1NC2B

Crystal structure of monoclonal antibody 2d12.5 fab complexed with y-dota
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
EVKLQESGPGLVQPSQSLSITCTVSGFSLTDYGVHWVRQSPGKGLEWLGVIWSGGGTAYTAAFISRLNIYKDNSKNQVFFEMNSLQANDTAMYYCARRGSYPYNYFDVWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MONOCLONAL ANTIBODY 2D12.5, LAMBDA LIGHT CHAIN
publication title Crystal structures of two complexes of the rare-earth-DOTA-binding antibody 2D12.5: ligand generality from a chiral system.
pubmed doi rcsb
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2002-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nc2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nc2B01
4PJIB 1GYAA 5J6HB 2HJLB 2L4OA 1F4WH 3MLWL 2Y7QA 3BKCL 1FNSH 4Q7DA 1EIBA 2BVQA 2ED9A 2N56A 5F9WC 4I77L 5HI5C 1A21A 1CDCA 2X89D 2ICWB 5TQ0H 5KG9A 4G8GD 5IR1A 3LV3B 3S4SG 4U1KB 4NRZA 1FDLL 4JPWL 3O9WD 3K0WA 4JM2C 5DEGB 1OAKL 3ZDZF 1PW3A 2HJKA 3RL2B 1N7MH 4P0DA 3TZVD 5FDYA 4YAQA 5J1AB 1FFQA 1PKQE 5TH2B 3D2UD 5C71A 1CFNA 1CD1A 2BNRB 1BJ1J 4HWBL 5BOPA 3DMMA 1QFUL 4K9EC 1MJ8L 4OFKA 2QADC 4L9LA 4NO2B 1J05B 1ZS8A 4GW5A 3VXTA 1S5HB 3MNWB 3AY4A 5K33A 4XXDA 2D7PA 1V7NL 1KCKA 3IDNB 1N6VA 1PKQA 1WISA 2MNUA 2XTJD 3T04D 3VXNB 4PS4H 5D5MF 5CIPH 35C8L 3RDTB 3O9WC 1J0KA 3MJGX 1KT2B 3LEXB 5DQJB 1Y6KR 4OCXH 4K8RH 3EYFA 4QXUH 5CEXA 2FRGP 4CKVX 1BZ7B 3U9PL 1A6ZB 1N64L 3KLAA 3RWGB 4F7MB 1QBAA 4ONOA 1LNUA 1YEDB 2H8PB 1R6VA 3DPBA 2Q6WA 3WHXA 3EKCA 5I1JL 3LQZB 4RGOH 2E9WA 3O2VH 5FKPA 1LO5B 4HIIB 2A6DA 2GY5A 3C09C 3O6FC 4X6EA 1LGVA 1WWAX 4OCWH 3ZTNL 3LN9A 2FB4H 1T21B 1CICC 1U58B 2F58L 5C9JB 4C56E 5MENE 1FRGL 3LQAL 4L1HA 2R8SL 3I9GH 3NOIA 4XC3H 3J7HA 1DFBL 3H9ZA 3UC0L 3WNKA 3IU4L 4XP6H 3RWCA 3CZJA 2AP2A 1OWWA 4M7LH 2CH8A 4ODSL 4PJCB 5ADOH 5CKAA 1YMMD 1Z9OA 2CJUL 4C56A 3BKJL 3DXAB 5MENA 1F4YH 3EGSA 3P11L 2Q8BL 4MA7H 1CVRA 4S1RL 3T1WA 3TBYA 1I4FA 3WFZA 2NY2D 1T2QL 3FB7A 4GRWB 4OGYL 3HI6L 5F7EH 1J8HE 3VGBA 3TA3C 1QOKA 3VRJB 4NZUL 2UWEF 1QD0A 3QCVL 1FN4B 2IPKB 5DJZA 4H8WH 5CEYA 3OR7A 1ZT1A 3VI3F 2XWTB 4U6HB 1KB5A 4G6FD 5D1XB 1F6LL 3QDGA 1CQKA 5DD5H 2DMCA 1MRDL 3HE6C 3E6FB 4IMKC 2CLZB 4H0IA 4JQXC 4X7SL 5IHZA 4TVPL 2NY2C 3PP4L 2X1PA 3INUL 1MFEL 2BSRB 3FCTA 2YD1A 3SE4C 1KXQE 1UWXK 3F8UB 4QXTA 2PXYD 1N0XL 3SE8H 1GPOL 5D96C 2VR5A 1WVZA 1JTOA 4OM0H 4PP1D 5D2LB 1U0QA 2XT1B 3LN4A 4HMDA 3TYFB 3GMOB 4M7JH 5JXED 1T1ZB 1C8PA 3KPNB 3S36L 1PZUB 3E1F1 5DGRA 1VFMA 1KULA 2DQCH 1ORQB 2EYRA 1EJOL 1GJIA 2JB6B 2JJTC 5F21B 1UJ3A 4WGWB 3C60C 1KJ2A 3W0WE 3PWPB 4LCYA 5C8JA 2W07A 4GUPA 3IF1B 1R3LB 4PB0H 2PXYC 1E4WH 5ILTL 4MA1C 4EN3B 1XR8A 5FO9B 4PP1C 1DBKL 3KJ4B 1B0WA 4LCWD 4JKPL 4Z0XB 4I3SL 4MJ2A 1RURL 2NXYB 4X7TA 3VU2A 1G9NC 5LAXA 4ZFOA 4AENA 4GG6E 4LQFH 4UDTB 5TFSH 3HNVL 4LVHC 3H2WA 2W0PA 3K1KC 1S9WB 4WWKB 2R2BA 3C6LD 3G6AA 5E00B 1JGUL 1MCKA 4JB9H 1S78C 3FQNB 2CMRH 2YRLA 1X9QA 3UBXG 2OJEA 1QBLL 4M7KH 2D7OA 1NJ9B 4XHQA 3K3QA 4RMTA 2WP3O 4Y4HC 5KW9L 2ZUWA 1AP2B 1SJEA 5KVFL 5CUSH 3NVQA 4QTHB 4JFQA 4WU7B 1YPZA 4G3YH 2EXWC 5E4EC 3GSUB 3S7GA 4J1UB 5EOQL 1LP9B 1NLBL 3HI5H 1TFHA 4JFFA 3T4AA 4HIXH 3HRPA 3HI1B 4WI2A 5ELIA 3S88L 2ARWA 4HLZH 1EUUA 1KIRB 4MXQD 2AW2A 5CSGA 3B3IB 1BQUA 1NC2D 3L9RB 4KFZC 4XWGL 5I0DA 3ULSB 3V79C 1ZHLA 5E03A 3GK8H 1EO5A 1VKXA 4KKBD 2W59A 4CMMB 1ERNA 3RKPA 4L3EA 4CW1B 1RZ7L 2JCCF 4Y4KA 5F7LB 5EN2A 3OKKB 3QQ9D 5GGRB 3DRQA 1QFPA 1LK3L 4N8VA 3WE6A 4PLNC 3TP4A 3KPRB 4HWEL 1YY8B 1G1YA 2VDKH 3RVUC 4KV5F 3VFTA 5FA4A 3ZYZA 5DUMH 3AFLA 4WFED 1U92B 1C08A 3BQUD 3DBXA 3ZLQC 5CZVL 2AABL 1GSMA 4B0MM 4MXQC 4RIRB 1YEEH 4ZAKB 3SDDA 2AJUH 3QI9A 4WENB 5D7LD 4KZEH 2DQGL 1YY9C 2FH8A 1SY6A 2W9EL 4PJ8A 2KZWA 1IGIL 1ADQA 2CDGA 3X3GL 2QQLL 3I6KB 1RUAL 3OXSA 1H8NA 4ZOBA 3MUGB 3BAEL 5E2VH 5SWZD 5IFJB 2GK2A 3WKMH 3MGOB 3QCTL 1B3JA 1LDPL 3CVIL 2WAHA 2H2SC 4OQTH 1N59A 1AY1L 5IMKA 3VFPA 1D7FA 4FQLH 4NQVB 4I0KA 4LSVL 2DWEB 1IAKA 3QEGH 3V4PH 2AI0L 5SWQB 2JK5A 1X5LA 3FQUB 5MEQB 3E2HC 4Y19E 1T5XA 1MFBH 4CN4A 5BVPL 5GS0H 3RI5F 2F5BL 3MJ7B 4N8CH 5GJTL 1BAFH 4PV8B 3IDGA 4EXKA 5ETUB 1RZJC 4YHYC 3F65A 2WMPA 1DVFC 2YEZA 4NRYA 1V7ML 4LPXA 1JNHB 2YPVL 3RIAF 2YOCA 4OGXH 2IGFH 3LPFA 4ZYKB 3T4YA 5FOBA 5IHBA 2PO6D 2F53D 4PR5A 3QH3A 4Y19A 2CRIA 3RVXD 4Z7WB 4XCEA 4AIZB 1RPQA 3IDXL 3MODH 3NZHH 4F2MB 1CFTA 4MQXC 5JMRA 4PLKD 2JTDA 2HVKB 4P3CL 2V6HA 3CX2A 4P2RB 1BVKA 2ESVD 2VZTA 1P4IH 1T0MA 3OG6B 3OQ3B 4K07A 4OM1L 4ZUSA 4FFWC 4JDZB 1KB9K 3IT8D 4F7CB 1I1FB 3EOBB 3DUSA 1OSZB 3CSYA 5C0JB 1MF2H 4MD4B 5EIVA 3IVKB 2X4UB 3UJJL 4JO3H 1AO7B 1W0WA 1INEH 4LLUA 5D7SL 4O4YH 4YEFA 3TPKA 1EEZA 2O61A 4HK0B 5HYIA 3RVXC 4QCIB 3OMZA 4TSCH 1XH3A 3WFDH 4HX1A 5CJ8A 2E5EA 5ABDE 1N4XH 5IEHB 2OXGA 2EO1A 1DLHA 1KELL 3IAPA 5EUOE 5F3BB 1MLCB 1QO3A 1UACH 1T4KB 1IKFL 1T1YB 5EWIH 1N6QH 5CJBA 2O5YL 4PTTB 4XVJL 5CWSB 2BOCA 3MRJA 3GNML 5ENWA 4Y5YA 1MHHA 5I8OH 4QNPE 3Q5TA 2G5RA 2HFGL 2A77H 3H3PH 1AR1C 4R26L 1A7RH 1Z0MA 4MVBC 3EO0B 3PWNB 3LS4H 5B4MD 4JREC 4Y0GA 3NFNA 2L7UA 1JUFA 2EE9A 3CMGA 1AGEB 3HMWL 1U6AH 3HPLA 1JNNL 1F5WA 3RWHA 1NKOA 2JE8A 4PJHB 4YBHA 1NDMB 3PHOA 4V1DB 1R3JA 4MD0A 4OD1H 1T03H 5GRUH 5JORB 4D8PB 3RA7H 4OFIA 3P9MB 3DMMD 3VXMA 3CFKB 2FBJL 3NIDF 3F7YA 4QOKE 4GBXB 3DJ9A 1FH5H 4X5WA 5EZOH 5B4MC 2O5XL 3OAUL 3L3HB 1IC7H 3HRZA 4LLWA 2VC2H 1F6FB 3AS3A 1BJ1H 1LK2A 4GJTB 4NBXB 3N1GC 1CU4H 5DZNA 2Z8RA 3L5WB 4MAYC 5D96B 2GSIA 4EVNB 4XBEH 1G9MH 1DBBL 1MHEA 1LO4L 1RJLA 4LLDB 3ARFA 4YNYB 4XH2B 4HKXA 2ZSWA 1EZVX 1XEDA 1U8QB 2Y4SA 4RAVB 4RMWA 3OJ2C 4PGEB 3KPPA 5F71A 5MP6H 3W9EA 5CMAB 1IEBB 2EKSB 4XMLH 4BELD 1BGXL 2AK1H 5D70H 3VDCA 4G6KH 3X3FL 2XA8H 3FFDA 1U9KA 1JZ3A 3CVHL 1WK0A 4HGMA 5K59E 3VXUA 5DD6B 4JCMA 1BZ9B 2OL3A 1EO8H 5ADPL 4J12A 3MV8A 1J1PH 4DTGL 3ARVA 1ZHNB 4MAUL 4KI5F 4GW1B 1IE5A 1C5DA 1MCBA 5MEND 4C56D 4QGTA 1OW0A 1BFTA 5BCAA 1SEQH 3JWDH 2G60H 2NW2B 4HKBB 1I9IH 5EC2A 3I50H 4XBGA 2AJXH 3FQTA 4RCAA 3QXDA 4MMZC 4XCNB 1Y18B 3I75B 3O45A 5KN5B 4TYUA 5CSBA 5IBLD 4LMQE 4WFGD 3DO3A 4GKNA 4QRRE 1XMWA 4OLZL 3WEXA 3QNYB 1JBJA 4GS7B 4Y4HB 4Y5XB 4F8TA 4JO2L 5D7KD 3CLEH 3KPSA 5HHMB 1JWUA 3JV4B 4J3WA 4M3JA 1YJDL 2A1WH 3CFIC 2VL4A 4MCYA 1R3IH 2EDJA 1U3HA 1ZA3A 1K8DA 2GY7B 3EOAA 1C1EH 5IK3B 1KN2H 4FXLA 5CEZL 5SV4A 4XPAL 3HG1E 5HYEA 1JCKA 4NM8H 1HYSD 2R0ZH 4PRIE 4XXCA 4RGND 3K4DA 1VFAB 1OPGL 1BX2B 2R1XA 4RRPG 2VDMH 5GZOD 3FRUB 4R97C 4BSVA 4Z7OF 5IBLC 5CBAA 2IADA 1T22B 5I1GL 4NNPH 1Y6MR 3W82A 1B2WL 4FQCH 5EH1A 4G6MH 5C1MB 4YHML 4PJAF 5IJVA 1VADA 2AXFB 3LRSA 4PRIA 3GB7A 5JIHA 4F7EB 5I2IB 1MCFA 4RISH 4XNQB 1FJ1B 3HNTL 2XWBB 4L3AA 5GRVL 4HUXA 3AGVA 3WL9B 3QIUA 5ICXB 4OLWH 1HYSC 4XPGL 3U6RB 4I13B 3UJIH 2D0HA 3TT1L 2ZG3A 5F9DC 5GZOC 3SDCD 5L2KE 2I24N 1X3DA 1A14L 1WCBA 1KJ2H 4PRHB 3VFOA 4M1DH 3WDHA 5KS9B 2A0LD 2GT9B 1U91A 1F58L 1A1NB 3GEWB 3W0WD 5TE7H 2BXZA 2IALB 2YPLB 4H0HB 5EULV 2AXHA 4N1HB 3D25A 4O02L 3HC0B 5KSUB 4U33A 5EPMB 4J3UA 1T80A 1KTKE 2V9QA 3QRGH 4FHBD 2IBBA 3MV11 4NHUB 5SX5K 5I1HL 3P4OB 1MCOL 2B5IC 4KXZH 4M03A 4M6MH 1FLRL 3SDCC 3BUYA 3MCG1 5IT2H 4M62H 1OP3H 1WC7B 1HDMB 3GJEB 1GHFL 4F37F 2I60H 4JAMA 3GBLA 3GSVB 2BFVH 1RIVH 1HI6A 1A4JB 1DQJB 4HLZG 1QR4A 4PPTA 4DVBA 5CFHA 1MAML 4YC2C 1MAJA 1BBDH 3GI9L 5JNYB 4YHYB 1DVFB 4X6CF 3MRGA 4LOUD 4GRLA 3OX8A 4L4VB 4QHLA 5CKGA 1T83C 4QRTA 3DX8A 4X6DE 4OIIH 5F7NC 1HHGA 3PF2A 3ZKNC 1T0NA 5E8DL 4JFFD 4JEGB 8CGTA 1FBIL 1LDSA 3SO3B 2FIKA 3DRTB 4G8IA 3OB0H 5DRXA 1R0AH 2Y07H 4HG4K 1IM9B 4MZ2A 2XZCL 5DJYA 4GW4B 3ARQA 4N8PA 4HGWA 5MEOA 2YHGA 3MXWH 5CSZB 2OR9H 4QY8B 1I1AB 4LOUC 5J8OA 5DEZA 4YPGA 5FEBA 5F7DB 4YBLC 4UV7H 4L3ED 3DYOA 4K7FA 3O3BA 5JW3L 1IM3A 1IGJA 4O00A 2FEEI 2GFBB 3FQXA 4H25B 5BW7A 1WBYA 3QAZC 3BZEB 1Q1JH 1N0LA 4KK6C 3LB6D 1X7QB 3I02A 1KACB 4N9GB 2IH1A 2CIIB 1MCEA 2DQHL 4NUJB 5CILH 3DLQR 2FHBA 3F7RA 3SDDD 5HVFB 3QI9D 2JCCE 1VACB 4PJ8D 4PGJA 4QTIH 1UB5B 3D18B 3MLPA 4FABH 5IKCB 1M7DB 4POZC 2BNQA 3VXQA 4CADB 1JF1B 2IFFL 4K3JL 3BGMA 1FV1B 3CCHB 3WLWC 5EBWB 2EDRA 1G0DA 4XNZB 2W65A 1S7UA 2HVJA 5K9OB 4ONHA 3K1DA 3MLYL 4GXUN 1JGDA 1BREA 2Z31B 3DVGA 4NKDB 1NMAH 1CL7L 1DQTA 3H42L 5HHOE 4HWZA 1EAPB 4DFIA 3PWUA 3DTXA 3B5HA 1QFHA 1U93A 4Y19D 2GUOA 1U8NA 2LVCA 4CMHC 4URTB 4ETQA 4Q6IC 3DYPA 3BISA 5ESVB 2W1NA 4JANA 3HFMH 3BKYL 4LPUA 1A9BB 1YYML 4ELMA 3MC0A 3BPCB 3VMOA 1K4CA 5HHOA 5C07B 4K7PY 3MRCB 4P4KC 5E7BA 3O2DA 3PL6D 3S8WA 5JUEL 3EYOA 1YZZA 3KPOB 1JPFB 3AXLB 2P49B 2ED7A 3LRGA 5FM5M 3L5XL 2OX5A 3QQ4B 3QHZL 1KJMA 4NKMB 3IFPB 3VXRA 3GMMA 4J4PA 4PB9L 3BD5A 3MMEB 3ZMRA 3HHRB 3EHBD 5B3JF 2HLFD 3IFNL 3RWFB 1OSPL 3PL6C 5ITBH 4I9WE 1RZIA 4OJFH 5DS8B 2GCYA 1WIUA 1AGDA 4ZXBC 1CCZA 1A6AB 5IOPA 2E27L 3IXTB 3RI5K 1LVEA 4FZ8L 5EUKA 2W9LA 3SGKA 3SY0A 3NFPA 1LD9B 3PV6A 4ZFZA 1S9VA 1KFAH 2NY5L 1G7HB 4Z7UB 3RIAK 1YMHA 4Z76B 3P30L 2AGJL 1ZE3C 2CUMA 4K23L 4JQVA 5D7IB 4PFEA 1QR1A 1IGML 2HLFC 1VFBA 3VH8A 1JFQL 5I19H 3VXMD 4HV8A 4F9LA 2Y25A 3S9DB 4Y5YC 1CK0H 2IJ0C 1JE6A 3F12B 3FQWB 1ACYL 2EDKA 1GGCL 2D03L 5LJYH 4G80B 3THML 1QEWB 1Z9MA 3VFRA 4YR6A 1TQCC 3S5LG 1FNAA 3C08H 1FAIL 3BJ91 5DJDB 3QUMA 4X4XB 2R1WA 4F7PB 4EI6B 3LD8C 2ATPA 3ARFD 3TGXA 1RUMH 2P5WE 3U4BH 3QQ3B 4NBYB 3U7YH 3UCRA 1XF3A 2VAJA 1VESA 1I3UA 3HCVB 1XFPA 4ZO8A 1HQ4B 4BZ1H 1DLFL 4HUWA 1RZKH 3QEHB 3MV7E 3ARBB 1K2DB 1NCUA 3WXVH 4UT6L 5CP7B 4L4TE 4NOBA 2CR3A 4M9OA 3VXUD 3MRKA 1V3MA 3EFDL 2DKUA 2VWEE 3ARFC 5T3XH 2CLRA 2CXKA 2IFGA 4LMQI 5BRZE 1WAAA 1UGNA 2DBJA 1X5IA 1Q94A 5HDQH 2DDQL 2OL3H 5FCUL 2V5RA 1S9XA 4YHIB 1JHLL 2FO4A 2HH0H 3QWQB 2J5LB 4L4TA 1S8DA 1UKTA 1HYRC 4RAHA 2PF6A 2BVTA 3TN0B 4NCDA 1A1MA 3JWOH 1B0GA 4WV1C 1FYTB 5T1KD 4J3SA 3QPXL 1HNGA 4XPHL 5DRZB 4WI3A 5DWUH 1RJZA 4HXAH 1FO0H 3WFBH 4JKWA 4JFYA 4KI5E 5GGSA 4KVCH 1UENA 2Z91A 4U6XB 5IHUL 4YDVA 4L9DA 1OTTD 5I1DB 1MCSA 3G6JF 3RZCA 1ND0A 4IOFD 2Y06L 3I2CH 1CBVH 1BVLA 5CBEB 5I16B 1NUNB 1D5ZA 1U3HD 4BH8B 2QLVB 5B38B 3NFSH 4KH2A 3KXFA 5JO5A 4CVXB 4P59L 1ZKAA 4YWGH 1DDHB 4UMGA 4YUEL 4MQSB 4BM7A 3MJ6A 1UT9A 4MNGA 1JRHH 4NJAH 2I9TA 5LWYL 3UYRL 4BUHA 3S96A 1LQSR 4N0YH 3HG1D 5JR1H 3CD4A 4C59B 1D5MB 1MAKA 3MREA 4PRID 3EO9H 4QRSA 5GGQL 1OTTC 3MFFA 4WI8A 4KDWA 4YBLB 4IOFC 1UCBH 1ZVHA 3U36B 1F97A 4BQ9A 3MLZH 4M8QA 4ONFH 4OLUL 2J8HA 4K71B 5AG8A 5F7KC 3GHBL 2M26A 5D6CA 3QIUD 5H8DA 1WEJH 1AQKH 2DQJL 4P9HH 3PV7A 2Q7NA 4NKIH 5JQ6L 4PJAE 1GGBL 2EDEA 1I75A 1RFDL 1X44A 5IFHL 2FX9H 3ZT6A 3GKWL 1P4BH 4S1QH 1MIEL 3MRBA 4FQ2L 1PZ5B 3T2NL 3R1GH 3CXDH 4R4BB 3ULUL 3LQMA 3NH7H 3G04A 4JDTH 5ANMB 5GSVB 5DR5L 1C5CH 4F3FB 3MO1A 1CD9B 4PRPA 5AAMA 4G7YL 3REVA 3BGFB 3T65A 5L2KD 3S37X 5E99L 4XNUH 1QVOA 1QUNA 1OAXH 4L8DA 4YHKL 1ULVA 2HT2D 2ICEB 4O2EA 4M61B 4OZIE 4JPKL 4HJJL 1F8TL 4HZLA 2NY3B 3SDXF 3H9HB 3P4MA 3FOLB 2FHCA 1G7QB 5TPWL 4LF3B 4O2FA 1QSFA 4DGYH 4AT6A 4HW6A 3VGEA 4NHCH 5E6IA 5GHWH 3CFJB 1EJ6A 5LQBL 2NX5A 3RWJB 2RIKA 1BBJA 3S4SB 4OLYL 4G9DA 2OZ4L 4GRLD 5IGXH 4OZIA 3B8YA 5K9QG 1QLEL 2DL2A 3UTPE 5IP4A 3O4OB 3WLBA 1FGNH 2QV2A 2DYPB 2X1QA 2HT2C 1CZ8H 3CIQA 1Q9KB 4OZ4A 3PDOA 4UQ2A 2N7BA 2VITA 3H9SE 3WNPA 3MRFB 3TT3H 2R0WH 1VPOL 5I8EA 2OK0L 5C0EB 4N8VG 4OZHB 1XGUB 4PJ9B 2EH8L 3TPUA 4QT5A 4X6CE 3FO2A 1NPUA 3KWWA 1PBYA 5K9JH 4ZO9A 2ORBH 1I7RA 2CKBA 4TTDD 1FNEB 3O6MH 3NCJH 2FYYA 3PWVA 1GXEA 1JI2A 2AQ1A 3P73A 5L2JA 4XRCB 2FGWL 1ES0A 3ZE0F 4ODXB 2NLJA 4R7NA 5A16A 4U1GC 3RVTD 3KR3H 4TUOB 1PSKL 5DJAA 5C0GB 4GAYB 2V17H 3BT2H 1Y0LA 2IBZY 5HGDB 7CGTA 1C12B 3MRHA 1RV6X 2YUZA 3HMXL 3LKPA 4Y5VA 1F3DJ 4KQ4L 4GRMB 3L95B 4YFLF 3LEVH 5HJ3B 3MJ9L 3OHXA 4HIEB 4F37K 2X44D 4E9LA 4NWTL 1OF2B 3EYVB 4ZXBB 4TTDC 1HXYB 2A9ML 5T1LA 3D0VA 5FUZL 2ATKA 4HMEA 5JIPA 5DRNA 4K9EL 3IRPX 4NNYA 4XMKL 4L8BB 1EBAA 1U8LA 1WTGT 1WWBX 4HXBH 3RVTC 2RFXA 1OAUL 4FQHB 2XRAH 3VRLF 2QSCL 4U0RB 4JDVA 3S37L 5ITFB 3MRDA 1NCCH 4BZYA 1RHHA 1FZMA 1Q0YL 3GUTA 5DLMH 5C0FB 4FZEL 1OHQA 1J0IA 5T1DL 3MBEB 4I4WB 3I3EA 3CSBA 1RZFH 2ITCA 2QQNL 1OT2A 2MSPA 1U8MA 1M7IB 2X1WL 1PG7W 3I3DA 4PJDF 3FKUS 4Y4FB 4K8RC 1U8PA 4S1DC 2EKJA 1NH6A 3CMOL 4PJGB 2B4CC 3OPZH 4EI5A 5BS0E 5IFAH 5H94B 2MOVA 4GLRH 5E70A 1UZ8B 1MQ8A 3ROOB 4HC1H 4A6YH 4OZGB 1DANT 2R1YB 2YZ8A 2VDRL 5HHOD 2P8PB 2PCPA 4P2OC 4JO4L 3MFGB 1DSFH 3EJYD 4PGDA 1W0YT 4JFZH 4LAQL 2GTWA 5IWLA 2FL5A 3PGDB 4EDXA 4EEEA 2VXVH 3HS0A 4XBPA 4TULL 3FOMB 2R2EA 2Z92A 4JFHD 4QOKB 5F3HB 4J4PD 1AI1H 4U7MA 1G0YR 4AMKL 3VJ6A 4JZNB 5BZWA 4OD3L 1JYWA 5J7CC 4JFDA 1ZGLM 1GL4B 2WINA 3RVVD 4HS8H 3TLRA 3BP4A 3EJYC 3NACH 3X12A 4UQ3A 1EHAA 5JA9A 4P23A 2V2TA 3C2AH 2I5YH 2B1HL 4DKFL 3QZWA 2QHRL 5I17A 3KJ6H 1HILB 5FHAH 5IB3A 3MRRB 4X8JA 5IMLB 2XA3A 2V7HB 5D5MB 5FGSA 4J4PC 3V2AR 3BH9B 3FJTA 5IJKC 3TVMB 1MCPH 1OCWH 1OGAB 1OAYH 5DTFA 5BVJB 4HWBA 1S9YA 4Y1AE 2HWZH 1JK8A 2VLLB 3RVVC 1MFAL 1J1XH 1T6VN 1F3JA 2OJZL 4ONGH 5IW1A 3GSOB 3UBXB 2SEBA 2EE2A 1QNZL 5E8EB 3X11A 1K8IA 1CE6A 1BVZA 4JY6B 1K3IA 5E1AA 3OGCA 1L9MA 1L9NA 2DWDB 3SQBA 4G8FA 4FQXC 2NW3B 8FABB 2H41A 5L9DL 1DBAH 4YHPA 3ZT7A 5D7JB 1JMXA 4JQVC 2H26A 2XXCB 3VWKC 2VKWA 3QUMH 1J5OH 5DYOA 1QFWI 4BSWB 3SGJA 3DVFA 2Q76B 4NQDE 3QG6A 4DGVL 5LXGH 4KROD 1XF1A 3JTTA 3TO4A 4I48B 2XFXB 3L3IA 1G9NL 3HE7B 3GO1L 5A43C 2A74B 1GGIL 4I3RL 4PY7B 1BQHA 4X98B 2UWEB 5JTWA 15C8L 5GISL 4F33B 1I7TB 5I1KH 4JFOB 3ARDC 3OSKA 2K1MA 2FSEA 2ARJB 1ITCA 3GJFK 1NUGA 1QLFB 2L7JA 1DQDH 1PAMA 3MJ8B 3P9WB 1XGRA 2E7HA 4L4TD 3V0VB 1OM3H 1W8NA 2R23B 1LO2H 4JRYE 4XPFL 4KROC 3OJMB 2WBKA 5BRZD 3L3GB 2EDDA 2VDPH 2WZPD 1TJGL 4TVPE 3TNMA 1A9EB 4U1LB 2LE9A 4N0UE 1ZANH 3QUZA 4YXHL 4L8CB 4OLXH 3JV0A 2DLFH 2OXHA 3HN3A 4FQQA 5C0IB 3TCLB 4U1MB 3GI8L 4LBEB 4P49A 4EBQH 2D7MA 2KBGA 1IQDA 1TIUA 3KXFD 4ZG1A 1WT5A 4I2XE 4JHBA 4ZUVA 5I30H 2VWEC 5FYLH 3OB0K 3PQYA 2HFEA 5DHYB 5FGBC 4Z7VA 5F89A 1AHWA 4KAQL 4YDLC 5CGYC 2X9WA 3KDMA 2A83B 1EHLL 1U3YA 2EYTA 4PTUB 3G6JE 5KSBE 5JW4R 1A6UH 2J8UF 1HCVA 5CZXC 1QKZL 4FG6D 1I8LC 2AAVA 5C6PB 3T3MF 4M43L 3F6IA 2R29L 1OP9A 4I2XA 4YE4H 4I18C 5BV7B 5ACLA 5GS1A 4RNRA 1JN6A 1KJ3L 1UVQA 1PX4A 3SQOL 4KDTC 4LNRB 4QRUB 2X4RA 4G8EB 3PXJA 3P0YH 4JVWA 5A40E 3G5VB 4KI5C 5KSBA 1H3XA 1IAMA 2AV7B 4MA8L 3TV3H 3W5MA 3HB3D 5F7HA 4MX7B 3IJHB 4HJ0D 4CVZA 5EO1B 2C4XA 4ELMF 2BVYA 1QSEB 1B6UA 4ODTH 4P46A 1HK6A 3CC5B 1KEML 4R0LA 3HNSL 4OD2A 2XQBH 3LPWA 3VXSE 3OR6B 1AXSA 4YXLL 4IRJA 5HY9A 4PRPD 2P7TB 4FTVA 3KYNA 5IVXE 1MIML 3BDYL 1OOAA 1DQLL 4LP4A 4WUKH 4B7LA 1KLGA 3QQNA 1JPTL 3OKEA 4GH7B 1TVDA 3LSOB 3VE0B 2MHAB 4AIXA 4HJ0C 3NZ8B 4YXKH 2FLBT 2V2XA 3TZVB 2XQYG 2KKQA 3A6BH 4POYA 3DVIA 3E0GA 1QRNB 4AZ8A 5IVXA 1FVDB 4Y2OA 1RD6A 1NC4B 5E6ID 1D6EA 5EFIA 2YXFA 2EZ0C 5CIPB 1I9JL 4ZSOB 1R5VA 3ZSTA 2VSDA 1U8JB 2V2WB 3AREB 2DLIA 3UXFA 1JGLL 4H5SA 4JGUA 4HHAA 4MQ7B 2OTWA 2Z0BA 1T7YA 2XTJB 2EH7H 3V4VL 3GKZA 1CLOH 3QHTC 3P77A 3WS6C 3IKCB 3MLRH 3WN5A 4WTWA 1EEYA 4N0FB 5SWSE 1F6AA 1A5FL 1VCAA 3LRHA 4P5MB 4HS6A 1CXKA 4LRNH 3V5DB 2IG2H 4M7ZB 2MKWA 4P2OB 5HHVH 5HHNB 5DJ0B 3C9NB 1BWWA 5E6IC 5FYKL 5E9DE 2ZG2A 3G9AB 3EOTH 3M07A 3P9LB 4GQ9L 4XX1G 4BFIB 1GOGA 2ZOLB 1N2RB 5SWSA 4ZPTB 2VL5A 3A0OA 4D0CA 2GJZA 2BRRL 4FFZH 3MV9B 4Z77B 1E6OH 2CKBH 5GS2H 1MNUH 3ETBF 3Q5YA 2MCPH 4IJ3C 2X7LA 4F57H 3TNNA 1RJCA 2AVGA 3D39A 5EZIH 2NCMA 1J1OL 2F74A 5INCB 1UM4L 4P4RB 4PY8I 3L7FB 2YK1H 3KVQA 4JLRB 3BOVA 5BMFL 3STZB 1A22B 2BJML 4K94C 4ZTOH 5CJOH 5T1LD 4GSDH 4ZOEA 1ED3A 1S5IH 3OXRA 1TPXB 4NFCA 3T2OA 3ARZA 5D2NB 1BD2E 4X7DC 1UQSB 3MACL 2VISB 1YNTA 4D9QE 4EQ2A 1NGQL 3Q5OA 3V6FB 2WBJA 4GAJL 4Z6AT 5C3TA 2DIJA 5HGHB 1L4IA 3M17B 1MFCH 5E08L 1EUTA 5FK9B 1T5WB 1AC6A 2J4WH 4RZCA 3C5SA 3PDGA 1YN7B 2OTUA 3C5ZA 2BHZA 2OP4L 4XNMA 3IETA 4FQXB 3VRLE 1R5WB 2QKIA 2CQVA 3NABL 3MLXL 4DQOH 4EI5D 1F2XK 1YEHH 2PW2B 4L8SA 3ARGC 2QQQA 1UB6B 1UG9A 1A8JH 1XF4A 2HKHH 4PJFE 1KPVB 3T0BA 3JZ7A 4YHZL 3T0EA 1BJ8A 2GAZB 1WCQA 3L3KA 4K3DH 2IPTH 3UYPA 3RJDA 3BH8A 4PJBA 1IGTB 4PJDE 1ETZB 3RTQA 4Y2DC 3SDAC 4KWUA 4PRBA 3GHEH 4NPYB 2ADJB 3IDMB 3IXAA 4JHWL 5BS0D 2H9GB 2P4AB 4TQEL 1YC7A 3WSQH 4MXWL 5I1CH 3QUYA 3T1FA 1J8KA 2IC2A 3Q1SH 1MJ7L 2DQDH 2DL9A 2EYSA 3FTGA 2VYRE 1UXSB 4EI5C 3K8MA 2JJSA 1TETL 1CXEA 1NFIB 2D7TL 3BZ4B 3EIFA 4HPYH 5L6YL 5AUMA 2RB8A 4LCWB 4J6RH 4JZOA 4ORGA 1IVLA 2YR3A 5D8JH 1DEEA 2VXQL 1CDIA 1S7QB 4Q2ZB 4CRPA 2NYYD 5MEPB 3D87B 3TO2B 3JUYA 3QIWB 2YD2A 2YZ1A 1XF2A 4BZ2L 4P23D 1H3UA 1E27A 1CLZH 2PTUA 3PIQB 1HXMB 3MLWH 1T6WA 2AV1A 2EC9U 4YK4C 2BNUA 3BKCH 3VFWA 1UWGL 3SKMB 4I77H 4LLVB 1RU9H 2AJVL 1XCQA 4OCLC 5F93C 4CDGC 4UILH 4QRPE 5I15L 5KSVA 1P2CA 5IF0B 1GC1C 1M7XA 4TNWF 5LG1A 1FDLH 2JELH 5GGVY 2Z8VC 4FXGA 1UZ6E 5F1OB 3CH1A 4MJIB 2YUXA 5H2BB 4DK6A 3ZYJA 3PE9A 4U1SB 2GIYA 4ZUWA 3CPLB 2Y23A 4E41B 5E2JA 1M1SA 4ODHH 3B9KC 5DVOA 4QRPA 3D3VB 4PJCF 4P23C 5C0CE 2XG5A 4HWBH 3FHQA 2UZIL 1QFUH 3HUJF 5CJQL 4Q74A 2BSED 4Q6YA 5J1SC 1FZJB 1Q9LB 2BOBB 4UINH 1IGYA 1T7WA 3VD3A 3JVGC 4DW2L 4XP5L 3V5KA 1UCTA 4GRWF 2XN9B 1D9KD 4Y1AD 1NANH 4FQJH 3ZSSA 3UTQB 4PGCA 5HPMB 35C8H 3OAZH 5C0CA 3GIVB 1G7JB 2GK0B 4X9GA 4RA0C 1A1OB 4O2CB 2LTQB 3LS5L 2W38A 5JHDE 4OIAA 3L3JA 4Q97A 5E8NB 4PJXE 1X4XA 3LOWA 2H6PA 1I3RA 3VWJC 1FHGA 4U3CA 3RWIB 3TO4D 3CVHA 1NGZA 4RA3A 3KNBB 4RFOL 5K9QI 3UYOD 2RGSA 1D9KC 3KHOA 3ZTNH 2F58H 3BQUB 1FRGH 1JGEB 2FJFB 3QEQA 4KHTL 1MFDH 5F7YC 5C0BA 2FBOJ 3MRPA 1HHKB 4JQIL 5IESL 1DFBH 1FFNA 5F7UA 5D7LB 5IV2A 1D6VH 3IU4H 5D2LF 5MERB 3ZDYF 1ZLUH 5EBLA 4PJ7E 4H20H 3SGJC 4Q0XH 5ESQA 1KXVC 4YIQB 4ODSH 1KC5L 2CO7B 5DVKA 2CJUH 1X5ZA 3GDBA 3P11H 3LQAC 4HBCH 5DDHB 2Q8BH 4S1RH 4P57A 5CEZE 4WI4A 4WFFE 3T0XA 2X1XR 2HN7B 3AC0A 3QUZD 2GSGB 5HYQA 5EBMA 2I9LB 3UTTA 3UTZB 4NZUH 5D1QB 4JRYD 4QYOA 3QCVH 1MCDA 5ALBH 4PJAB 3QIBA 4OCYL 1P1ZA 2DM2A 4ESKA 3L5IA 1N5YL 5F1IB 3MA9L 4TVPD 4XX1E 3ZKXB 3UZQA 4WU5A 1KIUA 3DROA 4UOW1 4LKCB 1LEKB 3PQYD 4P2QA 1UYWL 2R39A 2YMXL 4ZUTB 4X7SH 4OTXL 5FUOL 3M1BA 1S7XB 3LKOB 4CL7A 3LH2L 3INUH 1MFEH 3RX7A 2VLRB 1IGCL 2OCFD 1E4XI 4FP8H 2Q7YA 4ZMAT 3Q2CA 5JLZB 3CFCL 2CK0H 5C0AA 4NDMB 1TLKA 1GPOH 5L8KB 3MRNA 3V0AC 4LLYB 2VTFA 1KIPB 2F5AH 2Y6SC 4HPOL 3ZL4L 1ZLSH 3S36H 3L3DA 4EOWL 1BLNB 1A6WH 2YKLL 1NDGB 2E9BA 4MWFA 2GTZA 1G7LB 4YX2L 1AD0B 4ETYA 1FCGA 1NFDA 1N8ZA 4APQC 1IBGL 4IRZH 1HH6A 4MJ6A 2FWOB 1YQVL 1RUQL 3H0TB 3VFUB 5EOTA 3N9GH 4NT6A 5EOCJ 2Y7QB 4HCRH 4LQ1A 4P46D 5C08B 4NZDA 4C83A 4NP4L 5ILTH 1YNKL 4IRJD 4NRXA 5GS1C 4FTVD 1DBKH 4RBPH 5J11B 3CUPA 4OUUA 5KG9B 5BOZG 4I3SH 3B83A 5IR1B 1L0QA 3DUUA 5GRXG 1LWRA 2HJFA 2F54A 2UUDH 4KMQA 5DO2D 4NRZB 3TESA 1LILA 3HNVH 4TRPL 3WNOA 4CNIB 2X40A 2NXZC 3ARRA 5TDOA 2OQJB 1K4DA 4BH7B 5C7XH 5C2BH 3VXSD 3U1SH 2VSCA 3G6DL 2CGRH 2DD8L 4YAQB 4QHMA 3RUGF 1JGUH 1F4XH 1WBZB 1CFNB 3O3DB 3MXVH 2Q3AA 4NWUL 4G9FE 5F6HJ 3NCYP 4IS6B 5D9SA 1QBLH 1UEYA 2J8OA 4X4YA 4YDKH 4L9LB 3ECBA 2AK4A 2EXYD 3MROB 4HDIA 3GSXA 2FEDD 5KVFH 3CLFL 5B39A 4XXDB 4LL9A 4QHNA 1NL0H 2FEEL 5EIIB 1QA9A 1SEBA 4G9FA 1CFSA 3EYFB 5T3ZE 5EOQH 5C2UB 4R2GD 3BYYA 3FO1A 3VRIA 1ZGLA 3BJLA 2Q8AL 4M4RA 3PHQA 4G5ZL 1LNUB 5ACMA 3PP3K 2Q6WB 4JRXA 1T0PB 4QEGA 1CDJA 3ULVE 3S88H 1I3GL 4P5TA 3S5LB 5FKPB 3VFVA 2A6DB 1RZGA 3G9VA 2EXYC 1YEIH 4X6EB 2J7LA 5B22A 2Y5EA 5E7FA 5SWSD 4XWGH 2C1OA 4DZ8A 5I1IL 4F7TB 4HQQH 4HJGA 12E8H 3L3OA 1V8HA 4WHTA 5E9DD 2VJXA 4AQ1B 1A7QL 3RWCB 3QDAA 1TMCB 4X80L 3VI4F 4Z7WF 4XP4L 4HWEH 3UTSE 4X6BA 3QHFL 4F80A 3KPQA 3EGSB 1ZWIB 1T3FA 2N1KA 1N3NB 3TBYB 5CZVH 2AABH 3LEYL 1I4FB 3MOAH 2X6MA 3FB7B 1CXIA 2FJHA 3WUWA 4XP1L 4KMTL 1H0DA 2DQGH 5EU3B 2W9EH 4ODWA 1YEKL 1XIWC 1CGTA 3GSQA 3Q6GH 4JO1L 2QQLH 1YDPA 4NJ9H 3QEUB 2GJ6E 5DJZB 3OR7B 1ZT1B 4XI5C 3QCTH 3X13A 4W68A 5F1SA 3CVIH 5EB9A 1AY1H 3QB7C 3RWEB 4LSVH 3QDGB 1EERB 1A7BA 2HT4D 3A67L 2DLHA 2A2QT 2AI0H 3F62A 3S3JA 5IHZB 5BVPH 3ARUA 4RGNB 4LRIC 3UDWA 5JOEA 3C5ZD 3I85A 3ZE1F 4LHUA 3SJVE 4D9QD 4D94A 2BHUA 1TQBB 1JJUA 4NC1E 4YDJA 4MNQE 5J9PB 4QXTB 1WFOA 4AEIH 4S1SL 4QHUA 1CWVA 4F9PC 1SMAA 1RULL 4P5KA 3T0ED 4PJIE 4PJHF 4J7RA 3IDXH 1LO0H 3U83A 1KG0B 4M6NL 2HT4C 4KRPD 2HKFL 3IKKA 3RTQD 1NAKH 4P3CH 1WFTA 4G7VL 3VWJB 1KB9J 1UJ3B 1X5KA 1KJ2B 3C5ZC 1NFKA 4OM1H 4J8RA 4LCYB 5C8JB 1UM5L 4H1LA 3QUYD 1S7RA 2XZQL 4G43A 4PJIA 1KEGH 5J6HA 3MSPA 4K3EL 3UJJH 5KSAC 4XVTL 3QZWG 5D7SH 2FZ3A 3K4AA 1ZTXL 1LEGA 2ICWA 2ENSA 3KYOB 4X7TB 1I8IB 2BNRE 5LAXB 4AENB 5E8PA 1V3LA 3LV3A 4FMKA 4FXKA 1OLLA 2LU3A 4U1KA 1BIHA 3EYSH 5JW5A 2LVEA 4JHZA 3PHSA 4JN2A 4PLJC 1IKFH 1PY4A 3RL2A 3G6AB 2ZCLL 2WNGA 2R0KL 4FFYL 5J1AA 3RAJH 1UA6H 3QUYC 5DGQA 4EUPA 4R26H 2BNRA 4X6FB 2OJEB 1IC5L 2JJSC 4TUJA 1O7SA 1J05A 4NO2A 3HMWH 1BECA 1SJEB 3SKUD 5CD5D 3MNWA 4JZJC 5FYJH 3QDMA 4JFQB 2VXUH 1YPZB 3VXNA 4LVOB 2VE6A 5IBTL 3W11C 1KT2A 4LLQA 3LEXA 4QRPD 5DQJA 1SJHA 3HAEA 4JFFB 1S7WB 3T4AB 1IGFL 3KG5A 3RWGA 1VHPA 3MYJB 4F7MA 2WANA 4Z18A 2H8PA 4KZDL 3BYTA 3BD3A 2O5XH 3DI3B 3VA2C 3LQZA 3PGFL 4XZUA 4N90E 3DO7B 2XZAL 3BMWA 4HFWB 1O5DT 4Z7QF 5C0CD 1ZHLB 3WNMA 5CD5C 5CINL 4PJCE 1UH2A 1LO4H 2R4SL 1YECH 3QFDB 3DXAE 4UT9L 3HUJE 3W81A 4V2BA 2HTLC 4L3EB 4LHJB 4Y4KB 4WJ5B 1KCSL 4B7IA 3EJZD 4GRWE 5EN2B 4DFHA 4DKEH 5TE4L 5JXAL 3DRQB 3P2TA 4N8VB 1MEXL 2DBLL 1U8HA 3WE6B 4NBZB 2CRZA 2E7MA 1BGXH 3AUVA 3RBGA 5MI0C 3X3FH 1K3ZA 2AXGA 3GM0A 3R0NA 5I66B 1ONQA 1C08B 3DSFH 3QEQD 5TE6L 1SJVA 5KVDL 3ZE2E 3JUZA 3LVEA 1JHTB 1BF8A 1RQ5A 2PETA 4PJ8B 4OLVH 4JG1L 4TNWK 3KS0J 3P4NA 3GMRB 4DTGH 1P84J 2FJGB 3FT4A 4TTGA 2Y9RT 3BEVA 3IFOA 1FN4A 2ZCKH 4H0GA 5AWNH 4U6HA 3VFPB 3GMLA 4OI9A 2VLKB 2AEPL 5D1XA 2ZUQC 2X4TB 3U9UA 2JK5B 3QSKB 5D2LE 4UB0H 1T5XB 1CDYA 2CLZA 2A6IA 4N0RA 3FT2A 1I1YB 1I9RH 5ALCH 5IIEA 4NQXA 5GRJL 3QIBD 3IDGB 2BSRA 5KS9F 3STBA 5CEZD 1HHIA 2YEZB 4NRYB 4WFFD 1A3QA 5EU6A 1YJDH 3RY6A 5HHPA 2FLRT 2YD3A 1JTPA 1U95B 3IS1X 5KJRH 3T4YB 5FOBB 3KLDA 4X83A 3ZKMC 2JJWA 4PR5B 3QH3B 4P2QD 4XCEB 4XPAH 5DMJB 1T1ZA 1CFTB 3VXOB 3GMQB 5BV7L 4X99A 3MRIB 3U7WH 1BVKB 1T0MB 2JB6A 4DVRH 4I0PA 5I1GH 1NCNA 3WJLC 4NQEA 4W70A 1B2WH 1MWAH 3PWPA 3BX7C 4YHMH 2CK2A 2YUVA 3IF1A 3ULUE 4N5ED 4NCC1 1FNSL 4WFHE 5AD0B 4EN3A 7FABH 4LLUB 5FO9A 3VW3H 4PGZA 1EEZB 4DOHE 5TQ0L 1XH3B 1PVHA 4Z0XA 4HX1B 1MHCB 1WLHA 1OY3B 2ZOKA 5FYJU 4UDTA 3DETC 3OWEA 3SDXB 5I8CA 5J6GA 1N7ML 1S9WA 2VUYA 1BQSA 4WWKA 4WEUD 3LIZL 5IQ9A 2BOCB 3MRJB 4WW2F 1A14H 1MHHB 2IAMB 1EEQA 3HZMA 1F58H 3EUUA 4N5EC 2C4FT 1BMGA 4KU1A 3HC4L 3O3AA 5H35B 1TXKA 2VDNH 2RQ8A 3RWHB 1AP2A 1G6RL 5F1KC 1KCRL 1NUFA 1AC0A 5F6IC 1R3JB 2UVEA 4MD0B 2BY0A 2MTPA 4Y7MA 4PS4L 4OI7A 2VAAA 5I1HH 4S2SA 3VFSB 3CK0L 4R9HA 3B9AA 3GSUA 1J12A 4OCXL 1J87A 4K8RL 1LP9A 3NA9L 3VXMB 3F7YB 3UAJC 2B4CL 1QPXA 4X5WB 3U2SA 1GGTA 1MAMH 5HTSA 4RGOL 3GI9H 3HRZB 4LLWB 3LKQA 4TUKH 4XHJC 3ZKSD 1LK2B 1JL8A 5C9KA 4M93C 1B4JL 3BEWB 4OBRA 3RUGE 3KPRE 3C6SB 2GSIB 1RIHL 1MHEB 2FB4L 2LV4A 4G9FD 5DFTA 1RJLB 3SKOB 3Q0HA 5E8DH 1AXIB 3H9YA 3I9GL 4AEFA 5AZ2L 1XGQB 4CMMA 1FBIH 3FFCA 4HFUL 2BSTA 4JRXD 4HG4J 3KPPB 5GGRA 4P5TD 5LCVL 3W9EB 1GCFA 5KTEL 4IHOA 3KPRA 1I7UA 2C5DC 2NY6C 3VD5A 3FFDB 1A6TB 5T3ZD 3STLB 1F4YL 5D1ZB 4MCZA 4MA7L 1KCLA 3EO1B 1OVZA 3VXUB 4RIRA 5KSAB 1NMBL 4S10A 1E4JA 1UWEL 2OL3B 4QXGL 4ZAKA 4UV4H 3RHWK 4NO5B 3ULVD 5F70A 2FDBP 3MV8B 4U6YA 3HMXA 1L0XA 3JV5A 2YD8A 1CL7I 3I6KA 3PXHA 2VIRA 1WBXA 1C5DB 3BRFA 1V3KA 3MJ9A 2DI8A 5HPOA 4JM2A 4U1IA 4P5TC 3QUXD 2MJWA 4DWHA 1FO0B 2DQHH 1EFXD 4XBGB 3FQTB 1XGTA 1VEOA 3QXDB 3G5XA 5DD5L 5SWQA 3O45B 2A6JA 4Z7WE 3UTSD 3MJ7A 3WEXB 4MLIA 4RGMC 3ULVC 4MLSA 2X89A 2X70A 3WIHL 1HKLH 3KPSB 1JWUB 5HVHB 1X6NA 4JZJB 4K3JH 4P2RE 4MCYB 1A47A 4M02A 2MPAL 3ILQD 3O9WA 4OM0L 1U3HB 1ZA3B 1K8DB 3QUXC 4M7JL 1EGJL 4QWWD 4AIZA 3RU8L 2GJ6D 3V6BR 1R3HA 1T89C 4KKCC 4LHUD 1XGPB 3MLYH 1AO7E 2DQCL 3OJDB 4HKZA 3ROLA 3VXPA 2ICWI 4BSVB 5C0RL 5CBAB 4OGAD 2IADB 5A3ID 3V6OE 4KVNL 1ZT7B 4A2LA 3H42H 4JDZA 3RKDD 1WZ1H 3O6FA 5IJVB 1OSZA 3HC3L 3LRSB 4PB0L 1CICA 3GB7B 2AERT 5T5NF 2OS7A 4Z7UF 4ZS7H 3WNNA 3BKYH 4HUXB 4JKMA 4LIQE 1D5IH 3QIUB 2XPGB 3QPQD 4QCIA 1F90H 1GAFH 2CKNA 2EE3A 4LQFL 2ZKHL 3T77A 1ZEAL 2DQTH 5F3BA 1FQ9C 4Z5RB 4ZTPL 4P2CG 5KVMC 1S7VA 1KCVL 4PJHE 3R8BB 3RKDC 2CMRL 3L5XH 1IKNC 4HMCA 3SGEH 1U91B 2ZUSA 4G6AC 3QHZH 3TA3A 4KKLD 3EO0A 3PWNA 2HFFA 3S97C 1FL5A 3W39A 5E1HB 4LSRH 2LAGB 1AGEA 4NC1C 3D25B 5CUSL 1XF5A 4Z7NE 1NFDF 4V1DA 3V0WH 1JZ5A 2ZUQB 1OSPH 4DCQA 3NGBB 4FQ1H 4D8PA 3MRQA 6CGTA 3CU7A 2BNRD 5DEFA 4XAWH 4ZPVB 3HE6A 4IMKA 5L0QB 2E27H 3CFKA 1X5YA 4FZ8H 2VQUA 1C16A 4GBXA 4D0BB 4DVBB 3EYUL 4EUPH 3JWNC 5HSFA 2W0FA 1TENA 2NY5H 3CFDA 4RAUB 1L6ZA 3SE4A 4EIZC 3MRGB 1G7PB 3QNZB 3OX8B 4IRSB 1ZHKA 4QHLB 3SPVA 5BO1H 1T1WA 4EZMA 3TIDA 3L5WA 2VKXA 5HDLA 1RUKL 2EEAA 3OKDA 1HHGB 1T0NB 1JFQH 2B2XH 3KYAA 1IQWH 3MLSL 4DEPB 2FIKB 4PGBA 3RPIA 1PLGL 4RAVA 3HAEH 3IGAA 5TF0A 2JJTA 4PBWD 5DJYB 2VDKL 3G5ZA 3C60A 3QA3B 4HGWB 2P43B 3MX0A 5DUML 3WO4C 2D4FA 4F15B 3V4UL 4YPGB 2UV3A 4YHOH 3DWTA 3RDTC 2FH6A 5DD6A 4K7FB 3UROR 3EDKA 4YLQT 2BCKA 3O3BB 5IB2A 1CF8H 4KZEL 1IM3B 1IGJB 4N90D 2J3SA 2X4NA 3DARA 3FQXB 3BDBA 4PRNA 1OAZH 1WBYB 4K7PH 1C5BL 1SYSA 2P5EA 5EU4B 1NEZA 4Z7QE 3BWUC 4UDUB 2AEQH 4FQLL 4LLMB 3GMPB 2IH1B 4UT6H 2NW2A 4BQ8A 5HHME 3O4LA 2VXSL 4RBPK 3QEGL 4Q9CA 3EFDH 4M48H 1BZQK 3FN9A 3I75A 1MFBL 2UUDK 5KN5A 4HK3J 5GS0L 5I1AA 4N8CL 1GIGL 2DDQH 1LMKA 3VGDA 2K3TA 2BNQB 3CDGA 3E6HB 4Y4HA 3VXQB 3K2MC 3TJHC 3BGMB 5T5NG 5D1XD 5LVEA 3KS0H 4AIOA 2VDOH 2HVJB 1CGSH 3QPXH 4P3DB 1JMZA 2J8UB 4KPHL 1WWWX 1VFAA 2FX7L 1BX2A 3DVGB 4DZBA 4LCUA 3MLTA 1P4IL 5EU6D 1T22A 4P9MH 4AEHL 1JF6A 4HWZB 3PWLB 2Y06H 4U1NA 4A6YB 2Q3ZA 2A73A 2GUOB 3BSZL 4ETQB 4LFHG 2VLJB 4F7EA 2FNBA 5I2IA 4JANB 5D1XC 1FJ1A 4KUCF 1CFQB 1OAQL 2IPUG 4O4YL 4P59H 2W92A 4PRHE 1NLDL 4ELMB 5ICXA 1CD0A 5KS9E 4YUEH 1K4CB 3U6RA 5DT1L 1N4XL 4NQED 3BIKB 3PWPD 1UACL 2NY6B 5LWYH 3BHBB 2YPLE 3EYOB 5FCSH 3OL2A 3QULB 5EWIL 5F9JB 1SHMA 3QWOA 4DKDC 4W4NA 3HPJA 3O11B 4EN3D 3KYMB 5SX4H 1BP3B 1NC2A 2EIZB 4OLUH 1A7RL 4BKLB 2GT9A 3LS4L 1KJMB 2E7LA 5I9QB 3VXRB 2NXYD 3GMMB 4K94L 1A1NA 1MUJA 2IALA 2YPLA 1U6AL 3DURA 1TJHH 5JQ6H 2VUOA 3ULUD 1FL3A 1GGBH 2B39A 3HC0A 4WWKD 4WFHD 5EPMA 3CFBB 4NHUA 4OD1L 5IFHH 1T03L 2W0LA 4OZHF 4XNYH 2X05A 4LEXH 1MIEH 1CG9A 3P4OA 5GRUL 3RRQA 4L4VE 1JZ4A 3RA7L 3T2NH 4JG0H 3U46A 5I18H 1AGDB 4J23A 3GJEA 5IOPB 5DR5H 5DC9B 5E4IA 3I6GA 4MHHI 5EUKB 3SY0B 1A4JA 3B2UC 3X14A 2VXTL 1EAJA 5C0NC 5E2UL 5I1LA 5EZOL 4LSSH 4AEEA 1IC7L 2NXYC 4ZUUA 4KJWD 1YMHB 1DVFA 4YHKH 5SWZA 1QBML 4L4VA 4JPKH 4HJJH 3ULUC 1YEFL 4OV6F 1QR1B 1OARH 1VFBB 4FRWA 3BZDA 3LKNA 4HV8B 3ARPA 3IDUA 5DURD 3L1OL 4HS3B 5TPWH 1X6LA 2D9QB 2A6KB 3LZFL 5F8QC 1H8OA 2VMFA 1PY9A 1IM9A 3REWB 2YA1A 1DQQA 5D70L 4G6KL 3OGOE 1U2HA 3ARYA 3QUMB 4U1JB 1QLEH 1K6QL 4PRDB 2R1WB 2ATPB 3BVNA 4KJWC 5LGJA 5CSZA 1FORH 4QY8A 1NBZA 2EDYA 3WJJC 3FFCD 1EHNA 1AKJA 1EO8L 1XF3B 4Q9RH 2Z9TA 4XC1H 1VPOH 4O5LL 2OK0H 4WIQA 1J1PL 2EH8H 4TOYH 3KPRD 1CXLA 2GFBA 4WDIB 2B0SL 3BD4A 1NGXB 1AGCB 2NMSA 1SEQL 4N9GA 1NGYA 5GPRA 1KCUL 3C8KA 1AH1A 4NUJA 4MNHA 2AJXL 1MRCH 4ZAKD 5HI5D 3QDJA 1URLA 1VACA 2ZNXA 1Q94B 5ECJE 3VMPA 1H8SA 4ALAL 3D18A 3HLAB 1ZLWK 1S9XB 2H45A 3CFEB 2FO4B 1FG2A 3HMXH 3CDCA 4CADA 4NC0B 4KQ4H 4JE4B 5I8KL 5DJCB 2MCG1 1OP5H 1CDBA 1A1MB 3MJ9H 3N85H 2P8LA 1C1EL 1KN2L 4NWTH 2X42A 4KQ3L 2QADD 4ZAKC 1WF5A 5GGSB 1E4KA 4WWID 4NZTL 2Z91B 4E0RB 3H3KA 4BSJA 1G84A 4K9EH 4XMKH 4NKDA 3RZCB 1ND0B 4FQCL 3BPLB 5C07E 1EAPA 4G6ML 3DGCR 2QSCH 4MAYA 1AFVL 3FO0L 3KXFB 4RISL 5ESVA 4FZEH 3MNVA 5T1DH 3FB6B 5FOJA 4R96B 5JDSA 1A9BA 5K9KA 5FUCE 1YEJL 4P2RD 1HZHH 3UJIL 1BWMA 1T7ZA 4YGVB 3TC9A 3WO4B 1MPAL 3O6FD 3S96B 2WUCH 2KUTA 3MREB 1CICD 2H3NB 4JRWA 3LDBB 3WIIL 1C7TA 1I8KA 1L7TH 3AXLA 4ZS6D 2IQAA 4JVPA 2Y36H 3AAZA 4HKJB 4UAOB 2O5ZL 3UO1H 2VDRH 2Z8SA 1U8OA 1HHJA 1J0HA 5FGRA 1FIGH 3AB0B 3DV4B 2CDEA 3MMEA 3IJYA 1J0YA 1SVZA 4YQXL 1XGYH 4LAQH 4N1CA 3B9VA 3MA7B 4Z7UE 3RIFF 3RWFA 3MRBB 1XCTA 3AMKA 4M6ML 4TULH 4O58L 3DSNA 4M62L 1DN0A 5D7IE 3TA3D 3G04B 3RX8A 2I60L 1I85C 1A6AA 4UBDD 3MO1B 1RIVL 4HUUA 4ZS6C 4PRPB 4P2YA 2Q86A 3REVB 3T65B 1LD9A 3V6OC 1Z3GL 1BBDL 1FNFA 4JFEB 4XAKE 4L8DB 1F11A 3NIGE 4V1DD 3JSSA 4QRQA 5DFWH 3OKLA 4O2EB 2PTTA 5GRZA 1Q9WA 4DN3L 5M94B 1T20A 3PDDA 4OIIL 4QO1A 4KGJA 1MLBB 3RNQB 3HUJB 3P4MB 4GOSA 3HE6D 4MA3B 3O41B 4GKSA 3M45A 4O2FB 2APVA 4ZOAA 1QSFB 3CH8A 5EA0L 4AT6B 4GBXD 3LHPL 4MQTB 2E9JA 3FQWA 1CE1H 2NX5B 5EU5A 1R0AL 4UBDC 1QEWA 5CP3A 2EC9T 4D9LL 1RY7B 2VZOA 5ESAA 3GBNL 3MXWL 4K3GA 3M8OL 4WCYL 2HP4A 4R6UA 5CCKL 5T33H 1CGYA 1MFAH 4UV7L 3LY6A 1J8HA 4UQ2B 2OJZH 1TTFA 4WTZG 3O3UN 1QNZH 3NCCB 3TPUB 2Z4QA 4PJEF 4GBXC 1U8IA 3C60D 3KWWB 1Q1JL 5FM8A 4W4OC 2C7UA 2FECI 1I7RB 2CKBB 2VZUA 5CP7A 1Z9SA 2FYYB 5I73C 5FGCB 5DC0A 1V05A 2ICES 5L2JB 4MSWB 1A02N 1ES0B 3FN3A 4NQCE 1FYTE 2IPUK 2KL6A 4QTIL 4ZODA 5DJAB 4FABL 2P5ED 1Y0LB 3KGRA 3TWCL 4YHIA 2D0FA 3MRHB 3LKPB 2WP3T 2YPKA 1G9NH 3O4LD 3UZEA 3OHXB 1GGIH 1S78D 2W9DH 4I3RH 3SDCA 5T1LB 15C8H 2B1AL 5DRZA 1E28A 3WDJA 1CD8A 2LQRA 3IJSA 1RZ8A 3IDYC 1NGWB 1GVIA 4Y4HD 5DRNB 3H3BC 4NNYB 5HHMD 1NMAL 3W0WA 1U8LB 2VH5H 2RFXB 3R4DA 5I1DA 4MYWB 4XPFH 3EDEA 1T83A 5CBEA 2EXWD 5I16A 4JM2F 3QBTB 1E4XL 1MJJB 4JDVB 1FGVL 1JF5A 1FZMB 3HKFA 1M05A 3ALPA 3HFML 4DOHB 4ZFGL 3AROA 1ORSB 3MZTA 4OLEA 4H88L 1DDHA 2WW8A 1YEGH 2ITCB 4GG6A 1U8MB 4NC2B 3K81A 5D93B 3GI8H 4WHCA 4XP9L 4GS7C 3WMSA 4Y5XC 4N5UA 1IZKA 1U8PB 3NIFE 2B8OT 1D5MA 4NM4L 4UU9A 1KOAA 3DIFA 3MGTB 1MREH 1HSAB 1LE5A 1DE4B 2G9HB 4NFBA 4R4NC 43CAA 1A2YB 4XCCL 2PCPB 1EHLH 1MCNA 5ANME 3RVUD 3G5YB 4PGDB 1KIQA 4XGZA 1QFWM 2X4PA 2GTWB 3O3EA 2FL5B 5HI4C 2BERA 4EDXB 1ZLVH 1JWMA 4XBPB 5ITBL 3K8LA 1TVHA 4ZNEE 2M8XA 4D3CH 4OJFL 1KJ3H 1CS6A 1NCAL 1YY9D 3B4NA 3S34L 5BQ7A 3OTTA 5GSRB 5GSVA 4XPTL 4F3FA 1EA9C 2WLYA 3VJ6B 4MA8H 2YPLD 5E6ZA 1RMFL 5GGUA 5BZWB 2H2SD 4JFDB 3RUGB 3BP4B 5IMMB 4UQ3B 1OD9A 2H32H 1BHGA 4O51A 4OF8A 2V2TB 2DM7A 1NCWH 2DQEH 1KEMH 3H9HA 3HNSH 4HH8A 2QSVA 3QZWB 1HINL 1G7QA 4YXLH 1DUZB 2RJMA 3WV0A 3BDYH 4X8JB 1JGVL 2E7LC 3CFJA 3GMNA 3WFCH 1CYGA 3S4SA 2W60A 5ICYB 1DVFD 4YBQD 5TGBA 1FNHA 4OZHE 3C08L 1MI5B 3U4EA 4L4VD 4NGHH 5DTFB 5BZDA 5IEKA 1S9YB 1JK8B 1A0QH 1RZJH 2DYPA 1UADC 1RUML 4Q6IA 2R4RL 4W6XB 1TTGA 3U4BL 5B3NA 5IQ7H 3U7YL 3X11B 1K8IB 4MQXD 1LE9B 1CE6B 3ZYIA 3U0WH 5E1AB 4PJ9A 1XGUA 1IM9D 2MQ0A 4MJ5B 2NY0B 4Q9QL 1I9JH 3U7AA 4FFWD 1ZT4A 4P4KA 4BZ1L 3RGVC 4G8FB 2DQFB 2PW1A 3ESUF 5F8RC 4YHPB 2WSKA 3W5NA 4YBQC 3V4VH 3ZZ1A 4N9OB 1I1AD 3CXHJ 3S35H 3IS0X 2H26B 1AKJD 5FYKD 4XRCA 5T3XL 1CXFA 3RL1A 3QG6B 3SO3C 1FC1A 2BZDA 5C0GA 5FYKH 4GAYA 3EYQD 2HH0L 4GXUM 1C12A 2ILLA 5HGDA 3L3IB 4JR9L 3ALXA 3L95A 3T2QA 2JIXB 4HEME 5MHSE 3SE3C 3PL6A 5HJ3A 4CU7A 3QDJD 1AR1D 3BZFB 2D3VA 4MVBD 1I1AC 3EYVA 5DMKA 4ZXBA 1HXYA 5DWUL 4HXAL 2AQ3A 1FO0L 3GSNL 3WFBL 3NN8A 3DX9A 4KVCL 3PABB 5J56B 2WUBH 3TH4T 1XGRB 4MDIA 4NOFA 4KDVA 3U0PA 3I2CL 1CBVL 4LASL 3EYQC 1WUNT 5BMFH 4CN1A 2VZVA 3HZKA 4E42A 3NFSL 4LPCA 1XR9B 5ITFA 4PJGE 3DOSA 3ME0A 5C0FA 3QUZB 1Q0XL 5HGBB 4R90H 4RMUA 2YN5A 3MUHL 5EUOA 4FQQB 4OZGE 4HLJA 3QISA 1M7IA 2QHLA 4NJAL 3FZUC 2ZUYA 4MAYD 2XICA 3EO9L 3AU1A 1NGQH 5DA4A 1FFOA 4PJGA 1NAML 4ZUVB 1PD6A 5C6TL 1UCBL 5H94A 2VDQL 5SV3A 4ONFL 3PQYB 4BQBA 2HFEB 1UZ8A 4Z7VB 5E08H 5F89B 4XNZC 1AHWB 1WEJL 4OF5A 2EYTB 2YS4A 1E4KC 3BPOB 1WZKA 4NKIL 4U2ZA 3N1QC 2Z31C 3ZDZE 3NABH 3MLXH 1N6UA 2FX9L 5FKAB 3PGDA 1NGPL 4S1QL 5I73B 2D7QA 1NMCC 1NCDH 5E5MB 1JN6B 2NQCA 2P45B 1S3KL 4QOKA 3FMGL 5F3HA 1ZXQA 1MCCA 3U82B 5F7FA 4JZNA 4XNUL 4Y16B 5E8OB 3OKOB 5EU7E 5HDOA 4TQEH 4I0CC 3AM8A 1EZVY 4MXWH 5D5ME 4CVUA 3KAAA 1OGAE 2HLAB 4P46B 4WV1A 1MCIA 4R0LB 1MJ7H 2EIBA 4OD2B 4EQ3A 4DN4L 3KLSA 1AXSB 1TETH 4IRJB 4JM4H 5HY9B 5I75C 2D7TH 4FTVB 2W0KA 3IDYB 5FUCC 4NHCL 3MRRA 3BN9C 5GHWL 5I71B 2BVOB 3BW9A 2VXQH 1KLGB 1RK1B 3OKEB 2P8MA 1VEPA 5IGXL 5JPMA 1PG7H 2PN5A 1P84K 4S11A 3F7VB 3MOBH 1DEDA 3BXNB 2V2XB 4BZ2H 5HGGS 1UWGH 3B9DA 4KRLB 4HIHA 4KTDH 1T04A 2AJVH 3GSOA 4XPBH 1D6EB 4FQIH 2R0WL 5T1KA 4U3HA 5EFIB 3NPZB 2VDLL 4M6OL 1MVUA 5DD0L 3VGAB 1DZBA 5FAAA 1UJTA 2V7NA 5J13B 1M71A 3N1FC 2DM3A 4OUOA 3P77B 5CP3H 3WN5B 1J8HD 1GZPB 1F6AB 3BN3B 4R2GB 1KB5H 4HS6B 5CJQH 4EDWL 5AZEH 2UWEE 4QRRA 5F6HI 2Q76A 5IMOB 1VEMA 4KY1L 4OCRH 3QYCA 1GH7A 2Q20A 3VI3E 2V17L 1YNLH 3LPGA 2J6EL 2MKLC 2VQ1A 5CJXC 2APTA 3EDDA 5KZCB 4I48A 3RIFK 4NN5B 3L6FA 1IT9H 3BUTA 1WIOA 3LEVL 4ODVL 2APXA 4D0CB 2X4OB 3HG1A 4PY7A 4X98A 1B0RA 3BP6A 3IDJA 4W6WB 3SGDI 2DI7A 4L29A 4F33A 2X7LB 5HYSA 5T1MB 4PJEE 5IVNA 1NBYA 1QLFA 3TNNB 3QFJB 2H2PD 5L7XL 4PJ5E 3D39B 5FM5O 4BA8A 3MJ8A 5E2TL 1G7MA 25C8H 4HXBL 4RFOH 1KPRA 5D71L 5I74B 3TN0D 5HDBF 4LEOA 1KN4H 3ARBC 3ABZA 4OAWA 3WS3B 1FYTD 4JN1H 1NCCL 1CI5A 4KTEH 1ED3B 5IESH 1S7SB 1NSNL 2C3VB 3VGHA 3OXRB 3D5OF 2D4DA 4L8CA 2YUWA 3P0VL 1RZFL 3FONA 1YNTB 3PG2A 4ENEC 1TJIH 1P7QB 1KC5H 2H2PC 1FNGB 4LBEA 4UZGA 5L2KA 1A7PH 4KHXL 4MMXC 4FMFA 2J5LC 3BRDA 3EBAA 4LPWA 1WGOA 3ZKND 2WBJB 2WWMD 5IFAL 2LFGA 2JKXA 3TN0C 5CGTA 2X4QA 4EJ1C 4HC1L 4A6YL 4AK1A 4RZCB 3C5SB 3WFHA 2F19L 4U1HB 2OTUB 2A83A 2BC4A 5J4MA 4XNMB 3IETB 2QR0A 5GGVH 3RGVB 2QKIB 2X4SA 3ZO0A 4OT1H 1N5YH 2YC1A 4M1GL 2PYEE 4L8SB 2VXVL 1XF4B 3D9AH 1QSEE 3T0EB 2QTEA 4QRUA 2YMXH 2WWMC 5IVZB 5FUOH 3BH8B 1HIMH 1AI1L 4KRPB 4PJBB 5FO7A 3VA6A 43C9A 1FC2D 2AV7A 3RTQB 1Z5LA 3IJHA 4RQQB 4JY4A 3IXAB 2BY1A 2Z35A 4KK6D 1Q72H 4WW2B 2DRUA 2P42B 1AJ7L 4HS8L 4X6DA 3NACL 4PYHA 3T1FB 4G6JH 1IAII 3ES6A 1H3PL 2EYSB 3QUKA 3F58L 2I5YL 1KTLB 2GJJA 3OR6A 3GZKA 5AUMB 1QRNE 2P7TA 2YKLH 4E5XA 1NCBL 4K71C 4UT7H 5T3ZL 2E3VA 1DEEB 3NCMA 2NY4B 5EC1A 4POZD 2F8OA 5JQHC 3P3YA 4M1CD 2I07B 1OP5K 4WO4B 1YQVH 1MCPL 2MQ3A 2YD4A 3FO9A 3LSOA 3VE0A 4N0CC 2MHAA 3MRLA 1IFHH 3WLWD 3ULVL 4ZSOE 1XF2B 1E27B 2HRPH 2HWZL 2AV1B 2BNUB 2NY3D 2EDXA 2X2YA 3LKSA 3VFWB 1J1XL 1QRNA 2XTJE 3QP3A 1FVDA 1XCQB 4X7FC 4K3HA 4MD5A 5KSVB 1P2CB 1G6RA 4JJ5A 5IB1A 4GMTH 2YD6A 3CGTA 4KV5E 4ZSOA 1R3KA 2V2WA 3BGFC 4BK5A 3CH1B 1ZGLP 2F9BT 1SY6H 1LO3L 3J8F7 4IDJL 2NY7H 4M1CC 4MB3A 4ZUWB 3RNKB 2DYPD 1ADQH 1CGVA 3BP7A 3NA4A 2JCCA 3IKCA 5C0DA 5TDNB 1RK0A 5ISZB 2NY3C 1SYVA 1EH9A 3VCLA 4PJ9D 1IGYB 3MV9E 4L1DA 4P2OA 4P4KD 5LXGL 5IVOA 3CLFH 2PR4H 5C3LD 3TYGH 1AQDA 3DYMA 1N2RA 1NMCB 3WHE1 4ZPTA 4NN6B 4IOIA 2ADGA 1TNMA 3O4OC 3WXWL 4ZD3H 5I1KL 4KC3B 3O2WH 4MS8C 3L3JB 1GZQA 1AGFB 3CX5J 4G5ZH 2H6PB 1JZ6A 3W2DH 1I3RB 2YRPA 4X9HA 3HR5A 2G5BA 3DX7B 1NGZB 4PJ9C 1LEIB 1U41A 1CIDA 5D2NE 5INCA 1JPSL 1OM3L 1LO2L 3BKMH 2R9HD 1RI8A 2BDNL 2NTFB 4JFXA 4JLRA 3B2VH 3QEQB 3STZA 2DAVA 4ODUA 1UXWA 2Q1EA 4ZXBD 5C0BB 3U30B 2EE6A 1FFNB 5I75B 1FG9C 4G42A 1A7QH 4OLXL 4KMLB 4X80H 2DLFL 5D2NA 3BPNB 4XP4H 5ESQB 5GIRA 2VISA 5IJKA 3QHFH 4ZOCA 3ALWA 2RAMA 4LARL 1UM6L 3WIFA 2CSPA 4P57B 4HUVA 4TSAH 4LCCB 5F9OL 4DAGL 2R9HC 4R3SB 3VFNA 3TM6A 5FYLL 1TZGH 2AKRA 4L5FL 3WIHA 5HYQB 5LGHL 3T8XB 5F97E 3UTTB 1T5WA 5D72L 1YEKH 4WY7H 5ID0B 4BUGA 1YN7A 4QYOB 2ZG1A 1AE6L 4U6TA 5LKNA 1A6UL 1OWRM 5CJ5A 3QIBB 5KVGH 4FQXA 4CBPA 5I1EH 1BFOB 1F2QA 1EGJA 3HZVB 4WEBL 2WQRA 4YE4L 4WU5B 3DROB 3A67H 1UB6A 4QGYA 1ZV5A 4U0RC 4P2QB 5E0QA 3VWKA 3WFEH 2UY6A 1KPVA 3P0YL 3SOBL 3M1BB 5DD3H 1MWAB 4NZJA 1P9MA 3TV3L 1BEYL 1IGTA 2FATL 3MBEC 4RRPA 4OFVA 1ETZA 4LCWE 2VZ3A 2XKUA 5C0AB 3VD7A 3UJTH 4S1SH 3MLVL 3MRNB 1JZ2A 3GIZL 4Y4FC 5GS3A 5DRWB 1RULH 5JZ7D 1A4KA 2XQBL 4QOKD 2EDOA 2GITA 3L3DB 3NIDE 4M6NH 3ARDA 1YPZF 5E6YA 4YO0B 2J88L 4MWFB 2HKFH 3UBXI 4WUKL 3QXAA 2O26U 4G7VH 3TJEH 4OB5H 1M6OB 1NFDB 4FNLL 1HH6B 4Q2ZA 1GGYA 5F72S 1UM5H 5EOTB 4YXKL 4NT6B 3QIWA 2XZQH 1H5BC 1MJUH 3PIQA 4K3EH 4MJIE 4MB4A 4C83B 2P5WA 4PREA 4LSQL 4NRXB 4XVTH 5DK2A 3MV01 4E41E 3CUPB 2ED8A 4OUUB 5JZ7C 1MQKL 3DUUB 3D3VE 2OLDA 4HT1L 1D5XA 2HJFB 2F54B 3WDIA 4RMRA 2R69H 4WHDA 3MV7A 1J7VR 5I76A 1J18A 3OKMA 5TDOB 2ADFH 1K4DB 2ADIA 2XN9E 3C8DA 2AJZA 2EH7L 2ZCLH 4KKNA 1AXTH 2R0KH 1K5NA 4QHMB 4R8WH 3AM8C 2YSSB 3MLRL 2EDWA 2FHFA 3U79A 1W72A 3D3VA 4NQCB 5BRZA 5FGBA 2UYLA 5D9SB 1W0VA 1N5AA 1HHHA 3FQRA 4LRNL 3ECBB 2AK4B 2BOBA 5DQDL 5HHVL 3B5GA 5FA3A 4WRLA 4IBLT 4HDIB 2XN9A 2DTMH 1I8LA 3AS1A 4QHNB 2XKNB 5EU7C 2QL1A 2APBA 3EOTL 2DKMA 3LKRA 1EXUB 3TVMC 1QA9B 2VQTA 1SEBB 4XTRD 2BY3A 4I18A 4JGMA 4WFEE 4KDTA 4FFZL 1E6OL 3VRIB 1BPVA 1MNUL 1ZGLB 1TCRA 5C6WH 1A3RL 4QRRD 2MCPL 1B88A 1FE8L 3SCMB 4JRXB 5D7LE 4KZDH 5EBGA 3B43A 1TVBB 5IBUB 1BFVH 1ZLVK 3HE7D 2YK1L 2C1OB 5EORL 4LPTA 1ZVSB 1P7KB 3BESR 4DZ8B 5CINH 5GGRY 2R4SH 1I8MA 4HJGB 1JGEA 5DQ9A 4UT9H 4ZTOL 5CJOL 3L3OB 2Y1VA 4H26A 1CTNA 4GSDL 5IB4A 2V9RA 4WHTB 4GG8A 4XTRC 5D7JC 5IROC 2DM4A 2ZPKH 3MNZA 2AS5M 5JXAH 1MEXH 4Z7OE 1PKOA 3HZYA 2AJ3B 2DMBA 4X6BB 2EDLA 4IMLB 4RFNB 4BFGA 1S9KC 2C4FU 5IW3A 1F00I 5JPNB 5DDHA 2XOTA 4GKZA 4I5BB 5SX5H 3HE7C 2YD7A 1SBSH 2NNAB 2FGZA 1H0DB 1MFCL 4LSUH 4ODWB 4JG1H 5F44A 3RQ3A 2J4WL 2I9LA 3NBNA 1H3TA 1DJSA 4WW1B 1YDPB 1NQBA 3X13B 4PJAA 5HDBE 5FHBH 4KJYA 1YN6B 2CD0A 3I84A 2VLRE 2RHEA 2E6JA 3QJFA 2AEPH 4DQOL 5ERWA 1JZ8A 1YEHL 4LSPL 2YBRA 2F8VA 2VO5A 3WS6A 4LKCA 1VGKB 4PG9A 1LEKA 1AIFB 4AG4H 4K3DL 2IPTL 5F9AC 5JW4N 4LHUB 2CRYA 1A3LH 5D6DC 4UIKH 2BVPB 5GRJH 2QSTA 3GGWA 4KK8D 4ZDHA 3KPMA 1FZOA 5EUOF 3RZWA 3WSQL 5JLZA 2NR6C 4NDMA 3LN5B 4PYGA 3Q1SL 3GSWA 1H15A 2DQDL 2XTLA 2HG5A 5DD1L 2V5SA 3O6KH 1KIPA 5C08E 4B50A 1BLNA 3RVWC 4J6RL 5E94A 1BJMA 5D8JL 1AD0A 5I0ZA 4J8RB 1CXHA 1S7RB 1QSED 1CLZL 4XCFH 4KK8C 5GZNC 5C08A 3V7AG 1DBMH 4LVNC 1MY7A 4WI7A 4ZNCD 2FZ3B 5BV7C 3H9SA 1RU9L 1LEGB 4UILL 2LU7A 2VN7A 1IZJA 5C09B 4X6CA 5E8PB 2RCSL 1KUMA 3IRZA 4FXKB 5ACZB 4Y88A 4GAGH 2NTSP 5JW5B 2JELL 6FABL 4JN2B 3F7PC 4CNIA 4S0TD 1OTSC 1KJVA 4UNVA 5IUSA 2OQJA 4BH7A 5JDJA 2ENYA 2P24A 3LIZH 4LDEB 2OSLB 5FB8A 1QRND 4ODHL 4EUPB 4U4BA 2HA1A 3FN0H 1WBZA 4NSKA 3O3DA 3MBXH 3SKJL 4DGIH 1NC4D 4M00A 4IS6A 3MGAA 1NBQA 1CDHA 1ZHBA 4TUJB 3QXTA 1MRFL 3OBAA 4UINL 3HC4H 4OFPA 4Y8DC 3KPLB 3ARED 5TF1L 3MROA 4FQJL 4OKVB 1G6RH 3QDMB 1KCRH 4K8RD 4S1DD 3S36X 4L3CA 2X1OA 2VE6B 4LU5H 3O6LH 2HYMA 2B7DT 3QNXA 5EIIA 2I26N 4LLQB 3ARGA 3CK0H 4JY5H 1SJHB 5BXFA 3HAEB 1X5HA 4UTBL 3TZVC 5HHXL 4BQCA 3O8XB 3NA9H 1G7IB 1RVFH 5K59F 1EVTC 2B4CH 2VN4A 4P2OD 4Y2DA 3SDAA 1RUPL 4PY8J 1PX3A 4KGLA 4XZUB 5JOPE 2XNAB 3S5LA 1B4JH 2XWJA 5FV1L 1HQRA 3AREC 1RIHH 4M5YH 3B5TA 3TIEB 1ZA6A 4XCYA 4OV5B 5T5FL 4F58L 4F7TA 2XTJC 1MFDL 3MV9D 5TQ2H 5AZ2H 3Q6FA 5INDA 1Q9OB 1D6VL 4HFUH 1S7TA 3F5WA 5HVWA 1QG3A 1I3VA 2EO9A 1F3RB 1U8HB 2CIKA 1YYLL 5FM4A 5LCVH 4Z78A 4H20L 5KTEH 1XZ0A 4Q0XL 3U0TA 4WFGE 4HSQA 4M7ZC 3C2SA 4UTAL 2AXGB 1ONQB 4HBCL 1ZWIA 1H5BB 3TFKD 5D7KE 1N3NA 5DUBA 5BS0A 2VLME 1I7ZA 2WIIA 3VG9B 1NMBH 5FO8B 3IU3B 2R0LL 4WUUB 1UWEH 4Z0BH 3O2DH 4QXGH 2NY1B 3QDGE 1WSST 5EU3A 3P4NB 3I6LE 3FT4B 2EIEA 3BEVB 3IFOB 3EDJA 4OFYA 4RGNE 3QEUA 5ALBL 5KBNC 4LIQL 1CFBA 1WFNA 3U4AA 3HTLX 3GMLB 4U3XA 3LCYA 3RWEA 4IOSD 3NCYS 3TBSB 3U9UB 2L0DA 3B9KA 3UZVB 4NKOA 1QLRA 2R15A 5GQBA 5DJXB 3TFKC 4PV9B 2A6IB 2AQ2A 5EG6C 3MLUH 3FT2B 4H8WC 5IIEB 4NO0A 3JVGA 4NQXB 4DJMA 1EVUA 1TPXC 3WIHH 4FQXD 5B3JE 1A7OL 1HHIB 4FP8L 5D2NC 5EU6B 5J9PA 5HHPB 2BSSA 2CK0L 5EO0A 2MPAH 4I9WD 2CLVA 3DX6A 4X9IA 4QF1A 3VWKD 1IL1A 1EGJH 2J2ZA 4JHAH 4OCMC 3ILPA 3RU8H 2F5AL 1ZLSL 3JTSB 4OQ1A 4HH9A 1KG0A 1A6WL 1P69B 4X99B 4NQSA 1IEAA 2ITDA 5L88L 3NAAH 5C0RH 5KAQF 4I0PB 3VWJA 4KVNH 4IRZL 1HE7A 4NQEB 5HYJB 2ZNWA 1FVCB 5DUPL 1D5BA 1D9KA 3LMJH 3N9GL 4Y1AA 3HC3H 4HCRL 2YXMA 3ARDD 4NN7B 2ZWLT 4UOJA 3GM8A 3GJFA 5JXEC 3KYOA 1EMTL 1YQ2A 1I8IA 2D0GA 1B4RA 2ZOKB 4ZFFA 2ZKHH 1P9MC 1ZEAH 4N68A 5F88A 1U36A 4ZTPH 5I8CB 5J6GB 4MDJA 3QIWD 5C7XL 5C2BL 1KCVH 5IQ9B 3PNWA 1CR9H 3IFLL 3U1SL 1VFOA 5FDWA 2CGRL 4PG2A 4Z95H 2P5WD 5E24E 1K9TA 4X6DF 4IIQB 1YPZE 1F4XL 2FO1A 4OFDA 3HZMB 3EAKA 3MXVL 2DS4A 2DQIL 4X6FA 1DL7H 4X5XB 4YDKL 4NQDA 4JFFE 3O3AB 1MCWM 2P47B 3MV7D 5A2JH 2VRAA 4MJID 1NL0L 1PEZA 1FVEA 2CDFA 4BYHA 2VAAB 4E41D 4S2SB 2UZYB 4TPRL 3QIWC 1OP3K 4UUJB 3D3VD 2FECL 3V52H 3C6LC 1KSRA 2HRLA 2E6PA 1MCQA 3D1MC 5DURB 3NTCL 5CGYD 3WD5H 4PJEB 1S7WA 3U2SB 3EYUH 4L3EE 1TNNA 3MYJA 4NUGH 2XN9D 1W72H 4PJ5B 1ZSDA 5CZXD 3V6ZB 1CQYA 5FIEA 3LKQB 5B8CB 4GXVH 1QFWH 5LBSL 3DO7A 1R24A 2ZSVA 4JRYA 4HFWA 1YEIL 2YRZA 4Z8FL 1RUKH 4HQQL 5DK0A 4NNXA 5JIKA 3QFDA 12E8L 3V7AE 2DOCA 4N0UA 5IG7A 3MLSH 1CDGA 4KI5D 3FFCB 5HYSG 2BSTB 4WJ5A 1DTUA 1Q38A 1PLGH 3QR2A 3T08A 4IHOB 1J9CT 1JV5A 1I7UB 1KLUA 4APQA 2FD6H 2IANB 3L7EB 4MCZB 5I66A 4R7DA 3V4UH 3O0RL 3MOAL 4LVNB 2VLKE 3BO8B 1OLZA 5F9WB 4HEPG 1JNLL 4YHLH 1JHTA 3FB5A 1INQA 4U6YB 4OGZA 4KKBC 4MB5A 2LTQC 3QO1B 2D31A 3GMRA 3Q6GL 3D85B 2FJGA 4LK4A 3G6JA 2VIRB 4NJ9L 1WBXB 3VG0L 1C5BH 3SBWA 3SDYH 3QQ9C 4JM2B 1ITBB 4OSUH 4U1IB 2V5TA 3H7BA 2PYEB 2VLKA 5GS0D 2VXSH 2X4TA 1XGTB 3G5XB 2A6JB 3BQUC 1KTDA 2Y5TA 5KAQG 1QTYT 2QADB 5D1QD 2EZ0D 3KYKL 1GIGH 2C3WA 1I1YA 1W8OA 2WLZA 2X70B 2V5YA 5FF6A 4YGAB 4G8GB 5EZJB 3RY5A 4AEIL 5DA0B 3O9WB 1INDL 1U95A 2JB5H 3VXSA 3UPRA 5GS0C 1R3HB 4DK3A 1LO0L 5IM7B 3D2UB 3QCUH 3VXOA 4KPHH 3GMQA 4HKZB 4GMSH 3ROLB 3VXPB 2FX7H 3MRIA 2VLRD 1NAKL 2A9NL 2C3HA 3PGCA 3MCKB 5ICZA 5D1QC 3ZDXF 1DUYB 4AEHH 1JWSA 3C09B 3O6FB 1PQZA 1CVSC 1E6JH 5DJ6A 1CICB 1N26A 3MRMA 3S6CA 1KEGL 3BSZH 5E5RB 3SDXE 5CHNB 5AD0A 3ZKXC 1OQXA 1OAQH 3Q3GA 3CXHK 1NLDH 2PO6C 1BOGA 3SKNA 1L7IL 3GFUA 1CFVH 4I3GA 1MHCA 5DT1H 3T77B 3JV6B 3PWJA 2OMBA 3EYSL 3IAGC 1OGTA 4PLKC 3NCBB 3UTPD 1OD7A 3D6GA 1S7VB 3SDXA 2D9CA 5C08D 3RAJL 1UA6L 3ARSA 3FL7A 3H9SD 2EICA 2IAMA 4J3OC 3TA3B 1BIIB 2HFFB 1PYWB 1FL5B 3CDYA 3W39B 4K94H 4M7LT 1XIWA 3VXME 1P6FA 4OCNC 4D2NA 3SE9H 5H35A 1AGBB 1YUHA 5E9DA 2H1PH 1IC4H 1XF5B 5FYJL 1BQLH 5AYUH 2VXUL 4AM0B 3RFZC 1KBGH 4DCQB 1CT8B 1JPGA 1KNOA 5CLTA 1YMMB 2R2CA 1KXTB 3FAXA 3MRQB