4LCUA

Structure of kcsa with e118a mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcuA02
4LLVA 5D5MF 2XQBH 4G9DB 3Q1SH 3D69B 4M5ZH 1KXVC 1S7TB 5DFVC 4HC1L 2XWTB 4LCUA 4NQCA 1Q9WB 5D7SH 4XCNA 3V4UL 4W81A 1RIHL 4ZDHA 3QIUB 1JRHH 2UZXB 4D8PB 1YA5A 2N7BA 3IU3A 1CLOL 1IGIH 3QEUB 1YQVH 1ONQB 4OJFH 2BHZA 2WBJD 4P2RB 5F7UA 4LKCA 4JVWA 3QUZB 1UYWH 1MF2H 2FHFA 4D9LH 1F4HA 1A9BA 1NGYA 1BX2B 3BKJL 4X4YA 3A6BH 3TN0A 3SJVE 4X9BA 4KGJA 5C0RL 5F7DA 4N68A 5T1LD 1FE8L 4IRZL 5GGUB 1U6AH 1BBJB 2A74B 1BD2D 3L5JA 2LFGA 4O9HL 5CIPB 1NMCC 2DQTH 3FMGH 3K81A 4PJEB 4NN6B 4ZAKC 1SYSB 5KOMC 1ORQB 5DUPL 3TBSA 3W39B 1BZ9B 3BMVA 3WE6A 4LBEB 5MERB 1YNTA 1F3JA 2DIJA 5F1KC 3FFCA 4U1KB 2O93L 2APWA 5L88L 4WWKC 4NC1E 3D0LA 1FFNA 3QFJB 4EDXB 5ITBL 4XNYH 1LNUA 3LD8C 3TV3H 3ZE0F 2XTLA 4G8IA 1H3WM 1MCPH 3T0AA 2BNQD 4F9PA 4OZFA 1I1FB 4V2BA 4F3FA 3DROB 4Z18A 4L4TB 4AH2B 4U05A 1UB5A 1C5CH 1YMHA 5TQ2L 5BVJB 4PJIB 5C70A 1MHHB 1XGUA 1JGLH 1KB5L 4PY7B 4PUBH 5EU7E 3IXTB 3GM0A 3KHOA 3NZ8A 4JM2D 1IT9L 1KLGA 4HUVB 5IMOA 2FNBA 1CXEA 4FQJH 3L1OH 3W9DA 5HHOA 1AQKL 3MROB 4MNHB 5EORL 2RFXB 3BUYA 3VXSE 2F54D 1S7RB 5DEZA 3BAEL 3KDMB 2BMKA 5DWUH 1URLA 5I66A 4PJ8B 3QDJB 4C4KO 3W5MA 3P4MB 5E4EC 3BQUD 3LZFL 5EU6A 3HAEB 1MLBB 2RBLA 3TVMB 4ZG1A 3H8NA 1ZA6A 5MEOB 4NJ9H 2X89D 5EWIH 3O6FA 3S36L 4PRIB 2R23A 2ZSWB 2H26A 3GHEL 4HK3N 3VG9B 3IKCB 4HWEH 3W0WD 4EBQH 4WHYG 4RGMC 5C07A 4IRSA 3WFEL 1IAKB 3NVQA 5HDBF 3MRNB 4M02A 7FABL 3GBMH 4PRHD 1QPPA 2VQUA 5E2UL 4XP4H 3BDBA 4L1DA 3WN5B 2WLYA 1MWAL 4YR6A 2X10A 4P23A 5JR1L 1H3VA 2GTZA 3D39E 3GRWH 1FVDA 4NQVA 1RMFH 1A5FH 2BVTA 4DKFL 3RZWA 3U6RB 5E8OA 4WUKH 3OKNB 1MVFA 3KPOA 3ZSSA 5E03A 4WI9A 4YDVA 2JIXA 1MCFA 3IDGB 5CFHA 5C2BH 2NY6B 4KTEL 4AENA 4OZGA 1RVFL 4LVOB 2PYEE 4G6KH 4GQ9H 3EO9H 4NM4H 1KPVA 4OCYL 2D9CA 4YHKH 2YSSB 1E6OH 5DK2A 4MAYA 1KN4L 5D93C 4OZHE 2CRIA 5B8CA 4WRLA 2VN4A 1Z5LA 4PJGA 3TIEA 2FSEB 3WNOA 4CN1A 5M7QA 4UIKL 4QHNA 3T65A 5CD3B 4AL8L 3HCVB 1HILB 1S7QA 4QRRE 1V7NH 2NY0C 2CXKA 2GSIB 2W65A 3QT2A 4GXUM 4XBGB 3O3BB 4JRWA 3HNTL 3O2VL 1HHKA 4QRUA 8FABA 1C5DA 2AK4E 3ZHDA 2IFFH 3LVEA 4G80A 4J4PA 2V7NB 3OKKB 1E6JL 3CCHA 3QXAA 4HGKC 2BY1A 5HGBB 4Q6YA 2UWEF 1YEJL 4P4RA 4PJ9C 3HPLA 3BXNA 3K2UH 4CMMA 1I85C 4RQQA 1KB9J 4M1CC 2FX7H 5TFSL 3MMEB 3G08A 1T1XB 2WWKT 3WNMA 4KUZL 2V5SA 5BS0A 5EBWA 1D5ZA 3WS3B 5AWNH 2O5XH 4P5TC 1Y6KR 4HPYL 2YRLA 2OJEB 2VZOA 3RAJH 4JO4L 3QQ9D 3WBDA 4HV8B 2CDGB 5DDHB 4G9DA 1S9YB 3D69A 4E5XB 1AD0B 1S7TA 3M1BA 2XWTA 1FC1A 1KIPB 4APQC 5HDBE 1Q9WA 1XGYL 1CXHA 5EIVA 3QIUA 1XIWD 4D8PA 5I30L 2P8PA 4U1IB 2M2DA 3QO0B 3QEUA 2DTML 2NY2B 1GHFL 5DTFB 3QUZA 5DHYA 1FNGB 2XQBL 2VAJA 5FA4B 3TO4B 1LO4H 5FDYA 1V7ML 5KSBE 3U4BH 3LCYA 2YPKB 4M5ZL 5D7SL 5GGUA 1MIML 4LSSH 5C0JB 5C09D 3MOAL 1MQKH 4DN4L 1BBJA 2A74A 3S8WA 4G6JH 4NO0D 2NPLX 1IGIL 4WI2A 2IAND 5F44A 4OJFL 4X9GA 2CR3A 4L4VB 4PJEA 3SE4C 1NC4D 2CLVB 1MF2L 1ORQA 4D9LL 2H2PD 1NBZB 3VXUB 1PX3A 3MV7A 1QP1A 3W39A 1EGJA 4LBEA 5MERA 2EC9T 3GSOA 2FL5B 1U6AL 1SHMA 2R8SH 1H9VA 3BPCA 3QFJA 4EDXA 2ED7A 2OTPA 1CS6A 1IGMH 4KUCD 4QHKI 4TVPE 3GSWB 4U6HB 1FFPB 1K3IA 4O2CA 5IOPB 5BMFH 3CSGA 2VQTA 1I1FA 3DROA 4KJQD 5I2IA 4I77H 2OI9B 4AH2A 1CGTA 1A6TB 3SKOB 3VFOB 5J11B 1ZGLB 2BSSB 4M5YH 5FO8B 4G9FA 1IGYB 4PJIA 4XNYL 5BVJA 1MHHA 3TV3L 4RGOL 1JNJA 4PY7A 4XVSL 1MCPL 3IXTA 4HUVA 2APBA 3NCYS 4LNRB 3V79C 3QCVH 1QEWB 5I6XC 1PYWA 2FLBT 4MD5A 4GKSA 2RFXA 5FHBL 4YHOL 3W5NA 1YYLL 5SWZD 3KDMA 3TZVC 1GVIA 3DSFH 2G2RA 3MV9D 3P4MA 1RZKL 3GK8L 5MEOA 2FBJH 2LU3A 5GGVH 5A43C 2ZSWA 3PV6B 2GSGA 1DQDH 3IKCA 1ZA3B 4BYHA 3RIFF 2IJ0C 2JB6B 5DWUL 1YY9C 3QEQB 4DGYL 1IAKA 3MRNA 3HN3A 3ARUA 2A9ML 5DLMH 3PIQA 5F8RC 1CFNB 3JBG7 3WN5A 3V7AE 5E99H 3C5JB 2AJUL 3D85B 3L7EA 4HWEL 5F1OB 1F3DH 2WUBH 5DC4B 2EEDA 1KJMB 4N1HB 3CIQA 5DJXA 1S9VB 1O7SA 3U6RA 3KS0H 1MCNA 2DQUH 4FTVA 4YQXH 1JPGB 2PR4L 2Q8AL 1ADQH 4XP4L 4H20H 4XPAL 2HJFB 3IDGA 2QJDA 5L7XH 1S3KL 3QZWB 2D7MA 4KK8D 3GRWL 1ZVYA 1VERA 3ABZA 1RMFL 3QUMH 3ARRA 2YSSA 4R4FH 3LRSB 4E0RB 5IJKA 2P5WE 2PN5A 2XN9A 5J3HC 1HZHL 4HUWB 2FSEA 3PWLB 2VDKH 5C2BL 4I13B 5IW3A 5ADOH 5IHUL 4G6FD 3GKWL 5CSZB 4G6KL 4GQ9L 3SDXF 4P3WA 1CBVH 3HCVA 1MHEB 4NM4L 2GQHA 1HILA 4PTTB 4YHKL 2KL6A 1E6OL 3RIAF 1QRNA 5GGSA 1Q0YL 1OSPH 2CXGA 2VZTA 3JXAA 1IEHA 4BQ9A 3F7QA 4JKPH 2RR3A 3O3BA 2XTJC 2VERN 4BUGA 4HFUL 2BNRE 2D0FA 3V4PL 1EEUA 5D6DA 2J3SA 2V7NA 3OKKA 2YC1B 1V7NL 1B0GB 3SGEI 5HGBA 5ISZE 2P49B 4NBXB 2HT2C 3RY6A 4DGVL 3RVVC 5C6TH 1KBGH 4ZYKB 1IGTB 1CE6A 4M3JA 2IFFL 4UBDD 3OZ9H 3MMEA 1A64A 2QHRL 1NFDF 1T1XA 3V6OA 5T5FH 4UV4L 1NAMB 2Z31C 1EEZB 4RGNC 4WHDA 3TPKA 2NY5H 4QHLA 2VL5A 3DX7B 1A6UL 4K7FB 3HPJB 2VXTH 2OJEA 1FZOA 2FX7L 2NR6D 5D7KD 1P5VA 1G9MC 5GJSH 4HV8A 2CDGA 5DDHA 1S9YA 2YK1H 2QBWA 3GSVB 4E5XA 3SY0A 3NIDF 1MFCL 2AV7A 1IC1A 4PD4J 4OTXH 1Z9MA 2DRUA 3BKCL 4U1IA 3MRIA 3QO0A 3HS0A 3RAJL 4K8RL 2HFGL 1FLRH 5ICYB 1FJ1B 2ARJQ 1BD2E 1FNGA 4GRLC 3TO4A 4V1DB 1GYAA 2X44D 2R0ZL 1I7TB 4AT6B 2XZCL 1F90L 2AJVL 4B7LA 4NWUH 4PRNB 2EO9A 2DMKA 3QWQB 2EE2A 4KRMB 1CQKA 5I73C 1TQCB 3TT3L 5DXWA 4L3CB 4L4VA 1MJUH 2CLVA 5D72H 4KROC 1LO4L 1NBZA 2GTWB 2ADJA 3MBEB 3QUXC 4HZLB 2HAZA 4QRSA 4HLZG 1NBQA 1VFUA 1N8ZA 4G7YH 3A6CL 4LSSL 2C9AA 4BA8A 1CI5A 3O4LB 2BNQE 1IC4L 1KIRB 3C5ZA 2VNCA 4J6RH 3BIKB 5E9DD 4W68A 4MA8H 3IETB 2NZIA 1CTOA 3AVEA 3GSWA 3O9WB 1FFPA 4U6HA 5IOPA 2D31A 5E94B 3SCMD 1MIEH 3ZKMC 3V52H 3BKMH 2I26N 1KEGH 1RJLB 3BEVB 4P48A 3P0YH 3SKOA 1A6TA 1JHKH 2MOVA 3VFOA 4L29B 1ZGLA 2BSSA 4YHNB 3QPXH 2R8SL 3CD4A 1OP3K 3WFBH 1IGYA 5IR1B 1PBYA 4JFZH 1DE4B 1X5JA 4TSBH 2F54E 1IC5H 1XGQB 1QD0A 1K2DA 3FL7A 1I8KB 4YHZH 5JPNB 3KLAA 1G9NL 4MXWH 3BOVA 5FEBA 4LNRA 4IIQA 4MJIB 4PY8J 1QEWA 4LGPB 3ROOB 4BZYA 4M5YL 2GUOA 1JPSH 4NP4H 1MCCA 4TVPH 5HYJB 1GRWA 1JK8B 4PG9B 3ARFD 3EYSL 4L8DB 1I3VA 5BO1H 3G9VA 1RZJH 3REVA 1EFXB 1WUNT 2AJSL 5DMIL 3IXAB 3W0WE 4ZTOL 3CVHH 1CICC 4X7TA 1NFDE 3PWNB 1IAIH 2E8YA 3PV6A 3GMPB 1TZGH 3GHBL 1YEHH 5JDSB 4PRHE 1ZA3A 5C3TA 2JB6A 3HB3C 3DSFL 5FOJA 1TMCB 1XGTB 1OAUH 4RFEB 3QHFL 4JR9H 5GGTA 3SBWC 2OK0H 2HTLD 1NC2D 3V2AR 2AQ2A 4JQIL 1CFNA 5AAWA 2H8PB 2BC4B 4WY7L 5L9DL 3C5JA 1OAXH 5GS3A 4Z7VE 3NIDE 2W9EH 3D85A 1VADA 2DLFH 5ANME 4B0MM 4LCYB 1LK3H 3BI9X 4P2CG 5JOFB 1S9VA 4DEPC 4PGCB 4MZ3A 2EIEA 2AJXH 5DLML 4PB9L 1UJ3A 1T80A 4YEFA 4OLWL 3FZUC 4P2OA 3AY4C 4XXDA 2BSTA 2HJFA 5FCSH 4LQFH 3QZWA 2WUBL 2QR0B 4KUCF 4Y2OA 1WJ3A 4RIRB 1LVEA 2DQUL 4XBEL 3V0VA 3GEWB 1IKFL 2SEBA 4Y4FB 4H20L 4GW5B 2XG5A 3PWLA 2E7LA 1FZMB 1H3TA 4NO5A 3BPNB 5D1XB 5DVNA 5EH1A 5AUMA 1TVBB 1MHEA 5D7IE 4BSVB 4MJ4A 2HJKB 4PTTA 3X3GH 1A7RH 3MREB 5HGDB 1Q94A 3KPNB 1AJ7H 4GG8B 1AIFB 5TE4L 4ZD3H 4U6TA 1EV2E 2WUCH 2QSQA 2VC2H 1MFBH 1GOGA 3HUJF 5TPWH 4ETYA 3SDCC 1DUZB 5DR5H 5HHVL 2FWOB 4KI5F 5FB8A 2F58H 1G0YR 3F58H 5L0QB 2NY4B 3B5HA 4XPFH 5FCUH 4TSAH 1OSPL 4P2QD 4IRJB 3OKMB 4TNWF 2Q86B 4JKPL 3QO1B 5JHDE 5IW1B 4CU7A 3G5ZB 3I6KA 3QDAA 3HZMB 1B9ZA 4K94C 5EUKB 4ZYKA 3OG6B 4LSPH 5JZ7C 1IGTA 2XV6B 1H0DA 3PDDA 4XNXH 5B4MD 3UJTH 4ZPVA 3B8SA 3HG1D 3WJLA 1CFQB 2DI9A 3BJLA 3O8XD 5DJ8B 5DQ9B 2OCFD 3QHZL 5CJBA 4Y5YB 1I75A 4NKIL 1BEYL 3PP4H 4J3OC 1KBGL 1TTUA 3DX7A 2H3NA 4K7FA 2X4SB 2WIIA 3HPJA 2LTQB 5DYOB 3RWIB 2ZZUT 3K8KA 4YFLI 1SBSH 3OB8A 3C8HA 1EX0A 1YC7A 5LKNA 4I5BB 4QOKA 5T5FL 3E6HB 3QULB 3GSVA 3PWJB 4YEEA 3IFNH 3OR7B 2KKQA 4XP5H 5SWQA 5C2UB 1J10A 2C3VB 5FXCH 2NY5L 2DS4A 3H9SA 1MRFH 4KQ4H 4LMQE 4F80A 4M7LT 5C09E 4M00A 4XTRC 3L3OB 3AROA 1FJ1A 4OD3H 1JI1A 3HA0A 3GBNH 1FSKC 2YK1L 1AHWC 4V1DA 1NGQH 2YD5A 3ZYIA 3WKML 5DZLA 4ODUB 4OTXL 5DGRA 3KJ6H 1HWHB 4GRMB 2AGJH 1S9WB 4FS0A 1GXEA 1YNKL 1WAAE 2E3VA 4MLSA 5E6IC 4L3CA 4EXKA 5GRVK 25C8H 2RB8A 3B4NA 4Z95L 1AXTH 2CDEB 1PGRB 3MBEA 1GOFA 4HZLA 4AIXA 5DZOA 4X7CC 4Q6IC 5CMAA 2ZJSL 1N59A 4G43B 4NGHH 3UTPD 2PXYD 1OF2A 4PJXB 3TNNB 5GRUH 2BERA 2FD6L 3BIKA 1DQMH 3FO0H 3IETA 5D72L 1WK0A 2Q7YB 5HDQL 3LKQA 3S98A 1HN1A 5D1QD 4G7YL 1RJLA 4NUJA 4Q9CA 3B2VL 3HAEG 1GC1C 1M7DB 3BEVA 3TYGL 3LN9A 5JIPA 1Q8MA 4L29A 4K3JH 1D5IH 5IR1A 1BF2A 4MA8L 1RJYB 2FYYB 1DE4A 4NQXB 2FHBA 3B2UD 1II4E 3HUJE 1ETZB 1W0VB 5SWZE 5HYEA 5HTSA 5I74B 1I8KA 2VKWA 3V52L 3QR2A 4Y1AB 4MJIA 4F15C 5HI3C 4WV1B 3SQBA 3QPXL 4M4RA 4S0TD 3WFBL 5HYJA 4TUJB 3CLEL 1JK8A 2GJZB 4PG9A 5JW4M 4WFFD 4OFPA 4JFZL 4N5UA 1N3NA 1OSZB 3MJGX 1TCRB 3WFCL 1F2XK 1IC5L 1T4KB 4ZO7A 1EFXA 5D1ZA 4YHZL 4MD0B 2A6KB 3IXAA 3UO1H 2NXZC 4M7KH 4MXWL 2EO1A 4R96B 3B5GA 5AZ2H 3PWNA 1RPQA 4UU9B 3BZEB 2DQIH 3UTSB 3UTTB 2ED8A 3NCBB 3CSYB 4N0FB 1RZ8A 5JOEA 4NP4L 3O3AA 1XGTA 3T4YB 5BO1L 4L4TD 4RFEA 1RZJL 3BJ91 4KKBD 4RA0C 4XP6L 5JXEA 4YK4B 2IPKA 1OP5K 5F3HB 1X44A 4LAJH 2H8PA 5CJQH 2BC4A 5A3ID 2YUXA 1YEHL 2W0PA 4NWTH 1DLHB 4LLDB 4P4KB 1GIGH 3ET9F 1TJIH 3N1FC 4TSCH 5IVNA 5T3ZE 5AYUH 1KN2L 3RZCC 5J7CC 4JR9L 2Q87A 4HUKB 4HCRA 2EIZB 2OK0L 1OW0A 1YEGH 3I3BA 4PJ8D 3DOSA 3LB6C 4OKDA 2ERJC 2DYPD 2CKBH 4OCWH 4AJ0A 5J1SC 3U9PH 2OMNA 2DLFL 3TVMD 5DRWA 3ZE2F 5ID1A 4PRID 2AJXL 1KB5B 5HD8C 1KPUB 4XWOD 3IDXH 3BPLC 1YEKL 3SDYH 3TESA 4I18B 4Y4FA 5D4QA 3T1WA 4GW5A 3DURA 4LQFL 1FZMA 1I8LA 3TFKC 2V9RA 3VGBA 4BZ2H 4BSVA 2HJKA 4ORGB 3MREA 5HGDA 2XXCB 1BFOB 3KPNA 4GG8A 4G3YL 1AIFA 3FO2B 4XVUD 1MJJA 3GFUA 5C92A 5BXFA 3U0WH 4DUWA 1ZLVK 1FNFA 4PJCB 1UKSA 1MCDA 5HYQB 1FP5A 2JCCF 4LRNL 1XF2B 3L5HA 3KYKL 2FWOA 4JO3H 1L9NA 3WS6A 1I9EA 1A7RL 3O6ML 1AJ7L 1H5BB 3P77B 2QTEA 4IRJA 5CS7A 2WQRA 1W8OA 3HC3H 5EC2B 1P9MA 5IW1A 2WUCL 1A6VH 4KHXL 3HZMA 1QBLL 2VC2L 3UC0H 1OAKH 1MVUB 1C7SA 4HFWB 5C0IB 5TPWL 4R97C 1MWAB 3P4LA 5C86A 1MI5A 2F58L 1CFQA 5C0CD 1WISA 4KY1H 1D6VL 1L0YA 2EDNA 4MNQE 4TSAL 1N2RA 2VZVA 4LASH 2F53B 4WHYH 2FRGP 1A6WH 1AD9B 3T0EA 2UZIL 2XZZA 5J1AB 1XF1A 5CILL 2Z4QB 2X4SA 5DYOA 5JTWA 1TIUA 1DSFH 3RWIA 4YWGL 2FECI 4GAJH 1JGDB 4PREB 3QULA 4PGEA 4TQEH 2EDYA 5I15L 3OB0H 3OR7A 3U79A 3UBXB 2YA0A 2V2TB 4N8VB 4FQCH 2C3VA 3MXWL 4P3CH 3OAYH 4WU5A 3HC4L 2DB8A 3FCTB 3H3PL 4NZDA 2Q20A 3WIHL 4PLJC 3S37X 3ALWA 3OAUL 3L3OA 1M71B 2VXQL 4X7FC 3SN6N 3QUYC 4TUKH 2QADB 2WWKO 2ZUQB 3IFNL 1P4IH 1MELA 1Q9LB 1WC7B 3QDGB 3DI2B 1WLHA 4GRMA 5IK3B 1S9WA 3NGBC 4JPIA 4JY4B 5GRXG 3FB6B 4PJ7F 1RD6A 2X1XR 3T0VA 3P40A 4OD3L 5DRXB 4KFZC 3W9EB 3RUGF 3DUUB 5E9DE 2CDEA 3ZE2E 1XIWC 2Z8WC 1J5OH 3K7UA 1WCBA 1W0YT 4ZFGH 2M26A 1K5NB 2V5YA 1B4JL 4O51B 3RDTB 4G43A 3TNNA 3SDAB 1OT2A 4HQQL 4Q9BA 2BXZA 1KT2B 3MCG1 2X2YA 3QQ3B 4PY8I 1ZSDB 4ELMF 1GOHA 3BGMB 2NY2D 2DD8L 4MAUL 3VFGL 2EC9U 3GMOA 1M7DA 3EAKA 1OLLA 5GRUL 4X6FB 2ZPKL 1DLFH 4AMKH 2HMIC 1F00I 3O11B 3FO0L 2HKFL 4P99A 3DV4B 2FYYA 3DX8B 3B6SB 5F8QC 5H2BB 3U0TB 5T1KA 1ETZA 1W0VA 2JCCE 5HVHB 3TPUA 5F9OL 4MGXA 5B39B 3V95A 1WWCA 3SPVB 1KIQB 4Y1AA 4JPWH 4WV1A 3VWKD 3O2DA 1BAFL 3GNMH 3C6SB 4K3JL 1D5IL 1VFMA 4TUJA 2GJZA 5DRZB 4POUB 1OSZA 1TCRA 3VJ6B 1M1SA 5EO9A 4DW2H 4MD0A 1LEKB 2A6KA 4LIQE 3B9VA 2XYCA 4MMXC 5IMLB 3RA7H 5D2NE 3E3QC 1T6WA 4L9LB 3VXRB 4ONOA 3UTSA 3ZMRA 4YDLB 3CSYA 4N0FA 5HI4D 2ICWJ 1IRAY 4N90E 3SKNB 4J3WA 2EDRA 3T4YA 4KQ3H 3LY6A 2HFTA 1TVHA 2NW3B 3O45B 4A6YH 3QIWA 5BCAA 1T0MB 5SV4A 1UH3A 1J0ZA 1CGXA 1VEPA 3UO1L 4M7KL 4J23A 3RY5A 2PO6D 5FK9B 3F7YA 5F3HA 2V17L 5IROC 4KI5C 2DQIL 3EO1A 5KVFL 1OGAA 1PY9A 4I0PD 3BGFC 3OKDB 1B2WL 1DLHA 4TPRH 2D7TH 3KNBB 4ZOAA 4MB4A 5IKCB 3U7WH 4LLUB 1SY6L 5FGRA 1WBZA 4N0RA 4H0HB 5HYSB 3MCLH 4F33B 2EIZA 4PJHF 3P0VH 4Q2ZB 4JJ5B 2COQA 3I6LD 5F3BB 3EJJX 5CJQL 4PTUB 2GIYA 5DQDH 3QXDB 4NO2B 1YY8B 3U2SB 1GIGL 2R1XA 4IMLB 1TJIL 4TSCL 5T3XD 4I1NB 1M4KA 5C8JA 3BT2L 1U3HD 4WEBL 1KLUA 4PJ7E 1KPUA 3K46A 4HIXL 4WVRA 3QB7C 4D0CB 2O61B 1YEGL 4G6AC 1AC0A 3QEQD 3QDME 5HXMA 3RUGE 1IBGH 1HYRC 3HE6C 4OCWL 5E70A 3O6LH 3LDBB 3F7VB 3U9PL 4MNGE 2X4TB 3OXRB 4GMSH 1A7NH 1WVZA 1BFSA 1E4XI 2LVCA 5D8JH 4XPGL 5KS9F 4ORGA 4XMPL 3IDXL 5BOZG 4ISVB 3FO2A 1S78C 2Y9RT 2GY7B 4KK8C 1KENH 3UXFA 4PJCA 5I71C 1ZLWK 5BV7L 4P2QE 4S1QH 5DD0H 4J2XA 1FO0H 4PP2A 4HHAA 4NNXA 2Y25A 2VLJB 4BZ2L 1DVFD 4WFHE 4PJFB 4U31A 5CZXD 1MNUH 4QXUL 3VFUA 1SEQH 1PG7X 2W60B 2VLRD 3HG1E 3NPSB 1AKJD 3U0WL 2W38A 1OGTB 5I1DB 1T03L 1UJTA 4HFWA 1I1AB 5C0IA 5I17B 4ACPA 4YDJA 4TULL 4JO3L 3TBTB 4ODTH 4OCLC 2NTFB 3M45A 4MHHG 4EKXA 3MGTB 2F53A 5EU4B 4WGWB 1MFEH 1RUQH 1A6VL 1N5YL 1AP2B 5IB5B 5J1AA 4OT1L 2Z4QA 3N9GL 3QCTH 3G9AB 1PKQB 4NPYB 1CD1A 4DOHB 1CDIA 1QHOA 2CK0H 5AZEH 4FA8A 2BHUA 4KY1L 2VDNH 1JGDA 4PREA 4Z6AT 1O0VA 4LLWA 3C2AL 2V2TA 4MA3A 3MQIA 1L9MA 2FJGB 1FYTE 1MJ7H 2D7QA 4D9RD 3FCTA 2OL3H 4HDIA 1DSFL 5DURB 1RUPH 4S10A 3DVGA 1M71A 3KR3H 3CDCA 1MEXL 4U7MA 3BH8B 4BQBA 3QIBB 1V05A 1YEFH 4W6WB 1S5HB 1J8KA 4IOSD 4JRYE 4FQCL 4E41B 2NR6C 1Q9LA 3C60A 4PJHE 1WC7A 2J8UA 4YC2C 5IK3A 3EZ8A 4JY4A 1N6UA 5EC1B 1G7JA 3FB6A 2IMMA 1D5MB 3UTPE 2J2ZA 5L8LB 5DRXA 1TTGA 1IGJB 1KXTB 1TDQA 3CXDL 2QSTA 3D3VD 3DUUA 1P4IL 4K55A 1K5NA 2B4CC 4O51A 3RDTA 2YPVL 4M93B 3CX5K 3SDAA 4QF1B 2YD8A 4ODHH 1FH5L 3CLFL 3ZDXF 3BKYH 3M07A 1KT2A 3ZLQC 5K9OB 3QQ3A 5E5MB 5SWSB 4KKAC 4JHWL 3P9WB 1ZSDA 1FL6A 2P47B 5CUSH 1X9QA 3BGMA 5KTEH 2RJMA 1EAJA 4JZJB 2H1PL 5KS9E 5GGQL 3QFDA 2HN7B 3ARGA 5DJ2B 5D6CB 4X6FA 1JF6A 3R06B 3KYNA 4ZTPL 3DV4A 1NGXB 3DX8A 3B6SA 5H2BA 2BSRB 3U0TA 4QNPF 1BBDL 3UTZB 1AO7B 5JW5B 3ECBB 4WFFE 5B39A 3SPVA 5MI0C 3RL2B 4YHLL 1HQRB 1QLRB 3ILPB 1BIHA 3PGFL 1KG0B 5DRZA 5CJ8A 3EOTL 2ARJA 3VJ6A 4B41A 2EE3A 1RZGB 3ZL4L 1LEKA 4XAKE 3F12B 4TNVF 3O4OB 3LS5L 4LSRH 4HBCH 3VXRA 3WEXB 3GNML 1CWVA 5J9PB 3LN4B 5F72S 3SKNA 3G6JF 3UROR 1P7QB 3O45A 2NW3A 1AC6A 4KRPD 5E00B 1LDSA 3ORJA 1R0AL 4DW2L 4JFHD 3RGVB 3RA7L 2XRAL 5FK9A 1JZ7A 4X6EA 4OV5B 4KWUA 1NDMB 1YYMH 1QKZL 2EE9A 3HI1B 2DQEL 5IKCA 3R1GH 1HHJB 1UH2A 4Y4KB 1HHGB 4KQ3L 4UT7L 3WHXB 1FZKB 4LIQH 5HYSA 3U1SL 1SEBB 3T8XB 3VFMB 4Q2ZA 3GJEB 3UCRA 1JZ8A 4KV5F 4F9PC 2V9TA 5F3BA 5AEAA 5GZND 3D2UB 1HH9B 3LEVL 2DWEB 4PTUA 3SDDB 4JZOB 2FO1A 1JNNH 3U7AA 4RFOH 3QXDA 5B3JF 1FL3B 2HJLB 4HLZH 4TPRL 1HH6B 3IFLH 3U2SA 2HTLC 3D87B 2DKSA 4E9LA 4D0CA 3SJVB 2AEPH 2YA2A 2GAZB 2JJSA 3F7VA 1JYWA 4U6YB 1D9KB 1YEIH 5F71A 3OXRA 4JFXB 5HVGB 5B38B 5E1HB 4JFEA 3TM6A 4GAYA 1GCFA 2YRZA 4G5ZH 3S37H 5EOQH 2VN7A 2HWZH 1IBGL 3CU1A 1MCHA 3O6FC 1F42A 1BQHB 3GSNH 4GMSL 4POZC 4QCIB 3CFBB 4U0RB 5T3ZL 1PW3A 5H8DA 2Y4SA 2ICES 4N1CA 3KLDA 4FFZH 5C0FB 5FM8A 2FECL 5C0CE 4FHBD 4QNPE 1K9TA 5I1HH 1KENL 1OP3H 1A9EB 5KZCD 3GI8H 1OGTA 1SJVA 5I1DA 1JHTA 5I17A 1I1AA 2D03H 2EDWA 2C7UB 4ODBD 1Q1JH 4P23C 5IG7B 2VDPH 4XPTH 3LHPL 1L7TL 1S7SB 3VD5A 1SJXA 3TIDA 3DX9B 1JVKA 3GJFB 5CP7A 2NTFA 2FH6A 1SEQL 1T1ZB 3MGTA 4M62L 5EU4A 5DA4A 3VMPA 4UNVA 4ENED 1AP2A 2XNAB 5IESH 1CD9B 5IQ9B 5GJTL 4JREB 3VXSB 3P3YA 4NPYA 4M7JL 1CDBA 4M1DH 4HMEA 4OGYL 4GJTB 4NHCH 3PP3K 4X5XB 4JDVB 3LKOB 4RWHA 5I1EH 1OTUD 1H3GA 2VXUL 1QR4A 3G6JE 4NBZB 3UPAA 1NMBH 1MFEL 5B4MC 4DVBA 2C3WA 2FJGA 4ZFZB 4NN5B 3O8XC 4R8WL 5LXGH 3TBWB 2CMRH 3MLSH 3VI3E 2Y36L 4MVBD 4R90H 1OVZA 3DWTA 2DQCH 2VDNL 3QUMB 3T0BA 4ZFOL 1JTPA 3O6KL 5ID0A 2H2SD 2WWMC 3QIBA 4XP1H 1QSFA 4OF7A 1DEEB 2XXMB 1BECA 5JIIA 2L7JA 5CINL 4Y5XB 4WTZA 4Y4HB 2B0SH 2OL3L 4KV5E 5EC1A 4DAGH 1RUPL 3PE9A 5BJTA 5ILTH 1RV6X 3HC0B 1D5MA 1BIIB 2AXGA 3D39B 4X7DC 5FO9B 3PHOB 3KR3L 4WWID 1RQ5A 2EDLA 5B3JE 1IGJA 3X17A 2ZCKH 2W9DL 3BPOB 1YEFL 3VDAA 2RAMA 5K9QG 4QF1A 4EN3B 3LSOB 3D5OF 1P4LB 1JZ3A 5LAXA 2PYEB 5E5MA 3QJFB 4NKDB 4OZHB 4JPVL 5BZDA 4JZJA 1P1ZA 3KYAA 3QAZB 1ERNA 1I85A 5DJ2A 1RU9H 4P9HC 2DQHL 4ODHL 3R06A 3VGAB 5I0ZA 1NGXA 2W0FB 4H25B 2YWYA 3OBAA 2BSRA 4LGRB 1NL0H 3UTZA 1AO7A 4Z9KB 5JW5A 4QRRB 3OJMB 1NSNH 4WO4D 3RL2A 5D7JB 3ZO0A 1HQRA 1QLRA 2ZNWA 3ILPA 1UKQA 4X5WA 3IS0X 2AK4B 1LE5B 2N4IA 2VH5H 5FUZL 1RZGA 3QUZC 3F12A 2VDML 3MOBH 4HIIB 4XCEB 2OXHA 4EI6B 2LE9A 3MZTA 1CVRA 1U8QA 1RIUL 2CIKB 4WNQB 1I7ZB 3WEXA 3HE7B 5CIPH 5J9PA 3LN4A 4K7PH 4AG4L 1KCRH 1P7QA 5F70A 2PYFA 4NN6C 4ALAL 3RGVA 4UILL 5DD6A 4XI5D 4P0DA 4J3XA 4OV5A 4Z7UA 5JHLH 1NDMA 4HBCL 4KRNA 2VYRE 4MWFB 5TDPB 5C0NC 3HI1A 4PGZA 3C2SA 4YUEH 1HHGA 5J13B 4U4BA 4XCYB 3ILQC 3RRQA 3WHXA 3BISA 1FZKA 4BQCA 1SEBA 3T8XA 5HBBA 4HULB 3VFMA 4Z77B 4UNUA 2R9HC 4OLVH 3RJDA 2BX5A 5T3XE 1N0XL 1E4XL 3MNVA 3FB8B 2WLZA 1KJ3L 3SDDA 2XT1B 3QEHB 4JZOA 5FYKL 5KVDH 1ZV5A 2K3TA 1FL3A 1HH6A 2D0GA 3R1GL 4Q58C 3DMMB 2AEQL 4HPOL 1SYVB 1W8NA 1VSCA 5FV2A 3UTTD 2Y5EA 3JV4B 5A3IC 2IQAA 3K0WA 5KSBB 4I4WA 4RNRA 4YBQC 1JNNL 4U6YA 1D9KA 3VFWB 3IFLL 4OQTA 4JFXA 5B38A 5CD5D 3WSQH 4PJ8C 4GBXB 5ESVB 3HNSL 5CHNB 3WNKA 3AMKA 4L9DA 1N4XH 2J6EA 3KPSD 2UYLB 2YKLH 4NRZB 4P4KD 4PP1D 5MP6L 2AEPL 3TVMC 4OF3A 3TH3T 2R4SH 1BQHA 3VG9C 2B20A 2VLRE 1YEIL 4FXKB 4LARH 4JHAL 3CFBA 1ZXQA 3NA9L 2R1WB 3VWJB 3PNWB 4P5MA 4U1GB 1OTTD 5KANI 3B9DA 4G5ZL 3S37L 5EOQL 5C0FA 3WHE1 4MA1B 3CVHB 1J1OH 1A9EA 4KDTC 2YMXH 1JNLH 1CL7H 3WN5C 1FRGL 5HYIA 3CSPA 5T1MB 3UBXG 2C7UA 3GSNL 1G7HA 1DL7H 3NIFF 4N8VG 5IG7A 5LGHL 1H8NA 4K9EH 4CAGA 1S7SA 3RWDB 2R2CA 4MCYB 1BREA 1LK2B 3MLVH 1AFVH 3GZKA 5EOTB 4ZO8A 1MAMH 5I1HL 2ED9A 3FFDB 3GI8L 5LCVH 5IQ9A 2GFBB 5TE7H 12E8L 3RX5A 2D03L 3VXSA 5F6HJ 4JFDD 1Z3GL 1Q1JL 2G5RA 4XPTL 3RI5K 2K7PA 2NY6C 1YMMD 3B9EA 4LVOC 1FAKT 5CSGA 4D9RE 3LKOA 1V5JA 3RVXD 3JWDH 3EO0B 5CBEB 3SGJC 5IJKC 1CE1L 5CP3H 3JWDC 1A6ZB 1B6DA 4JDZB 1UCTA 4ZFZA 3ULUC 4EI5B 2FIRT 1ADQA 5C0DB 5DT1H 3TBWA 3WO4B 1LMKA 1QLFB 3FHAA 5DVMA 3CDYA 1OP5H 2HLAB 1X4YA 3QUMA 2WZPD 4WFGD 1DBMH 1WICA 3QHTC 3QXTA 3P9MA 3RWGA 4FZEL 1DEEA 4MAYD 5D5MA 5ETUB 5FO7B 3TYFA 3D3VE 1FAIH 4Y4HA 1NLDH 3GB7A 5DJ6B 3HC0A 1BIIA 2FLRT 5DZNA 3PHOA 1G6RH 3OKLB 4M43H 3VXTB 1WT5A 2DQCL 5DO2D 1KULA 1MH5B 2F74B 3EBAA 5KSVA 5KJRH 2BVOB 2DM2A 4JB9H 4PGDB 1OM3H 4PLKD 3RY6C 5C08B 2F8XC 1A1MB 4EN3A 3LSOA 2AXJA 1P4LA 4YPGA 4JAMB 1S5IL 2PYEA 2R56H 3RKDD 4KGLA 1RUKH 2Q7NA 5DK3A 2ZCKL 1A3RH 3QJFA 4NUGH 3V6OC 3P30H 4NKDA 2P5WB 2PW1B 2A1WL 3CXHJ 4F7CB 2AV1B 1U8LB 1V3JA 1FNSH 2APTA 2QADD 3FO9B 2F5AH 15C8L 4H25A 4YXHL 3OKYA 3QDGD 1FFOA 1GGIH 4Z8FH 4QRRA 2XA8H 1OD9A 4WI5A 2OR8A 4QRQB 1ZLVH 3I50H 3LEYL 5IMMB 5CLWA 4B50A 3P9LB 1RAMA 5D7JA 3WHE0 1RU9L 2X4QB 2BNRB 1SM3L 1CR9L 4OV6F 4ZS7H 2AK4A 2PETA 3T08A 2JKXA 1W72H 2NY2C 2EDOA 4U7SA 3NIFE 1R3IL 3TO4C 4HIIA 5ISZB 4XCEA 1FPTH 4OLZH 4WNQA 1I7ZA 4JFHE 3HE7A 3SQOH 5I8CB 3ZHLA 1J12A 4NQEE 5E8EB 1DBBH 2B39A 1E4WL 2VH5L 3LQAH 5FM4A 1OWWA 4JG0H 1FIGL 4CDHA 4ERSH 1YUHB 1FBIH 4G7VH 2GJ6D 4FFVC 4O2EA 1LE9B 3PL6D 2R0WL 1M6OB 1HSBA 1NAKL 4AIZA 4MWFA 4R26L 5TDPA 1QFHA 1ZTXH 4XNMA 3B9KD 2N1KA 3UYPA 3MZGB 5EG6C 1U8PB 1WIOA 4W6XB 2YPLA 5F21B 3TJHD 4BK4A 1CN4A 2WBJB 1ZLSH 5JHLL 3MV7D 3S88L 1MCJA 3BGAA 1ZT7B 4P5KB 3IU4L 3QEHA 5F7EL 4JPKH 2OI9C 2DQJH 1PG7L 3MRKB 5GISL 4NIKB 5J11C 3EGSB 3DMMA 5ACZB 4NFCA 4YUEL 5T1LB 1GGYA 4OLXH 3TO2B 2PKDA 3S5LB 4ELKB 1BD2B 1RULL 1VACA 3T1FB 3JWOC 1EO8H 3VFTB 1MRCL 2GY5A 4FQ2L 5KVDL 1VGEH 2BJML 3C9NA 4FQ1H 4KKLD 4ONGL 5ESVA 2CDFB 5T3XH 2UYLA 1KCKA 4BH8B 1KSRA 2BNQB 1EPFA 4NKOB 1WBYB 3PWPA 5E5RB 5D7LD 1U2CA 2R1WA 3WSQL 5E08H 1LILA 2E27L 2G60L 4JO1L 5I76B 5EFIB 1N4XL 4PJXF 2DMCA 4TRPH 4YHIB 3CVHA 3ZZ1A 4L3EA 4RCAA 1RZ7H 4JM2B 1JI2A 5LGJB 3U4AA 4LAQL 1A1NB 5T1MA 3WXVL 3MR9A 1C08A 4MCYA 3TNMB 3VD4A 2F54B 1IL1B 1CDCA 4M8QB 5EOTA 4UINH 4RRPA 2EDXA 3KAAA 1XR8B 3MRRB 2Q1EA 4RISH 3BQUB 2GFBA 1Q9OB 2UWEA 3FOMB 3DXAD 3IDJB 4K9EL 1A3LL 5LBSH 4W4OA 3FRPA 4YBLB 4DK6A 2HG5B 1N7ML 3EO0A 5CBEA 4RMWA 3W0WB 1CT8B 2XZAH 4JLRB 1NFDB 1A6ZA 4FTVD 2X41A 3EIFA 5LCVL 5IWLC 5E8DH 4ZODA 5TDNB 1A8JH 1EXUB 5C0DA 2CKBB 6FABL 4PRHB 4F57H 1KNOB 1QLFA 3OTTA 3T0WA 2HLAA 4ODWB 1MY5A 4BKLB 1GH7A 1R5IB 1D5XB 2CIIB 2LU4A 3N06B 2EEAA 5ITFB 2AERT 1MCRA 4X6CF 1U2HA 2D9QB 5FO7A 3ELAT 5ETUA 1S7WB 1JGVH 4MQ7B 2CJUH 5DJAB 1FNHA 1FDLH 1Q9KA 2A9NL 2K1MA 4Z7VB 1JF5A 3QQNA 5DJ6A 4XWGL 5ANMB 3OKLA 4K94L 3UYRH 3VXTA 1MH5A 1FVCB 1DBML 2F74A 3NPZB 5I19L 2BVOA 3VD3A 4LVNB 1OQXA 5JUEL 4UDTB 1UG9A 1J1PL 2HFEA 4PGDA 3MFFB 5EN2A 5DMGD 5E2WH 3H9YA 5C08A 3SDCA 4FP8H 1N5AB 5IMKB 1DQTA 4JAMA 2JK5B 5EB9A 1J05B 1WV7T 5MEQB 4M43L 3OKOB 1RHHB 4MA7L 5I1JH 4GO6B 5KJRL 5IFAL 3V8CA 2Q6WB 2P5WA 2PW1A 4F7CA 4XZUB 3T2NL 3NCYP 1U8LA 3ZDZE 5F7KC 3AM8C 1UWEH 4R4ND 3FO9A 4IOFC 4YDKH 4CVXB 4FG6C 3I9GH 2R56L 4E41D 5D7IB 5L2KA 4QRQA 5ALBL 4X9HA 3P30L 5SX4H 1ZLWH 5IMMA 3B3IA 3PQYE 4JVPA 3V9FA 1ZS8B 3BD4A 1F58L 4ESKA 5CJOH 4FZ8H 2F5AL 5EULV 1RZFH 2P46B 4OFKA 2JTDA 3PJSB 1IAMA 2XA8L 4QT5B 1KJ2A 1QBML 1OLZA 2QSCH 3I50L 2QKIB 2WAHA 3LMJL 1QOKA 4H1LG 5SWSD 5TDOA 1XEDA 4AEEA 3LKRA 5I8CA 2RQ8A 4ZS7L 4BUHA 3EHBD 5E8EA 1R3HA 3FQTB 1GGCH 2VO5A 2HRPH 4YO0A 2YD4A 4Y19A 4GMTH 5E2VL 3MBEC 3ZTNH 1LE9A 3V6ZB 4JFYB 3CVIH 1M6OA 3K2MC 2MTPA 3CFJB 2IMNA 1MCOL 2HFFB 4EOWH 2NY1D 1GC1L 2EYSB 4HMDA 5CEYA 5C1MB 3BP4B 4XNUL 1U8PA 3O9WC 4ERSL 4HMCA 1FBIL 3CGTA 5KG9A 1ACYH 4Q6IA 2WBJA 5GGSY 3CFEA 1MPAL 1C16A 1CXFA 1UXSA 2ZG3A 1ZT7A 4P5KA 4X6CE 4K8RD 1N0LA 3MRKA 3CJJA 5FIEA 4TTDC 2QQQA 3STBA 3EGSA 3SE9H 3C5ZD 4X4ME 1K8IB 4FQXB 4UQ3A 4AEHL 5T1LA 4P59H 1OAZH 5C09B 3TO2A 3GJFK 4EDWL 3S5LA 4ELKA 1BD2A 4NO0B 1IQDB 3DO7B 3T1FA 2HT3C 3BE1H 1ZLSL 3VFTA 4UUJB 3JV0A 1U8KB 3ETBF 4TTGA 4JPKL 1KTDB 3KPSE 1UWXK 1IEBA 4IS6B 2C4XA 1T5XB 2P7TB 3CFKB 2P24A 5F1IB 4OLXL 5HHOE 4I2XE 4JJHA 5TGBB 1DBAL 1A4JB 3LN5B 5IIEB 1JYNA 4BQ6A 2BNQA 5IFHL 4PV8B 3MLUH 1MHCA 1WIUA 4NKOA 1XH3B 3OHXA 1WBYA 1J8HD 4CN6A 4DCQA 2X6MA 4GLRI 1I3UA 1F6LL 5EFIA 1HNFA 4P49A 1JN6A 1ITCA 4P46D 3ISWA 3Q5YA 3ARSA 3SDXA 5F6HI 2BFVL 3MO1B 5JXEC 4YHIA 2R69H 3RI5F 4D3CH 3X13B 4NC2B 4ZUWB 5LGJA 1A1NA 3C6LD 1J0JA 2F8OA 1U3ZA 2VZSA 3OJDB 1R5WB 2DTSA 3TNMA 1YJDH 4U0QB 5I75B 4KKCC 2F54A 4CJ0A 5KW9L 1IL1A 3HUJB 4JFDE 4O4YL 3VFNB 4A6YB 5SWZB 5H94B 5GZOD 1YMME 2XFXB 1XR8A 4GSDL 2P48B 5DMYA 5FECB 1RZ7L 2RCSH 3MRRA 3BQUA 3K3QA 3RWJB 1Q9OA 4FQIL 3GIZH 4IDJH 3QNYB 3IDJA 4ZO9A 4YXLL 5IB1B 5C0BD 5FGCE 3O0RH 2HG5A 4OF5A 4UINL 2ID5A 3KPLB 1CT8A 3W0WA 4TUOB 4JLRA 5M94B 1NFDA 4IDLA 4RISL 4WFGE 5TDNA 1YPZF 4Y4FC 1EXUA 1T7ZA 3NACL 4P2OD 2WM0A 2CKBA 4PRHA 2BP3A 1KNOA 2I27N 3BPNC 5D1XC 5LBSL 3VGDA 5EPMB 1A7BA 3CFDB 3NCJH 2LAAA 5DI8B 4BKLA 4ENEC 1R5IA 4WW2F 2CIIA 3MRHB 5J12B 4PLNC 1ZAGA 1B6UA 4RAHA 2E9WA 3QDHA 4O02H 4N0YH 1PZUB 4FABL 2W0LA 2CLZB 4F57L 4JDTL 5ANMA 3ARQA 1VEMA 5L0QC 3AAZB 2NY4C 2VZ1A 1FVCA 3VG0L 5J6HA 3T2QA 5HY9B 4UDTA 5E24E 4IRJC 3MFFA 1JGVL 1XMWA 1CGVA 1P9MC 1P5UA 4MVBC 2QL1A 1LEGB 4PBWD 1LP9F 5IMKA 4Z7OE 1ZLUH 2H2SC 4KTDH 1FO0B 3S35X 2JK5A 4KXZH 3UYRL 4F7EB 3OKOA 1F3RB 1RHHA 3P11H 3SKUD 4Q0XH 4LSVH 3PF2A 4OIAA 1HEZB 4G6FB 1KELL 4XPBL 2Q6WA 4Y5YC 1S8DB 5C9KA 4DKAA 3Q48A 4UTAL 3QG7L 3GMNB 4FP8L 1IZKA 3FB5B 1AQDB 1DDHB 4CVXA 3MUGB 2LTQC 1U92B 4WCYL 5D7IA 3WYRA 4CVZB 1GZQB 5K33A 3HR5B 1PZ5B 2D7NA 1LWRA 1DQLH 1ZS8A 5IGXH 1MCQA 3AS1A 4FFWC 1NGZA 4KDVA 1UWEL 4UTBL 1NFKA 3UJIH 2P45B 3OF6A 2OM5A 4QTIH 2IGFH 5JO5B 4XC3L 3GSUB 3I9GL 5IBTH 3ARBD 3PJSA 4YBHA 3ARTA 4QT5A 3IF1A 3L3KB 3MXVL 5CGYC 1EHNA 2NNAB 1MAKA 4IHOA 2WP3T 2NW2B 4PJFF 5CJOL 4UV7H 3GDBA 3RKPA 4FZ8L 1GSMA 2OR9H 4XGZA 2OL3B 3RL1A 3DVFA 1BJ1J 1LO2H 2WQ8A 3FQTA 3QUYA 4I3RL 2DKMA 1VCAA 3QPQD 4MNQB 4WO4C 5I8KH 2CQVA 1P2CA 1IZJA 4KAQH 2EH7H 4NRYB 2JB5L 3CFIC 3V6ZA 2Z91B 4LHUG 4RZCA 2GCYA 1YECL 2HFFA 2I5YH 4NNYB 4ONFH 3RVUD 3KPMB 3UTOA 3FAWA 5I1KH 3MV7E 3THMH 1YPZE 1IFHH 2EYSA 3MRCB 2WV3A 3ZDYF 1XIWA 2VDLL 5GSVB 1FG2A 4BZ1L 4GMTL 1HHHB 1CK0H 5EZJB 3ZTNL 5E56A 5TE6H 4GLRH 2ICEB 2NX5D 4Y2DB 3CDGB 1ZHLB 2WINB 2FB4H 4CVUA 1R5VB 5GS1B 3VA6A 1T1WB 4NO0A 1IQDA 3MCKB 3QRGL 3DO7A 1ACYL 2IANA 2Z9TA 5I74C 4HC1H 1T66C 4G9FE 1D7FA 4UUJA 3V4UH 1NC4A 1U8KA 1RIHH 4Q97A 1H3XA 4WV1C 4Y7MA 4JE4B 4OGAD 2R29L 4IS6A 1CLOH 1N26A 2X1WL 3SE9L 2P7TA 4MD4B 1WTGT 1OAZL 1KXQE 2MQCA 2MCPL 1LP9E 5KAQG 3Q3GA 2AEWA 5D7LE 3BKJH 3PABB 2W91A 5E9DB 4AEFA 3BE1L 3LN5A 4UT6L 2N56A 4IRZH 2XA3A 3DARA 4JRXD 8CGTA 3ZYZA 4PV8A 3SCMB 5IV2B 1XH3A 4YFDB 3EW3B 5FV1L 1I8MA 4O9HH 4F58L 4OAWB 5DUPH 4U1MB 5EO1B 5I1LB 2OTUB 3PHSA 5CEZD 1AR1D 3MO1A 4YK4C 4W70A 3X13A 2YD3A 1IM9D 4ZUWA 4LHUD 3MLUL 5L88H 5IB3B 2E7HA 4X6DF 5ITBH 3OJDA 1R5WA 1U8HB 1OAQL 4P4KC 3ARPA 3DXAE 2JCCB 3HUJA 3VFNA 4A6YA 4I9WD 1BLNB 5H94A 5SWZA 3PWUA 2A0LC 3WD5H 4CJ1A 2XFXA 2BVEA 3ARFB 2QLVB 5EO0B 4BM7A 3V8OA 4GBXD 5FECA 4RAVB 3MV9A 3IJHA 4OI9A 1MCWW 4X7SH 43C9B 5TQ2H 4J3UA 4NZJA 3QNYA 4FTVE 1KB5H 3BVNA 3MNZB 3QISA 2DWDB 5IB1A 3GSXA 4NM8H 5DHVA 3KPLA 4WI3A 4TUOA 2XI9A 5D2NB 1AQKH 2E6QA 1I9JL 2RCSL 5EORH 4I18C 4NSKB 4PS4H 3BD5A 1NC2B 3BAEH 4NO3A 1GJIA 4IDJL 4LVEA 1YNLH 3CFDA 5E2TH 5DI8A 2XN9E 3LZFH 3I02B 3QNXB 3PXJA 4JM4H 4Y88A 3MJ9H 2HLFD 2VIRB 3ZDYE 3BN9D 4Q74A 5JMOC 3X3FH 2EZ0D 3RVTC 3RVXC 4KTYA 1QRNE 2CLZA 4HG4J 2E7MA 3VFSB 2G75B 1YQ2A 3WFEH 3NCJL 4HS6B 2ZUYA 3AAZA 5JNYA 1EAPB 5HY9A 1H5BC 3RU8H 3H0TA 2XPGB 1RJZB 4N0YL 1HE7A 4R2GB 3UAJC 1LEGA 3RX8A 5A2KH 1FO0A 1EA9C 3GSNB 4DKFH 1MHPL 4EI5D 1E27B 2ADGB 2UUDH 1HYSD 1HEZA 1QPXA 3BRDA 1IJ9A 4PJ7B 1A1OB 2Y6SC 3R8QA 3ULSB 4YX2H 2MPAH 1KGCE 2PCPA 3K4AA 3QDMB 2WNGA 2EYTA 3RUGB 2EDKA 3GMNA 4L8BB 3I84A 1UZ8B 3WO3B 3FB5A 1B3JA 1CDYA 1RVFH 4KTEH 5DO2C 3MUGA 4MNGB 4KTDL 4OCYH 3KPTA 2IH1A 1R3JB 3CX5J 1JJUA 4YHYB 4CVZA 1KN4H 1MI5D 3QYCA 3ULVD 4XB7A 1PZ5A 3U48A 5AG8A 1UH4A 1LO0H 1ROWA 1OD7A 1E0OB 3F65A 3FT3B 4JN1H 4JFQB 1PEWA 4QGTA 4PRPD 4NJAH 5F9AC 3UJJL 4UIKH 3WKNA 3T0ED 4I8DA 4P2QB 4AL8H 2X9YA 4DKEH 3GSUA 1RY7B 1BZQK 1KYOK 1RK0A 4X6DE 4EVNB 1G84A 1RURH 5FAAA 3L3KA 4OFIA 4MXQC 4N9GB 4O5LL 2NNAA 2QADC 1DQLL 4GUPB 3HG1B 5GPRA 2VABB 2ZUQC 4Z7WF 3PHQB 1K6QH 2NW2A 4OF8A 3O2VH 3UJIL 4S1DD 4QTIL 1U9KA 4CL7A 2B4CL 5DEGB 3S7GA 5JMRA 1A7OH 4DTGL 4HKBB 3WNLA 3QRFM 2YBRA 5EBLB 1MCSA 2B1HH 4RMQA 4NRYA 2Y07H 3AC0A 5GS2D 4OBSA 1YEJH 4G8GA 4PV9B 3S5LG 3RDTC 4UV7L 4XP9L 4HH8A 3ZKXB 3SDAC 2IADB 4K3EL 2J5LB 3OQ3B 4BFGA 5E5UB 4NOFA 1C5BL 5GSVA 1VHPA 3WDHA 4KUZH 1K4DB 2EH7L 4QHUB 1HHHA 4EIGB 4WHCA 3KPPB 2GEEA 3A6OA 2ICEA 3BP6A 1FYTB 2I5YL 4HPYH 3CDGA 4ONFL 1ZHLA 2WINA 5ISZD 4M6AA 4HX1B 3THML 4FFYL 4CRPA 1R5VA 5GS1A 1T1WA 4IOIB 5F89B 3A67H 3EZJB 4WI4A 3MCKA 1CGWA 4P57B 5HVHC 2VWEE 4OZIF 4OD2B 2A83B 4M7LH 5TE6L 4G8EB 4JRYB 3V5HA 1JV5B 4PJHB 2H6PB 5FYJU 2FB4L 4EZMA 3W11D 2DTMH 5E95B 3TA3D 4G6MH 1GHFH 2VDOL 1J8HE 1K4CA 2PXYB 2NY3D 1V7MH 3DYOA 4RX4D 3PABA 3X14B 5E9DA 5T1KD 2X09A 1WWAX 4RMTA 4LSQH 5ELIA 1MIMH 3MLXL 3MOAH 4DN4H 3P4OA 5DUMH 3SCMA 2I9LB 2VXVH 4L9LC 4CADA 3IDUA 4YDLC 2GK2A 5E6YA 2JJTA 5D1QB 4EUPG 4ZXBD 2ZP0T 2BDNL 4OAWA 1H3PL 2V6HA 5I1LA 1AR2A 4PJ5D 3HI6L 2CUIA 2E9IA 5FUOL 5KS9B 1VB9A 3T09A 3OG4B 1NCWL 5DD5L 3VRJB 2M8XA 1XGRB 1UC6A 4OZHF 2G5BB 1MJ8L 2YS4A 3O41B 2JCCA 1BLNA 2O5YH 5EO0A 1G7LB 3ARFA 1JFQL 5C0BE 1J18A 3OAZK 4RAVA 4KK6D 43C9A 3MGOB 4Z7WE 4RGOH 2FEDC 3KLHD 1EK3A 4XVSH 2FZ3B 3MNZA 4WGVB 2AI0L 1EHAA 5HVWA 1I1YB 3KPRD 3RNKB 1WF5A 3GMLA 3WD5L 4QRPD 1JWMA 3KHQA 5D2NA 1SMAA 3E2HB 3QI9B 1XCTB 2NZ9D 4M7ZB 3TT1H 4NSKA 4YHOH 5FHBH 4X7SL 1YYLH 1WFTA 3N1QC 2ADFH 3L3GB 1B90A 1NC2A 2JJSC 2EXYD 3LDBC 5TF1L 2OQJB 1OHQA 3T77A 1RZKH 4LOUD 4NM8L 4UAOB 4X4XB 3GK8H 2GI7A 3QXVA 1B4RA 2CRMA 2AK1L 5J4MA 4L3AA 1U95B 1D6EA 5DMKB 4PS4L 1YEDB 1G7MA 4CUCA 3VFSA 2G75A 3BFOA 1YNLL 4WUUD 5E2TL 4DGYH 2DYPB 1KTKE 2YN3A 1WWBX 4JGUA 1EJOH 1F4XH 2A9MH 4JM4L 3MJ9L 1EAPA 5HPOA 5DJZB 1JWUB 4MCZB 1FFQA 2P42B 3NPSC 2XPGA 1RJZA 3L6FB 3OB0K 3X3FL 4OZIE 2BVUA 2AJUH 3RTQB 2PF6A 4LPXA 3OAYK 4OD1H 1I1AC 4XH2A 1A2YB 1CZ8L 1E27A 2ADGA 3HZVB 1XF3B 4IMKC 3OSKA 5INDA 4PJ7A 1UM5L 4GS7B 5GRYA 3BX7C 2PR4H 4RMUA 3ULSA 1R6VA 2Q8AH 3RU8L 4L1HA 5I8OL 3O3EB 3RUGA 1KCUH 4XPAH 4Z7QE 4JKLA 1I4FB 1UZ8A 1S3KH 5KSBF 4MNGA 3RNQB 1R24B 5EZOH 3MRQB 3M17B 5DMGC 2VISB 3U83A 4PR5B 2Z8RA 4P9ML 4JO2H 4YX2L 2MPAL 3FT3A 4U1HB 4JFQA 5FF6B 1HZHH 1WBXB 5HHXL 1CLZH 5FUCC 1TETH 4ELMA 5IHUH 1MFDL 3GKWH 4MS8D 4QOKE 1E28B 4U6XB 2Z8VC 3EJZD 2ZG1A 5DK0B 4EVNA 3DUHA 1VGKB 1Q0YH 3U30B 3H9SE 4N9GA 1LO0L 1ZHBB 3QIBC 4C59B 3HG1A 4P3DB 4JN1L 4B53A 3PHQA 3O8XA 4KJPC 3IJSB 4HJ0D 5C0CB 4HFUH 4NJAL 1TQBB 5F97E 3V4PH 3MNWB 5DEGA 4DKEL 3HZYB 4HKBA 3ZT6A 4X8JB 3MSPA 2XZQH 3DLQR 1TZIA 1RURL 1NMAH 2NYYC 4HD9A 4ZUTB 3X11B 5KAQF 1NCTA 5KVGL 4JY5L 4DGVH 4PV9A 4F2MB 1K6QL 2ZSVB 3AS2A 4M93C 2IADA 4FQHA 3HHRB 1A7OL 3NAAL 2QHRH 3MUY1 1LDPH 2NX5E 3CMOH 4KPHH 4LPYA 1QSVA 3ZTJG 2B1HL 4UV4H 1G6RB 3IDYB 4KC3B 1K4DA 3Q0HA 2Y07L 4QHUA 4QWWC 3KPPA 3G6JB 4IJ3B 3UP1A 1P7HL 2F15A 3UEZA 5IEHB 4JZJC 1KFAL 1A6UH 4O2FB 5F9WB 2E5EA 4NCC1 4HX1A 5C6WH 2VUYA 5JHDD 4IOIA 5EZLB 3WNPA 4NQSB 1DQJA 4P57A 1U91B 2NXYD 4OD2A 2A83A 3G5YA 1MFCH 2ZUTA 4G8EA 3IAPA 1JV5A 5KSAD 1FN4B 4QKXB 4PJHA 1FNEB 2IALB 2H6PA 3BKCH 2CR6A 4ZO6A 4TNWK 1CF8L 3ARED 4K3HA 4LSTH 1IAOB 3KXFA 4JRXE 2ZCHL 4K8RH 2HFGH 2BOBB 2BVQB 2EC8A 2DIAA 3A67L 4OIIL 2PXYA 2KQNA 5KVEL 2R0ZH 3X14A 5FYKU 3ULVF 1QNZH 2MNUA 2XZCH 1F90H 1IE5A 4M7LL 3O4OC 1T83A 2AJVH 4BQ8A 1P84J 4LVHB 4YHMH 5CEZE 1HNGA 1ONQA 3CZJA 5D1QA 3TT3H 5CCKH 4G6ML 1EGJL 4P2RA 5HHME 3E6FB 4HUXB 1BX2A 1W72B 4M8VA 1NCDL 3RGVC 4FQXD 1CXIA 2WK2A 4LSQL 3A6CH 5DFVD 4C56D 5KS9A 1IC4H 2VR5A 5DUML 4I9WE 2VXVL 1U0QA 4JKKA 4KMQA 4M03A 4PD4K 1KJVB 2MWCA 1H15B 5CIPA 1XGRA 4H1LH 2G5BA 1U8IB 1SYSA 4Y4KC 3VWKB 4D94A 5F7FA 3O41A 2AJ3B 1BZ9A 1L0QA 1T1YB 5EU5B 4U1KA 3VGFA 3ARDB 4PYHA 2R2EB 3SDDC 2X9XA 3MGOA 2YRPA 1MAJA 3PUCA 4NHUB 5BRZD 3GKZA 2FZ3A 5JQ6L 4ZAKD 1I1YA 1HXYB 3RNKA 4LP4A 2O5YL 1G9NH 5GRZA 1IQWH 3S35L 1X4XA 4PGBB 4L4TA 4I3SL 3HI5L 1QUNA 1MFAL 5IHBA 1G9NC 1I3GL 2HVKB 3L3GA 2FATL 2H9GB 4WWKD 2PO6B 2YD2A 3EYSH 1D9KC 5GZOC 2XKUA 2AJSH 4I0PB 1U8JB 5DMIH 1Q38A 4ZTOH 3CH1B 4HF5H 1VPOL 3MX0A 3UZQA 3MROA 3TT1L 4MNHA 2EDFA 5DMKA 1U95A 3GHBH 1S7RA 3VH8B 2ADFL 2XWJB 4PJ8A 3NFSH 4NC1C 4U0RC 2DYPA 3QDJA 2FGWL 2IG2L 3QHFH 4WFED 3HAEA 1MLBA 3TBYB 5T33L 3JV5A 3TVMA 5DJZA 4JQIH 4M48H 4MCZA 4U33A 5ACMA 3X12B 1PQZB 4PRIA 4WY7H 5L9DH 1U3HB 3SO3B 5HI5C 1J1XL 1X5YA 1CD0A 2UZYB 3GJFH 5DS8B 1A2YA 3KJ4B 4WU7B 2W07A 4YXKH 4JFFD 3LKSB 3RVWD 3HZVA 1EJOL 1F4XL 1XF3A 4EEEA 5E6ZA 4PB9H 5EU7C 5J0BA 4OLWH 4KDTA 4GAFB 3N1PC 1UWXH 3V0WH 3ULVE 1MI5E 5IBUG 2A38A 1I4FA 2Y72A 4OD1L 4JREC 3INUH 3ULUL 4PRPE 5L6YH 1J87A 1R24A 4HWNA 3T0EE 3MRQA 4GXVH 3M17A 4XBEH 2B8OT 4KZDH 3DO3A 3OKNA 4BFBD 4X98B 1IKFH 4MJ5B 4U1HA 5FF6A 1DVFB 1WBXA 5T3ZD 1KCUL 1P6FA 2UY6A 4XRCB 1GPOL 4NN5C 5K9KB 2VLRB 1AKJB 3CSBA 1E28A 2EDEA 4U6XA 2VQ1B 5DK0A 5EZOL 1LGVA 4OF0A 3SGJA 2EDQA 2GJJA 1EHXA 1QFWI 3HNVL 5TE4H 5HDLA 1ZHBA 4JO2L 4P3DA 4QRTB 1RZIB 5CJ5A 3TC9A 1EBAA 1X5KA 1BJMA 1CLZL 5CP3A 1TETL 2C3XA 4RFNB 2I07B 4Y5XC 3MNWA 4OFYD 4Y4HC 5CD3A 5HHVH 4YLQT 3RX7A 4JM2F 2GSIA 1WT5C 4HIJB 2Z93B 4XBGA 3TF7C 3BPOC 4HS3B 1VFAB 5C0AD 2DQFB 5BW7C 5IEKB 4F2MA 3U82B 1TJHL 2ZSVA 1QSFD 1BOGB 5FYLD 3SO5A 3DTXB 4U49A 3MOQA 2B2XL 4EN3C 3NCMA 3NCEB 4Q7DA 1F6AB 3S4SB 2Q76B 2XZQL 3F7PC 3QHZH 1J11A 1NMAL 1IKNA 3VI4E 1IM3B 1G6RA 1N64H 1QBAA 2A77L 2NY0D 4NKIH 3STZB 5DEFB 3G6JA 4GG6F 1BEYH 1S7VB 4M6OL 3QAZC 2WP3O 4Y16D 5EOCH 4O2FA 3MACL 3CMOL 1LDPL 3VGAC 5JQHC 5EZLA 2YXMA 4KPHL 4NQSA 1X3DA 4I0CC 5SX5K 2GT9B 1U91A 3DUSB 4NNPL 2KDGA 3WS3A 2DBLH 2GITB 1PSKH 4PJ9D 1FN4A 3JVGC 1FNEA 3D3VB 4MNQD 4UNTA 1NEZG 4OCSH 5D7JC 3P0GB 4HK0B 2NY5C 4M1CD 1IAOA 3T2PA 4URTB 2BVQA 3T3ME 1ZK9A 3MUJA 1AD0A 4Z7VF 3LPWA 1KIPA 3WKMH 4Q9RH 1BZ7B 1JYXA 4P5TD 4XNQB 1KLFA 4LCCB 3HE7C 4PJ5E 3G5XB 1YNKH 3VMOA 4LSTL 3B43A 5DTFA 3E6FA 4HUXA 4Z95H 5FA4A 4YFLF 2Z35B 4Y2DD 3U0PB 3FOLB 1W72A 4NC0B 2YPKA 1JHLL 1U8MB 1QNZL 1T7YA 3I3DA 2LABA 3DGCR 5C0JA 3S9DB 1HQ4B 2ZJSH 4APQD 4YHML 2Q8BH 4KMTH 3SKJL 2J88L 2FD6H 1KJVA 4LCIL 3EYQC 1H15A 5CCKL 2APXA 1U8IA 2AJYL 3UDWA 4CU8A 3VWKA 5J13C 3VXUA 5HDQH 1X5ZA 2P8MB 1JYVA 3H42L 1OGAE 4DN3L 3P73B 4KJWD 3QXWA 3TGXA 1T1YA 5EU5A 2FL5A 3B2VH 3WFHB 3KPRE 3G6DH 5D7IF 3TYGH 2A6DB 5CEZH 1P4BH 4QRPE 3VMNA 5JXAL 3O2WH 4KHTH 4NHUA 4NZTH 2YWZA 3DMMC 5LQBH 4XXCA 4FN0A 1HXYA 2X1QA 4PGBA 5HGGS 2EE6A 4KRPB 5DJDB 4ODVH 2EDTA 1N6QL 2HVKA 5FO8A 2H9GA 4HKZB 4YDIL 4ZS6C 3CLEH 3U46B 4G8FB 2PO6A 3CC5B 3TJEL 5TJWK 4NQEB 3MV8D 3WFCH 4PJDF 4I0PA 1U8JA 4GBXC 5JORB 1IQWL 1G6VK 4WUUE 4R0LB 2DLTA 3OGOE 1ZMYA 4GG6E 4LLYB 5GGTL 2DBJA 1OTSD 5ERWB 4CBPA 1FL5B 2GK0B 5DMJB 3VWJC 5MEND 3TBYA 4XP6H 3UTQB 3FN3A 3MRBB 4U1GC 4HF5L 5FYKD 1RZJC 3MRMB 3JUZA 1EZVY 1PD6A 2C1OB 4MA1C 1B0WA 4N0UE 1QFWH 2HTKC 35C8L 3S96B 1EMTL 4Z0BL 3TZVD 3NFSL 3QEQA 1KN2H 4WU7A 1IC7H 4PG2A 1UADC 3ZSTA 2C3GA 5MHSD 4M48L 5IT2H 5HDOA 2PW2B 3KWWB 4N90D 2YA1A 1INDH 2O5ZL 1UM6L 3CNKA 1Q0XL 4JCMA 1UB6B 1CU4L 4U1NB 4UOJA 1KJMA 2HP4A 3BEWB 4UMGA 1YY9D 4MXVF 4YXKL 4W4OC 2DQGL 3EUUA 4FOMA 1AGBB 4I0KA 5F93C 1JPGA 3WLWC 4X98A 1YEKH 1WAAF 1DVFA 4H0GA 3V0WL 4XRCA 5H35B 5C71A 3SGEH 4EI5C 3QWRA 5K9KA 1HYSC 2VLRA 3INUL 1T2QH 1AKJA 5L6YL 2R1YB 3WO4C 2VQ1A 4R2GD 5KZCB 2JJUA 4GXVL 3LRSA 4E0RA 4G3YH 4KZDL 5IWLA 2FX8L 3VW3L 3ULVH 4QRTA 1RZIA 4HUWA 2I07A 4LRNH 5CSZA 3KYKH 3QA3B 5GS0L 3QDMD 3JV6B 2VOTA 4Q9QL 1ZHNB 4DQOL 2OBGA 3O6MH 4YPJA 2J8UE 3UPCA 4HIJA 2Z93A 4HGMA 4HS3A 1VFAA 1DBJL 2DQFA 5IEKA 5K9JH 4M1GH 4KHXH 1QBLH 2VLKD 4LK4A 1BOGA 3DTXA 4ODSL 1F6AA 2ZCLL 2Q76A 2X42A 1KTLB 2YC1A 3ES6B 1D6VH 1B0GA 3GSRB 1I9RL 4PLOB 3STZA 4PJDE 1X4ZA 2P8LB 2UZIH 5JW4Q 1S7VA 5F96L 1FG9C 4WFHD 5CILH 5CLTA 5GS2H 1GAFL 4F7MB 4WEMB 5HHNB 4YWGH 3L7FB 2K7QA 1AY1H 1N64L 1NAMA 5I15H 4QXTB 3BHBB 1OCWH 3DUSA 1EEZA 1A14L 1DN2A 3AM8A 2HKHL 3MXWH 3HMWL 1ODAA 3D3VA 3H3PH 3HC4H 5EOCL 3RVVD 5A2JH 3DRTB 1WTLA 3WIHH 5GGVY 4K23L 3OAUH 1UGNA 3DETC 2VXQH 4WDIB 1TJGH 2Q3ZA 2FR4B 4RMVA 4UIMB 4LKXB 2X7LB 2Z31D 1AE6H 1BZ7A 2DBLL 1PSKL 4WI6A 2R0LL 4EJ1C 3A0OA 2KZ1B 5FGSA 4OCSL 1AGEB 1KCVL 3G5XA 4C56E 3F6IA 5ICYA 3U0PA 1FYTD 3FOLA 3U7YL 3K4ZA 1I7TA 1U8MA 3PDOB 4AT6A 5L8KB 2AS5M 3H3BC 1GGBH 4MXVE 4Q9RL 1B4JH 1HQ4A 1F3DJ 4PRNA 1FV1B 4ZUUB 4XHQA 1TVDA 4HGWB 4HQQH 3I3EA 4D0BB 3KS0J 4WENB 4JRYD 3VGEA 1FZJB 4WO4B 2V7HB 4YAQB 2P8MA 4GRLD 2GTWA 4GW4B 1CLYH 3AFLA 2FX9L 5CEXB 2X4UB 3P73A 4JQVC 5BRZE 4QTHB 2DD8H 3NFPB 4MAUH 3DJ9A 3KLSA 3O4LA 3VFGH 1KIRA 5TQ0H 2WBJC 2Q8BL 3PQYB 3WFHA 4KMTL 2A6DA 4WHTB 2IAMB 3FRUB 1G0XA 2ZPKH 1EDQA 1NCCH 2HKFH 3E1F1 3O9WA 5E94A 4HJJH 4LCUB 4KROD 4LEXL 5F7YC 5F9OH 1CVSC 3QUXD 5CJXA 2YPLD 4N8PA 3G6DL 2F19L 5DJDA 1BAFH 5CEZL 5I16B 1P4BL 2CPCA 4YHNA 4J1UB 3O2WL 3OWEA 2JF1A 3U46A 5DJYB 1HINH 4G8FA 4KHTL 3CC5A 4NZTL 3EOYG 1A9BB 1NGYB 5LQBL 3TN0B 1XGQA 5F7DB 3E8UH 5JPNA 5JORA 5FYJE 4X9FA 3ZKMD 3V4VH 4LLMB 4R0LA 1RUMH 4WFEE 3ROOA 1ZANH 3SE8L 4ODVL 4GRWF 2EH8H 4LLYA 5IVXE 3I6GB 1H8SA 4JFEE 4L8DA 5ERWA 1FL5A 1YNTB 1F3JB 2NZ9C 2QEJA 3UTQA 3MRBA 4K2UH 5D96B 3MRMA 2V17H 5I0DA 1UXWB 2IQ9H 1EZVX 4JFFE 4K3DH 1CIDA 5KVFH 3GMPA 2OP4H 1CGSH 3D1MC 3GMRB 5JDSA 4HCRL 4X6CB 2FCBA 1B2WH 2X4RB 4JM2C 4XAKD 2O26U 1PEZA 3ZE1E 4MMZC 1JRHI 1KACB 1SY6H 3QI9D 4EUPH 1F45A 2QQKH 5IHLB 2P5ED 1CICD 2PW2A 3KWWA 3LKNB 1LO5B 1NUFA 2YN5A 4TNVK 1QFWL 1UB6A 3Q5TA 3BQUC 3KPSB 4LLQB 4LCYA 3NZ8B 3BEWA 5CBAB 1KLGB 4WTXA 5C9JB 1PY4A 3HB3D 5JOFA 1IC7L 4PGCA 3BT2H 1L7IL 4OLEA 4WEBH 4YBLC 4HIXH 5HHOB 4I2XB 5IT2L 4DVRL 4ZNEE 3L95B 1INDL 1F4YH 5H35A 1VFBB 1SVCP 1BP3B 1H3UA 3RWEB 2QR0A 3SEPA 4HWUA 4RBPH 2GW5A 3EOBB 1XR9B 4NFDA 2R1YA 4RIRA 4XPGH 2FO4B 1ZA6B 1BWMA 4XMPH 3V7MA 3RTQD 3D6GA 3DX6B 1V8HA 4OM0L 1G7QB 3FZUD 1NPUA 5BV7H 1ZGLM 4AQ1B 5D1XA 4IRSB 5C0AE 1TVBA 1T2QL 3QA3A 3S34H 1I7UB 1QSFE 3JV6A 5FYLE 1ZHNA 3ME0A 4QXUH 3OAZH 4JFDB 3IFPB 3LQMA 1CFBA 1YMMB 3ULVL 4LVNC 1KUMA 2GTZB 3GBLA 1FVDB 3LAFA 1T03H 4NQVB 1NCBL 4R4BB 1DUZA 1T0NB 4MDJB 5FA3B 4TULH 3GMQB 1KTLA 3ES6A 1YEEH 2EIBA 4U1SB 3GSRA 5FGCB 1EO5A 1SJHB 3FHQA 3OKMA 2R2BB 3WMSA 2Q86A 3QO1A 2P8LA 4YDVB 3WUWG 5K9JL 4M1GL 3G5ZA 1N5YH 3BWAB 4AENB 4OT1H 5EUKA 3N9GH 4F7MA 1M05B 1KPVB 1DFBH 2J8HA 3L7FA 4MAYB 4GRWE 5DK2B 3SDCD 5DJ8A 1BFVL 5DQ9A 1TTFA 2VLMD 4Y5YA 5B8CB 3I85A 3C2AH 4QXTA 5GRJL 3RWCB 3VXMD 3TIEB 3FQXB 3MGAA 4TOYL 5D2LF 3D9AL 1EBPA 3S6CA 3WV0A 5JZ7D 5MEPB 4OCRL 1HKLL 2B5IB 3MLRH 4MQXD 1R3LB 4UI2A 4WDIA 1MEXH 3JUYA 3FN0H 4I5BA 3ZKSD 3E6HA 1AY1L 1RIVH 3PWJA 4H88L 4HT1L 4UIMA 1DEDA 1OCWL 4LKXA 2X7LA 2I60L 2DM7A 1D3CA 1N6VA 2X1PA 1AGEA 2Y5TB 2XICA 1JPTL 5I18L 1NGPL 2CK2A 1TJGL 3CXDH 4H8WH 1FCCA 1SQ2N 4OUOA 3V6BR 4ODUA 1AE6L 2YPVH 1WFUA 3QQ9C 1QYGL 5DC9B 4HGWA 4JQXA 4PJAF 3EDJA 3G08B 1FH5H 3CLFH 4D0BA 5JA9A 4NRXB 5FM5O 1CXKA 2CO6B 3DPBA 5D9SB 4WO4A 2H45A 2V7HA 4XTRD 4JHWH 1I1RA 4Z7UE 5EBWB 3O3DB 5KANG 1HXMB 5KSUB 2X4UA 2ICCA 3FKUS 1A0QH 1GGBL 3VGGA 2H1PH 5GGQH 2A6IB 1T7WA 4HAFA 3MPCA 4NQUA 4PJXA 3K4DA 1TPXB 3FRUA 4MB5A 4ZTPH 1IARB 5E6ID 4FQXC 2Q7YA 4LPVA 1BBDH 3VH8G 5IM7B 3M1BB 3O2DL 1CLYL 1HI6B 1HCVA 2DKUA 3MV8E 3L5IA 2AXFB 4KRLB 2P8PB 5TQ0L 3GIVB 3ZTJH 3IRPX 4YHLH 5I16A 4OGXH 3PGFH 4J1UA 2H2PC 5TF0A 2EICA 2GJ6B 1NCCL 5CGTA 5DHYB 1RJYA 5DJYA 2VXSL 4NQXA 3PL6B 3EOTH 3ZL4H 4HJJL 1QACA 3MLTB 3NIGE 4MDIB 4QLRA 3B9KB 2UVFA 3LS5H 1QVOB 4LLMA 3ARYA 1BOYA 3ESUF 5MENE 3IDMB 4HC1A 3F6LA 3C8DA 4HXAL 5FYKE 3MLPA 4BSJA 3I6GA 1HINL 3AB0B 3LS4L 1KEML 3MV7B 5E7FA 1T4KA 1R0AH 1NQBA 1YPZB 3E8UL 3ARDD 4KJQC 2R0KH 1ZGLP 4R96A 2XRAH 3GSOB 3V4VL 1INEL 3RPKA 1ZE3C 4UU9A 3BZEA 1UXWA 1RUML 3BPCB 3HR6A 1Y6NR 1ZANL 4WW2B 4DUVA 3UTTA 5HI3D 2EH8L 3BUTA 3GMRA 4X6CA 2X4RA 5MHSE 1QKZH 4O2CB 2DQEH 3VA2C 1JTTA 5D2LE 4X4MA 4UT7H 3OKEB 3ESVF 1UA6H 2J7LA 3WIFB 5J6GB 5FYJH 1KC5L 2IPUK 3U1SH 1F11B 5I75C 4K2UL 5I2IB 2NXZD 4RWYH 3LKNA 2IQ9L 1LO5A 2H32H 4K3DL 2V5TA 3LEVH 4G9FB 2OP4L 1CGSL 1BF8A 1CDGA 3DHMA 1WZ1L 4LLDA 3D0VB 3KPSA 4LLQA 4P4KA 4OLYL 5CBAA 5C9JA 2W59A 1LP9B 4Z78B 4ZSOE 4I2XA 5D7LB 1PYWB 2QQKL 4MD5B 4GKSB 2ESVD 3L95A 2IPUG 4Y8DC 1VFBA 3RP1A 3RVWC 4FNLH 3RWEA 4JHZA 3PGCB 2G2RB 1MRDH 3EOBA 1XR9A 3W82A 4PJAE 2FO4A 1KB5A 3RZCD 5T1DL 3DX6A 3MJ7B 5J12C 3S4SG 2GSGB 3AXLB 1G7QA 4I18A 3LB6D 1F4YL 3ZKQD 5FFLA 4BFEA 5HHPB 2BNUB 3FQUB 4LGSB 2E6JA 5T3ZH 1I7UA 2IFGA 2OX5A 1U42A 2VLKE 5D5ME 1BFOA 3PIQB 3DXAB 4JFDA 5HD8D 2FJFB 3T2OA 3VD9A 3IFPA 3MLYH 2DF3A 1YMMA 3MJ9A 2NY7L 2Z8SA 1KYOJ 3L7EB 4PB0L 2LV4A 5HYQA 1XF2A 4R4BA 5DJXB 4NQDD 3S34L 1T0NA 3TFKD 3LHPH 4MDJA 1L7TH 5FA3A 2XTJE 4FTVB 3GMQA 4U1SA 5KOVC 3P77A 1H5BA 5JLZB 1SJHA 2R2BA 4M62H 1BGXH 4GQPH 4PRDB 5EC2A 3EDFA 3BWAA 1QQDB 1MVUA 1I9IL 2X05A 5GJTH 2YHGA 4XB8A 3STLB 5M95B 1M05A 1MWAA 4M7JH 2MSPA 3T0XA 4OGYH 5FYLH 1YEEL 1TFHA 2VXUH 2XN9B 4QHMB 3RWCA 3V5DB 1AD9A 3RWHB 3FQXA 1EHLH 1L6ZA 3CMGA 4DWHA 1LO3L 4X83A 3UPRB 3B83A 5MEPA 4R8WH 4KZEH 5HVFB 1DFBL 1QRNB 4RGNE 1R3LA 5GGSB 2Y36H 3ZE0E 1CFSB 4S0SD 2YZ1A 4DZBB 1A6AB 4POYA 5C0EB 1VFOA 4KJYB 3O6KH 1F6FB 4Y16C 4X9IA 3UBXA 4N8VA 1RI8A 4UBDC 4XBPB 3MRFB 3NCCB 5CINH 4Z0XB 3BP7B 1VENA 2Y5TA 4GRWH 3MLRL 1EEYB 3OF6D 3FN0L 3VD7A 5FKAB 1RIVL 2W9DH 1BMGA 2DL2A 1QFWM 1X5GA 5DRNB 1T7VA 3ARXA 5JIKA 1CE6B 3QDGA 2DJSA 3N1MC 4NRXA 3L9RB 3I2CL 1IGFL 2BCKB 3DHJA 4PLJD 3F62A 2OJZH 5D9SA 1G7IB 3W9EA 1VESA 4H8WL 3TH2T 3O3DA 3QUYD 2IF7A 1HXMA 3DGGB 4NBYB 5KSUA 5ABDE 4QHLB 2BSED 2CKNA 2ENYA 4JPVH 2VL5B 4LSDA 2A6IA 1HCFX 3Q6FB 1FZOB 4YHPB 2DQHH 4Y2DC 3NH7H 2YPLE 5JPMB 5GRWA 3SY0B 3M8OL 5IM7A 5GS1C 4X6DB 2AV7B 1HI6A 4OCXH 1QLEL 1ULVA 2H41A 1A0QL 2AXFA 4LCWD 3MRIB 2VDRL 3HS0B 3GIVA 3G6AB 2YUVA 4J12A 2GJ6A 4M4PA 3O11A 4GW1B 2HVJB 2XWBB 3PL6A 3Q1SL 4KJWC 5FUZH 1A7QH 3MLTA 2R4RH 4MDIA 2VDMH 3B9KA 2VE6B 2NY1B 1QVOA 1JRHL 1KIQA 3N85H 4QYOB 1V3LA 4IM8A 1RIUH 3IDMA 2DL9A 3MBXH 1YQVL 2JE8A 5C6PB 3C6SA 4OGXL 5J57B 43CAB 1T2JA 1UYWL 3SCMC 4AG4H 2HMID 2JJTC 3A6BL 2ADJB 1YPZA 3PGDB 4QRSB 3F5WB 4ALAH 1N8ZB 4UILH 3DBXB 1NBYB 3MFGB 5IMLA 3C5ZB 4PJBF 3PWPE 1Y6MR 4WEUD 3QP3A 4L9LA 4WW2A 2DQTL 3FMGL 1PDKA 4OI8A 1QFOA 2XG4A 2P5EE 1JZ4A 2D31B 4NCC2 5SX5H 3OKEA 1QR1B 4OBRA 1T0MA 2C1PB 3WIFA 5J6GA 1T6VN 2R0KL 1F11A 4L3EE 4L8SB 4CU6A 4NQED 1N0XH 4OQTH 1E4XH 1OTSC 3ARFC 1VDGA 1KJ3H 3VI3F 4LP5A 5FYKH 3OKDA 2CD0A 3D0VA 3KNBA 4BH7B 2J6EH 3WXWH 2AEQH 4HPOH 4LLUA 1K2DB 2F8VA 1UA6L 3KLAB 4H1LB 5ALCH 1Y0LB 5FYJL 4F33A 1LP9A 1J8HB 4IIQB 4Z78A 3GSQB 5D7LA 4JJ5A 4RWYL 2UWEE 1F8TH 1C5CL 2XQYK 2GUOB 5D2NC 1JMXA 4KI5D 1JGLL 4P46B 4PUBL 4NO2A 1OL0A 1YY8A 3PGCA 3REVB 4IMLA 5D71H 1ZLUK 4FQJL 5DJCB 3HNSH 4X7TB 3NMEA 2CUHA 4U1LB 3L1OL 2O61A 3C6LB 1X5FA 3MJ7A 5MP6H 1QRKA 3AXLA 5L8JB 1KV3A 4D0DB 5HHPA 2BNUA 3FQUA 3GO1H 3QBTB 4FNLL 2X4TA 4JHAH 2XQYG 1ED3B 1MRDL 5I9QB 3NA9H 4KVNH 1W2KT 3IAQA 1SJEB 2D7OA 1F4WH 4LFHG 4NJ9L 2YOCA 5EWIL 3DXAA 4ISVA 2FJFA 3OJVC 4G6AD 5FHAH 3VXOB 1VADB 3RHWF 5C0BB 1FCGA 4GT7A 1FRGH 3HE6D 4EBQL 4R2GC 1KPRB 4AQOA 2APFA 1J0IA 2IH3B 1MLCB 5LGHH 2VLJA 4Z7WB 3RBGA 3GBML 1UJ3B 4PJFA 2MHAB 1QSED 4P2OB 1EJ6A 5JLZA 4XXDB 5C08E 2W60A 3MLYL 2BSTB 4PRDA 1WZKA 5EBMB 1S78D 1JBJA 4PIRF 2VLME 1T21B 3NA4A 1QQDA 3WDIA 4ZNCD 2FIKB 4JZNB 12E8H 1A5FL 1IAII 3STLA 3VXME 1Z3GH 3REWB 3NN8B 4WUKL 4JGJA 3WL9B 4IMKA 3TBTA 1EO7A 1GL4B 3V0VB 4HK3J 2SEBB 4YHYC 4QHMA 1BGXL 3V5DA 1XT5A 3RWHA 1CE1H 1NFIB 1DTUA 3E0GA 5IB5A 4NO5B 5F7HA 5AUMB 3DNKA 3EO9L 1PKQA 4PJBE 4GAGH 5L2KE