4LCUA

Structure of kcsa with e118a mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuA02
4WO4D 3FOMA 4U6YB 5CILH 5IEKB 5HY9A 1QQDB 3VXUB 5T3ZE 1CDCA 4OGYH 3MA7A 1FLTX 1MHCB 3HMWH 5CEZH 4R2GD 2A9MH 1EEUA 1LK3H 3F12A 3HB3C 2OMBA 3CPLB 4XMLH 4LBEA 1G9EA 3MQIA 5CJOL 4W6XB 4Q9QL 2OR7A 3VXUE 1P7KA 1S7SA 2CRIA 3KPSD 4JDZA 4QHLA 3JV6B 5DS8B 2E6QA 3B8SA 3TJHC 4K7PL 2NW2A 3N1MC 1RZIA 4Q6IB 2ADFH 4ZUUA 4Z5RB 1N4XH 3K46A 1C5DB 1WBXB 2VAJA 5EH1A 3K1DA 4KROC 4X6EB 4I18A 1GHFH 3O8XD 3QT2A 4MZ3A 4Y7MA 4PRHD 4YPGB 1N59B 2P24B 2YD4A 4P2OD 3GBML 2ZJSH 5IBTL 5FYKH 3QIUB 1IKNC 4XTRD 3U4EA 1YJDL 3ARBC 4I1NB 4XCNB 5GRVK 1ZT4B 3F7VB 1Q0XL 2NY7L 3QXDB 2OTWB 2DTMH 4G6FB 2CR3A 2X1WL 5CJQH 3NOIA 1A3RH 4N0FB 4PJIB 4HAGA 1JHTA 3CVHL 4NWTH 2UWEB 1VERA 5LCVL 4LPWA 4U1SA 4WIQA 4R7DA 3V6FB 3CU1A 2OQJA 3L3DA 2AAVA 3QXAB 4XPHH 3WHXB 4DEPB 4NT6A 3TN0A 1MRFH 4I9WD 4PJIE 3AU1A 1WLHA 5FA3B 2UWEE 5FKAB 3DO7B 4WFFD 2FSEB 4F7EB 3HZKB 3TV3L 1AKJA 2EXWD 1JPFA 2VMFA 3T0AA 2BNRA 1NCAH 4L9DA 4ODXB 5DD5H 3REVB 5T3XD 3EOTL 4X7SL 3KPSE 3RL1A 3V8CA 2XWJB 3VXSA 1JRHI 4FQJL 4OCYH 3O6LH 3O8XB 4MCYA 4PRHB 3RIAK 3BWAA 4P2OB 4XXCA 4JM2C 1NGWB 4XH2B 3UXFA 4TUJB 3VD9A 4PRIB 3GSNH 4HKBB 4J3TA 1Y6NR 5C6WH 3GMLA 4PRHE 5INCA 1B0RA 3QG7H 3DXAD 4NQSA 1I1FA 1KIPB 4OT1H 2IFFL 3QHTC 5CJXA 1TVDA 5F9DC 4XHJD 1X4XA 1Q9OB 3D85A 3VH8A 5DEFA 2KKQA 4NJ9H 1MIMH 3WFHA 3QFJD 5EU6D 3RAJL 1W72L 4FP8L 3CVHA 4K71C 1DL7H 4CW1B 2Z93B 3RGHA 2EKJA 4XZUB 4ZFGL 3UC0L 5D9SB 1IE5A 3GJFK 3NGBC 2E9IA 4GKZA 2AJSL 4JRWA 4EDXA 1T0NA 2IBGA 3MJ9H 2NZ9C 3V8OA 4KTDH 4JG1L 4P59L 3VXPB 4Z7QE 1LEGB 1RK1A 3JTTB 4PJGE 4Y16C 1YMHA 2PR4L 5CILL 3WUWA 4I9WE 5I6XB 4LLYA 4OGYL 5CEYB 2BHYA 3HMWL 3H3KA 2HMIC 1U8HB 1G7MB 1G7HB 2R1WA 2NPLX 3U46A 4OD2A 2A9ML 1PYWB 1LK3L 2R0KH 2I24N 5T3XE 2F54B 1TJGH 2M8XA 1OAZL 1OARL 3HE7C 5DZNA 1RVFH 1KCLA 1II4E 5KSVA 4PJCE 3ECBB 4OLZH 3DXAB 1A7NH 5I1JL 2K1MA 3NPSC 1WCBA 2VSCA 3MGAA 4TQEL 4P4RB 5D2LF 1P9MC 3L7FB 2CLRA 2DM4A 5FHAH 3F6IA 4TRPH 1S9XB 1DUZA 1EEZB 5TE6L 1LE9A 2AQ2A 1M71B 4XVUD 3DXAE 4ZTOH 1CFSA 3U4BL 4JFPA 3S7GA 4M3KB 1PVHA 1H9VA 3PDOA 4MJ6B 4HZLB 5I1IH 1F4HA 3EHBC 3P9LB 3TO2A 2GSIB 2ZJSL 5F3BB 2P48B 4PJBA 2ZSWB 5EU6E 2NXYB 2GJZB 3K81A 3BKJH 3L5WA 3P3YA 5HI3D 4D94A 2IPKB 2B5IB 3D3VA 3P77A 4M5YH 1OTSC 5CJQL 3V6ZB 1C12A 4NWTL 3MGOA 5C0RH 4N0CD 4ZPVA 1NGYB 4J3WA 4YEEA 5ESQA 4HIIA 4HHAB 4XPHL 1BFOA 4XMPH 1JNHB 1NGXA 1MRFL 2X89D 4LSSH 5AAWA 4NWUH 3C60D 3CX5J 3MRMB 3MSPA 3NPZB 4ZO8A 1RUQL 1FL6B 3AM8C 4LSPH 5DD5L 4L4TA 1TCRB 1DQDH 4D0BA 1X5LA 3PE9A 1AQDA 3WHE0 4RFOH 4OCYL 3RDTD 1WFNA 2FBJH 1B0GB 2B1HH 4H5SA 3ROLA 3VXRA 3T4YA 4PJEB 1OAXH 2D0FA 2D03L 1NFKA 1MCWW 1KIRB 3G6DL 2GK2A 3BQUD 1Q9WA 1UCBH 1PW3A 2XA8H 4I4WA 3UEZA 2JK5B 1OL0A 1XCTA 3R0NA 3RBSA 4OT1L 4XXDB 1JYVA 3G5VA 1ZHLB 3QH3B 1G7IA 5FO9A 2CDEB 2UVFA 4NJ9L 4L8SA 1MIML 5D1ZD 1JPSH 5E5UB 4JFFD 3RZCC 4RWHA 3T0ED 5DT1L 1NUFA 2ZUQC 3LHPL 4XX1E 3GJEA 4X99B 3P11H 1DL7L 1CGWA 1JF1A 4KQ4L 2EH7H 5D96B 3FO0L 2R1XA 5TDOA 4ERSH 1JWSA 2MMXA 1MFBL 1FORH 2NNAB 1WBZB 1T3FB 2VDNH 5GISH 3JWDH 4KRPD 4JLRB 4I2XE 5SWSB 1EV2E 1A9EA 4JY5H 4GMTL 3RFZC 1NBYA 4QEGA 1KLFA 3L9RB 4WV1B 1FNSH 3CCHB 3LQMA 3RDTB 2HT4D 3G9VA 5I1GH 1RV6X 5SWSE 4PPTA 2R0KL 3HNVL 4XBEL 5F1SA 3RJDA 3SQBA 1K4DB 3ZKXB 4KZEL 4BH7B 2CRMA 3MMEB 3IDJB 1TJGL 5HVHC 1LVEA 3VGGA 2GW5A 1RVFL 1OY3B 1RJZA 4GW5A 2VXUH 3GSNA 4NZDA 4NBZB 2VH5L 3P4LA 1DEDA 1A7NL 2IALB 4NO0B 1UVQB 4N8VG 1NGPL 4X8JA 3UZEA 4U1LA 1PGRB 2A83B 5FHAL 3GSXB 1SJEB 5IB4A 1AE6L 3VFGH 1NC4D 1JJUA 1N8ZA 1TQBC 3EYUH 3VFMB 3DJ9A 2NY3C 3RWFA 4X83A 1T5WA 3NA9H 4KK9D 3QZWG 1X3DA 1X5IA 2NY0B 4LVEA 3RKDD 3E2HC 4UV4H 3IU4L 3T0EE 5D1QC 1Y6MR 4KRPB 3S3JA 1YY9D 1H8NA 1MFDL 3BP5B 1RAMA 3SO3C 3KPPB 3DUUA 4PJDE 2BNUA 1MREL 3C9NB 1UXWA 1U8PA 1D7FA 1JRHH 2V7NA 4LVOC 4UDUA 1LHZA 4NYLB 2O61B 1CXFA 1IGIH 4FQPA 1L4IA 4KRNA 3UDWA 2R29L 1S9WB 3GI9H 1NDGA 4HF5H 5MHSD 5EBGA 4Z7NE 5GS0C 3RZWA 4JY6B 2WINA 5CIPB 1U91B 5DQ9A 1QNZH 3VFOB 3I75B 4JZJA 1T1XB 2X1XR 1DQDL 1KPVA 2D4FA 2DKSA 4EUPH 4RFOL 1HWHB 4MXQC 2FBJL 5C0DA 3HZVA 1SYVB 1EO8L 1OAXL 2ZCHH 4MSWA 2H8PA 4MX7A 2ZUSA 3QEUB 1F6FB 2KH2B 5H35A 1BD2A 2W07A 3QHFL 3UTQB 2LTQC 2NY1D 2YXMA 1P1ZB 3TBSB 3K74B 3HUJF 5JHLL 4NO3A 1ZSDA 3B9AA 2DYPA 5IVXE 2YA2A 4HS3B 1JPSL 3JTSB 5CJ8A 3X11B 2KBGA 4MDJA 1AGDA 3WFEH 3P11L 5IMMB 2IAND 4N0YL 3BPLB 1WGOA 4MZ2A 4Y89A 5FOBA 4LIQH 3C6LD 1DN0A 1FORL 3GMMB 5BS0A 1BJ1J 5GISL 3BE1H 2DQGL 4IMKA 3GUTA 4R0LA 5IEHA 4RRPA 2FECI 3WNNA 3TPUB 4M4RA 3FKUS 3KPLA 3GI8L 3CFCH 3TBYB 3IFOA 3AS0A 5TE4H 2EECA 4LMQE 1CICA 5I1GL 3IJHA 5DRZA 3LKRA 1I3RA 4ODUA 4LAJH 4WGWB 2PO6C 5CJBA 4PGBB 3I3BA 4R90L 1BIIA 1OW0C 4ZQKB 5DMKA 3S3SA 1LP9A 2VXUL 3LQZA 1JYNA 4NQXA 3FT2B 5L8KB 4Z95L 4WNQB 3WFCH 1NEZG 3CFDB 4ZSOB 1ERNA 3SDDB 2WWKO 4ISVB 2MQ3A 3VFGL 1U9KA 1A7RL 5FYLD 2R1YA 4HXAH 3EYUL 1D5ZA 4RGND 4PREA 4KJYB 5LQBH 3NA9L 4ZSOE 4D3CL 4PJIF 2BY3A 4PB9L 4X9IA 5DJXB 2UWEF 4KV5E 1LDSA 1GZQB 4UV4L 1GZPA 4JR9H 2I60H 5LKNA 4YO0B 1A6ZB 2EICA 5F7WC 4PRAA 1JV5B 2GY5A 1NDMA 2O5YL 5FGRA 3PIQB 3UBXI 1FVCA 1MQKL 2IANE 1LEKB 4PLNC 4HULB 4M1CD 1HIMH 4OZHA 4Z7VB 2F8OA 3OAUH 2P5ED 1JRHL 4CVZB 1R3JB 4YZFE 4TUOB 2OM5A 4CN4A 3EYOB 1BPVA 3H9HB 5C09B 4S1RH 1HKLL 4AQ1B 5E4EB 4YHKH 5IWLA 1QBLL 1NPUA 1FQ9C 2X4SA 4OD1H 4EI5A 5JPNB 3PDGA 3GI9L 1QFWI 4HF5L 3DMMB 4PRDA 5BVJA 1ZHBA 3LPGA 2BVYA 3TA3B 4NQUA 4J4PC 4L1HA 4KKAD 3CXDH 1MHPH 1RIVH 1FAIH 5KBNC 4WEMB 2AK4B 3QUML 4YHMH 2G75B 3EGSB 1T83C 1R5IA 32C2A 1BVKB 3QJHA 4HLZG 4NO2B 1M6OB 1JMXA 2EIZB 3ARGD 2ZCHL 5ANMB 2Y6SD 1T89C 2Z8VC 4YDLC 4BH8B 1VACA 3QA3A 3T09A 5ITBH 2MWCA 5FYLE 3ARED 5IHBA 4Z7QF 2VB5A 2FWOB 4RGNE 4PJGF 3UROR 4S0TD 2W0KA 4ZS6D 1G9MC 5SWQA 3DGGA 5ANME 2W65B 1YN7B 3BDBA 3MXWL 1CFQB 1FNAA 1U8IA 2XNAB 4NUJA 4U0RB 7CGTA 2AXGB 3VWJB 3L3HB 3S88L 4XCYA 4JGMA 3WFEL 3TESA 3T0WA 2FJGB 3B9EA 4UDTA 1FGNH 3O45A 5E8NB 2P5EE 4PJCF 5L6YL 5I66B 2X4QA 3C08H 1YYLH 2Y7QA 3HRZB 2FX7H 2A1WH 2BY2A 1NJ9B 2FD6H 2C9AA 5LVEA 1S9YA 2ILLA 3CU7A 3VFPA 3GSWA 3CFCL 2OCFD 3GSUB 3QUMA 4I3SH 4L4VA 3BESR 4EUPA 2GKIA 4C58B 1VGEL 3ARGB 1KLGB 1XF4B 4CAGA 4G8FA 2XZZA 5JZ7C 1F90H 4WWKB 1TNMA 4DGIH 5DZLA 4EQ2A 4TPRH 5CD5D 3WFCL 4NGHL 4JE4B 2J12B 1SMAA 1X6LA 4HXAL 5IVOA 1QPXA 2AABL 3NFSL 1Y18B 5T1KD 5LQBL 1HHHA 5GIRA 3PNWA 3RL2B 2CIIB 3BP4B 3HB3D 4BFIB 4E41A 4U1MB 2V5TA 2I60L 4F57L 4RA3A 1T1ZB 4K23H 2BSRA 4Z7UB 2IC2A 1A6WH 2EH8H 1JK8A 2FO4B 3TJHD 3UP1A 3MROA 1JMZA 5CD3B 2ZWLT 3MLXL 1JE6A 4ETYA 1MCJA 1GC1L 3A67H 3GJFB 3KHQA 4QT5B 4U6VH 5DWUH 2JJVA 3L1OH 3ULUL 5ISZB 1FIGH 5GHWL 4AMKH 2X7LB 4MD4B 4QRSA 3SJVA 3Q3GB 3K7UA 4X6BB 3WS6A 2OBGA 1MHHB 1AGFB 3OKEA 3ARFA 5HHOA 2CKBH 3DECA 4K3EH 3ARBD 4LSUL 1R24B 4MHHI 1R0AH 3N1QC 2VIRB 3PG2A 3CXDL 5HHQA 3AB0C 3DROB 1MHPL 3ULVD 1H3WM 3S3PA 1CGTA 1KEML 3OXRA 3M07A 3G6AB 1R3IH 4QXTB 1LO2L 3TVMC 3MFFB 3X13B 5T1KB 1CD1A 3J7HA 4A2MA 4GKNA 3E0GA 2R2HB 1TVBB 3GIVB 2Q7YA 4F2MB 5FXCH 5ITBL 1PKQA 1CU4H 2BC4A 5C0BA 2CLVA 2V7HA 2I27N 4O51A 4FXKB 2A9NL 4FQHA 4DUVA 3IJSA 5FEBA 2RAMA 5DQJA 3LKSA 4KI5C 4XBPB 1AQKH 2KL6A 3DUSA 3C5SA 3GDBA 3EDEA 3NIDE 5T1MA 1INEH 1HQ4B 5B3JE 4YE4H 1YMMD 3ARWA 4UI2A 1OGTB 3CC5A 3DX7B 1NLDL 3AGVA 2FX7L 2K9UA 3QISA 2A1WL 3MRDA 4FHBD 4D0DB 1S7UB 2FD6L 3FFCB 5GGTH 3VFSA 1T7XA 1I3GL 3NCBB 4H25B 3OZ9H 3KDMA 4NRZB 4PV8B 1J0IA 1CGUA 3QUKB 5I1DB 4I3SL 3EO1B 4E42B 3PWLA 5BQ7A 1UGNA 2CGRH 2A0LC 2AV1A 2EDXA 3FFCE 3RWGA 4N0UB 3ULVE 5DRWA 1UG9A 5GJSH 4XNQA 5C0IA 3UPRA 3HZYB 5HHPB 3C2AL 4OV5A 3MRCA 4DGIL 2A6KB 4NHUB 4Y8DC 3RWJA 3BEVA 4EJ1C 3C8KB 3PQYB 4PJDF 2NZ9D 1MF2H 3ILPB 4L8BA 3VXMD 4N0UE 5K9JL 2Z35B 5I0ZA 4BZ2H 4R4FH 4ZFZA 4U1GB 4EDWH 1S5HB 3MNWA 2O5XH 1I1AC 3L5JA 2HT3D 4JFEB 3JWNC 5BMFH 4CMHB 2BZDA 4LSVL 5KTEH 2ORBH 5AYUH 5DI8B 2QADB 4Z7NF 2X1QA 1QFWH 3GHEH 2FJHA 2P4AB 3HE7D 4Y5XC 4WVRA 3WJJA 2YRLA 3SCMA 4JFEE 1P7QA 3CXHJ 1YMME 1A6WL 3OKYA 3FOLA 3JWOC 1P2CA 2VR4A 1FV1B 4LLVB 3KLHD 4PJ8A 2B0SH 1H5BC 3EKCA 4WFGE 1U3HA 1I9IL 1OF2A 3NCYS 5IMLA 5DWUL 4OLVH 4HUNB 1T1WA 3RX8A 2DQDH 4RQQB 1JTTA 5FIEA 3S36H 1T0PB 1TXKA 3NACH 3WLWC 2DQIH 3MRNA 3FN3A 1A6AB 3BW9A 5J6HB 4AEIH 2EEDA 1M7IB 1GAFH 1T21A 1BZ7B 2FATH 4K3EL 3RTQC 1KTLA 4KGLA 5I1LA 2VXSH 4LSTL 3FJTA 1QG3A 2C7UA 3D0LA 5B38B 2W9EL 2C26A 3OAZH 4PJFA 2P42B 1VEPA 3TH4T 1OTSD 5E8DH 1KCUH 1WUNT 1BEYH 3PXJA 3GSVA 4LF3B 3CDYA 4JAMA 3VG9B 4WW2C 3FQNA 2UY6A 1KB9J 1YPZB 1CU4L 3M17B 5L8JB 2YEZA 3NIFE 5C8JB 4YXLL 4LLQA 4HK0A 3U82B 3CLEH 4JPIB 2X4OA 4Q2ZB 4PTUB 4TVPD 2FECL 1DBBH 5IK3B 5CS7A 1EEYB 3IFNL 2JJSA 2NXZC 1XCQA 4S11A 1AQKL 3WNKA 3I6KB 3O6FC 3D1MC 4R4NC 1INEL 5EOQH 1IC5H 2XKNA 5C0JB 1ADQH 1ORSA 4G8IB 4N8PA 2ATKA 4P3CL 4Y19A 4PGJA 1PG7H 2ZOLB 4M8VA 2N1KA 4NQTA 4F3FB 2WP3O 3DVGB 2GJJA 5ESVA 1DLHA 3BKYH 5GGTL 3OZ9L 3MRLA 2DM3A 4APQA 1CDBA 5E8EB 3UTSB 4PJ9C 4I8DA 2VTFA 4D9RD 1MJJA 5EZIH 2YK1L 2CGRL 4NKQB 4KV5F 5BV7L 3RZCD 1LMKA 5GS1C 2ARWA 3ROOA 3H9ZA 2AQ1A 2LABA 3VWKC 1C5CL 2WBWB 5EZLA 3ES6A 3FZUC 1JHKL 3TA3C 2ICWI 2F74A 3MRHB 4AL8H 5FO8A 4Z0BL 5IB2A 2QEJA 4FQLL 3S9DB 1OTTC 1B88A 3O2DH 5EUKB 4HH9A 3GMQB 4YZFF 3MREB 1UB6A 4BZ2L 1NFIA 3MRKB 4QRQA 2O5XL 3OB0H 1TZHB 3P30H 5BMFL 3ARUA 1RHFA 2UUDK 3PWUA 3VXOB 2ORBL 4PRNA 1YY8B 1QFWL 4UU9B 3B43A 4WUUB 4JO2H 3KYKH 3DLQR 3QUZC 1I9RH 2AK1H 2CDFA 5MEOB 5D72H 2A77L 1XR8A 3IDGA 2IADA 2R4SH 4BFEA 1HWGB 3L95B 1F3DH 4FXGA 5GGTA 5BZDA 3FT3B 3K80A 2B0SL 4TSBH 5SX5H 5KW9H 2OL3B 1MAMH 4NDMB 3MCKB 2YPLB 5D7JB 4PJHA 4TN9A 4JY4A 4KHXL 3QULA 5CBEB 3TYGL 5CGMA 3S36L 1ZVSB 3IKCA 2NY3D 3NACL 3SE9H 3I9GH 2F15A 1OP5H 1AGEB 3ZDZE 4UTBL 4AEIL 2KQMA 3RPIA 1FZMB 1FN4B 3P4NB 1MELA 4UV7H 1IFHH 3VFNB 1MLBB 4MDIA 3KPTA 3UBXA 4BZYA 5IMOB 5KANG 3RKPA 1ZGLM 1N2RB 4OCLC 3T65A 4G5ZH 1AJ7H 3TIEB 4NQEA 5EA0H 1QR1A 2OK0L 1KCUL 2GITA 5IP4A 2EYSB 2BSSA 1CG9A 2E6PA 3SDCB 4IRSD 2HFTA 4AEEA 5GSRA 1OWRM 2X10A 5IMKB 5F9OL 4KZDH 3FB6B 5D7LA 1D6EB 2E5EA 1YEIH 3DV6A 3QDJA 1WIPA 2NW3A 2NY5C 4Q9BA 3SDYH 5HYJD 3OX8B 4N5EC 2Q1EA 5F3HB 3O3UN 3REWB 4WY7H 1ES0A 4C57C 3BDYH 4NZJA 3QIWB 2E7LC 3L3JA 2B1AH 2EE6A 1N5AB 2BOBA 1DQJA 1CBVH 3BT2L 3MR9B 4OF8A 5TQ0H 2QSTA 1MAJA 4LLMA 4PS4H 2BRRH 1A4JA 1RPQA 4M7LL 4PJAE 5EG6C 2H6PA 5IIEB 1J8HB 1PG7L 1S9VA 3QEHA 4PJ7B 3MRPB 4M4PA 3T4AA 3O0RL 3KPNA 3MRFA 2CDGA 4KDTC 5E99H 5ESAA 4HUMB 2M26A 3KYNA 4UNUA 4KUZH 1ZLWH 4NM4H 1T2JA 2K3TA 4QHNA 3S98A 1U95B 3QFDA 4HK3N 1KG0B 4C56A 3RIAF 1LD9B 1JP5A 3HE6D 5JHDB 4HDIB 1WQVT 4I18C 3VW3H 3KPQB 1AHWA 3MNZA 3EDKA 1LE5A 4LDLB 5HGDB 3BZDA 3V5KB 3T0DA 1SY6L 1CGVA 3S8WA 5E0QA 2MCPH 3K4ZA 5DK0B 4XP9H 5GS2H 2NTFA 2PW1A 3VU2A 5J6GA 3BZ4A 1QKZH 2X4TA 5J4MA 1E28B 4RA0C 5EU3A 3P30L 5HYJE 3O2VH 4TTDD 3D2UA 1ADQA 1BMGA 4XP6L 4FTVB 5EO1B 5T5NF 3WV0A 2PTTB 1T1YB 3KYKL 1I9RL 2PO6D 1GGBL 1MHEB 2Q8BL 5D72L 5A1AA 3R06B 4ZODA 1U6AH 5L2KD 3EDJA 4GAYA 4PG2C 2HFGH 5KW9L 1CDGA 4TSBL 2XV6B 5E1AA 5B8CB 5E8PB 3HE6B 3RP1A 1FVDA 4PJXA 5I19H 4W6YB 3CMGA 2Q86B 3OL2A 4RIRB 2XZQH 3I3EA 1ZLSH 2APWA 4YHPB 5HSFA 4K3JH 3QI9D 1IFHL 4U3HA 5FGCB 4LLDA 1VHPA 2BVEA 4HWNA 2IPTH 2DQFB 1YJDC 2AS5M 4TSAH 3O2DA 3NIDF 3MUHL 5DJYA 2ZUTA 5B3JF 1YEJL 3C6SB 1ZEAH 5EA0L 3RY4A 1KJVB 3QPXH 5FGCE 3TJEH 3DX6B 4AY0A 4MLSA 4P2RA 1QFUH 3VFVB 5HVWA 3HC3L 1NAML 2OS7A 3WN5B 2ZZUT 3U36B 5GJTL 4OZIA 3VE0A 1YEIL 1EO5A 3MLSH 1XF5B 4FFZL 1TVHA 4NN5C 5SWZB 5T5FH 1FO0B 3UJIL 4O2FA 5DEGA 3SDXB 3UPAA 4OSUH 3F6LA 2WV3A 3H9YA 4LOUD 1OOAA 1A0QH 3HFMH 5F9WC 3LEVH 4WY7L 2DLHA 2F53A 1UQSB 5LWYL 3QRGH 5TFSH 3ULVF 2O5ZH 3BDYL 5E1HB 2VXVL 3QIBA 2QADC 5SWZE 1B4RA 2B1AL 4WUKH 3SDXE 2LFGA 3CUPB 1QVOB 5F7LB 3TBTB 2BRRL 3QI9B 2WLYA 3DIFA 1NBQA 4GRLA 1I3VA 3D0VB 4LRNH 4HX1B 4IOSD 4HG4J 1JPTL 4MJ4A 4OCWL 5ALCH 1ETZB 5EB9A 5INDA 3BZFB 5KN5A 5K9QG 5LBSL 2NY4B 3ZE1E 5IGXH 3FN0L 1CI5A 1MI5D 2Q6WB 3H0TA 3VFRB 2GY7B 1V5JA 3FQXA 4IIQA 2XKUA 1BHGA 1KXQE 1FL5B 2AXFA 2CJUH 2HH0L 2Z4QB 5CWSB 1MEXH 3MOQA 4JRXB 1HHKB 3EW3B 4GQPH 4Y4KB 2CLZB 4XP9L 4MJ5B 2QTEA 1CR9H 1QKZL 3WNOA 3BGMA 3ZDXE 3CX2A 4ZTPL 5HGAA 2FRGP 2BX5A 4O2EA 4JRXE 1H3PL 2ESVA 3HA0A 3O2VL 3TNMA 2OJEB 2EYRA 3KXFB 3KR3H 1KYOJ 4GMSH 2RFXA 4TVSa 1MFAH 1EZVX 5JZ7D 4IRJD 1N0LA 2VDKH 4QOKD 1KIQA 3NCJL 2AJ3B 3ULSA 1NEZA 3KXFE 3MRRA 4U1JA 2DL2A 3PHQB 2HFGL 1KCRH 2HJFB 4WI4A 5GGVH 1FE8H 3IU3A 1XGUA 2XWBA 1JZ7A 3RNKB 3D9AL 5J1AA 2WBJB 3EO9L 3IF1B 5CGTA 3EDFA 3VI3F 5I19L 4R3SB 5ILTH 3NIFF 2HJLA 3NCEB 4GRWH 2XYCA 4K3JL 1XFPA 1AGCB 4RCAA 4Q6YA 5KANI 4GS7C 2YOCA 3NAAL 2XG4A 2IPTL 4X98A 4IS6B 4PY7A 3SDAB 4D9LH 4U49A 3V7AG 2YN3A 3OJ2C 3NN8A 1KCVH 4TNVK 3IS0X 4L8SC 1IKFH 1QFUL 2EDWA 5EBWB 3Q0HA 3HNSH 5EOCH 4P2QD 4IRJB 2JB5H 3U9UB 4OGZA 2F5BH 3CFBB 3EYQC 4OZFG 1DLFH 5D2NA 4L9LA 2EKSA 3WO4C 5T5FL 2DMBA 4CDHA 3OKNA 5E9DB 4Q7DA 1A1OA 3MCG1 4C55A 4QOKE 2W9DH 1DN2A 4ENED 2J88L 4NOFA 2EDBA 5C3TA 3TVMD 1W2KT 4Z7OE 4MNQD 3MRGA 2VKXA 4ETQB 1UWXK 3WIIL 1TQCB 2DQJH 3T0BA 2W60B 2F19L 3FCTA 4ODHH 4E0RA 4NQDB 3GSRB 3RNQB 5E08L 4KK5C 2AEWA 4YR6A 4R96B 5ALCL 1A6PA 5MEPB 5T33L 3G6JB 5CSZA 1CDHA 1CFVH 5DYOB 2FYYB 1HH6B 4YUEH 2AGJL 3MUGA 3QEQA 4P3DB 5IGXL 1FBIH 2DTSA 1UA6H 3S35X 1F3DJ 3V4UL 3GFUA 2VLRD 3G6JE 1G0XA 4HFUH 4YDJB 2CJUL 5D71H 4A6YB 3R1GL 5CEXB 5FV1L 5JMRA 3VD5A 1VADA 2V2TB 4P2QE 4XVJH 1E4JA 5ERWB 4CADB 1I7UA 1B0WA 4W70A 5DJ8A 2IGFH 1HHIB 3P0YH 1QR4A 3ZDZF 4MNQB 3QHZH 1PY4A 2N7BA 3WL9B 2P8MA 4WFHD 2VZVA 2A0LD 4JFDB 1MFAL 5LXGL 1DSFH 2ICWA 2VDKL 3UDWC 5JQ6H 4MCZB 2UZIL 4MNQE 2P43B 5DVKA 2VN7A 5ICYB 1WEJH 1CLCA 2VISB 5FHBL 1KCRL 3DV4A 3RVUD 1YDPA 4HEPG 2X5PA 4FQQA 1FE8L 1NCCH 5E6YA 5JO5A 4JZJC 3O9WA 4QRPA 1XF3A 4Y1AA 5DHYA 4YHNA 4HIJA 2OTUB 1JCKA 4S2SA 3T2OA 4F33B 1I1AD 3FHQA 5EIIB 4PY8I 3TBWB 2UYLB 4NFBA 1T7WA 1F4AA 4NFDA 3O11B 4B7IA 2V2XA 1U93A 4YGAB 1E27A 4P9HH 3TT3L 3C2SA 1U3YA 2OX5A 4NC0B 1G7JB 1LO4H 3KYMB 1PSKL 4RGMC 2VLRE 4G6MH 5DRNA 1KCVL 1KPUA 1DP0A 4WHCA 4Y5VA 1IKFL 5F21B 4GSDL 4PJAF 4BSVB 1YEKH 3MV9A 5F6HI 5EOCL 4LU5H 1VEMA 3MLVL 1U8QB 2JB5L 3VXQB 3WLWD 5J9PB 3VXTB 5DK3A 4UUJB 4DOHB 1MSPA 5EBMB 2J3SA 4WFHE 4XHQA 4PJ7F 3QXTA 3RTQD 3DYOA 2J8UA 5ADOH 2J4WH 1AR2A 4N90D 2W9DL 1OPGL 3PGFH 2KZWA 1CD9B 4DOHE 1F8TL 5BZWA 5CP7A 1ZHNA 4RNRA 3LN4B 4C54A 1CICC 4GAJH 2EDHA 5F88B 4LGSB 3B5GA 4ZDHA 2YD7A 5DO2C 3PHOA 4DGYH 4FQ1H 4KRMB 1WZMA 5KSUB 4HGWB 4HFWB 1U42A 5EZJA 5HYSA 4XWGH 4P57A 1CVSC 3HC0A 3V6BR 4QGYA 5TE7H 1IC4H 3V0WH 1KLUA 1M7DB 4Y4HB 4U2ZA 4WJ5B 3O6FD 1QUNA 1NAKH 4R4ND 1UA6L 2EE9A 3CVIL 1J87A 1SQ2N 3B6SA 4HFUL 2HWZH 3LRSB 4O58L 1QA9A 1LK2A 2WQRA 1I1CA 5D71L 3K8MA 43C9B 1KPRB 5E2VH 4DGVL 3JWDC 4XVJL 3N50A 1NGQH 4FFYH 1ONQA 1EFQA 2VDPH 4LCIH 4PBXA 2C1PB 2HN7B 1AO7B 4PJ9D 2X4NA 3P0YL 1N6VA 4X7DC 2QSCL 4XCFH 2VLJD 3RVXC 4N90E 4LHUD 5TH2B 1MRCH 4R26L 5EU7E 5L9DL 3MRIA 3VWKD 1MH5A 2ERJB 2F8VA 2FGWH 4MD5B 5FECB 5JQ6L 3O2WL 4EI5C 5D7KD 4KY1H 3GMNA 5I1KH 4EI6B 3T77A 3MJ7B 1YEDB 2WANA 2EO9A 4W6WB 4KKLC 1JZ2A 3WE6B 5DUBA 3HPLB 3RQ3A 1NCCL 3KPMA 1FDLL 2G2RA 4TTGA 3EOBB 4U6HA 1PFCA 1QP1A 2WQ8A 5FYJD 1L0XA 4FFVC 3MBEA 4YGVA 3KPRA 5HGGS 5I0DA 4ELMB 4JN2A 4FZ8H 4NZUL 2APTA 1HZHL 2EDQA 3D25B 3IVKB 4M7ZB 3WJLA 1OB1B 1NFDB 2ED9A 3PGDA 1A64A 4XX1G 1J9CT 4P9HL 2EXYC 1JI1A 1KBGH 1LO4L 2D2OA 3VRJA 2RQ8A 1BBJA 3ZKND 3ARDA 5I75C 2ICWJ 4DUXA 4G7YH 1LO5A 5IBLD 3SDXF 4G8GD 5IW6A 2YSSA 4MA1C 4LLWB 4YHIB 1E4WH 3DRQA 2ZSVB 4X6FB 4R4BA 1ND0A 3B9KA 3HC4H 4RGOL 3DYMA 1Z9SA 4H26A 4AENB 3Q5OA 4Y4KC 2CQVA 3MYZA 2K7PA 5E6IA 5ICXA 5JDJA 2UVEA 2VLJE 4M02A 5KVGL 4YDKH 2J4WL 1F4WH 1MPAL 5JW3H 2VL5B 5DJDA 3PHSA 3OQ3B 3ZE1F 4K8RH 5D7KE 4RMRA 5IOPA 1IM9B 1HXYB 2ATPA 4BYHA 3BPOB 2LU7A 2VDRH 1D5XA 2QQQA 5JOFA 2FLRT 3Q6FA 5F7YC 3LPFA 3MZGB 4XC1H 3KLAA 2BVQA 1A1NA 3ALPA 4MXWL 5FYJE 1J8KA 2QJDA 4YHZL 4ZXBA 1DE4A 3LH2L 3ZDXF 4OZGA 1WZ1L 5FCSH 1K4CB 2P46B 1IC4L 3EFFB 5DJ6B 2FBOJ 3GB7A 4G8GB 1HI6A 3V0WL 2VLKB 4WCYL 4NKDA 1GOGA 5IR1B 1CGYA 3V6OA 3BO8B 1VFBB 1INDL 4HWZA 5D5ME 2DLTA 4QTHA 2DN7A 1EPFA 3SKNA 5ACZB 3LQAC 4ZFOB 2R69H 3QQ3A 4G8GE 1AR1C 4I0PA 1VKXA 2GTZB 4GXUN 4LCWB 3QDMB 3KLDA 5E2VL 3E6HB 1DBKH 4G9DB 1WZLA 4OF0A 1R3LB 3SBWA 3VFTB 5HDLA 4U1IA 4PLOB 2WBKA 2VDPL 4LCIL 2ICEA 4M8QA 5ADPH 1Q38A 4D8PA 4CN1A 1I7TB 2B2XH 4LCWE 1ULVA 3LZFL 4R97C 3QDGB 5F1NB 4XCFL 4PP2B 4UQ2A 1RULL 1MRCL 4GG8A 3L5XH 4NC2B 5EFIA 5GGUA 1FG9C 1UZ8A 3I50L 2IQAB 3ARFC 4KY1L 4LRIA 5I1KL 5TGBB 2JCCE 3MO1A 3QDGE 3MOBL 3PABA 4MB5A 1VA9A 5EOCJ 5DD0H 3FT4B 1R3HA 3O3DA 1N3NB 2YBRA 3WHE1 5FGBC 4P46C 4K7FA 5JQHC 3EYFA 3H8NA 3SY0A 1DQQA 5ALBH 5F96H 2XKSA 2IAMB 3F12B 4QXGL 1HCFX 3EJJX 1BQHB 3MJ6A 2HFFB 1S7WA 4QY8A 3PGCA 4RBPH 3TN0D 1KBGL 5F89B 4JHAL 4ZUTA 4M62H 3RHWK 4G7YL 1JN6A 4Z7OF 4N8VB 1N26A 1VFOA 1RZIB 4LNRB 4P9MH 1KJ2L 1AKJD 5F9AC 3F7YA 5HPOA 3IDMA 3QAZC 5BXFA 2BNRD 2DAVA 3NZ8B 2JJTA 5MENA 4AZ8A 4NHCL 3VXSD 1KC5L 2QBWA 3RX7A 5TDPB 4OQTL 3QZWB 3SGDI 1IKNA 5H94A 4K94H 3T8XA 1F3RB 3IFPB 3QNZB 4FQXA 3U4EB 2AKRB 5A2IH 1ZWIB 3PJSA 3WCYA 5I1AA 1U8NB 5F1IB 4U31A 3L5HA 4GW4A 1U8JB 3D85D 3PWPA 1FPTH 5I8CB 1RD6A 3G6JF 5C9JA 2A73A 2D9CA 4LCUB 3G08B 4JZNB 1R5VB 3K2MC 4XC1L 5DHVH 3CGTA 4R7DB 3V0VB 5JA8B 4Y2DB 4DVBB 4MQXD 1V7NH 1L7IH 4NT6B 4IEFB 4OGAC 4U1NB 3C5ZB 4DZBA 4ONFL 5T1LA 1FYTA 5DXWA 3CXHK 2CK0H 1ZLVH 2V5YA 1XH3B 1MWAH 3BDXA 5J89A 1RJLB 2C4FT 3X12B 4HIHA 1AKJB 1T7ZA 3DGCR 2ZUUA 2BNRB 4XAWH 2OSLB 2VERN 1FZJA 4FQCH 4AT6B 4XNYH 4HQQL 4JM2A 4P23B 1U8KB 5HYIA 1NANI 2ICES 3W0WA 3LB6C 4PB0H 2JLLA 2R69L 5KVDL 1J1XH 3D48R 1WV7T 2BNRE 1RK0A 3BHBA 1C08A 2A2QT 4MAYC 1DBKL 2HRPH 3MV11 1Z3GH 4NQCB 3WJJC 3SCMC 1ZK9A 3CDGA 5GGRY 4HJJH 5ADPL 1DQLL 1T0MB 2R2EB 1OAUL 3D85B 3VH8B 1AD0A 3FQRB 1SBSH 3QJFA 1QSZA 2WK2A 5KVEL 1CFBA 2VWEE 4P5TA 1JWMA 2ARJA 3CVHB 1H15A 3MV8B 4G3YL 4HJ0D 1XZ0A 1T4KA 5IUSA 1WWCA 3L5XL 5FKPA 4L3CB 4XCEB 2J6EH 4HJGB 5AD0A 4OM1L 4GKZB 4UBDD 3T04D 1JGUH 3BKMH 4BSJA 5GRZA 3BIBX 4G7VL 1BBDH 2XICA 4ZNCD 1AXTL 1G7QB 1GOFA 1BQSA 4WU5B 3D3VD 2XT1B 4DW2H 4IRZH 1N6QH 5I8KH 4LLYB 5F96L 5FDWB 4OZFH 3U46B 5JW5A 2XN9B 4TVPL 5F1KC 2Q76A 5E2UH 4N1CA 3S96B 5IKCB 3HI5H 4H8WH 3U6RA 2DLFH 2XTJC 1NCUA 1GGCL 1QLRA 5IQ7L 3AXLA 3WXWL 3OMZA 2FDBP 4HUKB 3ARYA 3OPZH 4P4KB 4JRYA 1S7TA 5CFHA 3ET9F 1A4KA 4OLXH 2VL4A 4L4TD 1DUZB 2WIMA 3S37X 2CXKA 4F15B 3BP6A 4LASL 1QHPA 1FFNB 1W72B 3IB4A 2YA1A 3BJLA 3VXRD 4M6NL 3PDOB 1W0WA 3U1SH 3TO2B 5JLZB 3ESUF 1M4KA 3S4SB 4PJBB 1ZXQA 5FYKD 3L5WB 5FM8A 4JREB 4O2CB 3VGAC 1SMOA 5C71A 3TBVA 3OR6A 3D3VB 4APQC 4GXVL 4PJBE 2OR9L 1FPTL 3B3IA 2XY1A 1AD9B 1S7XA 3NBNA 2M1KA 3H9SA 1NUNB 4ZPVB 35C8L 1HSAA 4O02H 3U0PA 3D3VE 5ESQB 3TNNA 4P2CG 1EHNA 5JIPA 4RISH 3EYQD 1TETH 2N4IA 4LSRH 2PN5A 1D9KB 1MWAL 3AM8A 3MLZH 4L3AA 1DANT 4XBGB 1JBJA 3MXVL 5C2BH 4L4TB 3MRJA 2E8YA 3EYVA 4FQCL 4JFYB 4IDJH 5IQ9B 4DCQA 1AQDB 2I9TB 4JFZH 4YDIH 3ROLB 1NBVH 1C8PA 1J1XL 3BI9X 2MOVA 4L4TE 4NKMB 4WW2F 5DUML 1Z3GL 4I4WB 5EBLB 3GO1H 1EAPB 3VXRE 4HJJL 3MRQA 3G5XA 3TYFA 3CFJA 3H7BA 2OI9B 5T5NG 1G7IB 2GT9A 1KTKE 3FO1B 3OR7A 4M1GH 3WSQH 4PGCA 1H3GA 1K6QL 5TDNB 1MVUB 3MV01 3S5LB 3RGVA 3GJEB 2YRZA 4YXKL 1MCBA 4IOIB 5DHVA 3ZKMC 4YK4C 1JF1B 1LILA 1CK0L 1TITA 5DJ2B 3HZMA 4PP1C 4AEHL 5C2UB 1IAKA 1JGUL 2VDLH 1BBDL 1J12A 5I71B 1QFWM 1MWAA 1JUFB 1WFOA 1CXLA 3BPOC 4POUB 4D9QD 5FCUH 5IW1A 2ITDB 4DW2L 4IRZL 5KOMC 3DURB 3BN9D 5I8KL 3RY6A 1UFUA 4Y5YB 4UIMA 3DI2B 4M6OH 4X6CB 3HN3A 3HR6A 1K3ZA 4PGEA 5GS0L 5E2UL 1BQUA 2DJ4A 2A6JA 2EDTA 3HI5L 1WZKA 2G9HA 5CP3H 4KRLB 5ITFB 4WFEE 2YD1A 2R0WL 4GUPA 1LNUA 2Z91B 2QQKH 4FNLH 1D3CA 1ZLUH 1I7ZB 1WWBX 3OPZL 1AH1A 4X6CE 3HPJB 1M7XA 4OLXL 5IB4B 2GCYA 3KYOA 2XWTA 3BXNA 2HT2C 1KTDB 3D87B 5CMAA 3I2CL 4KI1A 2P44B 1Q94B 3CJJA 3U1SL 5GGRA 4M93B 1JFQH 5D1QA 1HNGA 4X6DA 5E5MA 1T04A 1BD2D 1DQMH 1QRNB 1YEEH 4KJQC 1T2QH 5C0CB 4O5LH 5DJZB 1WJ3A 4DZ8B 1X7QA 1JVKA 5EU5A 5D5MF 3TH3T 3WS3B 5FO7B 1UXWB 1U8PB 2DYPD 2V7NB 2VZTA 3HS0B 4UDUB 1MCPL 3HG1A 1NANH 1JZ4A 1QRNE 3RY5A 3HUJA 1FZKA 4OZFA 5C0CE 4O02L 2JELH 4LCCA 3OSKA 5EPMA 3QUXC 5GSVB 1DBAH 4PY8J 1TETL 4RZCA 4B53A 4AG4H 4LSRL 4U6YA 5IEKA 5BS0D 4XGZB 1QQDA 3VXUA 4CU7A 1EJOH 1MHCA 3MLZL 5IT2L 2G5BB 5C2BL 1Q72H 3CPLA 2UZYB 2PCPB 4JN1L 4IDJL 1AI1L 1EUUA 4JFZL 5CZXC 3PP3H 4NN6B 4DWHA 1CICD 1NL0L 1NBVL 2JCCF 3O4OB 3VMNA 3JV6A 1BVLA 2GJ6A 5HXMA 1VPOL 5C07B 5DO2D 1UM4H 5DMGC 5F6HJ 4Q6IA 1C7TA 3OB8A 4UQ3B 1BECA 3MV7A 2MPAH 4XNMB 4Z5RA 3O41A 4X6EA 1UYWH 5HYQB 1KEGL 3QB7C 2P24A 3WSQL 4M1GL 3CH1A 5H37G 1BD2E 1VENA 2DQHH 1AGDB 2XI9A 3QIUA 2DIAA 3MLYL 4XCCH 4NKIH 4XCNA 5IVZB 3WKNA 1ZT4A 3F7VA 5HHMD 3H3PH 1I4FB 3QXDA 5F70A 2OTWA 1I3UA 5LAXB 2VDLL 1DN0B 1AFVH 5A43C 5B38G 4GFTB 2H2SC 3GUTB 4N0FA 4PJIA 5KS9B 1CZ8H 3GK8H 2H32B 5HVFB 5FCUL 3V6FA 3MA9L 1K5NB 1QOKA 3IFOB 5A2LH 1T5XB 3QXAA 5FM5M 5BS0E 1XGQB 4X4MA 2R23B 5BOPA 5F6IB 4O00A 3LKRB 3RVXD 5KS9E 1XIWC 5FA3A 4M6OL 4K2UH 2CIKA 5FKAA 2B4CC 3C5ZC 2FSEA 3U7YH 1A7BA 3HZKA 1ZT1B 3H7LA 2IG2L 4EI5D 1QZ1A 1LP9B 4ODXA 4JDTH 1A2YB 3REVA 3BVNA 1AC6A 4OIBA 2QQKL 2XWJA 3MLRH 1YA5A 4OAWB 1WIUA 3A6CL 4CMMB 1ZANH 5TPWH 1Y6KR 1HHGB 1I8IA 4XH2A 1RMFL 4TUJA 1LP9E 2NY2B 3UX9B 1CE1H 3QIBC 4M6MH 4PRIA 2V9TA 4HKBA 1FFQA 3WD5H 2VABB 3GNMH 1ZHKB 3U7AA 3DX9B 3RRQA 1KIPA 2YD8A 4O9HH 4B5EA 3T3PE 4GRLC 1Q9OA 1G9ML 5MI0B 4P0DA 3IETB 2OTPA 1DQML 2EXYD 3KJ6L 1VGKB 3TCXA 1YEEL 4O5LL 1WC7B 4KMQA 5HHME 3SGEI 4M00A 4CW1A 2P1YA 1QYGH 4XZUA 3U9PH 5EWIH 5D9SA 1KSRA 5C7XH 1KYOK 3D6GA 1OQXA 4ODTH 2J1KA 1DBAL 4IIQC 4ZAKB 3QCTH 3P4OB 3VXPA 1KELL 1LEGA 4J4PA 4PRDB 5DK2B 4NN7B 4XT1C 5E2TH 1D6VL 5CEYA 3F58L 1URLA 4HMDA 1U8HA 1G7MA 4ACPA 3GKZA 1SYSB 4HIXH 1PYWA 1X9QA 4KKCC 4YBLB 4P49A 5AYQA 4I0CC 2GFBA 2F54A 1MJ8H 3JSSA 3QUYB 4OF7A 1IGCH 4X5XA 1MIEL 4L4VD 3LS5L 1T89A 5E00A 5CIPH 3ECBA 5E2WH 4PTTB 1P5VA 1UM4L 1F45A 1EAJA 3L7FA 3V52H 1S9XA 1EEZA 2MPAL 4JQXC 4AQOA 5IESL 3DGGB 4IJ3C 1HK6A 1UYWL 4NIKB 2JIXB 3BYTA 4NRYB 4MJ6A 4HZLA 2Y07H 3P9LA 2GSIA 3O6MH 2VYRE 5F3BA 2DQHL 2ZSWA 5D1XB 5KSAC 4HH8A 3RUGB 4AIZB 4XCCL 3B83A 4UDTB 5JW4Q 1AR1D 2IPKA 4E41D 4P48A 3WFDH 2X6MA 3V6ZA 5A16B 3TT1H 4P3WA 1S9YB 1CZ8L 1TPXC 4UTAH 3RWIB 1GGIL 1NGYA 4LVNC 4F9PA 5IFAH 4HHAA 2ZNWA 3QUMB 1QLFB 1I1RA 3OKMA 1JNHA 2D31B 4M43H 4K2UL 1UH4A 4G43A 4JFOB 4Q58C 3MRMA 3U7YL 4OKVB 5TJWK 3SJVD 2G60L 3ZL4L 1D9KC 5D2NC 1FL6A 3ARFD 5HHOD 4L9LC 1LDPH 3AS2A 4JDTL 4L4VE 4QTIH 3W2DH 1BX2B 1TCRA 3ME0A 3ZSSA 2IH1A 3MLRL 4PJBF 4U7KA 3VXNA 2Y23A 3RA7H 2P8PB 4G9FB 1ZANL 3FO2A 4PJEA 3FQTB 3CIQA 3L3GB 4HMCA 4F7TB 3THML 1CE1L 4PLJD 2EIDA 4M6ML 2J8HA 3MLWH 3FMGL 3AAZB 4KAQL 3GNML 1HHHB 2JK5A 5EO9B 4G9FE 2VQ1B 3QH3A 1XGTB 2QLVB 2CDEA 5C0BD 3T08A 4K7PX 5I1EH 1HQRB 3SE4C 3UO1H 1JNNL 3D39A 4X99A 4HWUA 3H3BC 4NCDA 4E41E 1ZVHA 5DGRA 2VDMH 4KPHH 3U9PL 1AIFA 5EWIL 4YQXL 4DN3H 5C7XL 4M61B 2NNAA 1WBZA 3BUYA 1T3FA 4ZOBA 3EJZD 1P7HL 4JKPL 4ODTL 3M1BB 4XAKD 4YBHA 2AEIT 5SWSA 3SJVB 2EO1A 3QCTL 2P8LB 5IB5A 4YXHL 1BF8A 4MNHB 1FNGB 3TEUA 3TZVB 2K7QA 4KDVA 2R2BA 4WV1A 2H1PH 2HYMA 3CCHA 3BAEH 5HHQB 3LPWA 3SJVE 4HIXL 5J06A 5ICZB 1KN2H 1J88A 5HHOE 1K4DA 4JANB 4EN3C 1AP2B 3MMEA 4FFWC 3IDJA 1MJ8L 4GBXC 3VCLA 4PFEA 2H2PC 5DJAB 1FRGL 5JORB 1RUKH 1CD1B 4RFNB 5JIHA 5I9QB 1Q8MA 4OB5L 1KGCD 5BVPH 1UM5H 4ZMAT 4AIOA 4NO0A 2H45A 1DVFB 3LRHA 2ZUXA 2A83A 4OGAD 1CFTB 1SJEA 4IDLA 5FYLH 2NY6C 3V52L 5FB8A 1OP3K 1IQDB 2V5SA 4MXVE 3IJSB 4ZUSB 3VFMA 5E6ZA 1YUHA 3O9WC 2Y07L 3O6ML 1SVZA 3C87A 3C5SB 4NRXB 4JVWA 1F3JB 5J11C 1OD9A 5AWNH 4X9BA 3U48A 4FG6D 3BP5A 1NH6A 3GMPB 4YC2B 3KPPA 5HHXH 1IGTA 4XNZB 4X6CF 4XP5H 5M7QA 2VDQL 3JWOL 1A47A 3C9NA 2A74B 3SCMD 3ULUE 4Q9CA 3R4DA 1P7QD 4NYLA 4XAKE 2XZAL 1FNEB 2O61A 3O6KH 4UTAL 5I15L 2MQ0A 5IFAL 4PJ8D 3F7RA 3T0VA 4L29A 3H42H 4HAFA 1U3HD 3W11C 5BQ7B 1OSZB 1S9WA 3O4LB 2EDOA 4YNYB 4JY6A 3JVGA 5CIPA 5I74B 3UPRB 1U91A 3LKNB 1F11B 3VFOA 3I75A 3CK0H 1LDPL 4JO3H 1UZ6F 1T1XA 4MJIB 4NO5A 4QTIL 3ALXA 2X70B 4X9HA 5DD3H 2HTLC 3O4LE 1KGCE 4GQ9H 3SGEH 3UJTH 2PXYB 2Z31C 1IAMA 5L8LB 3HI6H 2CK2A 2AJYH 2VOTA 4K3DH 2BFVL 4ELKA 1SYVA 3BD3A 4IMLB 2OZ4H 2CD0A 4HUUA 1J1OL 1WF5A 3MLWL 5JIKA 3VMPA 4J3UA 3UTQA 3DVIA 3CSBA 1P1ZA 1IT9H 3TBSA 2NY5H 1RIUH 4POZD 5AEAA 2HG5A 3OJDA 3M8OL 1P7QB 5DQDH 2QQNH 2XTJD 3UO1L 3X11A 3ARSA 1H5BA 3DRTB 5IMMA 1P2CB 5BJTA 1JF6A 1RZFH 3MGTB 4PJ8B 4TOYL 1U3HB 1I1YB 1FSKB 2AEPL 4WW1B 1XF2A 3UYOD 1WVZA 5DMYA 1MOEA 5CCKH 5I17B 5EN2A 2H26B 4Y19D 3QCUH 1FG2B 5HVGB 2V9QA 3TPUA 4HT1L 2BVOB 2D3VA 3TBYA 3GJFH 2H1PL 1G7PB 4KQ3H 3D0LB 4HUXB 1PAMA 1TLKA 2W91A 1EZVY 4APQD 1FNHA 1KN2L 2FR4B 1UJ3B 3E6FB 4PGBA 4PJ5B 3V4VL 4ZQKA 3GSVB 3P4MB 4LARH 5F7NC 3D69B 3QYCA 3FT2A 4K9EH 4N68A 1DJSA 3FQNB 4WNQA 4PJFE 5JNYB 5MEQB 2YEZB 3CFDA 2Z8WC 3SDDA 4ISVA 3WIHH 1BFSA 2X4OB 4BFGA 1EH9A 3QQ9C 1QSEB 3HAEA 1RURL 4FA8A 4KJYA 5JXAH 4I0KA 3CSGA 5KS9F 3MBEC 3ZT7A 1RJYB 2A6DB 2XTJE 1ORSB 4YO0A 1A6ZA 5AWNL 1JV5A 4QHUB 2OP4H 2B39A 2CUIA 1U58B 3PIQA 5D93B 1LEKA 3WJLC 3WFBH 3EFDH 5HHXL 2D7TH 4Z7VA 3B2VH 4XP5L 2Y36H 2YWYA 4HGMA 5I18H 1DLHB 1R3JA 4KC3B 2FX8H 3W81A 3EYOA 3O6KL 5EC2B 2BVUA 3H9HA 5C09A 1LP9F 3ARDC 4Y19E 3MRLB 3K4DA 1NC2B 2BSED 3T3ME 3A6OA 1GPOH 2FB4H 1OP9A 1X5AA 3H42L 5JPNA 2HJKB 2ZKHL 3DMMA 4ZAKC 3LRGA 1DFBL 4X0KB 3WEXB 5C08A 3TA3A 4MQTB 3ZKMD 1CGSH 3ARVA 3ULVH 5EZLB 3ES6B 3CK0L 2XY2A 4HBCL 1MCNA 2AK4A 5E6IC 4WHDA 3AS1A 2EDLA 4HPYH 4J8RB 4YBLC 1BVKA 4NO2A 1M6OA 3HI6L 2AJYL 2EIZA 4K3DL 2VXQH 3BPNB 2OZ4L 1F02I 5ANMA 3BRDA 5KAQF 3JV5A 4JGUA 3G04B 1YEGL 4NQED 5DMIL 1HXMB 2X05A 2B20A 3INUL 4XPBL 2FWOA 3QUZA 2Y25A 2NY5L 4ZOCA 4JPKH 4BUHA 1MNUL 5J1SC 1JHLH 1YN7A 5F8QC 1CFQA 4ZXBC 3QDJD 3V5DB 1IJ9A 1UACH 5DQDL 2QQNL 4EXPX 3VWJA 1J0HA 4FXGB 2FJGA 4B41A 4JHWH 4KMLB 5E8NA 3UTTB 1JYWA 1MQ8A 1RFDL 4D0CB 5I66A 3V6OC 2HT2D 3S35H 4X4XB 4LSQL 5BV7B 1IAOA 4OCSL 3IKCB 3NCCB 4FQ2L 3UYRH 4XNUL 1NJ9A 1QO3B 5KVFL 3BEWA 4I0PC 3RPIB 2J5LC 1XGRB 4X7CC 2ADJB 4ZS7L 2XFXB 4O4YH 4OLYH 4X7EC 3RHWF 4KQ3L 3GSUA 2AVGA 4L3EB 3N1PC 4KJQD 5H37H 2ZNXA 2DQTH 1XF4A 2OZ4A 4WWKA 3IFLH 1QR1B 4C56D 2XQBH 2Z8SA 2BSSB 4LARL 4K9EL 4TULH 1IEAA 2PNDA 4QRRD 5DJCB 3RUGF 3DV6B 3IDNB 4HIEB 3AY4A 1INQA 4LRIC 4V2CB 4LLUA 5GQBA 3SKOB 4YPJA 4KHTL 1BM3H 1EHAA 3VGFA 5DR5H 1JGLH 1Y18A 3PL6C 5JXAL 2E7LA 3RL2A 2GAZB 2CIIA 3BP4A 4BFIA 4U1MA 3PXHA 3L3JB 3MUJA 5CZXD 3D2UD 2OP4L 5I1CH 3F62A 1T1ZA 3F65A 1U8MB 4UAOB 4BJLA 3WFBL 1A4JB 4Z7UA 1S9VB 2H9GB 4KDTA 3AVEA 1EFXA 1S78C 5CAYB 3I3DA 5DMGD 5CD3A 1W0YT 3GJFA 4QT5A 3OAYK 5ESAB 5IJVA 3FAWA 5ISZA 4BUGA 5FUZH 1BFVL 4OFYA 5HI4C 2X7LA 1MCLA 3TP4A 2FB4L 3QFDB 1BGXH 3IDUA 4ODVH 4Z6AT 5ECJE 1MHHA 1E6JL 2JJTC 4DKFL 1T6WA 2GIYA 4B50A 1CGSL 1MFCH 1R24A 4QRRB 3MNZB 1AHWB 2MKLC 2VIRA 1A6VL 1FVEA 2Q8AL 3DROA 3KS0H 4XPFH 4C56E 5KSBA 4ODSH 1NUGA 5J13C 4W68A 4QXTA 4FQXC 3WIHA 4DVRH 5C6TH 3NFNB 4EIZC 3GSQB 4Z77B 4OUOA 2H2SD 4WO4B 3EYSL 3MFFA 3X13A 3IDYB 4QRRE 1DQTA 3VG0H 1MFNA 2R2HA 1TVBA 3UTOA 3W5MA 4F2MA 3N1GC 4R2GB 5I9QC 4ZD3H 1RUMH 4FRWA 2YA0A 4DK6A 4P2RD 2YD5A 4FXKA 3I6GA 1MAKA 1JHLL 3KPSB 1Q1JH 1EXUA 1ZA3A 3RWHA 4XRCB 1BF2A 2AI0H 4PG2A 1JNLH 1UM6L 2PYFB 4H20H 4GAYB 1HQ4A 3KYAA 3GIZH 4J6RH 4FMFA 1C16B 1OGTA 2BRQA 2VZSA 2F53D 2ENSA 1UADC 3DX7A 3N85L 5DLML 1SEBA 3EO0A 4NPYB 5M94B 4PJXB 1F2XK 2DWEB 4OIIH 1NCWH 3QIBD 1EK3A 1ZMYA 3LSOA 4YC2C 4D0DA 3UYRL 1S7UA 3FFCA 1SJHB 2NX5A 1CXIA 4H25A 4NRZA 2OL3H 4PV8A 4MXVF 4OLYL 4GRLD 4PJXE 3QUKA 5I1DA 4E42A 4YHYC 5DVNA 4WU7B 4Y4FC 4N0UA 4K8RC 3HZYA 5HHPA 4CVXA 3QNYA 2A6KA 3MPCA 3OKDB 4NHUA 1CLZH 4P5TC 3C8KA 2DIJA 3PQYA 3WIFA 3NCMA 4RDQF 4H88H 4PJGB 1F58H 3ILPA 4CU8A 4GKOA 4UT9L 4M1DL 3ULUF 2Z35A 5EDXA 4M7KH 3RI5F 1NMCC 4YDVB 4P2RE 5C0GB 1BM3L 4JFEA 4OZIE 2UZXB 1KB5B 4KKCD 4PJCB 4WFFE 3BIKA 1U8LB 5CEZL 3PWNB 3QNXB 3QQNA 2ESVD 4XMLL 1R5WA 8FABB 5I1CL 3S34H 4E5XB 4QCIB 3KLSA 2BNQA 2F53E 1Z9LA 1FV1A 3DIFB 4LLVA 1PLGH 5IF0B 1YQVH 4EZMA 3MLUH 2HP4A 2CO7B 3UJJH 4RQQA 5FUZL 2ADFL 3QFJB 5EU6B 1N4XL 3FRPA 2WIIA 4LHUG 4ODVL 1SJVA 1A6AA 4YLQT 5J6HA 1GHFL 1M7IA 2CRZA 1BZ7A 2FL5B 5I1HH 1BJ8A 3LDBB 1NAMB 1YYMH 2QKIB 1GJIA 3QFJE 5FYKL 1N5YH 3BP7B 5LGJB 3STBA 1S8DB 4XPFL 5JPMA 3PUCA 3L6FB 4XP4H 1EERB 1Z0MA 4LVHB 3CD4A 2GUOB 4L8DA 4HS6B 5C6TL 4JKKA 2DTML 3LD8B 1N6UA 5GS2D 3BGMB 1EJ6A 3WNLA 1A3RL 1O7VA 2BMKB 3P73B 1YPZA 2WSKA 4ZD3L 2MSPA 3M17A 2EYRB 2MJWA 2XZCH 5C8JA 4PBVC 4Q2ZA 4PTUA 2RFXB 3T1FA 5CLWA 5IK3A 4BQCA 1EEYA 1UH3A 1Q1JL 4X4ZA 2EE3A 5SX4I 1KIQB 2ESVE 2AI0L 1JNLL 3I6KA 3MRRB 5J12B 4H20L 1S7RB 5C0JA 3GIZL 4G8IA 4J6RL 1NCAL 4EEEA 4LDEB 4ZUWB 4QO1A 1E0OB 5EUOB 1HEZB 5FUCE 3DYPA 4W81A 4G80B 1XGUB 3K3QA 3MFGB 3O6LL 5FA4A 1K8IB 2ZOLA 1DTUA 4PJFF 4OIIL 3DVGA 3BZEB 4WRLA 4LKXB 5EUOE 4EBQH 3GSNL 4OCXH 3V5HB 5K9KB 2D0HA 2OL3L 5E8EA 5E7FA 5ENWA 3UTSA 5GRWA 3QG7L 4K94C 2BCKB 3FB7A 1MCDA 4GKSA 4X98B 1NCBH 2JB6B 4QYOB 2R2CA 4ZO7A 1NCNA 4I2XB 1WTLA 2EDDA 4FS0A 3MRHA 4BZ1H 3QEQD 3RGVC 2FX9H 3CFIC 1A14H 3NTCH 3R8BB 4CNIA 5EUKA 2PTVA 3GMQA 3MJ9L 3MREA 3C60B 3U30C 4KTDL 3RVTC 4HS8H 3MRKA 1WAAE 3T3MF 4X80H 1GGYA 2CMRH 1KV3A 1TZHA 1P4BH 2HKHH 1X44A 1MCOH 3VXOA 2YD9A 1YNTA 1UC6A 3IDIA 4UU9A 4WUUA 1TJIH 3OF6A 3RY6C 4ZG1A 2ZCLH 1PZ5B 2PYEA 5MEOA 1KCKA 2H2PD 3N06B 1FO0H 1BQHG 3BQUB 1RSFA 3D18A 3MRBB 2AEQH 3L95A 4OLZL 1PLGL 3BFOA 3FCTB 3G5YA 4E0RB 3FT3A 2OL3A 3NCFB 1DDHB 4NDMA 3MCKA 3MLUL 2YPLA 2NY6D 5D7JA 3UJJL 1A6TB 5CBEA 5D1ZB 1IRAY 4TRPL 1ZVSA 4JFFB 3T0EB 5I30H 1AGEA 1AGBB 4ZTOL 4CJ0A 2X9WA 3O9WD 4QRPD 1TJHH 4R8WH 4Y1AD 4Z18A 2RCSH 1FZMA 1FN4A 3GMOB 3P4NA 2E27H 3VFNA 5I1IL 1MLBA 4F80A 4HUWB 1YYML 1NKRA 4PJDB 4JFFE 1G1YA 2LQRA 1MLCB 1W8OA 2OXGA 3QR2A 3BKJL 3MJ9A 4XP4L 5A3ID 3Q6GH 3TIEA 1CYGA 3QEQE 5DVOA 3LMJH 3SGJC 1KT2B 1VADB 3STZB 3MNVA 2EYSA 4M5YL 3SDCA 5GRYA 1VESA 5AZ2H 3Q5TA 3BGFB 1JF5A 5IMKA 5DJ8B 5C0RL 4WI2A 1FZOB 3FB6A 1K9TA 1D6EA 1D5MB 2P8MB 1RIHH 2VQTA 4QF1B 3W11D 1RHHB 4KUCD 3E3QE 1FC2D 3MV9D 3OX8A 4XMPL 4HV8A 4LCCC 4LSSL 5F3HA 2ICWB 4ZO6A 5HPMB 2P49B 5F8RC 1DZBA 4NWUL 3TO4C 1WT5A 4H8WC 4U05A 5C1MB 2HTLD 3QIWA 4KVCH 4G42B 4LSPL 4YX2H 2IMMA 1YDPB 4JM4H 1N5AA 1NC4B 3X17A 3MR9A 3I02B 4QRPB 5CHNB 4NZRH 5DURD 4Y1AB 5IIEA 1J8HA 4PJ7A 3T2NH 2B1HL 3W39A 5BOZG 2ZPKH 4RSVA 4LHQB 3N9GH 3VFUB 5IVXB 4Q0XH 4EBQL 1UCBL 2XA8L 4QRPE 2CUMA 1EEQA 4Y1AE 4V1DA 4Q6IC 4P5MB 1U95A 5KVMC 4OJFH 3X3GH 5EC1B 4NJAH 1LD9A 1NCBL 1U3JA 1YEFH 3VH8G 5JHDA 1F4XH 3CZFB 4F37F 4HDIA 3TFKC 1V3MA 5BO1H 4OF6A 3UTZB 3V5KA 4X4YB 4N1HB 3LQAH 5D70H 4BZ1L 2EH7L 3OKLB 2FX9L 3QIUC 4ERSL 3NTCL 1VFUA 5DK0A 3BWUC 3EZJB 2VDNL 3SO5A 3JWDL 5E94A 4HS8L 1IGYB 1LEIB 1E28A 2VITA 3IDYC 4NCC1 4X80L 4JY5L 3MV9E 2ZUWA 3IJYB 2PF6A 1MCOL 2BY1A 2NR6C 5MHSE 5AG8A 1FNSL 4FTVA 3LEXB 5EO1A 3KS0J 3NMEA 5DURB 2IBZY 1TJIL 4DEPC 1IILE 2ZCLL 1MHEA 2WUBH 3L3IA 1FO0L 2J8UE 3R06A 4ZDHB 2AEQL 2NY1B 3EOAB 5TQ2H 2FJFA 1KJMA 3C09B 5HYSB 3EAKA 5E8PA 3LN5B 1TNNA 3QQ9D 1QBAA 2ZOKB 1L7TH 3O8XC 2Q86A 3CDCA 1U92B 1OHQA 4RIRA 2V17H 2DMKA 4P2OC 3L7EB 2Q20A 1TJHL 4R8WL 3S37H 4YHPA 3MBED 2IANB 3KPRD 2HKFH 2E27L 4XTRC 2DKUA 3DX8A 4NFCA 5A2KH 3S4SG 1MUJB 2EDRA 4M5ZH 2DQFA 5SX4H 2FO1A 3C6LB 4JJHA 2CSPA 1LK2B 1UWEH 4U2YA 4HZAA 2P7TA 3LMJL 2RR3A 1KJVA 3DX6A 3ZYOA 4PV9A 3ISWA 2FLBT 1TENA 3ARDD 3ARPA 3WN5A 5I8OH 3U36A 1IGIL 3QSKB 4OCRH 5AUMB 4A6YH 2GTWA 3OG6B 1XF5A 5DA0B 1V3KA 3K8KA 5SWZA 1FO0A 4Y88A 3B9KD 3SHSA 4OFPA 4PJXF 2DD8H 1NMAH 3T77B 1UQSA 4ZNEA 1OGAA 5I6XC 1QNZL 5IHZB 4YX2L 3CUPA 1QVOA 3KPMB 2H41A 3TBTA 1P6FA 3W9DB 4RGNB 1QTYT 5I16B 2R56H 3MLPA 3D0VA 3NFPB 5CGYD 3N9GL 1F4YH 1ETZA 4XHJC 3BZFA 1K3IA 1NLBH 4W4NA 3KPRE 4JPWH 4ZXBD 2DL9A 4OJFL 4OZIF 3X3GL 3AS3A 3MJGX 2BSTB 4MAUH 4NJAL 5GGSB 2P5EB 2VXTH 4LGRB 1F4XL 1MCEA 2I07B 5BO1L 2Q6WA 2Q3ZA 3AFLA 3VFRA 3JUYA 3S5LG 1FL5A 3LQAL 5CWSA 2Z4QA 1NMBH 3F7PC 2NXYC 4JRXA 2ZG1A 1HHKA 3B9KB 4Y4KA 2CLZA 4LIQL 1HSBB 4LPUA 4H26B 2XXMB 3BE1L 2D4DA 2B5IC 3RJQB 4I0PD 3JUZA 4Z0XB 3WKMH 4BELD 1KIUA 1G0DA 1H0DB 3KXFA 5DJDB 2Y5TB 5TE4L 4OGXH 3FAXA 2GQHA 4F9PC 1T80A 1ZT7B 4DQOH 5C92A 2WAHA 4MA3B 1BQLH 1X4YA 2AJ3A 3AREB 3AUVA 2DWDB 2UUDH 3SN6N 2D7NA 5TQ2L 2C1OB 3BRFA 4OZGB 5FYJU 3RNKA 4QKXB 2BVPB 2DBLH 2WBJA 3IF1A 5ID1A 3SPVA 3ZT5A 1A6UH 2V17L 1IGFH 5HI5C 3S37L 4OZGE 1XGPB 1AGCA 4JFHD 4QTHB 5HI3C 2DKMA 4XNXH 4JR9L 4IS6A 3SDAA 5D7SH 3U83A 3FFDA 1VKXB 1J11A 2Y1VA 4CRPA 4RAHA 5KJRH 4DTGH 3IAGC 3V6OE 5C9KA 3TCLB 1HIML 3TWCH 2X4UB 1TZIB 3OAUL 5EBWA 3V95A 1HDMB 3KJ4B 3KPOB 4N0CC 4QRTB 2ICEB 4M8QB 1QFHA 3FONB 4D8PB 4IRJA 5D96C 4OCRL 4S1RL 3U9UA 2DLEA 4UOW0 4XC3H 3CFBA 4PR5B 2C3HA 4QRUB 5EUOF 4KROD 4LFHD 5HGBB 4YHKL 5MEND 5EIVA 4ODWB 1TMCB 2DBJA 2EDJA 5E9DA 4OD1L 4F7MB 1Q0YH 2V2WB 2DD8L 5EFIB 3SE3A 3BSZH 1U2HA 4NKOB 3BX7C 4OFVA 3QWRA 1HILB 4WV1C 4FQXD 1RIVL 4GRMA 1FAIL 3RDTC 5FGBA 4IBLT 3O3DB 4P46A 3T2QA 4ETQA 1KTRL 4YHML 4PYGA 3GGWA 3ZKXC 2W60A 3PWPD 2R56L 3HTLX 4NQDA 3GSRA 5DJ0B 3O3BB 1CE6B 1F4YL 1CQYA 4LQFH 4R96A 1WAAF 2XOTA 3SGKA 2YWZA 4RAVB 5MEPA 1NLBL 3G6JA 1HINH 1UXSB 2YKLH 1N7MH 3F5WB 4JFHE 1NBZB 5DYOA 2FYYA 5IFHH 5T1LD 1FYTD 4P3DA 2YMXH 2VZ1A 4XPAH 5JUEH 1KJ3H 1BFTA 4QXUH 4YDJA 5HHVH 2I9LB 2NY0C 4KROB 5MENB 4A6YA 1FGNL 1D5BA 5CEXA 3HNTH 4KRPC 1X4ZA 4JM2D 3C08L 3W0WD 1X5GA 1YYLL 3ZTNH 3U79A 3ARBB 1EA9C 3T8XB 5ERWA 3CFEB 5MENE 1PY9A 5F97E 1Q9KA 3WL9A 2HT4C 4JG0H 2NQCA 4JFDA 5IB1A 2AJXH 4K8RD 4GW4B 3WLBB 1B4JH 4MCZA 4DQOL 3HLAB 3H6JA 1F90L 3NABH 1CDYA 4P5TD 1G7LA 3JVGC 5ICYA 4J3XA 3ZKSD 2VISA 3FHAA 5GGQH 4TPRL 3PWPE 2A6IB 2QR0B 2XPGB 5T1LB 2OTUA 1IEBB 4F33A 2FHFA 3OTTA 1WBYB 4KFZC 3TBWA 3GMRB 2UYLA 4Y16D 4KK9C 1LWRA 4NQVB 1CQKA 1KJ2B 3RKDC 1YMMB 1FZJB 2HMID 1FYTE 1V3LA 3QCVH 1KOAA 4NNXB 5GXBB 4XNXL 1GGTA 1G7JA 3KYMA 1YEHH 4JO1H 3AROA 4MAYA 4GT7A 4ZYKA 4F7PB 4K23L 5KAQG 1C08B 4KVNH 4F8TA 1G6RB 3P40A 1T03H 2YC1B 3TWCL 4TNWK 2EH8L 5B39B 2QV2A 3MOAH 4BSVA 4JQIH 12E8H 4XB8A 3NZHH 3A67L 4JRYD 1U8QA 4HEME 4U6VL 3L1OL 2GSGB 3BPLC 3VXQA 5JW4M 1AD0B 2HVKB 1FIGL 4JZOB 4XC3L 4K71B 4AMKL 4Z8FH 4UUJA 1KNOB 5EBMA 5IG7B 3VFWB 2ARJB 3L3OB 1XZ0B 3EHBD 1Q0YL 3NGBB 5F7MC 2CKBL 5FKPB 2EYTB 4Y2OA 3BSZL 4YWGH 3VXMB 2YPVH 5AD0B 5IVXF 5K93A 1R0AL 3OGCB 5E56A 4HW6A 5F88A 1R3IL 4Y16B 5T1DH 1A9BB 4CN6A 1HOCB 2G5RA 2AV7B 3VXME 2VSDA 2HVJB 1D5IH 4YIQB 5KSUA 2F58H 4HGWA 4HFWA 5B4MC 1MJ7H 3H9SD 1FNFA 3HE7B 1HH9B 4C83A 2Q76B 1CXHA 2MNUA 1HINL 2R0ZH 2VRAA 3HI1A 5B3NA 3SDDC 3IT8D 1M7DA 4JPVH 4Y4HA 5IFHL 3ARQA 1FJ1B 3NPSB 4WJ5A 8CGTA 1O5DT 4H0IA 1JGDA 3C5JB 3BPCA 4MQ7B 1KJ3L 2J8UF 1A4KB 3LRSA 4YE4L 4YH6A 1KPRA 3STLB 1PQZB 2NLJB 3QXVA 4R9HA 1G6VK 3GHBH 2CKBA 1BP3B 2C1PA 2HN7A 1AO7A 5BRZA 1C7SA 15C8H 3D5OF 1XT5A 3TBVB 3OR6B 5TH2A 1XGYH 1B3JA 3JV0A 4EUPG 4U3XA 5E4EC 3DUHA 5KZCD 5IB3B 1ED3B 1F6LL 3OG4B 1B4JL 1RUPH 4MD5A 5FECA 5GJSL 5C86A 4EI6A 3MJ7A 3NABL 1NGZB 1YEDA 3DMMC 4WGVB 3MODH 3RGVD 2V6HA 3V7MA 2QSVA 5GGQL 2OJZH 4PD4J 3WXVH 1P53A 4IHOA 1PJ9A 1MF2L 1U8OB 3EOBA 3BOVA 2XTLA 3WDHA 4ELMA 4YEFA 1OAYH 4R4FL 4EDWL 4RGNC 2PETA 3U0TB 4TVPE 5JOEA 3IVKA 3LKPB 2MHAB 3MRJB 4C59B 4K7PY 1OB1A 2ZUYA 1NFDA 5DRXB 5KTEL 3OXSB 5AYUL 2B4CH 3GSOB 3VMOA 1YEHL 3GHEL 4JO1L 1IZKA 2JJUA 4NOBA 1QSVA 5ID0B 4KVNL 4K7PH 2EDKA 4BKLB 1ZKAA 3MOAL 4U0RC 4YHIA 2ZSVA 4X6FA 3VWJC 3NZHL 3TYFB 3LKQA 3ZTJG 2EDEA 1ZVYA 1O7SA 4OLVL 3RZCB 2DQDL 2ZUQB 3OR7B 4PGCB 3L5IA 1RZKC 4I5BB 3GBMH 3U2SA 4AENA 4Z8FL 1EMTH 4U1HA 2DQIL 5I2IB 4J7RA 2QHRH 4D9RE 4OLWH 1GAFL 3DVNB 5ABDE 2FATL 2VL5A 5DFVC 5D1QD 4YWGL 2NY7H 2DQCH 2VXSL 1IAKB 2D7QA 1J5OH 1IM9A 1HXYA 3N0PB 4OF5A 2ADGA 3ZDYE 3CVHH 3ARGC 1ACZA 5LCVH 5E8DL 5IW1B 1BEYL 4WWKC 3DTXB 1EBPA 2F58L 2C3GA 4E9LA 3HG1D 4Z7WB 2D9QB 2H3NB 5HVHB 4UIMB 4ZS6C 4DAGH 1X5HA 2WLZA 1K4CA 1UWXH 3EFFA 3CLEL 5DJ6A 2R0ZL 4K3GA 4X8XA 3AY4C 2VLKA 1DBBL 5GS0D 4LHJB 4JPVL 2VLLB 1LNUB 3EDDA 2DM2A 5IR1A 4I48B 1BVZA 4Z7WE 3EOTH 3BO8A 4PJAB 1VFBA 1TZGH 3VXUD 4FQJH 5L2JB 4GLRI 4RDQG 3HRPA 5EOQL 4ZFOA 1IC5L 4BQBA 1ADQL 3P0GB 4X7TB 1TQBB 4ZPTB 3BXNB 4MXQD 3IAQA 2NY3B 2VE6B 4LCWA 1Y0LB 3QDMA 4OLEA 4WI9A 3FB5B 4HC1H 3ARTA 5IV2B 1RZGB 1K2DA 3E2HB 1R3LA 5D1QB 3VFTA 2GJ6D 2IFFH 2EE2A 3ZSTA 3BKYL 3SO3B 3MV7D 3DPBA 2BERA 3QDGA 3RAJH 4PP2A 2JF1A 1W72H 1UENA 4OZGF 1XGYL 1S7VB 2HFEB 3NA4A 4FP8H 5EZIL 4AM0B 5J1TC 2DI9A 2ED7A 4IRSB 1RUPL 4X6DE 4ZFGH 5EORH 2IQAA 5TGBA 1LGVA 1WFUA 3QUXA 5CD5C 3ZHDA 3QIUD 4AL8L 4K9EC 3WXVL 4P59H 3FT4A 1CS6A 1N3NA 2QQLH 5HYJB 2X4RB 2AW2A 3O2DL 4G6FD 3HG1E 4LLAA 2PR4H 2DLGA 3HUJE 3EIFA 2YPKB 1OAYL 3TIDB 2IAMA 2NR6D 5A40E 5D6CA 1JGEB 2FGZA 3NCYP 1BQHA 1OAZH 2B4CL 2HFFA 2Y06H 5HHNA 1OARH 2E7CA 1YZZA 5F89A 3KWWB 4JO2L 2AK1L 1BVLB 2GJ6B 2ADIA 5I1JH 3QXWA 2LTQB 4N8VA 2R4SL 1ROWA 1XR9B 4TQEH 4LNRA 2HLAB 3MV7B 4OLUH 3NZ8A 3FRUB 5TE6H 2BHUA 1BJ1H 4HLZH 1MAML 1BWMA 2E7MA 5IBUB 2VNCA 3O41B 2GJ6E 3U4BH 3RIFK 4PRPA 5TDPA 4KJPC 5MERB 3CH1B 3FTGB 3QZWA 3NIGE 1EMTL 3A6BH 2DQUH 3MV7E 1OLZA 3SE9L 3I9GL 3IFPA 3QNZA 1SJXA 4LKCB 5C0EB 4PRID 2QHRL 1L0QA 4OLWL 4QHMB 1A3QA 4JJ5B 4NC1C 4RMWA 2AKRA 1ZWIA 3RVWC 4UV7L 1M05B 3ULVC 3ALWA 2DQCL 1U8NA 5F1IA 1I9JH 2P47B 2PW2A 3MJ8B 4HLJA 1J5OL 3ABZA 1U8JA 3QQ4B 5I8CA 3O3EB 4G5ZL 1AJ7L 4LCUA 2SEBB 3G08A 4JZNA 2XQYK 1R5VA 1OT2A 2HTKC 3V0VA 2DICA 4Y2DA 4DVBA 2CUHA 1OCWH 2CPCA 1S7QB 1VDGA 2EC8A 3BH8B 1PEZA 1XIWA 4U1NA 3C5ZA 4KZDL 2PO6B 3QEGH 1AXSA 4DAGL 3IXTB 2CIKB 4HKXB 1XH3A 3LS4H 1RJLA 5EU4B 2RIKA 1J05B 5L2KB 3SDYL 3X12A 1RUQH 4U6XB 4U1GC 2YHGA 4J4PD 3BVNB 4X4ME 2OSLA 4KTEH 2C3VB 3DBXB 4AT6A 1TZGL 3W9EA 2AJZB 4P23A 1U8KA 4CMHC 1V8HA 1H3XA 5L2KE 4MWFB 1I8IB 2D03H 1CBVL 3G6DH 2F54D 5TQ0L 4PS4L 4HC1L 3DHJA 4NQCA 5HDQH 3EUUA 5HYFA 3CAFA 1T0MA 2R2EA 1HE7A 3EBAA 5E99L 1T22B 4HUVB 1RUAH 5F7UA 3FQRA 5F7DB 4PRIE 3BJ91 4KUZL 1J18A 4NM4L 2IMNA 1U0QA 5DT1H 2DI8A 3LHPH 3MV8A 5I73B 1J1PH 4OBSA 2UV3A 4HKJB 4KQ4H 2BOCB 5EORL 3FO0H 4L3CA 4XCEA 4H1LB 3VW3L 4HJGA 4P5KB 2VN4A 1FCGA 1A7OH 1MFBH 2NXYD 3HCVA 5IM7B 5D7IB 5CINH 4LEOB 1TDQA 2QQLL 1F00I 4JM2F 2MCPL 1G7QA 4WU5A 4GMTH 3WBDA 5C0AA 1NSNH 3CX5K 4NP4H 3OKKB 4JO4H 5DZOA 1SBBA 1E4KA 3FQUA 5JA9A 2HT3C 4NNYA 1CFNB 4JKMA 1F6AA 5D7IE 5JMOC 1XEDA 5FDWA 1JZ6A 3VG9C 4M9OA 2XN9A 3HNVH 4XBEH 4KZEH 2GFBB 1FYHB 2Y06L 3S96A 1E4XI 5IKCA 4X5XB 1BLNB 4YDLB 5E00B 5GGVY 4HC1A 2Z92A 4N1EA 2VH5H 4P4KA 3KLHC 2FH6A 1U6AL 4JQXA 1NGPH 5CUSH 2F54E 4OLUL 4KK6C 2JTDA 1AE6H 1CVRA 4WDIB 1PG7W 4RAUB 1YN6A 1MCIA 1FFNA 1W72A 1CT8B 1MI5B 2CXGA 3F8UB 3SKMA 5KSAA 4MA8H 5HI5D 3A6BL 5JLZA 2DQUL 3S97C 3S4SA 2XZQL 4LPVA 3IU4H 1ZLSL 5H2BA 1A1MB 4HPOH 4O2CA 1FFPA 1MFDH 1GVIA 3UBXG 1MI5E 2BP3A 1NQBA 3JV4A 1I9JL 1FFOB 4TSAL 5DD1H 4JFQB 1MREH 5DSCA 2YZ8A 3PWVB 4GLRH 4IM8A 4JFXB 4LEXH 1AD9A 1ZEAL 2BHZA 3QPXL 4S1QH 1RY7B 3TJEL 3D39D 3CSYB 4ZUVB 1OCWL 1WITA 4LCYB 5E5RB 3CFKB 2R29H 3OKMB 1REIA 4OFKA 4ONHB 3QEGL 4QOKB 5EOTA 3MLSL 3LS4L 1D9KA 4G43B 5SWSD 2H32H 4XBGA 4LGPB 4OSUL 4KTEL 1A0QL 3HFML 3PWJB 3LEVL 2IH1B 4JFYA 2I9TA 2LE9A 5IQ9A 3VXNB 1Z5LA 5EO0B 3QRGL 5TFSL 2O5ZL 4U3CA 2ITCB 3BH9B 1FL3B 3FO9B 2CKNA 3FO2B 1EO8H 2Z9TA 2KUTA 4WUKL 1F13A 1K8DA 4NKMA 1KUMA 4UB0H 5HDQL 4A2LA 3QWQB 3QHFH 5EBLA 1ZA6B 1EAPA 2HA1A 4LRNL 4ORGA 4NO0D 4PJEE 3KNBB 5FK9B 1RUAL 5JHLH 1CLOH 4GW1B 4S0SD 3SE4A 3FO1A 2VKWA 5D7JC 2GHWB 5TDNA 3LIZH 1MVUA 5F72S 1WFTA 3S5LA 3D39B 4IOIA 2CR6A 4KI5D 1J1PL 4N0YH 5DJ2A 4EIGB 1AIFB 4KJWC 2EDNA 4P2QB 3V9FA 2NY0D 3VDAA 1A7OL 1UWGH 3LV3B 3BUYB 1IM3B 2DQGH 3D39E 5CINL 4K07A 1MEXL 4WENB 1JUFA 5IB5B 1DUYB 3PV6B 1NSNL 4NBXB 2ITDA 4NP4L 4JO4L 3DURA 1CR9L 2R2BB 1EDQA 3AB0B 3GI8H 4BM7A 3RWCB 4HWBH 3B2UC 4Y5YA 3SDCC 4PGDB 4EN3A 4B0MM 1LO0H 4GBXA 3TVMB 4POYA 4X6CA 4CJ1A 3KR3L 1VFAB 3ESVF 3VCLB 4GMSL 3OKOB 5ITFA 4R90H 4G8EA 2Z91A 4CVWA 3AMKA 4Z95H 3EJYC 3OJVC 1I7ZA 4R7NB 4PGZA 2WW8A 3HPJA 5CUSL 3ZDYF 3O3AB 1WT5C 4OZ4B 4BQ8A 4F7CB 5FB8B 1A7RH 5GGVL 5IROA 3QIWC 1KTDA 1YUHB 1Q94A 4D3CH 4MA8L 4PB9H 5ILTL 2HRLA 2VLRB 2FIKB 4HPOL 1JZ5A 1QRNA 1X5YA 2GI7A 2O5YH 3G5ZB 4KI5E 1MQKH 4BQ9A 1I8KA 4Z78A 4Z7WF 5C0CA 5DJZA 4DZ8A 2D0GA 1IGTB 4WTXA 2C4FU 4D9LL 5DDHB 5DD1L 3WS3A 1PX3A 5FO7A 3ZHLA 3HS0A 4LEXL 3KAAA 5D4QA 4IRSC 5F9JB 4S1QL 1HKLH 3OBAA 1NCDH 3ETBF 4JHBA 4L8CB 1S5IH 4X5WA 5GSVA 1QBLH 4L29B 5MP6H 3HNSL 3BD5A 1MY7A 4MD0B 2F5BL 1DLFL 4XGZA 1JPGA 4MHHG 4QLRA 2G5BA 4NO5B 1J0YA 4WHTB 2Z31A 3QUMH 2GK0B 2PCPA 3V79C 4ZFFB 4X6DF 5JW4N 1HYSC 2E8ZA 1P4LA 5GRJH 4ELKB 1I8MB 1I1AB 5EZOH 4HUUB 1IL1B 4PRBB 5C07A 1OTUC 2F5AH 4UB0L 5DD6B 1JWUB 2DQJL 2X4PB 4UQ3A 4S10A 2W92A 3OHXB 1UH2A 4ODHL 4XNMA 5B4MD 2HG5B 4Y5XB 5HYQA 3VDBA 1CLOL 3MXWH 5IFJA 2ZP0T 3SDDD 5GZNC 3OJDB 5I8EB 4OTXH 5B8CC 3W5NA 5KG9B 3HE6C 4JB9H 1IVLA 3LIZL 5C3LD 5K9QI 5CBAB 4JKWA 3QG6B 2X1PA 2NXZD 1H5BB 1CFVL 3VJ6B 3S88H 2LV4A 2VAAB 5BJTB 4YUEL 1IMHC 5IVZA 1FBIL 1E4XH 1I4FA 2XXCB 5L6YH 3GBNH 5LAXA 1UWGL 1XF2B 1U41A 2W0FB 2BXYA 4HD9A 4U4BA 2ENYA 5EN2B 5KS9A 43CAB 3RTQB 2V9RA 2H32A 3UAJC 1K5NA