1NC2B

Crystal structure of monoclonal antibody 2d12.5 fab complexed with y-dota
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
EVKLQESGPGLVQPSQSLSITCTVSGFSLTDYGVHWVRQSPGKGLEWLGVIWSGGGTAYTAAFISRLNIYKDNSKNQVFFEMNSLQANDTAMYYCARRGSYPYNYFDVWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY 2D12.5, LAMBDA LIGHT CHAIN
publication title Crystal structures of two complexes of the rare-earth-DOTA-binding antibody 2D12.5: ligand generality from a chiral system.
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2002-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nc2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nc2B01
1AGDB 2GTWA 1LDSA 3IETA 4OGYH 4TNVK 5FKAA 3L3JB 3GSNH 4R2GB 4FQHB 4RGNC 4WTXA 4S1DC 3TNMA 3QUMB 1HOCB 4N0UB 1K8DA 1H8NA 5GS1C 4BSJA 1NL0L 2IANA 4ZQKA 4KRMB 3PWNB 1HNGA 3HR5B 4HXBL 4WWKC 3LZFH 5GS0C 5D7IA 4K94H 4ZS6D 5IOPA 2EDLA 4UIMB 4Z77B 4ONFL 1BPVA 4OFDA 1SM3H 4E0RA 1MFDH 4Y2DC 3MLUL 2EDOA 1AXTL 3QXTA 3I85A 3CFKA 3VCLA 5C3TA 5C71A 1T1WA 1UWXK 3MGTB 1IBGL 4KXZH 4JR9L 3MUY1 1QFWI 4TQEH 4JFED 1CF8H 1FL3A 1XCQA 2CDEA 3PDDA 2LABA 3VXPA 4ODVH 1TQBB 1NAML 5L8KB 1TLKA 5CEXB 1G6RB 3FHQA 3VFUB 1JPST 1FH5L 1HSAA 4G7VL 5DUPH 3RVVD 2AXFA 3ZKMC 1CFNB 5D1ZD 3TYGL 2ICWJ 4J3XA 4HS6A 3I02A 2RIKA 1H3TA 2A38A 5L9DH 4TULH 4NWTL 2ORBL 4JM2C 1IGCH 3GJEA 3CSYB 5ADOL 2AKRA 1YYLL 2YWZA 4HKZA 4NQSA 3B3IB 2ESVD 1U42A 1Q38A 3A67H 3MRKA 1JVKA 5CEYA 1IAOB 5T1LB 4AEIL 3LS5H 5JOFA 1U8LA 3MOBH 1Z9SA 4MQ7A 5D2LE 4YXKL 2P7TA 2O61A 2W0PA 4LU5L 1ZANH 1GYAA 1O5DT 4WFGD 1YPZB 4UQ2B 5DJAB 1AR2A 3AXLB 5LGJB 5JW4N 1YNTB 5HDQL 3OZ9H 3TO4B 2HJKA 3CC5B 3LKSB 3D1MC 4NM4H 3QA3A 3HG1B 3NCCB 4H25A 5BVJB 2X89D 5IJVA 4KH2A 1EHAA 3U1SL 4JHWL 4HCRH 1EUUA 3CLFH 1AQKL 1IARB 1YUHB 2XKUA 1J1PH 4LKCA 2NMSA 3G08B 3MV9A 1KC5H 4WI8A 4WRLA 3P0GB 2VR5A 4OCMC 4Y1AB 3VFRA 4OQTA 3BPLC 5HVHC 4S2SA 1ED3B 1KELL 4KRPD 5T1KA 5DT1H 3MBED 4X83A 1T89A 1EFXD 1EMTH 5JIKA 5C0AA 4OSUH 4JPVL 1KFAH 1HQ4B 4Y0GA 4PJ5A 3RL1B 5EU7E 2BXYA 4IMKC 5KVMC 3WKML 3I50H 4YFEA 1CDGA 4FQCL 2CUMA 3S97C 1A6TB 3QNZB 5DEFB 5I9QB 5IP4A 1N0LA 2BFVL 3T4YA 4OLZL 3L95B 2FEEI 1ADQA 2Z31B 1YA5A 4L8CB 2H9GA 1NEZB 5IEHA 1AP2A 1HDMA 3CAFA 5JIHA 5BZWB 5DJCB 3U79A 5EZOL 2VE6B 4PRIE 3KS0J 1PFCA 3QUML 2I9TA 2D31A 1RZIB 4EVNB 3MMEA 4PB0L 2WBKA 3VFSB 2MMXA 3RFZC 2YS4A 4OZFA 2R4SH 3O6LH 3IDUA 1NCCH 4DEPC 2XACC 1N59B 4WW2A 5EZIH 3S36X 5IB3A 4LHUA 1I1AA 5IMLB 2BVUA 2HTKC 3MRDA 3MR9B 5L2JB 5JUEL 4MS8D 4PJ9D 1SEQH 3BKYH 4P23C 4QO1A 1A7RH 2C9AA 1U3HD 4XMKH 4LCWB 5KVDH 1Q1JL 4NBYB 2DBJA 3QEUA 3ULUL 3QHFL 5LCVL 5B3NA 3H7BB 2ICWB 4RNRA 1RK1B 4KQ4H 5C0BB 1WSST 3PWUA 1RHHA 2IH3A 1BECA 3QEGL 4P9HH 1UXSB 4NNXB 1G9NC 4X9HA 5E95B 4F7PA 2VNCA 1ZT1A 4K7PH 1JWSB 4LBEA 2M26A 3GSOA 1P7QB 2PKDA 3U46B 1FV1B 3LIZL 1TJIH 4BZ1L 3DVNA 5E8DL 4ZTPH 4YC2B 3H9SD 4XHQA 1IC7L 2OMBA 1NFDB 3S96A 1P6FA 5DRZB 2AXGB 4JG1L 3N1PC 1A6WL 1ONQB 35C8H 4G8EB 4JKPH 3V52L 4P2RB 2PTUA 4UU9B 2P8MA 5K9QI 3RTQA 1IRAY 1AFVH 3O8XB 3GSQB 1OARL 4I18B 5L6YH 3W9DA 4GAGH 2V2WB 2C3XA 1G7HA 1JL8A 3RVVC 4JJ5B 3TA3D 4XNXH 1BQLL 3VFVA 2G5RA 4JRYE 1T04B 3QPQC 4QHKI 1CLYL 5F3HB 4KXZI 3QQ9D 3U7AA 3QUXA 3W2DH 3T04D 1IGIL 3LN4A 4QRSB 3ZYIA 4DJMA 2EE3A 5CBAA 2AJ3A 4JQIL 3MRMB 1A7QL 3NH7L 1DZBA 1SJXA 4PREB 4AMKL 1ZE3C 4ERSL 4S1RL 3S9DB 5LQBL 3HI5H 1JGVH 1OAYL 1E6OH 1QD0A 4M1DL 5B3JF 1RY7B 1EO8H 1Z0MA 4R96A 1UJ3A 1E4WH 2XN9E 2ZSWA 3KJ6L 3PHOB 4FZ8L 2Z91B 4KPHH 3L1OH 3MROB 4N68A 4Z95H 3HMXL 2QR0A 2NW3B 3I6LD 1KIUA 4H0GA 3SJVA 4QT5A 4IDLA 3RRQA 4IOIB 4J7RA 1VHPA 3CMOH 4LLWB 5BQ7A 4M5ZL 4NQDD 5DQ9A 1W72B 3C5SA 2JKXA 5A16B 5EU6E 3MNZB 4LVHB 3GMOA 5HYJD 5C6TH 1FJ1B 1N64L 4BZ2L 1KJ3L 3K8KA 2R9HD 3E8UH 4KRPC 4QRRE 2D0FA 4ZNEE 3MBEC 4P4KA 1F42A 1XIWD 3MRLB 5EOTB 3G5XA 4NKIL 3IFNL 1I1YA 1MIML 1XGUA 1X5KA 2HT4C 2XWTA 2IAMD 3T08A 1NC4A 3HC0A 1NC2D 5FCUH 2P44B 3V5KB 4UV7L 1A6ZA 3JWOH 3BDBA 4JM2A 1U0QA 3MOAL 2GTWB 2RB8A 5FKAB 5D6CA 3MRRA 3TESA 3LD8C 3TNMB 3HE7D 1JPTL 1K8DB 2Q8BH 4FABL 5JPMA 3I2CL 3V4VH 5FHBL 4DGVH 1DANU 1QLEL 2IANB 4ZQKB 1EDQA 2IGFH 3DV6B 4YHZL 5JORA 5D7IB 4EDWH 4KDTA 3EYQC 3HAEH 4R26H 5IOPB 1GPOL 3P4LA 4E0RB 3QDGE 5C70A 4PRDA 1R5WB 4MCYA 3CFKB 5INCA 3QR2A 2EDYA 3BGFC 1S7QA 1T1WB 2EDHA 3UTSA 1PKQE 2CLZA 2F5AH 3RWIA 2KUTA 1F6AB 1FL3B 1YQ2A 2CDEB 3FB7B 1Q9WA 4IRZL 3VXPB 4CBPA 4M62H 4P9MH 4G6ML 4PJ9C 2BSRB 1HSAB 4N90D 4D9QE 2EDRA 2AXFB 3CVIH 5F6HI 3ZYZA 3ARTA 1U3HC 2YD5A 3RX7A 3SN6N 1LO4L 3N85L 1WZMA 1F2QA 3OKDA 3I02B 4HS6B 4RWYL 3SY0B 2FD6L 1CTOA 5T5NF 4JEGB 1JZ5A 5CP7A 4XMPL 3GJEB 1GSMA 4GKZA 2PO6B 1JGUL 4LQFL 4NFDA 4RZCA 5IFHL 4HKZB 4F80A 2B1AH 4NN5B 3HZVA 5JW5A 3MRKB 4H8WL 5CEYB 3RX8A 3QG7L 1U58A 2AK4B 5JOFB 3FFCE 3K3QA 2VDOL 5EUOF 4MQ7B 2O61B 2P7TB 1LDPH 4KI5F 5DD3L 1QA9A 1T7VA 4P3DA 2BSSA 4PJHF 1BQUA 3QPXH 1GL4B 2C3HA 5LGHH 3Q5TA 4QRPE 5K93A 3DRTA 2GIYA 2CUIA 3AM8C 2NX5D 3IXAB 5D2NC 5GGSB 3PF2A 3UPRA 1D9KA 3BEVA 4JY6A 3WLBA 1RURL 5DLML 2HJKB 3JWDL 3U9PL 3G5YA 1ZLUH 3QA3B 4DW2L 3BUYA 4H25B 1A6AA 2JCCF 4P46B 3VFGH 3QDAA 2MTPA 4KROD 5IJVB 2MOVA 2R0ZH 1B6UA 1MAKA 43C9A 1CICA 2F8OA 3EO9H 3MV9B 5JXAH 4XC1H 1FDLL 3NPZB 3HZMA 4S2SB 4JKWA 5IGXH 3SOBL 4UOJA 2P5ED 1JWMA 1WEJL 2WBJB 4MB3A 3DXAA 4LLAA 5F89A 3LEYH 4PJ5B 5ANMA 3SKJL 3CPLB 1OW0A 1WBYA 3L3KA 4JPIA 3VA2C 4JFYA 5FGCE 4QLRA 1OOAA 3CFDB 4KV5F 5A2KH 2Z8WC 4X6CF 3ES6A 1MAML 4X8XA 3K7UA 1QPXA 5J4MA 1CDJA 4MJIE 1CXIA 1DLHB 4KKLD 4LKXA 2H9GB 1FYTA 4N8CL 5DGRA 7FABL 5IEHB 1AP2B 5F6IC 1HDMB 1K4CB 3IJYA 1MWAA 4GAFB 4ELMB 2I9TB 2VLMD 2D31B 2BNUA 5CJOH 1MHCA 5KANI 3C08L 3MMEB 4TOYH 3VFPA 3ZDZE 5I15L 1MQKL 4ODWB 4WW2B 5IB3B 3X12A 4LHUB 4N8VA 1TZIB 1I1AB 1HN1A 1CQYA 1MFNA 4Y2OA 4WI9A 5FUCE 3MRDB 1WAAE 3E2HB 1J5OL 2CRMA 4W6YB 2NY1B 2MQCA 5K9QG 5E03A 3RGVA 2OK0L 4Z7WA 4JZJA 2AJXH 3QEUB 3K1DA 3QZWA 1GGTA 3D3VE 1TENA 4RNRB 4K94C 5FHAH 4LEXH 5BV7B 2PYFA 3PWUB 4GAYA 2IH3B 5FAAA 4PYHA 3G5ZA 5L0QC 2APFA 2VISB 2Q87A 4M5YL 1NSNH 3HE7C 2BRQA 4OUUA 3Q6GH 4OCNC 2W1NA 5MI0B 1ZT1B 2XNAB 2VLRB 5CZKA 3GSOB 1QLFB 5JQ6H 1ORSA 5GJSH 3V6OE 3DVNB 4L3AA 3VH8B 4OAWA 5DK0A 3S96B 1ZS8A 1MFBL 4BQ9A 3MBXL 1QRNE 4JZOA 5FB8A 4FTVE 2X40A 2F8XC 4LIQL 1WTGT 4X6BA 5ENWA 3RTQB 2BNQD 3W9DB 4F7CA 4D9RE 1G7HB 4LDEB 3R1GL 2R69H 1OAUL 1RULL 2ZPKH 5ICZA 1BZQK 3PNWB 2A9ML 5J57B 1CLZL 3QUXB 1D5IH 2WIIA 4K7PX 5D1QA 4G9FE 4HC1A 3LN4B 4N1CA 1IAIH 2H1PL 1G1YA 1S5HA 5CBAB 5D7LD 2AJ3B 3ARFD 4OQTL 4G8GD 5H2BA 3EO0A 2AK1L 3VFNB 3EYFA 3K0WA 5JIPA 3VXUE 3GO1L 2GHWB 3HFML 4QOKA 4UI2A 1I9IL 2IPTL 4PJAA 4N0UE 1UJ3B 1JHLL 5CFHA 2ZSWB 2ARJA 4U7KA 4Z7QE 3HZYA 1QFWM 3A6CL 2QR0B 1UZ8A 2VQTA 1FFPA 4TTDD 1CFQA 5F44A 1ADQL 3O9WA 4PBXA 5EWIH 1C16B 4QT5B 1F4HA 3SJVB 4JM4L 3VXQA 4WI3A 1UKSA 4KROC 5BQ7B 4YEEA 3MLWH 3GKWH 5DQ9B 3C5SB 1LO0L 3FB6A 3T2NL 1FO0H 3SQOH 4JFOB 4NT6A 3GMOB 4YFLI 8FABB 1CGSL 1Z3GH 2IWGA 4X4YB 2WWMD 2NY3D 3Q5YA 4I0PD 4P4KB 1ETZA 3RI5F 5D1XB 1IGMH 4G9DB 4MLSA 1I1YB 1XGUB 1F4XL 2EIZA 5I1JH 1OSPH 5IQ7L 1NC4B 3RX5A 3HC0B 3U82B 1A6ZB 4WFFE 2MPAH 1J0IA 5C2BH 2B4CL 2ZKHL 4R4FL 5D6CB 3MRRB 4QXUH 4MXWL 4XNUL 2XA8H 1Q72H 2QHRL 4N0CD 3P0YH 4OM0L 5BV7L 2J88L 4KKLC 5JPMB 5IQ9A 2PYEA 2Y9RT 4YUEH 3QIWA 5KS9E 5JORB 1YPZE 2K9UA 4MAYB 3UDWC 1NCWH 4OLVL 5FUZL 5DHVH 4PRDB 3MJ8A 4WENB 3GSVA 4L3ED 5INCB 1J88A 3NVQA 2P5WD 3UTSB 2CLZB 5ISZA 1FNFA 3RWIB 3HG1E 3MODH 4R7NA 3QFDB 2DQCH 4FFZH 2H45A 3FOMA 4HBCH 2K7PA 5J6GA 3L5JA 2X70A 5CJXC 2H2SC 3B9VA 1R0AH 1INDH 1A14L 1J87A 4PGBA 2X1WL 4KMQA 5EPMB 3IFOA 3EDEA 2AJUH 4LSUL 3V0WL 3ZKSD 5HD8C 3OKDB 1RJZA 1FHGA 4GBXA 1T2JA 2BDNL 3STBA 25C8H 4YXHH 2APVA 4GKZB 4JQVA 3M17A 3QFJE 2AJYL 1BZ7B 3LKPA 2BSTA 4KWUA 5JW5B 4OIIH 5FUOL 4XPAH 3JV5A 4MB4A 2QKIA 4DGIH 1VB9A 4LSTL 4YDJA 5I1EH 2CKBA 4NGHL 3LMJL 3SDDC 4R0LA 4P3DB 2BSSB 2JIXA 4GRWE 3WUWG 1Q9KA 2VIRB 3DRTB 4FQ1L 4LDLB 2E5EA 1D9KB 2H3NA 3BEVB 4JY6B 1NMCC 3RVTD 1OPGH 4GRMA 4QEGA 3WLBB 2NY4B 2XY1A 4OGXL 4WUUA 2GTZA 3BUYB 3OKMA 1A6AB 4EN3A 1XFPA 5GS0L 3VGGA 43C9B 5KANG 1CICB 5D6DC 4YXLH 1K6QH 1WCQA 1XGTA 2Z8SA 3CDYA 3WHE0 2XKNB 3HZMB 2YWYA 1L4IA 3LEXA 4PRNA 4KHXH 1TQCB 3JTTB 3C6LC 4LCWE 5HPMA 3IS1X 1BQHG 4OT1L 3DXAB 2X6MA 3ARFC 1CZ8H 3FO0H 4MJ5A 1QACA 1WBYB 2XWBB 4JPIB 2ED9A 3OXRA 4UB0L 4D3CH 2VLKD 4HPOL 4BJLA 1UM4H 2BY0A 3ES6B 3ZDXE 4JFDB 4P2QA 4ZO7A 3RY6C 1JWUA 4QRUA 4LKXB 1CVSC 4ZOEA 4IRSD 3THML 2VH5H 4KHTL 1R24A 2B5IB 3BQUD 3IJYB 5J3HC 1H8SA 2X44D 3PE9A 1XZ0A 3PG2A 4TTDC 4OUOA 1NFDE 3LKQB 1MHCB 1JF5A 1UZ6E 2FZ3B 4QXGL 3VFPB 4YNYB 3X12B 3WNMA 3LB6D 1AGBB 2GJ6D 3OKEA 5J6HA 2WUCL 4AEHH 1MCOH 3QBTB 5JHLH 4LSVH 3F7VA 4S1SL 3SE3C 2WWMC 2NY3C 4GQ9H 6FABH 1NJ9A 3RGVB 4OCRL 4DAGL 1S7UB 4Z7WB 4PJDA 5I1KH 1HINL 4JZJB 4Q7DA 3HAEG 4X5XA 4ZO9A 1MELA 2F53E 3QZWB 5DVLA 4RA0C 1YZZA 1SQ2N 3A6BH 4NN7B 1WFOA 3CVHL 5C7XL 2PYFB 5IB1A 2GQHA 4GAYB 4JFQA 1K3ZA 3G5ZB 4OZGF 1PZUB 1JFQL 2R4RH 5EG6C 3L3IA 3MCKB 3KHQA 1NBVH 2VSCA 3WBDA 4OUUB 4TNWF 4N0CC 5SWZD 2RJMA 3D18B 1R6VA 1MJUH 3QNXA 3C5ZD 1ORSB 1JN6A 4MWFA 1PSKH 5AWNH 3ET9F 1I1RA 4OAWB 2PW1A 1CDCA 1INEH 5IHBA 1ZS8B 3MLTA 5JTWA 4A2LA 4JZOB 1NPUA 1GIGL 3FN0H 5FB8B 1E28A 3U4EA 2BNRE 4X6BB 3SDAC 3GMPB 4KK9D 4F7CB 2QQNH 3TPUA 1RZGA 5KAQG 4I3GA 5BS0A 4H0IA 1A6PA 4WFHE 3B2UD 4R97C 1LD9B 4MXQD 5ICZB 2A74A 3D5OF 3S37L 1N3NA 2BVEA 1P2CA 1YMMD 2WIIB 4TUJA 5CLTA 3O3DA 5D1QB 3WS6C 1S9XA 1KLUA 4PG9B 2VB5A 2NR6D 5IESL 1OP3H 2OJZH 1RU9H 1S5HB 1D5ZB 4FP8L 3EO0B 4CMMA 5IHUH 3EYFB 4J3WA 2D9CA 5GRVL 1H9VA 4G3YH 1K9TA 1WZKA 4DKEH 4UTBH 2EIDA 3BDYH 1XT5A 3PDOB 2BZDA 2ICEB 5KSVA 4ZFOL 1F2XK 3PP4L 4HUKB 2FDBP 1B6DA 1TJGH 1DL7H 5E9DA 2IANE 4HJJH 4NNPL 1FL5B 2ARJB 5D7IE 1S7WA 5HHOD 2Y23A 3HZYB 4OD1H 4RMWA 1QUNA 3RVTC 1UZ8B 1FFPB 4X80H 1KCUL 5ID0A 5LBSH 1CFQB 3QUYC 3O9WB 3MTRA 4L8BB 3VXQB 3BIAX 1G7LA 1G0YR 4QCIA 4X6EA 1G9NL 5EOQH 5I74B 5TQ0L 4CU7A 5IVNA 1U91A 5FM8A 5CS7A 5BJTA 1MWAL 1XF2B 5HI5D 3FB6B 2OXGA 1C1EH 1X5GA 5LKNA 1BHGA 4NO2A 5I8CA 4NZTL 1KENL 2ICWI 5FV2A 5IB4A 4HWBH 5EB9A 1A9EA 3S6CA 4F57L 1UADC 2OCFD 2Z93A 2BJMH 1R5VA 5JOPD 2H41A 2MNUA 2VLJD 5DJDB 1IM9A 5GSVA 4Z7NE 5E6ID 5HYSG 4B41A 4NO3A 43CAA 2FGZA 3IXTA 5HY9A 4DKAA 2DAVA 4YHOH 5GISL 5FA4A 5HDLA 4LLVA 4PV9B 5IB2A 3PGFH 4HIXL 3D39B 5T5FL 4MD0A 2KL6A 4GW5A 3PQYE 4XCEB 3CH1A 4PP1D 3HI1A 5D7JD 1JNNH 4IRSC 1MEXH 4ZUSA 3R0MA 5GRJL 3SEPA 3ZDYE 4R90H 2YD4A 1T7XA 4U1GB 1F5WA 3VXRA 2OR7A 3T09A 4HIEB 1MF2L 2R1YA 3MJ8B 4PLNC 3GSVB 3TZVD 1BGXL 5JW3H 1BMGA 2F19H 3JWNC 2AS5M 3P4MA 4C4KT 5ISZB 3PUCA 1U36A 3DGCR 4R7NB 4EUPB 3JXAA 4OLYH 2FJGB 3FOMB 1EHXA 5J6GB 4ZFGH 5BRZE 1CT8B 2ZJSH 1HXMB 3GK8L 4WHYH 4PJFA 3WD5L 1OTSC 1KIQA 5D71L 3RZCB 1HIML 3AUVA 2B20A 4PRPE 1RJZB 4G7YH 4GBXB 4CVXA 5C0AE 4C4KO 3FQUA 1U3YA 3C6LA 4IDJL 4HT1H 3M17B 1FIEA 4PB9H 5HBBA 5EULV 2X4UA 1RD6A 3LKPB 1U92A 1RAMA 1BD2D 1IQDB 2OMNA 3RUGA 4YDJB 5AUMA 5FYKH 4HC1L 4X0KA 5HHVL 3C5ZC 1IGFL 2CKBB 3L3HA 5TPWL 2R39A 1ODAA 1DBBH 1OAZH 4R0LB 4YHYC 4LNVA 2F8VA 4FFVD 15C8H 2JIXB 2QADD 3MV7D 2QQKL 5MEND 2XY2A 2PTTA 3K81A 4FQ2H 2XZCH 4OI9A 3HTLX 5D4QA 4GRMB 2BHYA 4UT9L 1A2YA 4JRXD 5ALBL 3Q0HA 4IHOA 3ARRA 4WUUB 3DJ9A 2GTZB 2C1OA 4AY0A 4KK9C 4EN3B 3FL7A 4EI5D 3PWPE 2OZ4L 1JTTA 2NY7H 2NXYB 4HZLA 4NDMA 1YYMH 5I19L 1XGTB 2P8LA 1SJVA 3GNML 3B2UC 4QHLA 4MXQC 3UJTH 3WSQL 3O6FD 3HUJF 3OAYK 4H88H 3LRGA 4YBLC 4LCIH 1WICA 3LEXB 4NRZA 5IJKC 1XR8A 4PRNB 3MJ6A 3FQWB 2HRLA 1FVEA 1UACH 5HPMB 2R2CA 4JCMA 4NP4L 1CL7L 3HI6H 4G6AD 2NR6C 1MQ8A 2W65A 4MJ5B 1ZTXL 1YQVH 4LAQH 3VXTA 4IM8A 1NBYB 5CKAA 3OXRB 2X5PA 3VFTA 3R0NA 4JQXA 1R3LA 2EDBA 4PD4J 1JPGA 4ALAH 4U6HA 4K07A 3EYOA 4XPFH 4P2QB 4YX2L 1F6LL 3FCTA 2J12B 3PDGA 2ICCA 1JWUB 1FNSH 5DD1H 2CH8A 1OTTD 2CR3A 3TN0A 1R24B 4HS8H 3OR7B 4Y5VC 1CD1A 1D6VH 4MAUH 4K3DH 5F93C 4GMTH 3NCYS 4F9LC 3NN8A 4ODXA 1H3VA 2EH7L 4PJGA 4AIZA 2NY5C 4Z9KB 5DD5L 3OKEB 2F5BH 3SGDH 3AB0C 5J6HB 1SMOA 3I75A 1FGVL 4JJHA 3CDFA 2HFGL 3R4DA 3REWA 2C1PA 3F7VB 3SDAA 1XGYH 2KPNA 5L7XL 1NJ9B 4PJDB 3ZL4H 1NMAL 3I6KA 1N5YH 2WP3O 4X5XB 4XZUA 5HI4C 4RIRA 2MFNA 1DQDL 1MCNA 1K8IB 1N2RA 2YD9A 1AD9A 4JY5H 5GIRA 1JGLH 1S7VA 5IB1B 5GZNC 1DDHA 3L5XL 4JFQB 3L3OA 1MCPH 4U3CA 1IJ9A 3EOAA 4RCAA 2FX8H 4DVRL 2XQBL 1P7KA 4IRJD 5I1AB 3QNXB 4ODHL 3NPSC 2WMPA 3RAJL 4FQQA 2QSQA 3VWJD 1JN6B 3K4DA 4PJCE 5C09D 4RGNE 5B39G 1KB5B 4J3OC 4NHCH 5I1DA 1ACYH 4BFEA 1X4XA 4MA1C 2PW1B 5C0GA 2CKBL 4HIJB 1EAPA 1ZVYA 3Q5OA 4OCYL 2DJ4A 3V0AC 2D9QB 3SJVE 4Z7VA 2XTJD 4X7DC 1E28B 3U4EB 2J8OA 3QDJA 3QUYA 4MA8H 5GPRA 5EN2A 5IKCB 5DMIL 3TPUB 1RZGB 3JUZA 4QTIL 5KW9H 1JI1A 2ADFH 2DQJL 4RGMB 1SY6H 4PR5A 4OFPA 4YHLH 3RPIA 2Z92A 2A74B 2DQEH 3VXMA 2XRAL 4MA7H 1N3NB 1P2CB 4TUJB 1YEKL 3O3DB 1I9JL 3SDCC 1FG2A 4UBDC 4XVJH 1S9XB 1KLUB 3ULSA 3BO8A 1YEHH 1AKJD 3BSZL 3FQNB 5IBLD 4CMMB 2MHAA 1ZHBB 4K3GA 3KNBA 5F8RC 4KVCH 1DJSA 2XI9A 4LCYA 4W68A 5J13C 5KSVB 2W38A 5CEZE 1YEEH 2FJHA 2VZUA 3TO2A 2VXSL 5DR5H 2QADC 3CGTA 3EYSH 5EO1A 1U8NB 5E9DB 2DDQL 4ZAKA 1S7WB 1L7IL 1B88A 1MCSA 2IQAB 3T3PE 3UO1L 5ID0B 3FRPG 3VXSB 2BSED 1J1OL 3OHXB 2DQHH 3WJLA 3EAKA 4QWWD 4KUZH 4APQA 1U91B 1U93A 1EEUA 5BJTB 4TRPL 2R8SL 1PGRB 2FATH 4R3SA 3GMQA 4O58H 4NO2B 5I8CB 3OTTA 5IB4B 4BQBA 1A9EB 1A0QL 1I3GL 3H42L 3LPFA 1XF3A 4M93B 2Z93B 4U2YA 1RZ7L 4XCNA 4G6AC 4RAVB 1IM9B 1YJDL 4Y4HA 5GSVB 4ENEC 1EIBA 1MY7A 2ENYA 3U2SA 4JANB 43CAB 4WGVB 1DBML 3IXTB 5HY9B 2ZNXA 4DWHA 1KTLA 1CFSA 4QGTA 5FA4B 2AV7A 3QQNA 4LLVB 5IB2B 4XX1G 2FNBA 2DTSA 4GW5B 2Y5EA 3CH1B 1QYGL 4NZJA 5CMAA 1M05A 3HI1B 4LCCA 1CE1H 1JI2A 1MRCH 3LEVL 3AFLA 1PW3A 5CWSA 3T0EA 1VGKA 3MZGB 1U8IA 5CSZA 3VXRB 2XZAH 3RNQA 1LK3L 1QLRA 2R1YB 5CP3H 1ZHLB 2V5YA 5D7SH 3P4MB 2FBJH 4R4NC 1CU4H 1JF1A 3OB0K 2DQTH 1A7BA 1IQWH 1DBJH 4RISL 5EU5B 3RVUD 5EUOA 5DQJA 4PJFB 5HPOA 5GQBA 1KIQB 1WAAF 4M7JH 1RZJC 5E4IA 4KVNL 4PJHA 2OM5A 4Q6IC 1EZVY 4OD2B 5DJXA 4CVXB 3REVB 3FQUB 3DXAE 4JFPA 4D8PA 3SGDI 3F7RA 3PWLA 4WI7A 2YD8A 4Z7OE 5ANME 4LFHG 4ONGL 4E9LA 5ACLA 2X4UB 3H9HA 3ESVF 1U92B 2Y07L 2JCCA 3RUGB 1RIUL 5AUMB 1UYWH 3L3HB 4E41A 5ICYA 3RDTD 2DBLL 2HVKB 1KCRH 4DUVA 5E5RB 2VABA 1QSEA 4MJ6A 1FYTE 3M8OL 1H3PH 1KBGH 2B8OT 2PTTB 4P0DA 3FTGB 1QSZA 4KTYA 2B0SH 4G8FA 3KPSA 1JZ6A 4K3JH 4XBGB 1A2YB 2L7JA 1T2QH 4IHOB 4HUNB 3AY4C 4WI4A 4HZLB 4NDMB 3GB7A 4GJTB 4CAGA 4X6CA 3O0RH 3QUZC 4QHLB 5FM4A 3UTTA 3V4PL 4MNGA 4NRZB 5GSRA 1XR8B 4MYWB 1FVEB 3GSUA 2IMNA 1CFVH 5KZCD 3MLXH 1MJ7L 2HYMA 1PZ5A 2CO6B 2W65B 3O4OB 4ZS7L 4WNQA 2B2XL 3VXTB 3KYAA 1PYWA 3BH9A 3VFTB 5MP6L 3MLVH 1KYOK 4Y16B 4BM7A 5F7HA 1JPGB 3E6FA 4U6HB 1MRFL 3VG0L 3EYOB 3UJIH 3FCTB 1QKZL 4C59B 2B7DT 2VZ3A 3TN0B 1NQBA 1XEDA 4ZNCD 4ODTH 5E0QA 2WUBH 4FZEH 1ZLVH 1CD1B 1MPAH 3T0AA 1XF5B 3KPMA 4QWWC 3NN8B 5FDYA 4LVNC 1OP5H 5H35A 1BFTA 3MRFA 4PJGB 1RZFH 3C09B 1Y6KR 4KK5D 5I2IA 3I75B 1S78D 3AREA 4LMQI 1AC0A 1AE6L 2C1PB 5I1IL 5FCSH 2NXZB 5FO9A 5CBEB 5D7KE 2VDPL 5DD0L 1NL0H 3I6KB 2Y6SC 2BVOA 3VFOB 4HXBH 4RIRB 4PRID 4JHBA 4RX4A 1ZEAL 4F15B 2NY6D 5E08L 3WNPA 1E4XI 1AD9B 4PGZA 5GIRB 1S7VB 1DDHB 4D0BB 1PD6A 2JB6A 3MLUH 1AXTH 3SDCA 1KCSL 3TVMC 5JLZA 3HZKA 2YPKA 3EOAB 2EH8L 1IBGH 2Z35A 1T6VN 3B5TA 4H5SA 4JR9H 5TF1L 1JGDA 4QOKE 2F54A 5CIPA 5JXEC 4PJAE 5J12C 1NAMH 3HPLA 1HKLL 2YD7A 1MSPA 4WHYG 3SPVA 1Z9OA 4FQXA 4XI5D 5TE4L 1FH5H 4G7VH 5I1DB 3L6FA 4ZOAA 3MRBB 5HHXL 1K5NA 3ARSA 3BP7B 5C0GB 4NQCA 1EAPB 3TYGH 4KAQL 2EXYD 2FB4L 2IFGA 2J5LB 1Z2KA 2EDWA 4ZO6A 3NIFE 4WDIA 3DYOA 2E8YA 4Z7VB 5BW7C 4Q2ZB 4NWTH 2ORBH 3EYUL 4TPRL 4WU7A 3QDJB 5ADOH 1YYLH 3WO4C 1LHZA 1NEUA 4WO4D 3E6HA 2VDML 1GH7A 4AEIH 3J7HA 1VDGA 4ZG1A 4PR5B 2P24A 1CDIA 2G60L 2Z92B 3K1KC 4YXKH 12E8L 4LU5H 3QQ3A 4PYGA 4PRAA 4AENA 4W81A 2FJFA 3ULSB 3KJ4B 3BO8B 5HDQH 2C4FT 1YN7A 2MHAB 1Y18A 3BGAA 1IC4L 1CXLA 1RUPL 3RDTC 4RAHA 4ZXBA 3BMVA 1JUFA 5DK2B 3TO2B 5EO1B 3U1SH 2PYEE 4JHWH 4ETYA 3J8F7 5E8EA 4ZAKB 2IADA 4D9LL 2FYYA 2JTDA 3VH8G 4JRYD 1G9EA 4XPGL 1KELH 3IDXL 5ITBL 1OGTA 1VADA 4K71B 5ISZE 4APQB 1U93B 4JPVH 5GGTL 5H8DA 1LNUA 4OZHB 2DKUA 4XVSL 4R3SB 3GMQB 3FO9A 3WKMH 3S5LB 3ARGD 5IEKA 4FQCH 4M6AA 1QFUL 1LEKA 2XN9D 1XF3B 2BFVH 1ITBB 1R3HA 3DI2B 4MZ2A 5SX4I 3O45A 4DGYL 4OLZH 1ZHKA 3O3BA 4XCNB 1A22B 5EDXA 4J4PC 3UYOD 4Y4HB 3ALPA 5ACZA 4NM8L 4OZ4A 3WFDL 3U2SB 3BIBX 1UXWA 4UZGA 5EZOH 1T0MB 2DL2A 3QUMH 1KTLB 1CFSB 2LFGA 1INQA 4PB0H 1UCBL 4NKOA 4L3CA 3MJ9L 5EU6D 4LCCB 1C5BL 3QEHA 4QRRD 5JUEH 3MX0A 1TJHL 3T0EB 3FAWA 1VGKB 4MDJA 3ZT7A 1EFXA 3P9LA 3MRPB 1U8IB 5CSZB 4RDQG 1HHIA 4W4OA 3RNQB 3DTXA 1QLRB 1I7TA 4QHNA 3U7YL 3G6JB 1Q1JH 4YWGL 5KVFL 3ULUH 1A7OL 4XH2A 2E7LC 3QHFH 5EU7C 3KPRB 4WUUE 5LCVH 3BE1L 3F12A 4HAFA 1S78C 1TMCB 3ULVF 2EKJA 5E56A 1EH9A 2QQQA 3QEGH 4K3EL 3AY4A 3QO0A 3KAAA 2IPKA 4XRCA 4O2EA 1BREA 1IFHL 5B38G 1MI5A 2ERJC 3LIZH 1GOHA 5DJXB 3RNKB 4BZ1H 3QDGD 5E8DH 3RJQB 2OR8A 2CK0L 3HKFA 3O2VL 4D8PB 1T0NA 3EW3B 3PWLB 4E5XA 4JG1H 3H9HB 1A6WH 2ZOKB 1TZGL 4PJ7F 3V52H 2JCCB 2O93L 5EZLB 2RFXB 1VFBA 3WNOA 4XNZB 4P2QE 5ICYB 1OARH 3BAEL 4D9QD 2VABB 1QSEB 4MJ6B 3TT3L 4JGUA 1I8LC 3BW9A 3EYVA 1XGRB 1DQJB 3P4NA 1BQLH 3MV8A 1BFOA 1JNLL 3KPSB 4G8FB 3H3PL 3BZEA 4QYOA 1CLYH 5C0CE 4KTDL 1IGYA 3LOWA 5KSAA 4HBQA 2HLFC 1X3DA 2ATPA 1IGIH 3WXVL 2DLGA 3NCFB 4JFHE 5K9JL 1W0VA 5I17A 4WJ5A 1A7QH 4WO4C 3NH7H 3GB7B 3HHRB 4AMKH 1KLGA 1B4RA 3FFCD 4U0QB 4S1RH 4ERSH 1DBAL 4GUPA 1KXVC 5LQBH 1U8QB 1OAYH 4B5EA 4MNGB 4Z0XB 4M1DH 5CZXD 2YPVL 2XOTA 1A4KA 5GSRB 3D85A 3SCMD 3GSUB 2Y1VA 4QRPD 2ZUUA 2GITA 3KJ6H 3KLHC 1I8IA 1PZ5B 4FZ8H 1NFKA 3D6GA 4WNQB 4R7DA 3HMXH 4NSKB 3BH9B 5CD5C 4GRWH 3QDME 3E6FB 4N9GA 1U2HA 1D5MA 3ARDD 3TVMA 4M5ZH 5IK3B 3OAUL 2A2QT 4O51A 3W0WB 2VSDA 3P30L 3BPLB 2EO9A 4K8RC 1C5CL 1N64H 2YC1A 4BZ2H 1KJ3H 1RMFH 2IPUK 1YNLL 2VDLL 4KJWC 5IVXE 3KPMB 4NKIH 3IFNH 2I25N 1MIMH 2XIDA 5H35B 4J2XA 5C9KA 3MRFB 1AO7D 4OZGA 1G6VK 5I2IB 4XWGL 4X99A 4G8IA 5T3XL 4UV7H 4UILL 3AREB 3MOAH 2YUZA 4LSSL 4M1CD 5BS0E 5FO9B 4MJID 4JPWL 1JPTH 4XP4L 3MRIA 3I3BA 4I77L 4MVBC 4FABH 3I2CH 5FHBH 4YHZH 1QLEH 1WZ1L 3VXOB 4NZDA 5DD6A 2MCPL 1F4YL 1QZ1A 1GPOH 4L1HA 5FF6A 1VGEL 5DO2D 5SX5K 1YY8A 2JB6B 3QXDA 5JLZB 1RUKL 4W4NA 2YPKB 2Z35B 4H5SB 3PABB 4WVRA 3VI4E 1J10A 1JGDB 2F54B 3U83A 4IRZH 4NO0A 2AEWA 3DMMD 3VU2A 5HYJA 3HPLB 2OSLB 1PEWA 4G6MH 3RGHA 3SPVB 4FQXB 4ETQA 3GSNA 4GRLA 3QUKA 4RBPH 3L6FB 3PV7A 3WJJA 5D5MF 4U33A 1QQDA 4Q9RL 3P2TA 3QSKB 4NQCB 1LO4H 5DYOA 3N85H 3D3VD 4RWYH 4XXCA 4WDIB 2FD6H 3OAZK 3GMRB 4OF5A 4W70A 4WU7B 4XMPH 4HD9A 1JGUH 4LQFH 3VRIA 3NMEA 1B0GA 5IFHH 4KDWA 1T6WA 4XNMA 3ZYJA 1X4YA 3HNTL 1CN4A 2ENSA 1KJ2B 5BVPL 4H8WH 1ZGLP 4H1LG 3HC4L 3KYMA 3QG7H 4M7LL 1F3RB 3MSPA 2XA3A 5DD3H 2DICA 4C83A 2NY5L 4PRAB 3TFKD 2HJFA 2FJFB 3EBAA 1QRND 4J4PA 1YN7B 4GMSL 1DP0A 1RURH 5DLMH 4FTVD 3W5NA 3U9PH 1CCZA 1Y18B 1PVHA 3DV4A 2I07B 1JF6A 1YC8A 2ZUSA 4ZXBB 4D9RD 4JO3L 4K9EC 4V1DA 1JUFB 3IFLL 4Y4FA 4ZUVA 5E8EB 5D1ZB 1ZVSA 1M6OA 5FGBC 4O9HL 2IADB 1QP1A 3RWEA 2FYYB 1OD9A 2NW2A 5SWSA 3ARQA 1FDLH 5JOEA 4GS7C 5D8JL 3OAYH 1I3VA 4G9FD 3SOBH 1OGTB 4XCYA 1OAQL 3ZHLA 4ELMF 1VADB 2XQYK 3WKNA 1WEJH 2NY0C 1I9EA 2ESVB 2Y36L 4BQ8A 3IVKB 1WFNA 1CK0L 1EJOH 3F7YA 4XP9L 4EI6A 1X7QA 3SKJH 4MX7B 2FIKA 3VXUD 5I75B 1J11A 5DJZA 5IEKB 2VXUL 3WXWL 5CZXC 1LEKB 3GJFH 1R3HB 1MAMH 3O45B 4XNYL 3DUSA 1ZHKB 3O3BB 4HIIA 3ZT6A 2NX5A 4HCRA 1QG3A 1Z9LA 1A3QA 3OKNA 7FABH 4N8CH 2I9LB 5ACZB 4OZ4B 4JCLA 3OL2A 2IBBA 4JAMA 1UXWB 3DETD 4BSWA 1F11A 2AXJA 5JIIA 2D7MA 1FRGL 3SGJC 3C08H 2FEDC 1BFVL 4OCWL 4CU6A 2XZQH 4NKOB 4L3CB 5I15H 1MQKH 4RQQA 3H7LA 4ZMAT 1GGBL 1QRKA 1K4DA 1X5ZA 5BZDA 3ULUD 3JSSA 4UAOC 1XCTA 2VJXA 1J5OH 3S3JA 2JELL 3HB3C 2P5EA 1FC2D 1EFXB 4MDJB 3P9LB 1HHIB 3DTXB 3H8NA 1IKFL 1I7TB 4PP2B 4JPKL 4QHNB 4R4BA 2OK0H 4XBEL 1CS6A 1B2WL 3HS0A 2EC9U 4EDXA 4XH2B 1MH5A 4FRWA 5E8NA 1EX0A 2CIIA 3F12B 4AM0A 1J18A 1U95A 4OFYA 4WFFD 5DFVC 1T66D 1N5AA 3QIBD 3BI9X 5T1LD 1FGNL 4TVPL 4M5YH 1OGAA 4HGWA 2NPLX 4MQSB 3MNVA 3QO0B 3SO3C 2IPKB 4OFIA 4O2EB 3EUUA 4U3HA 4C58B 2P8PA 3W39A 5IV2B 4NFCA 1HHGA 3D2UA 3CSGA 4XWOD 5EA0L 1AY1L 4E5XB 1MFBH 1J0ZA 3MBXH 2X4RB 3HG1D 4RMVA 5ILTL 1WVZA 2RHEA 3DMMC 2NQCA 4LIQH 1VFBB 5F9DC 2Z8RA 1HQRA 1EXUA 4HK3J 1DUZB 1I7UA 3QJHA 3BW9B 3EYVB 3R1GH 4KUCF 4HULB 3P4NB 1OAUH 3MV8B 1CGUA 4PD4K 1BFOB 3V6ZB 1RULH 3BZEB 3IU3A 2D3VA 1FSKB 1REIA 2A9MH 3D25A 1CLZH 1IGYB 2AQ2A 5KSAB 5F7MC 2UWEB 5HGBB 3QFJD 2H1PH 1J05A 4EUPG 4QHKJ 2VAJA 4OQTH 4HDIA 2AK1H 3EDKA 1KLGB 2EDNA 3U30C 3PL6A 1S9YA 4LLQA 2DWDA 1GAFH 3GO1H 2ADGB 3HFMH 3V6OC 3C9NA 3M1BA 5DMJB 1A4KB 3D85B 2GSGA 2PR4L 1JHLH 1D6EA 1FAKT 3K4ZA 4N5UA 5DI8B 3WUWA 4MQTB 3WCYA 3WIIL 1I8IB 1II4E 3H2WA 1G7QA 3A6CH 4R7DB 5KSUA 1DUYB 1ADQH 4J3VA 4JM4H 2BNQA 2X4OB 4NIKB 1RZJL 1JZ8A 2X1OA 1D5MB 5DTFA 2VXTL 3FONB 4ODUB 1LO0H 3TA3B 4PGCA 4PJ8D 3T2NH 4QHUB 4WI2A 1CGSH 4OZFH 4X9GA 3TEUA 1WF5A 1JCKA 1WISA 1KJVA 4LCWD 1DN2A 2CDGA 3MZTA 5DJ2B 4RA3A 4Y7MA 4G8GA 4NRYA 5J56B 3CH8A 1F4XH 1BQHA 1BJ8A 3BOVA 5IQ7H 4LGRB 2WQRA 4R2GC 1QFWL 1F45A 1ZKAA 1BIHA 4G8IB 4AIXA 3RKPA 2GY7B 5F1OB 2YD3A 2B4CH 2YUXA 2ZKHH 4R4FH 4OZIA 5I8OL 5B3JE 5F7EL 3MGAA 4MXWH 3IFPA 1Y6NR 4XNUH 4YK4B 4OM0H 1TNNA 3MRIB 5BV7H 1UENA 1YECL 3VXME 2IH1A 5FXCH 4BYHA 5DD6B 2GJJA 1L9NA 4RFNB 5FF6B 2VDNL 4OLVH 2X1QA 2DLTA 1YEIL 1YY8B 2ILLA 1FNHA 1FNGA 5ACMA 1C8PA 2EYRA 2W91A 1ZA3A 3VD7A 5ESQA 5F8QC 2J8HA 1TQBC 4JDZA 3SHSA 1VCAA 5HYJB 3IAQA 4DQOL 1VA9A 1A14H 1QSFA 1U8KA 3QH3B 1JMXA 2D0HA 1DQMH 1XIWB 3GSNB 4GRLB 2ADIA 2R15A 3NZ8A 1R3IL 4POZC 1GOGA 1QQDB 4LSUH 3V0WH 2IAMB 2F53D 1N6UA 4PJXB 5DYOB 4I2XA 4MD4A 3HAEA 1G7MA 1RUML 5F6HJ 5MEPA 2BDNH 1WBXA 3GSXA 4MQXC 3B9EA 4ZFFA 1T21B 3VRIB 2A6DA 3BZ4B 1X9QA 1FLRL 1Z5LA 2AJYH 3U0WL 5FUOH 4LSTH 3KYMB 3ECBB 3MLSL 2A6IA 4KJPC 2HH0L 4NGHH 3DHJA 3LMJH 1EA9C 4HHAA 5IHZA 3EJJX 5GZOD 2HJFB 2I60L 2XG4A 1RV6X 4L3EA 3TO4C 3C60A 4YHNA 4XPBH 4XWOC 2YRZA 4KJQD 3SDYL 3DOSA 5DC4B 4O5LL 4HV8A 4YR6B 1KNOB 2BNRD 4OGXH 2JF1A 5DWUH 2CMRL 5FM5O 4JKKA 5CKGA 1EEQA 1UWEL 5GS0H 3IF1A 4ZUVB 1ZVSB 4WFHD 1M6OB 4LVOB 3RWEB 2NW2B 3T0EE 1RJLA 2EDTA 4XVUC 4XXDA 3TCLA 5T3XE 4RGOH 3P0VL 1RIVL 4OT1H 2GI7A 3VWKA 3F7YB 3DURA 4EI6B 2FIKB 4UB0H 2GEEA 5I9QC 3EOBA 5DJZB 3ZSTA 2BVTA 4NQEA 3MGOB 5EUOE 1YY9C 2Z31C 3RU8H 4HPOH 4KI5E 2R2HA 2IAND 3CFEA 5IWLA 1WBZA 3DUSB 4PJHE 4HIIB 4NCC2 1MJJA 2NX5B 3OKNB 5DJ0B 1TPXB 3THMH 5C0JA 2P49B 1M1SA 4MHHI 4KHTH 4Z7WF 4JAMB 4BSWB 1F11B 1OTUC 1B4JL 5GGSY 2O5YL 4HKJA 1IKNA 4RMTA 2H6PB 4QXGH 3ARZA 2JCCE 1AHWA 3WNLA 4RQQB 2FECI 5BZDB 1K4DB 2E6JA 4PJ8C 4E41E 2A77L 1XCTB 2WUCH 2LE9A 1QSEE 1JNJA 4PUBL 2CLVA 4S1SH 1CXKA 5C2UB 2P5EB 2R2BA 5CJ5A 3LKOB 3KPSE 5BXFB 2HT3D 2BRRL 4LP5A 4OCRH 4R4BB 4DAGH 1RSFA 3KG5A 1HINH 3HS0B 4NUGL 4EDXB 1MH5B 4BK5A 5SV3A 2FO4A 5E8NB 2ZUVA 3GSNL 2CIIB 3CVHH 4KY1H 5HYSA 1U8PA 4Y88A 5T3ZL 5C7XH 5C0NC 1N5AB 1VFAB 2UVFA 4CADA 1JFQH 4KV5E 3PQYD 2R0WL 1Q9OA 3OGCA 4X6CE 1OGAB 4HGWB 3MNVB 3UTTE 2PETA 4MNGE 1QOKA 3Q3GA 3BQUA 4YC2C 3S7GA 2P8PB 3W39B 1G7IA 4JDTL 4PBVC 5CSGA 3D2UB 1I75A 2HWZL 4I9WE 1BWWA 5F9WB 5MHSE 3O8XC 3FT3A 4I18C 1GIGH 1DSFL 1KTDB 4ZDHB 5BRZD 2YN3A 1A21A 2A6JB 1X5AA 1BVLA 3WMSA 1HQRB 1EXUB 2LTQB 3GMMA 3WYRA 4U6XB 1PDKA 1TVHA 3AVEA 1I7UB 1XGPA 1OD7A 3QJHB 3HC3L 1MLCB 3QRFM 5T1KD 2C3WA 3SGEI 4PRPD 1ORQA 3WFBL 3IU3B 1T03L 5B8CA 5C0AD 3SBWA 3BP4A 4X7CC 3D25B 1MHHA 3S37H 4OB5L 2GK2A 5FYLL 2YMXL 5IESH 3LS5L 1J05B 3MOBL 4X6DF 4FP8H 4HDIB 1ZLWK 4ORZC 4L9LA 3PL6B 3HE6D 4OLEA 2DWDB 3JWDC 3VXNA 2YXFA 3C9NB 3QP3A 2H2PD 3M1BB 2GSGB 5D70L 1Z9MA 5GZOC 3V5HA 1D6EB 1P4IL 4NNPH 3WUWB 1ZVHA 3ALXA 5C08D 3K2UL 5EORL 3OMZA 3GDBA 5TFSL 4Z77A 2UV3A 3MA7B 4Y8AA 1KCUH 4HCRL 5C92A 1N6QL 1J1PL 2BNQB 1G9NH 1I1AD 3PWPD 5TQ0H 4HS3A 2F54E 2V9TA 5DTFB 4LVHC 1MWAH 3UX9B 4KKBC 2K3TA 5EZJB 1MIEL 4QXTA 4AZ8A 3LY6A 2NY1D 2MKLC 4K55A 5AZEL 1G6RA 2NYYC 4NZTH 1I7ZA 1KENH 4PGEB 2P46B 4PG2C 1KJVB 1YMMA 2OP4L 4LNRA 4F57H 1N6VA 4NQCE 2CDGB 1W0YT 2EIBA 1U8MA 4G8GB 4TVPE 3VXUB 1BQHB 4B7LA 3N1QC 5M7QA 1PLGL 1JZ3A 4PPTA 1PQZA 3OKYA 3QNYA 5GISH 4OZIB 3U6RB 4HIXH 5T5FH 1A1NA 1MFCL 3FO1A 1PG7L 1FO0A 4PY8I 2IH1B 4KRLB 2ZCKL 4ZPVA 5GRJH 3RWCA 1IGJA 4UQ2A 5DJAA 1T1ZA 3QHZL 3BPOB 1FNGB 1C08A 3GI9L 1MF2H 2VR9A 2EYRB 4JKMA 1BGXH 1SJEA 1ZA3B 4PJEF 3DROB 3LKSA 5ESQB 2ZUTA 5C1MB 2K7QA 1A6VL 3SKNA 5LAXA 4JE4B 4JDZB 5BVJA 1NGXA 3A6OA 1GGCH 4TSCH 3KYKL 1HHKA 1QSFB 1U8KB 4I0PB 3GK8H 3WD5H 4C56A 1G0DA 1AR1D 4Y1AA 2J8UB 4KKAC 3QUXD 5D71H 5E6IA 5HHME 4Y19E 1HIMH 2PO6C 4MD4B 5IW1B 3HAEB 1G7MB 1ERNA 5MEPB 4NN5C 3GSXB 1QVOA 1JYNA 4P9HL 5DHVA 4ZFFB 2A6KA 4L29A 2D7TL 1HQ4A 2A6DB 4F7MA 4N1EA 3EO1A 4IDJH 3RL1A 1Z5LB 2WANA 4K8RL 2XXCB 1QO3A 3UTZA 5D7JA 2APTA 3SKOA 2OYPA 4HC1H 5HHVH 2A6IB 1IGFH 3QNZA 5TPWH 1SMAA 4G6KL 4RGND 1S7XA 4S1DD 4UOW1 2R23B 4HHAB 5HGAB 3S34L 5IHZB 3DX7A 3FT4A 35C8L 3RQ3A 5GS0D 4L3EB 4WWKD 3C60B 1MFAL 4OI8A 2QQKH 2P5WB 2IMMA 3O4LE 3WIHA 2Q7NA 4WTZG 1GGIL 1HILA 5TDPA 3SJVD 5T33L 3H3KA 4UT9H 3KR3L 5ALBH 4EVNA 4P46C 4HV8B 5A40E 5CAYB 4MHHG 4HGMA 4LHQB 3TBVA 3VJ6B 5CGMA 4NN6B 3FQTA 2OZ4H 5IUSA 3F6LA 5I19H 3MR9A 5L2JA 3GNMH 3V9FA 4P4KD 1RJLB 1T89C 3WSQH 3NCMA 2WBJC 4XXDB 2Z4QA 4X9IA 4NP4H 1CL7H 1P1ZA 3D9AL 3VWKB 1BD2A 4GKSA 4L8SA 1ZTXH 4JM2D 4FFYL 1VFMA 3QRGL 3EFDL 2X4NA 3UZEA 5CEZD 3HNSL 3N06B 1JTPA 2Y25A 3CK0L 1G84A 4HUVA 2R2HB 4NNXA 9CGTA 3CFEB 1KGCE 2BC4A 4YX2H 1JWSA 1MJJB 1P7QA 1MI5E 2G5BA 1ZGLM 5C0JB 4OZFG 1FE8L 4JRXA 2AJSL 4PJDF 4PY7A 5IFAL 4ZUWA 1S7TA 3QEQA 4ZO8A 4WW2C 4I0CC 4HKJB 2EDJA 3FRPA 2AXGA 4EI5A 1I1AC 3OV6A 4YPJA 1UEMA 1ONQA 5B4MC 1AHWB 2EH7H 1RPQA 3FMGL 3E2HC 1LP9A 2QQLL 3UZVB 5DD5H 2NY1C 3O6FA 1FGVH 4WEUD 2VUOA 2V2WA 4M8QA 2HFGH 2P4AB 3MNWA 4GOSA 1OWRM 4JJ5A 3MV8E 5HVWA 1MVUA 5DRWA 5JDSA 3MJGX 1N4XL 5L7XH 1NMAH 3RWFA 5F9AC 5BV7C 1QFOA 5F3HA 1DQDH 3PIQB 5F7DB 4K9EL 5HYSB 4QRSA 1U8PB 1A9BA 1WLHA 3L5XH 4PJ7A 1BOYA 3EGSA 1OB1B 4CADB 5MI0C 2GSIA 4PREA 4EDWL 1Q9OB 3OGCB 3OX8B 3K74B 2YSSB 4JO2L 4DVRH 3C2AL 2XQBH 1MCQA 4ODHH 3D87B 3BQUB 4IMLB 3RAJH 2WWKO 1YMHA 4KTEL 2OL3L 5EU4A 5HYFA 1AGFA 1G7IB 2FGWL 4Y4KA 3NTCH 1D9KD 2K1MA 2NY4D 4X7TA 1FL6A 3FOLA 2CKBH 3E3QE 4CVZB 1L6ZA 2VDRL 4OCYH 3RTQC 1WWAX 2GJ6B 4PGDA 2AP2A 2C4XA 3DSFL 3FT3B 1AXSB 5TF0A 2YA2A 3BKML 4LPTA 2IEPA 4M7ZB 1UQSA 2AJVL 3GMMB 1TVHB 5DMIH 1XGPB 5A16A 3AROA 2D7PA 4KMLB 1RUQL 4HFUL 2HTKD 5HGDB 1F4WL 2D7NA 4QTIH 2DQJH 3QUXC 1M71A 1ORQB 4DOHB 4R9HA 5B8CB 1FFOA 3BP4B 2XRAH 3DXAD 1GCFA 4PG2A 2ARJQ 4YZFF 3RI5K 1I9JH 4YAQB 5I16A 4AQOA 4OZGE 1UVQB 1KXQE 3BSZH 3CJJA 5SWZB 4LL9A 5F71A 4IRJA 4L9LB 4LOUC 1UJ3C 3VXNB 1YEDA 2V9RA 5C09A 1QBML 1FYTD 3P9MA 1Q0YL 2VXSH 5F1NA 3V5HB 2AW2A 4C55A 2DDQH 3DV6A 2DI8A 2WZPD 1I4FA 1DVFA 4QY8B 4HUMB 4P5KB 3UO1H 5T1MA 1R5WA 3IDGB 3KPLA 1J1OH 5KTEL 1N26A 4Y5YA 4OCXL 5FGSA 4TRPH 4HS3B 4IIQA 1F6AA 3S37X 3FB7A 4QXTB 2R8SH 1IZKA 4LEOA 4NBXB 4P4KC 4C54A 2BSRA 1I7ZB 5EBWB 4XP1L 3CXHJ 3B9AA 5D1XC 3RGVD 1YMMB 4YDVA 5T3ZE 3H42H 1A0QH 1I3GH 2YK1L 3D69A 4LNRB 2YA1A 3CU7A 1AKJA 1U8MB 4P3WA 3SY0A 3BJ91 3QPQD 1YJDH 2O5ZL 1OLZA 4PJIA 3C8DA 1ZAGA 4MB5A 2OXHA 5C0RL 1DBMH 2PO6A 3B8SA 1PQZB 4AQ1B 1JRHI 3QNYB 4LSRL 1NKRA 2HFEA 5GS2H 5F97E 3IKCA 3VGAB 3ISWA 4P3CL 2HRPL 4EIZC 2EDQA 1A1NB 2AERT 3FO1B 2FBOJ 4MAYC 2AK4A 4KDTC 1QYGH 2GYSA 2AVGA 4PJFF 5HHOB 1FO0B 1HYSD 1CL7I 4FQIL 3LEVH 4ZPVB 1U41A 3PGCA 4HLZH 5D5MA 2QBWA 3QHTC 1FN4B 2DWEA 1IGJB 3RWCB 5CJQL 1T1ZB 3GRWA 4HXAL 3GHEL 3WN5A 3IXAA 5GGSA 2Y4SA 1C08B 1QBLL 1LK3H 1FZKB 5E24E 1SJEB 3B4NA 3TIEA 4YHKL 3ZZ1A 3HRZA 3D0LA 3SKNB 5DK3A 5LAXB 3FB5B 4P46A 4V1DE 3RUGF 1NGXB 3H3BC 5C3LD 1WWBX 1HHKB 2UUDH 1BLNA 4RISH 4UT6L 4Z78A 4AYFA 2XXMB 4MMXC 5FYLE 5SWSE 4EIGB 2OTPA 4KU1A 4C56B 3ARBA 3VMPA 2X9XA 5E6IB 4KVNH 5J1SC 3A0OA 5LXGL 2WBJA 4LRIC 1QVOB 5DHVB 2A6KB 1NLBL 2HT4D 4L29B 4F7MB 1MCJA 3EO1B 3TIDA 1CXHA 4HJGB 4ONGH 1DQQA 2XG5A 1NUFA 3CPLA 2HP4A 4NZUL 5L2KE 3UTZB 1QO3B 3GM8A 4QOKD 2H26A 5GJSL 5D7JB 2Y07H 4A2MA 2VZOA 1BX2A 3SKOB 1RIUH 3CFDA 3GBNL 5H94A 2CIKA 1NAKL 2DBLH 1S7XB 5KVGL 3DX7B 3FT4B 5FEBA 1DLHA 3WS3A 3M8OH 1D9KC 3TZVB 5B39B 1JMZA 2NY4C 1HXYB 1K4CA 3EYQD 2YPLA 4ELMA 1HILB 5TDPB 4Z7UB 2AGJL 2A73A 1LGVA 1GZPA 5IMKA 8CGTA 4JGJA 3TBWB 1BAFL 1CICC 2R69L 4ODWA 3TBVB 1TZIA 1FVCA 3FQTB 2GUOA 5LJYH 2Q8AL 3H9YA 1TQCC 2LVEA 4D94A 2EE9A 3V4PH 2Z4QB 3AS3A 5I18L 2W60B 3EHBD 3ZE2F 1KTRL 1MJ7H 1OW0C 1G6RL 1ZWIA 1P1ZB 1KF9B 2DOCA 1BD2B 4GKSB 4L8SB 4ZS7H 1AXIB 2B2XH 2DIJA 3X3GL 4PJGF 2DRUA 3E1F1 1DBKL 3WE6A 1GOFA 5JZ7C 2X4NB 2E9JA 3H0TA 3STLA 3RBGA 2VISA 1OGAE 1MRFH 1IEAB 4HUVB 3TPKA 4S0TD 2PYED 3VG0H 3QIWD 5E2UL 2XNAA 2BC4B 3ZYOA 2H32H 5EO9A 2VLRA 1QKZH 2B5IC 1QLFA 4TNWK 2G5BB 3SGKA 4JFFA 2WBWB 4JRXB 3NOIA 4PY7B 3NA9L 4ZUWB 3VH8A 1S7TB 1G9MC 2W9EL 3QEQB 4MD5A 1F00I 2F74A 5ISZD 1KUMA 1P9MC 4S10A 4EI5B 2R56L 4JO1L 3I9GL 1LP9B 5GS3A 5D2LA 5BCAA 2ZNWA 1EBAA 3O6FB 4WU5A 4M8QB 3HUJE 3MNWB 3RGVC 1AE6H 2D7OA 1CLOL 5I1IH 3DI3B 5LVEA 3CCHB 4JZJC 1SJHB 1S5IL 2VRAA 4TN9A 1MVUB 4I3RL 3BISA 4M02A 2VDPH 5DRWB 5HDOA 5JDSB 4GBXD 1RHFA 4HUWB 4NN7C 5DD0H 5H37G 3RWFB 2KQNA 3PNWA 5EFIA 5E99L 3QI9A 1ZEAH 4DKFL 5E08H 4ZTOL 1A9BB 1CR9L 4Z7VF 1IC5L 5I1CL 2FHCA 4PJ7B 1UB6A 4G6JL 3EGSB 1KCSH 4FQJL 4BZYA 3VFNA 2XYCA 2GSIB 5JMOC 1G1CA 2P43B 2EH8H 5TF1H 1NCWL 2VLLA 1HYSC 1H3WM 3SKUD 1UM6L 1HKLH 1JP5A 1YMHB 4OCLC 2V5TA 5EU4B 4RMQA 1AGFB 5TE4H 4XPHL 4Y4KB 5LG1A 1KSRA 4X7TB 1JZ7A 1IMHC 1FL6B 2YKLL 3FOLB 4KAQH 3SE8L 2EEDA 2FB4H 4WUUD 3TJEL 3SO5A 4PGDB 1URLA 1C16A 3G9VA 3EYUH 4TPRH 5E1AA 4UQ3A 2IBGA 1UQSB 3N9GL 3WIHL 4HEPG 5BOPA 5I0DA 1LO3L 1T1YB 1QFHA 4YH6A 3TWCL 3BPNB 4N0YL 4JFOA 2HKFL 8FABA 1M71B 5D1QC 5C07E 4X4YA 2G60H 3WFCH 3UTQA 1FFOB 1FFNA 12E8H 4CDHA 4BUHA 5B38A 5D1XA 3RKDD 2H8PA 4G9DA 5C0EA 4CW1A 2D4DA 5I16B 4BELD 4CUCA 3WLWD 4IRJB 1LEGB 4OZHF 2D2OA 1CD8A 5IR1A 1IC4H 4ZD3L 4P2QD 1RUPH 1YEDB 4I3SL 3VWJB 5C09B 4OLXL 4POUB 3P9MB 1U8JA 1OPGL 5CHNB 5F1NB 1X44A 3O11A 1I4FB 4MAYA 1DVFB 4D9LH 3F7QA 1RK0A 3O9WC 1LWRA 4L4TE 1I85A 3QAZB 5C0CD 4XPGH 5I74C 2XTJB 4CDGC 2ID5A 2DLIA 3IDXH 1IGTA 5T1MB 3KPLB 1WK0A 4I4WA 4JFHD 4WGWB 4G80A 4Y5YB 5DMGC 1T4KA 3ARVA 3O2DH 5GGTH 5D9SA 4IIQB 4NC1E 1BOGA 3QFDA 4XVSH 2FLBT 1QSFE 4LEOB 1Q0XL 5JW4Q 2IFFL 2JJWA 1QFUH 4YDVB 5GS2D 3D69B 3IDIB 4KKCD 3ULVL 5EPMA 1VKXB 1P69B 3EHBC 4DGYH 4I2XE 1AKJB 4M61A 4X7SL 1FC1A 4NM8H 4PJIB 3WFDH 5K9KA 2I5YL 4Q58C 3G6JF 4FG6D 1UM4L 4DZBA 3QDMD 4BQ6A 4LRIA 4HWEL 1L7TL 2HFEB 2FR4A 1BZ7A 1BF2A 1UCBH 3IKCB 4JZNA 3U9UA 3LQAC 3QIWC 2EC8A 3MJ9H 1CE6B 2QLVB 3MLRH 1C5BH 2CDFA 3LRHA 4U1GC 5FIEA 3STZB 1A1OB 2OI9B 3VI3F 3OJ2C 3PGCB 1CXFA 5D5MB 1WGOA 1D3CA 2DWEB 5T1DL 1TJHH 2VIRA 4YHML 2BK8A 1RUAL 3WN5B 4DN4L 4LVNB 4M3KB 5I1LA 4PRHA 1F97A 1V8HA 4YWGH 5KVFH 1A7OH 3GBML 3TIEB 4PLKC 1YNKL 1NCNA 3D0LB 3HRZB 5F3BB 1H8OA 3BE1H 1XGQB 4AG4L 4P5TA 4Z76A 3ARGA 1TIUA 3IKKA 4ZPTA 3O2WL 1A8JH 1IILE 5BS0D 2XN9A 3R8QA 1BLNB 4Z78B 3DYMA 5GRYA 3RZCC 5DEGA 4WV1A 4K3EH 4GBXC 4PJBF 2XKNA 3ARBB 1RJCA 5K59F 2DIBA 1AJ7L 1IFHH 2NY2B 3JTTA 1W72L 4JQVC 4L4VE 3QULA 4GG6F 2CK0H 3O2VH 3W11D 3EKCA 3TIDB 1DQQB 5CP3A 3N1GC 2XWBA 1CIUA 2H26B 4YHPB 1TZGH 1BX2B 4R0LC 4NQEE 4XVTL 1P4BL 2D0GA 1EJ6A 5H94B 2CIKB 3EIFA 4JFDA 2DQUL 3BAEH 5ALCL 4XGZA 3TT3H 3DNKA 4W6XB 2FH8A 1KN4L 3WS3B 4RMRA 4IS6B 4KZDL 2YPLB 5EBGA 2IALA 1JNLH 3SDXF 3H3PH 2A73B 3LKQA 3GSWB 1GZPB 4EN3C 2FZ3A 4KTDH 5IMKB 1NDGA 2NXYC 3WXVH 4YNYA 5K9JH 1P9MA 4GKOA 2ZCLL 3P4OA 1AGBA 5HI3D 1FVCB 4XPTL 2GUOB 2H2SD 1DBAH 4JREB 4H1LA 1FZOA 1FPTL 3AS0A 2YPVH 1N7ML 1KYOJ 5DDHA 3RKDC 4DFIA 2C5DC 1S7UA 3VG9B 3RPKA 5HD8D 4ZOCA 1ZWIB 4JN1L 3WLWC 1J12A 1KPVA 4KJYB 1CGTA 5K33A 4LLUA 3WE6B 1OHQA 5DFTA 4HJJL 3H0TB 3STLB 5A1AA 3WFHA 3MCKA 2QSCL 1T1XA 3TBSA 1MRDH 4MDIB 3D18A 4FXKA 5EO9B 3UJJL 3OAUH 2UZIL 3SDDD 2D03L 2W9LA 3P30H 4JFFB 1C5CH 1XH3B 1NBZA 3MJ7B 4WHCA 5E6YA 4MD5B 1NBQA 1KB9J 2F74B 1YNLH 2MWCA 2VDLH 4KDVA 5D96B 1X5FA 1A7PL 1DFBL 1H3UA 3RIAF 4L1DA 3TLRA 1JIBA 3C6SA 3V7AE 1YJDC 3GRWL 5D2LB 1MCWW 4XWGH 3PWVA 5T3XH 3GMPA 1GC1C 4WU5B 5DQDL 1IL1A 4UILH 1XMWA 4X98A 3L5WA 4YGVB 4LSSH 4KKCC 5KZCB 1YEJL 4JPWH 4XP4H 2J3SA 1LD9A 4I77H 5L88L 3FQXA 1WZ1H 2LU3A 5EFIB 4UNTA 1CXEA 3C6LD 3RIFK 3QI9B 2MCPH 3PGFL 1F4YH 4FG6C 3MC0A 4PG9A 1VGEH 1D5ZA 1UB6B 3EJYC 1MCFA 5IBTL 2BCKA 3CFBA 2EYSA 3WFEL 3C8HA 3OPZH 5B22A 3PDOA 4HF5L 2ICEA 2VOTA 2VLLB 4WI6A 2X1XR 1GZQB 5F7YC 3DX6B 4EQ2A 5IBUG 1FL5A 4P2YA 1WFTA 3Q6FA 1MVFA 5EOCJ 3GGWA 5J3HD 4Q9RH 1AO7A 2ZOLA 4X9FA 2VKWA 5ICXA 3OKLA 3LRSB 4L8BA 4GXUM 2GAZA 2F9BT 4X6DA 5E1AB 4UQ3B 1A4JB 2E7MA 2N1KA 1XF2A 1BBJA 4Z0BL 1MREL 3HNTH 4RGMC 3WEXB 4MNQA 1JNHA 5BVPH 1WT5C 5DJYA 3VGDA 3HC4H 4M7LH 3T1WA 1YMME 4PRIB 1NGWA 4OF0A 3RVWD 5LWYL 5ITFB 1NAMA 3N0PB 4KGLA 3UTQB 1FFNB 2GY5A 2NY6B 5IMMA 5B38B 1X5HA 2H8PB 2DM3A 4LP4A 2NY5H 3ALWA 3O81A 5DJDA 4CW1B 5C0EB 1BFSA 3W11C 1FAIL 3ARUA 1KEML 3K46A 4GMSH 2Q1EA 4YQXL 4GSDL 5A3IC 5IR1B 4NJAL 4PV9A 3U4BL 3O6KL 4CU8A 3D39A 4HUUA 5I71B 4XCEA 3QO1A 4JO3H 3IFLH 1U8JB 4FMKA 1ZLUK 4M6NL 3O11B 3BGMA 2R29H 1RK0B 5D8JH 1IGTB 2EEBA 4HIEA 4POYA 1J0JA 1OAQH 2C3GA 4I4WB 4G80B 3NIGF 1T4KB 2Y36H 3GEWB 5D9SB 5JR1L 1CK0H 5HI3C 2DJSA 1BOGB 4EUPA 4XP9H 2FJGA 1PJ9A 1NGYA 3SDAD 3SE4C 3CSBA 1CT8A 4M93C 2NXZD 1HXMA 3ZKNC 2VXUH 3WXWH 5DZNA 4C56E 4Y1AE 3LN9A 1K3IA 5F9OL 4XNYH 4BUGA 3RZCA 1ES0A 4D0CB 3HLAA 4GW4A 4TUOB 4M61B 3OG6B 4M4PA 5K9KB 3U7WL 4Q9BA 4DZBB 4PJEA 1FRGH 2M8XA 3HA0A 2FR4B 4YBQD 1FNSL 1T22A 5I73B 3KXFA 1BFVH 4OCWH 1DLFL 4JZNB 3K4AA 5IVOA 1IQDA 2BOBA 3U9UB 3P40A 3MRJA 1GGBH 4OGZA 5HGHB 4HX1A 3MA9L 2VAAA 2X41A 5JDJA 2CDFB 4JFZL 2HLAA 5DVNA 1HZHL 3TC9A 1P5VA 3AS2A 1I8MA 2JELH 5CIPH 4YDIL 1IKFH 4JPKH 5I1LB 2E7BA 4PRHB 4XBEH 4YPGA 2P47B 1B2WH 2E7HA 3CSPA 3QUYD 1E4JA 1IVLA 4P5TB 4Z76B 3ARGB 3O41B 3BHBB 1WTLA 4ZPTB 4NQVB 2XN9B 1FGNH 1N8ZB 3VGHA 1BJ1H 5CUSL 5DEGB 4JLRA 1T0PB 1IAKA 4P5MA 4WV1B 4O00A 3VXMD 1I3RB 5GGVL 4FA8A 3MQIA 4GXUN 1WQVT 3FQWA 4XAKE 3IAGC 3IU4L 1LQSR 1PY4A 3OJDA 3QULB 4S11A 1DQLL 1G7PA 1IT9L 2OR9L 2OS7A 2UWEF 5EA0H 1AY1H 5C0BE 1NBYA 4NNYB 2QSTA 1Y0LA 5ILTH 2YRLA 5DJ8A 2B1HL 1NGQL 2VUYA 3IJSA 4PLOB 3RWHB 2EICA 1T80A 1WV7T 5IROA 1OAKL 5DSCA 4XGZB 4JVPA 3VGBA 1FG9C 1IAII 1UC6A 5F1IA 1J86A 3QIUA 5J1AB 2X05A 2IALB 3QEQE 3OR7A 3CDCA 5ERWA 5CEZL 1E4KA 4APQD 3MV01 1F02I 1NDGB 5I1GH 3QIBA 4NBZB 4P2RE 4CN4A 2R0KL 4TSAL 3JVGC 3ULVE 4CVUA 1LP9E 3P4OB 4U0RB 4P57A 4WW1A 5CZVL 4JY4B 4HWZA 4OJFL 3NFNA 4JFXA 5TDOB 3RVWC 1CBVL 4H1LB 1BP3B 2ZG3A 1FZOB 3QDGB 3KPQB 1VPOL 1OTSD 5A43C 5DDHB 4Y4HD 2PR4H 2ZG2A 3O4OC 3T0BA 1S9WB 5KG9A 2EYTB 2E9WA 3WIIH 3PJSB 1K8IA 4JQXC 1KPVB 2J6EA 4GAJL 4E42A 1YEEL 4LLUB 4TUKL 3X3FL 1J0KA 4PJ7E 4ACPA 1VACA 5KOMC 5E1HB 5I30L 1CDUA 3WFHB 1QFPA 1F58L 1T1XB 4XX1E 1LO2L 2MQ3A 1RZJH 3TBSB 1UWXH 3UYRH 4QRTA 4MMZC 2VXTH 3TN0C 1LE9A 5I1AA 4FXKB 1YN6A 2RGSA 1AQDB 4GLRH 3MO1A 3T0ED 1WITA 5T3XD 3RL2B 1KB5A 1NBZB 2J4WL 3LHPL 1TZHB 5HXMA 5TQ2L 1A6UL 4QHMA 2DTML 1E4XL 4HIJA 4LPYA 3C09C 1WZLA 2ZUQB 1NGZA 4KK6C 1QSVA 3C6SB 3W82A 3FFCB 5EU3A 2OQJA 3HMXA 3NGBB 1QFWH 1W8NA 3QB7C 3PWVB 1LMKA 2NXZC 1IL1B 3MRHA 1H3GA 4KI5D 5EOCL 4B0MM 5IKCA 1HK6A 1HEZB 3SCMB 5C9JA 5I8OH 5M95B 4X98B 5EIIB 3L5WB 5F7EH 5I8KL 1IEHA 3EJZC 4PRBB 3T0WA 5FO7A 4F15C 3FQXB 1WT5A 4Q6YA 4UINL 4PJXF 4S0SD 2VDNH 3U48A 4IOFC 2DQFA 2XKSA 3QWRD 4CNIA 1O0VA 1NCTA 1YEIH 2GFBA 1NLDL 3FQNA 3IDJA 4YBQC 1TTFA 3ARDB 2BCKB 3CFBB 2Q86A 1ZHBA 2EYSB 4E41D 1BBDL 4YEFA 1QSED 1AI1L 4AT6A 4RFOL 5HVGB 4DQOH 2FLRT 3NAAH 1ZGLA 1U8NA 1UKTA 4Q74A 3KWWA 3IDNB 3OR6A 2J5LC 3KPSD 3Q6FB 1CU4L 3GGWB 3HN3A 1R3IH 2AQ1A 1AO7B 2ZOLB 2IQAA 2WIMA 3T2OA 5ICXB 4LGSB 3VXSA 1C5DA 3OHXA 3OKLB 1SBSL 1RUMH 2DLHA 2GAZB 4X6DB 3PWJA 5DC9B 3KLDA 1BBJB 1T5WB 3BP5B 1FLRH 4MNQB 4WUKL 3GI8L 3U0WH 1JNHB 4HK3N 3UTTD 4J6RL 5F88A 5F9JA 5DJYB 1G9ML 3T2PA 1BQSA 3I3EA 4F58L 3MLSH 1NGWB 4U1LA 5KVEL 3SE4A 2HH0H 4FXLA 2P45B 4B7IA 5K9OA 1NAMB 5IMMB 1N0XL 2KZWA 3UTPE 3KJ4C 2Q6WA 4OM1L 5JA9A 4RAVA 1J9CT 2I60H 4GH7B 4I9WD 5MHSD 5HI4D 4OF8A 3V4UL 1FP5A 4JANA 3KYOB 3CXHK 2DI7A 3SDYH 1ND0B 4O5LH 5GZND 3DMMB 2RCSL 3MLYL 3UBXB 2X42A 4HUUB 2CMRH 1KBGL 2DF3A 2AK4E 3QCVL 4ZAKC 3QO1B 5D72L 1UWEH 2BY3A 1PBYA 4NQTA 3S3PA 1CFTA 1OT2A 2FX9L 3OG4B 5D5ME 4CL7A 3MCLL 1C7SA 3ZKXB 4ZFZA 1YC7A 3BGMB 1EUTA 3D3VB 1ZXQA 2FX7L 5CGYC 1QNZH 4JO4L 3OJVC 4K71C 3WJLC 1WJ3A 4APQC 5J11B 3P0VH 5MEOB 1RIVH 1ZHLA 4XT1C 5E70A 5ADPL 2A0LD 5TDNA 4L8DB 3QCTL 3RWGA 3V0VB 4WIQA 3FKUS 3KYNA 5HHPB 1NGYB 5SV4A 3KPOA 1P84K 3NACH 2LQRA 3MXWL 5EU5A 3ARXA 3ZHKA 5E2JA 1CVRA 1NCDL 1TDQA 3MV9E 4Y4HC 2PW2B 3QISA 3ELAT 1RJYB 2DIAA 3PP3K 4RX4D 4J1UB 1ES0B 2OJEB 3HLAB 4O02L 4HIHA 4OD2A 4GW4B 5JHDA 1CG9B 1JYXA 4NRXA 3REVA 1BM3L 3SDCD 4UBDD 3EOTH 4PJEB 3MREB 4PJ5E 4J3UA 2O5YH 1T22B 3KXFB 4LCCC 4F2MA 4ODSL 4U1HB 2BOBB 4KK8C 3MRJB 2CPCA 4HX1B 5LGKA 2A77H 2VAAB 4FQXD 4P4RA 3F58L 3DWTA 5T5NG 3T0EC 2HVKA 1EHNA 2HLAB 3F62A 1FVDA 4PUBH 4M1GL 4G9FB 1WIUA 4M6OL 4NQCD 3GJFA 1U6AL 1I8MB 2YPLE 1L0YA 3DGGA 3FTGA 4ELME 4TVPD 2BRRH 3RJDA 4YPGB 4Q9QL 4XBGA 3BKCL 1P7HL 4NUGH 4YO0A 1SEBB 3M45A 4LPUA 3OKOB 1WC7A 4BKLA 4GLRI 5T3ZH 5DVOA 4KI5C 3BEWA 1TCMA 2R0WH 2R1XA 5GRUL 4BSVA 1I1FB 3JVGA 4JLRB 3X13B 1IAKB 1QBAA 4P5MB 5FYKE 2EO1A 4BH8A 4FS0A 1KPUA 3CDGA 4IJ3B 1KCLA 3OJDB 1G7PB 4JDTH 4ENED 2HWZH 4Z6AT 4F9PA 5C0IA 3RHWK 2ICES 1ZK9A 1Y0LB 4XNZC 4LARH 4Y16A 5DJ8B 4ZXBD 1DSFH 1MCHA 3IJSB 2PNDA 3KDMA 2PUQT 5E6ZA 2VLRE 5DSCB 1EAJA 4ONHA 3IDYB 4JFFE 5F1IB 3HC3H 5HHMD 5FDWB 3QIUB 4Y19D 4DFHA 1HE7A 1G0XA 2NZ9C 3WFBH 1T03H 5ERWB 1BF8A 4U1NB 2JJTA 3VW3L 1RZ8A 3QG6A 1XF5A 4M00A 2WP3T 1KJMA 3QIBB 3LQAL 4OB5H 1R5IB 3VRJA 5FYLH 3DUHA 3PQYA 4JDVA 2YMXH 5CINL 1V3MA 3BP6B 4KI1A 4R4ND 4P57B 5BMFL 1H5BA 1MJ8L 3AAZA 4ZSOA 1A3LL 3Q2CA 4WW1B 1X5XA 3UPCA 5KS9B 4HWZB 3DRQA 4XBPB 2ADJB 1OP3K 3NFNB 4JFXB 1KT2A 5CBEA 4HWNA 5HDBE 2ZCHL 1DEDA 2MKWA 3EOYG 2OX5A 5D70H 5IT2L 1P4IH 5KG9B 3VFOA 3O4LD 3ORJA 3K2UH 5EORH 1F8TL 1J0YA 2YD1A 5BOZG 5TFSH 3DVIA 2BVYA 1K2DA 3SQBA 2I26N 3P77B 4E42B 5GRWA 2F58L 1RZKC 4WTZA 5IIEB 4P99A 3GM0A 5BRZA 4D0BA 1VACB 4UUJA 4L9DA 1UM5L 4MXVF 1ZV5A 1N6QH 1JHKL 2WAHA 3GSRB 1ZT4A 4JKLA 3WNNA 1F13A 1KV3A 4QRTB 4OZIF 1BIIB 5HYIA 1LE9B 1YN6B 1MIEH 1S7RA 3MO1B 4PRPA 5AZEH 4UT7L 4CN6A 1MHPL 3VDBA 2DYPD 4L5FL 2OP4H 1YEFL 3MRBA 3WFZA 4QHMB 3BP7A 4OV5A 4LRNL 3QFJB 2OTUA 4XAWL 4OBSA 2VMFA 2A0LC 2HKHL 1NGZB 2X09A 3HCVA 4Q2ZA 1KCVL 3AREC 3HE6A 5EU3B 1PLGH 1WIPA 2OQJB 1ZT7A 3AS1A 5C6PB 4U2ZA 3LKRA 3MRHB 4GRWB 3GHBL 4Y5XA 5C9JB 1KGCD 1OQOA 2VXVL 3O3AB 1MFCH 3FZUC 4P2OA 1MI5D 3OXSA 3QUZD 1PG7H 5FO7B 1F4AA 4HG4J 4QTHB 5C08A 3RIFF 4ZUUB 4NO5A 2ZCKH 3JTSA 3LDBB 2J8UF 3BYYA 1QHPA 4M8VA 3CFCH 4CNIB 2DQFB 3GMNB 3QHZH 2GFBB 3ZO0A 3PWPA 3GI9H 4X7FC 3IDJB 4U4BA 1MCEA 2Q86B 3HMWL 1B3JA 4X8JA 4OF7A 1GJIA 4PJ8B 1A6VH 4FQXC 5GGQL 2FH6A 4AT6B 5DK2A 2BVPB 3KYKH 2GKIA 1VERA 3ARPA 1ZGLB 2APBA 3KWWB 3MV8D 3OR6B 5EC2A 3UYPA 3CUPA 1J8HA 3KLAA 1O7VA 1VESA 4LLYB 4QRQA 4R6UA 5KSAD 5IW3A 5E2WL 1P4LA 1C5DB 3UTSE 1ZSDA 1OM3L 5SWQB 4J3SA 2D7TH 3PWJB 4K2UL 3ZT5A 4OZHA 4K8RH 4ZS6C 5DRNA 3S5LA 5F88B 3RVXD 5F9JB 3D85D 3OSKA 3B9KA 3T3MF 3BDXA 1WFUA 4U1LB 4G6KH 5K9OB 4OLUL 3ROLA 1DN0B 5KAQF 4LSQL 3S34H 3JUYA 1FLTX 2AI0L 1NFIA 2Q6WB 2BP3A 2Y6SD 4LMQE 1MFAH 3OJMB 3OWEA 1A5FL 4NJ9L 1JV5A 1GC1L 1GGIH 1T0MA 5T33H 3KR3H 4YFLF 4ZXBC 1FYHB 5DMKA 4WCYL 3TVMD 5IM7B 3G6DL 4N0FA 3WUZA 4U7SA 5EBMA 5D1ZC 2J6EL 1X6LA 5JXED 1CFTB 3V6FB 2MQ0A 1ZMYA 5EBLB 2F53B 4ZFZB 2JJUA 4I0KA 1CIDA 3C8KB 4M7LT 4HFWA 3MRPA 3V7MA 1OAXL 1B0WA 4PRHE 2HFFA 2DS4A 2PXYA 3G6JA 1EGJA 1KCKA 5I75C 4QNPF 4CRPA 3KPRA 3D9AH 1KB5L 5TDNB 4OQ1A 3RWGB 3VA6A 2Q76B 4FFYH 4NWUL 2LVCA 3KYNB 5E7FA 3X11A 1H3XA 3KPOB 3QRGH 4KMTL 3G04A 3EFDH 4PJCA 5AAWA 3HNSH 1MCDA 4TVSa 3CK0H 3OGOE 3ZE1F 5GS1A 5L8LB 3NCEB 2OLDA 4WWKA 3S4SG 2FHBA 2VC2L 4HIHB 3RNKA 5JHDB 1FE8H 4NRXB 1GHFH 1JTOA 2AJSH 2VYRE 4Y2DA 5IFAH 1M7DA 2BNRB 3MRNA 1UG9A 4P59L 4PS4L 4EEEA 5JNYA 2ED8A 2DQIL 4NO0D 2ZOKA 4F2MB 3BJLA 3FT2A 3FMGH 1IAIM 5EZLA 1RMFL 4G43B 1E27A 2QQLH 4P4RB 2RFXA 4JFDE 3QWOA 4GRLD 1TCRA 2BHUA 4W4OC 3VMOA 1FVDB 5T3ZD 3B5HA 4PJBA 1XGRA 3GJFB 1DQJA 3CX2A 3DGGB 3L7EA 1N4XH 1MFEL 5B21A 2DD8L 4GG6A 5HGGS 2YEZA 5D93B 4DUXA 4YO0B 3S98A 3IETB 5DUBA 4HGKC 4KC3B 3KHOA 1WC7B 4K9EH 4BKLB 2L4OA 3BT2H 4X6FA 2YXMA 3ZSSA 3BEWB 2R1XB 4BSVB 1PX4A 2GK0A 3IRZA 2E8ZA 2YN5A 3K8LA 3MCG1 4JO2H 4A6YA 1U8QA 3C2AH 4BH8B 3BUTA 3LPGA 3T4AA 4Z0XA 5JA8B 1KPUB 1MLBA 1MNUL 1Z0NA 2E27L 3CDGB 3VCLB 4KTEH 4Z7WE 2OL3H 2GW5A 2FGWH 3SDXA 4J4PD 1XCQB 4N0RA 4XCCL 5TE7H 1HHJA 4NSKA 4OKDA 1L6XA 4XP5L 2VDRH 5C0IB 5FYJL 4MS8C 2FWOA 3DSFH 4M6MH 1KXTB 3DPBA 3IDMA 4V1DD 4X5WA 3CVHA 3BKMH 5KSBF 1V05A 3DX9A 2HVJA 3KDMB 4Y4FD 3LAFA 4UV4L 4HH9A 1R3KA 2ZG1A 2AJVH 1NKOA 2XT1B 5FYLD 3TBYA 5IK3A 5SWSD 1S9KC 3W0WA 4ONHB 1RUQH 4HFUH 4DTGH 2C4FU 1F4WH 1FSKC 5KSAC 4B50A 3T8XA 1Q94A 2AKRB 4NQSB 4JGMA 1RZ8B 4FXGA 2YZ1A 3QG6B 2CD0A 1KJMB 3VRJB 1KULA 3PQYB 4JDVB 5F96L 3DSNA 5L2KD 4IMKA 1U8LB 4NPYA 1H5BB 3AAZB 4ZSOB 3RVXC 4U1IA 4M48L 3W9EA 3CLEH 1KB9K 3DRQB 4JG0L 1KT2B 1EZVX 4FNLL 1MUJA 4PTTA 1QBMH 1Q0YH 1HWGB 3N50A 4ONOA 1DTUA 1OLLA 3VXOA 4QGYA 3E3QC 4JHAL 4AEEA 3WDIA 1K2DB 4ONFH 3DO7A 4TYUA 5BRZB 4UUJB 1RIHL 5KTEH 5CILL 2A83A 3TA3C 1ZT4B 4OCXH 4N8PA 4LKCB 3PABA 2GJZA 3VFRB 5I1HL 5T1KB 3QQ9C 1S7RB 3UZQA 4PRPB 4CMHB 2OSLA 5EUKA 1DCLA 5C0AB 4FFWD 4XP1H 3WO3B 4N5ED 4P23A