLZG 2X4TB 4TRPL 1T03H 5HD8C 3H8NA 4L9LB 3QPXL 1CDGA 3NCFB 1F6AB 4XVSL 3GGWA 2J6EH 3I9GH 4QO1A 3JV6A 4LPYA 5BRZE 1DR9A 3WO4B 3BZEB 1E6OH 4HWEL 4XNZC 4ODSH 5EB9A 2QV2A 2FEEI 4E41D 4Y4FD 2VZSA 2VERN 1WCBB 3VJ6A 3PP3H 4YH6A 3O9WA 3M8OH 5IQ9B 3ARSA 4LVHC 5CBEB 4WTWA 2IGFL 4IIQA 1WEJL 4EI6A 1NSNL 1UADC 4PTTA 1CG9B 5FO9A 1PG7L 3GSNB 2GTWA 2B5IC 2AK4E 5IW1B 3KLHD 3F7VA 4C59B 3RWGA 3L95B 5D1ZC 1JGEA 1R24B 5CEYA 1XF1A 5IFJA 2VAAA 5EU7E 3TWCH 4JAMA 1CXIA 4LRIA 1GC1L 4J3WA 4MQ7B 1SHMA 3BAEH 5IVXF 1D6VL 2HFGH 5HPOA 1YDPB 3NACL 1HKLH 4LSPL 4G8GD 1YEEH 4MCYB 1KELL 5FXCH 3PNWB 4EI5A 5FO7B 4LIQL 3QEQD 4H1LB 2W65A 2ZCKH 5J57B 1RJLA 4X99B 2DF3A 5AZ2L 1CF8H 3RNKB 2O5YL 4V1DA 3KPTA 5E8EA 5J8OA 3B4NA 4LLUB 3WKNA 3R8QA 4TVPL 2XY1A 3IU4H 3WFHB 5JIKA 3SKJH 2MFNA 2AEPL 3FOLB 4OSUL 1FL3A 1O5DT 2N1KA 1AGDB 3LVEA 3A0OA 3BRDA 4PTUA 1GOGA 4ZNEE 5LXGH 4LLDB 4EEEA 4LNRA 3MCKB 5EUOF 1PX3A 1G7PB 1LO2L 4I5BA 4D8PA 2WQSA 4L4TA 3F7YB 2R4RH 3U4EA 3BP4B 4KTDL 1BVLB 2A77L 5DRWA 1CGYA 3RVTD 1X7QA 5GS0D 2E7BA 3MRLB 3FFCD 3SQOL 3RNQB 4K55A 4ZAKB 1DVFC 3QB7C 3V4UH 1XIWA 1ZE3C 3DIFB 4JRXE 1P84K 1WUNT 1HQRB 5DVNA 3H9SE 4RFEB 1NAMB 5JDSA 1NMBH 1LP9E 3STZB 4G5ZL 2NR6C 2FR4A 5GGQL 3GK8H 1NKRA 3NOIA 4QKXB 1DTUA 1V7ML 3SDCD 1E28B 4LKCA 4KVCL 1MNUL 5D2LA 1T7VA 1W8NA 3GMNB 1RMFL 4JGUA 4N9GB 1KTLA 4NNPL 4K71B 5I8EB 4C54A 1NGXB 5C2BL 3W0WE 1I1AA 3IDMA 4KK6C 2E7LA 3V7AE 1CGXA 4KQ3L 3KPSA 4OGXL 4QOKE 1P2CA 4XZUA 3TESA 3HI1A 1WC7A 1N7MH 1SJEA 1M7IA 3GMPA 4RIRA 5D8JH 4HPYH 3W39A 4L4VB 1J8KA 3T0DA 1U8MA 4DEPB 4K3HA 4E5XA 4LCWA 3ARZA 3GJEB 3CSGA 1FZKB 1EA9C 1KUMA 4LGPB 3BDBA 4JM2F 2VLKD 4S2SA 2HWZL 3S37H 3X12B 2V7NA 5L88H 1JWUA 5AEAA 1YEIH 1DUZB 3UROR 2Z35B 4KJYA 2WLZA 3WD5H 4UU9A 4WJ5B 4NUGL 3TN0B 3KXFB 1NBVH 3IKCB 3PIQA 4UAOB 5EO9B 3C9NB 4WCYH 4ZS7H 3FQUB 1MH5A 1ES0B 1E4KA 2Q7YA 4QXUH 3EJYC 1C7SA 1TDQA 4BSWB 3X3FH 1XF2A 3QDMB 3W2DH 5IP4A 1OP9A 2WIMA 3MNVB 5EORH 3BZFA 4PB9H 4JRYD 4KZEL 2NLJA 2CK0H 2ZOLA 4YWGH 1TQBC 1XH3A 4IMKA 4O9HL 2XKUA 3HNSL 4HS3B 4N5ED 3OBAA 3MJGX 3FO2B 4NKMB 5C9JB 2W92A 3EO0B 3W5NA 1EEZA 5CJ8A 5D2NE 3MRHA 2FX8L 4WW1A 3IETB 2H41A 4I77L 3V9FA 2P46B 4HGWA 1IAKA 4B41A 4PRPD 4NP4L 1UJ3A 5J13B 4JKMA 3BQUA 1NGPH 4MVBC 1U8NB 4DW2L 1G9NC 5D71H 1TNNA 2Z31D 3FT2B 1EGJA 5GSRA 1PSKH 2I25N 4XCNB 3L1OH 5DC0A 3RY6A 2AK1L 3I75A 4PP1C 3VXRA 1MFBH 5BJTA 1UA6L 3HE6A 4YQXH 2IQAB 2A38A 2VDKH 4M6OH 5TQ0H 4P9ML 4LHUD 1QPPA 3O81A 1SVZA 3OTTA 5MI0B 1ZANH 4KDVA 3PL6C 4PJHB 4OZIA 4QTIL 5D7SH 2ZP0T 1A6UL 2CLZB 3GJFH 2DM7A 3TFKD 4KAQH 5GGVL 4TUOB 3DYMA 5IMOB 5FHAL 4P2QE 3LQAC 1QSED 4IMLB 5HYSA 5T1KA 1KENH 5ALCH 4HC1L 2V2WB 4HK0A 4NT6A 2CGRL 3V8CA 1ONQB 1X44A 1Z5LB 2DI7A 3RP1A 4MJIB 2R2EB 3EYUH 3TM6A 4IJ3C 4WHCA 1CBVH 4NIKB 4JFFB 2GKIA 1T80A 2FZ3A 4H88H 3TZVD 1BJ1H 4FFWC 2WMPA 1R0AH 4OZGA 1NCDH 3UDWC 1AIFB 4GKSA 3FQNA 1QA9A 1C5BH 3CH1B 4YPJA 2VQUA 5CEZD 5DR5L 4KV5E 2X9XA 5HHXL 1A4JA 4JHZA 3VFUB 4MQXC 4EN3C 2A6KB 2PTTA 1INQB 5D9SB 3MC0A 3CFKB 3TT3H 4MNHB 4QRPB 3G04A 2VZ1A 5L2JA 2WWMC 5T1LA 4OD2A 4X5WB 2Y7QA 3BGMB 1SY6H 1H8OA 3UJTL 1FIEA 3ARUA 5I15H 4HUVB 5FF6A 5C70A 5C71A 1E4XL 5FM5O 3OHXB 2R2BA 2MNUA 3B9KA 4QXTA 4WI4A 5ACZB 1ULVA 5HGGS 1TZHA 4QYOB 1Z3GL 5KS9E 4ZTPH 4X7EC 5C3LD 3TP4A 4JZJB 3E0GA 1JNNL 4NRZA 1FVDA 4F9PC 3MV11 3VG0L 2LU3A 3SKMA 3RUGA 4G42A 5B3NA 2RHEA 1IGYB 4PRDB 3EYFB 5DLML 3GJFK 5KW9L 4NNYB 5JHDE 2BSTA 4YHMH 4BJLA 5FGBA 3DHMA 3ZE0F 3JXAA 4PJ5A 3OXSA 4ZS6D 1NEZG 3MRKA 2QEJA 2ENYA 4PYGA 1D9KB 5HHPB 5DQ9A 3IXTA 3OR6A 3IYLW 1RSFA 2DBJA 3CXDH 2YPVL 3RX5A 4MDIA 4OZ4A 1LEKA 3A6BL 2EE9A 2HKFH 5I1CL 1MWAH 2BNQA 2ZOKA 2DQTH 5IBLD 2NY1D 1TMCB 4GG8B 3ZL4H 3L3OB 5D7IA 2GW5A 1C5CH 4LLMA 1TETL 3DX8A 2FWOA 5D7LD 4QHMB 5I18L 4K7PX 3FO0H 5I1KH 3OKYA 1DQLH 4NO2B 2XTJE 2DQFB 3B2VL 3MPCA 5C08A 5DUPH 1GPOH 1II4E 4IGBB 3H9ZA 3NCJL 2ADGB 3M07A 3MNZA 3BMVA 3P11H 5LG1A 4OLEA 1OARH 4B5EA 4GRLC 4GMTL 3UZQA 1CZ8L 1XF4B 3UTTE 1GGIH 1INEH 5C0RL 2JJSA 1T7ZA 1VPOL 5E2UL 3TO4C 4NWUH 4OLYH 3P4LA 5DJ6B 2ATKB 3MREA 2C3VB 1X9QA 4AJ0A 1JWSB 4FFYL 1TVHA 2AAVA 4Q0XL 3RA7L 2OZ4H 2YK1L 1F3RB 1BX2A 1QVOB 3C09C 2BERA 2HFEA 3TBWA 3D0LA 1B9ZA 3TA3D 1CE1H 3QZWA 1F00I 4MAUL 2BVQB 1AGEA 5E99L 2ZUXA 2Y5TA 5FKPA 1CVSC 1G9NL 5C07E 3Q0HA 3S34H 2QQKH 1G1YA 2HLAB 3LSOA 4JKPL 2YD7A 4OBSA 4R9HA 2Z0BA 1TIUA 5DA4A 5CD3A 4NM8L 2VRAA 4XPHL 3ARBC 3KPRA 2YC1A 2W9EH 1LO5B 2VITB 1BOYA 2OI9B 4OM1H 2GTZB 2EDDA 2AQ3A 1IM3B 3VXSB 3LKQA 4GW1B 1A9EA 3VFSB 1YJDL 4RAVA 4KXZI 3SJVD 3TCLB 2HTLC 2XN9B 1S78D 4P3DB 4XWOD 2JIXB 4U1GC 3LQAL 5D1XA 4ERSL 5GHWL 1ZLUK 1I8KB 4XTRC 4NZRL 4O5LH 3U1SH 5KVGH 3RBSA 3MRIA 2G9HA 5HYJB 1TPXB 4E0RB 5DJCA 3MLWL 2XACC 4HWZB 4JRWA 5EIIA 3TVMD 1T6WA 1WWWX 3MFFA 1TVDA 4G6FD 1TVBB 1FZOB 5B39G 3RGVC 1RUQH 4XP1L 2FB4H 5SWSE 4UTAH 5I1HH 2PYEB 1I1FB 1HNGA 1GAFL 2W0FB 2WM0A 1ADQL 4H20L 2VE6B 4PGBA 4LNVA 2VL5B 3CX2A 4GKNA 5T3XE 4O51A 3WS3B 1E4WL 3HR6A 1A21A 1M6OA 3O4LE 3ELAT 1WVZA 4XP4L 3ARWA 2R23B 4NPYB 4ODUB 3I3BA 1H3TA 1KCSL 5M95B 1LEIB 8FABB 5DHVH 1YN7A 4ZFOB 5J1AB 1CDCA 3S4SB 3FB7A 5DJ2A 2CIKB 4XPAH 1X6NA 4R4FL 4F3FA 2DL2A 2XA3A 4AEHH 3WHE1 4ZFZA 1QSFA 4JFPA 2CR6A 3FFDB 4F33B 3FTGA 1Z6JT 5TGBA 3LQZA 3ZTJG 3HZVA 4S1RH 4YK4B 3BHBB 2HT4C 5F9WB 2C1OB 5ISZB 4R4BA 4CGTA 2IJ0C 5LGJA 4HULB 1S9WA 2VR9A 5IMMB 2CIIB 1H9VA 2WP3O 2CMRL 4JVWA 1DANT 2D0FA 2OMNA 3HI5H 4JKLA 2IADA 5CIPB 2WOYA 1MCOH 1JNLL 4JFDD 5JPMB 4G7VL 2PR4L 4I3SL 5EOCH 4Z95H 4PV9B 5F7HA 4PGCB 4M9OA 4J8RB 5C3TA 2NW2B 2P5EE 1EZVX 3MOQA 3KLSA 1U58B 5IT2H 3AXLA 1YY8A 4P4KB 3TGXA 1EMTL 2IPKA 2MCPH 5CMAB 1N8ZB 1ROWA 2DLEA 2WINB 4OUOA 3I85A 1Q9WA 2EE3A 1T20A 1FH5H 1VESA 5FM4A 3IVKA 3VXUB 2OTUA 1F97A 1LVEA 3FT4B 1DVFA 2R29H 5A2JH 2A6JA 2VDQH 2AJUH 1R6VA 1LD9B 4NNXA 5K9QI 5C0CB 2IANE 2R56L 2Q3AA 3NABL 1GL4B 3LRHA 1KFAH 3I6GA 4Z76B 4FFVD 2J2ZA 5INCA 2EDWA 1KGCD 3M1BB 2RCSH 4HHAA 1U2CA 3I2CH 1IL1B 5I8KH 3MUGA 1HEZB 3IS0X 1BIIB 1JF1B 1UWGH 1A7NH 1LILA 3LEXA 3OAUH 3RIFK 3LS5H 1FNEA 2P4AB 4JFHE 3GO1H 4AL8H 3OV6A 1KLFA 1VENA 5FOBB 5TH2B 4PIRF 3LOWA 4J4PC 3U7YH 3T3MF 1DE4A 3PJSA 1JK8B 2OL3L 4Y89A 1NCCH 1YECH 5K9KA 3TBSA 3OZ9H 4M1CD 2I07A 4PRHD 3QHZH 3QUYD 4X0KB 3CFCH 5JIPA 3PP4L 4WW2C 4X6BA 1N0LA 2NX5E 3MLUL 4ZPVA 1UZ8A 5FYJL 3RL2A 5L6YH 4YO0B 4R8WH 3GSUA 1JI1A 2AJVL 1S7XB 1A6ZB 1QRNA 4M93C 5GGUA 2GFBB 5ITBH 4ALAH 5GRUH 5EG6C 2AEIT 4HUUA 2PYFB 4DZBB 5DZLA 1AJ7L 1IAIL 5AYQA 3V5KA 3H6JA 1AGFB 4JQIL 4JN2A 4YDIH 1F8TH 1B6UA 1S7TA 2R0ZH 2PXYD 3ALXA 1P84J 3RTQA 3CFEB 3RZCB 4KRPC 4NZJA 1KTDA 5MEQA 1J1OH 3MV7B 4IRJD 1JYVA 2VNCA 1FO0H 3DVGB 4C4KT 2UYLB 4PBVC 3QG7L 4PLJC 3FCTA 1PYWA 2DWDA 5JHDA 4M03A 1YC7A 1DEEB 1YMMD 4MA3B 4OF5A 1F6LL 1MLCA 4N8VB 5I17B 1LEGB 4ZD3L 4OI9A 4XAWH 2YWZA 1XR8B 3ETBF 3S35H 3IDIA 3GSOA 5JQ6H 1SYVA 2DLGA 1EUTA 4A2MA 3CDYA 4PJ8A 4MJ5B 1MFAH 2DKUA 4JY4B 4J3XA 3DMMD 4L9DA 4GAFB 4X7TA 1KPRB 1UH3A 3X14A 3WNLA 5IMKA 2EKSA 3D9AL 4M6NH 4TTDC 1AGBA 1T7YA 4U1NA 1MVUA 1IGIL 2VLJE 4BZ2H 1REIA 3PABB 5EBWA 4DZ8A 3LKOA 1N64L 1OGAA 4F15B 3KYMB 2YRLA 4HIEA 5DUMH 5IG7A 3BISA 5CHNA 3ZT7A 3VFNB 5E03A 4K3DH 4FN0A 3PL6A 4NN6B 5SWZE 2DS4A 3OKNA 2FJFA 3WYRA 4PJ7E 4NQCA 4Q6YA 2FH6A 1UM6H 3HFMH 3HR5A 4XWGL 2X5PA 2DMCA 1FZJB 1W0VA 2Q76B 3T0EB 2YD2A 3IFLL 2ZUUA 3GSNH 2WSKA 1IGTA 2IPTH 3FQRA 4BH8A 2J8HA 4TNVK 1UVQB 2D03H 4ODTH 2YBRA 3TPUB 2A9NH 5HI5D 3OWEA 2C4XA 5JO5A 4XCCL 3MGOB 4UDTB 1ZA6B 4UDUA 5IROC 2FATH 5IGXL 1GGCL 4HPOL 4JQVA 3UDWA 3MXWL 1DQQA 1BVKA 5KOVC 3WIFA 5EZOH 3T0XA 2FO4B 4KI5D 4Z7VF 4MD4A 1BBDL 5C07A 3MRFB 4ZSOA 1IGCH 4BZ1H 4H1LH 1A1OA 1N2RB 1WF5A 3BI9X 4P46D 4GW4B 2NXZC 3QUMB 4QRUB 1KIRB 2AV1A 4EN3A 4H1LG 1TZIB 4ZXBD 4YXKL 2EZ0C 2QSCL 5F9OH 1FLRH 3RIAF 3BO8A 2YSSA 1NC4D 2IC2A 1X3DA 4GBXD 3ZSSA 5FHBH 3STLB 2D31A 4GQ9L 3VWKD 2AERT 3TBVA 2ZUVA 1YEDB 5IFHL 1BLNA 3L3KB 4OI8A 2BC4A 5CEXA 1L7TL 5IFAL 4U6HA 4ETQB 3QO0B 1NGZA 2YPLE 3O0RH 5C0BA 3WJJC 2A0LD 4YFEA 2VUYA 3FHAA 1UXSB 5C92A 3FT3A 4PJAA 4F9PA 2XFXB 3GI8H 1ED3A 3BPCA 3RDTB 1G9EA 1NAMH 2IAMC 4LPVA 1AO7D 5L8KB 5E6YA 3PV6B 5I74C 1HZHH 4UQ2B 2X4SA 3O45B 3O41B 1SM3H 1UKSA 1P4LB 2WV3A 5DJDB 3FQXB 3C60C 4TPRL 3EO1A 1JPTL 1N5YH 1T5WB 1T21B 3SDYH 4P57B 4W4OC 4ZUSA 2OJZH 3G6DH 4P9HH 1AR1D 1ORSB 4OB5L 4PJGA 2H1PL 4WRLA 4BFIA 5DJ0B 1NFDB 3T2PA 1ETZA 5L2KA 3PDGA 3HZMA 5BOPA 4XRCA 4HJGB 2OQJA 4HXAH 5F7NC 5CBAB 4P2OC 3C6LC 1IC4H 1AGCB 1CK0L 1DBJH 4HH8A 3ZYZA 2OSLB 3QUXD 1JYXA 5EA0L 4MS8D 1IGJA 4WHYH 5M7QA 1QLEH 3VFPA 5BVJB 3MBXL 1EO8H 3OB0H 4WFHD 4Y16B 5C09D 1NPUA 4UBDD 5HPMA 2BY1A 4XPBH 5GIRB 1U8OA 2R1XB 3U4BH 3FN3A 5T3ZL 4GAYA 5DA0B 1LHZA 2ESVD 3CC5B 4X4XB 5IHZB 2C3WA 3AMKA 3BZDA 4TN9A 1YUHA 3WCYA 2B4CL 4ODWB 1CFTA 3L5WB 3MNWB 3TO4A 3NCMA 4DCQB 4CMHC 1B0GB 3UAJC 1ZHKA 3LRGA 3O6FC 3M45A 2F5AH 2GAZA 2XWJA 4PLOB 4R4NC 2E9WA 4P0DA 1XGTB 3IDJB 1D5XB 1HILA 4OKVA 3WIHH 2F19H 1YEFL 5FDYA 1YMHA 2NYYD 4OGAD 1GRWA 4NZUH 4LARH 1KB5B 2X89A 4YHNA 1ZT1B 3WNNA 4M9PA 2GCYA 1UB5B 4HFUL 4O4YH 3HPLB 5IHLB 1DZBA 1M05A 3H7BB 43CAA 4DGYH 3O9WD 1TCRB 2DQGL 3K8MA 1CGSL 1XF5B 1IM9B 3ARBA 5LAXA 5DMIL 4L8CB 3BUYA 5H94A 1TTGA 4UB0L 3QDJB 1BJ1J 1YEJL 4S1SL 5CLTA 1NCUA 3KYOB 1YEKH 4DKFL 4HIXL 4ZUTA 1T2QH 2XNAB 1UEMA 4Q2ZB 1T0NB 1MIMH 4LSSL 3VMPA 3ULUD 4XI5C 1B4JH 1OTSD 3IFNH 4OIBA 5I75B 2LABA 3MGTB 5A3ID 2CKBL 5EU7C 5D96B 4EI5D 3RL1A 5GS1B 4X5LA 5F72S 4BKLB 5I0ZA 5LJYH 2V9QA 1IARB 4BFBD 2OBGA 3VGAC 3LRSB 1CICB 3WKML 1T2XA 5DK3A 2UZYB 3MUY1 3OB0K 5HHOA 4FQQB 4V1DD 5ABDE 3KDMB 3MRQA 4RAUB 2X70B 1MHPL 4YHIB 5KTEH 4JO4H 2AW2A 4LASH 3ULSA 4H5SA 3RGVA 3O8XC 1RZIA 4DFHA 3UYRH 1MJ7L 3WXVL 1U8PB 4Y19B 4MAYD 3REVA 3P73A 2NNAA 2BVOA 5E2WL 2KBGA 1FNLA 1MFNA 1MHEA 4BH7A 4L4TD 5IB4A 4HD9A 2JCCE 3MYJB 3QP3A 1HYRC 4O58H 5I66B 1OAXL 5A1AA 1A6WH 3MRGA 5IB3A 3UP1A 4M5YL 1YEHL 2NX5A 3IJYB 5K59F 3ULVH 3CCHB 1IQDB 1J12A 5DQJB 1FSKB 3LEVL 3CSYA 1XIWD 4X8JB 1VFUA 4UOW0 4Z7WE 4UUJA 1L7IH 2ZWLT 1J11A 3OF6A 5ESQB 1FFNA 1IAOA 1A9BA 4JM2C 4ONOA 2EDHA 3B83A 1DQMH 5FYLD 5ITFB 1ORQB 4B0MM 5HTSA 5LGKA 2JK5A 3VXMD 3KJ6L 4Z8FH 2HP4A 3AU1A 4X98B 1MCNA 1UXWA 4GRMB 3WO4C 5ID1A 1JHTA 4Q9BA 1IQWH 4OCYH 1MRDL 4YZFE 5JA9A 1MPAL 1QLFA 3KPSD 3KAAA 4X4MA 3ARGC 3KR3L 3TYGL 3AB0C 1Q72L 1O7VA 1NANI 4D0BB 5FM8A 4XMLL 2VXSL 3QQ3A 3M17B 4C83B 2JCCF 5D5ME 4LCWD 3BOVA 2VZOA 2NY7L 3NN8B 3QAZC 1OTUD 1DQDH 3MTRA 2EYTA 5HHVL 2D7TL 2VDLL 4FFZH 3V4VL 1MCCA 4P48A 5CUSH 1KIPA 5B3JF 3S9DB 3AGVA 5CD5C 4Z7WF 1IGFL 1UEYA 2WUCH 3TIEB 1HDMA 2VLJA 1IEAB 2E8ZA 2X4NA 3WHXB 1RFDH 4J23A 2F5BL 4DKEH 2MJWA 1QKZH 1N5AA 2HFTA 3ZKQD 4HMDA 1A3QA 4RGND 4HIIA 1BP3B 4CVUA 4PJ7A 1UGNA 2A74A 4JM4H 4HXBH 1ZLWH 1F58L 3BT2L 3SDXB 5LCVH 4P2RB 4JVUA 5HDQH 2AV7B 3D87B 4YZFF 5IEKA 3U2SA 5EIQA 2FRGP 3SE3C 3JV4A 5FCUH 1KN4L 3IJHA 4CDGC 5I19L 1SY6A 4Y1AA 5DD3H 2X6MA 5HI3D 4M8VA 1RY7B 1DLHA 3REWA 4LDOB 5IBUB 3F58H 4JG1L 1ITBB 1DDHB 3BQUD 5TE4L 3NIDF 1Z2KA 4FQXD 4YUEH 3QDGB 4RFNC 2NY4D 2V5SA 2PW2B 4HBCH 3W81A 3EOAA 1WAAE 4AENA 4QRTA 2QJDA 3CH8A 3OX8A 1GGUA 4U1JA 5I76A 4QRRB 3BVNB 3HE6D 2YWYA 5F7KC 4NYLB 1BEYL 4R26H 3W82A 3NFPA 1NEZA 1UH4A 2EXYC 3DX9A 3SOBL 1HIML 4WW2A 4G80A 4NN5B 1FJ1A 4R0LB 3LDBB 1V5JA 4HAGA 3FZUC 1C8PA 2NY6C 3BIBX 4N9OB 4YDJA 4P9HC 1JFQH 3AM8C 5T1KD 4RAHA 4CMMA 3O4OB 2QSQA 1OD7A 2Q1EA 3WUWG 4U05A 5DTFA 3I02A 1MWAA 5JW3H 1YYML 3FMGL 5TDPA 2FGWH 1A5FH 3MGAA 3L9RA 4J6RL 1ZEAH 3MLZL 2F8OA 3G6JA 5IVZA 4APQC 3ZDZE 4N1CA 2EYRB 4DVBA 5LGHL 3WO3B 2B1HL 4DEPC 5GZOD 1D7FA 4PRBA 4WHTA 1G7HB 3E6HB 5DO2C 2BNRA 2P8MA 3CNKA 3TT1H 4HS6B 4QTHA 1RUPH 4ORGA 5MHSD 1BQHB 2AJSL 3QIUB 3SGJA 5C0AE 2VXUH 3SGEH 1A7RL 4IRSA 4FQ1L 1R3IL 4Y2DD 5T1LD 5AYUH 4EI6B 3VH8B 3L6FB 3MJ7B 5TFSL 5FO9B 3ME0A 3LH2H 1I4FA 3TF7C 1RAMA 3D39B 1WJ3A 3C6SA 4NBZB 3F7VB 1IRAY 5FUZL 2OZ4A 5F7FA 1MI5E 4X9IA 5KVFH 2O5ZL 4R97B 1NKOA 3HCVB 2VAAB 4JAMB 4P99A 4YBLB 2L7UA 4X7DC 3WXWH 5EU6B 2HA1A 3ARFA 4NQVB 4CU8A 4FNLL 5DJXA 5EOCJ 3BKYL 4AZ8A 2HT2D 5JUEL 1X4ZA 4K8RD 4WFGD 3WS6C 1B88A 1BF2A 2H8PA 2FHBA 1DN0A 3Q6GL 2Q8BH 1I9RL 1IE5A 1UACH 1EVTC 3TBYA 4WV1C 1K3ZA 3MV9A 5CJBA 3HMXL 3O2DL 3DRTB 5GJTL 4JCLA 3DURB 1R3LA 1P6AB 4O2EB 3GFUA 4WTZG 5BQ7A 3D3VB 2XWBA 4BUGA 4KHXL 3RVWC 4CVXA 4OLVL 4XCEA 5C0DB 1MRFH 3OQ3B 2XI9A 4KKAC 5DMKA 5BRZD 4LNRB 2PN5A 4KK8D 4FQIH 4I5BB 5KSBA 5CIPH 1WTGT 3S3SA 1FORL 3JTTA 5DRWB 1AHWB 3NGBC 1S5IH 3KPQB 1UYWH 4YFLI 1CLCA 3WDHA 5B39A 2O93L 4XX1G 1J5OH 2LQRA 3KJ4B 4FMFA 1U0QA 4M48L 2ZPKH 2AK4D 3DROB 4NZTH 4EJ1C 3BPOC 3QIBC 3R06A 1OPGL 2AXGB 2FR4B 3QEHA 4G6MH 3MV8E 1HE7A 3DV6B 2QL1A 4JLRB 2R1YA 1S3KL 3IGAA 4K9EL 4YC2B 3NZHL 2F54A 1A7BA 3CUPA 1I3GH 3ULVC 3SDDD 3IDMB 4G8EB 5CGTA 1ERNA 1CLOL 2V2XA 3L3JB 3WJJA 5I6XC 4L4VE 1OW0C 3QEGL 4BQ8A 4HFWA 3N06B 1P2CB 1OTTC 2JJTA 1SJEB 2QQLH 4YHZH 2K7PA 2BNUA 4RIRB 5JIHA 4U6YA 2J8UE 32C2B 3CPLB 2IAMA 3C8HA 1U8MB 1QBBA 2GYSA 5D72H 4NDMB 4E42A 2YUVA 4S2SB 4WWKB 3C60A 1CI5A 4JR9H 1T04A 4TUJA 3KXFE 1DANU 1U42A 3VRIB 2V7NB 3T09A 3Q6FA 4OFYA 1JWUB 1Q0YL 3EGSA 3KPRD 3HPJA 5ESVB 4UU9B 4M7LL 2P47B 5FYKE 4Q9RH 3PIQB 1L9NA 4AQ1B 4JZJC 2VABA 1MH5B 1U41A 4FZ8H 3JWNC 1FYTA 1N3NA 2Q7YB 4JRXD 1HYSD 5CSGA 3LZFH 2P5WB 1DBML 4NO5B 2AI0L 2HJFB 3ES6A 3H9SD 4NQSB 1XF2B 4P2OA 3C6LA 1Y6KR 4XBPA 5D1XD 4AH2B 1MF2L 2EYSB 5EU4A 3BZFB 2VH5L 4TQEH 4GLRH 1OHQA 2XZZA 3TYFA 5LQBH 5HHNA 4DN4L 1KPVA 3S36X 4LOUC 1DBBH 1JVKA 2VDRH 3BPNC 5E5MB 2J8UF 4BQCA 4LQ1A 4S0SD 3OKMB 5EULV 4PBXA 3W0WD 4ENEC 3T0WA 1IAKB 2MCG1 3LHPH 3IRZA 1U8KB 3I6KA 5I30L 3QFJE 2J88H 4LPUA 5FGCB 3O6FA 5C0JA 3MBEC 3K81A 1KJVB 5BZDA 5IM7A 1CDHA 2R8SH 1BD2A 1QR1B 1NFKA 2GJ6A 4LSRH 3G5YA 3I75B 4YXHL 4NKIL 3VXRB 3RVUD 2PCPB 4IGBC 3X13B 5IB1B 4RQQA 1JPGA 4JPWL 4Y2OA 3THML 4HGKC 4WUKL 4Z7UB 3LPGA 5H8DA 4Z7NE 3S36L 3HAEG 1OF2B 3PWJA 1QOKA 2QBWA 5IQ7H 1YC8A 1HHGB 1I7RB 4N8VG 1BM3L 1QBLH 1RU9L 5CJOL 5GXBB 3LCYA 3RWEA 1QSFD 3X11A 1AQDB 1L6ZA 4Z78A 2B2XH 2D7OA 3MRBB 1NCBH 5C9KA 3BJ91 4HK0B 1H3GA 2DJSA 4LL9A 1VGKA 1MIEH 4P23C 3KPPA 4Y4KD 1CFQA 1KULA 2V7HB 4K2UH 3U0TA 4YGVB 3OG4B 1GCFA 4UV4L 5BV7L 3STBA 4OZHB 2A6DA 3OXRB 4M62H 2JB5H 2X40A 5EUOA 5F97E 2DBLL 4MA7H 4DOHB 4UTBH 2UWEE 3EYSL 3QPQC 3VMOA 1AI1L 4RRPG 4KRMB 3PWUA 3PHOB 3MLSL 4MLSA 3ZDYE 2Z4QA 3BMWA 3FQNB 1WTLA 4R7DA 4WEBL 1NCAH 5E8NB 3P4OB 1ZHLA 4WUUA 1RUAL 4HSQA 4MZ3A 3WFDL 4EUPG 2CD0A 3GBMH 3L5XH 1A4JB 2OI9C 2PTTB 4GO6B 4HIJA 5MEOB 1R3KA 5L2JB 43C9B 4OD2B 2VZUA 1RUML 1HHKA 2HKHL 3IDNA 3OKOA 3GUTA 1FO0A 2QKIA 3MRDA 3KLDA 5EOQL 3W9DB 2R2BB 1AXSA 3B9KB 1IAMA 4G8FB 4NRXB 5I8CB 4DKAA 4JZNA 5HHMB 4XXDB 2NY3B 4ACPA 2N7AA 5FB8A 1TZHB 2A1WH 1DVFD 3QQ9C 5E7BA 1FQ9C 4GUPB 3UTSA 5MENA 1G7JA 1GGBH 2NY0C 1PAMA 2UWEF 3QUMH 4NQTA 4NRZB 3QT2A 4P2QD 4YBQC 3SE8L 3K8KA 5FUCE 5HYFA 2IFFH 1D5IL 2X4TA 4G9FB 1IGML 1OLLA 2NR6D 4G42B 4JM2A 3OJ2C 1ZGLA 4LSUL 2OS7A 4MMXC 3QG6B 1QD0A 5C6TL 3OXSB 4NQEA 5E9DB 3GMLB 3DXAB 3MRKB 4UILL 1I7TA 1ZMYA 2HMIC 1C1EH 5F96H 2Y72A 5E2VH 4GS7B 5H35B 2IG2H 3T4AB 1I7UB 3HMXA 3O2WL 4KK6D 3SGKC 4MDIB 4F80A 2ZUSA 4OZ4B 4WNQB 2W0KA 4WFFD 2H9GB 1WCBA 2BNQB 5FEBA 4H8WH 3FFCE 5IQ9A 4MWFA 4POZD 3SGEI 1K6QH 5CBEA 4CADA 1OY3B 1FL5B 4NWTH 1AXTH 2EC8A 1CG9A 2FWOB 8CGTA 3GSNA 4OZFB 1P6FA 5DURD 3WFEH 5A2FA 3PWLA 3L95A 3P9WB 1R24A 5IBTH 5C08B 4YK4C 2DRUA 3L5HA 4K94H 5F9WC 4XBEH 1W8OA 1QLRB 4MQ7A 2AEQH 4KKNA 2BY3A 2OMBA 4OCRH 1GGYA 2ITCB 1YDPA 3T0BA 5F6IC 1C7TA 5DC4B 3WNKA 3S97C 4WTXA 5BOZG 4MCYA 5FO7A 3RTQD 3QUKB 1DSFL 4H1LA 2EIZB 3I9GL 1F42A 3PQYA 4MXWH 1TVHB 4X99A 4UQ3B 1BX2B 3QHTC 1J7VR 5JHDD 3SE3A 1JHLH 3OMZA 2YS4A 1C12B 3QZWB 3BIKB 4P4KC 1CIDA 3VWJC 3FOLA 2BSSB 4WU7A 5T1DH 5D1QB 4DTGL 5ILTL 2DLFH 3VW3H 3BP4A 3O6MH 4PJ8D 1CXLA 5CD3B 4M7JL 5JXED 3MRLA 5AG9A 3RNQA 2YC1B 3QBTB 2ZKHH 1FHGA 3PWPE 3UJJH 3DIFA 2L4OA 1CN4A 3WNOA 1I9IL 4FMKA 3J7HA 5T3XL 4RFEA 1OQXA 3BAEL 1MFEH 4QXGL 4GH7B 1A9EB 2FL5A 3CFIC 2YD3A 3STZA 4RAVB 4ZUVB 3JWOL 2MPAH 3BESR 1KB5H 4XC3H 1MEXH 1ZLSL 1E28A 3AS0A 4NQCD 5HJ3B 4HAFA 5TQ2H 5D6DC 4QHLB 5HVHC 2Q87A 2J4WL 3ABZA 3GMNA 2D0GA 4N9GA 5CILH 2G9HB 2FHFA 5I8EA 3EDFA 3AM8A 5DJCB 2X1WL 2P8LB 5EIIB 2P1YA 5L9DL 3E6FA 1UCBL 1PBYA 2PUQT 4OQ1A 5LWYL 4H25B 5DZAA 1A22B 2WANA 1URLA 2FX9L 5GGTH 2E27L 4FP8L 4JN1L 4L4VA 4C56A 2CPCA 3NCYS 2P44B 2NTSP 4JCMA 4XMKL 2DIJA 4Z7OF 3GJEA 1FZKA 5IMLA 3GB7A 5DMGD 4PGBB 3X12A 5CZVH 4C4KO 3UC0L 1IC5H 2WBJC 4L3EA 4FQLL 4Z9KB 1NDMB 4NRYB 1DUZA 5C07D 2Z35A 3DUHA 4JFEB 4ODHL 4UINH 4XNZB 2OR8A 4NQUA 4WJ5A 3TN0A 3KS0H 4HCRL 4AM0B 3IKCA 3S37X 5EO9A 3OPZL 4K3EL 1A7OH 5ICZB 4RMVA 3SGDI 3WFBH 3FQUA 4D9RD 1QSEE 4LVHB 2WWMD 3VFVB 3TJHC 5LVEA 2NXYB 1VSCA 4JFPB 3RZCC 3MRPB 3QDMA 3MNVA 2XZAH 3HZKB 5D1ZB 1X4XA 5TGBB 3HZVB 4JDZA 3K2UH 1MCWM 4OCSH 3WJLC 4KMLB 3P40A 4R4BB 4HS3A 3EDJA 2PO6D 3FO2A 4NKMA 5C0BD 4GLRI 3F65A 3B6SB 4DJMA 3IETA 1EK3A 4KPHL 1INDL 4AG4H 1ZHNB 3QRFM 2IADB 3LQMA 2VC2L 4XPFL 3ZE2F 1OT2A 3R4DA 3FONB 4JFZL 1U8IB 5L88L 1U8NA 4WV1A 3QA3B 5I1EL 4OT1H 2H2SC 3FT2A 4N0YL 1I8LA 5SWSD 4XCNA 3NA9H 4WEMB 3DYPA 2FYYA 2IQAA 1MCLA 1MQ8A 1YY8B 3HTLX 4N0CC 1K9TA 4NJ9H 4PJHA 5I8OH 3O4LD 1KC5H 4FABL 2EO9A 4KKCC 2CLZA 4P3CL 1T20B 1CL7L 1DBKL 4A2LA 4GJTB 4RA3A 4JPVH 3GHBH 4JHWH 1I75A 3HE7C 5IMOA 4WGVB 2OTUB 3DSNA 5C0CE 4XCYB 4XP5H 2B1AL 3Q48A 4IMLA 3IDYC 4PG9B 3BD5A 1VEMA 2A6JB 2V2WA 1IC7L 4LSVH 4NNXB 1ONQA 1Z5LA 2BCKB 2ERJB 2ZCHH 5JXAL 1B6DA 1HK6A 5INCB 4U6VL 4MJIA 3QIBA 3K4AA 2R2EA 4MMZC 3GDBA 4OF3A 4W68A 1FRGH 4JFFA 4XC1H 3UBXB 4CN4A 4AIZB 1U8JA 1WZKA 1AIFA 4L5FH 4P5TD 3AREC 1V7NL 4PBWD 5D7JB 3L1OL 2YXFA 2VIRA 1F4YL 2MQ3A 4YX2L 2FH8A 4GSDL 4GRWB 1RZGB 3HKFA 2YZ8A 2A6IB 2EE6A 1DE4B 2A6KA 6CGTA 1INQA 3PJSB 5D9SA 2DQEL 1EIBA 5JOPE 5D7SL 4MNHA 5TPWL 3OJDB 4QRPA 5D7LE 2CK2A 4LU5L 1I8IB 1X5FA 3TBSB 2X89D 3MXVH 5EWIH 2I07B 4X5WA 2X4PA 1FAIL 2F53A 1CYGA 2VZVA 4HUVA 2A73B 1P9MC 2P5ED 1IJ9A 2ITDA 1JPFB 1WITA 5KVDH 1X5XA 1I9JL 4FOMA 1B2WL 3OHXA 3RL2B 1J8HB 3GSUB 4NJAL 1AY1L 2KPNA 3TH4T 1QRNB 4QYOA 5IBUG 3QULA 2VDNL 1BMGA 3H9YA 4H8WC 1NUGA 3MJ9H 4JZJA 1J1XL 3RI5K 3V5KB 2FD6H 3RDTC 5I71C 1T7WA 1IGYA 2IAND 4PRDA 3EYFA 1WBYA 3MRJA 3NFSL 3TIDA 1EERB 1KTDB 5TE6L 1PZ5B 1UJTA 1PGRB 4PS4H 4XTRD 4NSKB 3T1WA 4LRNL 3FCTB 1TQBB 4UIKH 4Y4HC 1KG0A 5HHPA 1U3HD 1UM5L 3HS0B 3WV0A 3U7WH 4HBQA 1NH6A 4UOJA 1JJUA 5HHOD 4X6DF 4LMQI 4AMKH 1FP5A 3FN9A 1U2HA 3U36A 5KJRH 3GSOB 3LKNA 3L3OA 4QF1B 3NTCL 4TUKH 1XFPA 3FOMB 2HFFB 3MQIA 4X80L 3MBEA 4QHMA 1BFOB 3ZYIA 3E1F1 3W9EB 4ZFGH 1AQKH 1MVUB 4NO2A 1KN2H 2DQFA 1HKFA 2D2OA 3SJVE 3T65A 1NMCB 1TJHL 4IGBA 1OGAB 2NX5D 2P8PB 2XQBL 4HIEB 5IG7B 2ADGA 2CSPA 5E6IC 3PL6B 4LEOB 1FVCB 1T3FB 3OKNB 4OJFL 3ZKMC 4LEXH 1XF4A 3OF6D 4D0CA 3K4DA 3T0EE 3A67L 2DTMH 4HWBL 5DJ6A 1AC0A 2VDOL 4YDKL 2ATKA 3ILQD 4OLXH 1JWSA 3OKEB 1IGTB 4BH8B 5KZCB 5A2IH 3MLYH 5KANI 4PJFE 4PJDB 1QVOA 3BP7A 3DNKA 1RVFL 5F1SA 3B2UC 3RHWF 2F58L 5BZWA 4NC1E 4IJ3B 4RFOL 4WO4C 2XZQH 3MA7B 5JO5B 3V6OC 3EOTH 1C5CL 2X1QA 2BVQA 1IKFH 3FRPG 2XOTA 4UDUB 4N0RA 4WENB 3W11C 4U4BA 3BWUC 3MOAH 2NCMA 3TV3L 3U0WH 1DQQB 2HLAA 2Z93B 3WIFB 4RMUA 4I0PC 4N8CL 4KUCD 1NC2B 1T5XB 4A6YL 4ZSOB 1MOEA 2M8XA 1OM3L 1CDIA 4PV8B 4EN3B 5L7XL 5HYEA 2GTZA 4PJBF 1IM3A 4FXGA 3VXSA 1QYGH 2GSGB 3VFSA 4HCRA 4ONGH 3LS4L 4LMQE 2VLJD 4HV8B 2GT9A 3TCLA 5T5FH 2XN9A 4V2CB 4P3DA 2R0LL 2D31B 5KG9A 3Q1SL 3NCCB 3TBVB 1NGYB 1EJOH 3VFTA 1I8KA 4GG6B 2PW1A 5J3HD 1IVLA 5D7KE 2X4QB 4NQXA 4HUXA 1MRCL 2BC4B 1FNHA 5JR1L 5HYJA 4PJFF 3C2SA 4E0RA 3WEXA 4TOYH 5E1AA 1GHFH 1I1YB 1NGZB 3N1QC 3ET9F 1CICC 4MSWA 4HWZA 4FQ2H 3H42L 1QZ1A 1QFOA 4BZYA 2JELH 1L6XA 1ED3B 2BVPB 4KTEH 4D3CH 5I1IL 2DQUL 3ZSTA 1TVBA 1FZOA 2VO5A 3KHQA 3F5WB 2PYEA 1I1FA 1NL0H 1BFVH 2E9IA 4LLQB 2W0FA 25C8L 1WSST 4XMPH 3EO1B 2VR4A 2VL5A 4XPTL 3WS3A 4XVJH 4LQFL 2VTFA 1MCIA 3QXDB 5MP6L 1LDSA 1EDQA 4ZUSB 2CO7B 1LGVA 2W0LA 1T7XA 3HC0B 3SGKA 1YPZB 1NFDE 2D4FA 4NPYA 5DT1H 1FSKC 4ODUA 5DRZB 2APVA 3GMRA 8FABA 2EXWD 5J1AA 4KMTH 3S4SA 2CIKA 1ETZB 3DLQR 5L2KB 4G6JH 2ARJB 1P7QB 3L5IA 4LFHG 3RKDC 3WDJA 4O5LL 2G2RB 5KVGL 4F33A 2R4SH 5EU5A 4WTZA 4FZEL 4XNUH 4XHJC 2BRRL 1MFCH 3R1GL 2FHCA 4X6CF 1EO5A 3CDGA 3BHBA 2ZCLL 4XP6L 4U31A 4RMRA 1OGTA 2C1OA 5ISZA 1U8OB 3GIZH 4X4YB 2X42A 1BFTA 2CXGA 4NKQB 3EYQC 4GRLB 5BO1L 4I4WB 5ADOH 2ICWA 5EZJA 2CIIA 1QP1A 1LO4L 1YUHB 1CFTB 1X5AA 2YPLD 3TO4B 3MLRL 4IOSD 1N0XL 5E94B 4CJ1A 4ZDHB 1T1ZB 5JPMA 1ZHKB 4KRPD 2SEBA 2XWJB 1FGVH 4HWNA 5MERA 2X10A 1B3JA 4PV9A 4PGCA 1DLFH 4PLJD 3C09B 4PRHE 5GRZA 1A3LH 3ZDXF 2I24N 4J8RA 3WLWC 4M1GL 5I1JH 1YMHB 1NMAH 4XCFH 3C08L 1U58A 3ECBB 1OOAA 4P4KA 4N0UB 3VWJA 4IRSD 3QXAB 4J3VA 2GCYB 5CMAA 1VADA 5GGRA 4BSJA 43CAB 2OL3B 1CXEA 3AFLA 2DM4A 3WIIH 3DETC 4S1DC 1NLBH 1AP2A 1YEGL 3JV0A 3QCTH 4OCWH 1K5NA 4TSBL 5I0DA 3QDJE 3TO2B 3AMLA 3VXUA 3ARBB 4JANB 4JG0L 1PZUB 1H3PL 3BUYB 3FT4A 4TTDD 1F4WH 1LD9A 1EGJH 1NCWL 3HNTL 2APTA 3D69A 4M1DH 3NBNA 5DQDL 4FA8A 4ZUTB 5D70L 1GGTA 3VI3F 2OK0H 4Z76A 2ICCA 3HI5L 4OFDA 3ARFD 1FE8L 4Z1PA 5A40E 3P0YL 5F9JA 1IL1A 1IFHL 4U1GB 4Z7VA 4NQDB 1KB9J 1BIIA 5D6DA 1JHKH 1U6AL 1JPSL 4HZAA 4ZO6A 4P59H 1F4XH 1E6JH 3MV9D 2BHYA 5J56B 3TNMB 5D6CA 5TH2A 3RFZC 2VXTH 2EIDA 4Y19E 3TC9A 5T1MA 1JK8A 3ULSB 3RGVB 4N90D 4PJCB 3P73B 1FH5L 2NNAB 2HLFC 4XNYL 2V17L 1A4KB 5HGAB 4NN5C 1ACYL 3VD9A 2NY2C 4R0LC 1MCDA 1LO3H 5IB4B 4U6TA 4TRPH 1NDGB 4K3GA 2JB6B 2IBGA 3G9AB 3MRGB 1QQDB 3IB4A 1S7XA 3O4OC 1RZFL 2NXZD 2Y36L 2GFBA 1YQVL 4XVSH 1GOHA 3S5LG 2ZNWA 1V3MA 3IXAB 2PYFA 3SE9L 4U1SB 4AEIL 1B90A 2EKJA 5IW3A 1IAOB 1A9BB 2YEZA 4PR5B 4HWEH 1F4AA 1VA9A 3CFEA 5EO1A 3RZCA 3MV7A 1FN4B 3I50L 4U1MA 3ZYJA 4HWBA 2UYLA 2HJKB 5ICXB 1OCWL 3QUXB 2IGFH 1WEJH 3WJLA 2J8OA 2F54D 1NSNH 3QIUC 1UXWB 1N6UA 1CXFA 1PG7H 1DEEA 4N0FA 1ZTXL 4QWWC 1JHTB 4M4PA 5KSAB 4N8VA 1LEGA 1KCVL 3VFRB 1RZJC 1E0OB 1XR8A 4HT1L 1G84A 5BS0B 3Q5TA 4MJ5A 1GC1H 4KDTC 4JY4A 2HYMA 1D6VH 2ZNXA 1KPRA 5J1SC 4KQ4L 1HQ4B 3S35X 3SDAC 2O5XL 3NACH 2NY5C 4LSPH 1K8DB 1KELH 1S9XB 4KROD 4OFYD 4A6YA 3PABA 3D85D 2D0HA 4LIQH 4RRPA 4YBLC 3KYMA 1WFUA 3VFNA 4RZCB 5AZ2H 4X6FA 2WP3T 2O5YH 3VDCA 1N5AB 1FYTD 2A83B 1HWGB 4TVPH 3SDXE 3RI5F 4P5KB 2AEPH 3D6GA 3HE7A 2E3VA 4P2OD 2Q76A 2IALA 4OZFH 4OFVA 1FAKT 2EEAA 4H0IA 1LO2H 2XPGB 2A77H 3P4NB 3EUUA 3DO3A 3ZHDA 3TPUA 4KI5F 4Z0BH 3SQOH 3QWRA 3BSZL 2ORBL 2YHGA 3BWAA 3IJHB 4F57H 2G5RA 4Y1AB 5IW6A 5FFLA 1U8LB 3QXVA 5JOEA 3MGOA 1S5HA 3QDGE 3BP5B 1XCTB 3N1MC 5CINL 1KEGL 4G5ZH 3HUJF 3RVXD 1T0PB 5GGQH 1AHWC 3UAJD 1LK3H 2DB8A 3O6FD 1V7MH 3CDFA 4R4ND 1N2RA 2DJUA 3MMEB 4PG2C 5CJ5A 1XZ0B 4GW4A 2FX7L 3K80A 4KVCH 1MNUH 4I3RL 5DHYB 3EZ8A 3KJ4C 3QUMA 4QRUA 4AENB 2GJ6D 4JB9L 1RMFH 1UB6B 3OX8B 4ZPTA 5CGYC 4NNPH 1ZVSA 5GRVL 3OR7A 1N6QL 4HQQL 3PV7A 3GSWA 4KU1A 1NEZB 1P9MA 3STLA 4KQ3H 4WFHE 4OGXH 3L3DA 4MAYB 5C09E 3BDYL 1RZKC 5ICYB 4RBPK 1YEDA 5J9PB 2IPTL 1QFUL 3L3KA 4PJEE 2W91A 2ESVE 4ETQA 3DV4B 5AAWA 3C5ZC 2HWZH 1U91A 1S8DB 2D7NA 5TDPB 5INDA 2H45A 3RDTA 3PHSA 3G6JB 1P4IH 4NUGH 5IVZB 5TE7L 1SMAA 3PV6A 3HA0A 1FG9C 4WHTB 5E1HB 1P4LA 1TJIL 2BNRB 3KS0J 4NGHL 2E7CA 1OWRM 5DJDA 4DQOL 5F6HI 4WU5A 3FQXA 1IGCL 4WWKC 4ORGB 4WY7L 5CZXD 4L29A 2Y25A 1T21A 4Y4HA 4P5MB 3HN3A 1KCRL 4PRIB 1X5YA 4WEUD 2HVJB 1NFIB 1ORSA 4K7FA 4NFCA 4KZEH 4PJ9B 2BVEA 4O9HH 5DJ0A 1NFDA 3CVIL 3HNSH 4PJXF 4XHQA 4HJGA 2WQ8A 5CBAA 1I4FB 3EJZD 2FX8H 4BSVB 4PJEF 3C6SB 2FBJL 4I77H 2RJMA 5EU6E 3KLHC 4M7KH 2W0PA 4F8TA 4NP4H 3CU1A 5BVJA 3ULUE 2EDFA 1Y18B 5C1MB 2BOBB 4PJIB 1JRHH 5ECJE 3RWDA 5E6IA 1JZ2A 3UTSD 2FJHA 4ELMB 1KPUB 2AK1H 2X4OB 4DVRL 3CC5A 4LBEB 4X4XA 5IHZA 3U79A 1UA6H 4ODWA 3L5WA 3MNWA 2H8PB 1J88A 4P9MH 4V1DE 1B0GA 4QTIH 3TBYB 4ODBD 1A6UH 3JBG7 2CKBB 5JTWA 5GGVH 5FUCC 1XGTA 3MCLL 3IDJA 2I60L 3S96B 5JORA 1RZJL 1CLZL 5FHAH 1WIPA 2BY2A 3UCRA 4HC1H 4XCEB 4L4TE 1MFDL 2CGRH 3V6OA 2A2QT 3HPLA 5BXFA 2LFGA 3H7BA 3HG1A 4AEFA 2VN4A 1TCRA 5KSBB 2NY5L 1KXQE 1EFQA 1IM9A 4OFPA 1QTYT 3ULUF 4XNQB 5C0EB 1F4HA 3UTOA 5GS0C 5IUSA 5B39B 3EDDA 3QDJA 1OAQL 3ZLQC 3KYOA 1XGRA 3CDCA 2FNBA 5GGTA 2FO1A 5DR5H 2XNAA 1MI5D 5HYQB 4Q2ZA 5EH1A 5D2LE 2HH0L 3QEHB 4CDHA 5HHXH 5FYKL 4YFDB 4DN3L 4FQJL 3K1KC 1Q9LA 5GS1A 3SDCC 3OPUA 3LAFA 1LE5B 4R3SA 1BECA 3CUPB 2E7HA 3KPSE 3LRSA 3UJTH 3WIHL 1BJMA 1CICA 1AFVL 1VCAA 4OLUL 3KDMA 2WUBL 4RAUA 4OQTL 4L3CB 2X70A 4YHIA 4LCWE 5DJAB 2X44D 4WI6A 5I74B 1Z3GH 4Z18A 1U8PA 3IF1B 2FJGB 1JNNH 4RA0C 3C60B 3NZ8B 3INUL 4YGAB 4U1KB 3VG0H 5KN5B 1L0XA 1HHIB 4MNQB 2UUDK 3MYJA 2PKDA 3EGSB 4U3CA 5DLMH 5KW9H 3IJYA 4ZAKD 3B8SA 3CCHA 1IQDA 5DQJA 3DJ9A 4BQ6A 4X8JA 5D2LF 4OF8A 1JV5A 4GRWH 1WWCA 4D9LL 2F6AA 2VABB 1PKQA 3T2NL 1WZ1L 3KPLA 4JE4B 1WISA 1RZKL 3NAAL 3NH7L 1GC1C 2YPVH 4WI2A 3A6BH 5I1CH 3BKML 2EXYD 4OLWL 5ITFA 5KVEL 5JHLH 4BYHA 1IZKA 1RZ7L 1TETH 1K2DB 1PD6A 2P24A 1U3JA 1YN6B 3BW9A 4PLKD 5I18H 3VI4F 4GRMA 4N5EC 1AKJA 5E8OB 3B2VH 1ZA3B 2AGJL 3BXNA 2C7UA 4YBHA 5FGCE 4D0BA 4EOWL 3NCJH 4L4VD 2P7TB 1P5UA 4CMHB 1VKXB 5EUKA 1B0WA 4GMTH 3VXRE 3NN8A 5ADPL 4Y8AA 1CZ8H 2R39A 1J10A 1BD2B 5C0RH 3QUZD 2KKQA 1VPOH 4MQTB 5E2UH 3LKRB 5HDBE 1O0VA 5IVXB 3T77B 4POYA 3WLBB 3TN0D 3KXFD 4FFYH 4QGTA 3VGGA 4Q0XH 3RA7H 4Y7MA 4ZTOL 2YK1H 3WHXA 4I2XA 4ONFL 5DSCA 4M7ZC 3IDUA 5GSVB 3MA9L 2C3GA 3QNXB 4OCNC 2MTPA 3TFKC 4HMCA 4ESKA 4AT6B 1F90L 5JW4R 3QWOA 3X11B 5GISL 4Z8FL 4Z78B 4MAUH 2R9HD 5E99H 3QDMD 5DJYB 5DXWA 1G9NH 3SDXA 1RIUL 4P2RA 1CFQB 5FCSH 4DOHE 4JKPH 2AV7A 4Y0GA 4NM8H 3DSFL 4XPHH 1JI2A 2EH7L 4L8DB 4OZGE 5EUOB 1PJ9A 4U7SA 3E8UL 3H7LA 4Z77B 2A9ML 3EJJX 3PWUB 1Q9OB 4M6ML 5D1QC 1FDLL 4U1IB 3TZVC 2Z4QB 4XXCC 4R7DB 4FFZL 3V2AR 1DDHA 4XH2A 3VGAB 5HDBF 4OZIF 3KYNB 4WUUB 3LQAH 4ERSH 2OXGA 5GHWH 1SJHB 2PW2A 3SKNB 1U92B 3ZHLA 5FDWA 3O2VL 2P43B 2OYPA 3MLXL 4QRRA 3BVNA 3O8XB 1E27B 3PXHA 1JWMA 2B0SL 3BPLB 4NYLA 3UPCA 3BDXA 3GUTB 4HJ0C 4R0LA 1DL7L 5GS0L 1D5ZA 5BCAA 3DARA 3QCUL 1AXSB 4JZNB 5F6HJ 1SEQL 5FB8B 3BKJL 4MDJB 3N1GC 4RISL 2FLBT 6FABL 4H20H 1ADQH 4G9FE 4OZGF 4WFGE 3RUGE 5MENB 1G7JB 1CTNA 3GNML 3O6KL 5B4MC 1E4WH 2IBZY 4XP4H 5FA3B 1ZGLB 4JM2B 4NKDB 3MOBL 4RDQF 4YHKL 4PJ5E 5IV2B 1KCSH 3SY0A 2EYRA 1OP5H 4JFFD 3DXAE 4G6KL 2AXFA 1G7HA 3E6HA 4J3SA 3BKCL 5CS7A 1CDJA 2X4UB 4HS6A 4NQEB 4R4FH 1LP9B 1KSRA 2V5TA 5GZNC 1I7TB 1BQHA 4DUVA 3QIUA 3ULVD 2BNQE 1K8IB 2FGZA 4ZS6C 4YHPB 2ZSVA 4P3WA 4TVPE 4LP4A 4I1NB 5D7IE 4JO1L 1SEBB 1RQ5A 4U1LB 3ARGB 3AB0B 4GXVL 1JGVL 4MWFB 1WWBX 4QRPD 5DRNA 4OM0L 4CADB 4KGJA 3OGOE 1S7WB 5IBLC 2NY1C 3L6FA 3MJ7A 4KDTA 3VH8A 4HX1A 5JPNB 1YNKL 1G6RL 1MAMH 2NXYC 1BQUA 1WK0A 5C08E 2CR3A 2CMRH 4HK3J 3D39A 3QAZB 1JTPA 4LVEA 3GM0A 4QOKB 3PWLB 1JFQL 3SDAA 1LO0L 3U9PL 1F6FB 1JNLH 3RUGF 2CLRA 2DLTA 3HCVA 3UJIH 2XRAL 4G7VH 4MHHI 2FGWL 1A5FL 2PR4H 3DHJA 4I3SH 3RWIB 5EU6A 4NQVA 4S1QL 1VFOA 2VLRB 5KAQG 5H37G 3K8LA 1T83C 2DL9A 1ACZA 1JRHI 1RI8A 3QR2A 3UO1L 4MJ2A 5J4MA 1EMTH 5EZIL 1HN1A 3PQYB 3DRTA 3K4ZA 1CFSA 2N56A 4J2XA 3GZKA 5D7IF 1T66C 3DURA 3UZVB 4O2EA 5LBSL 1D9KD 3MX0A 4EBQL 1X4YA 4U6XB 3D3VA 1MJUL 1JBJA 4OTXL 5JMOC 5HBBA 5C0DA 4B7IA 4WU7B 1OAKH 4KK5D 1DBAL 2C26A 2R56H 4NO3A 1JTOA 3LH2L 3KPRE 4I3GA 3NABH 3P30L 5CP7B 2RQ8A 1OP5K 3UPRB 5AAMA 3N9GL 1AHWA 5D2NB 3FB8B 2QQNH 2XKSA 4RFNB 3K7UA 3KPQA 3ZKND 4OCLC 4PG2A 1JE6A 3G5ZB 3QXWA 1FG2A 4UIMA 1IEBA 2ERJC 5JOFB 2EH8H 1FC1A 4IGBD 3Q2CA 2FL5B 2JF1A 3DROA 5GRJL 2HG5B 1MUJA 2AXGA 5ACLA 3PP3K 3OKDB 3VXPB 5ANMA 5E08L 3DV6A 2OL3H 1KBGL 2HTKD 4JLRA 5E70A 3N0PB 1G9MC 4U49A 1CGUA 2NY6B 5D7JC 3B9AA 5K9JL 1LNUB 4G8EA 3PP4H 4RWHA 5F7EL 3C5ZA 2G60L 3E6FB 3MLUH 3VXQA 3L3JA 2I5YL 4MB3A 5FYJH 1J18A 1KXTB 2R15A 1I8MB 1KIQA 4UV7L 1R3JA 4C56B 2AJVH 2KQNA 2VB5A 32C2A 3CPLA 4APQB 3EO9L 3QPQD 4LPCA 1HXMA 1J0IA 2HVKB 4NDMA 5IMLB 3JZ7A 1OAYL 3GB7B 1AJ7H 1IAIH 4WWKA 5CEZL 4JQIH 5F88A 3FHQA 3VRIA 2DYPD 5SX4H 3QWQB 4L3EB 4EKXA 3ARXA 3TJEL 5ESVA 1LP9F 2EDTA 2EICA 2YN3A 2OR9L 3QG7H 4MD0A 3RAJL 4E41A 1QSFE 4FQPA 3VXSD 3V0VB 3D48R 3PWPD 5F9DC 2CDGA 3N85L 4PRAB 2P5WA 4NO5A 2J5LC 5I1GL 2HJFA 4NQSA 2XN9D 1Q9KA 2JIXD 3HC4L 4ZD3H 2DQJL 3ORJA 4AH2A 2EYSA 2WWKO 1WFOA 3ZYOA 2EC9T 4JDZB 3QJHB 5CGMA 4OCMC 4YJZL 5HYJD 3VGFA 4RCAA 3QQ9D 1SMOA 3ESUF 2G5BB 3D9AH 5E5MA 4GXUN 2Q8AL 1G0XA 3OKMA 1IGIH 5BV7B 5JZ7C 4YBQD 1YNLL 1N64H 3PDOB 5C0GA 4LLWA 1TTUA 4R96B 1U8KA 5ENWB 2PYED 4O02L 3MUHL 4WV1B 4D0DB 1PX4A 2ADFL 4EZMA 3QEQA 4LPWA 4Y5XC 1KJVA 4YPGB 1EEQA 5EOTA 1KCLA 5GS3A 1QR1A 4XWGH 2HMID 2W1NA 1NMCC 2FYYB 2PCPA 5IB1A 3X13A 2IPUK 4Y88A 3CAFA 4XVTL 4XB8A 1P7KB 2E9JA 2W9LA 3IFLH 3HRZA 1QFWI 4Z7UA 3GKZA 3LZFL 2ZG3A 2NZ9C 2APBA 1OF2A 4Z7QE 1YJDC 1CCZA 1HHGA 1NBZA 1I7RA 1MCQA 4M00A 3CZFA 3NGBB 2NTFB 4G7YL 3RU8L 1AQDA 3PGCB 3MRBA 4XCCH 1MJJA 2Y4SA 3MXWH 2YRPA 4NHCH 4ZOAA 1IAIM 2V7HA 4YGVA 1J05B 1JZ3A 1BBDH 5ISZD 4OZHA 1JZ7A 1P7HL 3BPOB 3OXRA 3QIBB 3DO7A 1YA5A 2R2HB 1Q94A 15C8L 7FABL 2XTJB 1L9MA 1WBXB 2KUTA 3V52H 4YXKH 4JREC 1U8JB 2QHRL 2QSCH 4X7SL 1KJ2L 2IWGA 3PHOA 4LVOB 3SDCA 1BVZA 3DPBA 4WFFE 2FSEB 2VIRB 5E8NA 3P4OA 4GQ9H 1F3DH 3AAZB 4JZOB 3UTTB 1CS6A 5I6XB 5IFHH 5B8CB 2UZIL 3DOSA 1L7TH 1F3JA 5IFAH 4RMSA 5MEOA 2V5YA 43C9A 5ETUB 5IK3B 2E8YA 4GKOA 3T0AA 2X4PB 4P2YA 2F53B 2AJ3B 2XY2A 4M1CC 2ITDB 2K7QA 1T1WB 4R7NB 1BJ8A 3V4PL 5E8DL 3RVVC 3W9DA 3ZE1E 5JW5B 1LE9B 1QRNE 3VRLE 4K3JL 4G8FA 2VLKA 3C2AL 4NRXA 5I8CA 3VXUD 4XXDA 2JE8A 5T33L 2VQ1B 3O3UN 3QULB 5JMRA 4L1HA 4H0GA 4GUPA 4WI9A 2YPKA 4TPRH 3KPNB 1JPTH 5C0CD 5EPMB 1CU4L 4G9FA 1A6PA 1G9ML 5E00A 1WBYB 3MRJB 4OB5H 2CXKA 3TIDB 5EDXA 1MREL 4KHTL 3QG6A 4X4ZA 2RR3A 2Y6SD 2H1PH 1CE6B 3LD8B 4KV5F 4EQ3A 5E9DA 3GMLA 3DXAA 1QBML 2DMKA 1KG0B 5H35A 1OAZL 3T4AA 1CK0H 1I7UA 1JN6A 3BPNB 4JO3L 4J3OC 5EA0H 1PEWA 4WNQA 4YDLC 1A02N 1I9EA 2H9GA 1KJMB 2MHAA 4LLAA 5E2TL 2NW3A 3U36B 5H2BB 3EYVB 3WN5C 2DQHL 2ED7A 3LKNB 3LN5B 1JGUL 5T3ZH 1FL5A 4DGIL 5C86A 5DDHB 5JOPD 3MBEB 4OZFA 2V5MA 5IB2A 5AG8A 1OGAE 2B4CH 2YXMA 2FECI 5KS9F 3T65B 3GSXA 4MXVE 4NQCE 1AD9B 5IESL 1QLRA 2ZSWB 1JYWA 4JFXB 4CVZB 2X7LB 3T04D 1ZT7B 1YEFH 2ITCA 4F7CB 1T0MA 4D0CB 5BMFL 5IHBA 4FHBD 3TJHD 5DD1L 1X5IA 3GHEL 3QUKA 2YA0A 3D0VB 1YYLL 3T8XA 3RZCD 4PJDE 4HFUH 4RMWA 5KBNC 2EIZA 1C1EL 4XVUC 3MV7D 4P23B 2DQGH 4UQ3A 3BP7B 5IHUL 3LMJL 1CGSH 3FO1B 5DMIH 4K7PL 1C12A 1KF9B 5BZWB 3BIKA 4UB0H 2YD1A 5HI5C 1TNMA 2BSSA 5J12B 1YEJH 3VDBA 4S1SH 3DI2B 2V9RA 4ZSOE 4DKFH 5D1QA 4HGMA 4HIXH 3PGFL 5D4QA 3TZVA 4MA8L 4LHJB 3WUWB 4XXCA 1W0YT 4LSSH 1A0QL 4IBLT 2YN5A 2QQQA 4P5TB 4GQPH 2W60A 4D9RE 4KI5C 4MXVF 4HUWB 2XTLA 2CKBH 4GT7A 4KJQC 3MLVL 1JMZA 2DD8L 4FXGB 4NFDA 2H26B 1M1SA 5EBLB 2L7JA 2B39A 4ZXBC 3WKMH 4N0CD 4ZUVA 2GT9B 1N59B 5KG9B 1MHPH 3O11B 5HJ3A 3VFTB 2PW1B 4QHLA 3VWKC 5C0BE 4NQXB 4HUXB 3RZWA 1MJ7H 3EIFA 3L7FB 3WEXB 4PJAE 5E1AB 2UY6A 3T0ED 2FDBP 4GAJL 4MSWB 1NBYB 2ICEB 5E2WH 3DVFA 2P8LA 4GMSL 2B20A 2NY0B 2X4RA 3O3EB 4H25A 1IT9L 3CU7A 1HNFA 4M5YH 1YEHH 3QWRD 1GZPB 1XGYL 3LEVH 3FQWB 2EDBA 1MHCB 2Q86A 3CK0L 1NDMA 4NRYA 4PJGE 1EHLH 4JFEA 1QFHA 2VWEC 1G0DA 1IAII 5C8JA 5L2KE 1Y0LB 4AM0A 4CW1A 3T2OA 3GMRB 4ZOBA 2R0KL 2YD9A 5SX4I 1AR1C 3VG9C 3QXUA 1W72L 1CD1B 5ICZA 1FBIL 3VFVA 5TDOB 4FTVB 1A6AB 1MRDH 1G6VK 5GGVY 1MPAH 3ZTJH 3MRPA 3RX7A 5EU5B 2OJEA 3KR3H 4PJAF 3TYGH 3UTZB 3HZKA 1Q72H 5D1ZA 1SQ2N 3WE6A 3V0WL 3GSQB 3CDGB 3QUXC 4XMLH 2VXSH 1OGTB 3S7GA 1NAKL 4LCIL 2H6PA 4HC1A 3WSQH 2NY7H 1AH1A 5D7KD 5HHVH 2D7TH 2VDLH 3V4VH 5KSAC 2ICWB 3MACL 1CD0A 5DK0A 5EZJB 1T83A 2AJYL 2YR3A 3B6SA 4XBGB 5F6IB 1ZHNA 4R90L 4DGVL 1CT8B 1IGFH 3RDTD 4RDQG 1IMHC 3GRWL 3FONA 3U48A 2H3NA 3IFPA 2SEBB 1U8IA 3T2QA 5I16B 4N5UA 4PJGF 3QA3A 1HHHA 1KJ2A 2F5BH 5MERB 1FIGL 4N0UE 1QSZA 1RZ8B 1MCEA 2X05A 3C5JB 4R2GB 3R8BB 4L8BB 4O2CB 1F58H 3BT2H 3VWJB 4OGAC 2DQIL 1VADB 3WL9B 3GI9L 5GGRB 4KI1A 1RIVL 3DUUB 4Z0XB 4U7MA 2ADJA 2F15A 1KN4H 1AP2B 1K5NB 3O9WC 2VMFA 5FYJE 3K2UL 4XCYA 4IIQC 2Y06L 4PG9A 3OAZH 4ODVL 5FUOH 3P77B 1MELA 2QTEA 3D69B 2BCKA 4Y5YB 4JG1H 5L0QC 4Y16D 3C5SA 5TE4H 1RIHL 1QO3B 3NVQA 3OG6B 4M43L 1FCCA 4YIQB 5F9JB 4Z7VB 3UBXA 3JWDC 4AIZA 5F93C 4DK6A 3ULUC 1OTSC 3V10A 35C8H 5HVHB 3GBNL 1FGNL 5EFIB 5HHOE 4L1DA 2JJUA 5D7JA 4EI5C 4PJBA 5SWZB 3SOBH 1HIMH 2C5DC 5D6CB 4PFEA 5TF1L 1VEOA 3LN4B 1RZGA 2YMXL 3IDGB 4YE4L 2A6IA 3EOYG 3CSPA 3MR9B 4TVSa 1MJ8L 4NZDA 5T1MB 1VGEL 3VD5A 3OJDA 1KT2B 1I8IA 4ZFFB 2HN7B 3DVNA 2A73A 1FNSL 3FMGH 4JPKL 3ZTNL 4MAYC 1JPFA 4J6RH 3MLZH 2WBJB 1J8HA 1A3RL 2WBWB 1D5BB 5LGHH 2B1HH 3DBXB 3EHBD 2OM5A 3FJTA 4CAGA 3QDJD 4EXPX 4OLZL 5GJSL 1KCKA 5CJXC 1X5LA 2R1WB 3MJ6A 3GEWB 3O3DA 1DFBL 4QRQB 2YEZB 2VXQL 1A7RH 3OKLB 5EO1B 1N26A 4FQ1H 1R3IH 2B4CC 1PZ5A 4U1MB 3MSPA 2Z8VC 1CQKA 4NSKA 1R5VB 1KJ3H 5TFSH 3OAZK 3HAEB 4X4ME 1UC6A 3HS0A 1CICD 2DN7A 4N0FB 3VXOA 5FUZH 2AJXL 4ELKB 3UMTA 2B7DT 5BS0E 4K7PY 2O5ZH 3GSVA 4PJ9C 4ZUUB 3MODL 1QBAA 3QNYB 4QF1A 4FNLH 4RMTA 4Y19D 4X6CA 3QSKB 3FOMA 4JFDA 2HFFA 3BKYH 1BFOA 1FFRA 5JUEH 4Y5XA 3W9EA 1EAJA 3TBTB 3O3BB 1RHHA 1TFHA 3Q6GH 4A6YB 3RGHA 2IBZX 1CGWA 1I9RH 1H0DB 1MCPL 3LY6A 3TPKA 3GMOB 2P8PA 1QHPA 2QADB 3HMXH 3O2DH 4X6FB 5DJ8A 4FG6D 2R69L 4LEOA 1FVCA 4MA1C 3E3QC 1T3FA 4L3AA 1CLYL 4KHXH 4EUPB 1YQ2A 1HSBB 1E4KC 4OLVH 5AZEL 3HE7B 4UZGA 1Q1JL 3NCYP 2Q20A 3MJ8B 4XAKD 2E6PA 1RUKL 3QCVL 4RGNC 3EBAA 3IDYB 2IALB 3OKEA 2YKLL 2V2TB 3V7AG 3BYTA 4Y1AE 4PJDA 1ZVHA 4KUCF 4ZQKA 3BWAB 3K1DA 5GRYA 1Z0NA 3EYQD 5IW6B 3MA7A 4UT6H 3AUVA 3PWVB 4KZDH 4M48H 1DQJA 4PRNA 3UYOD 1S5HB 3P9LA 2K1MA 3HC3L 2Z93A 5DZ9A 3AREB 4QCIA 1OPGH 1NC2A 1T5XA 5JQHC 1S9KC 2HT3C 3BQUC 1ADQA 1HINL 3B43A 4FQXC 3SKOB 2NY4C 1S3KH 4PV8A 2DLIA 1OT1A 4K9EH 4ZPTB 1NUFA 1ZVSB 3NZHH 3ZKSD 3OR7B 4DK3A 2GSGA 4PJ7F 4LPXA 1CLOH 3HE6C 5HDLA 3GSWB 4HV8A 3BRFA 1UT9A 4KKLC 4MNGA 3QEGH 1E4JA 3L3DB 1G7IB 2BMKB 2BFVL 1NGYA 4S1DD 4GG6A 2X4QA 3L7EA 5F1NA 1ZGLM 2ENSA 1I1YA 4ODXB 2CJUH 3I84A 4P2RD 1U91B 1T1YB 2YD6A 3G6JE 3IKKA 2E5EA 3R0NA 3JWDL 5ESAB 1Q0YH 4EDXA 5INDB 3ULUL 2BNRE 2BVPA 3U9UB 3QISA 5I71B 4M7LH 4HW6A 5CKGA 1QHOA 3F5WA 3Q3GB 2W9DL 3CXHK 3HMWL 5T5NF 3JUZA 1XAUA 4PUBL 4LLQA 4HF5L 4WU5B 5GZOC 1TJGL 1ZSDB 1DCLA 4KY1H 4L29B 4TSAL 1DBMH 4Y4HB 4JJHA 3QXDA 2AI0H 5K9OB 3D5OF 3QDGD 3MZTA 3HC0A 2XG4A 3F12B 1YPZA 1MF2H 3BE1L 4WW2F 5HHQA 5DRZA 2BOCB 4K7FB 4DAGL 2VH5H 4ONGL 1YMMA 1H3WM 4NHUA 5FECB 4QRRD 3D2UB 4DN4H 2AABL 4UT9L 3WN5A 4TNWK 2ARJA 1P7QA 4Y2DC 3QQ4B 3CLEL 2G2RA 2VZ3A 5IEHA 2Y07L 4I9WD 1LK2B 3CFJB 4LSTL 3SQBA 1GYAA 4TOYL 3HRPA 4KRNA 3MUJA 3VXNB 4ZNCD 5I30H 3ZO0A 2JELL 4JFYA 3D85B 3RWDB 5E6IB 1CFVL 4X4YA 5CCKL 1P4BL 3WMSA 2FJHB 4GRLA 4I4WA 2JCCB 4YXHH 4WFEE 2QSVA 3F6IA 4NKIH 4F58L 1BFVL 1TZGH 4G3YL 1ZWIA 3MV9E 5FYLL 3V6ZB 2HT2C 4LCCC 4JPWH 5E94A 5I1LB 4ZDHA 4K8RC 1HH6A 4WUKH 1T1ZA 1EZVY 4WWID 4Z7WB 1IBGL 4N90E 2X9WA 2YOCA 4NM4L 5JORB 1BM3H 2ZJSH 1RU9H 3QIUD 5CJOH 1EFXB 5EBMB 1J0KA 5B38G 4YHOL 1Q38A 1V3JA 3ECBA 4N0UA 4WO4B 3RRQA 5KSBE 3QXAA 4AY0A 5BXFB 3X17A 4UV4H 2D9QB 2OL3A 5GQBA 5BV7H 3HG1B 1A7PL 1S9VB 4I0PB 2DBLH 4XNUL 5JNYB 5TF0A 3TO2A 3EYSH 4JANA 3D39D 1AI1H 2X2YA 1NGQL 4J7RA 4F7MB 3MLSH 4UNTA 1XGRB 4WEBH 4XNXL 2KQMA 3FKUS 2P45B 4LAQL 4ZXBA 4QY8B 2OTWA 5EU6D 1RUAH 1A1MA 3WFDH 3HUJA 1BGXL 3OKKA 1F3DJ 2F54E 1NEUA 4NQDA 1M71B 2Q6WA 4POUB 1Q9LB 3H2WA 5SV4A 1FGVL 3VWKA 4LSQL 4R3SB 1RUMH 4OCXL 5DGRA 5F8RC 1A3LL 2BHUA 3GMMB 1NMAL 2GJZA 3TNMA 5EOQH 2G75A 3TCXA 3SDDC 5AD0B 1GOFA 5ALBL 3SKUD 1WZMA 4FQCL 4OIIL 4I48B 2D3VA 4LP5A 4W6XB 2EC9U 4PGEB 3F6LA 1FL6B 3ZKXB 3BPLC 4PJCA 4UNUA 1N4XL 4O00A 1AO7A 3ARTA 1G1CA 3SE8H 3QIWB 1A4KA 5HGAA 1AR2A 5A2LH 3VRJB 4UT7L 1D5IH 1KTRL 4HDIB 1UENA 1NDGA 1PG7W 1IGMH 1F4WL 2JB6A 1HH9B 1QQDA 2MSPA 1GSMA 1FYTE 5C6TH 3DGGA 1QSVA 4FXKA 1CFBA 1JV5B 1ND0A 3A6CL 1PKQB 4UILH 3IXAA 4U1SA 1FFQA 3KPLB 5DD0L 3O2WH 2AJZB 4PR5A 3QRGL 2CUMA 5DHXB 1HYSC 3H0TA 5CJQL 1FN4A 2BZDA 2Y1VA 1XR9B 2HJKA 5ICXA 3QUXA 2KZ1B 2P24B 2F74B 3BW9B 2DQDH 1I1AD 2Z91B 4N68A 4PJXA 3RIFF 4Q9QL 1FYHB 1AKJB 2BSRA 5KSAA 5KOMC 5E5RB 3VFRA 3BXNB 1VFBB 4U3HA 2C7UB 1H3XA 3IFOA 1NJ9B 1PG7X 4BFEA 1BBJA 2O26U 5CP3H 5BS0A 5F7WC 1BD2E 1LO3L 5EUKB 1RURL 2GJ6E 2VZTA 4XP9H 4OD1L 5IVXE 1HQ4A 4WWKD 5FM5M 4G8IB 4WVRA 1K8DA 1S9XA 4F7TB 1RJZA 3GM8A 1DSFH 4M02A 4OGYL 4ZODA 1RULL 3RVUC 2OP4L 1A64A 4RZCA 2BX5A 4M4RA 1S9YB 2I9LB 4I2XB 3U6RA 4OV5A 1D6EA 5DFTA 5DSCB 5EC1B 1OSPL 1QEWA 4BELD 2A83A 5C0AB 1YY9C 4LCUB 2P5WD 1KEMH 4D94A 1A47A 4P5KA 3QWOB 1T4KA 1KACB 4CN1A 4DTGH 5ILTH 2DJ4A 5EUOE 1DN2A 2JKXA 4TTGA 4K9EC 2XPGA 4K23L 4AK1A 3P4NA 4WI8A 2DM2A 2BVYA 4M7JH 4Y4KC 4K8RL 1MI5B 5FYKU 4YAQB 1U8LA 1I9IH 2VKWA 3RY5A 5D5MF 5T3XH 3V6FA 2R0WL 4MXQD 4QXGH 4WUUE 3BP5A 1XCTA 1RHFA 2WZAA 3AC0A 3JWOH 4XH2B 5E0QA 5D2NC 4QT5B 5DC9B 3WUZA 1ZLSH 3MMEA 3U46B 1XZ0A 3LIZH 4J4PA 5DHYA 3CMOL 2J4WH 3G6AB 5FDWB 2VSCA 1UB6A 3VXRD 5DK2B 4YXLL 3LPFA 1U93B 1JWMB 2KZWA 5FO8B 5L9DH 4JHBA 1UCBH 5C2UB 3RBGA 5LWYH 2VDML 4MAYA 5E6ZA 2NY2B 1D5ZB 3EDKA 4JHAL 2FX9H 5ICYA 2E27H 4FP8H 4JN1H 5J9PA 1G7LA 4KJPC 3GKWL 3UTSE 5MENE 4XMKH 4ONHB 2X1OA 3TH2T 3H9HB 3DV4A 4Z0BL 4IHOB 3RPIA 1TITA 1S8DA 4F57L 3UC0H 4FQLH 4TNVF 4NO0B 5CJXA 4KXZH 3MV01 2DI8A 5FGRA 4HS8L 4ODHH 1U8HB 5ERWA 5DGQA 3FB6A 4KUZL 4HCRH 2UZXB 4NQEE 3SY0B 3OPZH 1CD9B 4K3EH 2AXFB 1ITCA 1ODAA 3VA6A 1LK3L 5C6WH 2PF6A 3H3PL 4NC2B 1WAAF 1ZLWK 4P5MA 4B7LA 2BJML 3VXMA 4PRIA 1MCHA 3MV8B 2HRPL 2ZSVB 4JO2L 2HVJA 5IJVA 5GGSB 1NFIA 4FRWA 4PJ9A 1NCNA 4TULL 1EPFA 4JY5L 1JGLL 5DRNB 4X6EB 2DDQL 4EDWL 3B3IB 5F7DB 2IPUG 4HX1B 4POZC 3SHSA 1EHNA 3ILPA 3FB5B 2IEPA 4BSVA 5EZLB 4KPHH 1INDH 2CDEB 5DD5L 3SDAB 4OD3L 3N1FC 2VC2H 4XPFH 3B5GA 4ZO9A 2J8UB 3FN0L 2CLRB 3B9KD 3O3AB 5F7UA 2VLRE 5HHMD 3QUZB 1Y18A 2NY3D 4JFZH 3SCMB 3IDXL 3KPMA 2NQCA 4NKOB 5F9AC 5I1EH 2BOBA 4PJIA 4C57C 4N0YH 1P4IL 5KSVB 4HEME 5CSZA 3ZDZF 4ELMA 1KPUA 5BV7C 4IS6A 2X4OA 4LBEA 3CLFL 3PQYE 4DKDC 4G9FD 2FEEL 3RJQB 1Y6NR 1GIGL 4PP2B 1BF8A 2XZCL 4FABH 3RTQC 4P3CH 2YD8A 1CL7H 1C5DA 2CKBA 2Z92B 4LGRB 4PJ5D 1DBKH 2ARWA 1CFSB 2VISB 2ZUYA 5E9DD 3DXAD 4GXUM 3S96A 4RNRB 2B1AH 3KYKL 1BZ7A 2J7LA 4G43A 1IC7H 5DYOB 1A14L 4GKZB 4KK9D 3VFMA 2J1KA 4F37K 1UFUA 4NO3B 2BNQD 5B21A 5JXAH 2DLHA 5IROA 4RWYL 3ARDB 4TVPD 4W4NA 5CZKA 4U6VH 4X7FC 4Q7DA 4TNWF 4M7KL 1W2KT 4PJ8C 3RWJA 1NQBA 4XNQA 5C0EA 4I18B 2MOVA 4LPTA 2O61A 4NUJA 4CNIB 5JXEC 2IMNA 4FQXA 2ADIA 1FG2B 4UIMB 1JRHL 1IEBB 3SO3C 4X9HA 5C08D 4JY6B 1V7NH 3QFJB 2XA8L 1S7VB 4BM7A 2OCFD 1F4YH 5HYQA 3B9VA 1MUJB 2UVFA 4YX2H 3QH3B 5IIEB 5KSUB 2GSIB 4GSDH 3C8KB 2XTJC 5AUMA 2DQEH 4RGOL 5ANMB 5TPWH 4Z6AT 1WLHA 1DJSA 5J1TC 4LU5H 1MSPA 4LVOC 2VXVL 2JJVA 1S7SB 4NN7B 1LE5A 1I7ZB 2AKRB 3VGEA 1FAIH 3QI9B 1WV7T 5FA4A 3C5ZB 3VXQB 5FAAA 4C56E 1I9JH 2CLVB 1B2WH 5K9QG 2OKMA 4X9GA 5B8CC 3NPZB 4L3CA 3CFDB 4NJAH 5DJAA 1KIQB 1R3JB 1AY1H 4IRZL 4TSCL 1J1PL 2VDNH 2E7MA 1XGUA 4L3EE 3IF1A 1Q0XL 1HXMB 1P1ZB 2FJGA 3A6OA 2JTDA 4IDJL 4RSVA 1VERA 3QDHA 5C7XH 5D1QD 1J1XH 2BDNL 3NZ8A 4M5ZL 2ZUQB 4U1KA 5F88B 5KN5A 4WDIA 1F11B 5BVPL 1HHIA 1DP0A 4JQVC 4MNQA 4ZUWB 5DMGC 1QNZL 1W0WB 2UWEB 4W4OA 3NFSH 2V6HA 3PWNB 5TE6H 4I8DA 3BIAX