1Q9KB

S25-2 fab unliganded 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
b'EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-2 Fab (IgG1k) light chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9kB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9kB01
4KFZC 1N7MH 5EWIH 3FFCE 1CG9B 5E2UH 1TZIB 3FOMB 1MCOL 4R0LC 3EFFA 1KC5H 3PDOA 4NUJB 5C07B 4J4PC 2IAMB 1N8ZA 2JTDA 3P73A 3SDAD 1HSBB 4M7LH 3ILPA 1XGTA 4P2OB 3RKDD 2AJYL 1G7HA 3NIDE 5FYKE 1K4DB 1VFAB 2YXFA 3HMXL 5GS0H 1WC7A 1GGCL 2A83A 5EOTA 4HFWB 3GIVB 1EEQA 3H9HA 2YKLL 3I6KB 3OPZL 4L8SB 2V2XB 2Z0BA 1YEEL 4RAVB 2FB4L 4ZAKD 4QNPE 3AMLA 2ZJSH 1MJUH 4ONOA 5DGRA 4LSSL 3B9AA 2NR6D 2XY1A 5GGQL 4KVCH 2QHLA 2A9MH 2YA1A 3GJEA 4QGYA 4RGNC 5E5MB 3UZQA 2ENYA 4X9GA 4NDMB 5DMJB 5IF0A 1NBVH 1FSKB 1LNUA 1LEKA 3N1FC 1AFVH 1WCBB 1TTGA 3G5ZA 3KPSB 1M71B 4F37F 1YEDB 4YFLI 1GZPB 2BDNL 2DI8A 5DVNA 2J88H 5IQ7H 3MGTA 3EBAA 2X10A 4N1EA 2Y23A 2Y1VA 2MFNA 2JIXB 4HUUB 4FQXA 4R7DB 1D5IL 4PRBA 1JJUA 2J8UE 1BFVH 5FYKL 3MUY1 2HJFA 3OQ3B 3SOBL 5T3ZH 1S7SB 2CJUH 1AGFB 3O6KH 5J3HD 2BVOB 2YUWA 1MVUA 5ANMA 4PJFE 5FXCH 5ISZD 3AMKA 3T1FA 1BJ1H 4HWBH 3D39B 3FOMA 3ORJA 1GZQA 4M3JA 3REWB 1UENA 1MFAH 5HVHB 5F9JB 1MIEH 1YNLL 1CXHA 5GZND 1QBAA 5I1HL 4JFZL 1OCWH 1F4AA 4O2FA 4KRLB 1VB9A 5D1ZA 1CGSL 3VH8A 3JWOH 5BVPH 1AQDA 5DVKA 4QYOB 3T3MF 5C0RL 4F9LA 4DGIL 1RU9L 2FL5A 4MXVE 5L6YH 1K8IB 4PJEB 4RSVA 3A6OA 4UIKH 4KDTA 3HPLB 5J1AA 3DOSA 1NAMA 5IEKB 3GK8H 1W72A 4Z7OF 2EIZA 5D1QB 1FDLH 4F15B 4JM4H 4X98B 3ZE2E 5CFHA 3NPSB 1E4XH 4LVNC 4PG2A 2J8UB 5JQ6H 1T83C 4GH7B 1CL7H 3ILQD 5D7LA 2DOCA 3VH8G 3TFKD 1U8PB 1S3KL 3MXWH 1F4WH 5ESQA 5GS1A 1PLGH 1FVEA 3ZDXF 4LF3A 1JGDA 2EKSB 3O2DH 1YNTB 2QJDA 2DRUA 1JWUA 4MA3B 5AAWA 4DUXA 1J8HE 4APQA 1MRCH 4ZS6C 5DQ9A 3QZWB 4M1GL 2Q1EA 5F96H 4PG9B 1X9QA 2Q6WA 4ZFZA 3O41B 1ZA6A 4EQ3A 3CX2A 3BJ91 2VZTA 4JPVH 3BP4B 5TH2A 1INEH 1JHTA 4JFEB 5C0BE 1CD8A 3H9SA 3EYUH 1XF2A 3D69A 2WP3O 1RIHH 2R4SL 4ZTOL 1E0OB 1U8IB 3EHBC 2QSVA 3ARSA 5CUSH 1JK8A 5KSVA 1Z9SA 4LASL 3Q5YA 3QFJB 3MNVA 2C1OB 3MRKB 3WIHA 1P4LA 2W92A 5HHPA 1KNOB 3VFSA 2W59A 4ORGB 4ODBD 2X4UA 2MCPL 5DMKB 1L7IH 5FCUH 3ARRA 4KV5E 3VFVA 3OXSA 2BSSB 3QJHB 2CIIB 4KI5D 3N1GC 5DMIL 5LGKA 5ECJE 1OF2B 3SKOB 3RL2B 4OD3L 4NZTH 1J8HB 2VL5B 4PB9L 4LSPL 3T0WA 1C5DA 4P2QB 4UMGA 2AS5M 3LN5A 1FZMB 2QR0A 4H1LB 2NY5L 3QDGA 1BEYL 3TBTA 3WNLA 1F00I 4JFYB 4NRXB 2AJUL 3RPIB 4PGBB 4HZAA 4OUUA 4PR5A 2V7NA 4URTB 4PJ7F 4MX7A 3U46B 4KJPD 3HCVA 2VQTA 3MLXH 4QRRE 1U8PA 3MMEA 2CXGA 1FL3B 4Y5XB 4NKIH 4WI7A 3GNML 1R5WA 4DKFH 2P5EE 5I16A 4HF5H 5EU6A 3U0WH 1UT9A 4AEIH 1BX2A 4V2CB 1T4KA 2BVUA 1XAUA 5FECA 1T5WB 4Q6IC 1IAII 1F4HA 4UTBH 4Y1AE 5EZIL 4YXKH 1EXUB 2APTA 2X9WA 3TWCL 3QUXA 1ED3B 4M7KL 1EA9C 3L3OB 1ZVYA 3BH8A 4HV8B 4NNPL 2NXZC 3QIBA 1TCRA 1LK3L 4XT1C 1CE6A 1UH2A 2G5BB 1IGCH 2AXFB 4LCWE 5D1XD 5DJXA 4MAYB 4R2GD 4P2RB 1OAYL 2F19H 3SE3A 3T4AA 1PG7L 4J3UA 6CGTA 4KMTH 3BZEA 3QIWA 5GZOD 2BJML 4Z0XB 3QUMB 7CGTA 5E94B 4G8GE 4BZ2L 5D8JL 3TH4T 4WUUD 3I75B 2AV7A 2R0LH 1DSFL 3V8CA 1ZE3C 2P5EB 1A47A 1RZ8A 1F4YL 2YPLE 5H37H 3BGMB 3O3EB 3MCKB 1Z3GL 4M9PA 2OL3B 3UTZB 1H3UA 3CDYA 5TF0A 3W9EA 2ESVD 5GGVH 1AI1H 2HKHH 5J7CC 1MFBH 4XPFL 1OB1A 5CGMA 2FJFA 4JFPA 3NVQA 3K2UL 1NDMB 3RWCB 4RISH 5JPMA 2VXSH 2AK4B 5EC2A 5I30L 5F88B 2W9EL 5SWZB 4DN3L 3AUVA 4WTXA 1MCBA 3HE6D 4NRYB 5IT2L 3T09A 2CKNA 1FL3A 2WQRA 4IHOB 5J8OA 1P4BL 5I1EH 2YSSA 4PJGA 2QADB 5A16B 3CLEH 2C1PA 1NGQL 1TTFA 2ICEB 5TDPB 4QXUH 4W4NA 1KYOJ 1DQLH 1HHIA 1IC1A 3P4MA 3OJVC 4FFZH 4P4KB 4MAUH 4GS7C 4HWUA 2VLRD 1ORSB 3HNTH 1ZTXH 3QAZC 4Z8FL 4U3CA 4LCUA 3KYMA 5E2JA 3S4SA 2PF6A 5DTFA 4L3EE 4ZG1A 4OGYL 5LQBH 4OSUL 1WBYA 3ULUD 2CDEA 5EUOB 1TCMA 4XCEA 5K9QG 1JPTL 3S96A 4DZBB 4JB9L 3MZGB 4L8CA 4TRPL 2PO6C 1I1FB 5B8CC 2EIDA 4AT6B 1U58A 5DMGC 4NSKA 2JELH 4ENED 1DQQA 1N6QH 4M4PA 5ALCH 5IGXH 5BRZD 1HQ4A 4FFWC 4BKLA 1QUNA 5FAAA 5HYSB 2DQIL 3EFDL 1I7TB 5C6TL 1YDPB 4L9LA 4L4VA 4GKNB 3CFEA 4PJAF 3TIDA 5T5NG 3S4SG 5BO1L 5EIIA 2D2OA 3D48R 2Y07L 3JWNC 3GHBL 2IF7A 3FTGB 3SDXB 1U8OA 3F7VA 2HLFC 4L4TE 5TFSL 3HLAA 2VZVA 5C2BH 2P5WA 4JN1H 2OZ4L 3MUHL 3QUZD 3KHQA 5ID0B 2F53B 3QDMA 1C1EH 1PY9A 1XGRA 1MJ7H 4XP4H 1RIVL 3IXTB 3TVMA 1CICD 2EE2A 2GITA 1AKJA 4XX1E 4WNQA 3MLSL 1NGPH 4X4YA 4H25B 3C60C 2PXYD 3SGJA 3V4VH 1QRNB 4HJJL 2LTQC 2VXQH 4XAWL 4U1IB 1JGUH 2IANB 3MBXL 4WJ5B 4XNZB 5E56A 5EZJA 2VDKH 4TULH 3VWJC 1FL6B 4X4ME 3O3DA 4HFUH 4LSTL 2LAAA 1G7IB 3QYCA 2FH8A 5K9JL 4UQ3A 4WW2B 5IJKA 2ATKA 1MHCB 2ZCKH 4S1RH 2XTJB 4YXHL 2DQDH 3ZTJH 1TQCB 2YRPA 4NHUA 3VRLF 3X3FL 4HWNA 4HH8A 1F2QA 1PJ9A 1R5VB 1OAXL 2DS4A 5D7JB 4XXCA 2R1XA 4K7PL 3E1F1 4WU7A 3L3KA 5EC1B 3DX6B 5IEHA 4I18B 4PY7B 3WN5C 4QEGA 4OAWA 5GRUH 5ADPH 1JGVL 3UBXB 2ZUVA 3M8OH 5IMLB 1QEWB 1EFXB 4NKOA 5AAMA 1CF8H 1NAKH 1HHJA 2MPAL 1N0LA 4GAFB 5DD3L 2D03L 4NQED 2ZUSA 1LEIA 1P2CB 4G7YL 1CFTA 1T21B 4ZFGL 3L3DB 4U1KA 4UT7H 2CLVB 3AGVA 2XZQH 4OZGA 5GJSH 2DIBA 3LKSA 3BN9C 1JPST 1FV1B 1P7QD 5E8DH 4YBLB 4YHLL 4OFKA 2UVEA 4I2XE 35C8L 1ITCA 1X4XA 5JW4R 3VWKB 3GFUA 3IDGA 4HQQH 3TO2A 4PRPD 5D96C 3WE6B 1KTLB 2R56L 4LCYA 4LSDA 3VXNB 2WUCH 2XNAA 4M4RA 1Q9KA 3MRDB 1OTUD 1BZ9A 2NZ9C 5INCA 3LQZA 3IDYC 2FX9L 3N1QC 4MD5A 3T65A 1KYOK 3JBG7 5F72S 2ARJA 2JJVA 1PQZA 3HI5L 1F5WA 5C71A 3V7MA 5DJAB 5BZWB 3QIUA 4I8DA 5I71C 3EZ8A 4MXWH 1KGCE 2FGZA 1J1OH 2AK1L 3ROLA 3OAZK 2A1WL 4XC1H 3PIQB 5GGSB 2DAVA 3BSZL 3DMMC 2G2RB 5D7SL 3T2NL 4U05A 3G08B 3VFOB 4NQDA 3DNKA 4F37K 5GJTH 3X13A 4JQXA 4EBQH 1RD6A 3P30L 5B3NA 3ZKXC 4QTHA 1Q9LB 1G6RL 2V17L 2GAZA 1J05B 1MCWW 3KPTA 4M6NL 3CSYB 3QUKB 1H3TA 1S7UB 4HKZB 1RVFL 3TPUB 4OCMC 1NCCL 3FQRB 4Z7UF 3O2VL 1MCNA 2PW2B 3WFEL 3N85H 1HQRB 4R8WH 1ZVHA 1QLEH 1I85C 2DTML 4FXLA 1QBBA 3QNXB 4EZMA 2C3GA 4X6BB 3BMVA 3VXSB 3U82B 4DZ8A 3CXDH 3KJ4C 1UC6A 1KJVA 5BOPA 3IF1A 5CKAA 3UYRL 3MC0A 5IB3A 4G8EB 2IPTH 5AYUH 1AJ7L 1CLZH 3MBEC 1YY8B 3GBMH 2ATPA 3VJ6A 3HZYB 4LVOC 2VAJA 3G9VA 3LS5L 3BE1L 4LSRH 3IJHA 2JK5A 3HC0B 3TZVC 3WDHA 1EVTC 4HIEB 4ODHH 1E6JH 1TPXB 2M8XA 2VDOL 1MCCA 1DN0B 1FLRL 4WWKD 4D3CH 5L2JA 2M1KA 1WWCA 5EU3B 4HWBA 4TSCL 3FN3A 5CS7A 1FO0B 3GRWH 3EDKA 5DJAA 3T08A 5JORA 1U3HA 4XMKH 3VGGA 5AZEL 3D1MC 1A3LH 1RQ5A 4H88L 2GK0A 4QTIL 2FEEI 3VDBA 1G0DA 4YHOL 1ERNA 3MUGA 2P7TB 4KI5E 2H45A 5C08D 1D5BB 3GMMB 2IADA 4U1MA 5CJXA 5L88L 3WJJC 3CPLB 5I8EB 4NN6C 3K0WA 3W0WA 1OP9A 1IAIL 4PJDB 5LAXB 2E3VA 4MA7L 1ZANL 4KKNA 1JFQL 3FB8B 2IBGA 1EHAA 3BP5A 2Q86A 3BVNB 4FFYH 4PFEA 2GYSA 2DMBA 4HUNB 4DUWA 2AJYH 4G42B 5L2KB 2X6MA 3HMXH 4OZHA 4B7IA 1GGCH 2PW2A 3HI6L 4RA0C 3RGVC 2OSLA 5CZVL 1NCTA 2LAGB 2X5PA 4F2MB 5EO9B 2BOCA 4LLDA 3OPZH 4MS8D 2NY2B 3L5JA 2N7BA 3HI1B 1F6AA 2FB4H 1YNKL 3VXSA 3OSKA 4J3SA 1NJ9B 3KWWB 3O2DA 4KKCD 4LSQL 3R8BB 1VFBA 5F97E 5FYJE 3DX9B 5KS9A 4WW1B 1IM9B 1KEMH 5ESVB 1O0VA 3VGDA 4LSSH 2NNAB 2E7BA 4I0KA 5GSVB 3RIAK 2UZIL 5GGQH 3FN0H 4B41A 4XCYB 4JCMA 2K3TA 4W4OC 3MRMA 1CS6A 4E41E 3EYOB 2Z35B 5C09B 3OG6B 1B90A 3EOAA 1AR1C 5KW9L 4QXGL 4Y0GA 2XYCA 3I6LD 4LCCA 2GFBA 5D2NE 4KK5D 2H3NA 5DJ2A 3ARGA 3HE7A 1KJ2L 5CEZE 3BJLA 3DXAD 3VXUD 2BDNH 5IFHL 1IJ9A 3I9GL 1FZJA 5K59E 4NBYB 3MRNB 1D5IH 4Z0BL 2YXMA 3IGAA 5DVOA 5FYKH 4PRHE 3BKCL 2J2ZA 4R0LA 1DEDA 3R1GL 4WI5A 5EZLA 3RWDB 1U91B 3PQYB 4NO2A 4Z78A 4HLJA 2W91A 2Q20A 1JWSB 2EIEA 4PJ5A 5FO7B 1BIHA 2GJ6D 5FYJL 3WLWD 3O6MH 3MFFB 4X6FA 1FCCA 3MLTB 3AFLA 3FB8A 1CDBA 2WV3A 1YNLH 2WIIA 4OLUL 3WFHA 5I1HH 4JFZH 1A64A 1L0QA 3OB0K 4N90D 1CGSH 1DCLA 1BMGA 4E41B 4ZPTB 5C0RH 4DGIH 3QI9D 2KZ1B 4NRZB 4LVNB 3TO4B 4KRNA 1Y18B 5BS0D 4LK4A 1NJ9A 3MLYL 4XZUB 3DIFB 5CEZL 3HUJE 3L7FB 1X7QB 4YGVB 3SQBA 4KGJA 4N9GB 1OP3H 3MRFA 5F7UA 4NHCL 2VLME 2XWJB 1RV6X 3GSOA 4L8DB 3LSOB 2WWMD 1F8TL 3RZCB 2YN3A 3IS1X 5C0CA 5GRYA 4OZIA 1ZGLP 4FOMA 1S3KH 5HGDB 2WIMA 5J6HB 1R24B 2FECI 5ALBL 4PJXB 5ERWB 5C09A 5F21B 4MJ5B 1YMMD 2H2SC 2ZSVB 4J7RA 1F2XK 1KT2A 1SJXA 3PWPB 3RVXD 4X8XA 4CVZB 1PBYA 5SWSE 3BZDA 2FZ3A 4Y2DB 4ELKB 5JUEL 5EN2A 2WINA 2PYEE 3DX7A 2Z4QA 4M1GH 1ZKAA 5GRZA 3AB0C 1WLHA 3O9WB 4L8BB 4PJIE 5EA0L 4DKEH 3UEZA 5MEPA 3RNKB 1DANT 2NY6D 1H8OA 5BV7B 2YA0A 3LY6A 1JL8A 2F8OA 3GMRB 4IIQB 5FF6A 3PP3K 3OB0H 3SDDB 1ZT7B 3HUJB 3ZYIA 5FO7A 3HZKA 4K7FB 5IHLB 4ZTOH 4QXWA 4ZXBC 4WHTB 5CGYD 2DM4A 3LEXB 1IMHC 1C7TA 1KBGL 4IOIB 5DYOB 5TGBB 3U6RA 1V3MA 4QRSB 3TT3H 4KHXL 5JR1L 4RWYH 2EYRB 1T5XA 4P5TC 3TJEH 2MCPH 3QG6B 3UTSE 4DKAA 4R90L 4KUCD 1A7NL 4EDXB 5DMIH 4RDQG 5SWSB 1T83A 1I7UB 1Y18A 5KG9B 4OD3H 4TNVF 5H37G 1AO7D 5CZXC 1BZ7B 3O3BA 4PB9H 4LSPH 4U1NA 4X4XB 2PYFA 4HUVA 1P1ZA 1P53A 4MD4A 4NZJA 1BEYH 3X12B 2AJUH 3KPOB 1NUDA 4M03A 4WO4D 5D7IF 4PRNA 3BQUB 3AY4C 1G7LA 4OV6F 3GNMH 2DICA 2YC1B 5TF1H 1NCNA 2VUOA 4Y4KC 1DL7L 3ZTNL 1INDL 2HVJA 1Q8MA 5A2LH 4C56B 4HKJA 3E0GA 3S37X 2NXZB 2XTLA 4ELKA 2H9GA 3N50A 1EZVY 4UIMA 5EZIH 2CDFA 2Y9RT 3GSNB 3T8XB 1OW0C 4HJ0C 4W81A 1LP9A 1FFRA 1FFOB 3VXME 3WIIL 4JRXE 4G6AC 5IHUL 2CRYA 2EZ0C 1FNHA 3SKJL 1ROWA 4NNPH 4ZUTA 1FCGA 1CT8A 3LKPB 3U83A 1LK3H 2XN9E 1A9EA 2PTUA 1JYNA 4JKKA 5KSAD 3SDCD 1OAYH 2H8PB 2Z31B 3GSVB 5HDBF 1NGYA 2P4AB 3V5KB 3P9LA 4J12A 3DV4B 1PG7H 3MUZ1 3V6ZB 5EBWA 5I1GL 1X5ZA 3SDAC 3IJSA 1OGAD 4IJ3C 4P23B 1I8MB 3RKDC 4H26A 5D8JH 3LB6D 1IFHL 1OSZA 3WJLC 4LSVL 1DSFH 5IK3A 5IMOA 3E3QE 2B1HL 2OJZL 1EHXA 1F4YH 3KPRA 3BGAA 4D94A 3LEVH 5IR1B 1Z3GH 2X70A 3KPQA 4HKXA 4ZAKC 4XPFH 1MCWM 1A22B 3GJFH 1HILB 1UKTA 5FYLH 3K2UH 4XPAL 4JRXB 2YD8A 1JNHA 1CBVH 1WIOA 5I30H 3TBYA 4GT7A 2W9EH 4HMEA 4DN3H 1QVOB 5CSZA 5IT2H 4Q6IA 1OQOA 4D9RD 1N2RA 1C5BH 3ARED 1KF9B 3QCUH 1NGQH 4Y4FC 2PNDA 2RCSL 4R3SB 5K9OA 1NH6A 5DEGB 3H0TA 4FQPA 3JWDL 2DLFH 1JNLL 5KSBA 4M5ZL 2IQ9H 3LN9A 2R0KL 3TP4A 3VGAC 4HIJA 2PO6B 5LXGL 3AM8A 3FO0L 4JFDD 4G9DA 4I77L 3ZTJG 2ZUYA 4OI9A 4OGYH 1XEDA 4OZ4A 2NLJB 4KZDL 2X1PA 4HX1A 1JPTH 2RBLA 4NOFA 1I9EA 4JB9H 3QWQB 5I1DA 4M61B 2FJHA 1HNGA 5J3HC 3SGEH 1KPRB 4G6KL 3GSRA 3IKCA 4QXTA 5AUMA 3CFKA 1PZ5B 2R8SL 5DT1L 4JANB 4QOKE 2FEEL 5EO0B 3RNQA 3I6GB 1BFSA 3RWJA 4F7CB 2DQIH 3D9AL 3EFDH 1EH9A 1J0KA 3FJTA 3S5LB 4QRPA 5C6TH 1C5CL 5GZNC 1UVQB 3QXAB 4XP6H 1G0YR 3KXFE 3PABA 4CN6A 3VFUB 5D7KE 2Y07H 2GCYB 4LQ1A 2I07B 1INQB 1QSZA 5TFSH 4YXLL 2BNUA 2LVEA 2FBOJ 3K46A 3VGEA 2OZ4H 4S1DD 1J1XL 4KK6D 4GRWB 1FZKA 3QO0B 2XWTA 1RIVH 5FYJU 4LLWB 2FYYA 4XMLL 3VWJB 1B0RB 3RI5K 4Z7OE 4LAQL 3MLSH 2GSIA 4JVUA 3GMNB 3DX8B 5H35A 1BWWA 2W38A 4HJJH 1M7DB 2JCCA 4XAWH 1NBYA 2F58L 3ILQC 3MBXH 3B9KD 3TFKC 5D5MA 4YNYA 3QH3A 1SYSB 2RFXB 4JDTH 2V2WB 2VLJB 1I3RB 1N6UA 3FONB 4YK4C 1UM4L 4YZFF 5E5RB 5FM4A 5ICZB 3NIFF 5K9JH 3ZDXE 3RTQD 4ZUVB 4MJ4A 2YPKA 3T0ED 1QD0A 1FYTB 2A74B 2A9NL 4PLOB 4YXHH 1FNEA 5C7XL 4OFVA 3X3FH 3T0VA 5B8CA 5E08L 4BELD 1OAXH 4P49A 5JW4M 4K7PH 2XI9A 4CVUA 5DK0B 2X4PA 2NLJA 4O9HL 9CGTA 3MJ7B 3VRJA 4JHBA 1M7IB 3F65A 1JGVH 4LRIC 4JCLA 3QEQE 3BMWA 4O00A 2MPAH 1NUGA 2A0LD 4LDOB 4PB0L 5GXBB 3KYAA 4EVNA 1MCPL 3UXFA 4ZFGH 3ULVD 2ZUXA 1PX3A 5A2IH 4K8RD 5EUKA 4OGXH 4RQQA 2C3VA 4TUKH 1OPGL 2YRZA 2AGJL 3HAEH 4LDEB 4OBSA 4PPTA 5D96B 2BNQB 1T20A 3C5SB 1DN2A 4YHLH 5EIQA 3WEXA 4KI5C 3QNYA 3C60A 1AE6L 3P4NA 3O3AA 35C8H 3GRWA 4D9LL 3KYNA 3OJ2C 4X5WB 1DE4B 1W0VA 1B0RA 4NT6A 2BY3A 4ONHA 5IVZB 3HC3L 3CVIL 4X6CA 3SE4A 2GJ6E 4ZO7A 5EU4A 1NL0H 4N8VB 3K74B 1FZOB 2FX9H 5I71B 3CIQA 1K8DA 4KJPC 2QKIA 3UX9B 2F8XC 4PJ7E 3DMMB 3HI5H 2R4RL 2BSTB 2D31B 2MHAB 3N9GL 1UM5L 1S7TB 3T77B 3O6FA 3BW9B 4G3YH 5GSRB 1Z9LA 1FRGL 2BNRE 3NZ8A 2AK1H 5HDLA 4F33A 2A1WH 4LKCB 2FECL 2Q7NA 1CXFA 3BSZH 4JM2D 4U31A 5D7SH 4OFDA 3WN5A 3HMXA 3IU3B 3T2NH 3VMOA 1I1RA 1IM3A 1ZLUH 1ZS8B 4WGWB 3T2QA 2AV1B 3VI3F 3P2TA 1RJZA 3ECBA 1JTPA 2RGSA 3IFOA 3P30H 4X6DE 5D1ZD 4YDVA 4OKDA 3CFIC 2DIAA 4W6WB 4JRYA 1WEJH 1G6RH 2V17H 4QT5B 5D1XC 1D9KB 5CILL 1QFOA 4R2GC 5DXWA 3MRLA 5DHYB 2AI0H 4IM8A 2ED9A 1RVFH 1GOGA 1QSFE 4JFQA 5KSUB 3T04D 4MLIA 1NCCH 3O2VH 1DQJB 4OZFB 3WFEH 3NCBB 5CHNA 3REVB 5GZOC 2DTMH 4ZDHB 3I02A 1PEZA 1CXKA 3J7HA 3QDJB 4ODWA 5IIEA 3HNSL 5CD5D 2I60L 2NX5B 4LVOB 2MJWA 1R3HB 3GBNL 1JE6A 4CUCA 1UH3A 4OGAC 4J1UB 1DBBL 3FFCA 3UYRH 1U8JA 5D7LD 2BNQA 5E6ZA 3TZVB 3IU4L 1CFSA 1ONQA 4DN4L 4G6ML 4R96B 3MO1B 1AJ7H 4IDJL 5SWQA 3QHFL 2VQ1B 3HB3D 4PGCB 4HZLA 3LS5H 3P9MA 2XKSA 3H7BB 5BZDA 2J5LB 2GUOB 3L1OH 2AQ3A 3BKML 3DGCR 4N0FB 5E1AB 2VDOH 1J9CT 4YE4L 5F7FA 1ZVSB 1UM6L 1FLRH 4S1SL 3HE6C 1G9EA 2DYPD 3IRPX 4ZD3L 4TSCH 3CLFL 5JIPA 5FFLA 1QSFB 3JV4A 1YUHB 5IJVB 5F1OB 3LCYA 1CFNB 2Y06L 5AZEH 3O2WL 3H9SD 4H88H 1T7ZA 4MJIB 4QTIH 2F15A 4LKCA 4YHOH 2EDJA 4X7FC 3VXRB 3E6HA 1A7RL 1FAIL 3LKOA 3CFDB 2AAVA 5L88H 3BPLC 1EO5A 2Z93A 3NPZB 5D93B 2F5BL 3ULUC 2D4DA 1G9ML 4PJ9C 1ACZA 1IAIH 1FG2A 1V3KA 1ZANH 4MA7H 43C9B 1FJ1A 1U92A 1I85A 4P3CH 3WYRA 4OGZA 4F7PA 4ENEC 5HHNA 1PGRB 2CIKB 4FG6D 3SO3B 1DQJA 1MCIA 4QRTB 5T1KB 3HI6H 5HBBA 2NY1B 5CZVH 1T04A 3AAZB 5KJRL 3FMGL 1LILA 3X11A 5E8OB 4ZTPL 1R5IB 3VD3A 3S88L 1A3QA 4KDVA 3QDGD 3MBEA 1E4JA 1IGTA 1OVZA 4HT1L 1YNKH 4XI5C 1RZJL 1T80A 4PJFA 4LSQH 3U0TB 2XQYG 2X89A 1SEBB 3OB8A 3VFNA 1GYAA 1KPUA 3ROOA 1Q0XL 1T1YB 2YUXA 3VFWA 1FIGL 3SGDI 1NQBA 4RMUA 2ERJB 3MGOA 5DI8B 2A6KA 3IKKA 1BQHB 4U6XB 5KW9H 4QXGH 4TNVK 4NZRL 4XCNB 5ID1B 3Q48A 3QUXD 1XGQB 4KWUA 3E6FB 1T3FA 5I8CA 1ACYL 5MENB 3QXWA 1KJ2H 1OGAE 3VA2C 5F9WC 5E99L 1NBZB 3MLVL 1T89C 1S5IL 1S9XB 5IFHH 4ODXB 3I9GH 1T1ZB 3RX8A 1PKQB 1CDIA 4Z0BH 3P0VL 5J56B 3WJJA 1KIPB 3PWNB 3BKCH 2E5EA 4O2EB 2AJXL 3DSFL 1S7VA 3RDTC 3R1GH 4PGZA 2YOCA 2EH8H 1IGYB 2YD2A 3T3PF 5E4IA 1QFHA 1F3DH 2WZPD 3QIWD 3VRLE 1MWAB 4YWGL 1HINL 4PJAB 1UA6L 5I1IL 3WCYA 1UZ6F 5E00B 3CJJA 2CKBH 4MQ7A 5FYJH 4F7MA 1I7ZB 3O3UN 2E9IA 2R2HA 2W65B 3RGVA 4NN7B 5C8JB 3BT2L 1N59A 2NY4D 4OLUH 1NGXB 3SE8H 4BSVA 4QHLA 3CK0L 2YBRB 1TVHA 5C1MB 1HWGB 4LARL 4D2NA 4JZJC 2H1PL 2ADIB 3LPFA 4UQ2A 1T0NA 2VLKB 1JI1A 1SM3L 4PTUA 4WEBL 5C0ND 4NNYA 5IMMA 2X41A 2X4SB 1BLNB 3WL9A 3MFGB 1QNZL 5CZKA 5C0BA 1A6AA 1U8NA 1YEIL 5SX5K 1GXEA 1ND0A 2UUDK 4W4OA 4KKBD 2G9HB 4JFDE 2X4OB 3EO0B 4NHCH 2QQNL 1MLBB 2HFGL 1NFDB 2CLRA 3L95A 5CSGA 3PDGA 5GGVY 3GMLA 1F8TH 3RWHB 1XF5B 1YEFL 5ALBH 3JWDC 1VERA 5E8PA 3ARFB 1OTUC 3GMQB 4GSDL 2CK0L 4RAUB 4DUVA 1AY1L 1MI5B 4AEHL 1KOAA 1FFPB 3ET9F 4PV9A 5JUEH 3GSWB 3SCMC 2ZUQB 2P8MA 4MDIA 3L3HB 4Z7WB 4TUJB 2VXTL 3BWAB 4XP9L 1E27B 3NH7H 5EA0H 4AH2A 5JMOC 3NABL 1XF3A 4PGJA 1I75A 4A6YB 2XKNA 3BKJL 4DEPB 1DLHA 1YPZE 4AIXA 4HEPG 4IRSB 5FB8A 3ARBC 5B3JF 4HH9A 3O4LB 1J0IA 4QRRA 5C9JB 3KYOB 3V6BR 4H5SB 2PR4L 4L4VD 4LLYB 4Z7VF 1YEHL 5DUML 1Q38A 4P5TB 4GXUM 1IL1A 3GJFA 2W60A 2CRIA 3B2UD 4AIZA 4Y1AA 5D2LB 1GL4B 1I1YA 2FIKA 3PGCA 3D0VB 2P5WD 1KCVL 3QHTC 5IB2A 4KHXH 5JR1H 1HOCA 4HMCA 1FL5B 3BPCA 3QDMD 4PJCA 4WTZA 4BQBA 1BQLL 2XPGA 3G5VB 3TVMD 4Z7UE 1FBIL 1AKJD 2HVKB 4R90H 5I1AA 1HHHB 1A7NH 1UYWL 5K93A 3VFRA 4LCWA 4HIIB 3T0EE 3TYGL 1BVKB 4P0DA 1XT5A 1DUZA 1L0YA 4ONFL 3NBNA 2RR3A 5FO9B 1VADB 1CK0L 2ZPKL 3G6DL 3NA9H 5D6CA 4PBWD 4ZFOL 1ZV5A 4UUJB 4G8GA 3E8UL 3IDMA 4WTZG 3RQ3A 4EI6B 3VXQA 3VE0B 5DSCB 1LGVA 4BFBD 2YPLA 3G6JB 4ZNEA 3QRFM 5I76B 4ZMAT 1DL7H 3ZTNH 1INDH 3P4OB 4WWKC 3EO1B 5I2IA 4X0KA 3ARTA 3AVEA 3ULVE 5DD5L 2R2EB 4NJ9L 5CEXA 2IQAB 1XCTB 4XPHH 3OJDA 3WIIH 3BH9B 3Q1SL 3WLBB 5IHUH 3MZTA 1D5MB 4PGEB 3OKLA 1EUUA 3SKJH 2YEZB 4YO0B 3DURA 4ZXBA 3VXTB 2J1KA 3IDIA 4L3AA 4CW1B 4JKMA 4P5MB 2X4TA 5IFAL 1Z5LB 5GGRA 3O11B 4U1LA 2OZ4A 1JF1A 5T1DL 4JO1H 3H3KA 3U4AA 3D18B 1BFTA 1EPFA 4KPHL 5I1GH 3K4DA 3PNWB 4FQQB 2J12B 1U8KA 4HD9A 1NSNH 4OQTL 2E9BA 3DVNA 1IFHH 4L3EA 4LSVH 5J11C 5HGAA 1A14L 2B1HH 2OJZH 2CLZA 4ZOBA 1PKOA 4MS8C 1KTDB 4DVRL 4DAGL 1XCQB 5JHLL 1G7JB 4KKCC 1OOAA 5IHZA 3S35X 3ULVL 3RFZC 1IGJA 4BM7A 3AY4A 1B0WA 4XPAH 3MA9L 1IGML 3ULSA 1F58L 1FNLA 4BQCA 5T1LB 3CZFA 3KLAB 4MJ6A 1H3VA 3QQ9D 4Y4KA 1HCVA 4EIGB 5LGHL 3QIUD 3MCLL 5HYJB 4ZQKB 4TPRL 5FCSH 1MAML 3D85B 1O7VA 3JTTA 3VGAB 1EIBA 1GC1L 1OW0A 3DUSA 3OAYK 2RCSH 3BPOB 3JV6B 4KK5C 3I3BA 1BOYA 3JWDH 4JKPL 1UFUA 1JNLH 4M5ZH 3KPMA 3OZ9L 5GIRA 1SBSL 2R0KH 2YK1L 5J12B 5LXGH 1PW3A 3BP7A 3FO0H 3X14B 5ISZB 1XH3A 1YN7A 2F54D 4D0DB 4ODVH 4V1DB 3QWOA 4KZDH 1OP5H 5CJ8A 4EN3A 4LPUA 5IROC 4MXQD 3VXTA 3HAEA 5B38A 1QQDB 3SDAA 4G6KH 1MHEB 3LRSB 2R8SH 5I1CH 3WJLA 1B3JA 4YC2C 3WLWC 2WUBL 5INDB 3KHOA 2R23A 2Y4SA 1FPTL 2P44B 2HTLD 1C5CH 5T3XD 4NQCB 3LPGA 1A1NA 2GJJA 1X6NA 1XFPA 5ACLA 4ZAKA 2ICWJ 4LHUA 1F4XL 3I3DA 3NFSL 5I17B 3DUUB 3QI9C 4NQSB 3UYPA 1KIUA 3EOYG 2BVQB 3STLA 3HAEG 3HR5A 5B38G 4X99B 1J1XH 2DWEA 3N1MC 5SV3A 1MNUH 1W0WB 1HK6A 3L3JB 4XMLH 4MZ3A 4YX2L 1RFDL 3FB7B 4LAQH 1BFOB 4FNLL 4HK0A 4Y4FA 4D9QD 2X40A 1AGEA 5L8JB 4OF6A 5CJOH 1U3HD 1JRHH 2F58H 5EBMA 2DKMA 5JOFA 4FMKA 2SEBB 4XNYL 4JHZA 3QB7C 4LHUG 1XIWD 2MSPA 1LE5B 5FUCC 5BJTB 3DO7B 2MOVA 5C0AE 3U9PL 4G80A 4UDTB 1MCEA 1BOGA 1AGDA 1G6RA 1ZGLM 1RIUL 4PV8B 1A9BB 4XXDB 3RVXC 5B39B 5DDHB 4I2XA 2HN7B 3I50L 1S7QB 5IB4B 2R1YB 3W0WD 1G9MC 1YMHB 4POYA 3C6LD 5E08H 1RULL 3JUZA 5MERA 5I75C 5ICXB 3OKNA 4G43B 2ZOKA 3UTPD 4O9HH 4Y5YC 1TJGL 3U48A 1RHFA 4I48A 3BZFB 4N8PA 4P5KB 1QFWM 1BD2D 3TBWA 4BFIB 2QSQA 3I3EA 4PP1D 1S7WA 1MOEA 1JGEB 1EEZA 3UJIH 1NCAL 5CGYC 5HHOE 1MCPH 3Q6GL 2FHCA 5DJ0B 2EO1A 4FZ8L 1OPGH 3WFDL 2AGJH 3EJJX 4K55A 3EJZD 4UDUB 5HYQB 4E5XB 3GHEH 4RNRA 1OTTD 1MAJA 1UXSB 3TH2T 1ZHBB 1X5HA 2E27L 2EDXA 4I4WB 2C3HA 4RFEB 4D9LH 3W82A 4YH6A 1IZKA 2BMKA 4HK3J 5A2FA 2AABH 3HC3H 3MV7D 3SJVD 2FDBP 4M48L 1U93A 3FO9B 4WO4C 3OAUL 3B3IA 1Q9WB 5IG7B 4KAQL 3VCLA 1R3LA 2CKBB 2R4RH 3OKOB 1Z0NA 5D7IE 1ZLWK 1Z9OA 5E2WH 3IJYB 5C0IA 2P8PA 5HGBB 1I1AD 5B39A 1B0GB 3RP1A 1FRGH 2V2TB 3FO2A 4PJ5D 3W9DA 5FOBB 4JFFD 3GBLA 5DUBA 3RL1B 3LN4A 5D1XB 5KBNC 4D0BA 1GOFA 3R0MA 4PGDB 4G9FB 4LRIA 4R2GB 4FXGB 3VD7A 3WS3A 5IOPA 5LG1A 1KELL 4OQ1A 3L6FB 5J0BA 1RJYB 1TFHA 3MRRA 1AGBA 5CILH 3EO9L 3GSQA 1KLUB 4NIKB 2VISA 2GSGB 5KSAC 4AYFA 4OLWL 4U1JA 1I8KA 3A6CH 5T5FL 1BVLA 1N5AB 5DD1L 3UO1H 4OLZH 2EYSA 1VEPA 4GW1A 4GG6B 5B39G 2C3XA 2WQ8A 5DS8B 1ZA3B 3JZ7A 5HDBE 4DW2L 1R3JB 3T4YA 3EW3B 4S1QH 1CFQA 2ESVB 4XWGL 1U8HA 5EO1B 3KPPB 3D2UD 1AP2B 3HNSH 2HKFL 2I60H 1G7PA 3GBNH 2DQTL 1JWMB 1N4XL 3KS0H 4MVBC 1YEKL 1DBBH 1L4IA 4UDUA 1R3KB 1KJ2A 1AD0B 1WVZA 4DN4H 4G6MH 3OF6D 4IDJH 3QHFH 1QLRB 1ZHNA 3HE6B 2AJSL 5DC9B 1QOKA 1FNAA 2HH0L 4NO3A 3SO5A 1LVEA 3NN8A 2R29L 2DBLL 4PRIE 4ETYA 3BKMH 2BFVL 4JREC 1QSED 4YE4H 4GRLB 2EEBA 5F7MC 4S1SH 2O5XL 4ZD3H 4M6OL 2VLRB 1YZZA 2CKBA 3K7UA 2DM2A 3AREC 1OSPL 3PE9A 4YHPB 4GW5A 3IJYA 4Y7MA 1VHPA 2Y06H 1HYSD 5KOVC 1CZ8L 5DUPL 1IILE 2ITCA 4J8RB 2AJ3B 3ARVA 4WU5B 5D1XA 1A7RH 1FAIH 5BXFA 1SY6L 4P3DB 5CIPH 3OTTA 1TNMA 1T0PB 1WFOA 4B53A 5F70A 5IMKA 2F5BH 3BHBA 1I8LC 5BRZB 1G9MH 4MNQE 5D2NA 4N1HB 2HLAB 4QCIB 4U6VL 3WMSA 1T0MA 4LOUD 5JHDE 4ZUUA 5TE4L 1BBJB 2FO4A 1T7YA 4WUUA 5E6YA 2Z8WC 4PRHA 1NCUA 5LJYH 3QXDB 4XVJL 5KJRH 3FMGH 3FQWB 4K23L 4ZTPH 1XGUA 3S88H 3QUZB 3BAEH 1KULA 5L7XL 4HT1H 5FA4B 3V0VB 2FWOA 1DVFD 1W8NA 1RZJH 3IETA 1CICB 3F58L 4YHYB 2Y7QB 2FR4A 1FVDB 4OIAA 1HNFA 1R3IH 2H26B 1WWBX 2PXYB 4JQIL 1Q0XH 4S1DC 1AXTL 4Q0XL 3F7RA 2QSCH 3BUYA 3GB7B 1F3JB 1MUJA 3NGBC 3JSSA 2X7LA 3WSQL 2FCBA 3WV0A 5JA8B 2XFXB 5E5UB 4BH7A 3NCCB 4XP1L 1QA9A 4NZRH 4PJGF 3CFCL 4P9HL 4Y19B 1TZHB 3AXLB 3B9KC 1ACYH 3CC5A 4P46A 1HHGB 3MRQA 2O61A 5FA3B 3MLVH 1A4KB 3EHBD 4YDJA 1KV3A 4XVUD 5T5NF 5EOCJ 3P0VH 5GRVL 3RTQC 4YZFE 3T0EC 4U1GC 2K9UA 1NGZA 3NIFE 2AJXH 5DRWA 4PJ9A 1HE7A 3DBXA 3TIEB 3H9ZA 4OUOA 3HFML 4HIXL 4JFHD 5C0GB 4OCRL 3MA7A 2DQFB 4NNXB 1LO2H 1EDQA 4YWGH 1HINH 1WT5A 3A0OA 1UA6H 3QQ4A 5FDWB 5I1IH 1GAFL 5BRZA 4OV5B 1JZ5A 3QRGL 1K5NA 3BT2H 3LDBB 3NFNA 3KPRD 2VKWA 1WBZA 2PYEA 2ADFL 3CK0H 3EOTL 1BQUA 2E7CA 5ILTH 1KXVC 2B7DT 4OF5A 5FUOL 2Y36L 5HHVL 2H1PH 4WEUD 3RZWA 4WUKL 2BXYA 3IDJA 5CBEA 1P7QB 1CCZA 3ULVC 1CDJA 1EBAA 5DJCA 1IEBB 4ZSOB 1QNZH 2ZSWB 5F7DB 3OR7B 4J3WA 5KANI 4WFFD 1BGXL 1HH6B 1YEIH 2ZKHL 4LEXL 5DMYA 1LO5A 5GGUA 4PRPB 3BYYA 1S8DA 1ODAA 2NY0D 1BIIB 2QQNH 3V79C 1GC1C 1F3JA 3CFJB 4PYHA 4PJ8A 1A7PL 1KEGL 3AS1A 3G5YA 2AXGA 2VXUL 4RCAA 1Y6KR 1HI6A 1JTTA 1ZT1A 5MEOA 3G5XB 3INUL 3C8KB 3QEHA 1VPOL 4GSDH 2CK0H 1T2XA 5F6IC 1AY1H 4I5BA 3H7LA 2BRRL 3UTSA 4NFBA 5DJ6B 5J9PB 2HG5B 1TZHA 5FKAB 3OKDB 1MCRA 1JGLH 1NFIA 3JV0A 4Y4HD 2VXTH 4L3CB 3RDTA 4XP9H 3HPJB 1HXMB 4X80L 5FKPA 4NO0D 1ORQA 2E8YA 3NABH 5ACZB 3MACL 5MEQB 4LEOB 5EU5B 3QFDB 3BKJH 1AD9A 5EUOF 1E28A 3S37L 4JM2C 1BF2A 4U1SB 4GQ9L 2ZG1A 3IXAA 1D6EB 4DGVL 5E4EB 3GDBA 2A6JB 1QFUL 4NO5A 1FHGA 3D87B 2PR4H 1BJMA 2BXZA 1EBPA 2VXVL 5L0QC 3VI3E 3PV6A 4JZJA 4NQEA 1RK1B 2CSPA 4DWHA 5DJ8A 1K2DB 3DV6B 4WIQA 1GIGL 1KCVH 3EYSL 1KPVB 2OQJB 3VXMA 5D70L 2OBGA 1YECL 1BQLH 4UOW0 2R0ZL 1FBIH 3SDXF 3D3VD 4RIRB 3OWEA 4R4FH 3QEUB 2XN9A 1UYWH 3ARDB 4ZSOA 4PG2C 1FFNA 1H15A 1U95A 3TYGH 5CD5C 5F7DA 5MI0C 4EEEA 3FCTA 3Q6FA 3FRUA 3UTQA 1TQBB 1HIML 1KFAL 4ONFH 1QRKA 5T3XL 1F45A 1CK0H 2ZPKH 3OKMA 1NPUA 3G6DH 4XC3L 5CBAB 1KIRA 1F11B 4L29A 4KJWC 1JZ7A 4AENB 1U8QB 5GGRY 4PP2B 1HEZA 1U8LB 5FK9A 3E8UH 3S3SA 1XGPA 1BD2E 3FQUB 3SCMA 4AZ8A 5F7KC 4FTVB 2R1WB 4I3SH 4CADB 4XNMA 4LGSB 4KKLD 4C83B 4UNVA 1NUNB 4W6XB 4LLVA 3IFPA 5FKAA 4O4YL 1G1CA 4OF8A 2BC4B 5DQJB 3V6FB 5DD5H 3ARBA 2FD6H 5AZ2L 5E9DE 3RWFB 4FQIL 2EECA 4TUOB 3Q1SH 2X9XA 1VGKB 2VN7A 4JN2B 4PRDB 5KVFL 4LEOA 5EU5A 4KHTL 4X6EA 3B5HA 3HG1E 4NQXA 3RY4A 1RZKL 1UADC 3JV5A 5IBTL 5CMAA 3MR9B 3DGGA 4GUPA 4MGXA 1J86A 2FJGB 3VXPB 5HY9A 5F3HB 1NMCB 1C16A 5IFAH 8CGTA 5I74C 1OAKL 2LU3A 4HDIB 4LLMA 5T1DH 4K7PY 5J11B 3W2DH 3MV7E 3NFPA 1D5ZA 5TQ0H 3SQOH 4AM0A 3V5DB 1D5XA 2ADGB 2IALB 4OQTH 3C60D 4FG6C 3PXHA 4JZNB 5IM7B 2ADJB 4MA1C 4CJ0A 2UZYB 1BHGA 1SJVA 3DTXA 3MRBB 4YEEA 1EEUA 4X7TA 4OCYH 4DVRH 4DAGH 5E8EB 2C4FU 2XQBL 1P6FA 3ULVH 1DUYA 5JPNA 1VEOA 3MA9H 2X4RB 4QOKA 1IGMH 1Y0LB 1CGWA 2IBZY 5HHME 5AD0B 4PTTA 4ZOCA 1N3NB 5CBAA 1F58H 1MEXL 3UTTE 3QDHA 4WWKA 3O6FD 3KXFA 4KMQA 1YQ2A 5C07D 5HPOA 4O2CA 3TCXA 1T7WA 2IAMD 3DXAB 2VSDA 1N0XL 1KJMA 1MAMH 4TPRH 4DQOL 5IESL 1GC1H 3PL6B 3ES6B 1WUNT 1A1OB 4P2OD 3CFBA 3G04A 1RZ7L 2HFEA 1EAPB 4GLRI 4JKPH 3WNKA 5CWSA 4RFOL 4F3FB 4JGJA 3C5JA 1RUKL 3OZ9H 4PJBB 1SBSH 1ZT4A 5C08A 4XBPB 2EDFA 3GIZL 1A2YA 2P8LB 4YC2B 4K2UL 3HNVL 4TTDD 1QR1A 3BEWA 2GI7A 1A3RL 3QIWC 4E0RB 1I7RB 2X1WL 3T3PE 3CX5K 1EK3A 5F3BA 2RHEA 2WUBH 5ESAB 4CNIB 3RX5A 5HHMB 4OZHF 1SJHB 3QI9B 1UZ6E 4D0CB 1L6XA 3FFCD 1QSEE 4M5YL 2NY4C 5BS0B 1MF2H 4F80A 3QQNA 3KPSD 2ADGA 3P0YL 4X4ZA 3U7AA 1F4XH 3NFSH 2CGRL 2ED8A 4HHAB 5KS9F 4KTEL 5C0NC 1MQ8A 2VIRA 2YMXL 5ENWB 1HYRC 1NAMH 4TNWK 5C0FA 3MV9E 1KB5L 2WP3T 4YX2H 1RFDH 4KKBC 1YMMB 2X9YA 4O51B 5BVJB 4GKSB 3UTOA 3NMEA 1K4CB 4FNLH 5JIKA 3CUPA 4Z7NF 5CGTA 1QYGL 5CIPB 2ITDA 4XNYH 1S9WA 2ICWB 4EQ2A 1EO8L 3VXUA 1B6UA 1A0QL 4XVSL 4XBGB 4WFGE 3U9PH 1XZ0A 2EDRA 4UU9A 1UQSB 1MCLA 4HWZB 1RIUH 2DN7A 5EORL 4FQHB 32C2B 3CDGB 1SJEB 3SGDH 2NY6B 3I50H 5CKGA 4CMMB 1AXSB 5IROA 4WI2A 3GMPB 4ZUSA 3QCTL 1EAJA 5D1QD 5GISL 3H6JA 4NBZB 2OR9L 4NCC1 2QQLL 2VAAB 5L9DL 2GJ6A 5LCVH 1TJGH 1XR9B 3VDCA 5HVFB 3IDXH 1KIQA 4IDLA 3ARYA 4PJDF 1ZLVH 5TDOA 4PJ7A 3MRIB 5B3JE 4QHUB 1UB5B 2O5ZL 4MCYB 3U0PA 1NCAH 2CH8A 2I9TB 3VGHA 4Y5VB 4GAYB 4LMQI 3B2UC 1Z2KA 2X4NA 3H42L 4Z7VE 3Q6GH 4MNHB 3GMOA 3FAXA 5GRJL 5HYFA 3DI3B 4RMQA 1AO7B 3WIHH 4FZ8H 1X5FA 3WO3B 5BOZG 2GT9B 2XKUA 3WFDH 5EOQL 4LKXB 2A6IA 1ZHLA 1FNGA 3TVMC 1S9YA 2DWDA 4R7NB 3P77B 4X6DA 2AXJA 3D25A 1IC5L 2V5TA 2UV3A 3BEVB 3SPVB 4HJGA 3AU1A 3SGJC 1A21A 4EKXA 1U42A 3F7YB 4P9HC 1FN4A 5IFJA 5D4QA 2VJXA 4JFED 4KRPD 3R06B 4XCFL 2P47B 1IKNA 2HFFB 4M48H 1HHKA 4YGAB 2X42A 4S0TD 1X5YA 3RKPA 1YYLL 5JW3L 2B5IB 6FABL 1T22B 3HC4L 4TOYH 5I18L 4KAQH 5C70A 2V5RA 3QFJD 4K3JL 3DRTA 5JXAH 1P7HL 1HXYB 1I3VA 3OKYA 4JFXA 12E8H 4HC1L 4NM4H 4MNGB 4Y5YA 5TDNB 43CAA 3C09B 4LPWA 4MYWB 1LD9A 5KSAB 4RDQF 3SDCB 5C0EA 1J8HD 1KELH 1A4JB 2FX7L 3KYKL 3C8DA 3CVHB 4MB5A 4P2QD 3TPKA 3IDNA 5DF0A 4FQ2L 1MCDA 3C8HA 3HHRB 4U0RB 5F1IA 3RWIA 4WFHE 3EO9H 3QJFB 4HUWB 4OLWH 4QO1A 5T5FH 2FSEA 4QHNA 4M93C 3TNNB 4RRPA 5DD1H 4JZOA 2H6PA 5DURD 1CDHA 4K94L 1FH5L 4DW2H 2A77L 4N0UB 5DHVH 2KKQA 4XWGH 5JOPE 2HKFH 4PJHB 1AO7A 2BOBA 5IKCA 2DQTH 3ISWA 3K8MA 2AJVL 4UTAL 1YEKH 3DRQB 1QPPA 5ELIA 4U6HB 1CGTA 4NM8H 4MD0A 4AMKL 2ZZUT 4NC0B 1M05A 4WO4A 5IVXB 1QO3B 1IQWL 4RRPG 5F1SA 2HH0H 1RZGA 4OCNC 2JB6B 2EE9A 1MCJA 4L4JA 4Z7QF 4YBQC 3HZVB 2R29H 4PJXF 3AREB 4P2RD 2DBLH 2Z91A 1TXKA 3M1BB 1ZGLB 2BFVH 2VABA 4GXVL 3QQ9C 5JNYB 3QIUC 5E24E 3QG7L 3FQNA 3KLDA 1RHHB 1PDKA 2VMFA 2YWZA 3NA4A 2DDQL 1YQVL 4ALAL 1OSPH 4OLEA 1WGOA 2DKUA 4GBXA 3VW3L 4QRRD 1NCBL 2JF1A 4Y16B 1ES0B 1CZ8H 2VDQL 5GPRA 2VERN 2P5ED 3PHOA 4OLYL 2FX8L 3MRGA 1I8IB 3MRHA 1CIDA 1SY6H 1KUMA 4JJ5A 2C7UB 1S9VA 4JLRB 4Y1AD 3RJDA 5C92A 1S7XB 1BJ1J 4MXQC 1Q9OA 4F7TA 1OGAA 4QF1B 4YAQB 3CU7A 4NYLB 5DHXB 5TE4H 3NCJH 5SWZD 1C12A 1CLCA 3FT4A 2M2DA 3HS0B 5I73C 1LK2A 2GTWB 3L5WB 4NKDA 2ZOLA 1HCFX 2QADD 1N6VA 3DVFA 4K23H 4YFDB 3W11D 4DVBA 5L7XH 2Q8BL 3EYVA 3NGBB 1U3YA 2LFGA 1RJLB 4X5XB 4DK3A 3F58H 4HS8L 1A6TB 4G8GD 4G8IA 5K9KB 1KLGB 5D9SA 1ADQL 4IMLB 4XPBH 1G9NL 4JQIH 2JB5L 2BHUA 1AXTH 2G75B 4Q0XH 4RFNB 4HKBB 3UP1A 4GRMB 3B9KB 2FGWH 5IVXA 5C2UB 5I66B 3MV8B 4MDJA 3BD3A 2PCPB 4XP1H 1PYWA 3CFCH 4P9HH 3WHXA 3RBGA 3RWGA 3RTQB 5D72L 2R15A 3KPLA 2H32H 5HPMA 2D4FA 1XIWC 1MHPL 3DVGA 3W5NA 4ZXBD 3EFFB 1OAQH 5KSBF 2WSKA 4XBEH 3PDOB 2HT2D 5B4MD 1N8ZB 4JFDA 2X1OA 4M6ML 3P73B 15C8L 5DD0H 4FA8A 4MHHG 3ILPB 4YQXL 1VFMA 1I8LA 2NZIA 4NUGL 1XGTB 1J5OL 1G7HB 5J1SC 1WC7B 2A83B 3HFMH 5EOTB 3C6LC 3G6AA 2BRQA 3H9HB 4RBPH 4Q9RL 4OCRH 3BDYL 3P3YA 2PTTA 1MCKA 4OT1H 3M45A 1YYML 1CGVA 1TIUA 1A6UL 1PX4A 3QRGH 1BZQK 4L3ED 5ANME 5SX4I 1H8NA 4LPCA 1MQKH 1QRND 2ADFH 3CCHA 4PP1C 2IAND 5C07E 1V3LA 4PUBL 4CN1A 5FUOH 1C7SA 3VRIB 4ZFOA 2Y36H 5HHVH 4DK6A 4QHKJ 4WUKH 1BJ8A 3MROA 5EOCL 1IT9L 1YPZA 3GJEB 4CJ1A 5IF0B 4U2ZA 5DQDL 1LEKB 1BGXH 2ZKHH 2XTJD 2VL4A 4LEXH 3EJZC 3A67L 4Y4KD 1A6TA 3G5ZB 3KVQA 4XRCA 5HGHA 3BWUC 1OTTC 4R97B 5FHBL 2HYMA 3MGTB 1G7MA 1WZMA 4XMPL 2I9LA 2PUQT 2A38A 3K3QA 1A7PH 4L4TD 1KEGH 1GGBL 4NWTL 3UPRA 4G6AD 4FQXB 4PRBB 2VXUH 5DLMH 2AJZA 1FYHB 4ZS7L 1H5BA 3QISA 2HJFB 3PWUA 4LBEA 3INUH 1VPOH 1EFXD 1NMBL 2PCPA 4Z7UA 3VMPA 2BRRH 1D6VL 1MVUB 5ANMB 1CE1L 3T0EA 3T1FB 1OLLA 4LMQE 4HS6A 4JM2B 3TCLB 4EN3D 1GZQB 3JTSA 1U6AH 5A2KH 3KPSE 4X80H 4B7LA 3DSNA 1A7BA 3MACH 1I1AC 1S5HA 3FQXB 4LCIH 4TVPD 4O2FB 2UY6A 1TJHL 3ZE1F 5D1ZB 3ZKMD 3VH8B 5F7EL 4OQTA 1VA9A 3S37H 1AQDB 5JLZA 3DYOA 2B4CC 4GQ9H 1IGFL 4DGVH 2FL5B 1VGEH 1S78D 3MYJA 1WAAA 3VWKD 1DANU 5J1AB 1NAMB 2ZCLL 1W72B 1CD1A 4XNQA 2EIZB 2V7HA 4G6JL 4LHUD 4BA8A 1ZSDA 2DL2A 1A7QL 1KLFA 3D39E 2I24N 1KCLA 5EBGA 4K3GA 1GIGH 3EYSH 2DKSA 5MI0B 1WBXB 5D70H 1YECH 2DQCL 5DRZA 3VRIA 4AL8L 3BDBA 2R0ZH 4WCYL 5D7LB 2DMCA 3QA3A 4Z5RA 5ESQB 3BZ4A 5GS1B 4P59L 1CD0A 1M4KA 2QEJA 4MQTB 1FVEB 1L7TL 4LF3B 1JGDB 4C58B 4PJEE 2OTUA 4FQJH 4GRWF 4Y4FD 1EHLL 3BD4A 1JWUB 4ZODA 1HIMH 1KFAH 1ZLSL 5T3XH 1UH4A 5JTWA 3LKNA 2EE3A 2YD9A 4APQB 4AQ1B 4XC3H 4OCLC 5DQ9B 3B2VL 1P7KA 2ED7A 1QBLH 5F44A 3VFTA 2YD3A 2Q6WB 2VN4A 4ZFZB 1ZA6B 3UBXI 1TVBA 4AG4L 2HFTA 3S35L 3SE9L 5CAYB 5JW5A 5TH2B 4NQVA 1JHTB 3S34H 4WEMB 3H9SB 3BOVA 2NCMA 4O4YH 1XF2B 3D69B 4NCDA 3DYMA 4YHIA 2HJKA 3IT8D 4JM2A 5EU6E 5AZ2H 1U3ZA 3TCLA 4FQIH 1VFOA 1JK8B 1HYSC 1S7RB 5KSVB 4ZYKA 1DBJL 1WK0A 3FQXA 5I74B 5KVFH 5DJYA 4KHTH 1X5JA 3K1KC 3MNVB 1DQTA 1P4LB 4NKMA 5HHPB 3U1SL 3VFSB 3PGDA 4O5LH 1KGCD 2X4UB 3KDMA 4P57A 3VFVB 3OXSB 3GUTA 3BO8A 1KACB 5FGRA 1OAKH 1WQVT 3QPXL 4JFEE 5F8QC 1C5DB 1WZ1L 2AP2A 2KUTA 4YDLC 4H20L 4LOUC 5IW1A 3LN5B 1UCBL 4Q9BA 2QR0B 4NP4L 2WW8A 3QDGB 3TBTB 3FO1A 2FHFA 4OUUB 4PR5B 1WBXA 4XPTL 3RRQA 3V95A 1NMAL 2V7NB 4JY6A 1HSAA 3ZLQC 4ODSL 4MX7B 3HCVB 3MJ8A 3QFJE 2HP4A 1PG7W 4QKXB 1UWXH 3MOQA 3MMEB 1WZKA 5MHSE 3PJSA 3BYTA 1BBDL 4HXAL 1R5WB 1DVFC 2J7LA 5I16B 1MIML 2XQBH 1TJIL 5EU6B 2OXGA 4BH8A 5AG9A 2CXKA 1JTOA 1BX2B 5ICYA 1T4KB 5FECB 5I8KH 4BSWA 4U33A 1JN6A 4P2QE 1MEXH 3QUXB 4M1CC 5HI3D 2DYPA 3BH8B 2VUYA 1N0XH 1GPOH 3QIBB 1RZFL 1TCRB 2D7OA 2P24B 3GO1L 1KB9K 3M17A 1CE6B 5DJXB 1OQXA 3O8XA 1RZ7H 4JHWL 1CL7I 4J23A 5HDQL 4PJGE 4RFOH 2BHYA 4KK8D 5DK2A 3T4AB 3FB5A 1XF4A 4YHZL 3QUYA 2NY2D 3GIZH 5H94A 3BZEB 4XVUC 2GJZA 3QIWB 1S7RA 2DQEL 3O4OC 1MELA 4LHJB 1CDUA 2IMMA 4FZEL 4RZCA 1KCUL 3RIAF 4OKVA 3TV3H 4K2UH 1TZGL 2AV7B 3HNVH 4MMXC 5BW7C 2QL1A 1J88A 4UB0L 1B9ZA 1RZ8B 2BCKA 3L3IA 5KTEL 5E8NA 1A3RH 4JPWL 1UZ8A 3W9EB 5C0AA 3RVVD 2F5AH 5IV2A 3FAWA 1UB6A 2B4CH 2Q76A 3MLRL 4JRWA 4YEFA 4P2RE 1OB1B 1DEEA 3WUWA 2FJFB 4JFPB 4M5YH 4F57L 5JPMB 5EC2B 4IRJC 3CU1A 2EYTA 3E2HB 2E7LC 3P0YH 3O45A 4CVXA 3OG4B 1U3JA 1NGWA 4GO6B 2UYLA 4KTEH 3C08L 2KQNA 2YMXH 4JGUA 1M6OA 2YSSB 1IZJA 4PJGB 2C1PB 4ZOEA 1U9KA 5JDSB 2NY0C 1HHIB 3P4MB 3PQYD 5HHOA 3WUWG 5I6XC 5FYJD 4EI5A 4LCUB 3KYMB 3S4SB 1QYGH 3EJYC 5DTFB 5BQ7A 2AK4E 5C0DA 1A6ZA 5E6IA 1WBYB 2CDEB 5EFIA 4XCEB 1EO8H 4XVTL 4XVSH 2NY3B 3S96B 2OX5A 2P24A 5SWZE 4L8CB 3U30C 1IQDA 5C6WH 5D6DA 3BIBX 1U58B 3AM8C 4E41D 4NSKB 5EORH 1JPGA 1DQQB 3GZKA 4JO4L 4KK9D 1E6OL 1TDQA 1G7QA 1HQ4B 4Y4HC 3TO4D 4BKLB 2VZUA 4PRAA 2IH3A 3QCTH 2R2BA 3K2MC 5CEZD 3U4EA 3ARZA 3WD5L 4U7MA 3BESR 4L9LB 5DHVA 2OR9H 4L4VB 4DCQA 2QQLH 5L9DH 3CFEB 3TIDB 1LQSR 3RGHA 3QUML 5EIIB 3MRJA 3OGCA 4IEFB 4OGAD 1U8OB 1J7VR 3F7VB 4PRHD 5B22A 5EUOE 4OD1L 3U2SA 3HLAB 2P5WB 3LD8C 3HN3A 5D7IA 3BDXA 2O5ZH 2PTVA 3LHPL 1PAMA 4ZFFA 5DZNA 2OL3L 3QDMB 2MNUA 4HUXA 1XGRB 3TVMB 4CKVX 2GITB 1AKJB 3CH1B 3MRCA 4X8JA 4LIQE 4RGMB 4WNQB 4JY5L 3IRZA 5GRJH 3PWPD 4JO3H 4X4YB 1G9NC 2JJUA 3PHQA 5TE7L 5EOQH 5IWLC 2YR3A 5C3LD 4ODTL 5EZJB 1WITA 5DJDA 4FHBD 1IC5H 3O9WD 3O3DB 2NXYD 3SDXE 3RHWK 1B4JL 1LO3H 4UQ3B 4R4ND 1LE9A 2ATKB 5I1KH 2DLHA 2WBJA 4S0SD 3LIZH 2GY7B 5JDSA 1OD7A 2F53E 4P46D 4XCFH 3DJ9A 1D7FA 4NHUB 2NW3A 4M8QA 3TNMA 3BGFC 1SY6A 2R1XB 1YYLH 2IGFL 4LLUA 2PW1A 2VLMD 6FABH 5JW3H 3HC4H 1UWEH 4WU7B 3L3KB 5I18H 3FL7A 1QRNE 3SY0A 4R4BA 5IEHB 4PJ9D 2IANE 4I0PA 2BVTA 4K3JH 5DK3A 4OAWB 4KKLC 5DVMA 5EPMA 2DD8L 8FABA 1AHWC 4NKOB 5A3IC 1FFQA 4HC1H 3PWLA 1DBKH 1YN6A 2WBWB 4QGTA 3GI9L 1MREL 3B4NA 3LQAL 1HHJB 2YHGA 5EZOH 4JO2L 1QHPA 3PDDA 4JQVC 4LIQL 1LEIB 5SWSD 1CFTB 3HRZA 4JAMA 2XTJE 4K9EL 4U1KB 4NC1C 1OGTA 3KYKH 4HBCH 4M93B 4PRIA 4OZGB 2PYED 2OTPA 4XI5D 4FQ2H 4UT9L 3LKSB 2F74A 2XZCL 5F1NA 3A6BH 3L9RA 4JDVA 3DO3A 4DFHA 3IFLL 3G9AB 5ITBL 2W1NA 4LLQA 1I4FA 4UT6L 4PJCF 2VR5A 3IDGB 2A77H 3TO2B 3CH1A 3ALPA 4LCYB 4P4RA 2XNAB 4ERSH 1Q9KB 4WHDA 4WY7L 3CDFA 1BZ9B 5IVNA 5INCB 1JF6A 3LQZB 4UTAH 4JY4A 1EMTL 3Q3GA 4MD5B 4PJ8D 3T65B 4ZO9A 2P45B 1FVCA 2H32A 2ARJB 4WWID 4OCSL 1H0DB 4MNQA 4AMKH 1PQZB 3F7QA 2IG2H 4TVPE 3ZDYF 1KENL 1NFDF 2LU7A 4Z18A 3SE4C 5CEYA 5JHDA 3UTSD 1KC5L 3QIUB 1IQWH 3LS4L 3ROLB 4U6YA 2Z31D 3DWTA 4S2SA 3RDTD 2AQ2A 5GS0L 3O6FC 3HZMA 4NQDB 4NJAL 3QG7H 3X13B 2IAMC 3PHSA 5T3ZE 4L5FL 4QTHB 2DDQH 1YQVH 4Z7WF 1ETZA 4P23D 4ALAH 2D0FA 2GAZB 4P2OC 2EXYD 1NCBH 1U8MA 2VDQH 3LEYL 4OLYH 2FX8H 4L8SC 4V2BA 5HI5D 3ZKND 2F8VA 3BRGC 4M43L 1JBJA 3WXWL 3H8NA 2A9ML 3S6CA 1CFBA 4DZ8B 3VXMD 4TTDC 5I73B 4JRXD 4GOSA 3QULA 4LP4A 5DFVC 5IB5A 1KJVB 3LV3A 3IF1B 3MLUH 2R0WL 1VACA 4TVPL 5GS2D 5IB3B 5D2LF 2XN9D 2E8ZA 5F7LB 3F5WA 1DQDL 2ATPB 3VJ6B 2X4QB 3GGWA 2DL9A 3IJHB 2JK5B 4M7JL 1KN2L 2HJLA 2Q8BH 5CP7A 2YA2A 4HS8H 4EXPX 1DQML 2D7TL 4K07A 4ISVA 5L2JB 2YN5A 2Z9TA 3VXSE 1H0DA 1ADQH 3IVKA 3EOBA 3SCMD 1G9NH 1UJ3A 4WHYH 2JB5H 3K81A 4HWBL 4GMTL 2B2XL 3TC9A 5F89A 1U3HB 5JORB 2CK2A 3KLHD 4WGVB 1MFAL 2GK0B 3F6LA 4WDIA 4FP8L 3BPNB 4GKZA 3MUGB 3ARBD 1OCWL 1NLBL 4YFLF 1DDHB 2UWEB 3JWOL 1AC6A 3U36A 2IADB 3G6JF 4U1MB 5D72H 3U79A 3GEWB 5DR5L 3EYFA 3O0RH 2MMXA 2ZUWA 4Z7NE 1MHPH 3W0WB 1YJDL 5IBUB 1MCFA 4PIRF 4RX4D 3ZL4H 1T03L 1PY4A 4M6MH 3BP5B 15C8H 2Q8AL 2Q86B 1H3PH 1OY3B 4YQXH 2F54A 4NUGH 1BP3B 1J5OH 1WF5A 4WV1A 4OZHB 4RWHA 5JQ6L 1DBAH 2LABA 2OSLB 4Q9RH 3BDYH 2BOCB 4LLDB 5D1QC 3RI5F 2AEQL 5KN5A 1CL7L 4F15C 1YYMH 2QTEA 3C9NA 1F6AB 2ENSA 4GLRH 4U6TA 1A6UH 1F4WL 1AIFA 1NLDL 1ZMYA 5E7FA 2P43B 3QNZA 2YD1A 1I9IH 1VFBB 3SKMA 2UVFA 4M3KB 5KS9B 4BK5A 3WIFA 2IPKA 1ZHKA 3F12A 4XGZA 5CLWA 4PJDE 4LVEA 4JG1L 4PUBH 3LKQA 1JZ2A 1F13A 2X4QA 5LGJA 1IT9H 4M9OA 3MRMB 4YHKL 5FGCB 5L2KE 5F8RC 4QOKD 3OX8A 4OCWL 3EOAB 5EBLA 5DQDH 2NTFA 5C9KA 2W9DL 1K9TA 1FYTD 4LCCB 2GFBB 2H3NB 5DJ2B 3ARGB 3Q5OA 5KZCD 4FXKA 3KXFD 2WMPA 3BISA 3HE7B 4JDZA 2ZG2A 5D7KD 5FHBH 5KAQG 1LMKA 3SJVB 4ETQA 3NZHL 3WO4C 1HH9A 4XMPH 1RIHL 3RVUD 3ZDZF 1FZJB 4RGNE 1GGBH 4NWTH 4D8PA 1FO0L 1QLFA 3IGAB 4ZS7H 1FC1A 2BHZA 3ESVF 4GFTB 1XIWA 4KRPC 4R0LB 1W2KT 1NMBH 1DDHA 4MCZA 5EZLB 1D6VH 2NW2A 2UWEA 3KGRA 4NO2B 4Z78B 2XIDA 5C09E 1CE1H 1BAFL 4PJ5B 1VDGA 1L7IL 3OXRA 3NAAL 4F8TA 2RB8A 4NCC2 1MCOH 3LVEA 5CP3H 3C6LA 4X6FB 1Q72L 3RWEA 4NZTL 2WIIB 5GRXG 3STZA 5CCKL 3WFHB 2IH1A 2XXMB 1TJHH 3N0PB 3ZHLA 5F7EH 4HIHA 4HUKB 3L7EA 1BD2A 1IGFH 2YKLH 4NOBA 1T1WA 2W0FA 4M7ZC 1YEEH 5I15L 2NY5C 2ZCLH 3PQYE 4LNRA 3WNMA 2PKDA 3I2CL 3U9UA 1NEUA 1A7QH 4X7EC 4QHMA 4RGNB 5IBUG 3S3PA 3U0WL 3MRFB 2EDLA 2XOTA 1NC4A 4AEIL 2EC8A 3IAGC 3NIGF 2CD0A 3MNZA 2XQYK 3STBA 2DQCH 3BN3B 5E95B 4AL8H 3QEQD 5A43C 3GSOB 5C0CB 4WCYH 4OZIB 3HG1A 1DBML 4OM1L 4P59H 3GKZA 2P42B 1OP3K 1L7TH 3HKFA 1JIBA 3TN0A 1KT2B 4UV4L 2MTPA 3LRHA 1OT2A 4KJQC 1ZLSH 2FZ3B 3C6SA 4MQXD 3LOWA 4QRUA 5EN2B 2F19L 2WINB 3MV7A 1QSVA 3B2VH 3SJVA 4G8FA 3DX7B 2Z4QB 5DC0A 1NC2A 4PY8J 2BK8A 1MFEL 5MEPB 4CGTA 2OTWA 4AG4H 5J06A 1JHKL 3S35H 3SE9H 4MAYC 5IQ9A 3B9EA 3SOBH 1NEZA 4Z7QE 1MRFL 5FF6B 1I1AA 4PJXE 2R0LL 4XNXL 4A2LA 2I25N 4JFFA 3HZKB 1X4YA 3PWPE 2YPVL 1K6QL 3EDFA 3B6SA 2RAMA 1RJCA 2VE6A 1DBJH 3U6RB 2FBJL 2GTZA 5DEFA 4XWOD 4F9PC 1BPVA 4Z77A 3UTTA 3ESUF 4RISL 2VXSL 1T5XB 4A2MA 1RU9H 2BNRD 3MUJA 4K71C 4WI3A 1P5UA 1NEZG 1KXTB 3QPXH 4ELMA 3OHXA 2HMID 3O3BB 4U1NB 1KB5A 1JZ4A 1XF1A 2PYFB 4HUVB 3BXNA 1P1ZB 3CLEL 4H20H 2OP4L 3ZYOA 3FT2A 1UCBH 4MD4B 3U7WL 1EUTA 3D2UA 2IPUG 3ALXA 4FRWA 4XPTH 1NMAH 4FFZL 1A6WL 4ODSH 1QSFD 2P46B 3IB4A 2QADC 4PRNB 3KNBA 4I9WD 1G7LB 3BUTA 3OF6A 3W11C 5DRXA 4HXAH 3PV7A 2C9AA 2Q3ZA 1A7OL 3L5XL 4GJTB 1MIMH 1TJIH 3VXRD 2HVJB 3MOBL 4HKJB 3DLQR 3TBVA 1CGYA 2H9GB 4Q7DA 4UIMB 2CDFB 1R0AL 1EFQA 4WI4A 1LP9B 1QSEA 3FQTA 3GSXA 5ALCL 1A1MA 1JCKA 2Y5TA 4ZUTB 4I0CC 1CT8B 1RZFH 3GO1H 3LQAC 4LU5L 3CMOL 1A9EB 3KG5A 5BV7L 3V0WL 3O4OB 4WRLA 3ZE0F 4JHWH 5IB1A 4K9EC 4LFHD 3EDJA 5T1KD 2NY1D 3ARWA 1NGYB 3MV9A 5HYIA 2R4SH 3P9LB 4JN1L 4YHZH 1OWRM 1DFBL 2HT2C 3QO1A 4C56E 5B4MC 5EBWB 2BERA 3IJSB 2DQEH 4M00A 4LASH 4FZEH 2VZSA 1KCUH 4H26B 3TYFA 1OSZB 1P9MA 3MYZA 1TZGH 5IK3B 4OM0L 5IMOB 1BECA 4UB0H 4OF3A 1IARB 2D7PA 3KPRB 4JPWH 2X70B 1JGUL 3KPQB 1JP5A 4TSBL 4U3HA 2VDKL 1GJIA 4HKXB 3BP6B 5J6GA 4GG6F 4HFUL 5EB9A 2Q7YA 4OD2A 4F57H 5HYEA 5J89A 2NY5H 5HJ3A 1JNHB 4S1RL 1DVFA 4K3HA 4XH2A 4XNZC 5C0JB 4HS3A 1XR8A 4H1LH 5C3TA 1RK0A 4QRPE 3TBYB 3WBDA 3VD9A 3GJFK 1JZ8A 4UNTA 5CSZB 2NY0B 2ORBL 2CR6A 3C08H 4Q6IB 1IEAA 4WW2C 4LP5A 1N2RB 4IOFD 4F8QA 2XTJC 3NTCL 1TQCC 5K9OB 1J10A 4ZPVA 1JHLL 3H0TB 4HC1A 1VFUA 5KSBB 5D7JC 1HDMA 4JFOA 2B1AL 3F8UB 4HIJB 1CF8L 4Z7VA 2QQQA 1LEGA 1AC0A 3TWCH 3EIFA 1IAIM 4GBXD 3GSNL 4G9DB 3I84A 4M7KH 1WTGT 4PLKD 4OZ4B 2VDRL 2B0SL 1VEMA 5KANG 4HX1B 1SMAA 2XZQL 5I1DB 4U1HA 2FJHB 3W39A 1EX0A 3VXOA 3GSRB 3IKCB 4QXTB 5AUMB 3CFKB 3KPNA 3ULUF 1E6OH 3VFMA 3UPAA 1VKXA 5E8DL 5J13C 2DM3A 4EN3C 5BW7A 3RNQB 3RWJB 4DFIA 4N0CD 3OMZA 4QRPB 1WICA 2BJMH 3LD8B 1KSRA 4BZ2H 3PABB 4JPIA 3QUMH 3ZKMC 5HDOA 4G6FB 1C08A 1T1XA 2VSCA 4MVBD 4PREA 3RUGA 3ZE1E 1YEGL 3QDAA 3MLPA 3SKNA 1S78C 4HAGA 2BNUB 4IRJA 3VWKC 1B88A 3LHPH 2E7LA 2OL3H 4NFDA 3BP6A 1PVHA 3V2AR 1FZKB 2XWTB 4YIQA 4GAGL 3ARFD 4YPGA 2FYYB 4U3XA 1RUAL 4JY5H 2GSIB 1TTUA 1EJ6A 3C5ZA 5C0JA 5H35B 1J1OL 3K1DA 5TE7H 3TBSA 2JCCB 4CL7A 1NBYB 3VFPA 3CSPA 5SX4H 1VENA 3L3GA 5D5MB 4YNYB 3QH3B 4HPOL 4GS7B 1P4BH 1SYVA 3QAZB 5F7HA 1B4JH 3BGFB 4HCRL 4U7KA 5JXED 4F7EA 4IRSD 2UY7A 5H2BA 2YPKB 1LDPL 3B9DA 5L8KB 4GRWE 4M62L 4Z76A 1FNEB 5F9DC 1YJDC 3O81A 4Z8FH 4OFYA 3MLWL 1MH5A 5B8CB 5CD3A 1MLCA 3CDCA 3LKRA 2XV6B 1MSPA 2HAZA 3ZYZA 3D5OF 4BJLA 4OSUH 2X4PB 3QCVL 5FV1L 4LAJH 4Y4HA 4PY8I 3MQIA 3VRJB 4ZUWA 4NO0A 4TRPH 5HHQA 4GQPH 2VITA 1L0XA 2DD8H 2VLJE 1IAKA 2DTSA 5FO8A 4HW6A 1OWWA 3GI9H 4IS6A 3QQ3A 1MREH 3FFDA 3LQAH 3MREA 3TA3A 4JO2H 2WNGA 3U4BL 2IPTL 2HT4D 4LIQH 4EVNB 1CR9L 2Z92A 1EEYA 3GBML 1N64L 1FYTE 4K9EH 5DGQA 5DRNA 2APFA 1JYXA 3BFOA 4IRZL 5EUKB 5BO1H 4RQQB 4UT9H 2C3VB 2XZCH 3GHBH 4C57C 3FOLA 1RZIA 4GW4A 5HSFA 1T20B 3IFLH 3Q5TA 4X7CC 1YEJL 1ADQA 3WEXB 1J18A 3QNYB 3SGKC 3T3ME 3C60B 4D3CL 5ITBH 1NCWL 3P4NB 3O3AB 2LTQB 3KAAA 4ACPA 4WENB 1Z6JT 1GVIA 4UT6H 2XWBA 5IWLA 3KYNB 5E2VL 3D3VA 1W0VB 1TPXC 4NT6B 4ONHB 4R26L 5E03A 4WY7H 4X6CB 2ZWLT 5EU4B 2BSRA 3QWRA 1MFCL 3PGFL 1EMTH 1K8DB 1NDGA 4N5UA 5FIEA 2QKIB 4OCSH 4JJHA 1LWRA 4NPYA 4QRQA 4LPTA 4LSTH 2FIRT 1KENH 1FE8L 2BNQE 3O6FB 1Q1JL 2DF3A 4WHYG 3NZ8B 2KL6A 3LS4H 4F33B 5HHXL 4FFYL 3WN5B 1P6AB 1IM3B 4ESKA 4OBRA 1AHWA 4OLXL 2ZCHL 1RJZB 5HI3C 4NJAH 3ECBB 3IFOB 4L5FH 4DOHB 1JPFA 1ITBB 3LMJL 4JQVA 3FT3A 4YDVB 3B83A 4JRYB 3HA0A 4E42A 1ZLUK 1JMZA 3MRLB 3VFGL 4QY8A 4OB5L 3VMNA 5I1LA 3LEYH 4JFQB 4OIIL 1KEML 4KK8C 2NMSA 5DD3H 5DD6B 3HRPA 4XAKE 2D03H 5TPWL 4GG8A 2NY2C 5CHNB 3FN0L 1X5AA 2A73B 4G7YH 5E0QA 2CDGA 3I02B 4M43H 5CSBA 3EZJB 3WXWH 3MRPA 1F3DJ 4ODWB 5IIEB 4PBVC 4Q2ZA 5JW4Q 2AKRA 3DROA 5DWUL 5F7WC 3FFCB 2R0WH 1U8JB 2D3VA 4TVPH 3PWVA 5T1LD 1CFSB 1ONQB 3RVVC 4CBPA 2OJEA 2L7UA 5SWQB 1DQDH 3IDYB 5HYJD 2JJTC 3D85D 1OHQA 1JUFA 4HZLB 3P9MB 1LO0L 2R56H 5BZDB 5IW6A 4M7JH 1KN2H 3V5HA 2EXWD 2IFGA 1DQMH 2D7TH 4WVRA 1J0HA 1A5FL 3QDJE 2NX5E 3S8WA 5ITFA 3OKEA 1AQKL 3PWJB 4KJYA 1UKSA 3JV4B 5CP3A 1CG9A 4GMTH 4V1DD 2B2XH 1TZIA 3O6ML 5A2JH 1I9JL 4NUJA 5C07A 2IAMA 4FP8H 3ZKXB 1HSBA 1NLBH 3E6HB 2ICES 4P2OA 5ACMA 1K4DA 3LKOB 1VFAA 5DR5H 2J8HA 2Z93B 4HFWA 3GIVA 3I6KA 1NKOA 1YJDH 4L8SA 7FABL 4NQCD 2V2XA 1FG2B 4S11A 4RAVA 1T03H 2DQJL 1FJ1B 1U92B 1FQ9C 2Q8AH 4M6NH 1G84A 3H3PL 4F7PB 4XNUL 1OM3L 2XT1B 5HHNB 4KK9C 4I9WE 5DD6A 3KJ4B 3TO4C 5D2NC 1FNSL 1T04B 2A73A 4MJIE 3FN9A 3S98A 3VI4F 3S36X 3X11B 3VXRE 2AEQH 1IE5A 1OLZA 4X9IA 1IGTB 3MBEB 4N0YL 2ICCA 1PZUB 1NLDH 3T2OA 4JEGB 4YLQT 4PBXA 5E5MA 4NDMA 4PJFB 1IVLA 4LVHC 1J0JA 3VFNB 1KPUB 3ROOB 1WCBA 3RZCC 3KPSA 1F6FB 1M71A 4JG1H 1YEDA 2D7NA 2M26A 2C4XA 4KJWD 3VFWB 1GZPA 5HXMA 1FGVL 3BE1H 4YHKH 1B2WL 4DKEL 1WFNA 3ARQA 3MGOB 2JIXA 4HUUA 4R7DA 2A6KB 4OCWH 3WO4B 2EDHA 1QHOA 4Y2DC 1UEMA 2W9DH 3VG9C 1S7SA 5I8CB 1T3FB 1AGFA 4KRPB 2COQA 3FHQA 3O9WC 2BVOA 2DI7A 1H8SA 3PWJA 2NXYC 3NZHH 3OBAA 3D39A 4R4NC 3O8XD 1FO0H 5BV7C 3REWA 5DA0B 3LRGA 5FM5O 1VSCA 4NN6B 4S10A 5F9JA 4IIQC 4P46C 1S7VB 3TT3L 2Q3AA 3SDDC 3QUYD 1PSKL 4RWYL 1CGUA 1BAFH 4QYOA 1JYVA 3TJEL 3NAAH 1K8IA 4PJEA 4MQ7B 4F7MB 2R2HB 4KC3B 4PJBF 3RGVB 3HPLA 5MENE 1JFQH 4MMZC 5IEKA 1Q72H 2Y5EA 1N59B 5D1QA 5CCKH 4BSVB 4M7ZB 4QHLB 4X98A 1WT5C 5C0AD 1TVHB 2EC9U 1PKQE 1SEQL 4JG0L 2J8UA 2WANA 3O6LL 4GMSL 4UILL 4UQ2B 1T0NB 3QHZL 4PTUB 2VLLB 4NNYB 1UEYA 5IMMB 5I15H 2EDYA 3WL9B 5C0BB 1A6AB 5DURB 5J4MA 1U8NB 1HKLL 1ND0B 3TEUA 3I2CH 4PJAE 2EKSA 5TF1L 2E9JA 1YNTA 4U2YA 4MA3A 2GW5A 2UZIH 4M6AA 2CLRB 3L95B 3BQUC 1F90L 3BRDA 3ZO0A 5FYLE 4OLVL 2B8OT 2CUMA 3GMLB 3QZWA 1DBMH 4OM1H 4X6DF 4PG9A 4PJCE 4MA8L 4Y88A 5E8PB 5HHOD 2ID5A 3O41A 2DBJA 3LZFL 2VLKE 4EI5D 4UV4H 4PJ8C 4BFEA 2OM5A 3BP4A 4PV9B 4JFEA 3WHE1 5E6ID 2G5RA 4G9FD 2P8MB 4MDIB 3VG0L 4AH2B 1XF3B 3V7AE 1U8IA 1MFEH 2XY2A 3ZDYE 3BRFA 3UDWC 2XKNB 1JHKH 1NFDE 1SMOA 1DLHB 5FB8B 1NCDL 2Z31C 3QZWG 3QFJA 4HH9B 4QRRB 2C1OA 1WTLA 3MRKA 1BREA 1MRFH 2YUZA 1JNJA 3MTRA 4CU7A 4XNXH 1KNOA 2C4FT 5JW4N 2DM7A 2VH5L 4ORGA 5DMKA 1MI5E 3LEVL 1MWAL 4ZNEE 2BSSA 3QJHA 2CIIA 2YPVH 1IL1B 4P23C 3GJFB 2W60B 1OF2A 3SKOA 3UZVB 1K6QH 3RL2A 2EXYC 4AIZB 5I8OL 1J8HA 4K71B 4Y1AB 2I26N 2VL5A 1N5YL 4AK1A 2FBJH 1I1YB 4Z7WE 2FIKB 3PGCB 2B20A 4P2QA 4TN9A 3CMGA 5IB2B 5FYLL 1HOCB 1FZMA 3BPCB 4H1LA 4PJCB 5EH1A 3QEGL 1CBVL 2XPGB 4JFYA 3B9VA 4NRXA 5EG6C 4PGBA 3RPIA 5HI5C 3NCEB 3ZKNC 2VLLA 2LVCA 5I1AB 3IAPA 3U46A 2N56A 3KR3L 3VFRB 4LCWB 3O4LE 1SQ2N 4Y5XA 1DUZB 4AEFA 1BF8A 3MLYH 1C5BL 3VDAA 5CEZH 3QCUL 2OP4H 4KUCF 3U7WH 1CI5A 2LV4A 4GRLD 5D6CB 2D9CA 2DLFL 1A6WH 1T5WA 2IQ9L 5D2LE 1G0XA 1EXUA 4G8GB 1D3CA 3IDMB 2OI9C 2WBJD 4H1LG 2X09A 2RJMA 1ED3A 3VXQB 2YRLA 3L3OA 1HZHL 3V9FA 4HV8A 3AB0B 1A7OH 3L5XH 4H0HB 2YPLB 3RPKA 2R69L 3MOBH 5I2IB 2G5BA 3BIAX 4ZNCD 2AXFA 4X0KB 4MAYA 4M02A 2IFFL 2VR4A 4P2RA 3AROA 1R0AH 5E1HB 3E3QC 5CEXB 4I0PD 1Y6NR 3OJDB 4HGMA 3KLHC 1RAMA 1CDYA 2H2PC 2DI9A 3OKLB 4HLZH 1HN1A 3WHE0 3DURB 4ZXBB 4CVWA 4KROD 3QUMA 4Z0XA 4XP6L 4LU5H 4A6YL 5E94A 3CMOH 3ABZA 5BV7H 5FYKU 3IDIB 3V0WH 1V7ML 3I75A 1X5IA 4PS4L 2X4TB 2P5EA 1FP5A 4PRID 5GGRB 4F9PA 2GIYA 4U1LB 3BGMA 3O3EA 1JF1B 3MCKA 3Q0HA 2OL3A 3G6JE 3RVWC 3UTZA 1DFBH 3NCFB 4KTYA 2BY1A 1KBGH 5E2TL 3NOIA 1U8KB 4H0GA 3DVNB 3ZHKA 1NDMA 1RUML 3RWCA 3JVGC 4L3EB 2AK4A 2VDML 4OM0H 2XG4A 5HGAB 4HPYL 2CLZB 4RAHA 5F88A 2DJUA 5FM5M 5SWZA 4TSBH