1Q9KB

S25-2 fab unliganded 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-2 Fab (IgG1k) light chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9kB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9kB01
3NH7H 3L3HB 5E8DH 1IMHC 1CE6A 3PJSB 1X5ZA 2YUVA 4Y19D 2AVGA 3WFCH 4PJ5E 1FNLA 1AO7B 4I3RH 5E8PA 5EOCL 3IJYA 3FL7A 4XVJH 3PHQB 4LP4A 4JKMA 1RAMA 4G8EB 5C6PB 4FXLA 2ZUVA 4ZO8A 1PYWA 1GAFH 5ID1B 4XX1E 1QOKA 3VGAC 4KY1L 3DRQB 2QQNH 2CR3A 2R29H 4LLDA 3IS0X 1PG7L 4HLZG 1HSAB 5H37H 3MV7A 1L6XA 5F21B 1I3VA 3FT4A 4R97B 2GSIB 3RIFF 4HXAH 4HC1L 3PL6D 2KZWA 2OSLA 4OZ4A 4U3XA 4IM8A 4JR9H 5F93C 5FGBC 3U48A 1T5WA 4JY4B 2NXYD 4LIQL 5I9QB 1GOGA 4RNRB 1RZGB 4KKAC 4WI5A 5BVJB 4U2ZA 3NA9L 1CLYL 4M61B 2NXZC 3G6JF 1G0YR 2UV3A 5LJYH 4X8XA 3LEXA 4Y2DB 5CCKL 1M7IB 2QQQA 1OAKL 3QIWD 4OZIA 4G43B 4AENA 3MFGB 4M8QA 4WW2A 4PGDA 3VG0L 1I7ZA 2BNQD 4FZ8H 1MELA 1IQDB 5CD3A 2ZCKH 2X1QA 4PJDE 4NKDA 4UILH 1MOEA 2I25N 1K4CA 1NGQH 1UM6L 3I50H 2DQTL 1EBPA 4FQXB 1J9CT 4LVNB 3RAJL 4JDVA 4L8SA 1IKFL 3VFNA 4V1DE 1GYAA 3Q1SH 4Z7QF 1CFNA 3L7EB 1T21B 3JV4A 1OM3H 2XQBL 3RWIB 1T1XA 3R4DA 2H2SC 4EUPG 4P2QB 5DMIH 8CGTA 4XVSL 1G9NH 4UIKL 4Q9BA 3BPOB 5IEHA 3ULUD 6FABL 3L1OL 2BRRL 3FO2B 4FOMA 3HMWL 2FX9L 3UTSB 4C4KT 5HHMD 3BH8A 4ZUWB 1RVFL 4NN7C 3EFDH 1M6OB 1Z6JT 3ZL4H 5KJRL 3O6FC 1M71B 2HT4D 2I9LB 1FZOB 1QHPA 1GZQA 1WZMA 5EBWB 4L3EA 5D7IF 3G6AA 5T33H 3SY0B 3PE9A 2AXFB 1LO4L 4NQDA 4X5WB 3S35L 2VISB 2X7LA 4KK5C 1JPFB 5E70A 4GG8A 5A2IH 4YDVA 2DQUH 3MV9D 1ZLWH 1S5IL 3QUYA 3UPCA 2I9TB 3RWHA 2OI9B 2B1HH 1A22B 3HC0B 4PRPD 1QRNA 3UJTL 2W9EH 3EO9L 3T4YB 2ESVE 2P45B 5CKGA 5ALCL 2WZPD 3MR9A 5DFTA 3IU4H 5JHLH 3R0NA 5FYKL 3OG4B 2F54D 3VXUB 2EKJA 3NIGF 1VPOH 1MAJA 3BUYA 1A4KA 3MUY1 5BVPL 4CN4A 3MJ9L 1AY1L 1S7XA 4XCEB 4UT9H 3SE3A 2ADFL 3L3IB 2C5DC 5D5ME 4XNZC 1G7JB 2V5RA 2IBGA 4EZMA 3GUTB 5I76A 4NO0A 5ANMA 5F7MC 3EYOB 1U8KA 1FG9C 3UJJH 1CIDA 5E08L 1DBJH 1MEXL 3NACH 5E99H 2NNAA 2CDEA 3MLVH 1VEOA 1FIEA 3BSZH 1MFBL 1ZA6A 1EX0A 5J11B 5GRJH 2BOCB 5C0BE 1DQLH 5D1ZD 1KEML 2K7QA 4KUCD 3VFMB 1WFUA 1F4HA 1FNGA 4RGNB 1FCGA 3D2UD 5GS0C 5CZVL 1MHEB 1JI1A 2A9MH 5DJXA 1INDH 4HUVA 1F3JA 1MJUH 1RIHH 1CXKA 1Z3GH 5F1NB 1QLFB 5EIIA 1YQ2A 4JDZA 5EOQH 4KRLB 3N85L 4PJFE 4G8GA 4APQC 5T1MA 4J6RL 1EJOL 4X6CB 1VERA 3WJLA 4CGTA 1U8JB 4ETYA 5TPWH 2EXYC 1H8NA 4E41B 5JW4N 1JGEB 1NMAH 1ZXQA 4HFUL 3CX5J 4OKDA 4ONHB 4ETQB 2OL3B 1LO2H 4LNVA 4Y5YA 2KUTA 3Q6FA 4XRCB 3W2DL 3WFHA 3VI4F 1GIGL 1NUDA 2A6KA 4MA1B 1RUAL 4S1SL 3CVHB 2COQA 4EN3C 2CKBH 4XC3H 5BQ7B 5T3XL 4UT7H 1L0YA 5HDBE 2HH0L 4CAGA 5D6DC 4DKAA 4PJEF 3ROOA 3VFTB 2NY5C 4F33A 1PEZA 3BEVA 5D2NE 3QJHB 2V2WB 4LEXL 3OR7A 4N8VA 1AGFA 3TBVA 2WBJB 5SWZD 5KW9L 2FJHA 2XWJA 3VFRB 2FL5B 3KPPA 1A3LH 3PGFL 5FHBL 3EOTL 3H42L 1ACYH 4J3WA 4MNQB 4U1JB 4PRIA 1G6RL 4AEIL 1F6AB 1ZWIB 2R2HB 2IFFH 4F7TA 5F1OB 4CU6A 4PJ7A 5FIEA 2ICWA 5C0NC 2MHAA 2JIXD 3B6SA 3G08A 4X6BB 3AAZB 4U6HA 4NP4L 4NQSB 3RTQD 3TN0B 3V6BR 3ZSSA 1S7SB 2HRPH 3H3BC 2DI7A 3FZUD 3L3GA 5FK9A 5JR1H 5LVEA 4C59B 4KV5E 3AXLA 1KJ2L 3HE6C 1X5JA 1UXSA 1X44A 1RIUL 3TPKA 1RJYB 4PJXF 3FOMA 1RK1A 2GFBB 3SE8H 4C56B 5IFJB 4TRPH 1S7WA 4GKNA 3MCG1 5CAYB 1JV5B 2ZUYA 2R8SH 2PR4H 5E00B 5D1QD 4QHKI 4F7PA 4FXKA 4R3SB 3HPJA 3ARTA 5KTEH 4ACPA 4OCSH 4F15C 1I9RH 3IVKB 2YMXH 5FXCH 5MEPB 1DQDH 4XTRD 2R1YB 1YA5A 4ZPTA 4QOKD 3ZKXB 2IPKB 3SGKA 1I7RA 3I9GH 5ITFB 1JNNH 3V6FA 4WDIB 3V0VA 4MWFA 1KBGH 4KZDL 2WQ8A 4IRJA 4H5SB 3AC0A 4XMKH 5A16A 1VCAA 1K5NA 1HH6B 3REVB 4Z18A 4P59H 2XV6B 4OLUL 4KVCL 3MRNB 1YECL 4I9WE 1VGKB 1S78C 4YJZL 2FBJL 4PJHA 2FWOA 3V8OA 4LLVB 3EDFA 3QPXH 4U1IB 5ETUA 3DSFH 3QEQE 1QFHA 1CLZL 1T6VN 2AJZA 5IVXE 4P5TD 5MEQA 4Z7OF 4A6YA 4ODSL 4KTDL 2NXYC 2FIRT 4NYLB 1S7RA 2VZ1A 3NTCH 5LGKA 4WHTA 1RFDH 4Q2ZB 1FHGA 3ARGD 5I1HL 3V79C 1S9XB 3BHBA 5FCUL 5DRZA 1N6UA 4LPXA 3GSRB 4XP1H 3NOIA 1CXHA 3F65A 5E9DA 5KSBE 1EUTA 3VDBA 5GRVK 5C07E 3QXDA 1BQLH 2DIJA 5D1XA 3I75A 5FM5M 3UJIH 1IM9B 1AI1L 1ZTXH 2LQRA 2DDQH 4HIJA 2VLKB 1CG9B 3MRFA 4Q58C 1H5BA 1BJ1J 2B4CH 4TUJB 1DL7H 1DEEA 1UJ3C 4JREB 5JNYA 3BAEH 4WI6A 2NPLX 4BELD 1UZ8B 2E3VA 2FEDC 5GGQH 3QO1A 4U6YA 3KXFE 1BBJB 5EWIH 5IMOB 3O3UN 2GJJA 3KDMB 4ZPVA 2P43B 1QBAA 1GC1L 2DM4A 3H9SE 5ISZA 1FE8H 4U1LA 1QLRB 3VXME 1Q0XH 1A6TB 3C60D 4DZ8A 3RNQB 2VAJA 1MHPL 5FF6B 2VDKH 2YRPA 2VDRL 4K3GA 5EPMB 1I3RA 5DVLA 3PQYD 3B5GA 4M6AA 3PIQB 4XWOC 1V5JA 5T3ZH 3TGXA 1KNOB 3FB8A 4PG9B 2OCFD 3UROR 3LHPL 1BX2B 3NCBB 2IH3B 4WV1A 2VNCA 4S10A 1UA6H 5F6HJ 3BKMH 2VXQH 5TDNB 2R56L 1FVEA 5DEGB 3B43A 1XGTA 3BGFB 3UC0L 1ADQA 3QDMA 3RU8H 1ZLUK 3ZO0A 4O2CA 1AD9A 1B9ZA 1HI6B 5JA9A 3M1BA 3UTZA 3PL6B 2AK4E 1F8TL 2JCCB 4NZRL 1TTGA 2NXYB 3Q48A 4KGJA 1EO8L 4YHNA 1OAXL 3Q0HA 5CIPB 3VFUA 3DV4A 4JN2B 3VWJC 3QIWB 5I15L 1VSCA 2BNQB 1A21A 3WNOA 1FFRA 1WICA 1B0GB 2VKXA 2XFXA 1P7HL 4Y5XB 1O7VA 5AG8A 3K4DA 1D5MB 4ZUVB 3WHXB 4YHKL 4CN1A 4G3YH 2RAMA 3SCMA 3QIUA 5FOJA 4QXGL 4M1GH 1MH5B 3ZDZF 4NUJA 3HZVB 4PTTB 3RZCD 1ZSDA 4WEMB 5FM4A 5JOPD 5E03A 3B2UC 3HCVA 1CS6A 3BQUA 1RHHB 3IYLW 4XI5D 3N1FC 4YXLL 3ARVA 1HKLH 3GJFB 4OZFH 2UYLA 1F4YH 4GW4A 1BAFH 1SJEA 5EOCJ 4MHHG 5ICZB 4FZEL 2R15A 1M7XA 5DMGD 2IANE 3LDBC 4CRPA 4TTDC 5HHMB 4I2XA 4Y4HC 3LS4L 1EFXA 4QHMA 4QY8A 5E6IC 3T8XB 5K9JL 1WT5C 3P4NB 2C3VA 3ULVE 3BD5A 5T3ZD 1ZLVH 3IDIA 4I18B 5GISL 5BW7C 1V3LA 4WGWB 4FFYL 5E7FA 5TE6H 3TA3D 1QFUL 2FCBA 4RSVA 1RJLA 1F5WA 2IBBA 4LSPL 1AO7E 4GG6A 3MV9B 5DJYA 2F5AH 4OCMC 3O81A 4KDVA 4PRPB 4DQOH 4H88H 1KPUB 3RUGB 2ZUXA 2MQ3A 2CRIA 2VLLB 4MJ5A 4PJAF 1D5IL 1FNHA 1MCOL 8FABB 5FFLA 3CAFA 5HPOA 5IWLA 5E2UL 2VABA 2F54B 4H1LG 3HE7D 4HS3B 2NZ9D 4NJ9L 1QA9B 3QCVH 4OLXL 3V5DA 3B9KC 4Z6AT 2EIZB 3Q5OA 2CLRB 4QRUA 2GYSA 1JGDA 2DICA 3GSXB 2F8VA 4XCCL 5DVNA 5EU3A 4AG4H 5SWSD 1FZMB 4OGZA 1CE1L 3ESVF 3U46B 4D8PA 1T3FB 2I24N 4RX4A 3MCLH 4EUPA 1C5BL 4CDHA 1DDHA 2FH6A 5D1ZB 4WFFE 3UO1L 5AUMB 2I27N 5KANI 3D2UB 5GRVL 2CLVA 3QHZL 3S9DB 3CFEA 5C6WH 1OAQH 2IWGA 4X6EB 1CR9H 5CHNA 5GHWH 1MIMH 2GK2A 2HFGL 5AEAA 5K33A 3QUMA 3RPIA 4JGMA 4X6FA 1YMHA 4JRWA 2APWA 1ZVSA 4N68A 4P2QE 5KOVC 3DROA 2CIIA 3O6KH 2IC2A 2HYMA 4JY5L 5J3HD 3DHJA 5I17A 1RZKC 1U8LA 3UTSE 3MV7D 4PR5A 1NPUA 2Z93A 5EC1A 4ELMF 3W81A 1GPOH 4ZFOA 4KK6D 2AERT 4S2SB 5CEXA 4C54A 4PRBB 4AH2A 4D94A 4NDMB 3LKPA 4HMCA 1KT2B 2J6EH 3V0WH 3V4PL 4MNHA 2WWKO 4YO0A 3RWCA 1AGBB 1OPGL 5IR1B 3RL1B 2GJZA 5HYEA 1A9BB 5B38G 1HZHH 2V17L 1S3KL 1C5CL 4YHZL 1RZFL 5E5UB 3RDTA 5BZDA 3JWDC 1HKFA 1M1SA 3NZ8A 1CL7I 2H9GB 2SEBA 5SWZB 4IEFB 4OFYA 1YEKL 4OM1H 2EO1A 1JUFA 4P5TC 4OLWL 4U49A 2BJMH 4LP5A 2B39A 2B8OT 5IFHH 2R0WL 4P4RA 2X70A 4G8IB 5F7HA 1JNHA 4GW1A 1J1XH 5GRXG 2JIXB 1J8HE 1GJIA 2CUMA 3RTQB 4JEGB 1BD2D 3QCUL 3HRZB 5EO1A 2XZAL 1NGXA 4MNGB 1Z5LB 5EC2B 5GGSB 1D6EA 1KLUB 1U6AL 3LEVL 1ZGLM 2VLRA 3S3PA 3V5KB 3CXDL 3ZTNL 1F3DJ 1VDGA 4HJGB 2UWEF 1I9IL 3SOBL 1YDPB 4RGNE 2ZCLH 4L3ED 1PEWA 3LS5H 4UIMA 1NFIB 1IGCL 4NQDD 1S9YB 4IRSD 5IB1A 5BO1L 4LKXA 4FG6D 3MUZ1 5D1QB 3ARDA 1FLRH 3QUYD 1OY3B 2VL4A 2Q3AA 5JUEL 3UZVB 3IXAB 4FQQA 1QRND 3D69A 4X6CE 2J5LC 3JWOL 2IPUG 3L5XH 2EDOA 3SJVD 4E41E 4OI8A 3IAPA 3C5SA 5I71C 1F11A 4NC1E 2KQNA 1NCBL 4ZUTA 4GAFB 4HJJL 2A1WH 3T77B 4QOKB 2R39A 2VXSH 4H20L 2CKBB 5HYQA 1D5BA 5MERB 4BH7A 4YPGA 3MYZA 2AQ1A 4LAQL 5B8CC 1PLGH 3F12A 3TT3H 4PBWD 3MCKB 3CXHK 4FMFA 2GY5A 1BBDL 4BFBD 4JQVA 4NO0D 4KHXH 5H2BA 3HS0A 1LDSA 2A77L 4PRNA 1MRDL 2LE9A 1MF2H 4WUUA 3U0PB 2DOCA 5DFVC 1ONQA 4HUWB 2HFTA 4OKVA 2O61B 2ZOKA 4LSRH 4P5TB 1WC7A 4E0RA 5GGUB 3MBXL 3T09A 4PG2A 1KB9J 5HHQB 4OGYL 2DQJL 4N1CA 1B0RA 2Y07H 2QSCL 5MI0B 3MRBA 1U8NB 4MNQE 5J1TC 2V7NB 3VI3F 2P7TB 3ARGB 5JDSA 3WL9A 4GAYB 3ROLB 2E27L 4NOBA 1H3XA 4U6VH 4G8GD 2DI8A 4IS6A 2FEEI 1NCWL 1U95A 4F3FA 1I1YA 3IDJB 3T2QA 2FGWH 4FQIL 4HF5H 1JGVL 1JGUH 5CEYB 1RUKH 2C9AA 1R0AH 3BPCB 1UADC 1BHGA 2WWKT 2X4QB 3HB3D 4NN5B 4I0PC 4Q9QH 3Q6GL 1CF8L 3HR5A 1SJHB 1G7PA 4ZSOB 3FQTA 3SE9H 4Z0XA 1B90A 3F7QA 4F7EA 1K2DA 2VDQL 5TQ2L 4C56E 3QZWB 4KK9D 2PN5A 5DJDB 5IBLC 5T1KA 3TVMC 2LFGA 5K9QI 1SJXA 1AHWC 1LO0H 1IFHH 5E8EA 1MQ8A 2UVFA 3C60B 3VGHA 4KTEL 4PY7B 15C8L 4KVNH 1T04B 4RISL 1JIBA 2NW2A 5GGRB 5TE7L 4RCAA 5JOEA 3PQYB 3DBXB 4BUGA 5B8CB 1Q94A 3QNYA 5HVHB 4BSJA 1EGJL 2BY2A 3AS2A 3KYOA 4GW5B 4QCIB 1JNLL 3U30C 4N8CL 2YK1H 5DJCA 4A6YH 4C58B 4PRID 4XMLH 5IHZA 3QYCA 4M7ZC 3VE0B 3OHXB 5I1JH 2J12B 2WNGA 3H9HB 5IMKB 4KKBD 4PJIB 1MAML 4QRPA 3FN0H 3U2SB 3P4MB 4RMTA 1WBYB 2AEPH 4FQ2H 4D0BA 1I7UB 4ODVL 3UYRL 4BZ2H 3SDDC 3X13A 2AKRA 3D48R 1TCRA 5FKAA 4NPYB 4QGTA 4XPBH 4MDJB 3KWWA 5I8EB 1AQKH 3DMMA 4QKXB 3QAZC 2MMXA 2NZ9C 4OAWA 1NCDL 1QLEL 4MB3A 2FGZA 2XKSA 2APFA 3GMPA 5C08A 1J5OL 2HT2C 5DYOA 5JIHA 4P48A 4Q74A 3VJ6A 3MRGA 1VKXB 1I9JH 2WIIA 3ARBC 2P44B 1KCUH 1UYWH 5KSVA 4YWGL 1XGQB 4XNUL 4XNMB 1W0WA 2W0KA 2X09A 4NZUH 2W9DL 1XR8A 1UXWA 2HTLC 2M8XA 5JLZA 3BW9B 3G9AB 2LAGB 3CSPA 2AABH 4MAYA 1IVLA 1KTDA 1MIEH 3RZCB 2R0ZH 4I0PB 4B53A 3DURA 2FLBT 1TVHB 2HFEA 4QHLA 5LQBH 1K6QH 5DJ2B 4XPGH 1XF4B 5CWSB 2OS7A 2BCKB 3P0YH 4JRYA 4ZTPL 3R8QA 3TVMB 2B5IB 4HEPG 4X83A 3BPLC 2YPLA 2HLFD 3RWEB 4K7PX 4XPFL 3MNZA 1AGDB 5DJZB 3PV6B 5CZXC 1J88A 1Y6MR 2WAHA 4PLOB 4ZD3L 1E6JH 1ADQH 5DT1L 2V2TA 4L1DA 4GAJH 3DV6A 1SEBB 4K9EH 3TA3B 5CP7B 4POYA 4Y19E 1A0QH 4GFTB 5F6IB 1IBGL 4EJ1C 2R23B 3JXAA 3HNSH 5M7QA 4LCCB 4GQPH 1JCKA 2OP4H 5EA0H 1B0WA 1H3PL 1EUUA 1ACZA 3ARFC 3DX9A 4OUOA 3RVWC 2AV7A 5FO8B 1HQRA 4Z95L 2XPGB 3MOAL 1Q9LA 4JPIB 1LO5A 1LP9F 5E9DD 4JO3H 2NX5A 2QR0A 2VLJA 5FGCB 5D1XD 3HE7B 3CLFH 3D25B 4PJBA 1PJ9A 2BVUA 3QAZB 5EZIH 2Y72A 2NY0C 3MRJB 2HJKA 4JFZH 2VIRA 4M5YH 2JCCE 1JTTA 2YWZA 1JWUB 4KJWD 4MJIA 5DEFB 5ICXA 3FO1B 4IRZL 4ZS7L 1ZT4A 2VDPH 4Y1AA 5SWSB 4M8VA 3QEGH 3LPWA 3QWOB 4ZS6C 4Z5RB 4YHML 5JW4R 3VH8G 1A8JH 2NY2D 3ARUA 5I1IL 4WTZG 4MD4B 1UACH 4G5ZH 4ODTL 2BNQE 4KMTH 4TUKL 3QDAA 4DTGL 2EDLA 4UDTA 5ISZD 3EJYD 1NUGA 2BC4A 3DX7B 2X4UA 3FRUB 4OCXL 4NRYA 4RMQA 3PF2A 3UTPD 4B7IA 3GI8L 3TH2T 4G6JH 1CE6B 3V52L 4M7LT 1X6NA 1EPFA 2JB5L 2JTDA 4OZFB 2EH8L 3LZFH 5DD3H 4HLZH 5CJOH 5E8PB 2ZPKH 3BVNA 3IJYB 4W6WB 3BN9D 1XT5A 4LKCA 2Q6WA 1PYWB 3EOBA 3CFBA 3S36H 2LVEA 3GMQB 4LLDB 3SN6N 3KPTA 3ULUE 5I0DA 3QDMD 4HX1A 3MV7B 5HHME 3MA7A 1EK3A 3FT4B 1AXSA 3MLWL 2OSLB 1OAYL 5F96L 1T5WB 1A7PL 1OSPL 5HDOA 5EUOF 2OR9L 4I3GA 4YDKH 4CADA 3FB5A 4XVTH 4H1LA 3V5HA 1RI8A 5I74C 3OKYA 5DI8A 3LEXB 2JKXA 3MV9E 4OZIB 4AENB 1BM3L 2EC9U 4M8QB 4HBCH 4WW2B 2AEWA 4PRPE 1CLYH 5F97E 4PGDB 1I7ZB 1ZANL 2ARJQ 1XGYH 5EORH 3RUGE 5CD3B 4YDIL 1E4KC 2ICWI 5GGVH 4NKDB 5ID0A 4IJ3C 1K4CB 4EUPH 5TF0A 3EOYG 4YBHA 3VG0H 4JDVB 4L8SB 3VFNB 3H7LA 4QYOA 4LNRA 2F54E 2OTWA 3SCMD 3QIUD 1KN2L 3KPRA 3DVNA 3EYVA 1TQBB 2DD8L 1EV2E 3RAJH 2L7UA 4PUBL 3JV4B 4PBVC 1T1XB 3GKWH 1RHFA 1LMKA 1NBVL 3RVVC 2VH5L 4JJ5A 1AC0A 1BD2B 2VXTH 1D7FA 1YMME 3QUMH 5IEHB 3NCFB 4TNVK 1N0XH 3BH8B 2J4WH 4LQFL 1EFXD 3GMOA 1HWGB 3GB7A 2ZCHL 6FABH 1UKQA 1E4WL 2E5EA 3QIBC 5FYJE 1GZQB 5CBAA 4L3EB 1R5IB 1RVFH 3C08H 1EH9A 5CJBA 3VW3L 3SDCC 2M2DA 3QHFL 5KJRH 4TOYH 4NQDB 1X5XA 3E3QC 4M00A 5IVOA 2X7LB 4CW1A 4GG8B 4YDVB 1I4FA 3QUYB 4PJDF 2X10A 3RWHB 1LO4H 1QRNB 1TQCC 2NMSA 3VRLE 1XCTA 3SJVB 1XF5A 2IAMC 2ZSVA 2UZIL 3MGTB 2VRAA 3MR9B 3U9UA 3JZ7A 4JPWH 4PLJC 1CT8A 3UAJC 3BUYB 1A4KB 5TFSL 5ILTL 2EDFA 4X5LA 5FYKH 1A6ZA 4I48A 1S7XB 3ES6A 3KPNA 3A6CL 1GGCH 5I76B 4NO0B 5ANMB 1H3GA 4X9HA 1CXEA 3MJ9H 1AY1H 1U8KB 1WISA 1FGNH 1EEQA 1T20A 4K8RL 4RX4D 1V05A 2CDEB 1OTTD 3CFCH 2VE6A 1A5FL 2PYEA 1ZA6B 4OM0L 1AP2A 2JJTC 1IAKA 5L2KA 5E08H 3C2AL 2P47B 2NYYC 4U1NA 1FNGB 4OV5A 5GIRA 4O58H 3MLRL 2OMBA 5DJXB 5SWZE 4HUVB 3AS1A 1F3JB 4XPAH 3SE4C 5LAXB 1KEMH 2Z92B 3VXPA 5EIIB 5TGBA 4D9RD 1AR1C 3FFCA 5L2JA 5CZVH 4GKSB 4JDZB 1A6UL 3S37L 3K8KA 3VGGA 4G8GB 4MD0A 5I1CH 5T1MB 4L29A 2EIBA 3ULVL 4K71B 1GZPA 1CU4L 5FUZH 5F8RC 4XZUA 5B39A 4DOHB 5E6YA 3JBG7 5KS9A 1KTRL 4MNGE 4J6RH 4YK4B 1NGWA 1EJOH 1X5GA 3RVTD 4Y5YB 4G9DA 1SHMA 3PP3H 1A6AA 2Q8BL 1F3DH 3Q6FB 4ERSL 4X5XA 3WFHB 2G5RA 5D5MF 1QUNA 5FO7A 2VZSA 3DETD 5HVFB 4JZNA 1B4JH 1DTUA 1Q9WA 4DAGL 4EVNB 2XXMB 1CIUA 5EU7E 1JHKL 3WIFA 1TQCB 2WWMD 3MJ8A 4S1SH 2Q20A 2RGSA 3V6OA 4LLMA 3ROOB 5T3XH 4IRJC 5MEOA 1N26A 1JPTL 1CI5A 1BQUA 3QDJE 4WUKL 2JLLA 4TVPL 4F33B 3BEVB 1JRHL 4F8TA 1MREL 3UBXG 3OR7B 1CD0A 4N8VB 1PX3A 1AGFB 1WWAX 2CR6A 2E9IA 2W92A 3IU3A 3TBVB 3U7WH 4QEGA 2FJHB 2XWJB 5FYKD 4OFYD 3KPPB 4XCFL 4QOKE 4PJFF 2FSEA 4MD5A 4PRIB 1J86A 4F7TB 1DUZA 4PJ7B 4YXHL 4NQVA 5BRZD 3F62A 3OKEA 3VXRA 2MHAB 3FO0L 3B6SB 3G08B 5HHPA 4OV6F 4U6HB 3RZWA 4L9LA 3WYRA 1E28A 5MENA 5HSFA 1AE6L 4OSUH 4P5KA 3L3GB 2AJVL 5FK9B 2OZ4A 2UVEA 1ZGLA 3L95A 1CDUA 3ZYZA 3VFOA 4R7DA 4N0FB 3AXLB 3EKCA 3MRQA 5ERWA 2VLRD 1UXSB 2Q87A 5K93A 4BJLA 4WWKA 4Y4FA 5HDBF 2IQ9L 3IGAA 3JVGA 1A4JA 3FOMB 1RK1B 2MPAL 1JPSH 3NAAH 1Z2KA 1S7WB 4GKNB 4HWEL 5MHSD 4OGAC 4JFYA 4DGVH 3D1MC 4O02L 4GXUM 1MY7A 3ARDD 3V2AR 4F7PB 4FXKB 4OFKA 1IAIM 4QO1A 3HPJB 4JN1H 1QFOA 2VZUA 3QUXC 5CFHA 4ZPTB 4H26A 4BSWA 5I1AA 1I7RB 2C3HA 4P0DA 1MFDL 3V6FB 1LK2A 1BVZA 3V0VB 4MWFB 4Q6IA 4WV1C 4IRJB 5T3XD 4NC0B 1D9KA 1ED3A 5A16B 4XP9H 1K5NB 4NCC1 4KV5F 1TENA 43CAA 2D7QA 3ZTJG 1MPAH 1P5UA 4P2OA 3B8SA 4PFEA 1JF1A 3LEYL 1GGIH 4PJHB 2FWOB 2DLTA 4KKCD 1FAIH 3BIAX 2OK0H 3OAZH 1R3KA 4OLUH 5ETUB 4KVCH 3TZVC 1SM3H 2VLMD 5MEQB 4A6YB 3PQYE 1E27B 1RJCA 4POZD 1OOAA 3TH4T 4BZYA 1S7RB 4JG0H 2WMPA 4WHTB 2B7DT 4UQ3B 3VGEA 3BRFA 5B3NA 3NCYS 3REWA 5D7LA 4F57H 1VB9A 3BHBB 1BFVL 5DRZB 2FH8A 5E9DB 5CUSL 4OF8A 2VC2L 1QNZH 4NRXA 4PJIE 5I75B 3U7YL 1JFQH 1IILE 1CGSH 5F8QC 3QXDB 4ZTOH 3MUHL 5FCUH 3BXNA 3I75B 1MCRA 2O26U 5D1XB 1U9KA 3MROA 5SX4H 2G2RB 3KNBA 4HIJB 4D3CL 2OR7A 5I30L 5A3IC 3MRFB 1H5BB 1RZJC 3GGWA 1FLTX 1DEEB 1ES0A 1G9MC 1SMOA 5JNYB 3AB0C 3LSOA 2I60H 5EG6C 3T3ME 3BQUC 3QO1B 3O4LA 4N1HB 4U6YB 2MCG1 1GSMA 2NY2B 5L88L 4KK8D 4M48H 1TVBA 2OL3L 1P7QD 2GT9A 5C0IA 4ZPVB 4C57C 5ISZB 4X7TA 4U1LB 5IVXF 4N0UA 3QUKA 4JFOA 3RWDB 5BMFH 2YSSA 4JHBA 4AQ1B 4PJGA 4DZ8B 4KGLA 5EIVA 3N1PC 2FECL 4ZO7A 4JFED 1I3RB 2UZYB 4XP4L 4OD1H 4NN6C 3CFJA 4EDWL 3RVXD 3VWKA 3GKZA 3FB8B 5JOPE 1MLCA 1P7KA 4ORZC 5KSBF 1FVEB 3UP1A 4OLVH 3LHPH 5C9JA 4HH9A 3TJEL 4X80L 1MCSA 1XGTB 3O3BA 4QRPD 4TQEL 1MRFL 3C2SA 3QDMB 1RUQH 2J8UA 4O2CB 1AD9B 1Y18A 2DQIL 3CXHJ 3NPZB 3M1BB 5JPMA 1BOGA 3UTZB 3BT2L 5IWLC 4LF3A 1T5XB 1U8PA 1HH9A 1MUJA 5T3ZE 4BQ9A 3DMMD 4YHNB 4R4FL 2BVQA 2DTML 5DUPH 3VFUB 5F7UA 3DV4B 5C08D 1IKNA 3B2VL 4NHUA 4K55A 3TV3L 3UDWA 1OAXH 2ZSWA 4OQ1A 1KCLA 2HWZL 1NCCH 3GHBH 3VMNA 3DNKA 3ARSA 5DJ0A 4O4YH 2XFXB 4RGMC 2CUIA 5ADOL 4JPVH 4AL8H 3VH8A 2XTLA 5KZCD 1MCJA 3GJFK 1JZ3A 5KAQG 5CP3A 4WTZA 3SCMB 3QIUB 4PGEA 4MAYD 5D7SH 5JXEC 1DP0A 5DVMA 3RWGA 1ZSDB 3HCVB 3QSKB 4R8WL 1XH3A 1N5YL 4PJXA 4D2NA 1QPPA 1PKOA 1HYSD 1UVQA 2UYLB 4JRYD 4GW4B 4JPKL 5SWSE 1SJEB 4AEHH 2YPLD 2A38A 2UZXB 3T4AA 4GLRH 5CGYD 4I2XB 5GS1C 1EFXB 4QY8B 1BJMA 1KYOK 2CK0L 3B5HA 5J1SC 2C3VB 3C8DA 4NJAH 5F7FA 1FFPA 3M8OH 2DF3A 5DQDH 3Q3GA 4JZOA 5BOZG 3QFJE 1RJLB 4LSUL 4GG6B 4MAUL 4U1HA 5DJYB 4H1LH 4GRWF 3OQ3B 5F9WB 4LHUG 4NZTH 4MJ5B 3C9NA 1KJMA 1S9WA 1R6VA 4L4TA 4RA3A 4KQ3L 1BFTA 5D96B 2NX5D 2VABB 4X7SH 2DB8A 2VLJD 3RDTC 1R24A 4G42A 3MV7E 1P6FA 4F7CA 2DM7A 3NCEB 3IFPA 3TP4A 5F72S 3V5DB 3CFKA 5IEKA 4MJID 5J56B 4UV4L 2VUYA 1JGDB 3P0VL 3O45A 1L7TL 1FNFA 3BO8A 3NABL 1KACB 2VDMH 5EU3B 3EYSL 4MA7L 4G7VL 1CFVH 4RGMB 4D8PB 1ZT7A 4U0RC 1QBMH 4EUPB 4OZIE 4AIOA 4FHBD 4XCCH 3VRJA 7FABL 3STLA 3ULVF 2CDGA 1DDHB 4JDTL 5IBTL 4KJPD 1CXIA 3MRDA 3MV8A 4KI5C 4L4VA 5A2KH 2CLVB 5F7NC 3AROA 2WP3O 1P9MA 2YD9A 3MO1A 3CFEB 3WN5B 3I84A 3L5HA 5FUCE 3BKJH 2VUOA 4PP2A 5D93B 1B2WL 3BPNC 5A1AA 1CVRA 3QUMB 3ZKMC 5DC4B 3RPIB 1YMHB 2BMKA 3HPLB 3HG1A 3VD7A 1ZVSB 2EZ0D 3DROB 3BKCH 1IZJA 4KUZH 1BD2E 1XIWA 4WHYG 1IC4H 4UT6L 1ZLWK 3JV6A 5I17B 2BXZA 1U8LB 1BGXL 4KKLD 4XB7A 4PR5B 2Z93B 2BFVH 5EC1B 1HINH 4ZFOB 4WEBL 4EOWH 1DSFL 4HAFA 5CLWA 1JMZA 2FHFA 4YXKL 5CEXB 3TCXA 2YPVL 1HILA 2YEZA 2B2XL 1G1CA 4AH2B 1YNKL 5IESL 4OF5A 5LWYL 3LKPB 2B1AH 4W70A 4YO0B 3RWCB 2V5YA 1REIA 4HJ0D 4PJ8A 2AI0L 2GJZB 4JO2H 4QWWC 3LQAH 5HHXL 4WHDA 1OW0A 4M1CD 4O2FB 4KMQA 5L8KB 3SJVE 5BZDB 3OKKA 4NIKB 3NZ8B 4UINH 1XMWA 2P5WA 1C5CH 4YHZH 2SEBB 4HCRL 32C2A 4DVRL 4C83A 1JUFB 2D7NA 2EKSA 3KPRD 1WUNT 2W60A 5EN2A 5AWNH 1YEKH 4P4RB 3KYNA 5BRZB 4HLJA 2X70B 5TH2A 4OD2A 3CDFA 1JNHB 4GW1B 1A1NA 4WO4A 1CQKA 4YUEH 4LVOC 1Z9MA 1E6OL 5ANME 1OARL 1L9NA 1UH4A 2EDQA 5EO1B 4XBGA 1YYLL 1NGXB 2E9BA 1D6EB 4ONOA 5DO2C 1UWEH 4PPTA 3WIIH 2VLRB 1OHQA 2JELL 4Q9RH 4QLRA 5AAWA 1CWVA 1RURL 3KLSA 5IOPA 1R3HA 3PWNA 5SX4I 4TNVF 4NHCL 3WO4B 4LGRB 2GTZA 4UIMB 2GY7B 3GMLA 1PDKA 3QH3A 3ULUL 1SYSA 3SOBH 5KVDH 5IB1B 1CZ8L 2W65A 2HP4A 1OTUD 3DIFA 4I0CC 4LKXB 1EHNA 1Z0NA 3OZ9L 3ARDB 1I3GL 4N5EC 5E8DL 2PYFA 4G8GE 5GZNC 4FQQB 3D69B 1CDIA 5BO1H 5IT2H 3GO1H 3RGVC 3WFCL 4I3RL 2X9XA 3C5SB 4MVBD 4XVJL 2ATKA 1F11B 1EERB 3FB7A 2E7LA 4Y4KA 1OTSD 2YC1A 5DXWA 4ZUTB 1DE4A 2YN3A 5BOPA 4KTYA 3GSQA 1GAFL 3S97C 5HYQB 1D5BB 2AQ3A 4YPGB 2QQNL 2R29L 5KVEL 4LLYA 2Y9RT 3UBXA 3F12B 2EE6A 1MCKA 2IALA 4HXAL 3QG7H 1FC1A 4JR9L 5H2BB 1A9EA 3HS0B 5C71A 1BBDH 4PRNB 4WI9A 3AVEA 2VDOH 3I6KA 1RK0A 1KENH 1ONQB 3V7AE 4DFHA 4OKVB 1MLBA 2ZOKB 4GRLC 3WHE0 2PYED 4OQTA 5HI5D 4P5MA 2VR5A 3ZHDA 2OZ4H 5L2KD 1WC7B 4E0RB 3W82A 4ODUA 5HGHB 1F3RB 4FZ8L 4G6KH 2ZCKL 3MRBB 4UILL 2RJMA 2HJFA 3DRTA 4LVOB 4PRIE 3I50L 3FFCD 3WL9B 3QUZA 5JDSB 1CVSC 1FL5A 1T4KA 2A73A 2WIMA 4X6CF 4AM0A 4JAMA 4UAOB 4IS6B 3Q1SL 5EB9A 1U95B 4F3FB 1I1YB 4BK5A 4KROC 4I13B 4JFQB 1WAAA 4HWBA 1OM3L 3I6GA 4U4BA 1EO5A 3WFEH 4UBDC 5DMIL 1XF3A 3LIZH 3G5VA 1G9NL 1WTGT 4J8RA 4FQIH 2J88H 3OWEA 1J05A 3TFKC 4JO1H 3HR5B 1G7PB 1EXUA 4R4ND 3FQTB 1FPTH 4Z0XB 5IUSA 3EFDL 3LB6C 5ITBH 4F7EB 1K2DB 3ZL4L 5BV7H 4NT6A 1LK3H 1P7QB 4CU8A 1A1MA 1WITA 5BS0E 2XQYK 5E8EB 5T33L 5TQ2H 2ITCA 3TF7C 3NMEA 3W0WA 2NW2B 3FQUA 5LBSH 2DQUL 5DRNA 1OP5H 3VMOA 2B1HL 1Q94B 3QNYB 2W9EL 2CIKA 3KYOB 1K3ZA 1ZEAH 1R3IL 5DJCB 1UT9A 5IHZB 1JMXA 4QRRE 3TWCH 1JNLH 3LPFA 3QG6A 4N8CH 4QRPB 3MX0A 1VPOL 1KCVH 3BX7C 4HW6A 4D0BB 5MEND 3X13B 2AKRB 5I1DA 4ZAKC 1TCRB 5FKAB 1BIIA 2JK5A 2XTJD 2EEBA 3KWWB 4PJHE 3S8WA 3DMMB 3UYRH 4BA8A 1EAPA 4OAWB 4N9GA 4TULH 3U6RA 4WWKD 1DBJL 4Y4FD 3GMPB 5C08B 3NACL 5E99L 3MLVL 5DYOB 3VJ6B 3QEUA 3MRGB 3BSZL 2WIIB 1KN4H 1QLEH 5GRJL 1DQLL 4CMHB 5KSVB 1C1EH 4K7FA 4WFGD 2W0PA 1WFTA 1KIPA 4U1GC 1J5OH 1W0WB 1RUMH 3P0GB 2F19L 1XR8B 2A9ML 1INDL 1UXWB 3QRGH 4U05A 5DEZA 1MJUL 5JLZB 3MJ6A 1RIHL 1A6VH 5E9DE 5KZCB 1Z3GL 4M6NH 3VCLA 1NAMA 4UNUA 4YX2L 2BOBA 4KJPC 5EOQL 4MAYB 1KTDB 5IHUH 3E6HA 1JWMA 2UWEA 3KPLA 5E1HB 4EXPX 2ICCA 2HFEB 2GTWA 4QHLB 1PZUB 2YS4A 5TPWL 5JQHC 3VXSA 4FTVD 2W1NA 4JRYB 4W81A 4NUGL 1LO2L 2YPLB 1ZE3C 4JZJC 3MNZB 1RQ5A 1D9KD 2EZ0C 2YPKA 3DUSA 5GGSY 3O6FA 3HFML 5J6HA 4L1HA 3QPQD 2CKBL 4WTWA 1UGNA 4XC3L 4M6MH 4P2OD 5CS7A 4UT7L 3MLSH 2V2TB 5CGTA 1BQHG 3HI6L 5FCSH 1FRGL 3O6MH 3F5WA 3DXAD 1A7QL 4PLNC 4ZD3H 2PW1A 5FGSA 1XF1A 4R26L 1AR2A 3MV11 2CMRH 3DX9B 4X6DB 2AV7B 2BP3A 1AKJA 4HJ0C 4O5LH 3T2NH 4WENB 1A3LL 1Q9LB 1Y6NR 1LO5B 3VFVA 3MYJA 1DANU 1ACYL 3OB0H 1U8QA 2NX5B 2QR0B 1EVUA 2VLJB 4XVUD 3QDME 2IFFL 4Z95H 3PDDA 4PJBB 1MNUH 3MZTA 4M7KH 5JZ7D 2EICA 2HJKB 3HAEG 4MZ2A 2VIRB 5ICXB 4MJIB 4JKKA 3OGCA 5D2LA 4WI7A 2IBZX 1ZT4B 1ZVYA 2HRPL 1DQQA 4Y1AB 3INUH 4KRNA 5JR1L 3O4LD 4U1GB 1QKZL 1ZS8A 3D87B 1VADA 5MP6H 2D7TH 3WS6C 2Y5TA 4D0DA 2H2PD 5J8OA 4UDTB 2BC4B 2X4UB 3SE8L 3FFDA 5I1IH 3BGAA 5AAMA 2R8SL 2L7JA 2YZ1A 4NRYB 1S9VA 1QACA 3HI1A 2PR4L 2D9CA 4Z7OE 4OCXH 3QULA 3VWKD 3C5JA 3BVNB 4J7RA 3P2TA 5KTEL 2BY3A 2QADC 2VERN 1I9RL 1TXKA 2DQCH 1ZLVK 4LKCB 3KPSA 1BZQK 1DQDL 1KXTB 3O2DA 2G5BA 3EOBB 3CFBB 3RY4A 4BFEA 3WSQL 5I8OH 1WZLA 2AQ2A 1Q9KA 1LEIA 1U8OA 1S5HA 4RMWA 3I9GL 4HX1B 2JCCF 4I2XE 1LQSR 4LHUA 1DZBA 1YJDC 4X7CC 5DRXA 1GCFA 4EN3A 1AXSB 5FOBA 3I85A 4ORGA 4J23A 4R90H 1LEGA 4XMKL 5ALBH 4YR6B 2G75A 4P59L 4IIQC 5D6DA 4CADB 3FB5B 4H1LB 3V5HB 1CL7L 3VRIA 3FQXA 1JNJA 3AY4C 3MFFA 4XXDA 4FQLH 1FVCA 3KR3H 5CSZA 4GG6E 4ODHH 5DD5H 3NFPA 1JYNA 3DSFL 1OP3H 4HK0A 2FX7H 4K94C 1T66D 4DW2H 3LN9A 1YZZA 5GGRY 5ID0B 4YHPA 3NTCL 2D31B 1BM3H 1DR9A 1RFDL 2EXWC 3VD3A 5SWQA 4QYOB 4LNRB 5HI5C 3A6BH 1URLA 5GJSH 3F6LA 3KPRB 4OI7A 3DVNB 3D39A 4XP1L 3O41A 3EYVB 5E6ZA 1X3DA 4AT6A 2IJ0C 4LRIC 3OX8A 4MJ4A 4CVXA 4DUXA 1KN2H 4LIQE 5C0EA 4RDQF 4JJ5B 3UJIL 4YDLC 1P53A 3ULUF 2P49B 1ZTXL 4PUBH 2VR9A 4YE4H 2DDQL 3WHE1 4ZOEA 2NR6D 3UPRA 1XAUA 3HE6A 1NANH 1NBVH 2Z4QA 1CICC 1DL7L 5D8JH 3BAEL 5HYSG 3FAXA 4BFGA 5GGQL 3GMOB 3QNXA 4JVPA 2Z8RA 3GB7B 5EWIL 4JB9L 1KULA 3RKDC 5CBAB 4WFED 1G7QA 3O3EA 1U8HA 2ZCHH 3O8XA 1FE8L 2E7MA 4OCLC 4D9RE 5CEZL 4F2MA 3PV7A 3R0MA 1U3HC 4CW1B 3RUGF 1I4FB 4NKOA 4JHAL 1VEPA 4JGUA 4YZFE 3PG2A 3VA2C 1XCTB 5T3ZL 3V6OC 2EDHA 4IDLA 1XF5B 1SQ2N 2XNAA 2ZSVB 4L4TD 3U9UB 4NNXA 5DGRA 5B38B 4WI3A 1UA6L 1CT8B 1G1YA 2VXQL 3BKML 5F71A 4Z8FH 2DQHH 3GI9H 5F7EL 3LH2H 4RZCA 1A6ZB 1X4ZA 2NY4C 4I48B 1JHLL 3ES6B 3RU8L 3ULSA 1CFBA 4MA3A 3KPNB 3U79A 3MGOA 4NZDA 2PKDA 1T20B 4CJ0A 4OCWH 4L9LC 3N1QC 4KUCF 5T5FH 5B4MD 4NKMA 2VE6B 2PYEB 1MI5A 1AP2B 1IAKB 3VD4A 5L2KB 2XIDA 3FMGL 4U1NB 4WI2A 3MV8D 2YR3A 4L4VD 5GIRB 4OV5B 4UZGA 1A5FH 5FYKE 2NY3D 4HCRA 3L7FA 4X7FC 3WKMH 3VXPB 5TGBB 2V5TA 4O51A 4QHKJ 1TZHA 4YDLB 1AFVH 3FFCB 3JVGC 5L2JB 3MLRH 3QQ9C 3VRLF 3BISA 5DRWA 5BRZE 4G3YL 3FN3A 2X4OA 5LG1A 4MD0B 4M1GL 4CU7A 4P3WA 1C7SA 1ORSA 4L29B 5HGBA 1RU9H 3HG1D 1GZPB 1AIFA 4XZUB 4O00A 1XIWD 1X5KA 2V7HA 3ZSTA 4YBLC 4RFNC 1NGWB 1UJ3A 2FHCA 1HKLL 1T7WA 4G6AC 4G9DB 2Q3ZA 3W39A 1N0LA 4FQPA 3IFLH 1A6AB 2A0LC 4U2YA 1F4YL 2VLRE 4PTUA 4X5XB 1RJZA 3B9AA 2ID5A 5FO7B 3CX5K 4JZNB 1IC5H 2DKSA 2XZCH 4Z7UA 1Q9WB 2X9YA 2ERJB 1T0NA 2Q8BH 4ODXA 4ERSH 2IADA 1KYOJ 1MJJA 3WIFB 1TIUA 5MHSE 4ZFGH 3MJ8B 1IGMH 1UCBH 4DGIH 4LLMB 5MEOB 1WGOA 1IC1A 5K9QG 4N1EA 3RX5A 5TE6L 5C9KA 1FYHB 2F5AL 4TVPH 2P5WD 1EHAA 3IU3B 2F58H 4DQOL 1FH5H 4H88L 3ZDYF 4OQTH 4XAKD 3ZDXE 5F7LB 2EH7L 3D0LA 1TVDA 2FSEB 1F02I 4MD5B 3LCYA 1DUZB 4RAUA 1WBZA 2HT3D 3E8UH 4WO4D 5HHPB 4E42B 2WUCH 4Z7WA 5T3XE 1AJ7H 1GHFH 4UNVA 1NSNH 3MLXH 3WXVL 1E28B 5MENB 3THMH 2XOTA 5A2FA 1YEHL 1N8ZA 4P5KB 1ZGLB 3L95B 3VFOB 4R7DB 5F1SA 2ARWA 2XTJB 3S3JA 2GAZA 3MRQB 1I1AA 1A7OL 4HWBH 3P73A 4AG4L 3BWAA 3X3FL 4KKNA 2ILLA 4WWKB 3VWJA 2VLME 4Y4FB 4LARH 3IGAB 3MCLL 4PD4J 1U42A 1A4JB 4JFDA 2MCPH 2HN7A 4JFYB 4JRXA 1JE6A 1PQZA 2IMNA 3IJHA 4HWZA 4JFPA 3GEWB 1NL0H 2P42B 2GSGA 1OAQL 3MLUL 2F8XC 3RA7H 5IB2A 1JTOA 1TZIA 4OFIA 1CR9L 3U7AA 3ARQA 1MIML 1PFCA 4O02H 2FX8H 4KRPC 2BHZA 4Y4KD 2XRAH 5HHVH 4PB0H 4JM4H 1YY9D 2YA2A 4XPTL 4H26B 4BSWB 5HJ3A 1ZHLA 3ZTJH 3O6KL 1X5LA 4FTVB 3VWKC 5CD5D 5BV7B 1LK2B 3U82B 3I02A 4RQQA 2D03H 4Q6IB 4Y4HA 2PXYC 4WEUD 1YEJH 1D9KB 1J18A 1ED3B 1MFDH 1XGUA 1GPOL 5E6IA 4TUOA 3TBYA 1WT5A 1WFNA 1TDQA 4V1DA 1IAOA 43CAB 4P2OB 1JF1B 5BW7A 4TVPD 3V0WL 1MHCA 3DXAB 4JFEE 2K9UA 1YN7A 1OP9A 4UDUA 3S3SA 1LNUB 1H0DA 2YD8A 3P9WB 1DBKH 4U1KA 3EJZC 1WJ3A 1IKNC 5D7LB 3REWB 2CDFA 5F7YC 3O4OC 4OM1L 3UDWC 2V9QA 4Y16C 4OZHA 4P9HC 4NRXB 2W0LA 3WDJA 4QRPE 2DS4A 1V7MH 2BJML 1AXIB 3B9KA 3BXNB 5IB4A 4OB5H 3MROB 1IAIH 4QHUA 4OFVA 1FORH 5CUSH 4LCYB 5FEBA 2EE2A 3KNBB 1NAMH 2X1WL 3GGWB 2O93L 1ES0B 1YYMH 3SO3C 4PRHA 3LSOB 1XCQA 2DQEH 4X4MA 5JW4M 1W8NA 5I30H 1EIBA 3MLTA 1FG2A 3O4LB 5TDPA 5C08E 3LKNA 1J10A 4HZLA 5JORA 2FLRT 1OLZA 1EEYA 1TVBB 2GT9B 5C0IB 1HXMA 2ZCLL 4X7TB 5L88H 1HHGA 1O5DT 2JE8A 5HYJE 4JFOB 2YSSB 1SMAA 4PJGB 5IMMA 4NCDA 3IAGC 3MOQA 3W0WD 5D6CA 1FLRL 3CFJB 5CJQL 3VWKB 1HNGA 1U93A 4UV7H 3L5XL 1MLCB 1P7KB 1PY9A 1BZ7A 4DK6A 3DUHA 4PJIF 1UG9A 4XCYA 3LRHA 4JRYE 2A1WL 3GMNA 5C9JB 2YPLE 4HH9B 1WCQA 2VXSL 5C0BA 4Z7VA 3O3BB 1JF5A 3JUYA 4NSKA 1N5AA 2F8OA 1KIUA 2J8UB 4LCWA 1PLGL 3T2OA 1Y18B 2H6PA 3TT3L 1VFAA 3TJEH 1BOGB 4X80H 2IH1A 2A6DA 1MRFH 5DHYA 4LF3B 1U8PB 1BIHA 3B8YA 4KKAD 4ZXBA 3T3MF 5B21A 1MUJB 3W11D 3SDXA 2NXZD 2BVQB 3UTQA 4KXZH 4EXKA 2OJZL 1X4YA 5GRYA 1DVFC 1MF2L 1C12A 1C8PA 3HAEA 5EZOH 4NHUB 3IDNA 4LSRL 2ZSWB 4HG4K 1GGBL 5DJ0B 1KCKA 4X6DE 3B2VH 2W91A 4XCNB 5FM5O 3CCHA 1A02N 2Y07L 1Q1JH 5B4MC 3VH8B 3PWVB 4WVRA 5GS0H 4PGEB 5IV2A 1IEHA 1UJTA 4BZ1H 3NCMA 4PJBE 1FSKB 3SO3B 3RWGB 4U6VL 1W72A 2H2SD 1XH3B 1I1FA 1E4XI 1M7DA 3PXJA 3LD8C 5IW3A 3VG9C 1OSZA 2FGWL 3VXSD 1WIOA 5JMRA 1UVQB 1JGUL 2C4XA 4R8WH 1RUKL 1N5YH 3N50A 1R0AL 1X5YA 5SV4A 1QFWM 3T4AB 1JGLH 1JL8A 3O2DH 3O6FD 5T5NF 5D9SA 3SE9L 2PUQT 5C7XH 1CBVH 3WNLA 1IGFH 3PWJA 1FFPB 3BGMA 4QGYA 4H0GA 3DWTA 3MV01 3Q3GB 4JZOB 4KK5D 5F9OH 1LO0L 1LILA 3PUCA 1ZVHA 2WBKA 2E6JA 1I85C 4U1HB 4KVNL 2BY0A 3TPUA 5INDA 3ECBA 1AXTL 4AEEA 4JHWH 4XWGH 3MLZH 2EYSA 2NY5H 2H1PH 3B9DA 2NW3A 1B6UA 1AKJD 1IEBA 3C9NB 1KJMB 1S9WB 4PJ8C 4L4TB 3K46A 3QI9C 3G04A 4DJMA 2AJYH 1YUHA 4A6YL 4XMLL 5CBEA 6CGTA 1J0KA 1R24B 4G42B 1TETH 4F7CB 5I1JL 5I1GL 1U2CA 3CFKB 3FN0L 1Z9SA 5IEKB 1WWWX 4J3VA 3U0TA 3RX7A 4FQ2L 3O45B 2VYRE 4ZO9A 5FV1L 1FNSH 1MJ7L 3BO8B 1JPGA 1FIGH 5LKNA 1SEQL 1HYRC 4YQXL 4XPBL 2O5ZL 1ZT7B 5JDJA 5CINH 3MUJA 3VRJB 3STLB 2CDGB 4OD3L 3KPQA 4TSAL 5KSAA 5GS0D 4Z78A 1KJ3H 3MRDB 1I9JL 3C6LC 3MV8B 2Y6SC 4L4VB 4FFWC 1KCUL 1UYWL 2X40A 4F37K 5HYSA 3MO1B 2NY3B 4RBPH 3PABA 1P84J 4U1MA 1G9EA 4WHYH 2RCSH 4NZUL 5AG9A 4M93B 4PP2B 3LD8B 3VG9B 4NWUH 3ARXA 4HXBH 4APQD 3MRPA 2C1OA 4LSVH 2AABL 2EXYD 3GDBA 4U7KA 2BMKB 4HIHA 3HG1B 3TBWB 5ACLA 5I73C 4MX7A 1MIEL 3KPSD 3ZKQD 1J1PL 1JP5A 2R0ZL 3N06B 4GS7C 1XIWB 1DLFH 5FV2A 3LAFA 1JZ5A 5M94B 2GHWB 1K6QL 3KLDA 4XPGL 1JN6A 3JV6B 3KYKH 3FT3A 2ADGA 1I1RA 3P0YL 4LVHC 4WI4A 1TTUA 2EEAA 4DK3A 4LHUD 1QSVA 1WF5A 1F6LL 4EN3D 1J0YA 4UT6H 4Y4KC 5DMYA 4FS0A 5GSVA 4J3UA 1ZA3A 4GMTH 3ZYOA 4QF1A 1HILB 1S7TA 2YEZB 4WEBH 1NMBH 1AHWA 4YC2C 5IGXH 2XA3A 4OZIF 1JWSA 4HZAA 4YXKH 1E6JL 4WW2F 5C07A 4GAJL 7CGTA 4M4PA 2B2XH 5I8KH 1YNKH 5IESH 4K9EL 4D9LL 5LWYH 1Z0MA 1PY4A 4Y88A 4LMQI 3OKKB 1XF2A 2P5WB 3HNSL 4OZGA 4YFDB 3OBAA 2OP4L 3PWUA 1F00I 3FHQA 5EU5B 4QT5A 4NM8H 1A2YA 32C2B 4C83B 3KJ4C 3HLAA 2Z31C 3D39D 2W60B 4C55A 5EN2B 4JO3L 5C0ND 4HCRH 1G0DA 2CGRH 3KYNB 5CSGA 5TH2B 4OD2B 2QJDA 1A1NB 4WO4B 3CLFL 3H9SA 3S88H 3EYUL 4NFDA 5EZIL 3QUZC 2VB5A 1F4WH 3SDDA 4JFZL 2AJXL 4M5YL 4XBGB 1I1CA 3HE6D 1I8LA 1E6OH 3CFDA 5DJAA 3EGSA 4P46A 2VDPL 1OARH 2VKWA 3DX8A 1KB5A 1YEDA 1YYLH 2PYEE 3TESA 3QEGL 1B4RA 4N0RA 1IAII 3SKNA 5IOPB 5L2KE 5IF0A 2BHUA 1R3HB 3P3YA 3PWNB 4D0CA 3ARBA 1UACL 4G5ZL 2JELH 1PBYA 3QH3B 3PP3K 4CJ1A 4KMTL 1IEAA 1SYSB 5I73B 1FGVH 3QWQB 3GNMH 2W65B 3DIFB 3FFCE 5JW3L 5KVGH 2P24A 4G6JL 2PYFB 4LFHG 3MACH 1PG7X 3U4EA 3LZFL 5DD3L 5CJOL 2DQGL 2XI9A 3B5TA 4QXUH 1JZ2A 3VXOA 2ATKB 3FB7B 5FYLH 3L3KA 4Y4KB 1BECA 2YC1B 1DE4B 5KVMC 3WJJC 3ZE1F 3GSQB 2BVOA 1JYVA 4G8FA 3S36L 3WFBH 2DLIA 2DJ4A 3KS0H 2LU7A 4LLYB 1U58A 3PNWA 3UBXB 4ENEC 2IALB 2LTQB 5KVEH 2FO1A 2LU3A 2K3TA 4HS8H 1S78D 4B0MM 3MJGX 1A9EB 3FN9A 1NCAH 1RZ7L 3HHRB 1Q9OA 4K3EH 3I6KB 1RK0B 5HPMA 3D85A 4YDKL 1KC5H 4XVTL 2YUWA 4AIZB 4AK1A 3WDHA 3BD3A 4P5MB 2F74A 1C16A 4HBCL 4ODUB 3W11C 3ARFA 4NCC2 1XGYL 5EORL 3WNMA 1D6VH 2FZ3A 3TT1H 5GGVL 2HJFB 3DRTB 4JQIH 4KXZI 2IANA 1KB9K 1T4KB 2A73B 5F9JA 1HQ4A 3TYGH 5L7XH 4AM0B 1J0HA 4JAMB 3LKQA 4HUKB 5DJ6A 3TBSA 1F90L 3L3JB 4WY7H 4V2CB 1HDMA 3BIBX 4PJCA 3T0XA 2HVKA 5MENE 5TQ0H 1UKTA 3I6GB 3QP3A 3BD4A 3GKWL 3O3DA 1XF3B 2VXTL 2XTJE 5L9DH 3G5VB 2FEDD 2EDDA 3QUML 1MFAH 1J05B 2XG4A 3OJVC 1QQDA 3OKLA 4G8EA 3CU7A 3IF1A 1N0XL 3S35X 1GOFA 2J4WL 1ZHNA 3X12A 1K8IA 1H15A 5GGVY 4NT6B 4QXTA 1CFQA 3TJHC 2BNUA 4WFGE 5IROA 1A1MB 4CUCA 4S1RL 2YD1A 2HA1A 3C08L 2DMKA 3U0WH 4Y2OA 4J1UA 4ZFOL 4TOYL 5CMAB 5FYLD 2GUOA 4XWOD 3W0WB 3FQUB 1BZ9A 4ZO6A 5C0AA 4S11A 5DRNB 3K4ZA 2CH8A 3OV6A 2JJVA 4MSWA 3SGEI 3VGAB 3OAZK 4Y2DA 3OXRA 1V3KA 4R0LC 4FTVE 2VDNH 4JPWL 1EZVY 1W2KT 1JF6A 3AREA 4LRNH 5AZEH 3QG6B 5I1EH 1R3IH 5HYFA 5B3JE 1PG7W 5DD1H 1UM5H 5H35A 2GEEA 3T2PA 2YA0A 2OX5A 1YEGL 5I1DB 1GGCL 1NFDA 5IG7A 4YBQC 1BIIB 2JK5B 1IGJA 1BFOA 4TVSa 1I1AD 2GIYA 2BDNL 2NXZB 1EAPB 1BFSA 3DXAE 5I66A 2L4OA 1FGNL 3MRIA 4N9GB 3U6RB 3VWJD 5IM7A 1TLKA 3CFCL 3QEUB 4JFDD 2DQFA 2E8ZA 3QQ4A 1E4KA 2IGFH 4JRXD 1BMGA 4HH8A 4K7FB 3WXWL 1KIPB 3FO2A 4O58L 1G7HA 4XPAL 1PZ5A 1ITBB 5HI3C 4WTXA 3SDYH 1R5WA 3WDIA 3VCLB 2HG5A 3D18A 4HHAA 1NAMB 2F19H 2BOBB 3B2UD 1GC1C 2C4FT 35C8H 3E6HB 4PV9A 1JWMB 2UWEB 3KPLB 1UFUA 5DHXB 3N9GH 5I1CL 4J4PC 4X5WA 2GTWB 5JHDE 1FZKA 4YX2H 5FUZL 3B4NA 2V5SA 2OXHA 2JJSC 3VXSB 3TIEA 4M03A 3HC0A 1IGTA 4S1QH 3O4LE 4GT7A 4TTDD 5HY9A 4Y4HD 4NN7B 2DMCA 3OKDA 3DUSB 2YPKB 2YKLH 5T1LA 5E6ID 4CVUA 3O6FB 1B4JL 2HMIC 3T0EC 3QIBA 4NUGH 5DZNA 5I8CA 5J6HB 1RZKH 4PJHF 4CNIA 5BJTA 4JVWA 3SDCA 2ZOLA 4Y89A 3HFMH 4NKQB 4PJGE 2Y25A 3F5WB 1FBIL 1T2JA 2ZUQC 4LASL 1MCPH 2YZ8A 2EECA 2PW1B 1KCSH 1J8HA 1G7JA 1TCMA 3HI6H 1FRGH 1WWCA 3OKMA 1A7QH 2ICWJ 2J3SA 2IAMA 5DVKA 3HAEH 2YXMA 3CJJA 1PKQA 1AKJB 2NY6C 3U7WL 4I3SH 3LMJH 4R26H 2EYTA 4FFVC 4HGWB 3VFVB 4BFIA 4WU7B 3JWDH 2BOCA 1U8QB 4ONFL 4LCIL 3SKOA 3B9KD 2J8UE 3KYMA 2O5YH 2RB8A 4XNZB 3OGCB 5D2LB 3IDXH 2Y4SA 2WQRA 4Y7MA 5KOMC 3G9VA 1W72H 3IXTA 4PRHD 4OJFH 1MVFA 4OSUL 5J1AA 4L9DA 5GXBB 5EUKA 1DN2A 3MQIA 3RVUC 5CILL 3ZKNC 1ZS8B 4FXGA 2JJTA 1JGEA 5IKCA 1HIMH 1QR1A 2Y5TB 4D0DB 1MQKL 3WEXA 5J12C 3HUJA 4MQSB 5EOTB 1QKZH 3FQRA 4PRAB 4Y8DC 1NH6A 3SE4A 2R1XA 1JPSL 3FFDB 3NAAL 4FQJH 4RMSA 4M43L 4WU5A 1S9VB 4DGVL 2QLVB 2R1WA 2KH2B 3HI1B 4TSBL 2R9HC 3K7UA 4NQXA 4GBXC 4APQB 3QULB 3ZT7A 3VA6A 3C5JB 5E8OA 2BY1A 4JN1L 3ARZA 2X05A 3O8XC 5E2WL 4XT1C 3EYQC 1CDYA 3KPSB 1HXYA 3GM8A 1OAZH 4G6FD 4I77L 4L8BA 2GITA 1A1OA 2G5BB 3V4UH 4K7PH 4HK3N 4RWYH 4GRMA 3L9RA 5C0BD 1Q9KB 1LEIB 4YDJA 3HA0A 1U8OB 1S5HB 4LCWD 4LHUB 5DGQA 5DRXB 3SKJL 3EO1A 3OL2A 4EN3B 3PDOA 5FOBB 4HT1H 3WSQH 1MCDA 4ORGB 5HGGS 3OJMB 1A7RH 1LEGB 2I5YH 4XP9L 4WFEE 4Q0XH 5E4EC 3ARYA 5CGMA 2WUBL 1MPAL 1X5HA 4DKDC 1G7IA 4O9HH 3FQXB 4XPHL 1GGIL 3A0OA 3MFFB 5ENWA 4XXDB 1FAIL 5CSZB 2OK0L 3DVGA 3CGTA 3NFPB 1TPXC 1CLOH 4RGOH 3BWUC 3TNMA 1SM3L 1CL7H 5HD8C 2HAZA 2OJEB 4HK0B 4ZFFA 5EBMB 2DI9A 2RQ8A 4YHPB 2VSCA 4JG0L 4L4TE 2E7BA 5SWQB 1OD9A 3TO4C 4F57L 4P3CL 4HPYH 4DFIA 3C87A 2OTUA 3QQ3A 4HGMA 3D39B 3O41B 2ED7A 4C56A 1QNZL 1JFQL 4AT6B 4MDIA 2Y1VA 1CGSL 4PJ9C 3OX8B 4CVXB 4ZTOL 5C0EB 3MXVH 4H0HB 1N7ML 3JV5A 1WVZA 3HZMA 3UPRB 2DL2A 3HE6B 1GH7A 1NJ9A 3RHWK 2LABA 1RIVL 2I60L 3QNXB 1FCCA 2YOCA 4R2GC 5FAAA 4BYHA 1YEFL 1G7QB 4L4VE 1YPZE 4M48L 1I7TA 3O3EB 5C2BH 4XHJC 1U8HB 5SV3A 1TITA 2JB6A 3O8XB 4GG6F 4JB9H 3SHSA 5I16A 4F2MB 5BMFL 4NKOB 2QBWA 3NFNA 4HUMB 4F15B 2YA1A 1VHPA 3QUXA 5CEZH 4HQQL 4OD1L 3HG1E 4CKVX 1VGKA 2HTKC 3NGBC 2XNAB 4JHAH 3RWFA 3SO5A 3HR6A 2AXJA 4NNXB 1KLGA 4F7MA 4MMZC 1K3IA 4OLVL 1SY6A 2X6MA 3NZHH 4X0KA 4RZCB 1RUQL 3ULSB 1QR4A 4MA3B 1J0IA 5F7EH 3JWNC 3MGOB 3NFSL 2N1KA 1JHLH 5DFVD 3UX9B 5IIEA 1UQSA 2DAVA 3HZYA 1K8DA 3TZVA 1IRAY 1YY8A 5DUPL 1EA9C 4NKMB 3ZYIA 4HPOH 4XAWL 3WNNA 5DVOA 3RY6C 5EU4A 3SBWA 4HG4J 5AD0A 2P5WE 1KB5H 1NCCL 3GHBL 1I1AC 5EO9A 2H3NA 4XAKE 1UZ8A 1KJVA 3L7FB 4LPWA 3E6FA 4O4YL 4YHIA 3FMGH 4O51B 4YZFF 5LXGL 1CDBA 4JPVL 4AL8L 3FQWA 1RUPL 4F37F 3QNZA 3QO0A 5DRWB 1BPVA 3SEPA 2X4OB 4BUHA 4GRWE 2IPUK 1ORSB 4X99A 5D7SL 5HGBB 4EIZC 1AIFB 1KF9B 1DQMH 5TF1H 1CDHA 3H8NA 2V7HB 5FF6A 1Q8MA 1V7NH 1UJ3B 4KQ4H 5EPMA 1MCFA 4Y19A 1DBAH 4I0PD 4KJQC 3JWOC 4PTUB 1TNMA 4AEHL 1RJZB 3FCTA 2IH3A 4OCRL 4Z7UB 3RWJA 1LD9A 1T0NB 4KDTC 4ODXB 5IBLD 2IADB 1U36A 3TVMD 1MJJB 1JZ7A 1A3QA 4X4ZA 3U36A 3JTTA 5CEZD 3KLAA 4NJAL 3NCYP 4KRMB 5C07D 5IB5A 5F3BA 1QBLH 3M8OL 1MFCH 5DQDL 2DYPA 3GM0A 2QEJA 5IMLA 1LGVA 2ADIA 4NNPL 1ZK9A 4OLZH 4O2EA 3BIKA 3HNTH 2VWEE 1UENA 3C09C 4J3XA 4X8JA 1HHKA 2FR4B 3ZMRA 4NZTL 3OKOA 3D0LB 4P4KC 3PWPA 4RAUB 4Y0GA 1WBZB 4X7SL 2EH7H 4AZ8A 3QDGA 3AM8C 3LKSA 3H9SD 4Z7WB 5LGHH 3N1GC 4UQ2A 3SDDD 3PGCA 3DJ9A 4XGZA 2Z8VC 3T0BA 1N8ZB 2JJUA 4LU5L 4YPJA 3DYOA 4TVPE 2GAZB 3WXVH 2VDML 3QXVA 1I1AB 3M45A 3P73B 1J7VR 3SGDH 2HT2D 1YEHH 1CFVL 3VWJB 5GRZA 3D6GA 1QBML 3ARBD 4IOFC 1WCBA 4GKZA 1A7OH 4JFDB 2D9QB 3X3FH 4U7SA 4JGJA 4NQCA 1JHTA 3W9DA 2HN7B 3WIHL 2MKLC 4JRXB 4YHYC 2HTLD 1PQZB 3IJHB 4HWZB 4JFPB 5F7WC 2J1KA 2GSGB 3W5MA 1H3UA 3BDBA 5IB2B 3BKJL 5JXEA 1P4LA 3C5ZC 1G84A 3ZDXF 3MLUH 1WAAE 4X4XA 5DWUH 2BX5A 4F58H 1LO3L 2ZNXA 3AMKA 3RQ3A 4KUZL 3BKCL 5E2JA 5HJ3B 1ZHLB 1IC4L 25C8H 4EKXA 5FGRA 1OP5K 4XPTH 3LDBB 4ZUUA 4RQQB 4Y4HB 5CZXD 5GS1A 1NEZG 2BFVL 2WBWB 1XGUB 1HINL 5E6IB 1NKRA 4EOWL 4TUOB 3TBYB 2HVJA 4V1DB 1IAOB 4PLKC 3D85D 1PW3A 2Q1EA 1MHCB 3FOLA 5DQ9A 1NGZA 2B1AL 2D7PA 3CH8A 3W0WE 3KHOA 1CGVA 5HTSA 1YN7B 4TPRL 1CXFA 4UDUB 4HD9A 4JO2L 2DJSA 3RL2B 3VDCA 3LQAL 4ZXBC 3LN4A 1W0YT 1DLHA 3BI9X 2ICEA 5KN5A 1H0DB 1T0MB 3ARFD 3NVQA 1KIQA 1YMMA 3GK8H 3RVWD 4EI5C 4NQTA 5K59E 3UYPA 4U1KB 4UINL 3GSNA 2IAND 4GUPA 3FO9A 3DGGA 2CDFB 2YN5A 4G9FA 4LMQE 4OZHB 4MCYA 1CDJA 2EDJA 1DUYA 3H3KA 3X11A 1T03L 4K3JH 2VXUL 5AUMA 2VSDA 2VZ3A 2NY0D 3K3QA 3B9KB 5IB4B 5AWNL 4QHUB 3VXUE 3TIDA 3EO0A 1DBBH 1TMCB 3FQNA 4YUEL 5C3LD 3KVQA 1IAMA 1EEZA 2L0DA 2DMBA 4PRHB 1CD8A 1XCQB 4ZS6D 4ZYKA 1T0PB 2NY1D 4YHYB 1UWEL 1FG2B 3MLTB 5TDPB 3UZEA 1BOYA 3LKNB 3JTSA 1DFBH 3WIIL 1NBQA 5KVFH 4Q9RL 3WUZA 3VGBA 4BSVB 1EEYB 3OJDA 3D3VA 4NGHH 1HXMB 5EH1A 5D2NC 4EDXA 4U3CA 4XC1H 5DSCA 5KG9A 1CD1A 5J13C 1HHGB 4TYUA 5KVDL 5IMMB 5A40E 1T83C 2P8LA 4RMRA 2X5PA 1P4IH 5C0AD 2KPNA 5E5RB 5B39G 1U93B 5IT2L 3GO1L 1BQHB 4V2BA 2LAAA 5F70A 5CJQH 3VXSE 4G6FB 4XCYB 4FNLH 4EI6A 2APVA 1S9KC 3GMNB 2BSSB 3ARED 2Z35A 5C0BB 4Z7VB 3F7VA 4NSKB 1N5AB 2VAAA 1N6QL 4LCWB 1YEIH 1VFAB 2H9GA 5D7KD 2IH1B 2A6DB 4GXVH 5DHYB 3SDAA 4LLWA 4ZXBB 4KI1A 3CZFA 3QG7L 3OB0K 3SDXB 5J06A 3GJEA 3UTQB 3LKOA 3GFUA 4PV8A 2VDOL 2P46B 4P2RA 5EBLA 1KENL 1C12B 2DL9A 3BESR 3HAEB 1HEZA 3RTQA 3IDNB 2OJZH 5HVWA 1UEMA 2OZ4L 5HGDA 5GGSA 4K23H 1MCNA 2R4RH 3RJQB 3CCHB 4G6KL 3MMEA 4M3KB 1GGBH 4HJGA 5KSAC 5IV2B 5FDWA 5EFIA 3LOWA 4HKBA 1W72B 2DLFH 3RVVD 4N0CD 1I1FB 5IFAH 4LSTH 5D2LE 2Y36L 3GSWA 5C86A 3BN3B 1M7DB 3O2VH 1OSZB 1NBZA 5TDOA 43C9A 3QDJA 3WFEL 3MNWA 3L6FA 5F44A 3WLBB 4KPHH 3LIZL 2J88L 3T1WA 5T1LD 3ILQC 4MJ6A 3QIBD 4JO1L 5D9SB 1J1OL 4L3AA 2BXYA 1FPTL 2VMFA 1DQJA 2V9TA 3SDCD 5ITBL 4PB9H 2YD5A 3PWJB 5BV7L 1LK3L 2DTSA 5F9DC 3BGMB 5I19H 4N0YH 3WCYA 2AS5M 4A2LA 4DWHA 1KGCD 3IRPX 3TPUB 5C0RL 4X6DF 1I8IA 5INDB 2J5LB 3ECBB 3RGVA 2HKFH 4KHTH 5LBSL 2IAMD 2EYSB 5I71B 1NMCC 2NW3B 2MOVA 1MCIA 1K85A 3E2HC 1IL1A 1IEBB 3GMMA 3P77A 4PLJD 1AXTH 3G04B 1ZEAL 3BP7A 4PJBF 1YUHB 4RFOH 1ZHKA 3UAJD 5CBEB 1OP3K 3TWCL 1NC4A 4CDGC 1FP5A 3O0RH 1X5FA 2C3GA 1KCVL 4TTGA 5DR5H 2QHLA 3U0TB 2GI7A 3B3IA 5I1GH 3CK0H 3IFOB 5LGJA 5C3TA 3GHEH 4GRLA 1V8HA 1MJ7H 2PO6C 2GKIA 1KG0A 4TULL 1SEQH 1D5ZA 2NYYD 4YQXH 1QFWH 3KPQB 5KSAB 2EEDA 2O5ZH 4Z78B 1I8LC 3FB6A 5JPNA 1KN4L 1W8OA 4P46C 5HYSB 4LLQA 1C1EL 4XNQA 4ZMAT 4OD3H 2QQKH 1AR1D 3PABB 4TSAH 4U1MB 1SVCP 3S98A 1QEWA 1RUML 1MCLA 1FL3A 3QRGL 3SGDI 2AP2A 2EDYA 4FQ1H 1A6VL 1OAUH 2PNDA 2C1OB 3SQOH 3TLRA 3V9FA 4M6NL 5TJWK 2ADJA 4HIHB 5IHUL 4MX7B 3EAKA 4NQUA 4R7NA 3A6OA 1MJ8L 1H9VA 4ZFZA 1JN6B 4UUJA 3STZA 1J1PH 2ADGB 3DBXA 1U91A 3DECA 3MBEC 4IMLA 3OB8A 4LHQB 2VLKE 4DN3H 3VFGH 2DQDH 5IQ7H 2R2CA 1RD6A 5GSVB 1TFHA 5J7CC 2HJLA 3AGVA 5C0JA 4QF1B 3IKCA 5M95B 1S7TB 1JRHI 5IW1A 1AHWB 5SX5H 4IRJD 4M6ML 1JWSB 1QO3A 3MLSL 3DTXA 3I2CH 5C07B 4YIQA 3O6ML 3O9WC 2G60L 4EEEA 1A14H 3CPLA 4DVBA 1EAJA 3LY6A 3GIVA 4MDJA 1XF2B 4XBPA 4DGYH 4K8RC 4OZGB 4PY8I 3U30B 4D9LH 2D0HA 2X4NA 3PWUB 1UM4H 1BREA 2CMRL 1LHZA 4QT5B 1A2YB 4M7ZB 3QXAA 5FUOH 3HLAB 4O5LL 1F4XH 3T2NL 1VKXA 4UU9A 3WV0A 2XKNA 5FM8A 4HGKC 3H9SB 1MNUL 4M7KL 2EDRA 3SDDB 5C0GA 4ZAKA 4ESKA 1F58H 2A74A 3EYUH 3CFDB 5DJAB 3EGSB 4LOUC 3ULVC 3AUVA 3DX8B 2AJXH 1KB5B 3INUL 1YEDB 1RZJH 1TVHA 1G9MH 3SKNB 5E24E 4E5XA 5IF0B 4D0CB 1KXQE 3FAWA 3ARBB 3RHWF 2DWEA 5MP6L 1RY7B 2D7TL 4OGAD 1HHHA 5BCAA 3KLHC 1ETZA 4NRZA 3OAUH 3DHMA 2ED8A 4ELKA 1NLBL 2NY1C 4KWUA 4OCNC 2EO9A 1U3YA 3GSUA 2P24B 5IQ9A 1T7YA 1AGEA 3QUXD 3ZE0E 5IROC 3H7BA 2DN7A 3U4EB 1F45A 4OFDA 4MS8C 1Q0YL 5JW3H 3VXOB 4R97C 5ESQA 3L3KB 3BE1H 2DQCL 2H41A 4C4KO 4J3TA 2BVOB 2DQGH 4G8FB 2ZG2A 5I9QC 3BPLB 4XP5H 1WEJL 3LKRA 3ARRA 3CSBA 3J7HA 1U58B 3PNWB 4JZJA 5I8OL 4LCCA 4PP1C 4Z7NE 3EZJB 5BXFA 4Y2DC 3U1SH 5I18H 4OIIH 3AREC 4R90L 1S7VA 2OTPA 2CKNA 5ALBL 2LVCA 1Q9OB 5HPMB 5IP4A 3D85B 3TZVD 2J8HA 3EHBC 5FYLE 4FQXC 4OZ4B 4W4OC 4LVNC 2UUDH 2DIBA 3KG5A 1RZ7H 2F74B 2P1YA 3ZE2E 2HLAA 4FQLL 3FO1A 3KR3L 4ODHL 5DD5L 1C16B 2FX7L 3ARFB 3S34H 2X2YA 4YHOH 4DW2L 4NO3A 2AJUH 4H0IA 4M3JA 3QWOA 2GJ6A 5DA4A 2IANB 1HHIA 5F9JB 1HQ4B 4LVEA 3LKQB 4XP6L 3A6BL 5DJ6B 3TBSB 5GJSL 3BPOC 4PJCB 4Z7WE 2HVKB 3FRUA 4RMVA 1F2QA 2NY0B 3DX7A 4JKPH 5I1KH 1P4BH 4RFEA 3BKYH 1EHLH 5A3ID 5JMOC 1F90H 1CGXA 3WKNA 2D7MA 3O3DB 4LFHD 1CFNB 4YE4L 3QFJA 2HFFA 4OZFA 3BQUD 4J2XA 2CO7B 3P11L 4XNXL 1QQDB 5D8JL 3UYOD 2NY1B 3OKLB 4N0CC 5H8DA 1CXLA 5F7DA 3IF1B 1YEEL 1PVHA 3WS6A 1ZHNB 3ALWA 3X12B 3J8F7 2UY6A 1K8IB 4JFDE 2FECI 1H15B 3OR6A 3QT2A 3KAAA 3DYPA 5GGTL 1EMTH 3GMQA 4QXTB 1CFQB 2OI9C 3WIHA 4JRXE 2BNUB 5AYUH 5IB3A 5E2VH 4N5UA 4J1UB 4N9OB 4W6YB 4GSDH 1NEZA 2DYPD 2GUOB 3UMTA 1C7TA 4S1RH 3G6AB 1BZ9B 1HOCA 3WS3A 5C0AB 3L5WA 4B7LA 4R96A 1MFNA 3TO2A 4MSWB 4RA0C 2W59A 5FB8A 3OXRB 4ZOCA 1AD0A 1FV1A 3PWPD 3WE6A 5FA4A 3AREB 2FBOJ 1B88A 1KLFA 4Z8FL 1HSBA 1IE5A 3QDGD 2DQHL 3GI9L 3GSNH 2D4DA 5C0CA 4JO4H 3W9EA 4URTB 3LH2L 1OGAA 3OXSA 5H35B 5J11C 1ZLSH 4B5EA 3BH9A 4IIQA 1MCWW 2CJUL 5IG7B 1NFDB 2EE9A 5FYJH 2APBA 1IGJB 1BFOB 4RGNC 5I74B 4X98A 3AY4A 3U9PH 5I66B 3MRIB 5IM7B 1INQA 1YEGH 2K7PA 4HV8A 4OCWL 4OI9A 4KMLB 5T5FL 1T1YA 2QSVA 2BDNH 1BD2A 2DQFB 4HIXL 3T65A 3VXQA 4NQCD 3NIFE 3S37X 3QQ4B 4NM4L 3RBGA 4IJ3B 2AXHA 2NNAB 3KPOA 1CFTA 1G7HB 3T1FA 3IJSA 1E4XL 5E1AA 1PZ5B 1I8MA 3WKML 4OZHE 4NC1C 5JXED 1R5WB 4H8WH 2FDBP 3WXWH 2HG5B 3D18B 1AFVL 4HHAB 2EDNA 4ISVA 1QFWI 1R5IA 4LRIA 4PV9B 3D9AH 1N64H 1NC2A 3ZDYE 1RU9L 4MA1C 1FZKB 4IRSA 4NWTL 4YEEA 3TIEB 4PRHE 4X4ME 1CICA 1UKSA 5B3JF 5FA3A 1ND0A 1IGTB 5HY9B 3IFLL 4MXVE 3OKDB 3SJVA 5T1LB 3S4SG 2LU4A 1EO7A 3R06A 3MGTA 1IC5L 3QIBB 5I8CB 2XZCL 4CNIB 5BJTB 2R0LH 4F9PC 4XBEH 1NGPH 4OLEA 3HC4H 3SDCB 2XZQH 2ZOLB 1QSEA 2A6KB 4ZFGL 1IGML 2WBJC 3HZKA 1UCBL 1U3HA 2J6EA 4DGIL 1T2QH 1II4E 4UB0H 5DD6A 3O2WH 1J8HB 2XY2A 3LRSA 3OKMB 1FBIH 4QTIH 3BDYL 1YMMD 4LASH 5IBUG 2IAMB 4XMPH 2VN4A 5E56A 4CMMA 1PKQB 3P4OA 2F58L 1FH5L 1TJHH 2EDKA 2VDLH 4OQTL 1X9QA 2EYTB 3RDTD 1W0VA 3TN0C 4G9FD 1H3VA 4BFIB 1GL4B 4Z7VE 4JLRA 5L6YH 5FYJD 3H0TA 4OFPA 3SKOB 4LCWE 3MA9H 1NUFA 2C26A 4JM2F 3E8UL 3Q5TA 3KYMB 2FO4A 5LAXA 2C7UA 2EYRA 4LEOA 2E9WA 2WUCL 2Z92A 4GAGH 1AJ7L 1GHFL 4LCIH 4ONFH 1NSNL 3ELAT 3MLXL 3G6JA 1KOAA 3WLWC 4GKSA 3SDXE 2ICWB 3THML 4FABL 3IXTB 5DK2A 5J1AB 5CSBA 1NCNA 5EUKB 4HWBL 4MXQD 4FXGB 4YLQT 5GSRA 5IKCB 3S7GA 1QR1B 3D3VD 4LARL 3WEXB 4KI5D 3C8KA 2IEPA 3HUJB 4PJGF 1BEYH 3FQRB 5CILH 1XEDA 3BZEA 3QDHA 2R1XB 2AJSL 2MCPL 4L4JA 4WU5B 4LLAA 2R1WB 1MQKH 3AS3A 3CU1A 3WD5H 1S7QA 4M6OH 4FMKA 3ZKXC 1NL0L 3JUZA 4LHJB 4NQXB 3ZKMD 4M43H 4EVNA 3RA7L 1OQXA 5E8OB 1VACA 4TSBH 2FX8L 3HC3H 4BKLA 1NAKH 1HXYB 2IMMA 2MSPA 2XRAL 4L8BB 5HHVL 2GITB 1A1OB 4PB0L 4JM4L 1R3LA 3DI3B 4GRMB 2J8UF 3L9RB 5E2WH 2IPTH 2DLGA 4YDJB 3U4BL 4I77H 3T3PE 5EZJA 2Q7NA 1TZGH 2R2EA 4OLYL 3EO1B 5D7IA 3PDOB 4Z77A 4OBRA 3EW3B 2D03L 2XXCB 4FP8H 1YEJL 4X7EC 1PD6A 1K4DA 3U83A 3SDAD 5GRUH 3SKJH 3MZGB 1L0QA 4ZSOE 3B9VA 3L3DA 3NCJH 1G7IB 3DI2B 3H2WA 4QWWD 4P2RD 5ENWB 5ESAA 3DVGB 1MWAL 2WUBH 3TNMB 1PSKH 4XPHH 4WUUD 5HDLA 3O3AA 4ZQKA 4ZFFB 4F80A 4LDLB 1KELL 4N0FA 4OTXH 1X7QA 3I3EA 3MLYH 1ZT1A 2R4SH 3TCLA 2AJZB 1OGTA 2VL5A 4LPYA 2V2XA 1DBKL 3MPCA 5DD0L 5DS8A 3OAYH 3SBWC 3GRWA 2OTUB 3QQ3B 4J12A 4U3HA 4JREC 3G5YA 5IVNA 1T22A 3DVIA 2W07A 3M17A 2FRGP 4MDIB 1V7ML 1JJUA 2B0SH 4ZUSA 4W4NA 4P3CH 5KSUA 4RBPK 5BS0A 4OB5L 1HN1A 1IAIL 1FORL 1F4AA 3QDJD 3VFPA 3QCTL 3HZMB 5DO2D 3K80A 1NAML 1N7MH 3DYMA 1NJ9B 2BK8A 1YYML 3HNVH 1YQVH 4LL9A 5J4MA 1U41A 2DQEL 2G9HA 4JY6A 4WJ5A 4KH2A 1TJGH 1KEGL 2QQLH 2KBGA 1RIVH 1I7TB 4QRRA 2JB6B 2C3WA 2WK2A 1FO0L 3VFWA 1YEFH 5I16B 4OIAA 2AK1H 4N5ED 4DN4H 5GZND 4HMEA 5T1KD 3NFNB 3RGVD 5IJVA 5L8JB 3CDYA 3X3GL 1RZIA 1HCVA 3QUXB 4MQXD 1U92A 3BGFC 2R69L 4U7MA 2JF1A 3RWFB 5DZOA 4AMKH 4UV7L 4BQ8A 4HQQH 2NY7H 3PL6C 1KLGB 4F7MB 3GBMH 1E27A 4OF0A 3QISA 3V7MA 1NC4D 4HKJA 4QRTA 3BRDA 4F9LA 2PXYA 4WV1B 4X0KB 4LLUA 4UQ3A 3RI5K 2KQMA 3MRLA 3K4AA 4PJEA 3LV3A 3QIWC 1H8SA 2RR3A 4YHLH 5CEZE 4K2UL 1T7XA 5IIEB 1X5AA 1UQSB 4HWNA 3HZYB 4GRLD 5J9PA 1K8DB 4Y5XC 5EULV 2PTVA 3TZVB 1YY8B 3NFSH 3BP6A 4PBXA 1YPZF 2G2RA 3DGCR 1H3WM 1L7IL 5EZOL 5EU4B 1S7UA 5AD0B 4MJ2A 1R5VA 4OZGE 5EO9B 4ALAH 3UTTA 2H3NB 1KJVB 4OT1L 4XAWH 3E6FB 2X1XR 1QVOA 4YHIB 2KZ1B 1Q1JL 4Y16A 3V95A 3FQWB 3QNZB 3QO0B 5GS0L 1MFEH 4NC2B 3MUGA 3CH1A 4KROD 3SKUD 4X99B 4BZ1L 3WUWG 5LXGH 3ULUC 1QPXA 1XZ0A 3CZJA 4HSQA 1RUPH 3RWDA 4UBDD 3UPAA 3BP4A 5FGCE 1J11A 4NUJB 3AB0B 2HT4C 4Y19B