1Q9KB

S25-2 fab unliganded 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-2 Fab (IgG1k) light chain
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9kB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9kB01
1YNLH 1RUMH 1TLKA 3IDYC 5ITBL 1YJDH 3BZDA 3IDGA 2R2BA 4OUUB 1KEGH 4M7LT 3MUGB 3B5TA 5GZND 2A6KB 3N85L 1T6WA 5IFHL 3WO4C 2KZWA 2V7NA 2VLKA 3KJ6H 4L8BB 4J23A 1YQVL 4MZ3A 4JFPA 3P0GB 4OBSA 2X4OB 5H94B 3P9MB 5DHYA 1Z5LB 3T65A 2BDNH 1ACYL 4YK4C 2AJZB 5GJSL 4X9IA 3U6RA 4JN1L 4B53A 4MQXD 5D2NC 1SM3H 3WFHA 5FO8B 4G42A 4K94C 1ITBB 5AYQA 5TPWH 5HYSG 1MJ7H 3IDGB 2R2BB 4OUUA 1ETZB 5FECB 5IHZA 4Y4KD 5B8CC 4MAYA 1AC6A 3U82B 2J8OA 1Q1JL 3I2CL 3HZVA 1V7NL 1WTLA 4M62H 3MRIA 1T7VA 5L0QC 3LQAH 3O6MH 1NGYA 1JWUA 1Z0NA 5HGBB 3P9MA 5DHYB 4JY4A 5ADPH 4K3GA 1CCZA 1IGJA 2YUXA 3SDXE 3U7AA 2DL2A 4Q6YA 4ZUWB 1Y6KR 2VLME 3B4NA 3UJJH 3T8XA 4N0CD 3LHPH 5BOPA 4OFVA 4KK8C 1MJJB 3CDFA 3ZE0E 3UC0H 3CSYA 3MR9A 3ISWA 4Z18A 1A7PL 4I3RL 4OFYD 3TN0A 3ULSA 4M6AA 4YIQB 1CGWA 4PP2A 1A47A 3S8WA 2H3NA 4OLYH 5HHOA 5GJTH 2FD6H 5HYQB 1CQKA 1MUJA 3TM6A 4LPVA 2VXTH 4XTRD 3DPBA 3MRLA 4U2YA 1NGXB 4AMKL 4IHOB 2VLJA 1MAJA 3SDYH 3FQTB 2HTKC 1NDGB 3QIUD 2UZYB 1EO8L 2YD2A 4HK0A 1J0ZA 1HEZB 2L7UA 2FSEA 5CINL 4RRPA 4HIIB 1AQKH 2R1YA 3KYKL 4UV4L 1BEYL 3QIWB 4YIQA 4KXZH 2VDLL 2ZG3A 1LK3L 4HQQH 2J12B 3IFPA 3WJJA 2V5TA 3RZCC 5HYQA 3EO0B 4X9GA 4MCZB 2XZCH 5KSBA 2VLJD 4OGAD 1KGCD 3IU4L 4JKPH 2B4CL 1HHKB 4PJBA 3ROLB 4ZXBC 3W9EA 1IKNC 4UOJA 4GRLD 3C08L 5GZNC 1X5IA 2H1PH 3QDGD 4FQIH 1HEZA 3VFUB 3KS0J 3A6CL 1A3RL 5F44A 1U3YA 3BQUB 3VXSA 5CP3H 5IEHB 5EOCJ 2GQHA 5MERB 5I16B 1OPGH 4R7DB 3V4PL 4WCYL 1CFTB 4FMKA 5D7JC 4PGJA 5DMGD 2R8SH 3MLZH 1MCFA 4CMHB 2DLFL 3NIFF 4AEFA 3QQ9D 4ALAL 3B9KA 3D69B 1Q9WA 4FABH 2AK1H 1NKRA 4EKXA 1X6LA 5MHSE 5E8DL 4D9RD 1GJIA 1MHCA 3G04A 1UM4H 1JRHL 4HFUL 4OV5B 4PJ8B 4ZD3H 2IPUK 1RD6A 4QTIL 5JORB 2ZSVA 3NFPA 3MV9D 3OZ9L 4M62L 4OJFH 3FB7A 5TQ0H 4N0FB 3R1GH 1YMHA 4JO4L 4RAVB 1QYGH 1MCCA 1PG7W 2VQUA 4PG9A 3TIEA 1HI6B 3QI9D 5D7IE 5BS0A 1T2JA 4R2GD 4G8FA 4TUOA 1O7VA 5BRZB 4XH2B 3EYVA 1WFNA 4PJCE 3REVA 1FO0H 1MIEH 1HOCA 2ZSVB 5EBLB 1QFHA 1LEIB 1TQBB 5CZVL 3UTSB 1S7TB 2DQHH 1PZ5B 5D1QB 4OZFB 3DVGB 3B6SA 4YX2H 3UBXB 1LEKB 4Y5XB 2X42A 3KG5A 4LCCC 4X7DC 3HAEB 1D5BB 4PJ7A 5E03A 3KPPA 2QR0A 1HOCB 1MRCL 4H26A 5I75C 1WICA 3PWNA 5LAXB 1RFDL 5SV4A 4YPGA 5DFVC 5E8PB 5C0EB 1ZT7B 4Z7VF 4L4TD 1D9KB 2X4NB 1T80A 1KCUL 4DTGL 1BX2B 4Z95H 1ONQA 2D7OA 4KKLC 2CH8A 5MEQB 2W9EL 3ESUF 3TN0D 5EBGA 4NZDA 1DQJA 2EDQA 5HHOE 5IFJA 4FQCH 3P0VL 4WRLA 2R4RL 3TCLA 3QZWB 3PQYD 4LHUA 3S3JA 4H26B 3RUGA 4M8QA 5C71A 2R56H 1A6ZA 1TZIA 4MGXA 1BBDH 5E8PA 1RZJH 4BH8B 1AQDB 5LQBL 1N8ZA 1HINL 4HUUA 2YS4A 5JW3L 4Z5RB 2CXGA 3BO8B 1S9KC 3VDAA 3K4ZA 3DGGB 4I0KA 1DQJB 2C7UB 3PWJB 4DK6A 2X4PA 1UVQB 4RIRA 5GGQH 4X4ME 2UUDH 1AO7A 3WN5C 1XCTA 1TCMA 2MQ3A 3BP6B 3ARWA 2C1OB 5D7SH 5HPOA 2E6PA 4XP4L 3KWWB 3CVHA 3JSSA 1T3FB 4Q6IB 4NZTH 5GGTH 2EO9A 3MUY1 2WWMC 1JPGA 2IG2L 5JPNB 1U95B 4XNMA 4YHZH 1UQSB 2F19L 4IEFB 5E6YA 3C8KA 1FZOB 1OP9A 3EJYD 1HILB 1ZHLA 1VFAA 1H5BB 4QRTA 2VZSA 1OSZB 2HKFH 3GSWA 5MP6H 1WLHA 3FQXB 3IVKB 1INDH 2H32A 3DV4B 3CZFB 1F3DH 3DROB 3UMTA 2EDBA 1IAIH 4MJIE 5I8CA 3HUJE 4I4WB 1CYGA 5D2NE 3VFPA 4Q6IA 4ODTL 1L7IL 2XKNB 2B7DT 3OXSA 5AYUL 2BOBB 5SWSD 4MD5A 3KNBA 5T1MB 3MJ9H 5E4EB 1UB5A 1KENH 5AWNH 3WLWC 3ZHDA 1RU9H 4U7KA 4LCCB 1G6RA 3S37L 3CDCA 4YFLI 2ZSWB 2DYPD 5CZKA 1X5KA 2H32B 1MCOL 1U8IA 1OD9A 4ALAH 4XC3L 1NMCC 5BW7C 1Z9OA 2CDEA 4L8SC 1AI1L 1VPOH 4WEBH 4OLVL 4TPRL 3D0VB 4U1LA 2VIRB 3TYFB 5ICYB 2JJTC 5JQ6H 3UBXI 1UB5B 4GW1A 4MVBD 1NAKL 2EYSA 1UXSA 2V7NB 2VLKB 2AP2A 2W9EH 1JNLL 4OF0A 3B3IB 4S1QH 4DAGL 4GOSA 4FFWD 1FL5B 3ECBA 2F9BT 2Y36H 2IC2A 4L8DA 3HE7A 1BD2A 3WUWA 2MOVA 4CDGC 4IRSA 3MLXL 3DBXB 5HHVL 4IOFC 3QUZD 1JNHA 1CE1L 2IPUG 2YSSB 2VO5A 2RQ8A 1MFEH 4R26L 1OGAA 4M48L 4XXCA 4X4ZA 4Z7WF 1I7TB 1MVUB 4P0DA 3U1SH 3IAPA 5I18L 1DP0A 4NUGH 5JW5B 2EYTA 2NY2B 1KPUB 3MRJA 4D3CH 1N2RB 4L8DB 2FHFA 3MJ8A 3RNQA 2WLZA 1A4JA 1KJVB 3I6LD 3CK0H 3MC0A 1BQSA 2BVOA 5BZWA 2DM4A 1VA9A 4JN2A 1P4IH 2DMBA 4WIQA 3V5HA 2P8PB 3H9SE 2B0SL 2RCSH 3DJ9A 3MR9B 5D2LE 1O7SA 4LGRB 4OLZH 2SEBB 4RMVA 1E6JL 5GRJH 2F54A 3F8UB 2HTLD 3CD4A 4MD4B 1N2RA 2FATH 4JPWH 2J88L 1KJVA 3PABA 4IHOA 3U4AA 4LLDB 1N5AA 2Y25A 4P46D 1WFOA 3QJFA 3X11B 1BGXH 2I5YH 2YA2A 1ITCA 5MEPA 4OQTA 2IANA 1PDKA 5CHNA 1SY6A 4AIZB 4HUXA 4N0UA 2GCYA 1A6AB 3IFNL 2R4RH 2CRYA 2UV3A 3D25A 3IJSA 5GS0D 3WN5A 3D0LA 4MD4A 5HDQL 5C07B 1LO2L 3OR6A 4KRNA 1LK3H 4X80H 1H8OA 2LAAA 3FOLA 3PV6A 3NGBB 5D1XD 4YHYC 5SX5K 1MAKA 3BP7B 4U6HA 2YK1L 1A2YA 3HG1B 1FG2A 3FQRB 4EUPB 5IP4A 4YBLB 5IEHA 5F1OB 4X7SL 3ZDZE 3D0LB 5I8EB 3A6CH 4ODUB 4R7DA 3FN9A 3GI9H 4LVNC 3LB6D 1G0DA 4J3XA 5H37G 4RMUA 1HHHA 2M26A 4OFIA 4RISL 5CIPA 3QXUA 5D96B 4ODSL 2EH7L 1C7TA 1V7ML 2KL6A 1S9XB 4PJDB 4WO4D 3S6CA 1K9TA 1JHKL 2BRRL 3AY4C 4KKCC 1A2YB 3HG1A 1UZ6F 1QFOA 3G04B 1FSKB 3T0AA 1IC4L 4MDIA 5EU6A 1N6VA 1N5YH 2QV2A 3S96A 1HKLH 4KTDH 1T66C 5DHVH 4KJPD 5MP6L 1S7VB 2CJUL 2R1WB 4Y5YC 3KYOB 4JEGB 6FABH 2YA0A 2ORBL 4XB8A 1UH2A 1MHHB 3HI1B 4NUGL 3AMKA 5IGXH 1V7NH 3QRGH 5CIPB 4PGEA 1IMHC 5CMAA 2VAAA 4LKXB 3STLB 5IB4A 4OZGE 5HGAB 3QCUH 4S1RL 1FFOA 2WZPD 3O6FD 2Y7QB 5E4IA 5KVGL 4MDIB 2MQCA 3C6SB 1PKQA 1KLUB 2VWEC 4RWHA 3RY6C 2P24A 4ZFOL 4K8RC 1BFTA 2IFFL 3I3EA 4FZEH 2Q7NA 5C0CB 3RL1A 5B4MC 5GS2H 3UJTH 4ODHL 1QBAA 3QULB 2YMXL 3CDYA 2OCFD 4N8VB 2VAAB 4LKXA 3SDCD 4WHYG 3FQUA 4L1DA 4KRLB 5DD5H 5TF1L 2V5YA 1MCJA 4PJGA 4GRMB 5DA4A 5E56A 4LF3A 1ZS8A 3F7QA 4TSAL 1I1FA 2VABA 1IFHL 4WO4B 5DUML 2CRZA 4NM8L 3V6BR 3Q5YA 1C16B 4CJ0A 1CFSA 5IW6B 3KPPB 1SJHB 3G5VB 4P2QE 4OZGA 1D6VH 4HJGB 3MGOA 5EIVA 1T4KA 4PREB 5KSBF 2ARJB 3VXRE 2ZCKH 3MGTA 3DVNA 3TT1H 5HDQH 1GGIH 3A6OA 1NBYB 4NQCB 4O00A 1U8PA 4GRMA 4OQTL 5ILTL 3FHQA 4XNUH 5J4MA 2XNAB 2DTML 3VH8G 4MNQB 2CLZA 4NFBA 1I1FB 2VABB 4PJEA 4YHOH 3BH9A 3L7EB 4CMMB 2I27N 3CLFH 1JGVL 3V8OA 5I66B 4LL9A 1L0XA 1FL3A 3C2AH 3LQAC 1KLGB 4UV7H 3IRZA 1JPTL 1ZHBB 2VQ1B 5J9PA 4HGMA 4ZOEA 1QRNE 2IF7A 2C3XA 4M8QB 3O6KH 1R3HB 3LB6C 1T20B 4ZS6C 3HHRB 3U7YH 2YD3A 1U8PB 3WNNA 3MROA 1OTTD 4Y4FB 2R1XA 1MFCH 1MRDL 2EE6A 3JUZA 3T77A 1A6VH 4J7RA 5I66A 4JM2A 1K8DA 4C54A 3QCTL 5EZJA 2FEDC 1QPXA 5SX4I 3GSQB 1NC2A 2A1WH 1B0WA 1W8OA 5EOTB 2OI9B 5LXGH 1PJ9A 3KWWA 3CVHB 4KY1L 5E2WH 3JV6A 4NC1E 4DW2L 4UU9A 4XPGH 3MROB 2VUYA 5FYJE 3MXWH 3IDYB 2FCBA 2XZQH 3QT2A 4HJ0C 5IHBA 3HMWH 3RNKB 5BW7A 2PKDA 3D48R 4C83A 2A83B 2ILLA 3CX2A 5GJSH 4MNQE 3REWA 2I9LB 4APQB 3HN3A 3FQXA 2QADD 4HUWB 1T66D 1VGKB 4R8WL 1IEAA 4RDQG 4MJID 1Y0LA 3D39E 4UU9B 3MLUH 1FPTH 3OJDA 4MX7B 4X4MA 4NN6C 3G6DH 4KMQA 3P11H 5EG6C 4PJXB 3GHEL 2DKMA 1H3VA 3LSOB 2CMRL 5BVJA 3O3EA 2XWTA 4GRLB 1JIBA 1KG0B 1JPSL 4P4KA 2UY7A 4QWWC 1BF8A 3TO2A 4NQUA 3QWOA 4N9GB 4NQEB 3D3VE 3E6HB 4PLKC 1MFBH 3FZUC 4XWGH 4DGYL 4P4RA 4LU5L 1Q9KA 1U8IB 4I9WE 3FHAA 2EH7H 1F02I 1Y0LB 1PAMA 3N06B 1PQZA 2R0KH 4FQJH 1JI1A 3TJEL 3QBTB 3CMOL 5I8KH 4JFFE 5IKCB 4XC3H 3D0VA 2A9NL 1RUQL 5C6TL 5C0AA 1WAAE 1A1NA 5KAQG 3ALXA 4ZPVB 2V17L 4RBPH 1M7DA 3JV0A 1KB5A 1P2CA 4NQEA 3RQ3A 3DV6A 1ZA6A 3OB8A 1JGVH 2IGFH 3JXAA 4L3EE 4RFNC 5E2TL 3ARDA 2XN9B 3OHXB 4LLQA 4GAYB 4PTUB 4EI6A 4IOIB 1JI2A 1UKQA 4H20L 5CWSB 4UILH 1I9EA 3SDDD 5I1KH 3RGVB 1OCWH 1G7HB 1PLGH 4X6CE 3KXFA 2EIEA 4CKVX 3OV6A 1S7SB 4KI5C 5DR5H 4ZPVA 2OQJB 3OAZH 4XBGB 1O0VA 1TNMA 5C1MB 2EE9A 5FA3A 5C08D 5JW5A 2HTLC 3F62A 5JHLH 4Y19D 3WE6B 1JHLL 2NYYD 3DURB 2HVKA 3EYQC 3MV01 1GZQB 5H35B 3CFDA 2FEEL 1QRKA 2PR4L 1G7HA 2DIBA 2G9HA 3DX6A 32C2B 2X4QB 4DZBA 5TFSL 4JFDD 3QNXA 3V4PH 1VCAA 5TE6H 1T7ZA 3MJ9A 1P5VA 5I8OL 2G5RA 3BSZH 1I85C 1D6EB 2F54B 4JKKA 4FQLH 1D5ZB 3PQYB 1BM3H 3PL6D 1CL7H 4MS8D 4ONGL 1S9WA 1A1OA 2NY4C 2VLLB 3S35H 4OGYL 3OKDB 3MODH 3BDYL 3BZ4B 4LLDA 4XC1L 4M6NL 4HFUH 5T3ZE 1YEHH 5DRZB 32C2A 2WUBH 2EEAA 5EU7E 1D9KD 2R29L 5GRXG 5CHNB 4AIZA 3O2DA 4WDIB 3ARQA 4M61A 4LMQE 3GMPB 4OD1L 2NZIA 3UYPA 4FTVD 2A6JA 3VWKB 4EUPG 2X70A 2ARWA 3VGGA 1YN6A 3OF6D 2O61B 3DGCR 2P5ED 2ZWLT 4IJ3B 5EPMB 3OKDA 4OLWH 2X44D 2Y06L 1VENA 4BH7A 5EO9B 2DF3A 3A6BL 2NY1D 5K59F 1N6UA 4JZJC 2BY2A 1CQYA 2QLVB 3GIVA 1EJ6A 3L5HA 4KDTA 3WDHA 4M7ZC 1GOGA 4HUNB 5F1SA 4JO2H 3CU7A 4I18C 4LSDA 4FS0A 4W70A 3GMPA 1HQ4B 4HUVA 3GK8H 4OAWB 4AH2B 1E4XI 1I7RB 3QYCA 3WNOA 3U0PA 2ZUQB 3VMPA 3LEVH 2PW2A 2FX9H 4D9RE 3IDMB 3VD7A 4XP5L 3FMGL 2Q76B 1L7TH 5MEND 3K2MC 1RZKC 4WFGD 4BH7B 2J7LA 3QUMA 2BNRD 2ENYA 4KTYA 5CJ5A 5C0RH 3V0VB 5TDOB 2OL3H 4KGLA 3HZVB 4HXBL 35C8H 3RBGA 4MA7L 4Z7NF 5E08L 2EXWD 1U8HA 3NGBC 5GGSB 3BYTA 4RDQF 1FIGH 1DANU 5HGBA 1I7RA 2IMNA 4QHUA 4Z0BH 3MSPA 2BFVL 5J06A 3BIBX 4K7FB 4QCIB 1ZLUK 1OVZA 1R24B 4WHDA 1QSFD 4J4PD 1ZA3B 4WI6A 1K6QL 4CAGA 5BVPL 4KI1A 5DHVA 4OCYH 5DRXA 4JE4B 1NUGA 5FYKU 2NW3A 2OR9H 4I0PD 2V9TA 4U6YA 3SKJH 1RZFL 2FH8A 3ARFA 5A2IH 4L4JA 4S1SH 3V6ZB 4LPUA 4MQTB 1FZKB 3T4AB 1TCRB 4KV5F 4YXHH 5JA8B 3CH1B 4OCWL 3MRLB 1KLUA 2P1YA 4WUUD 5SWSB 1R24A 43CAB 2VR4A 4WTWA 4M4RA 3SJVB 4YFEA 3JV5A 1G84A 3DWTA 4NQXA 3BGFB 1EFQA 1CICC 3PWPD 1F11A 1GZPB 5B3JE 2P8MB 1XZ0B 3FTGA 1KGCE 3KPTA 2R1YB 4LPCA 1EZVX 4GG8B 5CJ8A 1ZOXA 3L3HA 2OMNA 4AYFA 2XPGA 2Q1EA 3W2DH 2DD8H 3ZKNC 2VL5A 3W9EB 5E00B 1BF2A 4JRYE 1IAMA 1CFVL 1ROWA 2IALB 4LSTL 5GQBA 4ZS6D 3O0RH 5I1KL 2D4DA 4JRWA 3O11B 2ZCKL 1V3MA 3ZL4L 2VR5A 4MB4A 4W81A 4F37K 1N7MH 4X6FB 4D9LL 2QKIA 4YXKH 1KB9K 3WFEH 5JHDD 3EOAA 2AQ1A 2DDQL 4N90D 5IHUH 5L2JB 5C9KA 3E6FB 5J9PB 4UOW1 2X10A 2Q6WA 4JY6B 4G3YH 4TTDC 1QRNB 1QLFA 2AJVL 4KK9C 2OXGA 4WU5A 5TDPB 3RVXD 3D2UB 4HV8B 1DBBH 4M4PA 5KSBE 2HLFD 1TJGL 5MHSD 3NFPB 1P9MC 4BZ1L 1DDHB 2ZJSH 1YMHB 5L2JA 5J7CC 1P7QA 3NPZB 2HT3D 3TH4T 1NC2B 1VEMA 4LKCA 5IQ7H 4DJMA 2P7TB 2W1NA 2G5BB 4FQQB 4ODWB 2HT4D 3MACH 3VA2C 5GHWL 4QHLA 3QXAA 3LDBB 2FHBA 2BP3A 4MNHB 3LZFL 4FFYH 5HYSB 3MRQA 4OD1H 3P9LA 1U8JA 3EBAA 4OFPA 3C6LC 1AKJB 4P57B 1QO3A 5FB8A 5JOFA 3UBXA 2VLJE 5FDWA 2W0LA 1TETL 4D0CB 1VGKA 2EO1A 1KCSH 3VD5A 2BERA 5MEOB 4PJAA 4RFOH 4LLUA 3NTCL 5FV2A 1CGUA 3LRHA 4F58H 3OJDB 3V0AC 4F9LC 5J6HA 1FLTX 3MLWL 1DVFD 1OF2B 3VMOA 2W0FB 5FB8B 2E3VA 5D7JD 3X12A 1CK0L 1IGMH 2VRAA 1BJ1H 1BX2A 4CNIA 4KJWC 2QQNH 1I9JL 3BOVA 3HE6C 4KMTH 1P4BH 4EOWH 4BFBD 5J6HB 5HYFA 5T3ZH 2K1MA 3RL2B 2DRUA 4UT9H 2H2SC 1A7RL 2NY7H 5ENWA 5CSBA 1XT5A 3HB3C 5KSAB 1A9EB 2RR3A 1NBVL 3AUVA 3QO1A 3ZKMD 3BW9B 4KROB 2LVEA 4ZYKB 4HC1A 1AQDA 1WK0A 1RY7B 3V5KA 5GS0L 2CO7B 1SJEB 3PE9A 4PTUA 2C1PA 4LSSH 4Y5XC 1WC7B 1KLFA 2YN5A 3SCMA 1CTOA 4HBQA 1CG9A 2ERJC 2WIIA 4X4XA 1HIML 4I77L 3W0WD 5KANI 3WS6A 1VACB 2DQUH 4TSCL 4UILL 2Y07H 5F7FA 3DXAA 1K5NA 3QWRD 5I75B 1HQRA 3DUSA 1L0YA 4LCIH 4WFFE 2R2EA 1OP3K 3L3KB 1M71A 1MLBA 3RBSA 4XNXH 1JWSB 4YBHA 4BZ1H 1CR9L 1NJ9A 5FYJD 3ARPA 4TNVF 3WE6A 3F58H 3JWOL 2AK1L 2AJUL 4X6BA 1F4WH 2HVKB 2QQQA 3KPMA 1T21B 3A67L 3C8KB 3RIFK 5DD0H 2BVTA 3WJJC 5HBBA 4ZO7A 1MPAL 5JIKA 1BFOB 3TV3H 4Y7MA 1DQTA 3DV4A 4LCYA 3CFCL 2R2EB 1NEUA 1OAZL 4NKIH 3T2QA 1X5ZA 3SKNB 1NJ9B 1NBZB 4P46A 5SWQB 4RFEA 3QIUB 3TT1L 3MLTB 1G7PB 3L3JB 1F4XH 1BVKB 1DVFC 1T1YA 3O8XA 4WHCA 2C4FT 3ILPB 3FB6A 5EA0L 4KUCF 1MQ8A 3HC4H 2NY3B 2RIKA 3QIBA 1YEHL 4WDIA 4CADB 3OKNB 4RMWA 3TBVA 4GG6F 4UINH 1HZHL 1ORQB 4PJIE 2EH8H 3VFRB 1KB5H 3BHBB 3VWJB 4F15C 3SKNA 3U48A 1T5XA 2ADIA 2YPLA 3KPRA 4NN5B 2GFBA 3OR7A 2ICES 3WIHL 2APXA 1FJ1B 1GAFH 4NM4H 3WS6C 1BVKA 3HFMH 3BEVA 4ZFOB 5I6XB 4PTTA 4PIRF 4F8TA 4M3JA 4OCSH 3O8XB 4XP6H 4QOKE 4XZUB 4E41D 2CRMA 5IBTH 2C3WA 1AD9B 1MREL 2OSLB 2XWBA 1RZIB 2E7HA 2R0KL 4OAWA 4X6CA 5D72L 2YPKA 4AH2A 1OGAD 1S7RB 4QRUA 4JDZB 3UYRL 2Y4SA 3HE7B 3FO9B 2JB6A 5I74B 1DLFH 1YY8A 1A3QA 4HHAA 3MZTA 5C2BL 4OCXL 4N0CC 4FP8L 1LP9F 3DRTA 4XVTL 3JWDH 3N9GL 2VERN 2E8YA 4ONHB 2AV7B 3G6JA 4OZIA 3MFFA 4Z8FL 3B9KC 2VLRE 3QQ3B 4P5TC 2ZCLH 5GRWA 2EE2A 3PP4L 1AR1D 4PGCA 5KSVB 3FRPA 4Y2DA 4RMTA 4NGHH 5A3ID 5IMMB 2XXMB 4ZXBD 1XEDA 4Z78B 5F3HA 2IAMD 1BQHB 4AT6B 2Y9RT 1BOGB 4NN5C 3WYRA 4U6YB 1HKFA 3LAFA 5H2BB 1F4WL 5D6DC 4LSQH 1FZKA 4L9LC 2FX7L 3SE4C 4L4VB 1Q94B 1A3LL 3VE0A 4K94L 2V9QA 4YZFE 4TQEL 4HKXA 4CW1B 1IQWH 3KPSB 2VKWA 3PHQA 4KTEL 3ETBF 1T1XA 2IPTL 2AK4B 4BSVA 1VFUA 1U0QA 3QIWD 4W4OC 5B39G 4MJ5B 3VFOA 3T1WA 1JF1A 1YEDB 2Q8AH 5FGRA 1V8HA 1UXWA 1FFPA 2DQCL 5CFHA 3PGCB 1DFBL 2QSCL 3BDYH 1MJ8H 1EUUA 2CD0A 1HHIA 3B83A 4R7NB 4FFVD 2W0PA 3LPFA 3KHQA 4XAKD 2BNUA 4DKEL 3HAEG 3HPLA 2EIZA 3TNMB 4YJZL 4H25A 2VDQH 3TNNB 4Z95L 5HXMA 5HD8C 1MCWM 4ZMAT 3RPKA 5FIEA 3VXTA 4WY7L 4XNYL 4OJFL 3EYOB 5FGCB 3V6OE 1WWBX 1MH5A 1TVDA 2DQJL 4YDVB 1HK6A 1MCQA 1XF3A 1AGCA 4NJAH 4B0MM 5IWLA 4FTVA 5L6YL 2FWOB 3D6GA 3NVQA 3BH8A 1WIPA 4DQOL 4PRHD 5ACZA 4H25B 3TNNA 2PTTA 5EUKB 3UZEA 1UCTA 1TQCC 2R0WL 3HC0B 3RWGA 5CEZH 3LRSB 3OAUH 1XGQB 1G1CA 1AI1H 1VPOL 1ULVA 4UI2A 5F9OH 5JW4Q 4HIHB 3TBWB 2X05A 5C0NC 1ZSDA 2D31B 3PWPB 1KEGL 4O4YL 5FGSA 3BWAA 1MFBL 4Z7VA 5HI3C 4HWZA 5JHDE 3STLA 1P7QB 2CGRL 3MRPA 5DLML 5FF6B 5D5MA 1YEJL 1FVCB 5CJQH 2ESVD 4NQVA 3UJIH 2EDWA 1SM3L 1AH1A 3FFDB 4PRBA 1FAIH 3U7WH 4RGMB 1MCRA 4G8GE 4HAFA 1A6PA 4ZD3L 4F2MA 3WHE1 5DDHA 3KPOA 1I1YB 4LLYB 5IW1B 2CLVB 3AM8A 4JHWH 1FGVH 3O4LE 2VE6A 3RTQC 2PXYA 3F12B 3MCG1 4XCCL 5KSUB 3CUPB 4NC1C 1N4XL 3PG2A 4OF8A 1DQDL 1FVCA 5JZ7C 2XA8L 5BZDB 3WKNA 1VFMA 1RUAH 3C5SA 4LVNB 4P2CG 5I76B 3LKQB 4P9HL 1V5JA 1JV5A 3FKUS 4M43L 4NO5B 1E6OL 4RQQA 3HPJA 5DK0A 3IYLW 1T4KB 4PREA 1AC0A 5D7IB 2NTFA 5E6ID 3MLWH 1DBKL 5DURB 5JHLL 5D6CA 2CUHA 4XCEB 2V2WB 1VHPA 3DNKA 4JFQB 1C08B 1T03L 4P5MA 1YY9D 3C5SB 4NBZB 4LHQB 5GXBB 4V1DB 1LWRA 5HYJB 4YDIL 5F88B 2NY2D 1JCKA 4OBRA 1UEYA 4K07A 1PX3A 3ES6B 4KJWD 1XR8A 3R0NA 1ND0B 1NUNB 1BQHG 3ARGA 3D85B 4P4KD 2VC2H 5KS9B 1R3HA 4OGYH 4E42B 3BW9A 4GS7B 4ELMB 3OMZA 3SGJC 1CE1H 1BFVH 4JFOA 2KQMA 3GBNL 3BZEB 3VH8A 2BZDA 1Q0YH 1OB1B 5DJAA 3T77B 5GRZA 1KSRA 1CT8A 4OD3L 2J4WH 4HS8H 4FQ1L 1A8JH 4E9LA 4AEIL 4L4VE 2F74B 3FT4B 2FX8H 3C6LA 3D85A 5KS9A 4M7KH 3OAYH 1NEZG 4XNQB 3ARTA 3IU3A 4B7LA 3CZJA 3EOYG 3MOQA 1P4IL 2RFXA 2FB4L 3TBSA 3MUZ1 1KIPB 2YD9A 3HE7C 3O45A 5DJAB 3M45A 1XGPA 5SWZB 1HH6A 2ED7A 1MCOH 3L6FA 3C5ZB 2VWEE 1CXEA 3OXRA 2A83A 3LN9A 4X83A 5HYJD 1QQDA 3WLWD 5DD0L 3L3GA 4LDLB 1AXSB 5F96H 3VXSE 1X9QA 4ZSOA 1JVKA 5JA9A 3CXDL 1KPRA 1NKOA 5L9DH 3EFDL 3QUKA 4LAJH 3QRGL 1CLZL 3TBSB 1RZ7H 4G9FD 4NCC2 1NBZA 5AUMB 3SPVA 4Z7WA 1PY9A 4MA7H 5E08H 2VJXA 3L3JA 3RGVC 4KC3B 4JRXD 2CR6A 4GRLA 1AQKL 1MELA 5CJBA 3GBLA 3ULUL 3GMRA 5EWIH 3STZA 1DE4A 5TQ2H 3QWOB 4N9GA 2AXFA 1KNOA 5B21A 5E5RB 4JN1H 1KELL 4F33A 2BSRB 4OGXH 1TJHH 2D9CA 3PIQA 4LLMB 4R4BB 5KOMC 5ID1A 4FZEL 4RA3A 4U6XA 4HC1H 1I4FA 2YPLB 3KPRB 3T3PE 1X5AA 1RIHL 3QRFM 3RKDD 1KIRB 5GGVL 3MRDA 3PHSA 1D5XA 1AGBB 4QOKD 2ATKB 3O8XC 2B1HL 5BOZG 2GW5A 1AD9A 3C60A 3P0YL 4H5SA 5F97E 4Q2ZB 1RZIA 4PV8A 5IJKA 4IOFD 2QSTA 5LG1A 2B8OT 5C86A 1KC5H 4A2MA 4QRUB 4XAWH 4PRPB 4PJ8C 3UTZB 1MFDL 4G8GA 1AY1L 4CVWA 1KJ2B 3OJMB 2DOCA 3VJ6A 1OSPL 4L3AA 3N0PB 5C6PB 4ODXA 4XBGA 1A0QL 2ATKA 5E70A 3DX9A 3VG0L 3BMWA 4PRAA 1W0WA 4G8EB 3OJ2C 2DD8L 3C2AL 2WBJA 2A2QT 4F8QA 4A2LA 3HRPA 3MLRH 4MSWA 3UYOD 5JHDA 3B9KD 3V6FB 4D2NA 1WQVT 3B9VA 1QYGL 2ZUTA 3CH8A 3OGCA 4N8PA 4M7KL 4JRXB 5HI4D 3NABH 4G8GB 4Z0BL 5GISH 3RA7H 4FN0A 5HHVH 4RWYL 2X4TA 3UP1A 3UX9B 4EBQL 1BFSA 5F89A 2EKSA 4Z6AT 3PQYA 5F1NB 4HWUA 1C12B 2VLRD 5EOQL 1JWMA 3EO1B 4E5XB 2H1PL 3MBEB 2BVPA 5E6ZA 4PY8J 5JR1H 3FAWA 4JVUA 4KDVA 2JF1A 5DZLA 5I1HL 1IQWL 3LCYA 2FLRT 1CGYA 2JKXA 1YEDA 3BN9C 3WIIL 3TH2T 3UJJL 4J1UB 5I1LA 4YH6A 1F4YL 3KHOA 2IAMC 4OLXH 5DS8A 2X70B 2Z35B 1G9NC 4JLRB 5D9SB 4YQXL 3MYZA 2ZCHH 4PGZA 1HHIB 3W11D 1A1MA 4LSRL 4WTXA 7FABL 1FLRH 1H8SA 1EAPB 3UJIL 3E3QE 3MJ7B 1TIUA 1CDHA 3QPQD 5DJ6A 3EFFA 4U1NA 5LGJA 1JTOA 1KCUH 5D71L 1JGDA 4XX1G 2AAVA 1GC1L 3N1MC 3L3IA 4G5ZL 5EBMA 4CVZB 1YUHA 1RHHB 3MLYL 1NSNH 5DS8B 5BV7B 2D7QA 1XF3B 2FGWH 4N8CL 2WINB 4OCLC 2PW2B 1RU9L 4BQCA 3UTTA 4WI2A 1J1XH 4CVXA 3INUL 3QUMB 5DJ6B 3WS3B 4W68A 3ZKMC 2XKUA 2FIKA 4PJ5B 5IEKA 5IMOB 1T89A 3LRSA 1I1CA 4XGZB 2X4SB 1EHLL 4HIHA 3TBWA 3QA3A 1DEEA 4KQ3H 5GGVY 3VD3A 3RIFF 1NCTA 5D8JH 1MIMH 1ORSB 4N5UA 3HR5B 3QH3A 3NIGE 3K0WA 4HWZB 1JTTA 5F7DA 3HNVH 4P3CH 1NPUA 2G60L 3QNYA 4WCYH 2FIKB 2IBZX 3H8NA 4ZOAA 3V6ZA 4LK4A 4MXWL 1YEIH 1Q38A 2YA1A 4XGZA 1P1ZA 4AENB 3C8DA 3ZE1E 1YPZB 1KFAH 5FYLE 1DEEB 4U05A 1LE5A 4PJ7E 5HI5C 4GKSA 4S11A 1W0VB 3BZFA 1S5IL 1LO0L 4JFDA 1N64L 4NQXB 4LSSL 4PRNB 4R2GB 2E8ZA 3SGEH 2OJEA 5BRZD 3KYAA 1KIQB 1FZMB 4NZRL 1IKNA 2AXGB 3D5OF 3ZYZA 1UJ3C 1GH7A 1QHPA 4KKCD 4G6KL 5BZDA 4YHKH 3MGAA 4S1DD 5CEZD 4QXGH 5DSCA 1OAKH 1LE5B 4X7FC 3WLBB 1RZJL 3LN5A 1W0VA 3ARDC 2VL5B 2H41A 4Y1AA 2QHRH 1VADA 4OLZL 1ZT1B 3GSXA 3E3QC 1QTYT 3S88H 3ABZA 5F9JA 4NWTL 4ZXBB 5FOBA 1CL7I 4DN4L 2AXGA 4BA8A 4ERSL 3O9WB 5DVMA 3MRFA 2HKHH 2NZ9D 4S0TD 5E6IC 3JTSB 4FQXD 1X5HA 3WXWH 1A0QH 1E28A 4JFEA 4XVSH 5L8JB 1U2HA 4GKNA 3EOAB 3LN5B 4NT6A 2M1KA 5IJVB 4XWOD 5L88L 3T8XB 3D3VA 5ESVA 3AU1B 3UDWC 4DCQB 3ARSA 3S36L 3TT3H 4Z9KB 4Z7UE 4JY6A 1TZHB 3WIFA 1HE7A 3MRCB 1QSED 1ADQA 3SO3B 4QHKJ 3I02B 4JFZH 4M93B 5T5NF 1SMAA 3CVHL 4P9MH 2VXSH 3SCMC 3UTQB 5DMJB 4OZFH 1J5OL 3FQTA 5C3TA 3P9WB 3D3VB 3MCKA 2DLGA 5IM7B 1JZ7A 2JCCB 4NJ9L 4TTDD 1MWAA 4POZC 2W65A 1OTSC 2DIAA 1M6OB 5SV3A 5F7HA 4JHBA 1B9ZA 4OI8A 3MRCA 1I7ZB 4HUMB 3LQZA 4NRXA 4Q97A 1NMBL 3ZDYE 3EO0A 3FO0H 5HY9A 1HSAB 2CKNA 4MNHA 1R5VB 5C7XH 3TLRA 3HE6A 4RAUB 1MRDH 1KB9J 3BE1L 4EUPH 2DTSA 2LABA 4O2EA 1W8NA 5IB5B 3HZMA 1G1YA 5ICXB 7FABH 2MPAL 3UTPE 2HH0H 4YDKH 3VFUA 4LP4A 3RWDB 3M8OH 4LAQL 1MJ7L 3VGBA 5F96L 2Z31B 5J3HD 1ZTXH 3SPVB 1BGXL 4ESKA 2WAHA 1A9BA 1SBSL 4NO0B 2Y36L 3T04D 4NZTL 5GGTL 1AR1C 5T33H 1DE4B 4AIOA 5JXED 3T3ME 4C57C 5FYJH 1B4JH 1ZHKB 4N90E 4NNPH 4P2QD 5K33A 4DUWA 4HIEB 4XX1E 2F5AL 2Z91A 4YBLC 3WL9B 4NBXB 1DCLA 2PYEA 5C0JB 4MLSA 3V0WL 1FGNH 4EI5C 1JUFB 4C55A 4LCUB 2ICWB 2MJWA 1XIWA 4N0FA 2OTPA 3SDAB 4RCAA 5KANG 3VGAC 1KJ2H 1PEWA 4YK4B 3VXRA 3GMNB 3TIEB 3HFML 3CPLA 4U7SA 1KENL 1NGPL 5C09D 4DKFL 3K1KC 4O2CA 2XRAL 5AZEH 4GMTH 4X99A 4MXWH 3UTZA 3HMXL 4B50A 1FL6A 1QR4A 5M94B 3FONB 3RJQB 3VI4E 1XIWD 3EOBA 4ONGH 2PO6A 3P4OB 4WVRA 1S7XB 3STBA 3B6SB 3SJVD 1N7ML 3VXRB 4YHOL 4KTDL 4HS3B 1IGIH 5TPWL 4XCFL 1G0YR 3QCVH 5DJ2A 1P4LA 4HKJA 5KS9F 1QLEH 4HUKB 4FMFA 5CCKL 2IADB 1IKFL 2ZNWA 4YXLH 4Z8FH 2LV4A 1PEZA 1T21A 3OGCB 2J2ZA 4F7PB 4O5LL 3FONA 3FFCD 1DQQB 5C0AD 1BFOA 1P6FA 4OCWH 2H32H 5HGHB 1D5IL 1ZT7A 4WTZA 4X8XA 5SX4H 1A6VL 3WUZA 4JR9L 4BZYA 4HGKC 5K59E 3L3OB 3RDTC 4IMLA 4LQFH 4LRNL 2X1WL 3HI6H 2IADA 4P46B 3NH7L 5SWQA 2YMXH 2LU7A 5I1JL 1CIDA 1YDPB 1A7PH 4LPYA 2EEDA 3QB7C 1T1YB 2A1WL 4F7PA 3AY4A 2HJKB 2C4XA 4DVBA 3GSRA 2B20A 1QHOA 3I75A 2QEJA 5IESL 4M00A 3QIBB 4X5LA 1WCBA 1NC4B 4OV6F 3SKMA 4QY8A 4NKOA 2JJSA 5DWUH 2IMMA 1D6VL 3KXFE 4Z5RA 5CZXD 1VEPA 3PP3K 4IMLB 5FYKD 2NY4D 4UMGA 4OM0H 4JFFB 3MTRA 3HMXA 4G7YL 1FIGL 3T4YB 1B88A 1K4DB 2FEEI 2DYPB 4U1HB 1B6DA 3IKKA 1MFNA 1UH3A 5DJ0A 1MJ8L 4RIRB 1PKOA 1OT2A 3R0MA 4G6FB 3HRZB 1I8LA 1XFPA 2QL1A 2VDML 1YUHB 4HWBL 4O51B 4JDZA 3DXAD 1U9KA 1CICB 3HTLX 1A7BA 5E2VL 1EEZA 1S8DA 5CEYB 2WP3O 2QQKL 5EIIB 4ZFFB 5EU3A 4QYOA 5E0QA 4PLJD 5GIRA 1SMOA 2YPVL 2I25N 3U7YL 2HG5B 3PWPE 2CDFB 3KLAB 1DJSA 2HRLA 2V2TB 4PJHA 5GS1B 4MWFA 1E27A 5LGKA 1S9YA 3QJHA 4JRYD 4JJHA 3S5LB 1CLOH 3RWCB 3FO1A 1RZGA 2C3VB 4QXTA 4O51A 1GHFH 3ZDZF 43C9A 3GO1L 2NY2C 2HMIC 5IQ7L 3OB0H 1TQBC 5F3BA 5KVEH 3LH2H 4MD5B 3VI4F 4N9OB 1QSZA 5E2TH 4PJFE 1DLHA 5EUOE 5ACLA 5CBEB 2V2TA 1KXVC 1CLZH 4QRRD 5F9AC 3EJZC 4FXGA 4KAQH 4JZJA 4DEPB 4KPHH 3S36H 3TT3L 3VE0B 3ME0A 1YPZA 3R1GL 4NQTA 4PJ9B 5EUOB 3BP5B 5DHXB 2WLYA 3NA9L 3TO4D 1WZMA 5ABDE 3E2HC 2OR7A 2VDLH 1SBBA 3H9HB 3ULVH 4C4KO 5D7KD 4PUBL 1GGUA 5E1AA 4X7TA 3PJSA 4OZGF 2D9QB 2J3SA 1KIQA 4YR6B 3NH7H 1FGNL 2GAZB 5I0DA 5I15L 1IILE 1UXWB 4MXVF 5J1TC 4RMRA 2BC4B 3SOBL 5HHQA 5F70A 4RGNC 1W72H 4MQ7B 5EUOA 4B41A 4YX2L 2E6QA 3VMNA 1I8IB 1UC6A 1IGJB 5LKNA 2BNUB 2O5XH 2XTLA 5T3XH 1BVLB 1XCQB 3VA6A 3CFBA 5AAWA 3GRWH 4AL8L 3AB0B 3K7UA 4Y1AB 5D7JB 1OPGL 3ZE2F 5ERWB 2UWEE 3BJLA 1OWRM 3QUZA 2HN7B 3NIFE 2GUOB 4IRSD 1NGZB 3BISA 4YDVA 3JTSA 1ZLWK 1MUJB 5E8NB 3ROOB 1X4XA 2X89A 3BJ91 4U1MB 1NGXA 4P2RD 1AIFB 2RGSA 4GKNB 5GGRY 5GS0H 5F1KC 3GZKA 3O4LD 5BZWB 5E2WL 4DCQA 1AFVL 4Q9CA 4YDIH 3NZHH 3NCYP 4WW2B 2FSEB 1LQSR 3MCLH 1CDJA 1XGQA 2GUOA 3PNWA 3QIWC 1T2QL 1U41A 5E8NA 3ROOA 3OX8B 1TZGH 1J88A 2UY6A 1ZWIA 4K3DL 4IRJD 1AIFA 4LRIC 5IROA 4PJBB 3EW3B 3Q0HA 1HYSC 1SY6H 1CVSC 2A6IA 2N7BA 4JM4L 3S4SA 1J5OH 2W65B 3SDDC 4JGUA 3GMOA 1DR9A 3BQUC 5I1CL 4JJ5A 4NHCL 4ZUUA 5KSAC 3O4OC 2YZ1A 3OR6B 4Z7UF 2BK8A 5DDHB 3KPOB 1RZKL 1GRWA 5GGSY 1FAKT 4OT1H 4O2FA 2AABH 1OP5H 3QUYD 1RJZB 4G7YH 3KDMB 3MLXH 4LSRH 2F19H 3RIAK 2PCPB 5IFAL 1J12A 3L5XL 3SE3A 1SQ2N 2AJZA 2CR3A 4M9PA 5I8EA 1QSVA 3T1FB 1ZAGA 1JRHH 3B2VH 3CSGA 2WUBL 1EVUA 4GRWB 2NW2A 5GHWH 2FJFB 3CLEH 3BKYH 5BQ7B 2H26A 4WHTB 2VMFA 3TIDA 5ECJE 4Z77B 1BPVA 5D7IA 3MRHB 1EFXB 2XZQL 4G6KH 4P5KB 1AHWC 2R23B 5D6CB 3SE3C 1BZ7B 3HG1E 4FXKA 1I1AD 2KBGA 4PG9B 4XCEA 2V2WA 4RGNB 5F7EL 1OAKL 2YPVH 4APQD 3MRNA 1JWUB 5GISL 1E4KC 3KR3H 5IF0A 1BZQK 2WANA 2B0SH 4RWYH 1TJHL 4R4ND 2Z93B 1JUFA 5FM4A 4KROD 1FNFA 4JDVA 1XR8B 4I3RH 4EQ2A 4N1EA 4OZFA 4UAOB 1G9ML 2ITDB 4LQ1A 4P2RE 2DLIA 3VFGH 5CD3A 1V3KA 2P5WE 3MXVL 4OLVH 3TN0B 4E0RB 4OFDA 3S35X 2CQVA 3ZHLA 4M6MH 4M6OH 3EJYC 4HIXL 5IF0B 1IE5A 4BK4A 4LNVA 3RPIA 4X99B 5H8DA 3UCRA 3NPSC 3LV3A 5C0CA 3RL1B 1IAII 3R8QA 5EB9A 5DI8B 1L0QA 3BUTA 2BDNL 3FQUB 2P43B 1BHGA 1LILA 1KIUA 2EDLA 1F45A 4HIIA 1BP3B 3WNLA 1RZ8B 2WP3T 3IDUA 5I17B 1OTTC 2DQTL 1X6NA 4LSPH 5E94A 3W39A 2C26A 1K4CB 4RGND 1C5CL 4NP4L 5INDB 5IFJB 2EDJA 3I50L 1NCCL 4QLRA 1UACL 3OWEA 4KJQC 4XXCC 4KK5C 5KVMC 1GAFL 2WUCL 1NMBH 4Q7DA 4XVUC 4KH2A 4G9FA 3MV7D 2QHRL 3L3OA 1D5IH 2DLFH 3BH9B 4JHAL 2EXYC 4OM1L 2Q8AL 4Z7WB 3DTXA 4K9EH 1ES0B 2MWCA 5INDA 1I3UA 2QADB 3X13B 1UVQA 2O5ZL 4HPYL 1W0YT 5K9JL 3O2VH 4ZPTB 1ZLWH 3VGHA 1MHCB 1WCBB 4NYLB 2E9WA 4I3GA 4NKOB 2JK5B 2P5EB 4PBWD 2IQAA 3D85D 4WWKD 2DMKA 2VDPL 2Z4QB 1X4YA 4KAQL 5JORA 3EGSA 1JBJA 1U95A 2GTZB 4LOUC 5C6WH 2ZPKH 1M4KA 1FZOA 1YEEH 1D5XB 2AJ3A 2H9GB 1U8QB 5ISZA 1A6TA 3DUUA 1LP9E 2G75B 3VXUD 3WSQL 4GQ9H 4PJ7F 3DSFL 1OAQH 5EOTA 4TVSa 3QXTA 2P45B 4TVPD 4J3TA 4AG4L 4R90L 3EYVB 4N1HB 3VFPB 3PL6A 1XAUA 1LO4H 2XKNA 4EN3D 3LKNA 3DECA 2GT9A 5K9QI 3E0GA 2E5EA 2HG5A 4X6EB 4TQEH 3IXAB 1G7IB 1NMCB 4MJIB 4YXHL 1CS6A 5HDLA 1G9MC 2V5MA 1TVHB 4PRAB 4Y5VC 1PY4A 1S9YB 4IRZH 4JQVC 4YHYB 4G8IB 4HS6B 1RZGB 1XGYL 2C3VA 2MHAB 2V2XB 3DMMD 3LHPL 5DYOA 4G6JL 2AKRB 3HAEA 2BNRB 4F7MA 4GLRI 3QUML 2VC2L 4NNYB 4BSWB 1DFBH 1I9IL 2HFEA 1JPST 5DMKB 3GJFK 1U91B 5B8CB 4O58L 2VZUA 1DLHB 3TFKC 1QR1B 2VZOA 3MJGX 1VKXA 3TEUA 1IM9D 3MZGB 3QPXL 4PLJC 3EKCA 1CDGA 12E8L 3NCJL 3NZHL 5DYOB 4PJ9A 2ADGA 3MBEA 2GJZB 5E8EB 1KTDA 4DZ8A 4JFDE 2DKUA 2VQTA 2XYCA 4EVNA 1J8HE 5FA4A 3UO1H 5B8CA 5KG9A 2W91A 1HINH 4NRZA 1R3IL 1I7TA 1MVUA 4J1UA 5E9DE 5I71B 1ZA6B 2H2PD 4U6VL 3HI6L 5IIEB 1IC1A 3V0WH 1ZANL 4NBYB 1DUYB 4M1DH 4NO3A 3OG4B 1KPUA 1IGCH 4MYWB 5HHQB 2R0WH 3MJ6A 1UCBL 3SKJL 3RNQB 1JF5A 1QVOB 1CDBA 3EJZD 3TVMC 4QRPD 3RAJH 3V4VH 2FBOJ 1NMAL 2AJVH 2NY0D 4XPAH 2IH3B 2Y5TB 3EFFB 3ZT7A 3FOMA 2RAMA 4GUPA 1XCTB 4KTEH 3GRWA 4HLJA 2DI8A 5GGRA 2GY5A 3VRIA 2R8SL 3B8SA 3LDBC 5IIEA 2WW8A 3EOTL 3QG7H 3MPCA 4HZAA 3VDBA 5EWIL 4ORZC 5ALBH 4K23L 5IB3A 1ZKAA 1NBVH 1LVEA 1QEWA 3EYQD 3PABB 1LGVA 1PG7X 3QDMA 4V1DD 2CKBA 2XKSA 2OL3A 5IR1A 1VFAB 3F7YB 3QNXB 1JPFB 3IJYB 4QTIH 2MTPA 1ED3A 5IMOA 2EZ0D 1CGVA 3HI5L 3I50H 4JKMA 5T1KA 3VRIB 1A4KA 3MRBB 5F9DC 3IT8D 5BMFH 4PJHF 5CILL 4NM4L 4ODBD 2DBLH 5IMKB 4PYHA 1T1ZB 5CEXB 1ODAA 4PY7A 3QH3B 5DZNA 1QSFA 4L1HA 3S37H 1TZGL 1NC2D 4LIQE 3TBTA 1CR9H 2DJ4A 2YD5A 4ZUSB 1FG2B 3FQRA 3QDME 3U46A 3ULUF 2AJSL 1I9IH 3EDFA 4Y4KB 1RK1A 1WTGT 4BFGA 3MA7A 5JQHC 2CDEB 3U6RB 3GEWB 2XT1B 3ARGD 5HI3D 3DYOA 2PYED 1A21A 4JM2C 4J8RB 1MCPL 3ESVF 4RMQA 5IB1B 3DRQB 4G80A 3ULUH 1CLYH 3S96B 1YYLH 2PTUA 1DVFB 4YDKL 1KTRL 1S7VA 3TESA 1UM4L 3WNKA 5KVFL 5KTEL 5I1IH 2H26B 2YSSA 2DLHA 3GSXB 1QACA 2NX5D 1IGCL 5HGAA 2XQYG 4ZXBA 5HHME 1FFOB 2A0LC 3AREC 3IDJB 1K8IB 5JUEH 4PP2B 1HIMH 3RAJL 2Y7QA 1OTUC 2YC1B 2PR4H 3WEXA 5HHOD 3TZVB 4QHUB 5CUSL 4JFYB 4YC2C 1X3DA 1E28B 4JFEB 5D1QC 4KZEL 1A4JB 2AEIT 5F6HJ 5C0BD 3GNMH 4JAMB 4HT1L 2X4UA 4QRRE 5J57B 2P8PA 3HUJA 2IFFH 3ARBD 5EU4B 3LKSA 3TO4B 2EZ0C 5DMGC 4Z7UB 5TJWK 1LO3H 4LF3B 3I02A 4DKEH 5E4EC 4WO4A 5J56B 5L2KE 1GC1H 3VG9B 3UTQA 3QDMD 4FFZH 2XQYK 2NY3C 4EEEA 2ARJA 4DOHE 1QFWI 2ZCLL 3PWVA 4ZOBA 2E9JA 1M6OA 1QBMH 4OM0L 4LHUG 4IOSD 4L8SB 4ZTPL 1U2CA 3W9DB 2O5YH 4UQ2A 3IJSB 1FVDB 3DIFB 4OZ4A 4CMMA 3QI9C 1FL3B 2EDFA 4WFEE 4LSVL 1DZBA 1KB5L 2VR9A 5CBAA 1OTSD 4GBXB 4BFIA 5ICXA 1G7QA 3ZE0F 4U6HB 5HYJE 4J4PA 4XWOC 1T20A 4G9FB 3H9YA 5ACMA 5ITBH 4PJ8A 2Y07L 4Y4FA 1JZ2A 3CCHA 3T3MF 4HJJH 4QNPF 2R4SH 1ES0A 5FYKL 3BMVA 2X7LB 4ZQKA 2V9RA 5LCVL 5IJKC 2E7BA 2KUTA 5EZJB 3MBED 3QAZC 1BECA 2O26U 4K23H 4N8VG 2BHUA 1HI6A 5T3XD 3SO3C 3SGEI 2HT2D 2P44B 3U30B 1P7HL 4M7LL 4OIAA 1BIIB 1FNAA 4C58B 2JK5A 2NNAB 3UTSD 1IT9L 4ENEC 2IQ9L 5D1QD 2ZKHH 3QUXB 4NKQB 1FVEA 5C0JA 1JZ4A 1EO7A 3DVIA 4S1QL 3QP3A 2X7LA 5DK2A 1MHHA 1WWCA 3SE8H 4EDXB 1UM5H 4PJGF 5F7EH 2OLDA 1FBIL 4QNPE 3QI9B 3RWIB 3SCMD 1KCVL 3CPLB 3GBMH 3SHSA 4HWNA 1CFQA 4XPHL 1J1XL 2BSTA 1WF5A 2E7LC 4QHLB 3QXAB 1FC1A 1RJYA 3DI3B 5EZOL 3RX8A 1OAQL 1A22B 1IAIM 4Y16C 4PBVC 3MV8A 1KULA 3ZT5A 4X7EC 1QSEE 1S3KH 1KG0A 3P11L 4K8RH 1WZ1H 3QULA 1FO0B 2WV3A 1F3JA 1TVHA 5C0EA 3CK0L 1JPSH 5GS3A 4PJGB 4YO0B 4OCSL 4XP6L 3VG9C 1A7QH 2MHAA 1MF2L 5C0DA 1RJYB 2HT4C 1SJHA 3G5VA 4P2YA 1U58A 1RULL 4HJGA 1S7UB 4ELME 3O4OB 1OM3L 1U91A 4KK8D 1N5YL 4AQ1B 5HGHA 1OLLA 1CXKA 1FLRL 4LCWA 5AD0B 1WISA 2BSSB 1P2CB 1PVHA 3BQUD 3QHZL 4LP5A 2CJUH 3SE9H 1ZGLA 3BO8A 4CNIB 3JWDL 3N9GH 3LEXB 4HFWB 1RJLB 3OAYK 1B0RB 3WDJA 3GMQA 5BMFL 1FFRA 3PGFL 4YHNB 4GRLC 5EOCL 3GSRB 3IGAB 3LMJH 4N8CH 5FA4B 5AZ2L 2DICA 4EDWL 3ZKQD 3BAEL 4KZEH 2F8OA 2Y06H 5D2LB 4K9EC 3SKMB 2FB4H 2A9MH 4YUEL 4Y5YB 3OKKA 4Q9QH 1DUYA 1R3IH 3RGHA 4MVBC 4NO3B 4CU8A 1JN6A 3WFCH 1PSKH 2ZG2A 1GGTA 1DSFH 1XF5A 4HMDA 5DO2C 2DYPA 2WIIB 4OZHE 5IK3B 1N26A 2MQ0A 3BUYB 4IMKA 4DZBB 2FDBP 4XVSL 4OFYA 3GSQA 4HCRH 4U1JA 3I6GA 4DKAA 3LZFH 1H3GA 3MXWL 3DROA 1HQRB 3VCLB 1D6EA 5A43C 3D39D 1UB6B 1JWSA 1UEMA 4NWUL 1G6VK 3N85H 5IFHH 4LDEB 4YWGH 3NCBB 4R4NC 4ZUTB 5EIIA 4HJ0D 2EIDA 4X6BB 3OXSB 1YQVH 2DQCH 5J13C 1AXTL 3WFDH 1U3HB 1CFBA 3T0BA 2CDFA 3NFNB 2FECL 3IB4A 3G9VA 4FOMA 2CK0L 4XNZB 4Q0XH 3F7YA 2PXYC 4M6NH 1I1AC 5DMIH 3O6LL 5CSGA 1AFVH 1BQLL 1G6RH 2ICCA 4K55A 5DA0B 2D7MA 4FG6D 2FR4A 4GW4A 4JANB 5K9OA 5IMKA 5JMOC 3MMEB 1A6UL 4PV9A 4ZUTA 1YA5A 4X6DE 1BBJA 3SO5A 3MLTA 1LEGB 1UZ8B 4MQSB 3QNZB 1QSFB 3O3EB 2AQ2A 5EO9A 2AJYL 3KR3L 3BGMA 2EYSB 1XH3A 4PRHB 4Y2OA 2Y6SC 1UXSB 3RWHA 4ZUSA 1DBMH 2JIXB 4F80A 4CADA 1JK8B 2BSED 1HQ4A 1WGOA 3OQ3B 4KI5E 5JIHA 1RULH 3VGAB 1T5XB 2J8HA 5E9DA 2GJ6A 3N1FC 1BAFL 3H3KA 4O58H 2VISA 2B39A 4EI5B 3S97C 1H0DB 2OJZL 3SKUD 1NCDL 2X41A 1OGAB 3G08A 2IQ9H 5I1EL 3MOAH 1YNTB 3V2AR 1NEZB 5FYJU 4F7TB 3WBDA 3W2DL 4KI5F 2GAZA 4ZAKB 1OTUD 5GGSA 5CP7A 1XGTA 3QEGH 2J8UB 2J1KA 4LLQB 4NNXB 3GDBA 2YPKB 4HXBH 3V52L 4RX4D 5AZ2H 4I5BB 4CJ1A 4PRDA 3GM8A 4J3UA 5E9DB 3FJTA 3GJEB 2MCPL 3QQ4B 3DETD 1J7VR 1T22A 4F57L 3SDDB 3DI2B 5D2NA 5J11C 3RGVD 4CU7A 5I1JH 1QOKA 5E2JA 4IMKC 5CP7B 4NJ9H 1TCRA 4KRPD 1VFBA 4DEPC 4JM2D 4I5BA 3IDIA 5CGYD 5FKAB 4O02L 2L0DA 3GJFA 2XFXA 1BQHA 4PB9H 4L3EB 2OR8A 4G43A 2DWEB 1MJJA 1I9JH 2XQBL 2P8MA 2LVCA 2CXKA 3SDDA 2ZCHL 5DEZA 4N0UB 1SYVB 4JG1L 1F4XL 2AI0H 2VTFA 3OL2A 4HEME 1JGEA 1E4JA 2Z9TA 3BWUC 4PJHE 1RFDH 3DX7B 2XPGB 2DJSA 3CMGA 3KLSA 4ZAKD 3TF7C 1NL0L 3E8UL 1JZ6A 4HWBA 5FKAA 5B38B 1KJMA 3MO1B 3PHQB 4L3EA 2NXYB 1HNFA 4Y0GA 3OF6A 3BPNB 4TUKH 3OZ9H 3WV0A 2NPLX 3TCXA 3FN0H 3QZWG 1EUTA 4H20H 3T0WA 1MY7A 3SGJA 1CU4L 2VSDA 3NCYS 4O5LH 2A6JB 4GMSL 3VWKA 2R0ZH 3SDAC 3IFPB 4ODUA 3DX7A 4A6YH 2Q87A 3FFCB 5FYJL 2AGJL 1FP5A 4GJTB 4LCIL 3WJLC 4URTB 3TNMA 3C5ZC 3CVIH 3FCTA 3O6FC 2W07A 1GSMA 1IGFL 4TUJB 2LTQB 3U9PL 2WMPA 4HC1L 2VXSL 5D1ZA 3UPRA 4YEEA 3MNZA 3GK8L 3F58L 4KQ3L 2LU3A 3WFZA 4ZO8A 4EN3C 8FABA 4PBXA 1MH5B 3IFLL 4WU5B 4AEHL 1VGEL 4X6DB 5FK9A 5JOEA 3NZ8B 2FJGB 4PGDA 1OP5K 1LDSA 2FYYB 4HV8A 2YUVA 3UTTE 2JE8A 3V79C 1UA6H 1Z9SA 2R1WA 3WIIH 5TDNB 3U79A 1GIGH 1N59B 4WHTA 3TIDB 3QIBD 3PDOA 4UQ3A 4HJJL 5I1AB 4PGEB 2CLRA 4FZ8L 1J0HA 3NIDE 1Q9WB 1LE9A 5TDOA 1OAXL 1H9VA 4FXKB 5ALBL 5LCVH 3S35L 2NY4B 3QCTH 1EMTH 3KLHD 1PKQB 5BJTA 4QRRA 1EPFA 4Z7WE 4D94A 3K2UH 3SKOB 3KPLA 5CGYC 2WQ8A 5D71H 5EDXA 3VG0H 4K71C 2CK2A 3KXFD 5DJYB 5DMIL 4U6TA 3JWDC 4Z7VB 4HH9B 4GH7B 3FB7B 4JDVB 4DW2H 4EDXA 1WEJH 1J86A 5DHVB 2X1OA 4HZLB 5DRWB 4IDJL 4WI3A 4QKXB 1A3LH 2NW3B 4WFED 3NAAL 3GMLB 1W72L 5FDWB 4WUUA 3VI3E 5CD3B 4KVCL 4QXGL 3ARFB 5FM5O 4D0CA 1CFQB 1RK0A 2NX5A 2P49B 3HUJF 4QRRB 4M7JL 3REVB 2FL5B 1DQML 1QFWM 2JELH 4NQCD 3UC0L 1CI5A 5JW3H 5KVDH 4R0LC 1PYWA 1S7TA 1T83A 1ZLUH 3RTQD 4JCMA 4GQPH 5EOQH 2PXYB 5KSUA 5D7LE 5CZVH 3T2OA 5KAQF 4QRQA 4XBPA 3NPSB 3KJ4B 2J5LC 1NCDH 4GXUM 2K7QA 8CGTA 3O41A 1PBYA 4UB0L 2I5YL 5GRVL 4GO6B 2EDTA 2QR0B 3D9AL 4HPOH 4WY7H 3NBNA 2EDOA 4NOFA 4RQQB 1BLNA 1U3ZA 4BQ9A 1PX4A 1ZHBA 2VQ1A 1PYWB 3BT2L 1TXKA 1F00I 1R6VA 3ZL4H 2EDDA 5I73B 1TVBA 4LCWB 5AD0A 4XAKE 1KN2H 1D9KA 1C08A 4RX4A 1SJEA 1ZGLB 3QHFH 1U42A 2COQA 2YOCA 3G5YA 1SJXA 1RJLA 3SCMB 4JM4H 2EKJA 1YEGH 5JMRA 1EEQA 2CSPA 2YK1H 4NZRH 3V8CA 1BQLH 1F13A 4KJQD 2EICA 1A02N 4PYGA 5AEAA 1RZJC 3ZDXF 4M93C 4X7SH 1ND0A 5ESAA 5CUSH 1A6ZB 5A2FA 5ALCL 4KHXL 3VXOB 1EJOH 4UNTA 1UWEH 1M71B 1MLBB 3RA7L 2R56L 2MNUA 1BJ8A 4QO1A 4GW5B 1FYHB 1IARB 4OCRH 3T0DA 3DO7A 3EAKA 5D1ZC 1FNHA 4KK6C 2FNBA 1YECL 4U1SA 7CGTA 4DVRH 5CS7A 3QEHB 5F7KC 1EGJA 1YC7A 3HS0A 5IK3A 1EMTL 2DN7A 3JUYA 1A6TB 3DUUB 2VDNL 1T5WB 5F6IC 2DQGL 4LSUL 5J0BA 1WT5C 4LKCB 3MLSH 5JR1L 2IBBA 4FQQA 5CJXC 2BX5A 4FP8H 3DLQR 2KDGA 5FCUH 5E99L 4JHWL 4V2BA 1T3FA 4PJXA 4RFEB 1OAZH 3B5GA 4NKIL 4GW5A 5JPNA 1HCFX 2UZIH 3MRQB 4GFTB 3LSOA 5BVJB 1AJ7H 1FNEA 3NOIA 3IDNB 2DWDA 4Y8DC 5DD6B 4JQIH 3ZSSA 1QO3B 4WI7A 3SQOH 3OAZK 3TO2B 4XPHH 4Y88A 4PJFF 2GITB 2LU4A 1D5MA 1F90L 3VFVA 2QJDA 1Q9KB 4ZSOB 1ORQA 2X40A 4U49A 3WNPA 4RFNB 4OKVB 3VFTB 2BNRA 2R29H 4F7MB 3MMEA 3V95A 5LJYH 1H3TA 2FX7H 2IBGA 5TF1H 1KPVB 2DWDB 4LASH 3LQMA 1M7DB 3STZB 4UB0H 3BD3A 4G6AD 2JIXA 3MQIA 4NUJA 2BSRA 1EFXD 3DX8A 5K9KB 4WUUE 3K1DA 1A7RH 5DTFA 1Q0XL 3VD9A 3OKOA 3CFEB 1KV3A 1QKZH 1GGIL 1GHFL 3VXME 1MI5A 2DB8A 3ARVA 1EHLH 4MMZC 1LO3L 4QTHB 2EC9T 2HJFA 2YKLL 3F7PC 5IG7A 3RWEA 2AQ3A 3RI5F 1L7TL 3HNSL 3QQ3A 4P3CL 1NAML 1GPOL 2NXZC 3T2PA 1KYOJ 4X4YA 1OARH 4J3OC 4H88H 4LLAA 5HVHB 1QVOA 2ESVE 1PG7L 1IVLA 2CIIB 3CFDB 5F3HB 4Q58C 1JNHB 2C9AA 5ELIA 1T0NB 4OCMC 1LNUA 4QTHA 2BOCB 3CX5J 4U7MA 4BSJA 3IF1B 5K93A 4L3CB 3DX9B 4P9ML 5GRYA 1KUMA 5H2BA 3DUSB 3JWOH 2D4FA 4D0DB 2DDQH 2IPKB 2VLMD 2AEQH 2NY3D 3TBYB 1VFBB 4KKLD 3VW3L 5ADOH 3BZ4A 3GUTB 2GK0A 3BKMH 3GJFB 5IVZA 4GG6A 3ZDYF 1ZVSA 1LNUB 3AS2A 4JN2B 4Y19A 4X5WB 5E99H 1JPFA 1MF2H 3IF1A 3IJYA 5K9QG 4NDMA 2VDPH 2IEPA 3TPUB 1JYNA 5FUCE 4LCYB 5TF0A 5F89B 3LS4L 3SDXF 1MEXL 2IPKA 1LP9B 2XQBH 2CGRH 1EEYB 1S5HA 3PDDA 2YUWA 5D7IF 1WSST 2OYPA 5ANMB 1EEUA 3D3VD 4U1KA 5DF0A 4DGIL 3WFBH 1N5AB 3GUTA 5C3LD 1Z3GL 1H3XA 4A6YB 4TVPH 4X6CF 4YFDB 4G9DA 2R69H 2W38A 3FT3A 3N1QC 2XTJE 3QR2A 1CDCA 4H0GA 1RIHH 3OKNA 1OP3H 3TBVB 4HUVB 4OB5L 5JDSA 2B4CC 1EEYA 1RK1B 5DEGB 2UWEA 5J6GA 2YD8A 5ANMA 3L1OL 1FJ1A 3LD8B 4KHXH 4QRSA 1BBDL 2APVA 3P0YH 3RVWC 4PTTB 3MJ7A 2HT2C 4A6YA 1HXYA 2BCKB 2YD7A 4LLVA 4G9DB 4J8RA 1K3ZA 5IB1A 2LE9A 1A7NL 3W5MA 3O2WL 1QKZL 4ODHH 1S7RA 2J5LB 4RRPG 5FUCC 5KVEL 3NZ8A 5DT1H 1YY8B 1LDPL 3KYNB 2H8PB 5EULV 1T03H 5T1LB 1MSPA 1NCAH 3KGRA 5C08E 1XGUA 2IGFL 1GYAA 4F7EB 4XP4H 5DUMH 3NCFB 3GJFH 5EO1A 4KUZL 5FDYA 4L9LA 4YHIB 3ZT6A 4ODSH 3H6JA 2JTDA 1XR9B 3K81A 4UT9L 5L7XH 5BJTB 4PJ9C 1JHKH 2Y23A 1JF6A 3VXSD 4UOW0 4P2OD 2I24N 4G7VL 4NFDA 5IMMA 3ZYIA 4KK9D 5C8JB 4HWBH 4HZLA 3G5XB 5DRWA 4ZO6A 3CLFL 5CMAB 1G6RL 2APBA 5EU4A 3ELAT 1XZ0A 1ADQH 2KZ1B 5INCB 3U0WH 2CMRH 5GS1C 1RK0B 2EC9U 1EO5A 2YBRA 3QXDB 4L4VA 3EHBD 3VXUB 1IAKB 5IHLB 2DQUL 4TSCH 3GRWL 4W6YB 1I9RL 3WUWG 3LKQA 5AWNL 2YR3A 3NFSH 2LFGA 5IBTL 4QT5B 3W5NA 1WJ3A 3DOSA 4M9OA 4MLIA 3VXRD 1MVFA 4OUOA 4PRNA 3SEPA 2J8UF 1JRHI 1JF1B 2OJEB 1NFDF 4L8SA 3O11A 4JFQA 1QLRB 1QUNA 1YMMD 5JQ6L 1IAKA 3GI8H 4LSUH 5ESQA 4P2QA 3X3FL 3MRRA 5EC1A 3WLBA 5J12B 5LXGL 2KH2B 5D7SL 2NMSA 5L9DL 3KVQA 4FNLL 1UKTA 1JE6A 3MGOB 4CUCA 4W4NA 1I1RA 2D2OA 2FH6A 4NSKB 5DJ8A 2VYRE 3O3BB 4OF6A 5C0BE 4QHKI 1OLZA 3VXTB 3RIAF 3GKWL 5CIPH 4NZUL 1J9CT 1NCNA 4HWEH 3AAZB 3L1OH 4KXZI 3RI5K 4MDJA 1F6FB 3RP1A 4KJYB 5TDPA 3QSKB 3R8BB 3D1MC 4MNQA 2CLZB 4PJEB 1IGYA 1IGFH 1F90H 5IVXA 2W0KA 3Q6FB 5HHMD 3UPCA 4IRJA 4KZDL 4JO2L 5ACZB 4NT6B 4M8VA 3SGKA 1B4RA 1IAIL 1EXUB 1II4E 3QFJA 2F74A 3FT4A 4L5FL 1LO4L 4LPWA 3IDXL 5ESAB 1LDPH 3WHE0 3QWRA 4W6XB 2P7TA 4MMXC 1HH9A 4IDLA 4P59L 5I73C 1ZSDB 2D31A 3PWPA 5J3HC 4WI5A 1KIPA 3O45B 3QUXA 1FVEB 5BS0D 1M7XA 5HYSA 1V7MH 1HH6B 1EZVY 1JHTB 5DLMH 1XF2A 3P9LB 3TPKA 5A2KH 4MS8C 3A0OA 3TWCL 4K9EL 5MENE 4NPYB 3QEUA 2D7PA 5DD1H 2WNGA 2E9IA 3MRPB 4ISVA 4ETQB 4RMSA 3L5XH 3A67H 1EGJH 5HJ3A 1CE6A 1S7QB 4JCLA 1FAIL 3CXHK 4NQVB 5FGBC 4Z0XA 3U7WL 5MEOA 4Q74A 3Q48A 3EYSL 1IQDA 4BKLB 1RHFA 1NH6A 1ZLVK 4XVJL 4F2MB 1OF2A 5DWUL 1V05A 4KVCH 5IW1A 5CSZA 5HGDA 3IDNA 4I0PC 3M17B 3QEUB 1KF9B 2MCG1 2ZPKL 3PHOB 2I9LA 3I6KA 1D5MB 4I48A 3HZYB 2P5WB 3H9SB 3ULVL 5DR5L 4GXVH 5C0DB 1MFEL 4OKVA 1T83C 1MHPH 1TDQA 3TVMD 1T7WA 4FRWA 4S10A 4MXVE 1CDYA 1F3RB 4OSUL 5CEZL 2ZUXA 4QHMB 4LSQL 4NKMB 2XWTB 4NQDD 2BRQA 1KPVA 1MCHA 5KSAA 4NO0A 3JZ7A 3L7FB 3HNTH 5DK3A 1A6WH 2BSSA 1KBGL 3PHOA 4HIXH 4HXAL 4UBDC 4EXKA 5KN5A 3V5KB 5TGBA 4PJGE 4I48B 3MJ9L 4PB9L 2ZUVA 4XPFL 1QA9A 2ICEA 1E4KA 1HWHB 4CN6A 4FZ8H 2VUOA 2PYEB 1F4YH 1DBML 4LRIA 1WIOA 5IKCA 5FXCH 4K2UH 3LKPB 4MB5A 5DQJA 5HVWA 3X3GL 1KJ2A 3C8HA 4YHNA 5EUOF 4F9LA 5KSAD 2YEZB 3GGWB 5DRNB 4ZNCD 3Q1SH 4Y16D 2Z92B 1WZLA 4ODXB 1HHJA 1ZLSH 1GL4B 5C6TH 4GAFB 4JY5L 5EORH 5TGBB 3ARDB 2NY0C 5JXAL 4O2CB 5BV7L 3V4UL 1UWXK 1H5BC 3U0WL 3NAAH 4HEPG 3C5ZD 4WU7A 3C2SA 2VOTA 3HC3L 2YPLE 3KPRE 3EOBB 3VXQA 1GGCH 1S7SA 5DRNA 1U3JA 3U9UB 3NABL 1DBAH 4CRPA 4YFLF 3JV4A 1L9NA 1MFCL 1OW0C 4D0DA 1E6OH 2PYFA 4LMQI 5F1NA 4AY0A 3BP4A 3H7BA 3RZCD 2D3VA 5AG8A 2OS7A 4L4TE 5M7QA 2ITCB 3VFGL 1A5FH 3U4EA 4JFHD 2PYEE 4G6AC 4TRPH 4M03A 2NXZD 2PNDA 4GG6B 5IT2L 1B6UA 5I30H 2VZ1A 4KY1H 5L2KB 5FCUL 2O5XL 2VN7A 4NKDB 5T3XL 3VRLF 4NDMB 3SDYL 2IPTH 2W9LA 1RZKH 2PYFB 2WBWB 2ADIB 6CGTA 1S9WB 4O9HH 5AUMA 1AGDB 4OIIH 3QG7L 1KN4H 2BRRH 1UZ8A 2CPCA 4MA1C 1G0XA 2AI0L 2F53E 1J0KA 1U8LB 3CU1A 1F6AA 5CJQL 2QSCH 1YC8A 4XZUA 1XH3B 4FXLA 3BGAA 3NN8B 4JPWL 4OLUH 5J1AB 5IMLB 5T1DL 4AG4H 4P23C 4XPBH 5HI5D 4KZDH 2VZ3A 4XCYA 4X6CB 4ORGA 5I74C 2ZOKA 5DC0A 3RZCA 4Q9RL 2VL4A 4FTVE 3ALPA 4JPIA 3BGFC 1BOYA 2UWEB 1FN4B 5J6GB 1N4XH 5J12C 1H15B 2XOTA 5FKPA 3T4YA 4GBXD 1U8LA 4OF5A 3MRDB 3V5DA 4UNVA 1WAAF 1YNTA 5ADPL 2B2XL 4K3DH 3GIVB 4UT6L 5IMLA 4X80L 4BQ6A 5FAAA 4NN7C 4EIZC 4PRHE 5DJCB 4K2UL 5LWYH 2X4SA 2FGZA 4QOKB 3RZCB 1YMMA 3O3DA 3UXFA 1CICA 2AEWA 4XP1H 3KYNA 5K9JH 2H8PA 4TSBL 1ZVYA 5CEYA 1EEZB 1S8DB 2F58H 3QEQA 1N0LA 2H2SD 4IIQC 3QQ4A 4M02A 1KEMH 3NCCB 2FX9L 2H45A 1UM6H 4L9LB 1YJDL 4MA1B 4FFYL 1GGYA 1E27B 2I9TA 1DN0A 2V5SA 2VXVH 1U8HB 1ZV5A 3JTTA 3QUYB 4B7IA 1XR9A 2XV6B 1A7OL 3FO1B 1J1PH 4MCYA 4AENA 4J6RH 2W9DL 3NACH 3RY5A 5F6IB 5D1ZD 3BPLC 4HKXB 4CW1A 4GKSB 4QCIA 2WM0A 3ARBB 4MAYC 2WWKT 2APFA 2AK4A 3PWUB 4JZOB 2DWEA 4OQ1A 4XHQA 1CIUA 1CXHA 5F6HI 4YXKL 4LQFL 3S7GA 5BVPH 3LVEA 2X4TB 3RZWA 1RPQA 1FV1B 1GCFA 4N0UE 3F5WB 4G8GD 1SYVA 1DN0B 3S34H 4JHZA 3PGCA 3PGDA 2DQFA 3T4AA 3H0TB 3QDJA 4E41A 3VXUA 1IC7L 2JLLA 3CH1A 1KBGH 1SEBB 4NHUB 4QT5A 2BVPB 5D7LD 2BJMH 2EIZB 2VDKL 3H3PL 3IFOA 1WBXA 1ZXQA 1U93B 4OLXL 2XRAH 5JW4R 4OD2A 1MJUL 1GZPA 2VAJA 4IIQB 1IM3A 1QFUL 2F15A 1I75A 1YECH 3QDGA 3ULUD 4P23A 2A0LD 3PGDB 2DQFB 4FABL 4JLRA 5D9SA 1OQOA 4XC1H 3FRPG 2AS5M 1Y6MR 5ESQB 3HCVB 1FNLA 2J6EA 5GJTL 1Z9LA 4TSAH 3UPRB 4NQDE 4R4FL 4OB5H 4E41E 3L3IB 3JVGA 2Q86B 1UM5L 1NLDL 4I77H 2YZ8A 4TVPE 5E24E 4GAJH 4P23B 3ZTJH 4UTAL 1YEFL 4KK6D 5JIIA 4XNZC 1N6QH 2FYYA 3ZSTA 1IGYB 3MUHL 2QKIB 5J13B 2X4RA 5TDNA 2VSCA 2XZCL 4KRPB 1MHPL 4JQVA 1LE9B 2P8LB 1FO0L 1FE8H 4LSVH 2AXHA 4I2XB 3E1F1 4XMLL 2DQHL 3QA3B 3RDTA 1XIWC 2XWJA 4PRBB 4UTBL 5DJYA 4MJ6B 5C0RL 2N1KA 4XPFH 2X4RB 1XF2B 3CNKA 1Q8MA 3QEGL 1I8MA 4V2CB 3F12A 5FYKH 2A6KA 3GMLA 1MCDA 2LTQC 4ETQA 3BRDA 4L8BA 3CFKA 4Z7QF 5F7YC 1YNKH 1CE6B 4PJDE 4PR5B 2BFVH 4U2ZA 3MODL 2O5ZH 4JFPB 1J1OL 4MB3A 3K4DA 4Z0XB 4JJ5B 4UIKH 3DO3A 4KHTH 2QSVA 2XWJB 4LHJB 1IQDB 1EX0A 3OKMA 4DWHA 2ENSA 4JY5H 5EORL 3HPJB 1CLCA 3AS1A 4JFDB 4F9PA 2AV1A 3R06A 4DGVH 4KVNH 4Q9RH 3WMSA 3V4UH 1S78C 1B3JA 2NTFB 2VZTA 4MAYB 2LAGB 1FZMA 1RJZA 1LO5B 4QRQB 4XBPB 3CFKB 4AM0B 1IAOA 4HLZG 1ZHKA 4YHLL 3H9SA 2R2CA 4HIEA 1NFDA 3A6BH 4LLUB 1JGLH 4ZFGH 5DGRA 1S7WB 1QG3A 5GRUH 2GK2A 4XHJC 2Y1VA 4HSQA 1FYTE 1CD9B 4J4PC 2BY1A 4JG1H 2ICWA 4CN4A 2D0FA 3RWJA 4E42A 1BZ7A 3GFUA 3LIZH 1WFUA 5KN5B 3V4VL 5JIPA 1NFDB 4HCRL 4QXWA 1S7WA 4L4TA 5HHXL 5EU6E 5ENWB 1CL7L 3GGWA 2GEEA 1BEYH 1TZHA 1PW3A 5J89A 1Z0MA 5IB2A 4XNQA 1NC4D 1RIVL 3BKCH 1OSPH 1O5DT 2IAND 1P4LB 1AE6H 1SY6L 5T1DH 2CUIA 3WO4B 5KSBB 3DMMA 3ALWA 3L6FB 3RPIB 4L5FH 12E8H 3RVWD 3LV3B 5IM7A 3MNVA 1QQDB 3OJVC 2R9HD 3BPCB 1MWAB 4LDOB 3U9UA 3L3GB 4YGVA 4XP9L 3LMJL 3WKMH 3BQUA 1X5JA 3INUH 25C8H 3C6LD 1OD7A 3W39B 1MJUH 5HGGS 3EDDA 1PKQE 1M05A 3KPMB 2NX5E 1X4ZA 3U4EB 1YEJH 3B9AA 1PSKL 5C09A 4LNRB 5DD6A 1OWWA 3BPCA 4LARH 1BAFH 3HZMB 4L9DA 1JGUH 1ZTXL 1F2XK 1OAUL 1QPPA 3HAEH 1NUFA 4U6XB 4OV5A 1BJMA 2AERT 2O93L 5EFIB 4GSDL 4JO1L 1M05B 1D3CA 4FQLL 1ZEAL 1FNSH 3J7HA 4YQXH 5C09B 5D93B 4ZTPH 2X2YA 4RAVA 4C56B 1NBQA 5J1AA 1G9EA 4PRIB 4ZSOE 5JXEA 3DX8B 5K9KA 4OLUL 2NY5H 1YEKH 3HR6A 4F57H 4JPIB 5JOPD 2ZUSA 3EGSB 5EBLA 5EFIA 1F8TH 5CILH 4FQPA 2DLEA 5CLWA 2AJ3B 2H9GA 2FECI 1PZ5A 2ICWJ 5D1QA 5IG7B 4UZGA 2G75A 3WJLA 4DFIA 5F1IB 5GS1A 1LEKA 3RWEB 2XWBB 4I18A 3RWCA 3D9AH 4HPOL 4QRPA 3Q5OA 5L8KB 3OBAA 2WBJB 4QXTB 3O3DB 5I71C 3BE1H 3K8MA 3KPQB 1UT9A 4KKAD 3SE4A 3AXLA 5HPMB 3UYRH 1FL6B 1UENA 3V7AE 4X9HA 2PO6B 2Q8BH 3MACL 3L5WA 3MFGB 1HXMA 4ONHA 4HS3A 1YNLL 2VXUH 1SYSA 4QRPB 2WSKA 4IDJH 4NC2B 3I85A 5HDBF 4EIGB 2XN9E 4AEIH 1JWMB 3EO1A 3EZJB 4E5XA 3HC3H 2BNQB 3T0VA 3GKWH 3RVTC 3LD8C 3T08A 3BAEH 3HKFA 1CGSH 1B2WL 2GK0B 2XA8H 1P6AB 4GRWE 4MA3A 3D39A 3CSBA 3BD5A 1NLBL 1MCIA 5GGUA 4XNXL 4F58L 3QUZC 4HW6A 1HXMB 5EN2A 2ED8A 3HLAB 1TPXB 1SYSB 1MIEL 1S5HB 3QPQC 3EDJA 1BWMA 3QUYC 2BNQA 2NXYD 2ESVA 4BJLA 3LS5L 1A6WL 3PUCA 2OK0H 1T1XB 4DVBB 2CUMA 2BJML 1QZ1A 5EC2A 1KCRH 2R4SL 1J05B 3U0TB 3QDJE 3HLAA 3S3SA 2RJMA 5B38G 3HMXH 3O81A 4YHZL 3K74B 4TULL 4P5TD 1LMKA 1QNZH 3EO9L 1K4DA 5DUPL 4JDTL 5I1GH 1U36A 5ANME 4JRXE 3WD5H 1HILA 1ZHLB 2J6EH 4LBEA 1MHEA 1REIA 5A3IC 1OSZA 3GSWB 5FYLL 5BV7H 5GGRB 3CZFA 5D5ME 4U31A 2P5EE 4WEMB 5I2IA 3UTSE 1C5DA 2NLJB 1AGCB 4ZNEE 1IJ9A 4PB0H 5TE4H 3BXNB 3HR5A 1ZWIB 2HLFC 5DFWH 5E1HB 5T1LA 2P4AB 4NN6B 3BH8B 1J0IA 5LQBH 5DFVD 2CKBB 4P9HH 4YNYB 2PTTB 4PJ5D 3NTCH 5F9WB 1RUPH 4LCCA 3HC0A 2ZZUT 5E5MB 5DQ9B 1WBYA 1X7QA 3LRGA 3TN0C 4I0PA 1OAYH 4ETYA 2NLJA 4NQSA 5CEXA 4U0QB 4XMPL 1NAMA 5F3BB 3TYFA 1SVZA 5ICYA 2X1PA 4HD9A 3O3AB 4MNGA 4DAGH 4YNYA 1F4HA 1QBLL 1RZ7L 5E8OA 4P5TB 5INCA 4S2SA 1CBVH 3B3IA 1U8NB 2P42B 4JFHE 1EERB 3ZO0A 1WBYB 1X7QB 2MKLC 3I6LE 4TOYL 2L7JA 1RIVH 3BKCL 1T04B 1J0JA 5B4MD 3MV9A 3GSUB 3U1SL 5BQ7A 4DK3A 4U1GC 4K7PH 2EH8L 5EO0B 4MNGB 3PDGA 5E1AB 4X7TB 3W0WB 3QFDB 3G6DL 2R23A 5H37H 5E8OB 5IGXL 1WEJL 3MRFB 1IAOB 4UT7L 5DO2D 5HSFA 3ZYJA 2X4OA 5H94A 4Z7OF 1FBIH 3S5LG 1I8IA 4LEOB 3X17A 1MNUH 1XCQA 3CFBB 3C60C 5IJVA 2Z93A 3MV9B 25C8L 5D7JA 4D9QD 3PL6C 3O3BA 5IBUG 5FECA 2JELL 5E2UL 5CJOL 3RWJB 2LQRA 5C0BB 1P84K 4JVPA 3WEXB 3TZVA 2V17H 1S9VA 4JY4B 4I9WD 4F7CB 4IRJB 4ZUWA 1RV6X 3RKPA 1JNLH 1IEBA 1Z6JT 3MCKB 1WVZA 3QJFB 2QQNL 3CX5K 5TE7L 1AJ7L 1MCNA 2ZUWA 1CGSL 1I3VA 1QSEB 3ULSB 1I7ZA 4Z7UA 1MWAH 2H3NB 3PV7A 1NLBH 2FRGP 3JBG7 4ELMF 5A16A 3DSFH 4IS6A 5F7UA 4F7CA 1BIHA 4YHPA 2VLJB 2DTMH 5F9WC 3O6LH 4RAUA 2NY5L 1HZHH 3TO4C 1NDGA 5CCKH 4ZS7L 5F9OL 5B3JF 3WIHH 3NA4A 1X5YA 1NUDA 1OL0A 1UACH 4EUPA 1S7QA 3QFJE 1QSEA 5AYUH 3RVUC 3DVFA 1M7IB 3RWDA 1RMFL 1INQB 2WK2A 2E7LA 4ENED 2Z31A 1FVDA 4JG0L 1GIGL 2IAMB 1EJOL 2RB8A 4IS6B 1KXQE 35C8L 1XGYH 1MCSA 3M17A 4O2FB 4ZPTA 2F54E 3X14B 4L4VD 3L3DA 1D9KC 1FFQA 5C2BH 4ZDHA 1HSBA 5EU6B 1INQA 2VDQL 2J6EL 4J3VA 3T1FA 2Z4QA 2F53A 4GKZA 1NGWB 2BVUA 4TUKL 3VI3F 4KROC 4XCCH 2GTZA 4GBXC 5I9QB 3BIAX 2K9UA 4NKMA 2FJHA 4N0YH 1IL1A 4P2OA