3GI9H

Crystal structure of apct transporter bound to 7f11 monoclonal fab fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
217
Chain Sequence
b'QVQLLQPGAELVKPGASVKLSCKASGYTFTSYWMYWVKQRPGQGLEWIGEIDPSDSYTNYNQNFKGKATLTVDKSSSTAFMQLSSLTSQDSAVYFCARSPHYYGTTYNYPMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7F11 Anti-ApcT Monoclonal Fab Light Chain
publication title Structure and mechanism of a na+-independent amino Acid transporter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 40
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2009-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gi9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gi9H02
1S5HA 3J8F7 4ETQB 3ARGB 4I3GA 3H7LA 4PUBH 3HR6A 4X4XB 3ZKQD 2NY2B 5JHDA 2DKMA 2CKBB 1NLDH 5E5RB 4OZHB 2YN5A 2EIEA 4LAQL 4P4KD 4JM2B 3TA3D 3QG7L 1QBBA 3MCLL 4HQQH 3K3QA 4FP8L 3HI1B 4LRNL 4OF3A 5C0BE 3TYFB 1PW3A 2LAAA 4BUHA 3QIUC 1GYAA 3RNQB 4PJFB 5J0BA 3SE9L 5C07E 1BAFH 5DEGB 4I8DA 3N9GH 1T2QL 2GFBA 3CSYB 2X5PA 4L5FH 3NPSB 3BEWB 1CICB 3LQAL 3WS3A 3WDIA 2K7QA 5DQ9A 3GM0A 5FYJL 2Y7QA 4KKBD 3MR9B 1S9XA 3EYUL 1BF8A 3H2WA 1FPTL 3BE1L 4JG1H 1MRCL 4NNYB 1T83A 3B9KA 2R15A 3VWKB 2YSSB 3PF2A 2F8XC 5EPMA 5FOJA 3O8XA 3DIFB 4OLWH 1DBBL 1NH6A 1TQCC 3FOMB 3ARBA 1T1XA 4ODTH 2Z35B 4GBXC 4Y2OA 4JFXB 4HGWA 2JLLA 4F57H 2C7UA 3PQYB 1BM3H 5DD1H 2F54E 1MFCH 5DDHA 4LVOC 1PG7L 5DHYA 3B83A 4GMTL 4M02A 2E7HA 4F33A 2F8VA 3MV8A 2XG5A 4Q2ZB 1J7VR 1FBIH 1UKQA 1F58H 2NY6D 4LPUA 4KMLB 4HKXA 1UWXH 1SJHA 2AQ3A 5GRYA 1A4JB 2HJFA 1P4IH 3O45A 2A9NH 1KGCE 1LEGB 2FIKB 1SYVB 2W38A 1Y18B 4P59L 4WV1A 5I74C 2FO4A 4Y16B 1UACL 3VDBA 4G9FA 4ERSL 4GG8B 1P5VA 4MGXA 4ZOBA 4V1DE 1K3ZA 2DWEA 4HS3A 4U6HA 1ETZB 2VQTA 3D85B 5IB4B 2VISA 4X4MA 4QLRA 5ENWA 1S9VB 3L5IA 5FM8A 3D2UB 3GMMA 3TBTB 2GAZB 5CEXA 5HGBB 1YQVH 5IBLC 1B4JL 3TN0C 5DJCB 4OGZA 3LRSB 2IFGA 4LCWB 4P2OA 1XH3B 4QYOA 4POZC 3FN0L 2XZCL 5BXFB 1NDMA 3CCHA 1RZGA 3MRIB 4BYHA 4PJHE 3N1PC 1MHPH 2IADB 3TZVB 3RKPA 2GJ6E 3LZFH 4DKFH 1TCRB 4F58L 3LS5L 2XWJB 4L8SC 1I1AD 2E9WA 5F9WC 3X13B 3S96B 3MJ9L 3QUYA 4ZPVB 4OLZH 4IRSA 5L9DH 4M03A 35C8L 4OLEA 5INCB 2IF7A 3PDDA 3PG2A 1DTUA 1KCVL 1KJ2A 3LRHA 3Q1SL 3QO0B 1J5OL 2PCPB 3BH8A 3ET9F 3OXSA 1CDIA 3WNKA 1I8IB 2X4TA 2F74A 3NABH 5C0CA 3HZMA 4K71B 1FRGL 4Q9QH 3KYAA 2WQ8A 4L4VE 1BPVA 5AAWA 3MLSL 5EN2B 2A83A 3B9EA 4F7EB 3H9HA 1FVCB 2YXFA 4NRXB 3STLA 1OTUD 4KGJA 2NY4D 3P2TA 4XP6H 2HRPH 2VUOA 4OZFA 4M1CC 5LAXA 4LSQL 5GRUH 3S36L 3MPCA 4YQXH 1U3YA 4KHXL 3OJVC 4RDQF 4UIKL 4QRSB 3ULUF 4NZUL 4FQXA 4CNIA 3O4OC 1HXYB 1IGFL 1FDLH 3UX9B 3UJIL 3ZMRA 1YECL 2GK2A 4G8GB 5HI5C 1JVKA 4KROD 3IU4H 3V52L 2HVKB 5KVMC 3MRJA 5I16A 5GS1C 4HUUB 2UWEA 3HE6B 3INUH 4ODSL 4XH2A 1HXMA 3QNXA 5IFAL 1AHWA 4KUCF 4DW2L 2AK1L 2ZSVA 4JO4L 2V5TA 5ESVB 2W07A 5D2LE 2EDEA 1IGJB 2FD6H 4B7IA 2PKDA 2C1OB 2NY5C 3GMRB 4HZAA 3RY6A 4XHJD 1ACYL 1WSST 1FAIH 4JY6A 1IBGH 4PJIA 1FL3B 3SGKC 4C57C 4UUJA 3MGTB 3H7BA 4U3XA 2H26B 5J1TC 2VQ1A 1OAXH 3S4SB 4JKWA 4R4ND 4HH9A 3W0WA 2ZUXA 1WBXB 2XZZA 1OF2A 1A7QL 4H1LA 4GUPB 2DQHH 3HE7A 1U95B 1WWBX 4K7PY 1JI2A 5KS9E 1ZK9A 3RGVA 3TVMD 4HULB 1OSPH 5J6GA 5JIKA 5TE6L 1NCCH 1EV2E 3CDCA 3DYOA 1M4KA 2VH5L 1YPZB 1KCRL 1NGYB 43CAB 3ECBB 1F90H 4EOWL 4CADB 4JPVH 2ICWJ 3ARRA 4H0HB 1L7IH 4XI5D 4OZIF 1MRFL 5BMFL 1GPOH 5I1JH 1HHKA 1U93A 1UB6A 3E8UH 3IDGB 2ZUSA 4P46C 5A16B 5T3ZE 1FLRH 1FVEB 3RUGF 3NFPB 5CCKL 3HNSL 5GGUA 5I8EB 3QDJB 3QXWA 1HCVA 4NOBA 3K2UL 5GSRB 3OKDB 1MQKH 3BPNB 3DGCR 3CZJA 1CGVA 4FMKA 1CE1H 1QNZL 3V8OA 2I07A 1VB9A 5IW1B 3S97C 4L1DA 1IGMH 5DO2D 2FSEB 3MGAA 2A1WH 3SDYH 1A3QA 2NZ9D 4IOIA 2BY1A 3L7FA 4XXCC 5F6IC 5H2BA 3HZYB 4G6AC 3OMZA 1IGCH 3ARSA 3HC3H 5CD5D 4AH2B 4HIEA 3AREB 1YEEH 1G9NC 2Z8SA 4U0RC 4K3JL 4CGTA 4U33A 3GMLB 5CP3H 1ND0B 4M1DL 3FB6A 5DMIH 3VMPA 4OUUB 4PG9B 1DSFH 3U79A 3EO9H 3EYOA 3WFBL 1HI6B 4G6ML 1T4KB 3BKCL 5D7IA 4XRCB 2E7BA 3UDWC 4EBQH 3QUZA 1K4DB 5E6IB 2C4FT 1HH6A 2IAND 4XAWL 3VXPB 3Q6GL 4HWBH 2ZSWB 4YUEH 2APBA 3RWCB 3CU1A 4XBPA 4IRJC 4LIQL 4YDKL 3OHXB 1HDMB 3MLXH 4G8FB 4NOFA 4PJDA 1FGVH 3WKML 3KPSA 4K07A 2FCBA 1RSFA 1EFQA 4LSUL 2B2XH 3GSUA 4CMMB 2R56H 4ELKB 3VW3H 1PKQA 3BPLB 3QIUA 2ZUQC 4X99B 1I9EA 5D9SA 2YPLB 3IDJA 2RCSL 4RX4D 5DMKB 1X7QB 5FK9B 1IAIM 3U30C 1BP3B 4LAJH 2AW2A 2A74A 2W0FB 1RZKC 1RZIA 4EDXA 3Q3GB 1KB5A 3IB4A 3IDNB 1EIBA 3V5HB 3DLQR 4RBPK 4MA8L 1IGYA 5HHOD 5IHUH 4DUVA 5I1EL 3U2SB 1U92A 2ATKA 4GBXA 5T5FL 3BQUD 3QPXH 1ZGLB 2RAMA 4APQB 4MA3A 4YPJA 3RTQB 4AEIL 4NWUL 3TGXA 2N4IA 2RJMA 1X5ZA 1ZTXL 5A1AA 2IGFH 4FFZL 4GLRH 4X9GA 4WW1B 1FL6B 5F9JA 3QCTH 4OIAA 3VXUD 1QZ1A 5EUOF 4QXGH 3MBED 5ILTH 3DUSA 2R0LL 5IKCA 3IRPX 3CSBA 5GIRB 3QJHA 3TO4D 2E8ZA 4JGUA 1YY9D 1AD9A 1I85C 6CGTA 4YHYB 4XC1L 5GQBA 1OTSC 3FQNB 3D25B 2OP4L 3P4OB 1S9YB 4Q9RL 3MV9E 4NN6C 2ZOKA 3WIIL 3LPWA 3FFDA 4P9HL 4L8CA 1D5IL 2R2BA 1QSEA 4PFEA 3U7WL 4M4RA 4I4WB 5E2WL 4LSRL 2UZIL 1YEFH 3VG0L 5I2IA 3UXFA 3B2VH 4LF3B 4MX7A 1Z3GH 2HFGH 3B3IB 3TN0A 1A3RH 5DVLA 1YEJH 1S3KL 4D9RE 1IQDA 2NXYB 1E4WL 4P23D 4JO3H 5HGGS 3QDAA 5T3XD 5EZLB 4D0CB 4LSPL 3OAZH 1DANT 2YXMA 4IRZH 1F3JB 4C4KO 1TVBA 3TBSA 3AU1A 4K94L 3TBYB 4F2MA 5GJSH 2VRAA 1FAKT 1C5CL 1IGIL 3KPOB 1CGUA 3QQ4A 1LDSA 3VFRA 4UT7H 3PWPE 4LPVA 2FIRT 3DRTB 1F6LL 2EO1A 2VDNL 4FTVB 2JB5H 4L8SA 5LQBL 1CXHA 2DQFA 3HNVH 5J7CC 1NUDA 3LKNA 3VE0A 1ED3A 3ULUH 4ODUB 5JOFB 2FJGB 5DEFB 4LP5A 3OKNA 4PJ9D 5FYLH 4L4TB 2YKLL 3C60C 5GS0H 5E9DA 5EO1B 3VD4A 2JCCB 1YDPB 5AYUH 2KQNA 2HKFH 3SGJC 1IM3A 3L6FB 5FHAH 3TIDB 1MCHA 2J8HA 3I84A 5IMOB 3QEQA 4I77H 5TDNA 4IDJH 1LP9B 4LQFL 2R0WH 4RZCA 5D7LD 1CDJA 5FHBL 1WT5C 3SDAD 2QSVA 4PRPE 5F1IB 1MIEH 4UTAH 1TDQA 1UB5B 3LKPA 2E27L 3VXSD 4MNQA 5T1MA 4OIBA 1CLOL 2FWOB 1MI5D 5JR1H 5C6TL 4NP4L 1CFQA 1V05A 4P9ML 1AQKH 1WVZA 4PTTA 3FQTA 5D7SL 1Q9LA 3SQBA 4OZGE 4LPTA 3GSWA 5TQ0L 3O81A 4WY7H 5HHNA 5GSVB 3QJFA 3KPQA 4KK9D 3JBG7 2AAVA 4XMKL 4P49A 3D3VA 5DJ8B 4UV4L 4KRNA 5E95B 5HD8C 2A38A 4P4KC 5AYQA 4OGYH 2ILLA 3KLHD 3E3QC 3WFDL 2OSLB 3L3KA 1AIFB 2L4OA 3JV0A 5GS1A 1CDCA 3RWIA 3MCKB 3NCJL 5IESL 4HBCL 1DJSA 1U8OA 3SKMA 1H3UA 4HXBH 4DCQB 1WC7A 4LLUB 2GCYB 5E7BA 3U82B 4M4PA 1CGWA 4HC1L 4HWZA 2YOCA 1NKOA 4EVNA 3TFKD 5JOEA 1RVFL 4MCYA 1U3JA 3WFHA 1U8KA 5CINH 5FA3B 5F88A 4ZFZB 1FL5B 3CPLB 3SGKA 4HT1H 2R4RH 3MRQB 3UO1H 5CMAB 3FQRA 4LLWA 2X4RA 1WICA 5C0BB 5EULV 2F19L 2H6PB 3LIZL 2VDLH 3HRZA 5B21A 1T7ZA 5ID1A 5C07B 4YJZL 2XN9A 4H8WC 4L3CA 1U8IB 4RMVA 2CKNA 1ZLUK 4PRBB 3NACH 4OCRL 3V0AC 1LILA 3WFCH 4XNUL 5FYJE 5DK2A 4DN4H 3QEGH 2UUDH 5I1IL 1FO0A 2HN7B 3GMQB 1HZHH 1OAUH 2D03L 2NY6C 1CR9L 1PFCA 3EGSA 1XF4B 3H9SD 1ADQH 4MQTB 4BKLA 4U31A 1KLUA 4P46A 1OW0C 3O2VL 2BHYA 5IB5B 3W9DB 4R96B 4OM1L 1D6VL 1F4HA 4YDJB 3ZT6A 3U6RA 4XNYL 1PX3A 4JM2C 4N1CA 3ZE2E 1MWAH 4TSCL 5E6ZA 2F54B 2DM2A 4TQEL 5IIEB 2PW2B 1NGPH 4FG6C 4PV8A 1Q0YH 3AVEA 2FB4L 1ZLUH 3VGEA 1A6AA 3NPSC 1OGAA 1V3LA 3ROLA 2E9BA 3UTTA 4XXCA 4ZFOL 1CICC 2C3HA 4MHHI 1LDPL 2GSIB 3ZL4L 4X6EB 1U8LA 3FFCE 4PJXE 4YBLB 2DLHA 1WTGT 3GIVA 3BGMB 4U1IB 3V6ZB 4YHKH 5HYJA 4OQTH 2EH8H 1A6TB 4TSAH 4ALAL 4V1DB 6FABL 2AABH 1XGYH 5JOPD 5DA4A 3HMWH 2H2PC 3MOBL 4XNQB 4JN2A 3UDWA 2ATPA 3T1FA 4BZ2H 4Z8FL 1I1AC 1DDHB 1GOFA 4I48B 3GBMH 3HCVA 3L9RA 5FEBA 4XPTL 5LGHL 5IM7B 3BWUC 5F72S 3T3ME 1SEBA 1XGPB 4IRJA 2DMCA 4JR9H 4YDVB 5I75B 2AJZB 5IHLB 2DKUA 4NZJA 1RK1A 1X5KA 1CYGA 3RAJL 4PJHB 4ZMAT 4R3SA 3REVA 1EPFA 4P4RB 2HJKA 4JFZH 2EECA 2P7TB 3VFGH 2P8MA 3GI9H 1A4KA 5LVEA 4OD2B 2GJ6B 1I3RB 1U8PA 3AY4A 2D9CA 2CMRL 1DLFH 2VQUA 1FFPB 4S1RL 4JPWH 1J8HA 5DJ6A 5C0GB 5LGKA 3SJVA 4K3EL 3JXAA 3RWEA 5FUOH 4HUWA 4KVNL 3LD8B 4F7PB 5T1LD 4QRRD 5D6CB 1H5BB 2OJEA 4GXUM 3V95A 1Q72L 3JV6A 3QZWA 4NQVB 3EFDL 3VFOA 2O61B 3UZQA 1JNHB 5J13C 1W0VB 4RGMC 3V5KB 4L4VB 2ESVA 2FYYB 4JFEA 3PUCA 3STZA 5B8CC 1UEMA 2A6JA 1OD7A 3OB0K 5T5NF 3MOQA 1DLHB 3RWGA 3BGFC 2CIIB 3DO7A 1IE5A 4NNPH 1YYML 2FR4B 3RX5A 1NC2B 1WWWX 1T22B 2BNQE 1GGIL 2JIXA 2X4QB 3RA7L 2ZCKL 4JRYA 5DI8A 4YNYA 3S7GA 4WHTA 3L5WB 3ZHDA 1S9WA 1ONQB 2DMBA 3W2DL 2EC8A 4HD9A 4XHJC 3B9AA 1TETH 2I24N 3D39A 4JEGB 2HKHH 4QTHB 1I75A 4PP1C 5I17B 5C0RH 4JN1L 3BKJH 1A6ZA 3JV4A 1JN6B 3W5MA 3E6FB 2VE6B 1Z9SA 4OTXH 2Z8WC 1I85A 1QG3A 2DTSA 4MLIA 4X4YA 5D2LB 1KIPA 1JYXA 2DL9A 1NCAH 4C4KT 4LKCA 5I19L 4K9EL 2W9DL 3GRWA 1EHLH 5C0FB 3DVIA 1T1YA 4LCUA 3IFNL 2P5EA 1BJ1H 1CFVH 3AS3A 1HHJA 3D0LB 3ZTNH 2LE9A 5FUZL 4L8BB 4GMSL 1U36A 5KZCD 3GMPB 4NZRH 4DN3L 1XR9A 5KS9B 3OWEA 1XGUB 2UWEF 1ZLSL 3MROB 4KRPD 4DVBB 1KEGL 4DGVH 4ZUWB 2UZXB 5JO5B 3RPIA 3MODH 5D8JH 4LOUD 4OD1H 4PUBL 4X6DE 2F8OA 4J3TA 5TE4H 3NBNA 4U6YA 4MQXD 43C9A 3HPJA 2J6EA 1YQ2A 4PJIF 1NLDL 3IS1X 1EEYB 4M6OH 2NZ9C 3NCYS 2NY0D 4HQQL 4XCEB 3K46A 5C09D 2AXGA 4UOJA 2NW2A 3U9PH 1BZ7A 4WI5A 5F3BA 5CD5C 3C60A 3N9GL 1NL0H 2X1PA 3C09B 4I0PD 4L5FL 3VXUE 5EOCH 3QULB 1TLKA 1N6VA 3SGJA 1QUNA 3T77A 2CRZA 2QHLA 5I9QB 5TFSL 4HLJA 2A6DA 2D7TH 2F9BT 4HMEA 4W4NA 2WP3T 4PJ5E 1IQWL 5K9JH 1NLBH 5E99L 5DK0A 1A02N 4AENB 4U6XB 1B90A 3GSOA 3BHBB 3VH8G 2BRRH 3IDXH 1Z6JT 2R2EB 4OLWL 3F58H 5DLMH 4OGAC 1CD1B 2DLFH 4ODTL 3CFCH 2PN5A 4CKVX 2AJUH 1UEYA 4F57L 1N3NA 4RGOH 1SBSH 4KI5F 1BM3L 5DD1L 3UTOA 3PHOA 1NMAH 4P4KA 1A7PL 2JB6B 3C5SB 4H88H 1MFCL 3HLAA 5MEQA 1YMHA 1AGEA 3QDHA 4X98B 3IF1B 3BP5A 1FBIL 1F58L 3HZVA 1BF2A 4AQOA 2CQVA 1FCCA 1OP9A 2LFGA 5EO0A 2BFVH 5TF0A 4ZNEE 4TYUA 4MA7L 3BPNC 4UZGA 2FGWH 2EDOA 4WFFE 1P4IL 2A9NL 1NFIB 3E2HC 3RQ3A 3HAEA 4MWFA 3RWHB 5C0EA 4TTGA 4LIQE 2A6KB 3DHJA 3UTQB 4XMPH 3LH2L 4HPYH 3BP6A 2IG2H 4KK5C 2A0LC 1EEZB 1LE5B 5H94B 4NC0B 2BSRA 2EYTB 3AREC 2IH3A 5D7IF 1CK0H 1LO2H 1NSNH 1IKNC 1F4WH 1YQVL 3BQUC 4KJPD 2ITCB 1NGXB 5D1XD 5ISZE 3QXUA 3UROR 4PV9B 4XBGA 7FABH 1C5BH 1T3FA 2VXUL 5FM4A 1QEWB 1J0IA 2I25N 1A9EA 1FE8H 4FZEL 3MBEC 1DBML 4J23A 4PJDF 1G7QB 3HG1B 1MHPL 3I2CH 3MYJA 1S7UB 1UH2A 3RVTD 3PNWA 1QFPA 3TO4C 3QO1A 1AXTH 1OW0A 4MD4B 5EBWA 3B5GA 3KYKH 1VFAB 4G3YH 4OGXH 1K8DA 1CFNA 1L9MA 2YD4A 1MIML 4JM2A 1MHHB 4I18B 2Y07H 4L3AA 4LPWA 1JHLH 4W81A 1PGRB 2E9JA 2Z31D 4LHJB 1G84A 3ILQC 4W6YB 4WI4A 4LHUB 4YDIL 4G6FD 2OJZH 3GIZH 3L3DB 4D3CH 4C59B 3MLZH 1TNMA 2F58H 5F7DB 2LQRA 1A7RH 3T0ED 3BEWA 4I0CC 5GHWH 1A7NH 3GEWB 4X8XA 4XNMB 4ESKA 3MFFB 1H3XA 3NCYP 4JPKH 2HRPL 2QR0A 1K5NA 1URLA 3U83A 1MFDH 1FZJA 4PLJD 4JY5H 2AJXH 5BRZE 2EDTA 1A47A 1WGOA 3TA3B 3CVIH 3EO1A 5KSUA 2DQUH 4E41D 1DQQB 1E4XL 2VXSH 1I4FB 2EXWC 2DI7A 4O51B 2GJJA 1ZVSB 2H3NB 2JK5B 5ICYB 1I1AA 3IU4L 4HKJA 3MRHB 2C3VB 3HA0A 3PQYA 5GGSY 1PYWA 3C6SB 3VA6A 2WAHA 3KR3H 3W5NA 1U2CA 3INUL 5IMLA 5FYKH 5DC9B 2D31B 1P7QD 1T66D 1D3CA 4MMXC 1A4JA 4MDIA 2FD6L 5K33A 2VLJE 2J1KA 5DJXB 1FAIL 2XXMB 4GW4A 2AKRB 1SYVA 1AP2A 4X8JB 1MAJA 3PWPB 4Y5XB 4WUUA 4NQDD 4XWGL 4QHMB 1LK2B 2BNRA 2ICEB 2VZ3A 2CDFA 4HG4J 4C56E 4GG8A 1HQ4B 2BP3A 3LAFA 5I71B 4LLQA 1KJ2H 3PWJA 1RI8A 5C7XH 2X1WL 4C55A 2VXTH 3VXME 3VH8B 1OSPL 3O3UN 1B4RA 2YHGA 3D2UA 1NCCL 5EU6D 3ZYZA 3VRLF 1M7IA 4BFIB 5HGBA 3TYGL 1D5MB 2D7MA 3I9GH 5EA0L 4PREA 2NZIA 3KLHC 5B8CA 2P49B 5D93C 2NXYC 4JPVL 3GBNL 3RWJB 4PRPB 1NCDL 5C08E 4Y5VC 1W0YT 1N6UA 3I3BA 4OZFH 3IGAA 1GPOL 5I1JL 1D6EB 1RY7B 1JWMA 2IADA 2DQEH 1MUJB 4OZGB 4ZAKB 5B3JF 4OV5A 2YR3A 1P7KB 1GVIA 4DEPC 2Y5TB 4NQTA 4XBEL 4Y4HD 1UCTA 3BISA 2X42A 3PIQB 5GGRB 4AK1A 3GSXB 4KKCD 1AC6A 1YA5A 3S96A 1T5XB 3Q0HA 4QCIA 4G43A 4Y7MA 1F3DH 1MQKL 1RJCA 4NGHH 1R5IA 4HJ0C 1MH5B 4MQ7B 4WVRA 1CE6A 1CN4A 1CE1L 5JLZB 5JW3H 5FKAB 4MA1C 4XNZB 4WCYL 4HGMA 4HEME 1QSFE 3UEZA 3LSOB 1PQZB 1V7ML 5IVNA 1A3LH 1RUKH 4OKVB 5CWSA 4PRDB 4O2FB 3BMVA 3HC3L 3KDMA 5H37G 4KTEL 1YEEL 3O0RL 3WO4B 4NRXA 4JFYB 3AROA 4WO4B 2C26A 5DMIL 4LEOA 1DSFL 3OAUH 2VWEE 2VDQH 3EO9L 4BQ8A 1G7HB 2DI8A 2O5XL 4H1LH 3L5XH 4H25B 5EBMB 1S7WA 4X6BB 4KU1A 2D7OA 4X4ZA 3MBXH 4G8GA 3N1MC 3V2AR 3BRDA 5I1CH 4DZ8B 2L7JA 1N59B 2HVKA 4HWBL 4M5YL 5DT1H 2E7LC 5DD0H 5HYQA 4N0UE 1HKFA 1JWSA 1OL0A 5MHSD 5HHME 2UYLB 5DZLA 3GSVA 3U4EB 4KZEH 2ZCHL 1IM9D 2OTWA 2DJUA 2QADB 2NY4B 3UMTA 4NQXB 3FQWB 5ESVA 2AERT 2B2XL 3C2AL 3VXRD 3GJEA 2R56L 1IGJA 5FB8A 1X4YA 4G5ZL 4B50A 4N8VG 3GMRA 4GG6A 4PRHE 1KPRB 1NEZG 3RNKA 5HJ3B 3VFWA 2PTTA 4KC3B 2D0HA 3BUYA 4BZ1L 5B4MC 2XI9A 5CIPA 1MY5A 2B4CC 2VR4A 3S4SA 2HFFB 4KROB 1JJUA 1WBXA 2ITDB 4R7DB 1VA9A 4XVSH 1QKZH 2Q1EA 1FYTD 5KW9L 1JUFA 3P0YH 3BT2H 4LLDB 4TUKH 3M8OH 3IETB 3K4AA 3BIKA 3SKNB 1RQ5A 5DFTA 5DR5H 2IANA 4YHPB 5IHUL 4PY8I 5DQDH 2XY1A 3FFCB 4PJXB 1BVZA 5K59E 1QO3B 4NHCL 2AEIT 4PB0H 2DIBA 4AEHH 3QPXL 1DQJB 4Z7VB 2X09A 1M7DA 3CXDH 2A77H 3IDGA 5HYSA 2NLJB 1Y6KR 1D5XB 2F5BH 3OGCB 3QXDB 2R8SL 5F9DC 2AJVH 3QCTL 4QXGL 5AZ2L 5ILTL 4I2XA 4RAVA 2FBOJ 4X9HA 3VFPB 2MWCA 1E28B 1EA9C 5LG1A 3OKDA 2R69L 3NVQA 1PLGL 4R97C 4QXTA 4KKNA 4OFKA 3WN5C 4V2BA 2Z4QB 3FHQA 4UDTB 2P24A 2E5EA 1E6JH 3MGOA 3KXFD 2AEQH 3OKOB 3QPQD 1R3LB 1BJ1J 4HXAH 1JYNA 2V2TB 4R7NB 1LHZA 5E8EA 3ZDYE 4JFHD 2B7DT 2IQ9H 3AREA 1JI1A 1CDHA 1NCNA 5CEZH 3WHXA 3B2VL 5JQ6H 5DD5H 1IKNA 1Z3GL 2HFGL 5AUMA 1BFVH 3BQUA 1A3RL 4P2RE 1U6AH 1PY4A 3FB5B 3OBAA 1YEJL 3B6SA 1MREH 3IJSB 2XKNA 5ESAB 4RMRA 1I1YB 4JO3L 2B5IB 1JPFB 2FHCA 4KDTC 4IRZL 5J57B 1KB5H 1KFAH 3MBEA 4HLZG 5GJSL 3GMNB 4N5EC 1U8QB 4M61B 1XR8A 1JGUH 3CFJB 4BH8B 1QRND 1OM3H 5C6PB 4PD4K 4WGVB 4UT7L 3TO4A 3VRJB 1YJDC 4G8FA 5IBUG 3EYQD 1D5ZA 2BNQB 3HMXL 3L3HA 1FZOB 4NO3A 5EO9A 2EE2A 3HNVL 5FM5M 2XFXA 4ZSOA 5EOCJ 5D72H 5FAAA 4CMMA 3EZJB 2ARJA 3VI4F 4S10A 1P2CB 4LPCA 5GS0L 3BP4B 3V4PH 4LLVA 2FHBA 1KELH 5FGBC 3KJ4B 5AYUL 2HKFL 4TUOB 1ZHBB 3LD8C 5D96B 4I77L 4IDJL 1WIUA 3DBXB 2OX5A 2R0WL 1MCOL 5DS8A 1OVZA 4P5TD 4R90H 1MIEL 4UTAL 5J1AA 2W0FA 4P23A 3C08H 1MEXL 5JR1L 1W72A 3LKQB 5SX5K 1MLBA 3VFTA 2H9GA 4W70A 1AQKL 4J3OC 3KVQA 5SX4I 4M93B 2VYRE 4X6CA 2EO9A 1MJUL 4WY7L 3BWAB 4LOUC 3MZGB 2VKXA 2CJUL 3LV3A 1UYWH 4ZODA 2DOCA 4QEGA 1YMME 4HK0A 4NKMB 4MD0B 2NY0C 1JBJA 3R06B 1A6VH 3TC9A 4PJ7E 2P5WE 2J8UA 4HUXA 1VFMA 1A1MB 4N8VB 5CKGA 3TBWB 1TVHB 2V7HB 5IJVA 1NEZB 2X4SB 4N9OB 3SY0A 4J3SA 5CEYB 1TZGH 4AT6A 3MRCB 3KYNA 4PYGA 2VLKA 4X6DB 3IS0X 5CINL 1T0MA 5D7LA 2CRIA 2WINB 5H8DA 4HT1L 3L7EB 3QUKA 3SDAA 4K8RD 3VXSA 1EAPB 5IB2B 3BD3A 4U1MA 1MI5A 3EOYG 1XF2B 3D5OF 3MZTA 3OKEA 4UINH 3VMOA 4I4WA 1BFOA 2VDLL 1CG9A 1CLYH 4LLMB 4ODWB 4WW2C 3VXUB 1AO7E 5TDOA 5CLTA 4YO0B 2FGZA 4XVUC 2FO1A 4JANA 5IFHH 1T1ZB 2OI9B 3NIFE 3M1BA 1TENA 2PYFB 2BSSB 3QEGL 5DHVB 3BW9B 4PJ5B 4Y5VA 3MSPA 3KWWA 1BQLL 3CDGB 3MRBA 5IOPA 1T89C 4H5SB 2R39A 5DFVD 4TVPD 4RFNC 3DV6B 3DROB 1QFUL 3EUUA 3R4DA 4ONHA 1BX2A 3QDME 5F7HA 1MWAL 3MRNA 3QHZH 5JXAH 4ODUA 2Y1VA 1R3KB 4XCNA 3BKYH 4YLQT 1MELA 1UM5L 5F97E 1G9EA 3GZKA 4XZUA 1RUPH 4QF1A 4RNRA 4DTGH 4EEEA 4P5KA 1HINL 3TIDA 1TPXB 4YIQB 2VDKL 3OZ9L 1LK3H 3CH1B 5D1XC 8FABA 4XP9L 1NCTA 4MXVF 3RDTD 1XF5B 2NY5H 4GRMA 4KUCD 1WCQA 5GS3A 3SPVB 2WV3A 3RIAF 3D18B 3GJFA 3VWJD 1IAOA 4OQTL 3ZDZF 3ARDD 3WLBB 2EH8L 4HCRA 3BN3B 4TSAL 4EQ2A 2AABL 1XGYL 3H9SA 3HMWL 3PL6B 3IJHA 2P1YA 2W9LA 1OB1B 4ZFGL 4E5XB 4YK4B 3SDXE 4X80H 5DJ8A 4H0IA 4QY8B 2YPKA 1P1ZA 5E4EB 5ISZB 2R0KH 2E7LA 5IBUB 2VDMH 1LWRA 5FDWB 5JXED 4G9DB 5ITBL 4DGYL 4PRAB 4WI3A 1EFXD 1IT9L 4DCQA 4H26A 1FO0H 2QJDA 3A6OA 5IVOA 4JFZL 3TNNA 3QUXB 1ZA3B 3GI9L 4MQSB 5EIIA 4K7PX 3T0EC 1ZVHA 1J1PH 1JPSH 3CFBB 3P9LB 5JDSB 4QOKE 3DXAE 4X0KB 3DX6B 1UVQB 1XCQA 5FUOL 5CMAA 4PLJC 1F8TL 2IBZY 3P77A 4NQCE 5FIEA 5GPRA 1H3PH 3TP4A 2Y9RT 4C54A 1OWRM 2EDRA 4DQOH 1HHGB 4CU7A 1EMTL 4WNQB 4EDWH 3JWNC 1B0RB 4U2YA 4ZUTB 2EC9T 1CIUA 3HNTH 3O41A 2APTA 3JVGA 2GTWA 4JHWH 1QYGH 3LKOB 5CP7B 3MMEB 3QH3B 2EE6A 4CN4A 5FV1L 5I76B 4NNPL 1WBYA 5BW7C 1GGYA 1G9NH 5DVKA 4M5ZL 4YHIA 1PDKA 1U2HA 5IMKB 4IS6A 1T66C 5K9KB 3ZZ1A 5BRZB 3NFNA 1F3DJ 4JM2F 5DUBB 4L8DB 4U7SA 5HI4D 3I6KA 4R96A 1MJ7H 3L3IB 2HKHL 1XF3A 1KN4H 3OPZH 4LBEB 4NFDA 4OJFH 1NMCC 1Q8MA 5C0RL 4GKNA 4MXWH 4CRPA 3BKJL 1OCWH 5L88H 5T1LA 2F5AH 3C5JA 1WQVT 3BGAA 3WN5A 4JFOB 4LMQI 1N0XL 4MJ5B 1GZPB 3I85A 2IBBA 1U3HB 1JPGA 3MNWB 4TNVK 1E27A 5E24E 5IW6A 3PV6B 4QRQB 5EFIB 4WWKD 5EBGA 4C83B 1HOCA 2VLJB 1NCAL 5CJQL 1X5XA 3TCLA 4KY1H 5C3LD 4X6EA 5F7NC 3I75A 1A64A 4GW5B 1NFDE 1EHLL 2R1XA 2GW5A 2CKBL 2KL6A 4FMFA 5HHVH 4C56B 3HS0B 1A6TA 3SGDI 4MZ2A 4CVZB 1NAKH 5ETUB 3ZTNL 4QTIL 5C3TA 2FLBT 2VITB 4NZRL 5IK3B 2X9WA 3VXMB 4Y4HC 1FSKB 4YXHH 4M6AA 2CDEA 1RZKH 4KDTA 4U1JA 1FIEA 1AXSB 1LO5A 1Q94A 4DGVL 1KN2H 5EU4A 4L3ED 4XXDB 4AY0A 3MODL 5D8JL 3FCTB 3MRFB 4GRLB 4Z0BH 3ARVA 5D2NC 4OD1L 3DUUB 3QFJE 1OLLA 4HS6A 5L6YH 1XGPA 3KG5A 1JZ5A 4YDVA 4U49A 5C08B 4BSVA 4D0DB 4JVUA 1UH3A 2AK4E 3RL2B 4LARH 1BD2E 4P4RA 3IFLH 4J2XA 1BBDH 3IKCB 2CO7B 4OF6A 1I3RA 3U9PL 1FFPA 3VJ6A 4FQ1H 4IHOA 5SX4H 1NL0L 2KKQA 3ARQA 5FGBA 5EOCL 5D6CA 5GS2H 3KPNA 5GGVH 5D4QA 4PJEB 1IVLA 4XB7A 1ORSA 5J3HD 5E1HB 3VCLA 4FABH 3OKKB 1FFOB 4NO5A 2D7TL 3P4NB 5BJTB 2O61A 3DX9B 3MYZA 1QSFB 2X4NA 3FT2A 4JRXE 1NLBL 1JGDA 2Y6SD 2BRRL 3IDXL 2WWMC 4HFUH 4PGZA 3F58L 4PJCA 3PGCA 1CDYA 5DLML 4PY7A 3D48R 2E6QA 2DLFL 4U1HB 5EC2A 4F15C 4YXLH 3GRWH 4Q97A 1TJGH 3LRGA 2ADFL 2AJUL 5HGHA 4LLYB 3I6LD 3BESR 2H1PH 3RFZC 1ZWIB 4H88L 3AXLA 2AEPH 3O3EB 4BFGA 1I3GH 2Y06H 2AI0H 3ESUF 5C09A 2E6PA 5DTFA 1CFTA 2CDGA 4ZXBB 1OGTB 2HTLC 1BVKA 3GGWA 2BFVL 4I0PA 3O6FD 4X5WB 1OAQH 3FQUB 2FGWL 4ELMA 2X6MA 3ARFD 4N0UB 5HHMB 2FZ3B 1MY7A 1CXEA 4J4PD 4XMPL 3X3GH 1G6RA 2J6EH 2NY1D 2IG2L 4LP4A 1BQSA 4N1EA 5IB1A 5IQ9B 3OAYH 3CC5A 5GISH 2EKSB 2ICWB 3NZ8A 5A2JH 1QR4A 1KACB 3V6FA 4OCSH 4U6TA 1CK0L 1RUAH 3JUYA 1LO2L 4WO4C 5HHPB 5C0FA 2ADGB 1NSNL 1F4WL 4WW2A 5BZWB 2CRYA 4GAYB 4GT7A 1SYSB 1MCDA 1VDGA 7FABL 3UP1A 3MRRB 1MFBH 1KJ3H 5KSAB 2IH1B 5I15H 2R1WA 3BPCA 4J8RA 2EICA 3MRLB 2GTZA 1M05B 5D70H 5EBLB 4JREC 3O4LE 1R3HB 4FXGA 4ZS6D 3EYVB 4ZUUB 1N6QH 1FNAA 3T0BA 3I2CL 5EOTA 4ZFOB 1T89A 1ZHNA 3LQAC 1WAAA 5FGRA 3U4BH 4HFWA 2FX9H 3KYMB 3X3FL 4GG6F 3KYKL 3EW3B 4PTUA 5F1NA 5SWZD 3QNYB 4NC1E 2CRMA 1K4CB 4M7JH 5IVXB 5I18L 5ANME 2OZ4A 4KJYB 3H0TA 1AKJD 3UZEA 2Y07L 1IMHC 1DUYA 1JHLL 2F53E 3JTTB 4TPRL 5JDJA 3QPQC 2MOVA 5C9JA 1S78D 3MLYL 4CVXA 1T7YA 2OJZL 3GIZL 1XIWB 1QLFA 2ARWA 3MLVH 2HTKD 2F58L 3DGGA 2BNUA 5IF0B 5GHWL 2OL3A 3NN8B 2GJZA 5D1XA 3V0WH 1JGLH 4HHAA 5MEND 1SJXA 5EUKA 1JHTB 5KG9B 3QXAA 3DMMB 4JPKL 2Q3ZA 4RMWA 2BCKA 1JMZA 1BQHB 2AJXL 5JIIA 2XNAB 4AENA 4FNLL 3VGGA 3H8NA 5EG6C 2VXSL 3OJMB 4WI8A 2X4OA 3JWDH 3CLEH 4P57A 3MV01 3EYQC 1P5UA 2GK0B 3C5ZC 3PWUB 1M71B 4H8WH 4AQ1B 2X70A 1SY6L 4PBXA 1J12A 2HH0H 3KR3L 4N0YH 5AWNH 3RVWD 5DMJB 3VI3F 3FB8B 4JFFD 5FYKL 2MKLC 5DJYA 1T7XA 1GGBH 4D94A 2QQLH 4OB5L 3VDCA 3FQXB 5ESQA 1KXQE 3ME0A 3UZVB 2VR9A 3CXHK 5DJDB 2BJMH 2J8OA 3DOSA 3T0EA 4MVBD 5B3NA 4LVNC 4Z7OF 3HHRB 1MLCA 1T1WA 3ULSA 3WE6B 3DYPA 4P3DA 4NZTH 1XGTA 5L2KD 3NIDF 1S5IH 3QIWB 4P5MB 4JO2H 3CD4A 5CD3B 3ULUE 2EYTA 1FC1A 1S7SB 5CZVH 5T33H 1DVFD 1KJ2L 4XAKD 5C7XL 2WBJB 5IEHB 4HDIA 2EZ0D 5FYLE 2AP2A 4E41A 1BEYH 1QFWI 4KMQA 2OBGA 5C9KA 3O6LH 2VB5A 1I7UA 3IFPB 3I9GL 3T65A 3FOLA 3LKRA 2D7NA 4N0FB 5IJKC 3IKKA 2LAGB 2YRPA 5IVZA 5DURB 1X5YA 2FJHB 1NUFA 5BW7A 3BO8B 3EYSH 4UNVA 2D9QB 2YD5A 4EN3B 3RBGA 1MHCB 2DQEL 1AH1A 4Y4KB 1NCBL 3O8XD 5J12C 5CHNB 2YC1A 1ZT7B 4MD4A 3EHBD 3OXRB 4NT6A 5ITFA 1JRHI 1UM4H 5B39G 4WJ5B 5CFHA 1YMMB 4K8RC 2VIRB 4NWTH 5GGTL 5I73C 3B8SA 5DJZB 3T4YA 5JW3L 1KJVA 4WTXA 5GRXG 4PJ7B 2P5WB 3IXTB 4LHUA 5DZNA 3SGDH 3KJ4C 3DURB 1I1FA 5CBAA 5D96C 1A1NA 2DICA 3PJSA 2VSDA 1XCTB 1V5JA 5EU6A 1RUKL 4JGJA 3IDYC 3QRFM 2IAMD 3MFFA 4X6CF 5D7JD 1A0QL 1HHHB 3NAAH 4OZIE 2IPKA 2X41A 4N8PA 4NUJA 3WUWB 4HIXH 1S7RA 4XVTH 3DX8A 3MV9A 4M93C 1EUTA 4ZYKB 1FZMA 4P2QA 3KPRE 3K1DA 2EDYA 3X11B 2FL5B 4HIIB 4WTZA 1DQQA 3RUGE 3AGVA 3O3AA 4XPFH 3DUHA 4Y4HA 2J8UF 1AO7B 2UZYB 5ICYA 2CD0A 5DT1L 1OAKH 4OBRA 5DD0L 1NDGB 4JFQB 1FJ1A 4P2OD 1OP3K 1P84K 1YYLH 1S7TA 5D2NA 1KIQB 4JAMA 4PRIE 4H20H 1KENL 5D1ZC 1S8DA 2GT9A 4OD3L 5EOQL 1CFBA 2KPNA 4PY8J 3ARUA 3OG4B 5F7MC 4NN5B 3NGBB 4PS4H 3HN3A 2MMXA 3G08B 3M07A 4X6FB 1B6UA 3QDMB 4IRSD 3VWJC 4MJ6A 4M48H 4S2SB 3CMOL 1HQ4A 1QA9A 4N0CC 1BMGA 3QUMA 4UT6H 1H0DB 2AV7B 1K8IA 4ZO9A 4Y2DD 4XVSL 1QKZL 5C0AE 3P0YL 1HIMH 2DQCH 3BT2L 1VACB 2NTFB 2PW1A 3M8OL 4ZS7H 5DSCB 3MRDA 4XVJH 4RRPA 4KQ4H 1DEEA 1H15B 2WIMA 4JPIA 5DR5L 2MJWA 5DQDL 1VFBB 4ZDHA 5I1KH 1MCNA 4PB0L 4AEHL 4NQDB 5F8RC 1IM9A 3CXDL 2A77L 3HUJA 1WIPA 1F42A 4ISVB 2EYRA 4U1SB 2DTMH 4FQXD 3IU3B 4OZGA 2LU7A 1F00I 1FH5H 1PKOA 3MJ8A 2YK1H 1YEKH 1VEPA 2AJVL 5GJTH 4NCC2 3V4VH 3ARZA 3SDXB 3Q5OA 1R5VB 1A5FL 1AR1C 1WCBA 4WFGE 4WWID 4F7MA 5IG7B 2ZKHH 2OR8A 2ZOLA 1MCWW 4G8EA 5SWSE 2BVOA 1MJ8H 3EYFA 1FYTA 2WUBH 4JY4A 5KN5B 2AEQL 4NIKB 1EBPA 4FFVC 4IIQC 1EJOH 1HKLH 3QG6B 3HI6H 4HXAL 4OKVA 1RV6X 3PWNB 4QOKB 3QDGE 3DXAB 4RA3A 4G8IB 5J6HA 5CEZL 4OT1H 5JQ6L 5DD5L 3NCEB 3NA9L 2ZUYA 5CIPH 1BFVL 1U6AL 4NQCB 1L7TH 2VKWA 1MREL 4GAGH 3PL6C 1DFBH 1HE7A 5HI4C 3DX7A 5EUOE 1XZ0B 4YK4C 3FZUD 1JF1B 1KB5L 1KFAL 4K3HA 4L9LC 4DZ8A 4LGPB 5DF0A 5A2IH 5B39B 1CGSL 5L0QB 1J0KA 1OM3L 1JK8B 4G7VH 2ADJB 2LABA 2YBRA 1VGKA 3F7QA 3QUXC 4HJGA 4CUCA 1EXUA 5IMMB 1C16B 3UYRH 3GSNA 5D72L 5J11C 3KXFA 3V6OE 4OAWB 4WWKC 2ZUVA 2XZQH 3C8HA 5I1LB 4DFIA 3V4PL 1KELL 5D71H 3VGBA 3TBVB 4QT5B 5CGYD 4LSTL 4BSWB 2HFFA 1PX4A 1OD9A 1LO3L 1DN0B 1G7MB 5DUMH 1JYWA 3P4MB 1BVLB 1W0WB 2EH7H 3HR5B 4R90L 4P48A 5HDBF 5FA4A 5EC1A 1KC5H 3ULVD 4CVWA 3EDJA 1G7LA 4NQEE 4PGEB 3QQ3B 1OP5H 2DD8L 3F5WB 3SO5A 4XCYB 1NANI 3VXRB 2Q20A 4Z6AT 3FFCA 4PJXA 4WIQA 3H3PL 3LN5A 1QR1A 1NFDB 1IEHA 3LEXB 3QA3A 1DE4B 3C5ZA 5DA0B 1I8LC 3QAZB 1W8NA 3MRKB 5EZJA 4E0RB 2BMKB 3QUZD 2GI7A 3MA7B 1A6VL 2VABA 1BECA 3MRMB 5IFJB 3QI9D 3IDMB 4MAYB 3EFFB 2G2RB 4X7TB 3C6LB 1U8HA 3NTCH 1TZGL 4JVWA 1QFWH 1KSRA 3VXOA 3QFJB 1CTNA 5J3HC 3PP3H 3NPZB 5MERB 4HSQA 5F1KC 4UDTA 1NBYA 2ICWI 3K4ZA 3BN9D 3G6JA 3KPSD 4LPYA 4NJ9L 3OJDA 2AK4B 1YUHA 1JL8A 4K94C 3V8CA 3MX0A 2Y6SC 5DQJA 2NXZB 2Q8AL 1FVDA 2XRAH 4UINL 2AXFA 5D1QC 1RIHL 3B9DA 2BOBB 2HFEB 5ACZB 4RGNE 3MJ7A 1DQDH 4Y19E 4Y8DC 1CLYL 4BH7A 3MJ9A 5I1DB 3QQNA 4AL8H 3IJYA 5FKPB 4NCDA 1JTOA 3UPCA 5IFHL 1HNFA 1TZHA 1JRHH 5GGSA 5IJKA 1EX0A 1GIGH 3MFGB 1FSKC 1IC4H 2H45A 4RDQG 4TUJB 1JPFA 4K23H 4JRXB 5T3XH 3KLSA 1W72H 5TE7H 1MF2H 4MJIE 2SEBB 1LVEA 5E8PA 4Q6IA 5SWQA 3FTGA 1KBGH 3CFJA 4BH8A 5T1KB 3ARFC 2Z92B 5DRZB 3VRJA 4GBXD 4KZDH 5HDOA 5IW3A 2BNQA 1IC7H 1ZAGA 4Z76B 2HJLB 3G6AA 3B43A 3SKJH 4M7ZC 5JXAL 3QEHB 4WTWA 3BKYL 5I66A 1VKXA 2P8PA 1AGFA 3F7YB 1RUPL 3BP7A 1AJ7L 1MVUB 2GITA 4DTGL 2DB8A 2NX5E 1Q0XH 3H9YA 2XKUA 3P73B 2VLME 3DO3A 1KCUH 3IT8D 3O9WB 3FO2B 1BIIA 2NY5L 1Y0LB 2WWKT 3ES6A 2G5RA 1QRNB 4PJCF 3GB7B 1DQLH 2Q7YB 4FQJH 5JHDE 4JB9H 5TH2A 4ZS6C 2X4PA 1WZKA 1RZ7L 3PABA 3GBLA 5KTEH 1TITA 3P0VH 2V5YA 5HVWA 1RPQA 4YBHA 2X7LB 1RHHB 2J12B 3BYTA 1A1OB 4HF5H 4X80L 1TZIA 1YN7B 3TN0D 2VWEC 4K55A 1KXTB 4DGIH 2Q86A 5HHXH 2R0KL 4NKMA 3GSQB 5K9OB 3THML 4ELMF 4LSVH 1EZVY 5F21B 4DK6A 3MLTB 3HZKA 3LCYA 1JHKH 1FO0L 4ZXBC 3TBWA 4P5TB 2DYPB 1RJZB 5D1ZA 3WO3B 1ZGLP 2EXYC 5FO7A 5FOBA 4R2GB 2MCPH 4DAGL 5A2LH 1JPSL 2D0GA 1Q1JL 1VSCA 3BPOB 4CL7A 5DJ2B 1ZLVH 1I8KA 3S6CA 3L7EA 4D9LH 1A2YB 3VWJA 1NAMH 5ANMB 5IB2A 1XF2A 4NDMA 4WW2F 2NR6C 2F53B 1H3PL 4X5XA 4LVHB 2IFFH 4CN6A 4EI5B 4YHNB 4U7MA 3MNVB 4UU9A 3MV8E 2LTQC 2JE8A 2XV6B 1T0NA 3ZO0A 2I27N 1PZ5B 1T7VA 3CXHJ 3MNZB 3HNTL 3ETBF 1T1ZA 1UKSA 1QYGL 3LEYL 5KSAC 2EDDA 1WAAF 3G9VA 4HH8A 5JXEA 2PYFA 3LPGA 4MNQD 3EJZD 1T5WA 3GJFH 4JM4H 4NKIH 1EFXA 4G9FE 1KG0B 5F89A 4HCRH 5EB9A 4PJ8D 2H8PB 3DJ9A 4ZTOH 4S0SD 1V3KA 1MJ7L 2EYSB 4X4ME 3NMEA 4JHZA 1MCSA 5HI5D 1P4BH 4W4OC 5H35A 3UTPE 4JG0H 2HLAA 1EUUA 4MXWL 4FS0A 5ABDE 1OCWL 4U1KB 5LWYH 2F5AL 5E8OB 1ZT1B 3OR7B 1DVFC 2Q6WB 5FYKE 3MC0A 4YWGH 3VGDA 4UQ3B 5EU7E 4LK4A 3OKMB 1LD9A 3KNBA 1YNTA 5EU5B 1QHOA 4ZNEA 4NN7B 2VLRD 4IIQA 3CH1A 4E42A 4QKXB 4KY1L 1WZMA 1NCWH 4ZUVA 3DMMC 3W9EB 5FO8B 3UTSD 5DD3H 5HHVL 1N5AB 4PGCB 1A22B 3QIBD 4OSUH 1NAKL 2XTJD 5BS0D 2N56A 5C92A 3FL7A 3SBWC 4UAOC 3NZHH 5FXCH 3PL6A 3PWVB 3SE3C 4N90E 4O2EA 4IJ3B 4YXHL 1PBYA 2RIKA 3EHBC 5BOZG 1HEZA 4QY8A 5C0CE 2W9EH 4Z0BL 4L9LA 1UXWB 1MFEH 2G60H 5L6YL 4JFDD 2IPUG 3RDTB 2XQYG 3OTTA 4B41A 3U1SL 4PRAA 5ALCH 2NMSA 2ZP0T 4YX2H 4LARL 1KTLA 4GKZA 1Z0MA 4QRUB 1L6XA 1ZA3A 3IFLL 4QRTB 4FFWC 2W0KA 4ZOCA 4F9PC 5B38G 2KH2B 2HYMA 4WWKA 2IAMC 2XWTB 3TESA 5I1HH 3CFBA 1K2DA 5D7JC 4X0KA 4YR6B 2Z91A 4K7FA 4UBDD 1NANH 3UBXA 1D5BA 4JZJC 2E7CA 2VLLB 4OZ4A 4GS7B 5GGVL 4RQQA 3H9ZA 4FABL 2NTSP 1YEDB 1E0OB 3TJEH 1RIUH 2DS4A 1VGEH 4AZ8A 2UWEE 3WNNA 2RR3A 1OGAD 4LSSH 1A7OL 3UTTD 1INDH 1W8OA 1J0ZA 1ZEAH 4G6AD 3ZLQC 5MEPA 4Z7UA 4L3EA 1I8MA 4QGTA 3SCMB 4WEUD 4HFUL 4OCYL 4ODBD 2V2WA 1JZ4A 4PJIE 1QBLH 3LN9A 3KHQA 3ZYOA 4YXLL 3GRWL 4OZIB 1I7ZB 2CK0H 2R2HA 5LBSH 1RZJC 4DFHA 4UV7L 1FFNA 4ODXB 1F02I 3SKOB 2V5SA 1I8LA 3KJ6H 3KPRB 2PUQT 3W0WE 2AEPL 1D9KB 4RFOL 3T4AB 2Y06L 4K9EC 3RUGB 3CZFB 1JIBA 1JNNH 1FN4A 1HYSD 3WHE0 1OAQL 4D0BA 1IAIL 4WHCA 5TQ2H 3L95B 2FX8L 2VN7A 1JTPA 4R0LC 3S3PA 4KJQD 1GC1H 4Y2DC 1I7RB 4HV8A 3P30H 2G5BB 4PRIB 1RMFL 4JFOA 3X3GL 4GW1A 4MJ5A 2NW3A 3RWFA 5BV7H 1WUNT 2ENSA 1YJDH 1GGCH 2RFXB 4QRQA 5GISL 3MLRH 3TT3H 2VLJA 3S35H 3MACH 2GQHA 5AD0A 3EO0B 2WW8A 2EIDA 4HIHA 5D1QA 1J8HD 1HHIA 4GW5A 5F7EH 3VD7A 4BM7A 3SJVD 1X5JA 3RBSA 4XCCH 2YMXL 3AFLA 3SQOH 1XT5A 1DN2A 3BOVA 4FQHB 3TH3T 1INQB 3RL1A 4KI5E 4JO1H 1MWAB 3CDFA 2DIJA 2V9TA 5FECB 1MFBL 3M17B 1ZLWH 5C0AB 5I15L 2PYED 4Z77B 1X4ZA 5D70L 4F7CB 3R1GL 3CLFH 3MRGA 5KSVB 4KKAD 1N6QL 2DN7A 2ESVD 4XXDA 3VG9B 1BREA 3WDHA 1CD0A 5CZXD 3MLPA 3RJQB 1J8KA 5IHZB 3U4BL 3DI3B 3KYOB 3FONB 3R8BB 1EEQA 5IGXL 2FX9L 2X10A 3ARFA 3V7AE 5C08A 4TSBH 4N8CH 4J4PA 1MNUH 1MPAH 3AMKA 3UPRB 2XPGA 1QLRB 3IKCA 5D7IE 4DZBB 1QSVA 4YHZH 2XY2A 5C0JB 3MLVL 3SO3B 1JMXA 2BVEA 3NCMA 3IXAA 1FNGB 4NQSA 1ZHKB 3VFUB 5SWSB 5INDA 2PR4L 3ZYJA 1RAMA 1FFOA 3ILPB 3P4NA 4F3FA 1ORQA 1BBJB 4P3CH 5AG9A 5LCVL 1G6RH 1QSFA 2BVTA 3PGDA 3SDCC 1MCBA 4HC1A 4M9PA 3FZUC 3B5TA 2IALB 4L29A 3OV6A 3QWOA 4CJ0A 2D2OA 1RFDH 3HUJF 4WFED 1H9VA 2E9IA 4K2UL 4AMKH 4DKEH 4OZGF 3FO9A 5FO9B 1TJIH 3QDGB 2CO6B 1J0YA 3JWDL 1PKQE 4U1HA 3CLEL 1GJIA 4HIJA 4TNWK 5CEZE 1AFVH 3GI8H 4MLSA 4H8WL 2HH0L 1KJMB 4RCAA 4N0YL 1AKJA 5AWNL 4C58B 5AG8A 3KPLB 4UILH 5DC4B 1GGBL 3VFSA 5EUOB 2WANA 1FHGA 5E6YA 1C5DB 2QQLL 4CW1B 5E94B 5B38B 3FB7A 4ZXBA 3U36B 4Z5RB 1ZS8B 2H32A 1IEBB 5ERWB 3HRPA 4NCC1 1MFNA 1MRDH 3FQUA 3TEUA 1I9JL 2BJML 4NRZB 3TNMA 1F4YL 1N8ZB 4CU8A 2FZ3A 5MENA 5I30H 4PBVC 2I60H 2QQQA 4NZTL 2I26N 2XZAH 4MSWB 1JPTH 1T03L 5HYIA 5IT2L 1S5IL 3WEXB 1MJJA 2QV2A 4QRPD 4JO2L 1HCFX 2OZ4H 3ULVC 5E56A 4DKAA 3FAXA 5T33L 4PRNB 3MV7D 4PRHA 1A6WH 4LCCC 4MDJA 1BEYL 4I5BA 4ONGH 4XP1H 3O6LL 4KK6D 3G5ZB 4QHUA 5BZWA 1SVZA 2EEBA 3O6FB 2OL3H 1H3VA 4NKOA 3FRPA 2Z9TA 5KSAA 2DQDH 3MRLA 3QI9C 3LKSB 3REWB 3EYVA 1IILE 4NQEB 1ZT4B 3E1F1 1I7TA 4ZFOA 1JWUA 1U8MA 1QSEE 2E6JA 4AIZA 1YZZA 1ULVA 1MCEA 4ZUSB 5DRNA 3W39B 1K9TA 3D0VB 1BHGA 1NJ9B 1UM4L 3VFMB 2R23B 3BN9C 2FH6A 4W4OA 4O58H 5HD8D 5C0NC 4E9LA 5L2KA 4KJYA 5JUEL 4NWTL 4OCWH 4UNTA 3CFDB 5E8NB 1DQML 1K6QH 3ABZA 5F96H 2FX7H 4KDVA 1JF6A 2AXJA 5DJ0B 1DVFA 5J4MA 2HWZH 5BVJB 2OQJA 1LEKB 3AB0B 3AS1A 3FRUB 3CUPA 1QVOA 4NBYB 5E00B 4JDZB 5IF0A 3L3OB 1E4KC 3FO1B 1RJLA 4JLRB 3S5LA 2Z8RA 1CGXA 3RIFF 4RAUB 4A6YH 3DMMA 4PJXF 4KUZL 3DSFH 5SWZB 4NO0D 4MZ3A 4BQCA 4U6VH 2XNAA 1HSBA 2GY5A 5B3JE 2APXA 4Q9CA 5KVGH 3G04A 2QQKL 4XPBL 5ID0B 3SBWA 4UDUB 4XPFL 3KPTA 4RGNB 1NPUA 3MREB 5IEKB 4Y19B 5HY9B 2I9TB 2X4UB 5E9DE 1GZQA 3SE3A 3BZEB 3WIHL 1F4XH 2V7NB 4NM4H 5T5NG 3T0XA 1OSZB 1KNOA 3QAZC 4P2RA 3VGFA 3QEQE 1CXKA 3TT1L 1YYLL 3OL2A 2UVEA 3NCCB 4D8PA 1P4LA 3T3MF 3DRQB 4MAYC 2IBZX 3C6LC 3G6JF 3SDDB 4IMLB 1AQDB 4MJIB 1AGCB 2ICES 3ARGD 4FXLA 3S98A 1S9KC 5DYOB 5KVDL 2IAMA 3ALWA 2J3SA 4PS4L 4EI6A 5D7JA 4M7LH 4HWNA 2W60A 3O11B 3D3VE 1RZFH 4GLRI 4JM2D 1DUZB 4JZJA 1U8NB 5GRVK 1NGZB 2BVPB 3Q2CA 1NBQA 1Z5LA 4ZFFA 2Z8VC 4FG6D 5E5MB 4OZFG 3DARA 2ZNXA 1B2WL 3B2UD 4LDLB 4XGZB 1CGTA 1U8JA 4ZS7L 5ADPH 4XVJL 4EUPA 4G6JL 2NX5B 1KYOK 4KQ4L 1KLGB 3Q6FA 2XKSA 2VOTA 4Z7WA 5F7KC 1CICD 1IEAA 4M1GH 3FKUS 4KHTL 5E03A 1XMWA 3ISWA 2B8OT 5I1KL 4IBLT 2FJHA 5TDPB 5JHDB 1C12A 3O3DA 4IOSD 5E1AA 1P6FA 1JZ6A 2FDBP 4X7SH 1D7FA 1MHCA 4JZNA 2DTML 3VWKD 4HUVA 3TCXA 2ZZUT 5MP6H 2H2PD 1FH5L 2GYSA 3LPFA 2YK1L 1YEKL 1Q9WA 5GJTL 3U0TA 3JUZA 4GRWF 5CAYB 3V4VL 2IBGA 5I6XB 3FJTA 1WEJH 2GFBB 2XN9E 3PQYD 2ZKHL 3QT2A 5GZND 4TOYH 3FN3A 3ALPA 4R0LA 5DJZA 3WS3B 5DQ9B 4Y2DA 2Y7QB 1S9XB 4FXKA 2GEEA 2WUBL 2BSTA 4OLVH 1TMCB 1HILA 4ZQKA 4H1LG 3RP1A 4R8WH 4M3KB 1VESA 1EJOL 3B9KB 3PGFH 3HI6L 1LNUB 3O9WC 5EPMB 4PJBA 4WUUD 1G7PB 3ARBB 1T1XB 2BNRD 4HWUA 5J06A 4Y16D 2VC2H 4OT1L 2PXYC 3EJZC 1GAFL 3WUWA 4HGWB 4JDVA 3QSKB 4PLOB 2C7UB 4Y1AE 1MSPA 5L2JA 3QUMH 1L7TL 4WDIA 3S88H 3X11A 4GAGL 4PJ8C 3D85D 1M6OA 5DDHB 4GXUN 3AS0A 5DHYB 1N5YH 5HVFB 4F33B 1X5LA 3D2UD 3MV8B 1SVCP 1AO7A 4JKKA 4KQ3L 4Z0XA 4HKXB 4LCWD 1SJHB 2HJFB 4PJAE 2R1YA 3O45B 4WENB 4D2NA 4OI9A 3BSZL 4WV1B 2Q7NA 2VZTA 2ED9A 2FO4B 2Z93A 4YHLH 5ECJE 3WIFA 1PEWA 4G9FB 5HYJE 2OXGA 2J88H 3V6BR 2BERA 4XMLH 3S3SA 3TZVD 1U91B 2DWEB 4HS3B 4U6HB 1JGVH 1F6AA 2XZQL 1J0JA 4YPGA 1MAKA 2VISB 4S1DC 1WWAX 5D71L 1BGXL 5ENWB 1FORH 4PP1D 3V9FA 5CEXB 3GMMB 3P4LA 2P43B 5CJOH 1O0VA 3V7AG 3QIBC 3S3JA 5F7UA 3G5XA 2AV7A 3V4UL 2XTJC 5DUML 4Y5YC 3MXVH 2EH7L 4QYOB 5KJRH 1IAMA 2IMMA 1NDMB 3CCHB 1MCJA 1AGBA 3O6MH 1KC5L 3BXNA 3SDCA 2PETA 3CFKA 4KTYA 4OF5A 4ZNCD 5KVEH 4LCIH 3BZ4A 5LGJA 4WFHE 5HYFA 3AUVA 1QD0A 1NUNB 3RY4A 4LU5H 3IRZA 2DDQH 4MD5A 3QUYB 4I3RH 4NHUA 3BKMH 3DWTA 3ZDXF 1FFQA 1AE6L 4U1SA 4JFPA 2CIKA 3VI4E 2A73A 1KJ2B 3HTLX 4KPHL 1RJYB 4I9WE 3SE4C 4G8GD 4HUNB 3BH8B 3OXSB 4GH7B 3QNZB 2F74B 1T2QH 4UBDC 1XEDA 3HZMB 5C0CB 2YEZA 1T04A 1B0GA 2D7PA 4CBPA 1QFWL 1HSAA 4Y4FC 4YHML 4JFEE 3VD3A 3DTXA 3HE6D 2YWZA 4RA0C 3UAJD 2A83B 3H9HB 5FYJH 3STLB 4Q6YA 5JNYB 5GZOC 3BE1H 5KN5A 4LDOB 4OZFB 3RIFK 5LAXB 1N2RB 3P0GB 1HWGB 4HMCA 4JRYE 3ALXA 4D9QE 2PO6C 2MFNA 3GSNH 1EJ6A 4FQXB 4BQ6A 4CNIB 1VHPA 1CBVH 3IVKA 1DBBH 3DXAA 4PBWD 4LCCA 2J7LA 3D39E 4JDTH 1DBAL 5JORA 4AL8L 1I9IH 4HGKC 1CF8H 2Y36H 4MNHA 3BIBX 1II4E 3MRJB 2YA0A 4JCLA 2VL4A 5F1OB 5GRJH 1IGTA 1JRHL 4ZO6A 4XPHL 1GIGL 2UWEB 3BFOA 4OIIH 5GS0C 1IC4L 4NFBA 1HXMB 4GMTH 4LNRB 5T3XL 1HYSC 3QI9A 5TE7L 2ZSVB 3E6HB 4WU7A 1MF2L 1KBGL 1YEIL 3H6JA 4KJQC 4OGAD 4JY6B 1T2XA 5MEOA 4PJIB 1LO4H 4KZDL 4Z95L 2HMIC 1IC7L 1KOAA 3H7BB 4RWHA 1ZHLA 5HGDA 3FT4A 4ERSH 2P5EE 2VQ1B 3QYCA 1JV5A 4HH9B 1JPST 3W0WB 2I9LB 3KAAA 3CMGA 4H1LB 5I1AA 3HE7B 2R29L 3V0VA 2EDXA 1A8JH 3RGVB 3RZCC 3LDBC 4U2ZA 5I8KH 3UCRA 1RIVH 1Q0XL 5J6GB 2A6IA 4PGDB 4MNGA 3DVFA 3EOBA 1E4KA 1G7MA 4Z7UF 1N7MH 2C4FU 3P4MA 1BZ9A 4QHNA 1DQLL 3FN0H 1Q9KB 4XPGL 4KK5D 4JB9L 2A0LD 5BQ7A 4CU6A 5BZDA 4KKAC 4OM0L 1KEMH 1U93B 1UB6B 3HG1E 5DGRA 3F5WA 5CZXC 4CMHC 3MUGA 5BCAA 2VL5A 3P0VL 3JWOC 3ARED 3U0WH 4F58H 1HH9A 3WSQH 5LJYH 5GGUB 3VFVA 3MJ9H 4DGIL 3OB8A 2FJFA 3NCFB 5HHXL 2IQAB 4L9DA 3OG6B 2B0SL 5E8DH 4E0RA 2BMKA 1KCVH 2NY3B 3MA7A 4LSVL 3Q1SH 5AAMA 1J5OH 4B5EA 5IFJA 1JHKL 4MAYA 1LE9A 3C6LA 4J12A 4IOIB 2V9QA 2EDLA 5H2BB 3VU2A 4MXVE 3RJDA 1MFAL 5MI0B 3QFJA 3MLSH 4PR5A 1RURL 4BFEA 4FHBD 5JIPA 4HIEB 4KRLB 4HX1A 4RBPH 3X12B 3ZDZE 2AK4A 1NAML 3PHQA 1BD2A 3QWRA 2WIIA 4ONOA 4LSQH 3DHMA 4K8RH 3EYOB 3MUJA 2IFFL 3E3QE 4J3UA 3P40A 5E2UH 4NZUH 3ILQD 4HW6A 5D7IB 4GRWH 2UVFA 5ACZA 1FG2A 5J9PA 2YPLD 5KANG 5TPWH 4K7PL 4PPTA 3O3BA 3CX5K 1KPVA 5DUPH 3F7VA 4YZFF 1PEZA 2VXVH 1MCLA 2V17H 32C2A 4NKIL 4JM4L 5C0DA 4PJDB 1WFTA 3QFDA 3VG9C 2HVJB 5DJAA 4HCRL 2NY7H 3GSUB 3CX2A 4OLXL 3B5HA 2OTUA 2EXWD 3CH8A 1PKQB 1MCKA 2H2SC 3QIUB 4TVPH 1P4BL 5E4IA 2C1PA 4FOMA 4AYFA 4JG0L 4PB9H 5D9SB 4APQD 3IDJB 3GSRA 3WYRA 4LCYA 4O4YH 1F5WA 5HPMA 1FIGH 4WUKL 1S7QA 1FZKB 3F12B 4U1GB 2A74B 1RZIB 3HB3C 4JHAL 2VJXA 2XA8L 1KB5B 3U9UA 4KK6C 4HWBA 2VLKD 3TIEA 2VH5H 3U7YH 5KSBE 1J1OH 1G7JA 2LU4A 3FO2A 3O9WA 3QHFH 1UXSA 1TQCB 5EU3A 1T7WA 1U92B 5DD3L 2ATKB 4GBXB 4LGSB 2PXYA 1MRFH 3EOAA 4OSUL 4KTDL 2APVA 4MA3B 4LEXH 3V5DA 3NZHL 4PJ8A 3F7PC 4B53A 3S9DB 4LVOB 5HBBA 5F9JB 1I3UA 5CCKH 3CFEA 3ZYIA 1C7TA 3DUSB 2W9EL 5IKCB 2GUOB 3K2UH 3AAZA 3GSQA 2BK8A 2WP3O 4BK4A 2DQIL 2G60L 1C1EL 2NXYD 2CUIA 1AD9B 5ALCL 4JHBA 5I74B 1RZ8B 3WXVH 4R6UA 1CFSB 3O4LA 4YX2L 3T08A 1JGEB 4HS8L 1Z9LA 5IR1A 1J87A 4LMQE 1EGJL 3FFDB 4RMQA 4L8CB 2VLRA 2R2BB 1QSEB 2ADIA 5I1HL 1ZV5A 4MJ2A 4FTVD 3WNMA 4K3JH 1E6OH 5C0IB 5I2IB 4AIOA 4MX7B 3UTSA 1OOAA 1UQSA 3GDBA 4HJ0D 4U1LB 3V6OC 3GKWL 4YGVB 3QIBA 3TJEL 1RIUL 3WFBH 5ELIA 1VGEL 5BS0A 4L4TD 1WITA 4Y5YA 1NC4B 3KLAA 5D7KD 1Q38A 1DP0A 1YY8A 3L3GA 1INDL 1TVBB 3TBSB 1ZEAL 3AU1B 2ZG2A 4F2MB 4HKBA 4MS8D 1EH9A 3ZSSA 4NPYA 4RMSA 3QQ4B 1J18A 3VFRB 1QBLL 4YDKH 1RULH 4JFDA 4DUXA 4Q58C 4R4FH 5DXWA 4L8SB 4BUGA 3IFOA 2DQFB 3VE0B 1IAKA 1ED3B 2Y25A 3KJ6L 3ARGC 2I5YH 1L9NA 1Z0NA 4YAQB 4YBQC 3OKNB 2NY2C 1JNNL 4OCMC 3HPLA 3SE4A 5E9DB 3WHE1 2YWYA 3KHOA 3QEQB 5TDNB 4Y4FA 4RZCB 1GC1L 1QHPA 4QXUL 3RGHA 4FFYH 4QO1A 3BH9A 3KPPA 2WBKA 2YUXA 3B2UC 2ZWLT 3LKPB 5BV7L 1NBZB 5T1MB 1GGCL 4J1UA 5JMRA 1ZKAA 3QZWG 1Z2KA 1KT2A 1CFQB 3FQTB 2PO6A 1QACA 3G5YA 3TT3L 3MACL 3GSWB 3TWCH 5F7EL 5HHNB 1WJ3A 3KPMA 4HKZA 4XCCL 3PWLA 4AM0A 5B4MD 3SQOL 3D3VB 3HMXA 3W82A 5IV2B 2J4WL 4Z7VE 4JO1L 1G7IA 2WUCH 4J6RH 3JTSA 5C0BD 3VWKC 4AEIH 3L3KB 3L3JA 5GS1B 3ARPA 3RWIB 5EORH 4RGNC 1QPPA 3NFSH 5C07D 1U8OB 1AD0A 3SKMB 2XYCA 3CLFL 2FBJL 1WC7B 4N5UA 4HWZB 4TULH 4EVNB 4MCYB 5C86A 2QKIA 2VUYA 5C8JA 3WFHB 5GZNC 3CVHA 4GJTB 4GKOA 1U8KB 3OQ3B 1KUMA 3T2OA 1EHNA 1CWVA 5F88B 1KXVC 3G9AB 5F44A 2Y4SA 4TSBL 4N8CL 4M7KH 4M6NL 4XC1H 4Q9RH 4LLWB 2X4RB 4NYLA 4QRTA 4G42B 3WIIH 4QHKJ 3U7WH 4WU5A 2FLRT 5JHLL 3HRZB 5ID1B 4FQ2L 3RZCA 4Y16C 2XN9B 2F54D 4L3CB 4Z7WF 1W2KT 1R24A 1G1YA 1S3KH 2ZJSL 3ZKMC 2N7AA 1E4WH 5DK2B 2MQ0A 2K1MA 4P3CL 1FO0B 2PYEA 4LSPH 2DWDA 5HHQA 3UC0H 1R3JA 2B1HH 1JZ2A 3EGSB 3ZT5A 4FQQA 1EO5A 4K94H 2XA3A 1RFDL 4BKLB 1KGCD 1ZSDB 4PJGA 4P46B 3ROOA 1IGIH 4AMKL 4GG6E 3QRGH 1GRWA 2MCG1 1OAZL 4Z78A 4GKSA 4MYWB 2HG5B 3GI8L 4Y8AA 3U6RB 4V1DD 2O5ZL 4Y1AB 3TZVC 2YRLA 3ZT7A 4UILL 2AJ3A 1JCKA 3B8YA 1SMAA 5I6XC 5KBNC 3C8KB 5EWIL 1A6AB 4RMUA 3ROLB 4N5ED 1MRDL 4KK8C 5KOVC 2Y72A 5CSZA 4PJAB 2IANE 4LQFH 1J1XL 5FHBH 3UTZA 4JJ5A 4PRIA 2Q8BH 4PJBF 2I60L 1JFQH 1KB9K 2XZAL 3EDDA 1JPTL 4U0RB 5ICZA 3GIVB 4NRYA 5HYJB 2AVGA 2RFXA 4K71C 3OB0H 5C6TH 4NP4H 2GJ6D 5D7SH 2QHRL 2FATL 4KVCL 1A6WL 3WJLC 1TTFA 1PSKL 4JN2B 2ATPB 2X89D 4ONGL 3T1FB 5FGCE 2XWBB 2ID5A 1CT8A 4I2XE 2PTVA 1MWAA 3HCVB 3L9RB 2OL3L 5I8CA 3VI3E 1FNFA 1SEBB 4IRJB 2DQDL 4U1NA 3WV0A 4UB0L 2AS5M 1RK1B 3H3KA 4L4VD 4ONFH 4HC1H 4R3SB 3REVB 1FP5A 2BZDA 2HJKB 3D9AH 3MRPA 1I1CA 2P8MB 4J3WA 1A4KB 2ZUUA 4Z7OE 3FONA 1U8PB 3HE6C 1UZ8B 3F6LA 3UAJC 1NC2D 1XFPA 5HHOE 1J8HB 5DJ6B 1FLTX 4GAJH 5J8OA 2ZUQB 3EAKA 3NIDE 5FYJU 4O58L 4OQTA 3RWEB 5L8JB 3HAEG 2M1KA 4HUWB 4OCWL 3FAWA 3BUTA 4QRPA 3WNLA 3K81A 5IUSA 1K6QL 3JV6B 5F96L 2FX7L 3QZWB 3VFOB 5GGRY 4MXQC 3U30B 1BWWA 3MV7A 3OR6A 1BAFL 2JKXA 3OX8A 2H32H 2P8LA 5FF6A 1G9MH 1NGWA 1FNGA 2ESVB 9CGTA 1L0YA 3VXNA 4JFEB 4NO2A 2A6JB 1IJ9A 1ES0A 1QFWM 2BVQA 4XNUH 1WT5A 4GFTB 4A6YL 3RWGB 3DO7B 1RK0A 2MTPA 5CJ8A 5I1IH 4JG1L 4XTRD 2JIXB 1I1RA 2D03H 4PLKC 4JRYB 4NM8H 4U6VL 4ZSOE 5DI8B 2IALA 4YNYB 4WHTB 3MA9H 5KVGL 1S9WB 2UV3A 3RWDA 2IEPA 4GQ9H 2JTDA 4NZDA 3OF6D 3VXQB 2CXKA 4NNXA 3D39B 4OM1H 1F4XL 4TRPH 4NM4L 4DUWA 4XVUD 4XNYH 2LVEA 1NFKA 4TSCH 2D7QA 1A6ZB 1BZQK 3P3YA 1QQDA 2CLRA 3JV4B 4XB8A 2KUTA 4JJHA 1C5DA 5T3XE 1VADA 2VAJA 4X4YB 4NN6B 1KIPB 3ULVF 4L1HA 4X6CE 1LDPH 5KAQF 1X6LA 4LKCB 4Z7QF 2GHWB 4M7LL 2QEJA 4L4JA 4R4BA 1RZFL 3TPUB 2P5EB 4LLAA 5T3ZD 4NO0A 4ALAH 1HHJB 4XPAH 3V6OA 4RFEA 4OFYD 3ARWA 5JPMA 5D5ME 2J8UE 5ADPL 4DOHE 3WLWC 3RPIB 3GMOA 4RIRA 2HT2D 4M1GL 4XPTH 5LGHH 3WMSA 4U6YB 5D7LE 1FV1A 2DQGH 43C9B 3HPJB 2XG4A 5E6IC 5J1SC 3RAJH 3VXSE 4RAHA 4NQEA 4X7SL 1MI5E 4ETQA 5MP6L 3ARGA 2CGRH 3LZFL 2AXGB 2X1QA 2NW2B 3CSGA 4X4XA 1BZ7B 4DKFL 2YN3A 5F3BB 3DNKA 3W39A 1Y6NR 3D0VA 3C60B 2CKBA 3VFMA 5CSBA 1P7HL 4OLZL 4K3EH 4OZHA 5L9DL 4HAFA 4KDWA 4I13B 1EAJA 4KVNH 4TOYL 3L5HA 3T77B 5E8NA 3K8KA 5E70A 3HE7C 3HI1A 3EFDH 3TYFA 3BPLC 2A6DB 4U0QB 3RNQA 4PJFA 4LSDA 5DEGA 3UJTH 3NABL 3CSYA 4R8WL 1U0QA 2PF6A 4Q9QL 2WK2A 5I0ZA 4WI9A 2VDPH 4RWYH 3PGFL 4S0TD 2J5LB 1CICA 3MR9A 2VC2L 4XP6L 3F62A 3GHEH 4NNYA 1N3NB 5GRUL 5AEAA 4YQXL 5F8QC 3QUML 3PHOB 4P4KB 3ZHKA 3S88L 3VDAA 1J10A 2YSSA 3VWKA 3W2DH 5HVHB 3HLAB 5MEQB 5E2TH 3DIFA 1N5YL 1FDLL 3FOMA 1YMHB 1AGEB 1L6ZA 1PJ9A 3ZKSD 4FQIH 3BP5B 3MREA 4DKDC 2Z35A 3HZVB 4EUPH 3ELAT 4JFXA 3GHBH 5EO0B 1AI1H 4APQC 3RTQC 4JN1H 4XHQA 3TJHD 3L1OH 4MWFB 5C0EB 3ZE0F 1YEHH 3QXVA 1WWCA 1YEGH 4Q2ZA 4ZG1A 3BP6B 4LRIC 5BVPH 2J88L 4WHDA 1RZJH 4XMLL 4M3JA 2XTLA 1NEUA 1JGVL 3H9SE 5DYOA 1ZVYA 2AEWA 4NUGH 1LEGA 1IBGL 2FIKA 1Y18A 2IH3B 4K9EH 4YHYC 2C9AA 1FORL 4Y16A 1WISA 5CJOL 1OAXL 2ZUTA 2BVPA 3NH7H 4XBGB 3MXVL 2DQHL 4LHUD 1ETZA 1CGYA 1T3FB 3D85A 5IB4A 4DN3H 5KJRL 1MCFA 1ZLSH 1QTYT 1ACZA 5DFWH 3O6ML 3PXJA 1A9EB 1S9VA 3TBTA 2GAZA 5KVEL 2FRGP 2NY6B 2CSPA 4LCIL 5DJCA 3GM8A 5KSBB 3LRSA 3MYJB 4LCWA 4KV5E 4YFDB 1ITCA 1F90L 4G80B 3PNWB 3SN6N 5JW4R 1XH3A 2AV1B 3QO1B 5EBWB 4LU5L 1L7IL 5JW4N 2DDQL 5TDPA 5BXFA 2OK0H 3MRIA 1K8DB 2VO5A 4I3RL 1CFNB 3BKML 1EEUA 3MV9D 4P2QD 3E8UL 3TZVA 4CAGA 4Q0XH 1FLRL 2DMKA 5JOPE 1TCRA 1FNLA 3C9NB 2XWJA 3X13A 1TXKA 4ZPVA 1V7NH 3VD9A 5INCA 3N06B 4D9RD 4PJEE 5DGQA 5TFSH 3QO0A 3W11C 1UWXK 5HDBE 4U1GC 3S4SG 5KANI 2PCPA 1IGML 1ZMYA 2EIBA 1MCQA 2QR0B 4KI1A 1K5NB 4QGYA 1I8IA 1OARH 1IQWH 1KIRB 2A1WL 3SDYL 2EKJA 1FZJB 5E99H 3GSNL 2EE3A 1HWHB 5FGSA 1LNUA 1IGCL 1FNEB 4MS8C 5EN2A 1UA6H 4MAUH 3EO1B 3PWPD 5KSUB 1CBVL 4F7EA 1G7PA 3WJLA 1FVCA 1Q9OB 2MNUA 4JDTL 3T09A 4BK5A 2CR6A 1I9IL 1CF8L 2Y36L 1I1AB 5IP4A 4HKJB 2AQ1A 3DVGB 1PYWB 4LASH 5GRJL 2O26U 1A7PH 4QRSA 4QRRE 1IKFH 2YRZA 4OF0A 1HXYA 4OIIL 4EBQL 3WKNA 5IMLB 1GL4B 2WQRA 5HYSG 2ARJQ 4U05A 3K8LA 3Q48A 2ZNWA 4MA7H 4MDIB 4YUEL 2WWMD 4HUUA 4PRPD 2ENYA 4GW4B 3HE6A 1F13A 1AP2B 2JELH 2R2CA 2EDNA 3MLXL 1LO4L 4WUUB 1FGVL 3LH2H 2BNRB 2AXHA 3VXTB 2CDFB 5FFLA 2W91A 2HAZA 3WD5H 5FM5O 4ZAKD 1U91A 3BDBA 2C1OA 4LLQB 3PWJB 1BOYA 3VW3L 5EIVA 1FL3A 2HTLD 4R9HA 5I8KL 1RIVL 3MGTA 2YPVH 2H26A 5J13B 1M7IB 15C8H 4UIMB 1S7VB 1WZLA 4RGMB 1SY6A 1QFHA 4PREB 2HT3C 1N7ML 5B8CB 4GUPA 4UOW0 1U95A 1VEOA 2IMNA 2VXUH 3BGFB 3HC0B 4P3WA 4CDHA 1I9RH 3IGAB 2FH8A 4FZEH 1KEML 4RISH 1DBMH 1CIDA 1JWMB 3ULVH 3OJ2C 1YPZA 1NGYA 2BDNH 43CAA 4OV5B 3ECBA 3U0WL 4CADA 1UC6A 1AR2A 2EDFA 4WO4D 1Z9OA 3WSQL 4AG4H 4QCIB 5IVXE 4YEFA 4G43B 4GAFB 3WNOA 2MQCA 1R5IB 1MIMH 7CGTA 5E8DL 3R8QA 5IWLC 2VXQH 1CE6B 5A16A 1EHAA 4ORZC 2IGFL 1RJYA 1FVEA 4YDIH 3NFPA 1KV3A 5I8EA 1H8OA 3X14B 3QDJA 3QNZA 3TVMB 3T0AA 2VNCA 4HJJH 4KAQH 5GSRA 1A14H 2YUWA 5SV3A 3EOTH 5CWSB 5FYJD 3KDMB 4PJCE 5IW1A 2QADD 5JNYA 2VAAB 4XX1E 4XP5H 1N2RA 5FUCE 2FSEA 4JZOB 4LEOB 3MLWH 4K8RL 3HZYA 3VFNB 4FQLH 5E2UL 3ARXA 3MUHL 4AH2A 4XNXH 5BOPA 4YBLC 1E4XH 5C09E 1S7WB 1YEFL 1MVFA 5TPWL 3GMLA 1ND0A 1T80A 4OUUA 4PG9A 5DUPL 3BJLA 1KCKA 5GGTA 5HYQB 4ELME 1HI6A 2VXVL 4PYHA 3RHWF 1T4KA 1JWSB 4XRCA 1KB9J 2V17L 2M2DA 3GSVB 4LNRA 1K4DA 2OTWB 5E6IA 4Z7NF 3E6HA 2NY7L 4HUMB 3VXPA 3GJEB 2ZSWA 5FB8B 4I1NB 5HI3D 3FFCD 4NKQB 3MQIA 4GG6B 3O2DA 3RWCA 3RNKB 3RI5K 3OHXA 2CUMA 5I75C 3VFWB 1HDMA 4QNPF 2PTTB 4TVPL 4XWGH 2B20A 2ZG1A 2JB5L 3BUYB 4PB9L 3C5ZD 3RX7A 2XXCB 2MSPA 3DYMA 5CIPB 4O4YL 4WHYH 3ULUL 2I9LA 1FIGL 4NKDB 4ELKA 5FYLL 1JUFB 4EIGB 4X99A 3BIKB 5FHAL 2YPLA 1H5BC 4O2CB 4PGDA 3WXWH 3TYGH 3U7YL 5EA0H 1J1OL 5DMKA 1X7QA 1EERB 5FK9A 2IANB 1WAAE 3MUZ1 4PJGF 4TTDC 3QHFL 3GBNH 4TNVF 3UYPA 1Q9KA 1NCDH 2BSED 2BY3A 3Q3GA 3IDNA 1M7DB 3V5HA 2Y5EA 3ZTJG 5HYSB 5LKNA 4LEXL 2CLVB 4XBEH 3WFZA 1QP1A 1HQRB 3U2SA 4M8QB 5FGCB 4I2XB 4RAVB 5JA8B 2X40A 3ORJA 1ZGLA 3LS4H 2IQAA 4OGYL 4APQA 1YNLH 4QXTB 3RTQA 3E2HB 3P9MB 4WW1A 3N85H 1FL6A 3BDXA 2P24B 4HXBL 1HN1A 3WXVL 4WCYH 5D6DC 2GSGB 1IC1A 3MGOB 4LRIA 2DQTH 3BVNB 1V7MH 3RRQA 1J05B 5GIRA 1CLZH 5E8EB 5SX5H 4KTEH 5HHOB 3O0RH 2BNQD 1E6OL 2R4RL 3X12A 5HDLA 1PG7W 3UO1L 3FQNA 4WEBH 3RPKA 3WHXB 3D25A 4XTRC 3P4OA 1S9YA 5AUMB 3BQUB 1CQYA 5T1DH 3B6SB 2O5XH 2XKNB 5ALBH 4M8VA 1NMBH 1CXIA 4LF3A 4S1SH 3MBEB 3B3IA 4M5YH 2LU3A 1IRAY 3NACL 1XR8B 3T0EE 3WFCL 4P0DA 4F7TB 3TO4B 1J11A 1RULL 4DN4L 3F65A 5EZLA 4D0CA 4R4FL 1HZHL 1OAUL 1D5ZB 3L3HB 2ZCHH 1F3JA 4NO3B 5EO9B 2HVJA 2XFXB 4ZSOB 2YA2A 3TBYA 1ADQL 4ENEC 3C2AH 2I5YL 5DVNA 4G5ZH 3KPOA 3AY4C 2ARJB 4JQIH 4Y89A 2L7UA 4E41E 2YUZA 3DRTA 4LLVB 2YZ1A 5DRXB 4FTVA 4BZ1H 1UWEH 5M95B 3T04D 3PXHA 1FNSH 5JOFA 2FJGA 1NGPL 1Q0YL 5DEFA 1WFNA 5DS8B 4FFYL 1FZKA 5KW9H 3F12A 4L4TA 5D1ZD 5J1AB 5AZEH 5EO1A 4P23B 2JCCA 3C09C 4OF7A 4CN1A 1YDPA 1W72B 3L6FA 1RD6A 4HK3N 1MLBB 3VFTB 2DM3A 2H9GB 5TGBB 5IMOA 2HT2C 1GXEA 1LP9A 4X6CB 5I9QC 3TWCL 2R9HD 1EVUA 3LV3B 3KLDA 5F1IA 3NA4A 1UB5A 4NHCH 2FWOA 4YHKL 4NQDE 4N0CD 4GXVH 2WUCL 4J6RL 4HK0B 1RHFA 1ERNA 5EORL 5GSVA 3NFSL 5D5MB 2R8SH 4PJ9B 2J8UB 4HUXB 4BZ2L 4KMTH 4M00A 5AZ2H 4DOHB 3EDKA 4TULL 5IJVB 5I8OH 3GBML 3SY0B 2GUOA 5EU6E 2FEEI 4AT6B 2R69H 1PLGH 1X44A 3KYNB 3OAZK 2P4AB 3BDYH 2OSLA 1AIFA 2VLKB 3LOWA 3MCKA 5C2BH 1T0MB 4JR9L 4PJ5D 5D7LB 5DMYA 4LDEB 5TF1H 1RZ8A 1CLCA 2HLFD 1CFSA 3OKLB 3QUKB 4LLUA 2GCYA 1INEH 4M7KL 3SDAB 5JA9A 1JGEA 3VXSB 4U1MB 1MI5B 3VFGL 4P2QE 3OKEB 3HC4H 1DLFL 1BFOB 4YGAB 5FA3A 4JPWL 4X9FA 4ZFZA