3HR6A

Structure of the corynebacterium diphtheriae major pilin spaa points to a modular pilus assembly stabilizing isopeptide bonds
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
431
structure length
420
Chain Sequence
RTSIAVHALMGLPTGGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVVQELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALSEPVKTAVDPDATQPGFSVGENVKYRVATKIPEIASNTKFEGFTVADKLPAELGKPDTNKITVTLGGKPINSTDVSVQTYQVGDRTVLSVQLAGATLQSLDQHKDQELVVEFEAPVTKQPENGQLDNQAWVLPSNPTAQWDPEESGDAALRGMPSSRVSSKFGQITIEKSFDGNTPGADRTATFQLHRCEADGSLVKSDPPISLDGKQEFVTGQDGKAVLSGIHLGTLQLESNVMKYTDAWAGKGTEFCLVETATASGYELLPKPVIVKLEANESTNVLVEQKVKIDNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative surface-anchored fimbrial subunit
publication title The Corynebacterium diphtheriae shaft pilin SpaA is built of tandem Ig-like modules with stabilizing isopeptide and disulfide bonds
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Structural protein, cell adhesion
total genus 94
structure length 420
sequence length 431
ec nomenclature
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr6A03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hr6A02
1MWAA 3QEHB 2OL3L 1DQJB 1KGCE 1G6VK 5A2IH 1RZGB 1MQ8A 2WV3A 5GRUH 1IAMA 4HD9A 1FNEA 4J1UA 1ODAA 2EDRA 4N0YL 1B6UA 3D69B 5IW1A 4FXKB 1U91B 3QDJB 2EXWC 5CWSA 2BSSB 5CEXA 3MC0A 4Z7QE 5FXCH 4CMHC 1K4DA 2VLKB 3ARYA 1NJ9B 3NA4A 3O2WL 1T0MB 1WISA 3VFGL 3OSKA 4L9DA 5SX4I 1HDMB 1NCWH 1J18A 4PJ7B 1RPQA 1MEXH 4WCYL 3SKMB 4K3EH 4CN6A 4C56E 1F6AB 4GW5A 1DSFH 4FTVD 5DJ6A 3BP7B 4FQJL 4GQPH 2PETA 4NFBA 2Z35B 4KHXH 4NNPL 3T3MF 1J0JA 1UEMA 4F3FB 4DK6A 1RZJH 5ESVB 2HA1A 1MJ8L 3ARDB 2EE3A 4LPXA 5H37H 4OD2A 1MCLA 4LSSL 2HKHH 1QBBA 4NQDD 3VFUA 1QSVA 3O45B 5FYJL 4OZGA 4PJ5B 1JHLL 4M7JL 1T6VN 5BOPA 4U1JB 3I6GA 4NP4H 3RPKA 4ENEC 1X4YA 4PRNA 5FA4A 2VLJA 5EUOA 4AIZB 4UINL 4PV8A 1A7PL 1Z2KA 1B4JL 4BSWB 3S88L 5JR1H 4Q97A 1MVUB 1G6RH 4G8GB 2O5YL 4OZIE 3OTTA 4IGBD 1ZSDA 1MCPH 5GSVB 3UMTA 3L5HA 4F7TB 1OAXH 4LKXB 1A1MB 1I8LC 3X11B 4KKBD 1P4LA 4J12A 1JNHB 3BZ4B 1OCWL 2FEDD 2VWEE 3G6JE 1YYMH 3KWWA 3MRDA 4P2OC 3CXDL 3ZKXC 1U8PB 4XCEB 5GZND 1SJEB 3O2VL 4ELMF 1EMTL 1KPRA 4NQXA 2GK0B 3QIUD 4PYGA 1JHTA 5FECA 1T5WB 1IFHH 4HAGA 3V2AR 3VXRB 3W0WB 1LO2L 3BKYH 4J3UA 1ZLSL 3G08A 3IDJB 2XA8L 5F9OH 1WZ1H 3QI9A 1RMFL 3KYOA 2EE9A 4GH7B 2UY6A 1U93B 1ZVHA 3NIGF 4GKZA 4RRPG 2C3VB 3OKLA 1IKFH 2XWTA 1IAII 3PWUA 4OZFB 3RVWD 3ZL4L 1WFNA 4JAMB 4PY7A 3MV8A 1GGUA 5GS1B 2F19H 4ZODA 4MQSB 4FQLH 4UB0H 4HUXB 3IDGA 1PY9A 2IC2A 1CXEA 2I9LB 5ACZA 3C87A 5D96B 2RCSL 4JHAH 4X5WA 1H15B 5KW9H 5INCA 2IFGA 2J1KA 3BPNC 1BBDH 3Q6GH 1JUFB 3ZKND 2AJ3A 3GI8H 4P59L 2N7BA 4G6MH 3ZYZA 4IMKC 1FJ1B 3MRJA 4IBLT 3SGJA 4Z78B 5CJQH 2DQGL 5B8CA 1XGRB 1TJHL 3LH2H 1CFVL 2EIDA 3JUZA 4G9FA 4XNZB 4EBQL 1DBJH 3EYQC 4F58L 4FQ2L 1AQKL 5KS9E 1EO8H 1MELA 5TE4H 4XBEL 3STZA 5DD5H 3U9PH 4UT6L 4AEIL 1E28A 5GHWL 2YD9A 4XAKE 1BOGB 1FNHA 2IPTL 4WTZA 5LCVH 5BVJB 1UG9A 3WE6B 1FL6A 4X9FA 1ZT4B 3PDDA 5ALBH 1MRFL 5FFLA 1ZHKB 5TE6H 1T80A 1TETH 3AY4A 4QCIB 4JFHE 4X7SL 1DR9A 2LTQB 3VG0L 2FZ3A 2HFFB 4EUPH 2WANA 5GGSY 3M1BB 4BFIA 2ATKA 1F3JB 1UB6B 2XN9E 4XP9L 4UV4L 4LF3A 1PLGH 3P9LB 1ZGLM 1F90L 4AEHH 3AUVA 1BZ9A 4XNMB 3TBWA 5IW6A 1W0VA 2AJVL 3U30C 3LB6C 1UENA 3BGAA 1G9NC 5K9KA 5C9JB 3GNML 4H8WH 5DD0H 1G9MH 3QEQB 2P24A 5B3JF 1C7TA 5DS8B 5IOPB 1EO7A 1OGTB 1T22A 3HHRB 5JHDA 3ARGD 1CT8B 4IIQC 3DRTA 4HW6A 1GAFL 3WUWB 4ZNEE 3JWOH 4MNHA 5AZ2L 1FZMA 4ZSOE 5TFSL 1MHEA 4EI5B 1HSBA 3BIKB 4M9PA 4JHWL 1MCCA 3P4MB 1EVTC 4DAGL 1SMAA 5IUSA 5C08E 4NQEE 2JCCA 3ULVE 1HQ4B 3RTQA 2Q3AA 4RMVA 5JW4Q 1DANU 4X80H 1G1YA 2H6PB 3FT2B 4WFFE 1M6OA 3N1FC 3QDMB 3U4EA 3VMOA 2PYFA 5FYKU 4RFNC 2VIRA 4HUNB 1CIUA 5GGTA 2K3TA 5AUMB 2Q20A 4WFGE 1DLFH 5DD3H 3KPSA 5SWSA 3A6CL 4OLXL 4OM0L 4P2QE 1FNFA 5KG9B 1F6FB 3HTLX 1KB5A 2QL1A 3QXUA 5DQ9A 3O4OC 4XVUD 4K55A 1BVZA 3CXHK 5T5NG 4PLKD 3P9MA 3QWRA 4QGYA 1A7RH 1REIA 2WBJB 5AAWA 2J6EA 4LKCA 1GZPB 3BPOC 3OXSA 2FGZA 1T20A 4G6KH 4LRIC 4MNGB 1S7WA 1EGJH 2FD6L 1FNGA 3LRGA 4YHNA 3ZHKA 5DVMA 4MJIB 1U8OB 2IMMA 3E2HC 1RZKC 4XCCL 4XP4L 5TPWH 3MLTA 2QQQA 4XTRD 5CP7A 3R1GH 3RWDA 3MRCA 2FBJL 5KVGL 3QQ3B 1T2JA 1FZJB 1JV5B 2L0DA 5IQ9B 3GJEA 3U36B 4GAYB 4X6DB 5JLZA 3UPRB 1U9KA 3T77B 5TE7H 4GXVH 4XNYH 2WQ8A 4OB5H 1QYGH 5FV1L 4NKMB 1QRNB 3PWVA 4NT6B 3SDDD 3ROOA 3KXFE 4LLUB 4M1DL 3SGDI 1LP9F 2VITA 3O4LB 3BMWA 3NFNA 3QJHA 4PREB 1XIWA 4FP8H 4RGOH 3FRUA 1H0DA 2Y36L 1CDYA 2EDYA 1YNLL 1B0WA 3MJ6A 4HQQL 4M93B 3SDAD 1I7TB 3ZKSD 2XACC 5A16A 1TVBA 3ARFB 4BZYA 1IRAY 1MSPA 5EIVA 1IGJB 4FFVC 5DFVC 2V6HA 4H0HB 4A2LA 1UT9A 3IAGC 4MA7L 4R96A 4ZFOB 3ZTNL 3QHZL 1U8JB 1G7HB 5LGHH 2H1PH 1MRCL 1TQCB 3TBYB 2A83A 1T1YA 4GO6B 3F8UB 4CDGC 2BY3A 4YO0A 1EHXA 2F54E 1A7BA 4HPYH 5DXWA 4RFEA 4JO3L 4WHCA 1F2XK 1AXTL 4ODBD 4X4ME 1QFWH 2OR8A 4YHIB 1DBKL 2PTTB 1YY8A 3ARPA 3QE5A 4KWUA 1B0GA 1T5XB 4U6XB 4WHYH 3IFPA 3L5WB 1IGIL 3ZKQD 5F1SA 2DAVA 3RUGF 3OAZH 5DRNA 5IFAH 3DGGB 1U8HA 5IVXB 1ZV5A 5IHUL 4TN9A 5AYUL 5DTFB 3IDXL 5I75C 4BSVA 2XY1A 1KJVA 2OJEA 5L88L 1T1XA 1JI1A 3LKSB 4XPHL 5I1AB 2HN7A 1AD9B 4KY1H 5GGTL 3RVTD 2FX9L 3SKUD 2ICEA 4LARH 2UZXB 4LSUL 3CVIL 3TO2A 1KCRH 1KB5L 4JVWA 4N1EA 5TDNB 5JORB 1I1CA 5JUEH 3K8LA 3BGMA 3B3IA 4HEPG 3FQNB 4EVNA 3X12A 5D8JH 3LN4A 1CICB 1GXEA 3MYZA 2D31B 4C56A 2FBOJ 4UIKL 3BKML 4S0SD 1HKLH 4HJJL 1Q9LA 1U36A 4X5XA 4Y1AE 5D2NE 2GEEA 2JJUA 4WU7A 1CFQA 1UJ3B 2QQNL 4R7NA 2LVCA 3FQUB 1NUDA 4QHKJ 1U58B 3OR7A 5I8CB 5JHLL 2NY3D 4TUKL 5BW7A 2A77H 1AGDB 4OFIA 5FKAA 4X6BA 2D7TL 2HRLA 1EXUB 5IIEA 5CINH 3VDBA 2ESVB 3T3PF 1Q72L 5IB1B 4YWGH 3MGOA 4R4ND 5DHYA 1SM3H 3SE8H 1QACA 1YQVH 3KNBA 1TPXC 3HPJA 2R29H 3MGTA 4HK0A 2GJJA 5DUMH 5J89A 3VGAC 4WI5A 2H9GA 2ERJB 1EO5A 1FZOA 1D6VH 2XWJB 2ZUTA 1ES0B 4NN6C 4R90H 1HHGA 1DN0B 5DEZA 3D25B 1U8NB 2P7TB 3TLRA 3LKQA 1A6VH 2AJYL 5DK3A 4IGBC 4YE4H 3K80A 1GL4B 3B9AA 3QCVL 4NNYA 4F80A 3INUL 5KVFL 1ITBB 3U0PA 5I0DA 3CFBA 1I9JH 1S9WB 4PY8J 1NKRA 3U0TB 3RWJA 1PG7L 1Z0MA 4KKBC 1F4WH 1XGPB 3G6JA 3SO3C 2KBGA 5EORH 4ETQB 4LLYA 2Z91B 4HKBB 2PW2A 2FEDC 2YUVA 3DTXA 2VLJD 3UTTE 1I3RA 1UGNA 3V6ZA 1CDCA 3EYVB 3U46A 4YJZL 2R8SH 5GZNC 4YAQB 3AMKA 5E5UB 3QIUC 3IDYC 4M61A 3FHAA 2HH0L 2MNUA 1M71A 1LO4L 4NO0B 3L6FA 5EBMB 5FYKE 4KI1A 1JP5A 1HEZB 4Z7UF 3PL6D 4UT9H 2IANB 4OCMC 2LV4A 5D7IE 2H45A 4QOKD 3F12B 3RVWC 4TPRH 4LPUA 3UC0L 3W39B 3X13A 2FDBP 5EUKA 3L95A 2HJFA 1A6UL 1ROWA 1ZGLB 3QO0A 5JQHC 3MLUL 1KJMB 4NZUL 4HG4K 3CDYA 1PKQE 4B7IA 3L5JA 4LP5A 1RHFA 3QI9D 3MJ7A 1YMME 3BO8B 1DBML 2CKNA 1IILE 3TWCL 3DUSA 1XEDA 3ZKNC 4IS6B 5HHME 1CDHA 4YXLL 2UWEE 5KS9A 2OYPA 4TTGA 3MV8D 4JDTL 4YBHA 5LGJA 5C6TL 1HINH 2A2QT 1WFTA 1G9EA 5BJTB 1DJSA 3N1QC 2C3XA 3MRNB 1FVCB 4MD0B 3ELAT 2DBLH 1BVLB 4D0CB 4P2RE 5DQDH 3MLRL 4G8IA 2V7NB 1JPSL 1OQOA 2DLFL 3F6LA 3BEVA 2JF1A 3WIFB 4WWKB 1T21A 3S37L 3CK0H 1GGCH 4M6NL 4A6YA 4Y4HD 1UH2A 1JZ8A 2CLZB 1XF4B 5HI4D 4O5LL 2BNQE 3TESA 5IB2B 3ULUH 1A9BB 1OAYH 1FO0B 2P4AB 4F9LA 3GSQB 1MQKH 1SEBA 3KYNB 4E41E 3KHOA 1A8JH 2XN9A 2F53B 2X4PB 1MF2L 5K9JL 1JPTL 3QEGH 3OKEB 2E8YA 1RU9L 1S9VA 4QTHB 3A6BH 4XNXL 2NY2D 1CR9L 3ZDYF 4QEGA 2Y7QB 2VABA 4GJTB 1QHPA 3E6HB 3NPSB 3S36L 5I0ZA 3BAEL 4LHUB 4W4NA 5FA3A 4PYHA 1HH9B 4Z76A 4FFYH 1FL3A 1CDIA 5T3ZH 1S9XA 4I18A 5I1IL 3GRWH 4MVBD 4ZNEA 1UXSA 3ARGC 4ZSOA 4K9EH 4NGHH 1T7VA 5KN5B 4Z7WE 3D39D 3EDDA 4N8PA 4XC1H 2ZP0T 3LKNA 3PDOB 2QHRL 2ZKHL 4M43L 1P4BL 4YHKL 5ESAA 5FM5M 5C08A 3PHOB 2EE2A 5E8DL 3BHBA 1J8KA 1LMKA 4HKJA 2XTJE 5SWQA 4J6RH 1MREL 4UU9A 2Y07H 2NZ9D 4L1DA 3GMNA 4ZD3H 3LZFH 4TNWF 3RWIB 4DGVH 5HYQB 5GS0H 3GB7A 1VACA 5JHDD 4WHDA 4HIXH 3A6OA 4NBYB 5I1GH 1QOKA 4P2QA 3IU3B 4TUJA 2FATH 3KYMB 1UKTA 1NCBH 3SCMB 1L7TH 3L3GB 2AVGA 2OK0L 2PUQT 4OLUL 4Y5VB 4LCUB 4XVUC 2Y5EA 5H8DA 2A6DB 3WFEH 4PS4L 4PLKC 1Q9WA 4P5KB 4DJMA 3GSXA 1NCUA 2GW5A 4X99A 3R8BB 3Q0HA 4E42A 5IV2A 2IG2L 4IJ3B 5D1ZA 1A47A 3V79C 2D9CA 4K94L 4NN5C 2B4CH 1KXVC 4GRLD 4FQ1L 4XTRC 3MNVB 3L7FB 3S4SA 4X9BA 1XF2B 3KPSD 3KLAA 1MJJB 3UDWC 4XC3L 5CJOH 4CADB 1T03L 4AJ0A 5C0DB 1QQDA 2VDML 3QWRD 1A64A 4Y2DA 5I9QB 2X4UA 3FB6B 3GM8A 4TRPH 5KANG 2IMNA 3KXFA 5DWUH 5MEPA 3SDDC 3O6MH 2AS5M 3RGVB 5HSFA 5T3XE 2VSCA 4ODXB 1EAJA 4IDJL 4YBLC 1MFBH 2P5EB 3V0WL 1CLOL 4BK4A 1CLZH 5BRZD 1QA9A 2FIRT 1EDQA 1U95A 1W2KT 2E6QA 2XNAA 3SDAC 5C2BH 3G5XB 1RURH 5J56B 4MDJA 2X4NA 1I9RH 5FF6A 5D7LB 3KDMA 2VL4A 3CFDA 1BD2B 5D6CA 4AK1A 3QR2A 4EKXA 3QEUA 2PW1A 4G3YH 3FT4B 1OHQA 4NKDB 4S1RL 1UCBH 4K71C 3K7UA 5HYJB 3MRMB 1MH5A 4G9DB 2ITDA 43C9A 2F54A 4LHUG 1XIWD 3I3DA 3PWNA 4JPVL 5CEZH 4LPWA 3JSSA 1TTUA 4X4MA 1T83A 2X89A 5EOTA 4OF5A 1F6LL 4URTB 4J3WA 1WBXA 4OGXL 5E4EB 4Z8FH 5IROC 5GGRY 5F7LB 4YDVA 3H42L 2XKNA 4RAUA 1OM3L 4XCNB 2GUOB 1JF1A 5IBTH 5F1KC 4B5EA 4R2GB 3BUTA 4GUPB 3RAJH 1K5NB 3ULVL 5D1QB 1LK2B 4DTGH 1E0OB 2FWOA 3SN6N 5EFIA 4WTXA 1IEAA 2R4RH 1OP3H 3VFRA 3V8CA 4EOWL 3EO1B 4JRYD 5FO8B 5HI3D 3GM0A 1C16A 4IOSD 5EBLB 4PJBB 5ETUB 3FL7A 2DQUL 3MV9B 2A74B 5BS0B 3RVTC 1RJYB 3MBXL 3QRGH 1EIBA 3G9VA 3NFSH 3AXLB 5DJDB 2P45B 3DX6B 3JV4A 3BYYA 4LRNL 3A67L 4JFEB 2GJZA 5D2NA 4Y1AA 3QA3B 5ICXA 1EBPA 5JW4R 1KYOK 3MRQB 1BWMA 4OCYL 4F33A 5ITBL 4XMPL 5LG1A 1HHJA 3OKOB 3PE9A 4POUB 1IKNA 3U2SA 5EU5A 4CL7A 4XCYA 1KENL 1OD7A 4X98B 1W8OA 2NY3C 1CGSH 3HAEB 3RL2B 4M7LH 5T1KD 1OW0A 3W81A 4OFVA 5F7YC 1RVFL 5IF0B 1MCQA 1PG7W 4OT1L 3HLAB 1T7YA 2X41A 5JMOC 3DPBA 2FYYA 4R4NC 4FN0A 3OBAA 4ISVB 4PJ9B 1BQUA 4C56D 3MV7E 3L1OL 4Y19E 5HVHB 3WFCL 4DVRL 4LSQH 1MI5E 3DV4A 2V17H 4X7CC 2D3VA 4HK3N 4P9MH 1XFPA 3CU1A 2NW2A 3WNOA 3FQRA 4TSCH 5DLML 1FE8L 3LHPL 1DZBA 2AP2A 32C2B 4YDIH 5HYEA 4PJEE 1IAOA 3U48A 1A7QH 4XAWH 1R5WA 3C5SB 4JY6B 2PYEE 2OKMA 1QSFD 4NHCH 1CN4A 5IEHA 3HE7A 5EBWA 5DT1L 1EJ6A 1UWGL 4XXCA 2VDRL 4DN3L 3U7WH 1U8MA 3UTTA 1YYLH 3GIVA 4UILH 4M62H 4PR5B 3RWFA 3STLA 1FN4A 4LVNC 4Z7VB 1Z9MA 3MPCA 2HJKB 1OAQH 4QHUA 2HMID 3VXPA 3FKUS 2CDEB 5EZLA 3MXWL 3OB8A 4Z95H 2BVEA 1V3LA 3EYSL 5FHAL 3PV7A 3HZMB 1X6LA 1YJDH 3FCTA 3QYCA 4GLRI 5D5MB 1PY4A 5D7IA 3BH9A 1YPZB 3K4DA 4Z5RB 4PP2B 3PL6C 1YEHL 4KZDL 2WINA 4OGYH 5C09B 3G04B 3P73A 4ODHH 4YPJA 3IRPX 1A6AA 4Y0GA 3O0RH 5EWIL 4JG0L 4F8TA 4F7CB 3U7YH 4NQSB 2EKSA 1PKQA 3FQTB 4QHKI 4ZDHB 4NN7C 2VO5A 4WW2A 2DD8L 5ALCH 4NCC1 1YMMA 2D0FA 2J5LC 5KOMC 1WGOA 4GRMA 1V7MH 4QHNB 2HVKB 3QI9C 1I1AA 4OCWL 1EZVY 3GSNB 1CXKA 5MEOA 3IKCA 3Q5YA 5HVGB 5E6IA 1JN6B 2X4RA 5E9DD 4HFWB 4XCFL 5F72S 4RIRB 1QFUL 3NAAH 4JY4A 2UWEA 4UTBH 1J8HB 2R23B 1YY9D 2DYPB 4KV5F 4FHBD 3REVB 1VFBB 4YGVA 1ORSB 3TNNA 2AQ3A 2UZIL 4FQQB 4DFIA 4EQ3A 1RJZA 2R1XA 4U1IB 12E8L 4FMKA 4P2RA 3GHEL 3O3AA 1SEQL 1XR8A 3D1MC 4WGWB 4XPFL 2OR7A 5DUBB 4BFBD 2OP4H 3SJVE 3QJFA 5D2LB 1EBAA 1R5VA 5E08H 4ONFH 4X6CE 2IH1B 3TT1H 5MEQB 1KLUA 1EERB 5ICYB 1UZ8B 4N1CA 1CQKA 2BNQA 3LDBC 1MCOH 2VC2H 3OR6A 4M8QB 3IAPA 3VXTA 5EU3B 4C4KT 3P11L 4Y4HC 1DBAH 2AJXL 3PQYE 2GJ6E 5HI4C 2CGRH 1A3RL 4LDLB 4PY8I 3SGJC 3ZHDA 1CBVL 5B8CC 1A9EB 4K7PX 3M07A 1RY7B 1X7QA 1NBZA 5E94B 4E41A 3DX8A 5CCKL 1G7PA 4O2EB 3UYPA 4PLNC 1UH3A 1G0YR 3UTPE 1BFVH 1J9CT 2VZUA 5JW4N 2VDOH 5IB5B 3V4PL 1RFDL 4P99A 5HGAA 4FQIH 3MA7A 1CGUA 1VCAA 1K2DA 1XF3B 4P2OB 3ZKXB 3C6LB 1ZKAA 2GFBB 2DLTA 2EDXA 4OLZL 1R3LA 4PB0L 3WNPA 1BQLH 4M1GH 5B38A 1AMXA 4XX1E 1JMZA 2NY2C 4KHTL 1RK1B 4WTWA 1H3WM 4HCRA 4NKOA 2ITCA 3I6LD 3ORJA 2EC9U 2YWYA 3HR5B 3VFWB 5E95B 2IFFL 2X9WA 4YHMH 1EA9C 4KXZI 3AY4C 5CZXD 4Q9QL 4MVBC 3T08A 4Z7WA 4ZYKA 2DQFB 5E7BA 3AGVA 2WIIA 2IF7A 3GMOB 3FO0L 1CL7I 1LO3L 2EXYD 2PTUA 3HKFA 1H8OA 4PJGE 1MJ7L 5E8NA 3C2AL 4UZGA 5H2BA 3MREB 1JWMA 2VQTA 5FYKL 1U92A 2C7UA 1HHKB 2IJ0C 1ZMYA 1IEBB 2NZ9C 5F7UA 5HDQL 2GCYB 4GW4B 3FRPG 5CZVH 4TVPH 3BPNB 7CGTA 3OX8B 3BRGC 1KN4H 1YC8A 1S8DA 1T1ZA 1IC7L 2W9DL 4JO2L 2NY6D 4LCCB 2F5BH 1RV6X 4WFEE 4LQFL 3OKDA 5C08D 3ULVD 3T3ME 3KYKL 4GAJH 4O00A 1BHGA 3Q1SH 5IGXH 3AVEA 4YR6A 4OKVA 1BFOA 2DJUA 3SGKA 1U8IB 1CVRA 1KN2L 2CIIB 2DDQL 1DUZA 4PG9A 2HKFH 4KGLA 4WFGD 1U8QB 4JZJC 4GRLC 3C5JA 4Y8DC 3BEWA 3WIIL 1KIQA 5I15L 1FSKC 4NHUA 1NANI 4JFZL 4HS3A 4OQTH 5CAYB 5E24E 5BO1H 1QFPA 1RK0B 5J1AA 1D6EB 1ZT7A 1CK0H 3V4UL 4JCLA 4NSKB 5DK0B 3FN0H 2C4FU 1A5FL 7FABH 5L2KD 1VESA 4L5FL 1U8LA 4GQ9L 2CJUL 4NQVA 1FYTB 1RSFA 1EVUA 1NAKH 4PJDF 1E4XL 5C0GA 1D5ZB 3O6LL 1HHHB 2FX8L 1ND0B 3KPTA 4MJ6A 4I13B 4MXVF 5I73C 1NLDH 3VRJB 5F93C 3EOBA 4NOBA 4NYLA 3DARA 4MD5B 1UWEH 4NKQB 1BF8A 2XFXA 5HHVL 1H3UA 1FVDB 4CJ1A 5DJ0B 5E2TH 3TJEL 5F8RC 4X7FC 4Y2DD 5HHQA 1N6VA 1QRKA 2VXTL 3KXFD 1NGXA 1N8ZB 3SY0A 1LEIA 1DFBL 3WS3B 2Z31B 3KPNA 1YEKL 1NFIB 4J3SA 1IBGH 2F58H 5KBNC 4PBVC 4BQ8A 1KB9K 1XIWC 4PJAB 5T5FL 4GSDL 5JPNA 4HKXA 3LS4L 1QKZL 1MAML 1U3HA 1FFPB 5GGQH 3NIGE 3OHXA 2A73A 4PGBB 5I1DA 2P8MA 4RFNB 1IC5L 3E3QC 1N5AA 4UDUB 5C0RH 5K59E 4KMLB 4R26L 3O4OB 3QT2A 2JB5L 4Q2ZB 1UH4A 4QWWD 2AV7B 4PGEA 3QFJE 4D0BB 3O3DA 2F54D 3BE1H 2X9ZA 4BH7A 3V7AG 1JGEB 3OPZH 5BQ7A 4NUJA 3BPOB 4JFYB 4YZFE 4HWZB 5IESH 1T7ZA 1XGQB 5JDJA 4MA3B 2YZ1A 5HI3C 1A7NH 1GGIH 2W1NA 4O02H 1LE9A 3E2HB 3HC4H 3EFDL 3GMPB 3G5VA 2DQJH 2OCFD 1KEMH 3L3HB 5C0IB 1ZHNA 4WJ5B 3K46A 4JQXA 4LCYA 2CKBB 2JJSA 3FOLA 3H9HA 4R0LA 2XKSA 1AO7B 5ENWB 1FO0H 5KSAA 2R0ZL 3RKDD 4D9QD 1GOHA 2CO6B 1MHPL 4ODSH 2KKQA 4HDIA 1DEEA 2MCPH 1OAKL 1T7XA 3V6OE 5FGCE 4M03A 1MIEL 4LLVB 4QXUL 1D3CA 1CF8L 3GBML 3MV7A 1ZHLA 3HUJB 3Q6FB 4HH9B 4Y19A 3I50H 5MP6H 5F97E 4Y1AD 1MRDL 3WFBL 1B2WH 1NH6A 1HILB 4ONGL 3LQMA 1I8MB 1MI5A 3QUYA 4NC1E 5T3XL 3G6AA 5E8PB 1VGKB 4MB5A 2YD7A 3WDJA 1I8KA 2AJUH 2J4WL 2BK8A 3EYUH 3SHSA 1K8IA 4HUMB 3UZVB 5B3JE 4QRRE 4O51A 1XGYL 1EHNA 5AWNH 4JFFB 5BW7C 2GQHA 4PJEA 2PYEA 2D0HA 4HC1H 5JXEA 4JDZA 5CSBA 3GGWA 2V2XA 3V5DB 4IRZL 1RZ8A 2E6JA 3NACH 2B1AL 3O9WB 4ZUWA 1V7NL 2AJSH 2HT2D 1RUKL 5FDWA 4Y5XC 3MQIA 3RNKA 4ZOEA 3VXUD 5GGVL 2NNAA 3IFOA 4G5ZL 4O2CA 1CXIA 1XGUB 2FL5B 3B8YA 4NBXB 1DDHA 2FEEL 5F1IA 3U4BL 4DN4L 1TTFA 2HMIC 2XQBH 1NMBH 3CFEB 5I75B 4Z77A 2CLRB 3FFDA 4JKWA 4XP6H 4GBXD 3QXDB 4G6JH 3AMLA 4XPGL 4XHQA 1AGBB 1I1FA 3BP5A 4U49A 3GMQA 3BW9B 1KIRA 2H26A 4DKDC 1MIMH 3R06B 4BKLA 5EU4B 3HFMH 3UTTD 3GIZL 5C0AE 3ZSTA 2OTUB 4P3DA 1EPFA 3MZGB 3NFPA 5EN2A 4MD4B 4ZAKA 3PGCA 4WW1B 4JFDD 4M6OL 4FQHB 4LIQL 3PGDA 1YUHA 3CAFA 4K3DL 1SJVA 3BXNA 4FTVB 1Q0XH 3P77B 1WCBA 5EC2A 4XNQB 1T04A 2Q86A 2ZCHL 5FYKD 1FAIL 3KPOB 2W0KA 4O58H 4TULH 3MJ9H 4OTXH 5C0CE 4DKAA 4KUCD 2RBLA 3T4AB 4NZDA 3C60A 2BY2A 2QR0B 3VI4F 4D9LL 4IDLA 3TZVA 1Y6MR 3C8KA 5FCSH 4JFOA 3CUPA 1YY9C 4KGJA 5IW3A 3GSUB 4NQDB 5J8OA 2AK4E 3FMGL 4PUBL 1TPXB 4QRPE 1TCRA 1MFCL 4YPGB 5DHVB 1LP9E 5HHNA 5KJRL 2YPVH 1KFAH 3VGAB 3BPLC 3SJVA 3C5ZD 5CIPA 4X6CA 2R39A 4NN6B 5H94A 4I3RL 1YMMD 3BQUD 3LIZL 3HI5H 1JCKA 1BIIA 5SX5K 5IMKB 5F1NB 1N6QH 5KSBB 1I1AD 1WIPA 3MLVH 4XVTL 2CDGA 3CPLB 1DQML 5E6ID 3PQYA 2GJ6A 2IADB 1EHLL 2AABH 2ZUQC 2YMXL 4KZEH 3NCMA 4K94C 5C8JB 2BDNL 1KT2A 3HG1E 5IHLB 4N0FA 3V0VB 1ZXQA 2NX5E 1KUMA 2BOCB 3CSYA 4P2RD 3I85A 5DR5H 4PRPB 3LMJL 3NH7L 2IALA 4OLEA 2WNGA 4U6YA 3ES6B 1KPUB 4PRHE 5I1LB 4JN1L 4PB9H 2HFGL 5DGQA 4KU1A 5EO9A 4ZUSA 4HV8A 2AEQL 3LSOA 4I3SH 5F88B 1CFTB 3QIUB 3IDYB 4K3GA 3H3PH 1TNNA 4LNRB 5DJ8A 4LHQB 1Z6JT 4OZGF 4TUOA 5ILTH 3MYJB 5D7SL 1EAPB 5D9SB 4UTAH 4E41D 1EEYB 5F7FA 1R5IB 2XXMB 4F9LC 5EUOF 3VH8A 3D3VE 4OCRL 1AGCB 1WBYB 5CZXC 3WD5H 1TZIB 4GG6B 2CUIA 3ZE1E 5FGRA 1X5YA 1LDSA 3BVNA 3T65B 1I85A 5F7HA 4PJGA 1S7RB 2JK5B 3V8OA 4ODTH 2EXYC 5GRZA 1RD6A 1LK3H 2HP4A 5DVNA 1KTDA 2BP3A 5A2JH 3ARED 4EDXB 4MWFB 4FXGA 2A0LC 2Q76A 4IEFB 4NWTH 4AG4L 1DANT 1I8IB 1ONQB 4I18C 3UJTL 3RWEB 3F7RA 4C58B 5A2LH 4NDMB 2I07B 2BMKA 2W0FA 3HAEH 2L7UA 4I5BB 1WT5C 1KCKA 1GGYA 4LCIL 4PTTB 2NY6C 5LAXA 2YEZA 3QXAB 9CGTA 4IRJA 1JZ3A 1L0YA 3ULVC 3BUYA 4OLYH 3G5ZB 1BOYA 2DRUA 1KCUL 1IM3A 2AAVA 3WFDH 2A6IB 3ET9F 4R4BB 5JW3H 4N90E 1BWWA 1FG2B 1X5GA 4UIMB 3AM8A 1BPVA 1P7QA 1BGXH 3QCTL 2V5SA 1N7MH 2YD8A 2HVJA 5KZCD 2WMPA 1SVZA 1I9IL 2VERN 1MAKA 5GS3A 2FO4B 1FFOA 1D5MB 2G2RB 3HE6D 3WO4C 5J1SC 3P4OB 3UBXA 4OFPA 2MTPA 4V2BA 4ODUA 2DI7A 3PHSA 4H88H 4KPHH 5HGBB 2X7LB 1CZ8H 4ZUUA 1FVEA 1P4IH 5EH1A 5DJ2A 5FV2A 2R15A 4DVBB 2VZ3A 1CFBA 3GJFA 4IRSB 3X17A 1IGFH 1ZLUK 4BH8A 2BXZA 4PJBF 4OM1L 2X9XA 1PD6A 2B39A 5JTWA 2DJSA 2NZIA 3MRBA 3HC0A 5KSUA 2P5WE 5C7XH 2FLRT 3F65A 1YDPA 4O2FA 1W72H 2B1HH 2VDPL 3ARGB 1FIEA 4N9GB 4ONHA 3TA3D 4Y2DC 2MKLC 4EN3D 2JELH 4YDLC 2YKLH 1LE5B 2NYYD 2BRRL 5T3XD 1P84J 1SYSB 3GEWB 3O11B 4RMRA 1ED3A 2WBWB 3FQWB 2W65B 1J86A 1RUQL 1SY6A 1BLNB 4KDTC 1NGWA 5ERWB 2ORBH 4WRLA 4I4WA 3QUXA 4LMQI 2ZNWA 4KFZC 4P9HL 1UM5H 3NCFB 5GGSB 3J7HA 3OKKB 5E00A 1K6QL 3KPQA 4GMTH 3GSNH 3QG6B 3QFJA 25C8H 2R2BA 3W2DL 5GQBA 5I74C 1S7QA 3U1SL 3EGSA 4QWWC 2OL3B 4X4ZA 2Y25A 5IMMB 4AM0A 4YXKH 4YLQT 1Q0YH 3VE0B 1E6OH 2V2WA 4R97B 5J9PA 2G60H 1QUNA 1T83C 3B4NA 4EI6A 1L7IH 1UCTA 4M1CD 4NN5B 2BSTA 2ICWB 1G6RA 1YN6B 3T1WA 3PNWA 5DZ9A 3HNVL 1N64L 2HLAA 2BVOB 3GSWB 6FABH 4YUEH 3CD4A 2IAMA 3PWPE 5IHZA 4Z7VF 3RKDC 1I1YB 4IOIA 1JI2A 1R0AL 3SDDB 5DYOA 3HC3L 3V6OA 2VTFA 2K9UA 4Q0XL 1IAKA 5DRXB 3SPVB 1N3NB 1YN7A 4YBLB 3VXME 2YPKB 3MCKB 4Y89A 2J8UB 3MRIA 3PWJA 4G80A 8FABB 3QIBD 3SDAB 4U2ZA 1HQRA 1MCIA 3VGEA 1KPVB 3ARQA 5L2JB 5ACLA 4UQ3B 1IGTA 1B0RB 5D2NC 3BKJH 4XP5H 3B5HA 2AXFB 3ZDYE 1GH7A 4QRRA 1O5DT 3IFLL 3BESR 4QTIH 5GRUL 5I19H 1WEJH 1IKNC 1C5CH 2NW3B 1P9MA 2F9BT 4K7PL 2VUOA 2DMCA 2XZQL 5IJVA 3O2DA 1XH3B 4HX1B 3NGBC 1OW0C 4KAQH 2NTFB 3EHBD 1HI6B 2VE6A 1NANH 4XBGB 4QXGH 5GSRA 3MV7D 1NGPL 3WFHB 4Y19D 2NPLX 3OJVC 2ZUVA 4KROD 2HT2C 1MI5D 3OZ9L 3CFKB 4WI4A 1NCTA 3IJYA 5HY9B 2OLDA 1AJ7L 1SY6L 3P0VL 1PZUB 4Y16A 4PJIB 3OAUH 3ULSB 1WFUA 3ARRA 4RBPK 1DP0A 1IM9A 1DE4B 2PYED 4MAUL 2CUHA 5JXED 4XWGH 3KPPB 3TYFA 3G9AB 4GBXC 5LQBH 3QB7C 5IMOA 1SVCP 1PZ5A 3UYRL 2VXUL 1NBYB 5EZIH 1RJCA 2GSGA 3T1FB 1OARH 2AI0L 5C0AA 2VL5B 1P69B 3QNYB 4KK6D 4DKEH 4PGDA 5DEGA 1EFXA 4S1SH 4C83A 3RBSA 2OTPA 4HBCL 4ZPTA 2N7AA 3NCCB 4TOYL 4APQD 3VFPA 4K3JL 1CFNA 1JPFA 5F1OB 2LE9A 2B2XH 2OQJA 5IW1B 2F68X 2PXYA 4EUPA 3FT3A 2Q3ZA 4KTDH 4X7TA 2UZYB 3P0YH 1KCSH 5CWSB 2GITA 5C0CA 3MLWL 1JHKL 2GY5A 1NMAL 4OV6F 3LQAL 2P42B 1C12B 4M5YH 2NY3B 1ACZA 4FABH 1IC4L 1MFEL 2CK0H 1AE6H 4D8PB 4DGYL 3WHXB 3QSKB 3CNKA 2AK4A 1G9NH 3MROA 1UA6L 1OAXL 4QRPA 4B53A 2BSRA 1LP9A 2DWDA 5JOPE 3FO2B 1ZGLP 2ADGA 4AMKL 5JQ6L 4Z7QF 4JE4B 5GS2H 4NNXB 2R0WL 2EECA 3QDJE 5I30H 3VFNA 5T3ZE 4MZ2A 3C5ZC 3RZWA 5DJ6B 4HUVB 4DEPB 4WW2C 3I6KB 1R24B 3BQUC 4XRCB 3O3BB 1HXYA 1QP1A 1BX2B 3QDGB 1I1AC 2BNRB 3C60D 4R8WL 5E6IC 4I0PA 3HG1A 4LLMB 3TZVD 4U1NA 2MJWA 4PJ7E 2NX5A 4J3TA 3H9SD 3X14B 4DGIH 2VDQH 3D85D 3BX7C 2XG4A 1Q8MA 4QY8B 2RJMA 3MUY1 2CIKB 3SQOL 1U2CA 1MPAH 4MHHI 4H26A 3VG9C 4PRHA 5F7EL 3I6GB 3SJVD 5F44A 3TV3L 4LSRL 4NFCA 5D1XD 4DWHA 1OLLA 5FA4B 2VLJB 4OD3H 1KNOA 4XPBL 3O2DL 4HUKB 4FQLL 1P7KA 5HJ3B 1KJ2H 1Y0LB 5GJTH 4OIAA 3OAYK 2XOTA 4JB9L 3NCEB 2W9EL 2X05A 3GHBH 1RUML 2MHAA 4MJ2A 2JIXA 3D3VA 4PJ5E 1EGJA 1M7DB 1AD0A 1JNLH 2YN3A 5F7DA 3QFDA 4DOHE 2EH8L 5I1KH 1RZKH 2MOVA 1P4LB 3KS0H 3PL6B 1S78D 4OZIF 3FONB 1U8KB 2O26U 3NCBB 3R8QA 1YEEH 1AI1H 5E2VH 3MRDB 4QOKB 1QEWA 2V9TA 4WU5B 4IMLA 2CKBH 2R0KH 3L5XH 4G8GE 1A6WL 2RHEA 1KPRB 2Y4SA 1JTPA 3HRZA 4XPTL 5HDOA 2VQ1A 4YHZL 4NN7B 4RMWA 2WUBL 3IXAB 3MCLL 2J5LB 4MA8H 3G08B 1FBIH 2VDKH 3G6JF 4HIHA 3AREC 1FV1A 2P8LA 4F9PA 3CH1A 4X8JB 4QYOA 4CAGA 3U9UA 4LEXH 4PJHB 3C2SA 4YQXL 4JR9H 1QVOB 4UV7H 3T4YA 4R4FL 3MSPA 5TE6L 2XWTB 2XZCH 1TETL 4KVCL 4LBEA 4PY7B 4JM2F 3MV8B 1N5YL 3O81A 1VERA 1JGDA 3W0WE 2H3NA 5TGBA 3ARUA 4U6VL 1AQDA 2XTJC 5I71B 5HHOD 4WUUE 1X5XA 2SEBB 4ZXBA 5EZOH 4G42A 4W81A 4MMXC 5B3NA 3TO4B 4XVJH 3OMZA 1OPGL 1C1EL 3B9KA 5INCB 1Q1JH 3LDBB 4TNVF 3VXQA 2R9HD 1RIVH 4Y4HB 1ZWIA 2Q8AH 3UO1L 1CU4L 4U1SB 2FLBT 5B8CB 3HE6C 3S5LB 2ATPA 5CEZE 5CEYA 1ZVSB 3H0TB 3EO9L 4X7DC 1A0QH 2HFEA 3F7VA 2EEDA 2ZOLB 4PLJD 1BZQK 4IRJD 3V7MA 4I9WE 4OZ4A 4WIQA 2NXYB 1CG9A 3TT3H 4L4TD 5LJYH 1ZANH 4XNUL 1P7QD 4HK3J 1BVKA 2NY2B 3RWHA 2VLMD 4ODVH 3IFNL 2FHCA 5KS9F 1F13A 1FPTH 1LDPH 1C5DB 2P5WA 3KVQA 1L0XA 4NJAL 5INDA 3EO0A 3MJ8B 5DA0B 4CN1A 4NWUL 4YDJA 4LPTA 2XQYG 1IVLA 3LAFA 3PIQB 4DCQA 3MBEA 4Y4FA 1BQSA 2YUWA 3TA3C 3TBVA 1TNMA 3IYLW 3D39B 4EN3C 3ROLB 2NYYC 3WLWD 3TJHC 1GVIA 1EJOL 2OR9H 3MRFA 1BZ9B 3JVGA 1G7LB 3TCLB 3HNSH 3TBSB 1S7XA 2CLVA 5JW5B 5K9KB 5HYSA 4FRWA 4LSVL 1CLCA 1T89A 3BP6B 2I5YH 3WMSA 4M4PA 2B5IC 3T2OA 3T2NL 5JHDB 5FO9B 2OJZL 3KLDA 1A7OL 2ZOKA 1FH5L 3OB0H 2OXHA 5T1MB 2NCMA 4P4RA 3CVHH 5E2UH 5C71A 1JWSA 2KH2B 4K23H 4LCWD 4MNHB 1FZMB 3LKPA 3ESUF 1HSBB 4WI2A 5TE7L 4LOUD 1RZFH 1QYGL 5C1MB 4FNLL 5DHVH 1EFQA 2JCCB 5I8EB 4QGTA 3SKOB 5TF1H 2DIAA 2G5BA 3WYRA 2EYSA 4FP8L 4JANB 4M1CC 4G8FB 2PYFB 4FQPA 5LWYL 4JZJB 4GRLB 3CC5B 3O6FA 5J6GA 4CVXA 1GHFL 3RI5K 3KPRE 4JPKL 4J23A 1FSKB 5T1LD 3QFJD 4P23A 3PWPA 4L8CA 4ELKB 1JRHI 3BWAA 3DX7B 4P5MB 5CBAA 2VZTA 4LKCB 4P3CH 5CILL 1AHWB 3QDME 2O5XH 1T20B 4OSUL 3VXMA 1S7WB 5BXFB 4U1LA 3X3GL 5J13C 4OLVL 4YHNB 3B5TA 1M05A 4FQXB 5EU7C 3MLTB 5CP7B 3RIAK 1LO0L 1F4XH 4PGJA 5A2FA 5BRZB 4Z9KB 1NUNB 2YUZA 1TJIH 4NO2A 4ZOAA 1FL5B 4JQXC 3QIBC 5F3HA 4LFHG 2JJSC 5DSCA 1ZVYA 4U6TA 3ISWA 3L3OB 4KKAD 3ZSSA 2DM7A 3PV6A 2IAMD 4XMLL 5JNYA 1A6ZB 2W60A 1DVFD 2MQCA 4MNGE 4WTZG 3PWVB 5FUCE 4UDTA 3ROOB 3V9FA 1R3IL 3QQ9D 5DMGD 2C3GA 2BVUA 2ZG2A 3QJHB 3SKJH 1XIWB 1H0DB 1SHMA 4HHAA 4JQIL 4LLQA 5FKPB 4L29A 1QZ1A 3EHBC 2GSIA 5A16B 1TVBB 4HKZB 3K2UL 4HWBH 1GGBL 4KROC 3DV6A 4J7RA 1Z3GL 3BOVA 3QUYC 2R4SL 1KEGH 1G1CA 1MCKA 1Q94B 5SWZD 1EEZB 1N2RA 4QRRD 3WKNA 5A2KH 3K4AA 4HGKC 3MNZB 3I2CL 3MR9B 1FZKA 1MY7A 1T1YB 5L0QC 1JFQL 3V5KA 1HHIA 4PGCA 3WKMH 5E1AA 1WWCA 3C6SB 4JRYB 4JFQA 4WO4A 5JXEC 1T0NB 1HIML 2NY0D 1MCHA 1TDQA 2ZPKH 3S9DB 1YY8B 3U4AA 3RA7L 5I6XC 5DJCA 2RR3A 5ADOL 4P5TB 4KK6C 2BX5A 2E9WA 3WLBA 2VDLH 2XRAH 5I17A 3I02A 3QO1A 4APQC 1CE1L 1IM9D 2GAZB 2AEPL 1IQWL 1QLRA 4ODWA 4R90L 2OJEB 4ZS7L 5H35A 4YDKH 1QR1A 5DJZA 5HD8D 2HN7B 5GGRB 3QEHA 2DQTH 2ICEB 1DQJA 4RRPA 5T1KB 1RZGA 2B20A 4NZTH 3QISA 1C8PA 1DL7L 2PKDA 1VPOH 4NM4H 4LVHC 1I7RB 3D69A 3X12B 1T7WA 1T3FB 3B2VH 1PDKA 5I1EL 4FXKA 3QDJA 5I16B 1OVZA 4OAWB 1RUPL 3LN4B 4HMCA 4OFYA 4RMQA 2UVFA 1Q9LB 3GRWA 2BXYA 4RMUA 4I77L 4X5XB 1TJGL 4MXVE 1NJ9A 3UZQA 5C0CD 3C8DA 1T0MA 2EYRA 5FHBH 2D7MA 1J1PL 1HDMA 5CP3H 4K2UH 4PJ7A 5JW4M 4TVSa 5GJSH 4YHLL 3C60C 2I60H 2AK4D 1GIGL 1NMCB 4ZPVA 1INDL 2LU4A 5F71A 3TZVC 1BAFL 5JA8B 5IEKB 1F6AA 1QSFB 1ACYL 1GCFA 2CRZA 5E2WH 3S96B 3UBXI 3P0GB 4Y5XB 6CGTA 5JPMB 3MGTB 4GAGH 2XWBB 2Z35A 2ZCLH 3I9GH 3JUYA 2H9GB 5C9KA 3CFCL 1KIPB 2YA1A 4BA8A 4GRWB 1JGUL 5D1XC 2W92A 3ARDA 3GSRB 1EK3A 1E27B 5E70A 4JPWH 2ESVE 2PF6A 4U1HB 3LKQB 4I0PD 2OL3H 3BPCB 2BNUB 2E7CA 3HG1D 4MNQD 4PJ5A 3FAWA 3HPLB 4NNYB 4U1JA 2R56L 2C1OB 4HAFA 4N0YH 2EC9T 3RPIB 1DQDL 4AIZA 3RWJB 4I48B 5I1CH 4BSWA 1S78C 3ARBA 4G8GA 2QQKL 4ZTOL 4N0CD 1TXKA 5GSVA 3U46B 2DBLL 4MAYD 4F7TA 3VFGH 2YA0A 4M61B 3DWTA 1A1MA 4X4XB 1L9NA 1V3MA 3IGAA 2V9RA 1JNHA 4BJLA 2Q87A 1M71B 4WCYH 4HUWA 3TM6A 3BZ4A 1IT9L 1NBQA 3D3VD 1DUYB 1JGLL 5AYQA 4JREC 2EIEA 1A3QA 1ZK9A 5E9DB 1U8PA 4XCEA 1SJEA 1MNUL 4FQJH 1CD0A 1CTNA 3F62A 4L9LB 2GK0A 4P9HC 3RWGB 4NNPH 1RZ7L 1CD1A 1T5WA 1I85C 4W4OC 3W0WA 1C5BL 3OKNB 3W11D 2M1KA 4WUUA 1MJ8H 3BPLB 3L95B 4FZ8H 1I4FB 2W91A 4P57A 4LSSH 1NFDB 3NIFF 1U93A 4WGVB 5FYJH 3VU2A 3TGXA 4F7MA 1JHLH 2C3VA 4M7JH 5DMYA 4OZFA 2M8XA 4JAMA 2IANE 3GMLB 4RAHA 1X3DA 3WHE0 3O6KL 3L3KA 3DUSB 2ZUQB 1X5LA 2R9HC 2AXGA 5GS1A 4ERSL 1OTSD 4RMSA 2QSQA 4UINH 2R2HB 5CD3B 3C09C 4S1QH 1A7PH 3B9DA 1B4JH 4NJ9L 4HUXA 2F74A 4RISL 4PJFF 1XR9B 2O5YH 2I9LA 1S7VB 4LVEA 3M8OL 3MGAA 4PLJC 4Z0BL 4IRJC 2YRZA 3GI9L 4N90D 4XC1L 4RQQB 4RZCA 4ZXBD 4YFDB 3RP1A 2FSEA 4U1MB 1JUFA 5CJBA 3RIFK 1N6UA 1FJ1A 4Z78A 1XGRA 4POZD 3KJ4C 1LHZA 1OCWH 2EIBA 3EYFB 5DJXB 2GKIA 3CXDH 1I3GL 3MRRB 2FO1A 3FFCE 3PP3H 5GS0L 3O2VH 5EULV 1EMTH 1LD9B 2X70B 3THML 4MYWB 4CNIB 3SGEH 2ICCA 3CFJB 1INEL 3TH2T 1LO2H 1AP2B 1ZLSH 3D9AL 4WVRA 2ZG3A 1A4JA 4X0KA 1RMFH 3WE6A 4MJ4A 2Z8VC 3PG2A 1ZT4A 1E4KA 3WLWC 1P6AB 1H5BA 1U41A 1ZHKA 3ARTA 3ZL4H 3PJSB 4QCIA 4F7PB 3HCVB 2WAHA 3M1BA 1CLYL 4M4RA 4Z76B 1YEDB 1FL3B 2XPGA 3DBXB 1ITCA 1F3JA 1UB6A 4L4VB 2F53E 1UXSB 2OMNA 1IAIL 4BUHA 5JOFA 4ORGB 4Y4FD 3P9LA 5FO7B 4XNMA 4Z0XB 5DZLA 2RCSH 2QLVB 2EDNA 2DQIL 2NY6B 3LKNB 4KJWD 3VGDA 4JG1L 1SJXA 2IBBA 2X10A 5ESAB 5C9JA 1WF5A 3OV6A 1J1XL 4LOUC 4P59H 5DS8A 3FB5A 5IOPA 1KACB 1T2QH 1TJHH 5SWQB 1CFVH 4EBQH 4H20L 4OZHB 5CJXA 3GMNB 4F58H 4Z7WF 5DURD 4FQ2H 1AQKH 8CGTA 4WEUD 1VEPA 4JDVA 3WUWA 3WL9B 3GB7B 2DQCL 3DIFB 4XBEH 5GGUA 3KPRA 5L8KB 3BIKA 3SE9L 4UT6H 4AEIH 3P4MA 5GHWH 4BSJA 1DBBL 2IPTH 3S35L 2HTKD 1HWGB 4W68A 4GW1B 1HE7A 1NCAL 1VFOA 2Y06L 5ISZD 1MRFH 3VXOB 2H6PA 3FT2A 1F3RB 3QDMA 1ZA6B 5L2KB 5DI8B 1MLCB 3ZTJG 2XV6B 3QUKA 4E42B 4X7SH 5AUMA 1LO5B 3F5WB 5E5MA 3MUJA 3VG0H 3WDIA 5F3BB 2BY1A 2CR6A 4LVOC 4OD1L 5KG9A 3BZFB 4M7KL 4PJCB 4U3HA 4BFGA 1AY1L 4U33A 3LQAC 1YNTB 4G7YL 4FFZL 1NSNL 4XP9H 3UTZB 3VW3L 4RGMC 4UV4H 3VFSA 4OFQA 5E8OB 4Z8FL 4Q7DA 2WBJA 1F90H 3EOTH 2AJVH 2VN7A 4P23D 3AS2A 1GZPA 1F11B 4MNGA 1ZLUH 4KKAC 3GKZA 3RAJL 3GNMH 4Y2DB 2IAMC 2X4UB 5LVEA 4N8CL 1JK8B 1U8OA 5GRYA 1DVFC 4YHOL 3VGBA 2YZ8A 1FFNB 1TENA 4MZ3A 5EO1B 2VN4A 3VXMD 1HYRC 2E8ZA 3QQ3A 3V6OC 3QQ9C 5DMGC 3N9GL 1JV5A 3DVGA 1GAFH 5IQ9A 5AZ2H 3U36A 1QA9B 2ICES 3T77A 1U95B 4QRSB 4KK8D 3MOBL 1S9YB 2XNAB 4DAGH 1RIUL 3K2MC 4NKMA 1Y18B 2DLIA 2X4NB 4LGRB 4NT6A 4NC1C 1MCDA 4MLIA 4LLUA 2YXMA 3CFDB 3TBTB 5D7KE 4HJGB 4PREA 1BZ7A 3QEUB 4JKKA 3ZDZF 3D2UD 5I74B 4U7SA 2A1WL 1NDMB 5EZJA 2VXSL 43C9B 2P5EE 1A22B 1I7TA 3PWNB 2W38A 1Q9OB 4OLXH 4OM0H 3ARFA 2QHLA 4EXKA 1IGJA 4AIOA 4ZFFB 3KR3L 5EOCL 3WNNA 2NY0C 1D5BB 4ZFOA 2VXVL 1U8JA 1G7HA 3HS0B 3GSOA 1JF1B 3TBYA 1MFAL 4ZFZB 5HYJE 3MMEB 4PRDB 3QRFM 5F9DC 4XP4H 4XCCH 5CFHA 5JMRA 1WAAF 3IF1B 2FBJH 2RQ8A 1FC2D 4U1GC 5KVGH 4OV5B 4KI5E 5D71L 3VFRB 1NC2D 3WV0A 4YHIA 4P9ML 2PTTA 1ZHBB 1G7MB 1T5XA 4JM4L 3TPKA 1C16B 5ICZB 5HD8C 4AZ8A 2DM2A 2VLRB 4OI7A 4TSAL 2QBWA 3NPZB 3CLEL 5HPMA 3DGGA 2FHFA 4M1DH 4W6YB 5DTFA 3TCXA 1HYSD 2X4SB 4D9RE 2Y36H 5B4MD 5D2NB 4Y1AB 4R3SB 1YNLH 2NLJA 3QIWD 3LKSA 4HQQH 1IARB 1AD9A 4F33B 4RX4D 5FOBB 1NBVL 4P46D 4PJBE 3MV9E 4JLRB 5J0BA 3MFFB 4PIRF 5TDNA 5BS0E 4G43B 4HWEL 1NFKA 3FB7B 4M6ML 3FQNA 1OY3B 1O7VA 1PQZB 1U6AL 4MA7H 2WWKO 3VRIA 2RAMA 3NGBB 3ZTNH 1CICA 3QHZH 1MRCH 4DW2L 5M94B 3QDJD 4MQXD 4MA1C 1WZMA 1JRHH 3FQUA 1R3JB 3B43A 3T8XB 4JO3H 1U58A 3WJJC 3VXUB 1QFWI 1AXTH 2LAGB 1AGDA 3O41B 4ODHL 1DBKH 2ZJSL 2ESVA 1OAUL 5IB1A 3FQRB 4PRIB 1RULL 5JOEA 5LBSL 1IGIH 3LB6D 2X6MA 4GBXB 4HULB 4I0PC 5IFHL 3IU4L 5GRXG 1R5WB 3BIAX 5IHUH 2QSTA 5AG8A 3NZHL 5GISL 3IDXH 5F7MC 2IPKB 3ABZA 5GS0D 1AKJD 1ES0A 5L88H 5EBWB 1OGAE 1DN0A 3D25A 1U8MB 3SDXB 4XZUB 3UTTB 4YIQB 1U8NA 4XPHH 4PJEF 2P7TA 1JVKA 3V52L 5GGTH 1WCQA 2FX9H 4Y2OA 4LSUH 3CVIH 4QHUB 5C07E 2OS7A 1KB5H 4N0CC 5HGHA 4F37F 4JFDB 2FJGB 4P4KD 4DKFL 4KMTL 1NCNA 2OP4L 4MAYC 3RHWF 2LAAA 5E08L 1G7QB 2P43B 3Q2CA 3TT1L 3U0TA 4ZFOL 1XGPA 4UIKH 3BKMH 5C0BE 3CMOL 4HJJH 4ETQA 3FCTB 2Z91A 4HKBA 2MWCA 2JB6B 3E6FB 5D7IB 3BH9B 2QQNH 1NCCL 1BQHA 4Z7VE 3CDGB 4OJFL 2WINB 2XYCA 3ARBD 4TUKH 4HIEB 1BFVL 2D7TH 5TJWK 3BD4A 3I3BA 1X5AA 3QG7L 3W11C 1BIHA 3N50A 1FYHB 3MRHB 1PBYA 2GK2A 3C5ZB 1Q72H 4TQEL 3U79A 2VXQL 5L7XL 4NO0A 4WW2B 5EBMA 1S5IL 3BQUB 1NCDL 2IANA 4GRMB 5D5ME 4F9PC 1I1AB 5MEOB 1YPZE 3IKCB 1BEYL 4O4YL 4L3ED 4L8BB 3W39A 5CSGA 5C09E 2UWEB 4P3WA 1OTSC 1WV7T 5EPMB 1ZGLA 1KJMA 3CLFL 1LEGB 4P2RB 3VG9B 4CVWA 4WUUD 5DA4A 1XR8B 3AC0A 3LS5L 2JE8A 3BO8A 3QCVH 4XPAL 3INUH 5KVFH 2V9QA 4M7ZC 4ZXBC 5LKNA 2H8PB 1R5VB 3VFTB 3WJLA 4IS6A 4MXQC 3KAAA 4OI9A 3RHWK 1J8HE 3FFCA 4OF0A 5C92A 4POZC 1MJUL 2Z0BA 1YQ2A 5C70A 4F7EA 2KDGA 1BREA 3MRNA 1FVCA 4MD0A 5HTSA 1BVLA 3QH3A 4D0CA 1UADC 4E41B 5IB4A 3DX8B 1KN4L 3DYOA 4U4BA 4DZ8B 2V7NA 5ID0A 2HH0H 3LKOB 3OAYH 4WWKA 1NAML 3MA7B 4H25B 4Z7NE 4KMQA 3HMXA 2VYRE 1VADA 2EKJA 2CLZA 1XF4A 3ZYIA 1R3LB 2J2ZA 4WHTA 1A9BA 1FO0A 4J3OC 4EDWL 2AGJL 4W6WB 3GSQA 1MOEA 2ITCB 3LN5A 3DUHA 3HNTL 3RVVD 3UC0H 3AREB 3NCYP 2F53A 2X4PA 1A6UH 1WFOA 1VEOA 3MLUH 4NZUH 3OKEA 2FR4B 4ZYKB 2WIIB 3T0XA 4Y4FC 4B41A 1DQLL 1KC5L 3ARSA 4WEMB 1DBMH 3E6HA 4KJWC 3TWCH 3ZE0F 4LHUA 3R4DA 1HH9A 4XXDB 3P30L 1JWMB 3BN3B 4YXLH 2F5AL 5KAQG 5GRJL 4KTEL 1WWWX 3Q3GA 4JDTH 5C6TH 2Z8SA 1T89C 3MTRA 1NGYB 5KN5A 2I27N 4L3CB 4PJGF 1A14L 5KZCB 1UWEL 4JQVA 3MLRH 5IQ7L 1JPSH 2DLFH 1S8DB 1T1ZB 3HE6B 5J06A 3RZCB 2EYTA 5E2TL 3VWKD 2CRMA 2ZNXA 2HTKC 3OKDB 3S37H 3TIEB 1KTLA 4M6NH 5DC9B 4NUGL 2WQRA 4HS6B 4O5LH 3RWIA 5HYQA 3L7EB 3V7AE 3F7PC 3EYOB 1F42A 2JLLA 3JTTA 1BFOB 3IU3A 4JVPA 3TC9A 2P46B 3SCMA 5E6ZA 1FRGL 1CIDA 1DUZB 2EDFA 4GRWH 4PG9B 1LWRA 2R2EB 1L0QA 3KPRD 5FYLE 1MF2H 5K9JH 2MKWA 4LCUA 4RWYL 1JPTH 2A6DA 1NQBA 5J4MA 1K9TA 3BEWB 1YMHB 2EEAA 4P5KA 1RU9H 3QBTB 4ZUTA 4NRYA 4XNXH 4YH6A 4HS3B 3DMMD 1CR9H 4IHOA 4P23C 1UWXK 3UTQB 3S36H 2VISA 1MHCA 3TA3B 4EN3B 2Z8RA 1I1RA 3ZMRA 4NPYB 2AV1A 3MNVA 3L7FA 1XF2A 2OI9C 5I1IH 2E7LA 5J3HD 2V5YA 1PSKH 4ZUVB 2D4DA 3DLQR 4M43H 5C0DA 2QHRH 2ZKHH 1D5IL 1P4BH 4YHKH 2EDOA 4KK8C 5E8DH 3S7GA 2B5IB 1OB1B 2DQJL 4WY7L 1N26A 1MREH 5I1JL 3HMXL 1FYTE 4ODXA 4RDQG 2VZVA 1QSED 2P5EA 5B38G 3KPNB 5JZ7D 2AW2A 3FZUD 3EUUA 3MOQA 2WP3O 3G5XA 2EDBA 1RIHL 5TH2B 4OLUH 2YC1B 2A73B 5F9AC 4PS4H 1XZ0B 3SDYL 3N1GC 3FT4A 5HYJA 1N5AB 4G9DA 1GPOL 3ZTJH 5E2JA 5BV7L 2IG2H 4JO4L 5I2IB 1MWAL 4CBPA 2X9YA 1BJ8A 4K94H 3B6SB 4FQ1H 4PJAE 5I8OL 4M7LT 4PJXB 1RUAL 5TQ0H 3FN9A 3E8UL 1LILA 3EYUL 5K59F 2WOYA 2FIKB 4XC3H 1ULVA 1KULA 4U2YA 1GZQB 4XCNA 1T03H 5J13B 4NCDA 5TQ2L 2BVPA 2VDMH 4GUPA 5CBEB 3VDCA 1K5NA 4QNPE 5D1QA 1LK2A 3I84A 5KTEL 3MODL 3RVUD 3QIBB 4YZFF 3RDTA 1BP3B 5F6HI 1HYSC 4IDJH 1CLOH 3UJJL 5B4MC 2EE6A 5GRVL 3KG5A 3QIWC 4PJBA 3GJFK 3MV9A 5ETUA 2A74A 1QLEL 3TH4T 5BS0A 4LHJB 5C0JB 1SMOA 4M02A 1RJYA 1CXFA 4P46C 4HIJB 3AXLA 1TMCB 1NMBL 2MQ0A 5DJDA 3UTSB 3DX6A 1P1ZB 4JHBA 3RY4A 3LQZB 5T33L 2GY7B 4UNTA 3MRQA 1AO7E 4YXHL 3IS1X 1M7IB 3OKOA 4JPVH 5FCUH 3GKWL 4MQXC 3QZWA 3TN0A 4YX2L 5J6HA 1JNNL 1AH1A 2R1WA 3G6AB 4PRBA 4X98A 1QBLL 5ID1B 3HAEA 1QLFA 3RL2A 1I8KB 4MDIB 1T1WA 1OM3H 3AAZA 5L0QB 3KPLA 1RJLB 5CS7A 1NFDF 3HLAA 3WSQL 2AJZB 2BC4B 3K1KC 1Q0XL 2H41A 3L3IA 5DJAA 1J0ZA 4ISVA 4PJ9A 4JDZB 4ALAL 3GGWB 4LPCA 1U3JA 1LNUA 4U0QB 2VR5A 1CDBA 1NUFA 1OGAA 4QRTA 1T66D 4EOWH 5GS0C 4HZLA 5L8LB 3RNKB 2DMKA 3VCLB 3HZKB 3IFOB 32C2A 5C07A 5CSZB 2DQUH 5C2UB 2OTWB 2PO6D 5C0FB 4JFFE 3MBXH 4APQB 5F1IB 3C5SA 4RA0C 3EDKA 4P4KC 3SE3A 1NEZA 1F3DH 4LRNH 5C0BA 1QBAA 3MNWB 2WUCL 3A67H 3IVKB 3H3KA 4LSDA 4KH2A 3OKMA 3BP5B 4OCYH 4PR5A 5ITBH 3GMQB 3GO1L 2X4QB 4Z7VA 2OMBA 2ZZUT 2HJKA 1GYAA 3OPUA 2WBKA 2CDEA 1KENH 4P3DB 3ARBC 4N1HB 3L3JA 3NFPB 1S9KC 5EDXA 4Y5YA 2XZAL 1KBGL 4M6AA 1RVFH 1SBSL 3QUMA 3QDHA 4OT1H 2XTLA 5EOQL 4Z7OF 3FQXB 3BXNB 3HI6L 5D5MA 3VA6A 1YPZA 2Q86B 4PP2A 4ONOA 3L1OH 4MCYB 5C09A 3WFCH 4DVRH 2M2DA 3DUUB 2AXJA 4P2CG 3C60B 3DNKA 5IK3B 2APFA 4F7CA 3C8KB 2A9ML 2BJML 3CUPB 2Z93A 4UT7L 5C6PB 3FQTA 4ACPA 5JA9A 3H9SB 4ZDHA 1ZLVK 5DLMH 1FE8H 3D85B 3LHPH 2EIZB 3WD5L 4YBQD 4GKSA 4PV9B 1XCTB 4FTVE 4QLRA 3C8HA 4OCLC 5GIRB 4X6CB 2DTML 3DI2B 5D1XB 1JN6A 2Q8BL 5H94B 4HFWA 1TVDA 1J8HA 2R23A 3NA9L 4Y4KD 4OF6A 1UWGH 1VFBA 4YHPB 3BH8B 2VDRH 5DT1H 3REVA 4DN3H 4OZHF 1ORSA 4FQQA 2CDGB 3QAZB 5FK9A 4HXBL 4U1IA 1MVFA 2LFGA 5AEAA 1YECL 5GS1C 5MEND 1KT2B 5BVPL 4XH2B 4N0FB 3MXWH 2PTVA 5DUBA 4M3KB 2GHWB 3CSYB 3WXVL 1KJ3H 3IXTB 2IH1A 3EYSH 4JKPL 5MEQA 1FIGL 2DKSA 5FHAH 2YSSB 5EU3A 1S7TA 1RHHB 3LSOB 3CSGA 2BFVL 2DLEA 1A9EA 4FG6D 5M95B 1YEHH 1Z5LB 2BCKA 3FFCD 4KZDH 1P2CB 4XNZC 4O2EA 2W0LA 5DFTA 2AEIT 3RVVC 1P5VA 4JG0H 3BDYH 3MUGB 2JTDA 4JREB 5FYJU 4PRPE 4I0CC 3C6LA 5E8EB 2G75B 2GFBA 4WWKD 2FECI 2OBGA 3BVNB 1UC6A 3RWCB 1RK1A 4OCWH 4UUJB 1E4KC 1OOAA 4XCFH 3HR5A 4PRAB 4JN2B 1QFUH 1H5BC 2QADD 3VFWA 5HHOB 2OXGA 1KTDB 4OF7A 2UZIH 1Z9LA 3VD9A 1ZTXL 3ZE1F 5C6WH 3D0VB 2LTQC 12E8H 3GHEH 4KUZL 1A2YB 1SEQH 1G0XA 2Q76B 3CDCA 4GG6E 1SYVB 5F96L 2YN5A 1UB5B 2BMKB 2W0FB 3C09B 3MREA 3QUML 4RAVB 1HHKA 3VWKC 5LAXB 3DXAB 5JO5A 2VR4A 4IRJB 3MOAL 4LU5L 1HOCB 3P11H 1D9KB 2AJXH 4XBPB 2J6EL 3BI9X 3KLSA 4XMKL 5FUOL 1CBVH 1PGRB 2FJHB 3OX8A 4L4TB 5CCKH 4N9OB 5CJXC 3KJ6L 1P7QB 4E5XA 3V4PH 4X4YB 3UAJD 4JY5L 3GUTB 1RFDH 3U7AA 1CDUA 3FO1A 4LCCA 4X5LA 3LVEA 2EDTA 2GT9B 2RGSA 4OLZH 4PB0H 2VQUA 4ZFGL 4ODUB 5KVEL 4KHTH 3DMMC 3EOYG 2CQVA 2IQAB 1HN1A 1U8IA 2CIIA 5TDOB 1U8QA 2IFFH 3B83A 3UYOD 3H7BA 4J3VA 5J11C 35C8L 3MA9L 4GAFB 4Q9QH 3SCMD 1CD9B 3VMNA 3GJFB 5J3HC 2G60L 3P4LA 1D6EA 4OZIA 1MLBB 2WQSA 1LO3H 3VFOA 3MRBB 4KVNL 5K9QI 5KSUB 3WNKA 3G6DL 1MJ7H 4NSKA 5DK0A 3C2AH 4O9HH 1YDPB 1F4YL 1JYXA 2Q6WB 4ELMB 5FYKH 1FYTA 4LMQE 1CL7L 2GIYA 1D5ZA 5FUCC 1ND0A 4LCWB 2BVQB 5HDQH 4D94A 2MPAL 1EEUA 4MD5A 4NRXB 5JZ7C 2ZCKL 3D18B 4TSBL 3FZUC 5EO0A 1FVDA 3QXWA 3F6IA 3TF7C 3ZYOA 4OI8A 1IC7H 2W9DH 5FUZL 4JO2H 4BZ2L 1W8NA 4LQFH 3S34L 5IWLA 4I4WB 2VDNL 4JM2A 3KYKH 5D7KD 2Z31A 2V5RA 1RZIB 3KPQB 2G5RA 1KN2H 4KDWA 4FZEL 5T1LB 3QFJB 2DDQH 4PJAA 1GJIA 3UJIL 3NIFE 5IJKC 3EGSB 2N56A 1YEFL 2D4FA 4NQTA 4BYHA 2AEWA 2NY5L 4B0MM 3LPFA 4M93C 1FC1A 3JV6A 4PGBA 3WIIH 4AM0B 3CCHA 5I15H 5I19L 4JFPB 3RY5A 2V2WB 4JFZH 4EI6B 4LVOB 4Q9CA 2DJ4A 3V4UH 3IKKA 3MLXL 1BM3H 1CE6A 3N1MC 4CRPA 1A5FH 4Q2ZA 1EH9A 4H5SA 4PJFE 2AV7A 5F9WB 4L5FH 2YD2A 4GQ9H 2CJUH 4RGMB 4D0BA 1DCLA 2AK1L 3PNWB 4QHMA 3ZYJA 3RVUC 4PG2A 4XB8A 1E4XH 1JGEA 3O6LH 2FX8H 3LEVL 2Y9RT 4ZO8A 4M5ZL 1XGQA 1IGCL 3IDNB 4MA3A 4WV1C 2AKRB 2IAMB 3B9VA 5MI0C 4POYA 4NM8L 5HHVH 3GMPA 1DVFB 5FYLL 4RGNB 4M8VA 4OIBA 3BSZL 3LEYL 1PJ9A 5DYOB 2OZ4A 3L3HA 3TJEH 1S7SB 1IAKB 15C8L 4R2GD 1QSZA 4WJ5A 3T0WA 5EU6E 2VXTH 4HGMA 3NCJL 3NVQA 2AXHA 5D1QD 3PWJB 3B9EA 5LQBL 1DFBH 4PLOB 1AO7A 1YEKH 4L3AA 3ZT6A 5JXAL 3ESVF 2NR6D 2FNBA 5EZIL 3RDTD 1HQRB 3SDCA 5I76A 1A1OB 2D2OA 4LP4A 5T5FH 3WXWL 3MRGB 4GSDH 5F21B 3LS4H 1QKZH 1MAMH 2ZSWB 4G9FD 3M17A 3MV9D 5ITFB 4D0DA 5BS0D 5SWZB 4QRRB 1BECA 4LFHD 3QDAA 1IC5H 4LLVA 2DLHA 2P8PB 2APBA 4WUKL 2J8UE 3Q5OA 4JO1L 5DDHB 5IJVB 2JJVA 5C3TA 5AAMA 2HTLD 3QNXB 4R26H 1D7FA 3BKCL 2JB5H 3H3BC 1HILA 1WSST 3OG6B 1I8MA 4FQCL 3C08L 1ZE3C 2Z92B 1A3LH 1T66C 3PXHA 5E4IA 1K3ZA 5FYJE 3TN0D 1AIFA 4JFFA 5KANI 2GYSA 3EFDH 1X5KA 1HKFA 1MHHA 2PO6C 4NC0B 4U1GB 3V5DA 5HXMA 1IM9B 3O9WA 1IGML 4NQEA 4U3CA 1MAJA 5IMOB 4X6EB 2NMSA 2R0ZH 1OGAD 3UX9B 1JMXA 5TF0A 3WNLA 1XGUA 2FL5A 1MHPH 5H37G 2ADJA 4ZTPL 3CFEA 1OAKH 5C07D 1PEWA 2CLRA 4EIZC 1LVEA 3WDHA 1MIEH 3VFPB 5CGTA 1CFNB 1JPFB 4QXUH 2OQJB 3HZVB 1I7ZA 1CF8H 3GBMH 1AGBA 3T0EE 4X7TB 2C1PB 5C0BD 4OIIL 3BW9A 4F57L 2GITB 4DZBB 3R06A 1MRDH 2HYMA 1JWUA 2VAAA 3H6JA 4PP1D 4QXTA 4ONGH 3RTQD 5T3XH 2OTUA 4NFDA 3ULUF 2J4WH 4MD4A 4WW1A 3MROB 4FQHA 3GSVB 2BOBB 1XGYH 4JRXB 4CDHA 5AD0B 2OSLA 1LP9B 5SWSD 5CGYD 2DWEA 4FTVA 4YBQC 4XNQA 1WQVT 2G9HB 3BDBA 1CFSB 2OZ4L 3KPOA 1KXQE 4ZS6D 4IRZH 3ETBF 3REWB 3TH3T 2R0KL 2B0SL 2B1AH 5JIPA 1MCEA 1RUKH 3V6FB 4Y4KC 5GGVH 5C09D 5KVMC 4KDVA 4G5ZH 4DK3A 4A6YL 3X3FL 2UYLB 3JWNC 4I0PB 2VDKL 3HG1B 4MNQB 4YPGA 5DHVA 4U1NB 1V8HA 4DN4H 3EFFB 3ZDZE 2LABA 3OL2A 4HS8L 2LU7A 3PXJA 1I7UA 1MCWM 4TNWK 4OCXL 4K3HA 5IMKA 4MXWL 3AU1B 2E6PA 3CPLA 4XPGH 4F8QA 4LSPL 4PJ7F 2IADA 3QDGE 4UNUA 1P7KB 2BNRE 2HRPL 2NY7L 3WJLC 3KS0J 5C8JA 3SKNB 3GMMB 4MAYB 5EZOL 3V0VA 4AL8H 3GIZH 2LQRA 4FG6C 5F9JB 5DMJB 2QSCL 4OBRA 1YNKL 3QUZA 3RUGB 4PRPA 1Q1JL 4M6OH 1H3GA 3D3VB 3V5HB 1X5FA 4LIQH 5I1LA 2C4XA 4K3DH 2HWZL 1WAAE 3FB8B 5F88A 4WWKC 1CFTA 2ZCHH 1FAIH 3MXVL 3QIUA 4G7VL 2DM4A 1QEWB 2H32B 5FGBC 2JJWA 1LEKB 2V7HA 1HK6A 3Q5TA 4D9LH 2VQ1B 5D9SA 2QADC 3VXSE 3VWJB 1R5IA 4JZOB 1A4KA 2CR3A 3FMGH 2A38A 1AGCA 1WBYA 1ZEAL 3EBAA 4NO5B 4PUBH 1TZIA 3ARWA 1MFCH 4GG6A 3QPXL 2P8LB 1UM4H 1PYWB 4RNRA 5A3ID 5KJRH 3OXRB 3S97C 3GMRB 1YEGH 5F70A 1S7RA 2JK5A 4I3RH 3LIZH 4QOKE 5CUSL 4CMMA 3WN5B 3D5OF 4BZ1L 1F00I 1KGCD 4XVTH 1DQMH 5BV7C 4CVUA 4M00A 1EHLH 5EC1A 1JGDB 4EDXA 4HWBA 1D5XB 1GSMA 5TGBB 2YMXH 4MWFA 5T1DL 5AZEL 2BDNH 4M7ZB 1ONQA 5I66B 3RWEA 2I07A 4K07A 3NOIA 4I5BA 4PJHE 4JPIB 3JV5A 3UAJC 3LMJH 3NH7H 3VXQB 1WK0A 4PTTA 3HMWL 4JN1H 3QXAA 4JQVC 2HFGH 4Z6AT 4Y7MA 1CCZA 2AEQH 3RY6A 3G5ZA 1RAMA 2BHZA 2HFEB 2A6IA 3F7VB 2FB4L 2QEJA 1EHAA 1FG2A 4UIMA 3TIDA 5D7SH 3JBG7 5IVOA 3CZFB 4XP1L 3F7YA 1X6NA 3LPGA 1BFSA 2B7DT 2FO4A 5FYLD 1D5MA 4OCRH 2G2RA 3PGFH 2AQ2A 3SCMC 3P4OA 5HVWA 3RWHB 3TVMB 1J1OL 2WLZA 3PABA 5T5NF 4P2YA 2ID5A 4H1LA 1K4CB 4ZO6A 1S7UB 4DVBA 1U3ZA 1FDLL 2FGWL 4Y4FB 4IJ3C 5C0EA 3MJGX 3AS3A 4IRSA 2XIDA 1E6JL 2D7OA 4AG4H 3QHFH 3UJTH 3TNMA 2E7LC 2X5PA 1QG3A 3TYGL 1G0DA 4Z7UB 1IL1B 2PNDA 1F8TL 4N9GA 4LCIH 1JZ7A 3IDMA 5DURB 1OQXA 4E9LA 5I9QC 2O93L 5K93A 1YEIL 1KTKE 1LE5A 1W72B 4YNYB 1KCUH 4V2CB 3BRDA 1FYTD 2ZOKB 3WO3B 4CMHB 3GK8H 3D39E 5CP3A 4P4RB 3FQWA 1JWSB 1ADQA 3RX5A 1XCQA 4ZMAT 1OSPL 5DMKB 3LKPB 3QCTH 5DD1L 4UMGA 2IH3B 5ISZB 1I9IH 2MSPA 1CYGA 1MCFA 2DQEL 5GGSA 1KG0B 4Q6IA 1B6DA 4JM2D 5D93C 5J1TC 1FGNL 4PJFA 1VFAB 4DFHA 2Z31D 5ANMB 4CVXB 2DI9A 2OL3A 2YR3A 5FEBA 2D03L 4OCNC 4LQ1A 5E99L 3VE0A 4P23B 3LV3A 3QQ4B 2CDFB 1WZKA 3BD5A 3NIDE 1OD9A 1TVHB 5CBAB 4C55A 1WWBX 5E4EC 4MSWB 1OSZA 3LPWA 2OI9B 1OP3K 5EU6A 5EB9A 2VDPH 1YN6A 1R3HB 5D72L 4R2GC 1KELL 3UDWA 3DSFL 3GSWA 4AQ1B 5D1QC 1SQ2N 1INQB 1T4KA 4WEBL 4NO2B 2NR6C 1KLGB 3RDTC 1I1YA 1RUQH 5IHBA 3IJHB 3SDDA 4XVSH 3PV6B 1VSCA 4KJQD 5JNYB 1WC7B 5DRXA 1WUNT 3SPVA 1BJ1H 1N3NA 2W60B 1ERNA 1JTOA 3OJDB 2YPKA 3MCKA 1QFHA 4MX7B 1AXSB 2J8UA 3D2UB 4P9HH 8FABA 1KB9J 3QNZB 1IZKA 5L6YL 1AR1D 4XAKD 1K6QH 3FOMA 4K8RH 4L8DB 4NKIL 5BRZE 1KPVA 3RU8L 2HTLC 2UVEA 4LLQB 4UQ3A 3W2DH 1B0RA 2O5ZL 2OM5A 1PEZA 3FTGB 3U1SH 5D6DA 1QNZL 4P48A 3SDCD 3EW3B 5KOVC 4JFHD 3ZE0E 2N1KA 3TN0C 3DV6B 1TZHB 4QT5B 2A6JB 4NRZB 2YWZA 5IVZB 4WDIA 4GKNB 4HIIA 3JTSB 4TTDD 1XH3A 4HX1A 3DYPA 2XN9D 1M4KA 3VD7A 4MQ7A 4X6DF 1FZKB 1HI6A 3ZE2E 4XBGA 1KLFA 5IROA 5E1AB 5IR1A 1NC2B 3HNVH 1IZJA 1N64H 3WFHA 2J7LA 4JFQB 4R7DA 3S36X 5ADPL 1XGTB 2IWGA 5ESQB 3CFKA 2X4TB 1J5OL 5L9DL 5CGMA 2RFXA 3MRKA 5HY9A 1ADQL 2A0LD 5A1AA 1R0AH 5BMFH 3HC3H 3MLYL 4Q0XH 1RQ5A 1IEHA 1DE4A 5DQJA 3AFLA 5DC0A 1JZ5A 5TDPB 2YXFA 4BK5A 3QO1B 3C9NA 4JRYE 3T0EA 2Y1VA 3QIWB 4E0RB 1NBYA 2J88L 1EX0A 3O9WD 4XB7A 1CDGA 3SE3C 3T1FA 4NQED 4P46B 2VL5A 5I18L 1HSAB 4WFFD 4PP1C 5LXGL 1KSRA 3RTQC 1A1NB 4AH2A 3GJFH 3IFLH 4ETYA 3VXNA 5JDSA 4X6FA 4P2QD 5IVNA 2ARJB 3S3PA 4K7PH 4R9HA 2XZQH 5CGYC 2ZSVA 3IDIA 2OX5A 4NCC2 5I1CL 2J12B 3FN3A 1GC1L 4Y5YC 1C12A 2VRAA 4U6HA 4ZS6C 1NGPH 4D8PA 1TZGL 3WHXA 5IVXF 1OF2B 2QSVA 1JZ2A 2Q7YB 2EYRB 3OZ9H 2C26A 1H9VA 4NO3A 5D1ZD 4OUUB 3FO2A 4QRUB 2EDWA 3U30B 1AXIB 1ZA3A 4NNXA 1JJUA 1AJ7H 1SY6H 2DICA 2KPNA 3P0VH 4ZPVB 5B21A 5D70L 2VMFA 3S98A 3VD4A 4HUVA 1AKJB 4MAUH 3I6KA 1R24A 3K8MA 4XRCA 3O3BA 3MACH 3UYRH 2VXUH 1BX2A 3QDGA 3PWLA 4IIQB 3CH8A 2VZ1A 2BNRA 1EZVX 3BD3A 4G8EB 3WIHA 1C7SA 4LLMA 4FZ8L 2AI0H 4P4KB 2DIBA 1IQDA 1QBML 3CSBA 3CU7A 3X14A 2P1YA 5CLTA 2ICWJ 4HCRL 2D7QA 4D3CL 3IETB 3MV11 4QY8A 1QSFE 2CIKA 4HBCH 4TOYH 4Y8AA 3OGCA 4K3JH 4CW1B 1Y6NR 3PP4L 5E0QA 4DOHB 1WAAA 3PHQB 1JF6A 3UXFA 1F2QA 1QO3B 1MY5A 1YZZA 5HJ3A 1Y0LA 3KHQA 3MLWH 1JHKH 4GRWE 4NZRH 1NMAH 4S1QL 3LQAH 3ARBB 2R0LL 4LDOB 1IC4H 3CDFA 4PD4J 1MFEH 4I2XB 4DGYH 2AERT 1KJ2B 3VXSA 3ZT7A 1UA6H 1M7DA 3ZDXF 3IGAB 5CKGA 3QUZD 4AMKH 1UVQB 5JQ6H 3PL6A 4PRPD 2LU3A 2R0WH 2A9NL 4HUWB 3FONA 1U8KA 2X89D 3MLZH 5A3IC 2RB8A 5DMIL 2QQLH 1H3XA 1UJTA 2A6KA 4KQ3L 4QOKA 4WU5A 3C6LC 4OLWL 4L3EB 1UACL 5HHXL 4NOFA 4NQCB 1J10A 2BHUA 2E9IA 1CD1B 3IXAA 4QHLB 1V3JA 3W9EB 4R8WH 4FA8A 4WUUB 4WNQA 1W0WB 4P57B 4X8JA 4PJHA 3MRLB 4OUOA 1QVOA 2NY5C 3MRPB 1ZLVH 3SQOH 4F7MB 1DEDA 1WJ3A 4XHJD 1JPGB 5E9DE 1NDGA 5F7EH 2N4IA 1TIUA 3TV3H 2XY2A 4Q9RL 5IG7B 4LSRH 3L3KB 2AXGB 2CD0A 4XPBH 3O2DH 3TPUB 3VDAA 2SEBA 2J8HA 3MO1B 2F74B 3TO4A 3DECA 4JB9H 2W9EH 1UYWL 1NFDE 1RUMH 2X4OB 4RZCB 2FSEB 3W5NA 1ETZB 4K7FB 4Y4HA 3VFMA 2EH8H 3W5MA 4U1SA 3S5LA 1T2QL 2BHYA 4JZNA 1ZVSA 4JKLA 3H0TA 4FS0A 4WI8A 4LAQL 4LCCC 1B9ZA 2ZOLA 4V1DB 4JJ5A 1A6WH 4XPTH 1MFDL 5CJ8A 4YHZH 2WUBH 3BJ91 2IQ9L 3MCLH 1VFMA 4XGZA 3WIHL 3QCUL 1A4JB 4X0KB 2KZ1B 5F8QC 3V95A 4LEOA 1C5DA 4HFUL 3RL1B 4YQXH 1WTLA 1H5BB 3DX9A 3MJ8A 3I6LE 4R4FH 5CMAA 3SOBL 2CXGA 4HF5L 5C0ND 4KVCH 2P49B 3PIQA 1N5YH 3LKRA 2ZUSA 5C3LD 2XPGB 1DQQB 3BZEB 3D39A 3ECBB 3ROLA 4U6VH 4AT6B 2I9TB 3L3DB 5JOFB 5DZNA 3EOTL 4IRSD 1G7LA 4QXWA 1OPGH 3HE7D 3TCLA 1C1EH 1K3IA 4Z7OE 1NGQL 3TBSA 1CI5A 3VWKB 5JW5A 2VWEC 4PTUB 3ILPB 2DQHL 3BP6A 5IKCB 4S2SB 3FB5B 3UO1H 1CU4H 2ADIB 3UTOA 1WBZA 5FO9A 3K81A 1PAMA 3EO9H 5IM7B 5T1MA 1OTUD 5DRWA 5EA0L 5IWLC 4L4VE 2R69L 4JDVB 4JM2C 5GGUB 3KPRB 3VGFA 3BIBX 2Z31C 4GXUN 5J12C 4OKDA 3CVHB 4XNUH 5DJYA 1E4JA 5E6YA 5HPOA 1F58L 1JZ4A 3DMMB 2FX7L 3IFNH 5I8EA 1JTTA 3SKOA 1E4WL 2J8OA 4MCZB 4JANA 4G8FA 4KQ4H 4OZHE 4U1KB 4NJAH 2J3SA 4JZJA 4GRLA 3CC5A 4OZFG 3QUKB 5J11B 2O61B 4NWUH 5MERB 1ZS8B 5FM5O 5E5MB 5I1HH 1OL0A 5DUPL 2HLFD 4ELKA 1EJOH 3VFSB 1X5ZA 3DX7A 3EOAB 4P5MA 5HHMD 1X9QA 4PG2C 5F6IC 4IGBB 1FGVL 3CX2A 1AHWA 5L2KE 1Y6KR 5BXFA 4KRPD 4LSVH 4KJQC 4XWOD 2F15A 2YD1A 5EIIB 1H3PL 4FQXA 1QSEB 3S3SA 4G6FD 3SO3B 5EU6D 3T2NH 5BRZA 4JEGB 2OJZH 3WCYA 1A7OH 1GOGA 4PJCE 1FH5H 2NXZD 2IBGA 4OCSL 2H32H 1FL5A 1AR1C 1AFVL 3VJ6B 5CJ5A 3DVGB 3L3OA 2JKXA 3EDFA 1A6ZA 4LLDA 2BNQD 3NTCL 1FQ9C 4NIKB 1PFCA 3SDCC 1K8DA 4FNLH 4HUUB 1JYVA 4X9GA 2GTZB 3U0WL 1NLBL 4D2NA 4EIGB 1BZ7B 2MMXA 4GMSL 2YPLE 1TQBC 4CVZB 3LRHA 5LWYH 4TTDC 3DURA 5FKPA 5EZJB 3M45A 1GHFH 1OAZL 3EJYD 4JPKH 3P9WB 3DO7A 3KYAA 4HKZA 2HJLB 3STBA 3WUZA 4M48L 5FYJD 1Q94A 1HXMA 3NABH 1EEZA 3DOSA 1C08A 4S10A 1G7JB 3GSOB 3MNZA 5CILH 3MR9A 1HZHL 3RVXD 4OSUH 1H8NA 3X3GH 4OLVH 3RKPA 1MUJB 3C6SA 2VH5L 3MUHL 4JRYA 1JRHL 2V5TA 2AQ1A