3GI9H

Crystal structure of apct transporter bound to 7f11 monoclonal fab fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
217
Chain Sequence
QVQLLQPGAELVKPGASVKLSCKASGYTFTSYWMYWVKQRPGQGLEWIGEIDPSDSYTNYNQNFKGKATLTVDKSSSTAFMQLSSLTSQDSAVYFCARSPHYYGTTYNYPMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords 7F11 Anti-ApcT Monoclonal Fab Light Chain
publication title Structure and mechanism of a na+-independent amino Acid transporter.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2009-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gi9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gi9H02
4NSKB 4PJDF 3CNKA 4X7FC 4LKXB 2OYPA 2XTJB 2DAVA 3MREB 1N6QL 1II4E 1C16A 5FCUL 1UA6L 4JM4H 4LSRL 4ODHH 3QR2A 2YUWA 4F80A 4OCWH 3LEVH 3WHXB 4PJDE 3WFCH 3FAXA 1CIDA 3SEPA 1BP3B 4TOYL 1XZ0B 4NUGH 4Y1AB 1HSAB 3TT1H 3WIHL 5GIRB 1ZS8B 5A43C 3D3VA 3C60C 4I13B 4EQ3A 3H3KA 4KTYA 1AQKL 1OAYL 3VI3F 1FNAA 1U93B 4J23A 4O9HL 4PG9A 5CZVL 3E6FB 4PJFB 1I1AA 1P4IH 5D93C 4YHPA 4JCMA 1KB9J 1KELL 1XR8B 1YPZF 2CMRH 3K2UL 1MI5E 2DRUA 4PB0L 5J06A 3TV3H 3KPMA 1H15A 1UM5L 1CLYH 4M7LL 3L3DB 2AAVA 2F53B 4P49A 3DJ9A 5DJYA 2IALB 3BZDA 4HKXA 4UB0H 3GO1L 2V2TA 3B9KD 5E94B 4XNXL 2WANA 2QV2A 4LOUC 1KIRB 4PRDA 2YPLB 4HPOL 2ZPKL 4K07A 1B6UA 5EO1A 3EO0B 1YPZE 3QULB 2XN9B 3FL7A 4GFTB 4ZQKB 3MFFB 5C0BD 2B4CH 1A7OL 1T83C 4XNQA 5CP7B 3MV8D 1TPXB 4N0YL 2B5IC 3ARFA 2R1WB 4HCRA 4OIIH 5GS0D 3OSKA 2F8OA 3BISA 1MWAL 2PXYB 2CRYA 4PRHA 1KB5A 2Z8RA 3QAZB 2ED7A 1SJXA 3IFPB 4CW1A 2BCKA 1SJHB 5CSZA 1ZLWK 2EDXA 4HT1H 2X4UA 2C1PB 3O6ML 1T0NA 1BOGA 1MLBB 4F7MB 4KK6D 4ZO7A 4KY1L 3NA4A 1RIVH 5J9PB 3QCUL 1FFPA 2VC2H 5E2UL 1TZGH 4Z95L 2APVA 1HHGB 4KRMB 3VFTA 1OL0A 1DBMH 1HH9A 2GHWB 3WEXA 3I6KA 3G5ZA 4Z7WB 2OL3B 3WD5H 1S9YA 2D7QA 3S5LA 2HJKA 3MJ9L 1MQ8A 4HC1A 1QQDA 4YO0A 1QPPA 1F3DH 1IM9B 1JUFA 1NMAL 2CLRA 2X9XA 3IXTB 1EFXB 5EZLA 3P4OA 1CD1B 4JFOA 4PRNA 5IVNA 4P3CL 4M5YL 4F7EB 2NXYB 1U3JA 4Q2ZB 1JP5A 4GW4A 2P5EE 3OJMB 1SVCP 2FRGP 1RUML 2FX9L 3L3KB 4Y4HA 2AABH 3MXWL 3HZYB 1YMMA 3KPSA 3L95B 2Z31A 4H20H 1QFOA 2KZWA 3ARGB 3ZL4L 3I6LE 1MCIA 4LP5A 4PV9B 4HZLA 3S3JA 3HFML 5FF6A 3MRKB 1FQ9C 3QXTA 3IFLL 1LEGB 3KPNB 4QXWA 2C3VB 2AJZA 1HI6A 1CR9H 4WW2B 2X40A 2E8ZA 3QJHA 1N59B 4BQ9A 4WHYG 4QHUB 4TUKL 5BV7H 3FFCD 3HS0B 1ETZB 5HI3C 3HCVA 5I73C 5FYKH 1L7TH 1AFVH 1J1PH 1U6AL 2A6DB 4PRHE 1S7XB 1BVLA 2DQCH 3ARBC 1OF2A 1A9BB 1T21A 3DVNA 3MBEB 3BUTA 4RGOH 2CIKA 3QXDB 2DM7A 4AG4L 4ODTL 1NBVH 1EJ6A 3LS5L 4G6FB 5E4IA 4OGXH 3OKNB 3G08B 4JVWA 3TVMC 3B3IB 3MRLA 3VJ6A 1RSFA 3S34H 3O3DB 5DJCB 1QRNA 1UJ3B 3ORJA 5F3HB 2ZCLH 2HKHL 3H7BB 3IJHA 3DX8A 2XKNA 4PLNC 3SKNA 2J8HA 1UVQB 4PY8I 4GLRH 5FYJD 1Z6JT 3AY4A 1FGNH 3GJFK 4QHMB 4OCXH 1IGJA 3GJFB 4MB5A 5F71A 1WT5C 4Y16C 3AMLA 3BW9B 4MAYC 5F9JB 4I8DA 4L4VD 4DKEH 2JIXA 4ZFGL 5IESL 1F00I 2ERJC 1JPSH 1KJ3H 5CZXC 4TVPD 3L7FB 1OP3K 3AB0B 1I9RL 4NZRH 5JMRA 2XKUA 2FJGA 1CFNA 5ESQA 3ALPA 3GMPB 3K3QA 1U8MA 5HVFB 1BZ9B 4G8GB 4H1LA 1FNGB 5D70H 1C12A 3MLVH 1T1WA 5A3ID 4X80L 3S97C 1YMME 2CK0H 4PY7A 2F54D 3KPSE 5SWSD 1FL5B 5ICZA 5ITFB 3KPLB 2D31A 3TO2A 5J1AB 1E4WL 1G9MH 2KL6A 1HZHL 4JFXB 4EJ1C 1IKNC 3FB6A 3L3GB 4WV1C 3BFOA 5D1QC 4YXHL 2BOCA 4JANA 4RGMB 2DLTA 3VFPA 4Y7MA 2VLJD 2VYRE 1T1ZB 4FQXD 4Z0XB 1KV3A 1EXUA 2ATKA 1K3ZA 4F57L 5SX5K 2PUQT 5KSAD 5GJSL 4CMHC 4JKMA 3MXVH 3G5XA 3RDTC 2G5RA 4WWKA 2AJUH 3MRIB 4D0CB 4MJ5B 4EDXA 1C5CL 1YEFH 5CUSH 1MRFH 4YDIL 1MREL 2CK2A 5IMOA 1RUPH 5ELIA 1U92A 2LFGA 2V6HA 4LU5L 4ZXBC 5SWZA 3GMMB 1QR4A 4M6ML 4KJQC 4XX1E 4RISL 1MAKA 4GAYB 3ZE1F 2G75B 1JBJA 4JFFD 2EEAA 4KUZL 1X4XA 3M1BA 4KUCF 3N1MC 5C0BB 4F7CA 3EYSH 5DJAB 3DROB 3SOBL 1SYVB 1FP5A 2F19L 4HKBB 4MJIA 1TETL 4LKCB 4X0KB 3MV8B 4MNHA 4FXKA 5FUCE 3WE6A 3GSRB 3S88L 3ZE1E 2GT9B 3E3QE 3MV9E 1CXEA 1FFQA 4JM2D 2NY0C 3BXNA 3QIWD 3W9EB 3QWQB 3GMOB 3JWOL 3UAJD 2HJFB 4M61A 2FECL 4CVUA 5J1TC 2F5BH 3VE0A 1WWBX 4LMQE 4X6BB 1U8JA 3OB8A 5EUOB 1NGQL 1S9XB 5CIPB 2I07B 1CTNA 5DHVH 1KT2B 4P4KD 3RPIA 3OX8B 4JHZA 4XP9H 1C5BH 1OT1A 5F9OH 5CEYB 1FAKT 4C57C 2FSEB 2F15A 5EZIH 1ZOXA 3S37X 3N1QC 1ZT4A 1PKQA 1ADQA 4M7ZC 1VFOA 2PETA 4YHIB 1H3TA 1MHPL 1SJEB 5B22A 4DW2L 4UOW0 1G7MB 4RCAA 2Y1VA 2X9YA 4LLQB 4WFED 3GSNL 1N64H 3KYMA 5BJTA 3UTSA 1ZHKB 1UB6B 5K93A 1G7HA 1MCHA 4NRZB 5GHWL 1F4XL 3BZFB 4JB9H 1UWGL 4P46C 4HWBL 4TUJA 1RMFL 1VACA 2CIIA 2H8PB 2MNUA 5SWZE 2AJXL 4QF1A 4MDIB 2X4OA 5KSVA 1WBYB 5D2LB 3R1GH 2X1OA 1KTLB 1INDH 3IKCA 2XG4A 4JN2B 3MLWH 4YPJA 1RV6X 3AS3A 3GSWA 3T0EA 3T0DA 2CJUH 3ZHKA 4G6KL 2R2EA 3EJZD 3VGAC 4MJIE 3NH7H 3FFCB 3RUGB 1NAKL 3HPJA 3LN5A 4ZDHA 2DWEB 2BHZA 2XA3A 1NKOA 2XNAA 4P9HH 1A1MB 1T20B 1RUAH 3O81A 1T7WA 2BVQB 2DQEL 2MJWA 4Q58C 5A1AA 1WCBB 4GBXC 3UO1H 4BSJA 3P73B 3ET9F 4IRSC 1A6ZA 3UROR 4MD4B 5LCVH 2XY2A 3LQAL 4MA8H 3BPLB 5T5FL 1JGVL 1YA5A 4P2OA 5FUZL 5JHDD 3A6OA 2ITDA 4LRIA 5D7IA 4KI5D 3KXFA 5JIKA 5AAMA 1R5VB 3LKPB 4L4TD 4HUMB 3Q6GH 2NY7L 4KRPC 2B0SL 2H45A 4L4VB 2DOCA 5LGJA 4A2LA 5FA3A 1WC7B 4A6YA 1WLHA 3MMEA 5LQBL 3KWWA 1PKQE 5ESVB 1PEWA 5MI0C 2FX8H 1FZMB 4LEXL 3K4AA 1YEHL 3WDJA 3P0VH 4HHAB 4JHAL 5DRWA 1QHPA 5BXFB 3DIFA 3UTSE 1F11A 4UBDD 2Y4SA 4AQOA 2ADFL 1PW3A 1YUHB 3SPVB 3BE1L 3QCTL 2J6EH 3F12A 3O3AA 4HFWB 3D2UB 5CJXA 4NJAH 2CPCA 5SWSB 2F54B 2WWKO 3VXQA 1FO0A 5JW4M 5DC9B 5ID1B 1I9JH 3QUZC 3MLZL 4XMPH 4KDWA 4X5WB 1M7IB 4NT6B 1G1YA 3LD8C 1QKZH 4RBPK 3DGCR 3L3IB 4LVNC 1YDPA 3T0EE 5JZ7C 2R8SL 3L1OH 5SV3A 1NMBL 1SBSH 3TESA 3MRDA 1FFNB 1L9NA 3CH1A 3FFDA 3BP7B 4JAMA 1E28A 5I74C 3TBYA 2P46B 5KSAB 2IF7A 1VFBA 2LTQB 3UC0H 1MJ8L 1VFAA 3C87A 5T5NG 4KZDH 4OZGE 3RIFK 4MS8D 1KLGA 3MLRL 4MA7L 2I9TA 3IU3B 5D7IF 4XXDB 3O6LH 2D3VA 4FQCH 4JQIH 2EE2A 1I85A 4QRQB 2NPLX 1FRGH 3BD4A 1V7NH 1EO8H 5LG1A 3CVHH 4JDVA 1DBJL 2P5WB 4PLJC 5FYJU 1QLRA 5GSRA 4KK8D 2FIKB 2OZ4A 4LSPH 2V7HA 4U1KA 4AZ8A 4QRTB 5D7IE 3NCYP 2ICEA 5DQDL 1NLBL 4JFFB 4MA3A 3RJDA 4PS4L 2DYPD 1I1AC 4KJWD 5F7NC 4PJ5D 2YRPA 2FB4L 4BUGA 4M1CD 4YHZL 5I1KH 1EV2E 4LVOB 4HFUL 4ZO6A 1WISA 1FPTH 2B1HL 2WLYA 1IJ9A 4DK3A 1WBXB 3QDHA 4J6RL 5B39G 4KGJA 3HC4L 2NW2A 1I1RA 4ONGL 3SCMD 4JM2B 1CFQB 3QIWB 4KAQL 1X5FA 3WKML 4CU6A 4YK4C 1FORL 1B88A 4NHUB 3RA7H 3DUSB 4LSTL 3GUTB 1RU9L 3U79A 5IGXL 5TPWH 1JGUL 3P4MB 1ZA3A 3ILQC 4P4KB 1TVDA 3DBXA 3MUHL 2BVTA 1I7TA 3I3DA 1TCRB 4NN7B 5C0GA 4O58L 4Y5VA 4BJLA 3ULUH 2PO6A 3MRQA 4JHWH 1JI2A 5DJ8B 2B4CC 3LSOA 4XCCL 5FO9B 1WTGT 2KDGA 5CEZH 3HN3A 3D6GA 4PGDB 1J1XH 4O2CB 2A9NL 5DD3H 3CPLB 3HAEH 3SQOL 2AJ3A 2DDQL 4G8EB 3V5KA 3IDGA 3OKKA 1I8MB 5DEGB 3O0RL 4D3CL 1U58B 5I1AB 4XP4H 2NMSA 5DK3A 1F6AB 3CFDA 3KDMB 3STZA 1QFWL 4XVJL 4OZ4A 3T0VA 4U6HB 4F37K 2VN7A 1OGAD 2PW1B 2R69L 2W0PA 3VWJB 5HGAB 1NGPL 4S1DC 4N8CH 1N2RA 1ZSDA 4NQCD 5IKCB 1DR9A 5CZKA 4PRAB 1YYMH 4CNIB 4N0RA 1X7QB 5ANME 5DYOB 4DKFL 3TCLA 3SDYL 5I0ZA 5IJKA 3CSGA 1FE8H 2YMXL 2VXQL 3FTGA 3UZVB 5I1HH 3LMJH 1QR1A 3RWHB 4JKKA 5ILTL 5FAAA 4FFVC 2L7UA 2MCG1 5I71C 3JVGA 4FZEH 2DLEA 2ESVD 4LSVL 5IB2B 3QEQE 3WNPA 1UKSA 3DHJA 4OGYL 3LB6D 2HLFC 1QFUL 5ISZD 3PWLA 3BT2L 1AGBB 2Z31C 2VZTA 1KXTB 3B9AA 3B8YA 3FN9A 4CMMA 4MAUH 5EUKA 3MNZA 3QDGE 3CX5K 1U8HA 4NN5B 3W9DA 4LCCA 1W72L 4OLZH 3WS3A 2BP3A 2H41A 4MB3A 4JG0H 1LO2H 4BZ1H 3AU1B 4NKMA 1KN4L 3U9UB 2IH1A 1D6EB 5IUSA 2Z8SA 2EIZB 5JHDB 1DCLA 1H3GA 3O2DL 1WSST 1OTSC 5JOPD 4MXVE 5HSFA 3VD4A 5F89B 2GEEA 2RGSA 3MLPA 1KENL 3RWGA 2WWMC 5EOCJ 2NY3D 3MJ8A 2ZUYA 1A47A 3TWCL 3O9WB 4RFNC 2WBKA 2J5LC 1MUJA 1T04B 3ZKXB 1WZ1L 3GB7A 4XNYL 5A2JH 3BPCA 3TNNB 3AY4C 1CE6A 3KYOB 4AEEA 4HLJA 4YBLC 2IPUK 4HJ0C 2VJXA 3PJSA 4WCYH 1G6RB 2R0ZL 2H2SC 1V3MA 3QO0A 5HHNB 3CDCA 3T08A 4R4FH 3QFDB 1QLEH 4F33B 3NAAH 1IC7L 2X4RB 1MRDH 1VGKA 1IAMA 3NCFB 2OX5A 4Y4KA 3FQUA 1RZKL 1H8OA 2OP4L 3BEWA 3P0GB 3NVQA 2UUDH 4LVHC 4X4YB 3QB7C 3GHEL 3BRGC 2OSLA 3EOAB 4FQLL 1HKFA 4XI5C 3U36A 4NFCA 1AQDB 1RZ8B 1HEZB 1WWCA 2WBJD 4CN6A 5T3ZE 3SE8H 1CLCA 5HJ3B 2IANA 2AI0L 5L8LB 1RZIB 3MSPA 1BBDH 1RUQH 2BFVH 1OD7A 2ARJQ 5I19L 1SEBA 1UWXH 4IOIB 3CK0H 1A1OA 1XF4A 2H9GB 5IOPB 3WV0A 2E7LA 5L0QC 2MFNA 2PR4H 2YA0A 2FX7L 43C9B 4EVNB 2YBRA 2EDTA 4AK1A 5E2WL 4OKVB 2KQNA 4XP6L 5DR5H 4UUJB 5IW3A 1F90H 3EOTH 2QSTA 3WSQL 4V1DD 1Q9LB 2VIRA 2EE9A 2AGJL 2B8OT 2G5BB 3OKOA 3MGOA 1ONQA 1W72B 5IB3A 4R97C 2DYPB 2EDBA 4PJ5B 4LF3B 5IB4A 5JOFA 2EXWC 1QLFA 2X44D 4YBQC 3TNMB 3EO1A 3O11A 3LEXA 2DTSA 4XCYB 2WBWB 4JPWL 1A6WL 3MOQA 1N0LA 1TNMA 4KPHL 4YH6A 1T89A 4U1JB 5FYLE 3H7LA 1I4FA 4K2UH 3O4OC 4HQQH 1AP2A 4L8SA 3SCMB 3SGDH 3TN0D 4RDQG 3ZE2F 4ZAKD 4IIQB 1LE9B 3ISWA 3P0YL 3DSFH 4MD0B 4ZUTB 2VISB 2ED9A 1Q0XL 3VA6A 5I1EL 2ZNWA 2Q7YA 2IPKB 3BMVA 4N8VG 5EPMB 43CAA 2OJEA 1OCWL 2ORBL 4F7PA 1CICA 3BO8B 2GCYA 3ZE2E 5C09D 3DV4B 4WEUD 2R0LL 3H8NA 3PV6A 2FLBT 5DA0B 3UJIH 4U6XB 3D85A 5AWNL 1NEZB 4HG4K 5IBLD 2A6KB 4LFHG 4TPRL 3HI6L 2IANE 3DWTA 5F7DB 1ACYH 2A6JA 3DYOA 3VXNA 4ZODA 3GKZA 1OM3L 3QA3A 4U1NA 1LDSA 1Q9OB 1AGDA 4HXAL 4XPHH 3KS0J 3EIFA 3F7VA 4ONHA 5F6IC 1CD0A 1F45A 4PJ8A 3B9VA 3K8KA 5E08H 4M4PA 2ZWLT 1JWUA 4G80B 3FO9A 2AQ3A 1YY8B 2W91A 3F5WA 1MFCL 3EBAA 4CADB 1UM4H 4P5KB 1IAKA 4QKXB 3H42H 3STBA 5E9DA 1RJYB 2EYTB 5KOVC 1HHKA 1TVBA 5I1IH 4H26B 1O5DT 15C8H 3MRNA 4YBHA 5I66A 3HRZA 4OV5B 3PIQA 4X9IA 1OAXL 4GG8B 4TRPH 1QFWM 2ESVB 2Q8AL 4OFYD 1NCBH 2CGRH 3FQTA 1HSBB 5ISZB 5TDPB 1I3RB 3DUUB 3TYFB 1I75A 3IXAB 1I7ZB 1RIUL 5I1GH 5B8CA 1FV1B 3H6JA 4AMKH 1VPOL 1MJUL 3OHXA 3PP4H 3V6OC 1UZ8A 3FRUA 1QHOA 1A0QL 1I7UB 3RWIB 4NNXB 1DQMH 2W92A 2DI8A 4BYHA 4NZTH 4MZ2A 4Y5YC 2X89A 5LBSH 4MQ7B 4I4WB 4LPVA 1JGLH 5ERWA 1EIBA 3QQ4B 2ZUSA 4GAFB 4ZTOL 1BQHG 1KSRA 1KN2H 4JKPH 4J1UA 4OF7A 3LPGA 2EKJA 2NY3B 4WI9A 2H1PH 1I9IL 4P59H 4AIXA 1A6VL 1GXEA 2V17L 3N85L 4PRPD 2VLKD 5D7SL 1P69B 4PJ9C 5DS8B 1CZ8L 3NIGF 5JO5B 4P2OC 2JJUA 5GRVL 1ORQB 2WUCH 3MOBH 1NGXA 2R0KL 4O51B 4P9HC 2R0WH 4ODSL 4CRPA 5HPMB 1A4JB 1UQSB 1FIGH 3QWOB 5DO2D 2VXVH 3WFZA 1LO0H 4WU7B 1R3HA 2ZSVB 1JF5A 2YZ8A 1GZQA 1KJ2A 2ICES 2G2RA 3RY6A 4Y4FA 5DF0A 5E9DE 4ODUA 3ARED 3NIGE 5EO9A 2X1QA 2MCPL 1IFHL 2BVOA 5GS1C 1FGVL 3CVIH 5D5MA 2B1AL 4OLVH 4JVUA 1BZ7B 4RFEA 3BPOB 1AY1L 1BX2A 1TJHH 3VFMB 3ZKND 3BKYH 1FN4A 3DYPA 2NLJA 1I1FB 4F7TA 1WICA 2WBJB 3IJSB 3PF2A 4K7PX 5CJXC 1IE5A 5DJXA 3VU2A 1GC1L 4DZ8B 4OF5A 2Q8BL 3U4EA 2HJLA 1NAMB 2GFBB 5JLZA 5JPMB 3VD3A 4YXKH 1DVFA 5CINH 3PWUA 1P7HL 3CFJA 3WN5A 4F8TA 2DBJA 4BA8A 2ZG2A 1TXKA 2AJSH 4R96B 3VH8A 4FQ1L 1R3LA 1W0WB 3W82A 4JFDD 1B4JL 3GMRA 2Z92B 2NY5H 3DXAA 1BQSA 3JV6B 1J0ZA 1FVCA 4V1DB 1HCVA 3PUCA 3G5YB 4XMKL 1ZHNB 1KBGH 4W4NA 4FZ8L 3W5NA 1T66C 3UBXG 4YHYC 3C60D 2I60L 1KPUB 1I85C 4Y5XC 4Z7UA 5D6CA 3TIDB 3VRJB 1JZ7A 3V4UH 2VDPL 3O4LD 2ZCHH 2P45B 3IVKB 4LPYA 2FCBA 1FLRL 5F7LB 4JKLA 1JHLH 1S7VA 4AENB 2ADGB 4KHTH 5D5MF 5KVEL 3WHE1 3TN0B 4P2RD 5MEND 1DFBH 1YEGL 4L9LC 4ELKA 2HT2C 1DSFL 4ZAKB 3OJDB 3C5ZA 1WEJH 4LHUG 4BH7A 2EDHA 3MR9B 5AD0B 1P1ZA 1R3KA 4Y8DC 5KW9L 4QO1A 1WTLA 5JXEA 2Y36H 5DJ6B 4Q6IB 5AYQA 1C5DB 5GRZA 5JNYA 5BOPA 2AJVH 2IC2A 1DUZB 2MWCA 2XRAH 4XB7A 3ZTNH 5D5ME 2WMPA 4YDKL 3LH2H 2QQNL 3LN4A 1FSKB 3T3PE 3O41B 4DUWA 3TLRA 1CQYA 2DBLL 4KZEL 2OL3H 3ULVE 1DBBL 3X13A 3VFNB 2CUIA 3RHWK 5IBTL 4JFED 4C4KT 1GCFA 2CKBL 3C8DA 4HBQA 5FCUH 2NW3A 3RZCA 2VLRD 2HVJB 3GK8H 2JB6A 4OIAA 4XPGH 5SX4I 1FVDA 3WFBL 3OKMA 1EZVY 3L5HA 4XHQA 4LBEA 5JW4R 5E8PB 1EVUA 5IEHB 4H0IA 1CTOA 1G7PA 1I7RA 4Z7UF 1CD8A 2P49B 3MA7B 1KEML 2C7UA 4L8BB 3SKMB 3VFSA 4TOYH 1WBZA 5FIEA 3S35X 3OAYH 4Z76A 4M5ZH 3DXAE 4YHKL 4G43B 5I17A 4X5LA 5CMAA 4KKBC 2W38A 3ZTJH 1DL7H 5JOEA 4HWEL 1NLDL 1WVZA 1B0WA 3DYMA 4IOFC 4OB5H 5GGVY 3CH8A 3S8WA 3W39A 4Z7UE 4M8VA 5MEQA 3ULUC 3TT3H 1CK0H 1REIA 3GSVA 2X4PA 1J87A 4R26H 3GO1H 4WUKH 1RUKL 4Z6AT 1FH5L 1BD2A 4KHXL 4O2FA 4ZUUA 3VXUD 4XNXH 1X4ZA 3REVA 3QWRD 3JTSA 3MTRA 3QCVH 1JV5B 1G1CA 1R5WA 4IDJH 4K23H 5FO7A 1ES0A 5I8EA 4NQDA 4GO6B 3HE7A 2AEIT 3BGFB 3QH3A 4GQ9H 1T1XA 2K7PA 1B0GB 4DCQA 3OR6B 3CUPB 3DMMA 1YNTA 1RK0A 3JVGC 2DQGH 1KF9B 2BC4B 5GGSB 4D9LH 4PTTA 3QQ9C 1X44A 4RAUA 3GJFH 4OQTL 5HI3D 4LCCC 3V7AG 3RNQA 3AXLA 4GAGL 1QPXA 1KGCD 4PJIA 4JRXA 3ARBD 3QUXB 3UJJH 4GKNA 3PE9A 3SDCC 4RQQB 5EH1A 1ERNA 1OP3H 5L88H 2H3NB 3OJVC 3GGWA 4UT7H 2XXMB 2VLKB 3OXSB 4PRPB 5DK0B 3TVMD 3UZQA 4B7IA 4OCSH 5KVDL 2AK1L 3MV11 4RNRB 5F7YC 2VWEC 5DLMH 4ZNCD 4EXKA 4HLZH 2A1WL 2C3HA 3AS0A 3F7YB 1MH5A 1XGRA 1RJCA 1HWHB 3MJ9H 4M48L 4W6XB 3DRTA 4ZD3L 4A2MA 4NN6C 4Y16D 4MAYD 2RAMA 5CJOL 3EFDL 3AREB 2X9WA 2JJTC 4GKSA 3O45B 2NTSP 5CZXD 1D6VL 1K5NB 1OPGH 3ROOA 1KCUL 3RX5A 1YECL 3WO4B 4P3CH 1HQRB 5HGBB 4NM4L 2R1XA 2AEQH 1MHEA 1XH3A 3HR5A 3MRJA 3QG7L 2ZOLA 4NO3B 1HIML 1QBLL 3MXWH 3V5HA 5JW3H 2Q86A 5TE7L 5IFAL 5GZNC 2BSRA 2EE6A 3O8XC 2MHAA 1QD0A 5SX5H 1BD2E 3QEGH 3LKNA 1QACA 2HT3C 5TE6H 2HP4A 1R5IB 3CFKA 4LMQI 3I2CH 2WQRA 4TSAH 4HUXA 4NQDE 3HI1A 4PJIF 4J3WA 3PQYE 5DVOA 1IGFL 4HH9A 1KJVB 5F1NB 3T77A 5C0JA 1LP9A 1EGJL 4TULH 5K9JL 4JFDB 4KVNH 1JFQL 5EOQL 1R3IH 1HYSC 1LO3L 5GS3A 1OW0A 1I8LC 5EIIA 2DI7A 1F13A 4JN1L 1L6ZA 4NOBA 4PJ7A 3C60B 4AG4H 2DWDA 4MXWL 4PJIE 1SMAA 3P11H 1AO7E 4JRXE 3FT2A 5ALCH 3CFEA 4XNUL 3S4SB 4UTAL 3QG6A 2HKHH 4WHDA 3O4LB 2R2BA 5D93B 4H8WL 1R24B 1KIQB 1MFAH 2IPTH 3G04A 4PG2C 1JZ4A 5GS0H 1K4DA 3WUWB 1NPUA 2VLLA 1BFOA 4P2RB 5MENB 4ZXBD 4JFHE 1T6VN 4CGTA 3L3JB 3PGCB 4AIZA 1UXWA 4LPUA 2VAJA 5E6IC 3TBSB 4KJQD 2Y5TA 1OOAA 4P3DA 2J8OA 4QEGA 1I9RH 3KYNB 5CIPH 3HG1D 2NYYC 3EAKA 1Q0YL 3F58L 4LCYA 4QTIL 4S0TD 3T2NL 1WWAX 4TTDD 1T89C 3B5HA 4L8SC 2XG5A 2B5IB 4HJGB 4I9WE 1JNNL 1U8KA 4PD4J 5DUPL 4DGIL 1QBML 4D8PB 5FDYA 4AIOA 1LP9F 1ED3B 3MCKB 4JFEB 3TBWA 4OLUL 2NY0D 4MX7A 2VLRB 5DMJB 1E4WH 3U48A 4S11A 1MCQA 1R6VA 1TZHA 4QRPD 4Y19A 2EDWA 1N7MH 35C8L 4R7DB 3UTQA 4DN3H 4PJ7F 1CICC 4EZMA 1MCPH 1FVEB 2ZCKL 5J0BA 2BNQB 2AV7A 3NABL 4UZGA 3RI5F 4GT7A 5TE4H 1XIWA 1S7RB 5EWIH 1LP9E 3MA9H 5GGQL 4HJJL 4F57H 2FJHA 3G5VB 2PTVA 3BP4B 1NDMB 1AKJD 2E27H 4FQQA 4JY6A 2DKMA 4E42B 4M6OL 1IRAY 4PJ8C 3RPKA 5CEXB 3VWKA 3GRWA 4G9FE 5J1SC 1HINL 4X7SL 1MREH 3ECBA 4X9GA 1JPFA 3JXAA 2JELH 1L0XA 4QXTA 1UM6L 4LPCA 4LU5H 4MD5A 2A0LC 2CDGA 4PJGB 2K3TA 4YDLC 5FUOH 4UT6H 4PGZA 3Q3GB 3VXUB 2A83B 2XZQL 4YHMH 3VDAA 3KJ4B 4HH8A 4KRNA 4OFKA 3TPUB 4OFPA 4WI3A 5GGVL 4FQIL 5DTFB 3DVIA 4LGPB 5DC0A 1GVIA 5K9KA 1T5XA 2VB5A 2DLIA 2FJFA 2BNRE 1QRKA 5GZOC 3V8CA 1LWRA 4J3TA 5C7XL 4EI6B 5C0CA 2NY1D 4PRBA 5GRUL 2OLDA 4JO3L 4XBEH 3MOAL 4RMRA 5FYJH 5CKGA 1LNUA 4JY4B 4C83B 1SHMA 7FABL 3RBGA 5EOTB 5I73B 1X5HA 4NQVB 1KPRA 3CC5B 5IF0B 3ARBB 5EU5A 4TVPH 3BHBA 4OZFB 1E6JH 3BEVA 2IMNA 4GBXD 2PTTA 2WIMA 4DVRH 4PGEA 5KJRL 4OM0H 5E0QA 3TVMB 3WBDA 2HTKC 4IRSD 4Y19E 1KYOJ 2D7TH 2YRZA 4EBQL 1KG0A 3VFGH 4Z78A 5B39A 3ARXA 1UCTA 2BXZA 2Q7NA 2DIBA 4LIQL 3C9NA 5ALBL 1QNZL 2QSCL 5D1XA 4Y16B 1JF1B 2J88L 3TH2T 3C8KB 1F2XK 2NR6C 1UB5A 4BK4A 2PYFB 3MODH 1MI5D 3NCEB 2CLZA 1DLFL 3I84A 4LSQL 4RBPH 1F4XH 4LRNH 3SO5A 2BY0A 2O5XH 3KJ6L 5BO1L 5TDNB 2NZ9C 3Q1SL 2P24B 5D6DA 3GBMH 3RY6C 1MNUL 4Y4FC 1CU4H 5DZOA 4UILL 4LLDB 4RMTA 5HYEA 4M93B 1LK2A 1KTKE 2VXSH 1A7RH 3KLAB 3KPRA 3NA9L 4U7SA 1CXKA 1QUNA 5B3NA 4WI5A 3OMZA 5C0CE 2WQ8A 2VZVA 1WAAA 4WV1B 1U2CA 2K7QA 3IETA 3N9GL 2GQHA 2YKLH 5CJ8A 3LRSB 4XPBH 6CGTA 3ROLB 5EFIA 4OJFH 1FNEB 4P2CG 3LS4L 1MJJB 4CMHB 2DKSA 1IGTB 3JWDC 5I76B 1EEYB 4LSSH 3WN5C 3LQAH 5DD5H 3T0AA 5DHYB 5T5FH 1J8HA 1JGVH 3L3OB 1KPVB 3SDAB 3IF1A 4YR6B 1YNKL 5D71L 3NCCB 1JHKH 4PLJD 3QRGH 3DX9B 2NY7H 4ZXBB 4BSWA 4JJHA 3STLB 3D3VD 2YN3A 3JTTA 1H9VA 4PJCB 1W2KT 3ULVL 1X5JA 1NSNL 3ARPA 3E6HB 3X11B 3TCXA 2E8YA 4W6YB 2O5YL 3K1DA 1A6TA 2IQAB 2W60A 2LAAA 3HG1B 5IFJA 1I1AD 1U9KA 1GHFH 4NJ9H 5C0DB 2FEDC 3L9RB 4NDMA 4YFLI 1EUTA 1JPGA 3HB3C 3ULSA 2RCSL 2YEZA 4H0HB 3A6CH 4X98B 3IJYA 4BKLA 1WAAF 1T2JA 1OAUL 3S3SA 4CVWA 2NY0B 5JXEC 2PYED 5FO8A 4M3KB 3FT3A 4OD1L 5TF1L 4HS6A 3NFSH 3MLZH 4NC1E 3C5JA 4QRPB 4KKLC 1TJIH 5C0AA 3RL1A 2PXYC 2H32A 3DVFA 4X7TB 3DHMA 1NANI 2FO4B 1BFSA 1T7ZA 1OWRM 1WAAE 3BJLA 1A21A 1U8QB 1NUGA 4CJ0A 1CGUA 5BOZG 4PRHD 1MRCH 2BVUA 1AKJB 3RZCC 4XGZB 3T0XA 3WXWH 5EU7C 3MCG1 1D5ZA 4HIHB 4JQVA 5LGHH 1AGEA 2R2HB 4MSWB 5SV4A 4ONFL 4M6NL 3MLTB 4OCYL 5CLWA 4I77L 1XMWA 1A4KB 3NZ8A 1KXQE 4HXBH 4W81A 4LLMB 5DQ9A 1J8HE 4LAJH 5INCA 3X3GH 4E41A 1L4IA 2BRRL 1XGQB 4HKZB 5C6PB 5IW1B 3P40A 1MAML 5F7MC 4QXGL 2VDKH 1OAQL 3QJFB 2BVPA 4PP2B 4PJAA 5F93C 4S1DD 2VAAA 3VFRB 2IGFH 3KYKH 1CGSH 1UEYA 1DQLL 4YUEH 5J6HA 3CSYA 1J0KA 3MJ6A 5ETUB 3PL6A 4N9GB 5K9QI 3CZFB 1D5XB 4U1MB 4ZFZB 1MHCA 3TP4A 2NY1B 1Z9OA 3FT4B 1KFAL 1RVFL 2ITCA 2YD6A 4FFVD 3Q2CA 3CDGA 3HC4H 1JNHA 4KDTA 3VFUB 3QDME 4KAQH 1YMMD 3HC0A 2HLFD 3KPSD 4NKQB 4ZTPL 2X4SB 4WW2C 2Z31D 4C56A 4CN1A 3TH4T 4JM4L 4C4KO 4ODHL 4UMGA 4OCWL 1MQKH 3LEVL 1QBBA 5EZJB 4HSQA 4JDTH 4GBXB 5DA4A 1NC4B 1XCTA 3IDXH 3WFCL 1NBYB 1DANT 4IRSB 4BFBD 4IRJA 4NUGL 4OLEA 3BN3B 4PJDB 4R4BB 4ZUVA 4UIMA 5C0AE 3QI9A 4NNYA 4XBGA 4MQSB 3MBEC 4JPIA 4UIKH 3TT1L 4MGXA 2NX5A 1G6RH 3IDMB 1X4YA 1AR2A 1S7UB 1ZT1B 1DLHB 4LLVB 1OTSD 5C0IA 5LAXA 3WLBB 2L7JA 4JZNB 4O4YH 1VFMA 1P4IL 4P57A 1AGFA 2DDQH 4OQ1A 2CMRL 3OXRB 4I48A 1A7QH 2WWMD 4DVBB 4ISVA 1ZLUK 1WIUA 1N26A 3TV3L 4PJAF 4I5BB 1MI5B 5MI0B 1CLYL 2PCPB 1QRND 1QFWH 1K4CA 4XVJH 4JJ5A 4UB0L 4WO4A 3FOMB 3Q48A 5GGUA 2R69H 5HBBA 5KN5A 1B0RB 2Q3ZA 4E41E 1P2CB 3S9DB 3NFNA 2DQFA 4HJ0D 4ONOA 1J5OH 3VXMA 3U0PB 2H2SD 2JIXD 2VR4A 1YPZB 1IEAA 4PJAE 2YMXH 2VXQH 1IC5L 2B4CL 5ICYB 4LK4A 4XB8A 1VSCA 5E70A 5D7LA 2C3XA 5D96C 3TJEH 4DFIA 3NFPA 4OIIL 4ZOCA 1Q9KA 4ODWA 5DXWA 4PLKC 3LD8B 2BVYA 4HIIB 1NL0H 1HWGB 4YHLH 1VADA 3BT2H 5M95B 1A2YB 3LHPL 4XI5D 4HT1L 4KUCD 5GGRA 1W72H 3NN8A 4RDQF 4C56E 1C16B 1RIVL 2QQKH 4OM1H 1U8OA 1TZIA 2VC2L 4PRIE 1TZGL 4MB4A 4O02H 4XVTH 1DBML 5E1AA 3NOIA 1SJVA 2ZJSH 1KN4H 3BDYH 4O2EA 3WD5L 1G9NC 2EXYC 2IBGA 5DDHA 2DL2A 1L6XA 4UNTA 3HNVH 1MEXH 2I27N 2MPAH 2DQTH 3ZYZA 3D3VB 4ZS6D 4WWKD 3QUKA 4PG9B 4XCNA 5C9JA 1IM3A 5JPNA 1I1AB 4YHPB 1PG7H 2EXWD 1WZ1H 4D9QE 1KCRH 1Y6MR 4YBQD 3FB7A 3KPMB 2AABL 1H15B 2V5MA 5CEZE 3RZWA 3KPPA 3MRMA 2QEJA 4PBVC 5SWZD 5DJYB 4HKXB 1EO5A 4H20L 1A3RH 2ZSWA 3UYRH 1BQHA 3PGDA 5GRWA 2LABA 3MQIA 3PWPA 4PRDB 3HA0A 2Q6WA 3VXME 3FB5A 3HZVA 2XQYK 1FHGA 1K6QL 3O6FA 5EO1B 4YK4B 1CR9L 4LLYA 1KCVL 3U7WL 4WFFE 1RZKH 4MJ4A 4XNQB 5D7LE 4OIBA 4OD3L 1DQJA 5A2LH 2CSPA 4AT6A 3ARUA 3ARFB 5FYKL 1NBZA 1AFVL 1J1PL 2DQCL 2AI0H 4LVEA 4PRHB 1KB5B 3Q0HA 4RGOL 1ZANH 4ETQA 4CW1B 2BCKB 5CSZB 2X4UB 1NBVL 2PKDA 4OGXL 2YUZA 4K3GA 1T0NB 1BOGB 3S34L 2VN4A 3BI9X 1X5AA 2ZCLL 3QO1A 3H2WA 4ZOBA 1FFPB 3DO3A 1JVKA 2ARJA 4JG1H 3GEWB 3VFTB 1XIWC 1HH9B 5KTEH 1FGNL 3Q5OA 5JXAH 4OCXL 2GJZA 3WEXB 3BIBX 3I6KB 3G5ZB 3FQRA 4DKEL 3V5DA 2CO7B 1S9YB 3S5LB 2HJKB 5HI4C 1JPSL 1KJ3L 2XZCH 3QIUA 4YPGA 4P4RA 5BS0A 4BSVA 1QQDB 4YO0B 1WV7T 4NZRL 1JUFB 2CLRB 2V5SA 3VWKC 4GS7C 4OF8A 5EZLB 3P4OB 2W59A 4JFOB 4PRNB 4QHNA 3UTSD 5D70L 1DANU 4GW4B 3MLVL 2VNCA 1LVEA 5I71B 4Y4HB 2CK0L 1MHHA 1J12A 3HMXH 1YMMB 3EYVA 2FNBA 2C4FT 4Z5RA 1L7IH 3KPSB 5D2NA 5IHLB 5IM7A 1OSZA 5FM5M 2Z31B 1ZEAH 4NKOA 1G9ML 1CFSA 1NC2A 5I1LA 4HZLB 5FF6B 4B41A 1NCNA 3B6SA 1UC6A 1ZHBA 5EC2A 2PF6A 1I3VA 2IPUG 4R6UA 2AJZB 3ZKQD 2ICCA 2ORBH 3QJHB 3T0ED 3OB0H 2R0LH 1S7SA 3K2MC 3SBWC 3BESR 5GRJH 2WV3A 3HCVB 3MXVL 4XWGH 3NIDF 4P2QA 4TPRH 3ZDYE 2AJUL 1BVLB 1EHXA 1BREA 2W9EL 1OF2B 1T21B 3DVNB 1YEFL 2CIKB 1MRFL 5CUSL 4LCIL 5DGRA 3QFJA 3MO1A 3V8OA 5I1DA 4U31A 2YD4A 2YD5A 5C0FA 3MRLB 1RUPL 3VJ6B 3LOWA 1QRNB 2ADIA 3JUZA 4RFNB 3DX8B 2J5LB 2L0DA 2XKNB 3VD7A 3OJ2C 3SKNB 4P2OD 5EBWA 4YNYA 1G7QA 3U46A 2JJWA 3KXFD 4YBLB 1IGJB 3VGEA 1ODAA 5D1XC 1KCLA 3P3YA 4F3FA 3WKNA 2JIXB 1NAMH 1C1EH 3BVNA 3EYSL 5BS0E 4U3XA 2YD7A 4DKAA 3C6SA 1AR1C 2FJGB 1CFNB 1IAOA 1CDGA 1NCCH 5ESQB 4WTZG 1SBBA 1OAXH 2NNAA 1U8MB 1FCGA 1IC1A 2JJSA 4XP5H 3K4DA 1AD9A 3ARTA 4H1LB 4LVHB 5L2JA 4G6MH 3EKCA 1FJ1A 1C12B 3F6LA 5D6DC 1T1WB 2F5BL 3PWNA 2H6PA 4WGWB 4PJBE 5HDOA 3B2VH 1HILA 3MZTA 4PY7B 5D2NE 3F62A 5GISH 1FFRA 3H0TA 5IROA 1ADQL 3DPBA 3TO2B 2D31B 1A0QH 4M3JA 5TDOA 2XPGA 4V2BA 2FBJH 3FB6B 2HRPH 4XP9L 2BOCB 4JANB 5F9OL 3VFPB 4TN9A 4JREB 4NO5A 5EZIL 3CJJA 1EXUB 2ATKB 4G8IA 4P2QE 3PXHA 4X6FA 1MY7A 3G5XB 2COQA 4WWKB 5IVZA 1Z3GH 4WJ5A 4JGMA 1JL8A 1U2HA 1T66D 4MNGB 1N64L 2J8UE 4EDXB 2Q76A 3QFJE 2V17H 3DTXA 4R97B 3EYOB 3N85H 4NZJA 1KJMA 3B5TA 1NEZG 1WCQA 2R0KH 3GIZH 3QDAA 5IMOB 1U92B 3ARWA 3DECA 2X09A 5SWZB 3FN3A 5I16A 3O4OB 3R1GL 1Z0MA 3IB4A 1INDL 4L4JA 4PJHE 3UYOD 4ZS7H 3MLWL 3M1BB 3D25A 1CXIA 3U4BH 4RGNE 2CJUL 4F7CB 3SE3C 4GSDH 3MLYH 4WFHE 2H2PC 4KKCC 3QIWC 5JIHA 4MJIB 5IR1A 4MNHB 3WJJA 4FXKB 3WE6B 4JR9H 4XPTH 2C3WA 4P9HL 1RUAL 4RRPG 3BXNB 1SY6A 3VD9A 5BQ7A 2W1NA 4NQSA 4M61B 2A77H 3UO1L 3VE0B 1DBKH 2VL4A 2P1YA 1DN2A 2F74A 5IMLA 5F72S 4LNRA 1VERA 3QEUA 1U8JB 4MA8L 2M26A 4XH2A 2VDMH 4IJ3B 4PPTA 3RPIB 4EI5A 5KAQF 4NBYB 2V5YA 1JYVA 3QPXH 2XXCB 3Q6GL 1XGPA 2VKWA 3MJGX 1N5YL 2PO6D 1S8DA 1QA9A 5AZEH 4LHQB 2C4FU 4PJEE 1ZT4B 2FX8L 1XAUA 1W0YT 1PKQB 4JQVC 2DJSA 3RVWC 5IB1A 4L3EA 5HYFA 3BZEA 3CLEH 3PP3K 4KKBD 1IT9H 3R8QA 3P0VL 2YUVA 1QVOB 2Z8WC 3UP1A 3VWJC 4IOFD 2VDPH 2V2WA 1I1CA 5EBMA 2D0GA 3KYMB 5BJTB 3UTSB 1CN4A 1G7HB 3ULUD 2J6EL 3K4ZA 1Z0NA 2VDQH 5DMGC 3TBTA 4TUJB 1B9ZA 1VACB 2CIIB 2K1MA 4QF1B 1JE6A 3I85A 1I9JL 3V7AE 2X4OB 1MAJA 5KSVB 4XMPL 1BJ8A 3TM6A 4XTRC 5BVPH 4UV4H 2O61A 1KTDB 2HTLD 1QKZL 4NGHH 4DN4H 5KSBA 1X5XA 3OKLA 2LU3A 3L1OL 1SBSL 3OAUH 3GSWB 3RL2A 3T0EB 3DO7A 3UTPE 2XTJE 4JPKH 2C1PA 3QXVA 5DMIH 1HDMA 2CXKA 2R2EB 5ID0A 4NN5C 4ZFOL 1SEQH 1Q1JH 5ADPH 5T3ZD 3HPJB 3UC0L 4Y5YB 3LN5B 1MF2H 5I9QC 4ZDHB 4KZDL 3QQ9D 5FGBA 3WS6A 1TCMA 4WUUA 1HHGA 1NUNB 2XNAB 4FQCL 4JQIL 5E4EC 1FRGL 1NGYA 5D7JA 1EO8L 4NKIH 3CVHL 1HHIA 2F5AH 2E3VA 1A6ZB 5HYJA 3SDCD 5JHLH 3QI9C 3GBLA 4G7VH 4LSPL 2X7LA 3T04D 3U7YH 1IM9A 1VENA 1ORSA 4P2OB 5E00A 4KMTH 2D9CA 2ITDB 5D7IB 3KXFB 1HE7A 3O9WC 4KKNA 3G9VA 4KGLA 5CP3A 1NGWA 5HHOA 5LGJB 1NLDH 1MFNA 5FA3B 4A6YB 3ZKXC 3MMEB 3KWWB 2F53E 2ADJA 4FQ2H 3WIHA 4L3EE 3HZYA 2CRZA 5I1KL 4BM7A 4BH8A 5E03A 4K94C 3M45A 4QOKD 5DRWB 3ARGA 4WO4C 1FPTL 5GS1B 3U6RA 4JRYA 5IW6A 3DIFB 1F11B 5HGGS 1YEKH 5KSBF 3I9GH 3BWAB 3PHOA 1NFIA 1N0XH 4F15B 2Z4QA 3F12B 4NRXB 3O3AB 3O8XD 2VSDA 2X4TA 3VXQB 1FO0B 3U2SA 5TPWL 3CU7A 2BJML 4C59B 2ZNXA 2HT3D 5DK2A 4OI9A 1DEEA 4X9HA 1IQDA 2JB5H 1YDPB 3GHBL 3S98A 2P7TA 3ULUL 3MRDB 3DOSA 3CH1B 2BOBA 3FFDB 1T1YA 4YHOH 4JAMB 1V3KA 3O3DA 3F7PC 5KOMC 1T80A 1UWEH 4GOSA 2IAND 3TBYB 1J1XL 4LLUA 1LQSR 5DD3L 4WNQA 3H7BA 3VGDA 1HYSD 2VQ1A 1VFAB 4WUUE 3RY5A 1KLGB 2I9TB 3FCTA 1RIHH 3HHRB 3LQZB 1MWAA 4HUWA 4YHYB 4N8PA 2DLHA 4ZPVA 4Z7WE 5CHNA 4OBSA 5CILH 2AK1H 4JDVB 5HYJE 2B7DT 4XCFH 3BGAA 1VESA 1QLRB 5GSRB 4N8CL 4JGUA 2V7HB 4U1KB 1YYML 3SQBA 4FMFA 1DBAH 4KJWC 3EFFA 3FN0H 3WXVL 2OMBA 4LLAA 4ZOEA 1FE8L 4P9MH 2FATH 3RY4A 3GMPA 4PJXA 2ICEB 4CUCA 4OCMC 4M1CC 4QRRA 3LMJL 4MA3B 1QG3A 4QHKJ 4N0FA 5E6ID 5HHOE 3MV7A 3P9MA 1E4KA 2BY1A 3GNMH 4XZUA 5GGTH 4GLRI 1XF3A 4FZEL 2NYYD 1G7IA 4IIQC 4GW5A 4JRYE 5E2JA 3ES6A 4OF6A 4POUB 2NW2B 4YLQT 3T4AA 3MRFA 4OLZL 4OGAC 1KLUA 4URTB 1OT2A 3FMGH 5M7QA 4Z0XA 4ENEC 4DQOH 3SE4C 4JG0L 4BZ1L 5IG7A 2R9HC 3OGCA 32C2A 8FABA 1ZA3B 3QZWG 2YR3A 5BW7A 1CICD 2V7NA 3DBXB 1RZGA 1ZGLP 5K33A 1I7TB 2GAZA 2Z9TA 3ZYOA 5C0GB 4Y5VB 3D85D 5MHSE 2PO6B 3MRQB 4CN4A 1HYRC 2Y72A 3LSOB 5I18H 5JR1H 4ERSH 2FEEL 3X3FH 2AJ3B 3B9KA 2EYSA 5IHZA 4PJXF 1FFOB 3V5KB 1NJ9A 4PJ8D 3OKKB 2N56A 3VG9C 2QR0A 3CFDB 3OAZK 1JHTA 2HFTA 2ZUWA 3QUMA 3STZB 4OZ4B 3I02A 4R4FL 2A0LD 1H3WM 4NBXB 1QLEL 2HWZL 3QIUC 1N2RB 4QYOA 1ZSDB 1MRDL 5E9DD 3TCLB 4PJXE 4FTVA 1Z2KA 4BFIA 4QRRE 3TA3A 4OZFH 3FTGB 1QR1B 3LB6C 3VGHA 2JKXA 2BSED 5DZNA 1ZLSL 1E4JA 2Q3AA 5AUMA 3SE8L 1S5IH 3PNWA 2WNGA 2YS4A 5LXGL 2AVGA 1OAZH 1BBDL 1BVKA 1RUQL 2BFVL 3PWLB 3ZHLA 5HYSA 5CGMA 3GMQA 4JY5H 4CMMB 5EUKB 3CK0L 1YN6B 3MNZB 2I5YH 1U8HB 1FNLA 1MVUA 4E9LA 2WSKA 4LCCB 1J1OL 4U3CA 5JDSA 1BWMA 1KNOA 2OTUA 3QDJA 35C8H 3MACH 1A6UH 3WS3B 3SDCB 2E9BA 4NYLA 3KAAA 4EOWH 5DR5L 3KLHC 2W07A 2NY2C 1F90L 3EOTL 4NKMB 4X4MA 4MCZA 1J8KA 2R4SL 1BQLH 1ZVYA 2NY3C 4YDJA 2NXZC 5GSVA 3BRDA 2EE3A 4UAOC 4E5XA 3WFDH 4EN3C 5J13B 2ZP0T 1I8KA 3RWGB 4QXUH 1A3QA 3MJ8B 1A9EA 1JZ8A 2NR6D 3QHZH 3GB7B 4K2UL 3VDBA 4HQQL 3BPCB 2EO1A 1CE6B 3P9WB 1BVZA 5D8JH 3EYUH 4APQA 3PJSB 4JZJA 2XZQH 5I1CH 3DSFL 1A6PA 2BHYA 5C3TA 3PDOA 5FECA 1V7ML 5DD0H 4G6JH 4Y4FD 2EDLA 1VGKB 2D03L 4FTVE 2OTPA 2DWEA 3FQUB 2JE8A 3IDIA 2WINA 2XY1A 3BEWB 3KG5A 1U8LA 1N5AA 3P77A 2ZKHH 3UJIL 1TVHA 4NO2A 2OSLB 4Q9BA 1IBGH 3U36B 3RQ3A 4M7JH 3PHSA 5I0DA 2HVKB 2C26A 1ACYL 2WIIA 2IANB 3V0WH 5IROC 4XPHL 2VDRH 5E1HB 1SEBB 5HTSA 1FZOA 2Z35A 1J0HA 1LO4H 4PGCA 1DVFD 1A1OB 3SY0A 1XF4B 5KJRH 1RULH 4F9PA 2E7MA 2YBRB 2VZOA 2VLME 4HDIA 1OLZA 5EA0H 2GIYA 1UM4L 1L0QA 4PYHA 1B3JA 3IDYC 4XVUD 3H42L 1WZMA 1UWXK 3QHFH 2QSCH 4RX4D 4DGVH 3OKOB 3MGOB 5I1IL 4FRWA 5IB3B 5F9AC 4XAKE 15C8L 1FYTA 1JGEA 5IB4B 4C54A 1DLFH 2YD1A 1QLFB 3TN0C 4TRPL 3EO1B 3O11B 1Z9LA 3NCYS 3SO3B 3EYQC 1NCBL 3WNMA 2CGRL 1P84K 5GS2D 1H3PH 4HAFA 1LE5A 1CL7I 2Z91A 2FEDD 4NOFA 3MLUH 3GSNA 5DMKA 1S7WA 5I1GL 1I4FB 3HB3D 3J8F7 5BMFH 1AP2B 4L8SB 3RAJH 4AMKL 4GUPA 3L3IA 4KJYA 8CGTA 3JV4A 3L5IA 3PP4L 3C5ZD 3N1PC 1CLOL 1ZA6A 2VLJA 4U1GC 4HWBA 4CU7A 5JXED 4FQXA 2EICA 1CXHA 3FFCE 4HK3J 2MMXA 2JJVA 1DQML 2Q7YB 4NZTL 5IBLC 4KKLD 43CAB 2OJEB 5FHBL 3WJJC 5LBSL 4F7PB 1CICB 4JGJA 2GCYB 3WDIA 2D4DA 3D85B 1V3JA 1KN2L 4JKPL 1JPTH 5DJ2A 4RAVA 2J12B 3JBG7 5IWLA 1KCKA 1G0YR 3S36H 2H1PL 2A6JB 3VXNB 3QA3B 4U1NB 4B7LA 4P59L 3RZCD 1BWWA 1AGDB 1X5LA 4QRTA 5ECJE 4P5MA 1ITBB 3FQNA 3F7VB 4ONHB 2WUCL 3MOBL 4PJ8B 5F96H 4EI5C 3O3BA 1V8HA 2O5ZH 2FD6H 1JWUB 7CGTA 1FIGL 2VXVL 1EJOH 1LO0L 3FO9B 1OQXA 4I3SH 3F5WB 4OZFG 4KI1A 4QNPF 3BH8A 1IAKB 1YEEH 3LV3A 1TTUA 1EEZA 5F8QC 3RNKA 1QYGH 1M05A 1AHWA 5E9DB 1A7PH 3DURA 3CVIL 1HHKB 4OLVL 1TVBB 2ZUUA 5EZOH 4X83A 1TJHL 4AEIH 3BKYL 3MRNB 4UOW1 4KRLB 5I66B 5IJVA 1MPAL 3HRZB 4QNPE 5SWSE 3PIQB 4NM8H 4M7KH 2RCSH 2CDFA 4ZSOA 5ESAA 3FQTB 1S5HA 3LKSA 4E0RA 4HWNA 4O5LH 5IVOA 2LVEA 4R8WH 3RIFF 5B8CB 4YXKL 3IDJA 2P42B 1BEYH 1BJ1H 5CS7A 3OHXB 3ARDA 2VLJE 4CVZA 2XZAH 4NQDD 3HE7D 1CS6A 1LO5A 1UZ8B 1QZ1A 3FRUB 3GSQA 1DTUA 2AJSL 3FO1A 3RU8H 1Z9MA 2JTDA 5T1KA 1U3ZA 4AM0A 2NY5L 1XF2A 1RZ7H 1KBGL 3QUXC 2CH8A 3MBED 3WS6C 5IMMA 5ERWB 3HTLX 5D7JC 3ESVF 4J1UB 2XIDA 4RFOH 3SJVD 4U6HA 2ARWA 4ONFH 3RVVC 2HLAA 5JORA 2ZCHL 1Z9SA 3TJHC 1TQCC 1ND0A 1JHLL 4L3CA 3WLWC 5DYOA 4KHTL 1NGXB 4ELMA 1DFBL 4JFHD 3FO0L 1WEJL 5SWQA 1R3HB 3WO4C 3MFGB 2FYYA 1GZQB 2Y36L 3CU1A 5EU3A 1KJ2B 2G2RB 5FOJA 2AJVL 5D72H 4Y4FB 4ODUB 3QYCA 2XRAL 5EO9B 5JA9A 2BVOB 2ZG3A 2XI9A 3OTTA 5D5MB 4IM8A 3LH2L 3CFBA 3EDKA 1JJUA 4RFEB 5I2IA 5M94B 3DI3B 1BX2B 3KGRA 2DM3A 2I9LA 2OL3L 1FN4B 4PLKD 2NLJB 3SE9H 4F7TB 4OLWH 1CFVL 4ZSOE 3SKUD 2WW8A 4ZTPH 5DJXB 4MXQC 2DMCA 3GK8L 2HJLB 1IAII 4XPGL 5JLZB 4AL8H 4M00A 3RTQA 1OD9A 2FLRT 1DVFB 1MCNA 4RZCA 4L4TA 2LE9A 3NBNA 2IJ0C 3PWUB 3CFJB 3WN5B 3E2HC 2X42A 3VH8B 4M5ZL 1R3LB 4X4XA 4CDHA 4G5ZH 3C8HA 3GMRB 2EXYD 2W65A 2OMNA 1FVCB 1DL7L 4D2NA 4WGVB 4K3EH 5HGDA 1UYWH 3TF7C 1MFEH 4OB5L 4ELMF 4H0GA 5D6CB 4Z7UB 2P5EA 3FKUS 4M8QA 3P2TA 3TT3L 2E7BA 4AH2A 2EDJA 1CK0L 1K8IA 2GY7B 4NCC1 1BFTA 3UCRA 4R26L 4KVCH 3BYTA 2ENYA 5GRXG 4WUKL 3TZVA 2DQJH 4HCRH 3MLSH 1S7VB 1WZLA 4MJ6A 1YQ2A 4ELME 3QCVL 3VXTA 1KB5H 2VDNH 4IDJL 4K23L 4ELKB 3D39A 4U1HA 1HCFX 3C5ZB 3MRPA 5SX4H 4BH7B 1IC5H 2RBLA 4YGAB 1P1ZB 1R3KB 3I6GA 3CX2A 4GQ9L 3BH9A 1E4KC 1GGCH 5JNYB 1I9EA 1SYSA 3BQUA 2O26U 3FQWA 2DQGL 2YXMA 5IEKA 4NKDA 1BMGA 3J7HA 4D9LL 4NWUH 4QY8A 4XC3H 4ZUWA 1C7SA 3DARA 2DD8H 4LSUH 1T7XA 3LN4B 4PUBH 1EZVX 1D3CA 3LHPH 1Q72H 3D0LA 2C9AA 3O3UN 3X13B 5DMYA 4HC1H 3UJJL 1HQ4A 2VDOH 4RMWA 5L88L 5E24E 2NW3B 3RZCB 3UX9B 4UT7L 2JB6B 4OCSL 3FRPG 1FVDB 4P2YA 4U33A 3W2DH 3OKMB 1IARB 4Y19D 5DLML 4LBEB 2XWJA 4L4TE 3T8XA 3W81A 2NTFA 3P9LA 1G7PB 1I7RB 2E9JA 1BOYA 1T2QH 2C7UB 2DYPA 3VFSB 1A5FH 1WBZB 3N1FC 4HS3A 1UZ6F 1XIWD 5C6WH 4Z76B 2CO6B 2BSTB 2IWGA 4PTUA 5I17B 3Q5YA 5CMAB 4TQEH 5HI4D 4WDIA 1OPGL 3O2DA 5JQHC 3WFEH 4NRYA 3T65A 5J12C 2GKIA 3W39B 1FL6B 4ORGA 3VWKD 5MEQB 4YGVB 2AEQL 3GZKA 3OAYK 1UZ6E 1CE1H 3D69B 4JFZH 5HGHA 5JW3L 4KXZH 3KJ4C 1AIFA 3TH3T 1KXVC 3GSVB 2X4PB 4QHKI 2EDEA 1CXFA 5F97E 3QEGL 2DQDH 1BD2B 4O2FB 4ZUUB 2KPNA 2Z0BA 3UZEA 2C1OB 2HN7A 5CGYC 5TE6L 3REVB 3JTSB 5DEZA 3D39E 5HI5D 1K6QH 1R5WB 2IMMA 3HE6A 3I2CL 4OFIA 3AAZA 4TSAL 3UBXI 5FO7B 1ES0B 5I8EB 1KCVH 3U7WH 1D5BA 4NQDB 2BK8A 3HE7B 1JWMA 4J7RA 3QH3B 1T1XB 4DCQB 4OD3H 2YK1H 3DMMB 5C0CD 3I75B 4QTHA 4TULL 1YNTB 1RK0B 1I8IA 4KVNL 4HD9A 5CBEA 5EO0A 1J9CT 1R3IL 4F2MA 4PTTB 1UT9A 1S7QA 1R3JA 4EKXA 3P11L 3AXLB 1U91A 1JN6A 4PJIB 3SJVB 2VDLH 4M43L 1OGAA 4PBXA 5ALCL 4JRXB 4GKNB 4H5SA 1HOCA 4MLSA 4NQCA 3GSOA 2EYRA 1MFAL 3GGWB 2IPTL 4J2XA 5GS0L 4Z8FL 2EYTA 1OVZA 5FGSA 5F88A 1XT5A 3OKDA 4TNVF 3OL2A 4H1LH 1GIGH 1MH5B 4RRPA 1XGRB 1AD0A 3KNBA 4PJ5E 5IQ9A 4HMEA 2A74A 5DD1H 1EBPA 2XWTA 3PV7A 4RMVA 3DRTB 3RJQB 1BF2A 5D1XD 4TNWF 2IAMA 4EIZC 4LCWA 1EERB 4GKSB 2EIEA 3ROOB 5INDA 3IXAA 3MV9A 2YZ1A 1YC8A 1AR1D 5D96B 4OAWA 5CJQH 2R1XB 5EBLA 1MHEB 3D2UD 3HR5B 4JZJC 3GDBA 3MRJB 3V5HB 4M93C 2Q86B 1PX3A 4S1QL 1LEIA 3RWIA 4S1SH 1UGNA 3P30L 2BSRB 4NIKB 2MHAB 3F7RA 2A6IA 3LKNB 3MX0A 4BUHA 4YAQA 1MJ7H 1N7ML 4DN3L 4LARH 3CFKB 1J0YA 1MCSA 1D5IH 2AERT 1MCPL 3KPRD 4HUXB 4N1CA 3HI1B 5EOCH 3SDDA 3BP5A 3KVQA 5TE4L 2PN5A 5EWIL 4HH9B 3T77B 3MA9L 4YXLL 5C0JB 1LP9B 1UXSA 4FQHA 1F02I 3CMGA 2XQYG 2GSIA 2E27L 2PW2A 1ZE3C 4Q74A 1WUNT 2W9EH 5EIIB 5KG9A 4PJ7B 3SDAC 4LCIH 5I1JL 5IP4A 2DWDB 3L6FA 4EXPX 3JWOC 1OGAE 5HYQA 4F9PC 2P5WD 2JELL 3FT2B 4LNVA 3CFEB 3FOLA 3QG6B 3SKOA 4NQCE 5KANG 2R2BB 2R29H 5FUOL 4J12A 4KQ4H 4UT6L 3G04B 1K4DB 3WYRA 2VRAA 4YHML 4IHOA 2VLLB 3LEYL 2D4FA 1TQBB 3ZT6A 4M9PA 1GYAA 1C7TA 3QQ3A 4AIZB 1UXWB 5E8DL 5F1OB 4YHNA 1EHNA 1P6FA 4TTDC 4P3DB 5F44A 1KLFA 4HPYH 1MCOH 4YWGH 4GAJH 1JRHI 4LCWE 5ISZE 4LCYB 5DVLA 4XBEL 3S5LG 5DQJA 3R0NA 5FYJL 4LSDA 4L1HA 2H2PD 4KKCD 5IMKA 1JIBA 1ZVHA 3INUH 1U8KB 5DJ0A 4JZOA 1H3UA 3C2AH 4JDZA 4TVPL 3TBWB 4MX7B 1ADQH 2YD3A 1E6JL 3OZ9H 4NFBA 2DM4A 3PP3H 3THMH 4DVRL 4OM0L 2D7TL 2HT4D 3P4LA 1TZHB 4HIJA 4EUPA 2M8XA 4R0LA 4Y19B 3VFGL 5C0AD 3UTQB 5D9SA 1JNJA 1J11A 4OFVA 3RIAF 3GSUA 2AV7B 3RVUC 1T22A 4S1RH 1XIWB 4DEPC 1INEH 2FJHB 3G6JA 4ORZC 5ADOH 5IHBA 4R2GC 5IWLC 1XF5A 4W4OA 4FQQB 2XA8H 4JY6B 3MODL 1S9WA 3OKYA 2QQQA 3WNNA 1F3RB 3RVWD 4K3HA 3G6AA 3GIVA 4F9LA 1UACH 3VWKB 3RGHA 1A7BA 4LRNL 4XMLH 3BPNB 4GS7B 3ECBB 2O5XL 3PG2A 1JPFB 3VWJD 3MR9A 4JE4B 4QXTB 4TTGA 5FHAL 3GKWH 4QCIA 4MD5B 4E41D 2EO9A 5B4MC 3GBML 5KZCD 1Q8MA 1CU4L 3MRGA 4P99A 5E5RB 5DMGD 1AHWC 5B38A 2VXSL 3IDNB 5C09A 3SGEI 1A7RL 2NY1C 1RURH 4PGBA 3SKJH 1T5XB 5K9KB 2QJDA 3EHBC 2FJFB 3ALWA 3CX5J 3GJEA 3PL6D 1JWSA 4XTRD 4NCC2 2KBGA 5GJTH 5MEPA 3KS0H 3GI8H 5C0CB 1M7DA 2XOTA 2YKLL 2ZUQC 5EU4A 1IGMH 4PRBB 4XPBL 1LGVA 3BYYA 2XT1B 9CGTA 4OZGA 4OJFL 2VZSA 4KK5D 5FV2A 3AM8A 1LNUB 1X9QA 1MOEA 4W6WB 1KPRB 1U8NA 4L8BA 3QHTC 4LSSL 4A6YH 1N4XH 4J4PA 5DD5L 5EU5B 6FABH 3G6JF 3N06B 2UY6A 3LQMA 1FAIH 3VRLF 4JO4L 1AJ7H 3BEVB 2PTTB 1GL4B 4PGEB 3V6FA 1JHKL 4RA3A 3HNSH 4IRJD 3QRGL 5IV2A 3QI9D 1KG0B 4Z78B 5B39B 1JZ3A 2DQHH 1N5YH 4UU9A 4Q9RH 2NX5D 1T2XA 2EH8H 1CCZA 3C9NB 3G6JE 4LCUA 1INQA 3VRLE 3O9WD 5D1XB 1FO0H 1YMHA 1BFVH 5BZWA 3TO4A 1K2DA 4AJ0A 1GHFL 1UB5B 1Y6NR 4NJ9L 5H35A 5DVNA 3CCHA 1A7NH 4D9QD 2CLZB 3QZWA 3S7GA 3C6LC 2AQ2A 4MNQA 2ICWA 4WO4D 5C2BH 3A6CL 1BGXH 1KC5H 3ZHDA 5FDWA 3RHWF 4PIRF 1P9MA 3FAWA 3RX8A 3BKML 3NFSL 4GXVH 3VXMD 1X5IA 2VTFA 4XPAL 3CXDH 2Y9RT 4OZGF 3IGAA 4YZFF 1TJIL 5C09E 1KIUA 1F4HA 1NH6A 5HHPB 4G3YH 1XR9A 5D7LD 3KPRB 1HHJB 2HKFH 4IRZH 4HMDA 5BZDB 4LDLB 1EAJA 5CD3A 5J11C 1AXTH 5DD6A 3Q6FA 3IETB 2FZ3A 2OJZH 2OZ4H 1MRCL 1CGXA 3D5OF 3OXSA 4PRPA 3WXWL 4YZFE 5EFIB 5LGHL 3CFIC 1NCTA 4UDUA 4Z0BH 3RTQC 3RFZC 2UZYB 3LDBC 3M8OH 3KPOA 4Z7OF 5J6GA 2VUOA 2H26A 4HXBL 3E0GA 5CKAA 4R3SB 3X3GL 2CKBA 1J8HB 1XCQA 1V05A 3IF1B 3C09C 4NFDA 5CD5C 3AREA 1M71A 5KVFH 2C4XA 5ANMA 4NC2B 2VDKL 1JTOA 5GXBB 2IGFL 3KYKL 1P7QA 4BSWB 1CGSL 4WI4A 4WI7A 4YUEL 1Y0LA 3BZ4A 4Z7OE 5HGBA 3PABA 3JTTB 2Y7QA 3VXOA 4I0CC 1A6AA 4IOSD 3FO2A 3MGTA 1A6TB 2W60B 2SEBA 3QEQA 1RZFH 5FEBA 3QNYB 4IDLA 5H2BA 3NMEA 4HZAA 3TZVC 2F58L 4KDVA 4NDMB 4ZO8A 3QDGA 4MNQE 1JPGB 2A9ML 4HUKB 3B83A 3ULSB 1VKXA 4TUOA 3TFKD 2YEZB 3NCBB 2VMFA 3IJYB 4BKLB 3PWPD 1MQKL 1T7YA 5FO8B 2BJMH 3DUHA 3FT3B 1TDQA 4JDTL 4HS6B 4HG4J 3C5JB 3ARFC 3IDXL 3BQUC 3BGMA 4OGAD 5F1IA 3EZ8A 4ENED 5C0AB 3RL1B 2OQJA 4UIKL 2H32B 3GHBH 2R9HD 3T1WA 5C0RL 1H5BA 4UOJA 5FKAA 4W70A 1G6RL 3OAZH 2AKRA 4R90H 3BJ91 1BAFH 1O7SA 3M07A 3O4LA 4O4YL 5H94A 4PRPE 1IQWH 1W8OA 1ZWIA 2NCMA 1IGYA 1DE4A 1A7QL 4FHBD 1D5ZB 1HNFA 5EU6A 1AGEB 3F6IA 4OQTA 4P2RA 3BD3A 1YNLH 4YFLF 3ZDXE 4FNLH 3NZ8B 4H25A 4KROB 5DQ9B 3BOVA 5INCB 3ARQA 4E41B 5T3ZH 1QSFA 3IDUA 3F8UB 3WXVH 5KZCB 1AI1H 1J5OL 4U1SA 4HK0A 1LILA 1N6VA 1T83A 2BVPB 4PJAB 3QIUD 5CFHA 2VAAB 5BS0D 3H9SA 2IFFH 4L8DA 4KMLB 3TJEL 4Y88A 4BQ6A 5J6HB 3CSYB 3VI4F 4M9OA 3PL6B 4Y4HC 1ED3A 1IKFL 2QKIA 1NL0L 1MHCB 4JKWA 4YHLL 2Z8VC 1W0VA 2ITCB 3BDBA 3CDGB 4EEEA 5E2TH 1JNHB 3EDJA 1CQKA 5I75C 4MXVF 3HC0B 4NP4H 5ENWA 1MCCA 2QQKL 3HE6C 4OM1L 5LKNA 5I9QB 3VI4E 2EH7H 4WEMB 1BBJA 4X9BA 4O02L 3VXSA 4XVTL 5E4EB 4KWUA 4CVXB 2R4RH 4JFDE 4KTDL 5ACZA 4NNPH 2ZG1A 2ZJSL 1YEJH 3SDXA 4GKZA 3BDYL 1NDMA 3X14A 1CWVA 5C9KA 4XNMA 3NACH 1GZPA 4IRJB 4K8RC 4ZUVB 1CDIA 4UIMB 3HNVL 4RMUA 1MLCB 3QI9B 1MEXL 4NNYB 4XBGB 2MPAL 2DQTL 3KLHD 4JPIB 5L7XH 2NY2D 2AXFA 1RI8A 2YPKA 2NX5B 5BRZA 4OUOA 3MRRA 1A3LH 4P2QD 5E99H 3LIZH 4M62H 1EK3A 2NXZD 4JFYB 4L8CA 3O4LE 5C0IB 2YC1A 1EGJA 3QNXA 5LAXB 1EHLH 4N0CD 2RFXA 1AGFB 4P57B 1PG7L 3QFJD 4EN3D 3CLFH 4I48B 1KCRL 1Q94A 3Q3GA 5EU6E 3VXUA 4ISVB 4P2RE 2BDNH 5MENE 2XFXA 4N68A 5TF0A 1K4CB 5C71A 4JJ5B 4WO4B 5F21B 3V0AC 5GGUB 2HG5A 1A3RL 4Z9KB 3UYRL 5KN5B 2UVFA 2HWZH 3T3ME 1QSFE 1WZKA 1Z5LA 4EI6A 3NFNB 2DQFB 1QP1A 4I3GA 3VXMB 2WLZA 5DT1H 1OP5H 2IAMC 1WF5A 3OKEA 1IEAB 5DRXA 3NZHH 3H9SE 5FUCC 2HMID 4Y2DA 3QEHA 2HFEA 3E3QC 5E8EB 4U6VH 4LP4A 5D7LB 3MRHA 4KQ3H 1IVLA 4GRWF 3NFPB 5AG8A 1ZLSH 1PSKH 1Q9KB 4ODWB 2MOVA 1XGYH 5LXGH 3SDXF 2VLRE 1F4YH 1ZANL 1EBAA 5FA4A 4HGMA 2F8VA 1S78C 1J1OH 5GGRB 3IFNH 3NN8B 1B6DA 4U1IA 4GRWE 4JREC 1U8OB 3F7QA 1TZIB 3CMOH 1N8ZA 3SDDC 3VXSE 4JG1L 3REWA 2RB8A 1C08A 2BSSB 5IIEA 5KTEL 5E1AB 5JXAL 1J0JA 2HH0H 4NUJB 3SDXE 1WT5A 4MAYA 4PYGA 1I3GH 4O2EB 4ZS6C 2R4SH 2Y06H 2FECI 5GGSY 2OR9H 4WWKC 5DDHB 5KS9A 3OBAA 4OBRA 2XZCL 3VXRA 4ZMAT 5BRZE 2JK5A 2G9HA 4NQEA 3K74B 3SHSA 4PJGE 5DJZA 5KVMC 3QUKB 4OLXH 4XCNB 1IM3B 5JPNB 3VXUE 5IK3A 1HKLH 4LLDA 3GMNA 3FB7B 2FR4A 4HEPG 3HMXL 1S9VA 3EYQD 3KPPB 4X6CA 3MRMB 4N90D 1L7IL 5E56A 1NCDH 4LEOA 1ZEAL 1NFKA 2Q20A 2ZSWB 4KK9C 4PB9L 4XAWH 3PGDB 1V7MH 5EBGA 4DAGH 3OG6B 3PWPB 4X8XA 2DMKA 5D1QA 2EC9U 2Q6WB 3RVXC 3FB5B 3HZVB 2D03H 2B20A 4P5TA 4CU8A 4LLYB 2QLVB 5MERA 4L5FH 3HAEG 1DQJB 1BIHA 1EHAA 4AT6B 5GRJL 3EGSA 1KGCE 4XWGL 3RDTA 1P4BL 1DQQA 4RWYH 3RP1A 1NBZB 2EIDA 2DLGA 3NTCH 1NKRA 4ETQB 2E7HA 4MZ3A 2W0FA 4UDTA 5KS9F 4IJ3C 3HI5H 2J3SA 5L2KA 3DSNA 2X05A 4R0LC 3ZMRA 4WTWA 3QO1B 1G7JA 1ZAGA 1MSPA 1JYNA 2ARJB 4OD2A 4OF0A 4EI5D 2GJZB 3VG9B 4J3SA 1U36A 4EIGB 3QXAA 2GSGA 1LD9A 3FQRB 5KS9E 3KPQA 3V5DB 4K55A 1NAML 3VXRE 1OSPH 1C1EL 2GUOA 4W4OC 5CCKH 5IQ7H 4YPGB 3QIUB 4P4RB 5BS0B 4BSVB 4X6CF 5CSGA 2ZOKA 4NQEE 4L3ED 4F9LC 1NCCL 4ODVH 4WRLA 5E5MA 2ICWJ 2WP3O 4L29A 3DVGA 3UTTA 4XP5L 4QWWC 4QHNB 3L5JA 4G6ML 2BERA 1U41A 5D4QA 4FXGA 1A02N 3TIEA 4X6CE 3B2VL 1MHHB 5ITBH 5GISL 3DRQA 3DV6A 3EYVB 1BQUA 1IAIM 4Z5RB 5D2NB 4J8RA 1I3UA 5IM7B 1OSZB 1CLOH 4NKOB 3T0EC 1CFSB 1NC2B 2AXJA 1HH6A 2FBJL 5F7WC 5I1LB 2BX5A 2HRPL 3B6SB 2UYLA 2NY6C 1ZHBB 5EC2B 1UEMA 1QOKA 4M1GH 1KACB 5FHBH 4OT1L 4HX1B 1QEWA 5T3XD 3ARYA 3CGTA 3AM8C 5B3JE 2NY2B 1S7SB 4W68A 3K80A 3O2VH 3E1F1 3UTZA 4Q0XH 2UWEA 2UZIL 4P2QB 5F1KC 3LKRA 3QUXD 1Z3GL 3O3EA 2NXZB 3DX6B 4WUUD 3CD4A 1E27A 3WFHA 1KJ2H 4J4PC 5A16A 1CDYA 2IADA 3RWDA 4UAOB 5D7JD 3OB0K 3QFJB 4EN3B 5DRZA 5I1DB 5IW1A 5L2KE 3GIZL 1JTTA 4P46A 5FB8A 5C0FB 4LRIC 5HYJD 3RVVD 1OTUC 2LV4A 3JSSA 3TJHD 3WLWD 2CDEA 5EBWB 2X4QA 3AS1A 4YNYB 1G7QB 3U46B 3JZ7A 4ZS7L 4BZ2H 4N5ED 2GTWA 3TO4C 4F3FB 3U4BL 5HHOD 3BVNB 1E4XH 4GSDL 3MLYL 3FRPA 3VFUA 3C6SB 3JWDH 4LIQE 4FFWC 4G8FA 1RK1A 4F15C 1IAOB 3RBSA 1MPAH 5C92A 2W9DH 4JR9L 4MDJA 1CF8H 3UTTE 4JRYD 4XPTL 2NNAB 4OZIA 2FHCA 2YD2A 1AD9B 3NIFF 1P9MC 5L2JB 3E8UH 5DUMH 3X17A 3U9PH 1FJ1B 2A77L 4JFPA 2H6PB 1DBKL 5E8OA 3U0TA 3BMWA 1HILB 2X1PA 4MXQD 3H0TB 1JK8A 3T4YA 2UWEF 4ALAH 2VDML 2GTZA 5TDOB 2VR5A 2XPGB 4LLWA 2XYCA 4P3WA 3NIFE 3QPXL 4P23A 1OWWA 4WHYH 5D7KD 5GS2H 2VR9A 1WK0A 4JQXA 1H3VA 4NO5B 1VEPA 5AZEL 5IBUB 4M4RA 3IDYB 2UWEE 3CLEL 4G8IB 1IT9L 1HXMA 4Y0GA 4X6FB 3MNWA 4Z7QF 3SGJA 5IVZB 5I30H 2YSSA 4WJ5B 1GGBH 1T0MA 3DGGA 5HHME 4RIRA 2UV3A 4LAQH 2YWYA 4UV7H 2Q76B 2X70A 3DTXB 1KJMB 5GQBA 5FKPB 4WWID 4PREA 4YIQA 3CDYA 4OCLC 5HYIA 2VDQL 1BLNA 4DK6A 2AXHA 3MCLH 3PWVA 3T3PF 1X6LA 4FMKA 3D18A 2M2DA 3FO0H 3OQ3B 3QUZA 4U49A 2AK4A 2CLVA 4Z7QE 3ULVF 5I16B 4OZIF 5BVPL 4X7EC 4QRRD 1GH7A 1SMOA 4NGHL 4UV4L 4DN4L 4PV8A 3MV7D 3D25B 1QFWI 3OAUL 4U1GB 4JPKL 5DMIL 1SEQL 1Q1JL 3GSXB 5ADPL 1K8DA 4POYA 1NMCB 2WK2A 5IR1B 1MF2L 4OZIE 1CFVH 5D1ZA 5T33H 4YDVA 3BIKA 4ODXA 5BQ7B 4NQSB 4NKIL 2MKWA 2F5AL 3IFOA 2F74B 5IMLB 4I3RH 4ZNEA 4LNRB 3QEUB 5JHLL 2EEDA 4OZHB 2BNQD 4G7VL 4Y5VC 3U7YL 1LHZA 4XH2B 1H5BC 1A1NA 2PO6C 3CXHK 2EKSB 3LY6A 4KMTL 4IMKA 4DGYH 1G6VK 4EI5B 4DJMA 1EA9C 5C0ND 2BZDA 4KKAC 3GBNH 4M7LT 5HHXL 1XGPB 1YQVH 1S8DB 4HWUA 1QA9B 2Y6SC 1C8PA 1X5ZA 4FQ2L 3K7UA 4MWFA 3D48R 1ZVSA 1SM3H 5IB1B 1E6OH 2RR3A 4L3EB 3BZEB 2V2XA 1BPVA 3VI3E 1RFDH 2A2QT 3V6ZA 2V2WB 3N50A 5EBMB 1YEKL 3W0WA 2PYEA 3I9GL 4P0DA 1N0XL 5JTWA 2YN5A 3ZO0A 5IJKC 1YN7A 1QO3B 2XWBA 5DUBA 3TBTB 2HTLC 2RQ8A 1U0QA 2AK4E 3WNKA 4ZFFA 3PQYA 3FHAA 1PAMA 5CGYD 4FTVD 2DI9A 3TA3D 4U1LA 2O61B 5KSBB 2JB5L 1AGCA 4IMLA 3OKLB 3RL2B 2DMBA 3DO7B 5BVJA 4YHOL 1HDMB 2GI7A 5ID0B 3FJTA 1IEBB 5EN2A 1UWEL 3BUYA 1FCCA 3PXJA 5EIVA 5JUEH 1AO7A 1JZ2A 3VFVA 4WUUB 1RIHL 3I3BA 4PLOB 1CT8A 1NGYB 1ZGLA 5D7JB 5CILL 3C5SA 5FOBA 4ZNEE 1HHIB 3QDJD 4XCFL 4GXUN 5HYJB 4LPXA 2FDBP 2VLMD 1H0DB 2Z93A 1TQCB 3D3VE 5FXCH 2X7LB 1U95A 1KCSH 4U6YA 1DBAL 3DI2B 3FN0L 5CWSA 1ORSB 4CJ1A 5J13C 5E00B 1PZ5A 4GW1A 4P9ML 2FATL 5HY9A 2BXYA 1T4KA 2R15A 3EOBA 2P8PA 1DDHA 2GK2A 1NGWB 5HHOB 4XAKD 3FZUC 2YRLA 3UMTA 3GNML 2ADJB 2IG2H 5GGTL 3T0BA 4OCNC 3VH8G 2AJYH 3EDDA 1CFTA 1D7FA 5C70A 4BH8B 1NGZA 3U6RB 4JRYB 5IW6B 4HAGA 1KUMA 3S96A 1NDGB 3W0WE 2PYEE 1QSEA 3PHOB 4Q6YA 1NFIB 4H8WC 1G9NH 4XCEA 2Z4QB 4APQD 3FMGL 1S9KC 1MIML 4Y4KC 4DQOL 4Y2DC 2X4TB 5CJ5A 5FM4A 1B2WH 3U2SB 5JW5A 1MCRA 1P7KA 1W8NA 4NBZB 1Q38A 5DK2B 3U1SH 3MGAA 4ETYA 2Y07H 1DEEB 3B9DA 1Q9WB 1IQDB 4R7NA 3EYFA 1AXSA 2P7TB 4XHJC 3ZE0F 3E2HB 3QIBA 3QUML 1F3JA 2BOBB 1T1YB 5I18L 5JR1L 4ERSL 3BRFA 5T1MA 2XQBH 3X3FL 2JCCA 2E7LC 4LLUB 3G6DH 4G9FA 4WNQB 2VQ1B 4M43H 2IEPA 4U4BA 3FCTB 1MWAB 3SDAD 4HUWB 4ZPVB 5DRNA 3ZE0E 5CHNB 4Z8FH 2OS7A 1KIPA 5K59F 4KV5F 5TQ0L 3MNVA 1U8PA 4UTBH 1F8TH 3BP6A 5JW4Q 4MHHG 4U0RB 3MZGB 4R4NC 3EFFB 2VH5H 1T3FA 2BNRA 3QUYA 5TH2A 2Q87A 2X4NA 4PJXB 3R0MA 4QRRB 3SO3C 2OK0L 4HKJA 1MIEH 4N0FB 3MV7B 1FYTD 3IU4H 5K59E 3HC3H 4KV5E 3P9MB 4XZUB 1PEZA 1XF3B 1CGVA 1S5IL 5C08A 1G7IB 2HA1A 4GW5B 1OAZL 4M1DH 2E9IA 3ES6B 4JY5L 4S1QH 3OGOE 1Y6KR 3P30H 3I50L 1CBVH 2I5YL 1QSEE 4D9RD 2DICA 3T4AB 3MRFB 4XP1H 4CDGC 4P5TC 3MACL 1A6UL 1KLUB 1KEGH 1J0IA 4EOWL 2EDYA 1GOFA 2JCCF 3GRWH 3ZTJG 5IG7B 3OGCB 32C2B 3M17A 8FABB 1LMKA 3TGXA 4I2XA 4YXLH 1BQLL 1NQBA 3NGBC 3A6BH 4MNGA 4HULB 2V7NB 1RZGB 2MQ0A 2GAZB 3RVUD 3EYOA 2NY4C 1K85A 1XGUA 4TSCH 3WFDL 3U4AA 1OGTA 4LGSB 1FZKA 1N6UA 4QXUL 4R2GD 1QRNE 5I1JH 3X12A 2JCCE 2QBWA 5FYKE 3VCLA 2Y25A 1KB9K 3B9KB 2EYSB 4WVRA 3QHZL 4UNUA 5IHZB 4UQ3A 5JMOC 1NJ9B 5J12B 4Z7NF 2ED8A 1T7VA 3WCYA 2QR0B 4RAHA 3EYUL 5D8JL 5MP6H 1JHTB 3QUMB 5I1CL 1OY3B 5JDJA 1NFDA 1D5MA 3LEYH 1UCBH 4DTGH 3I02B 1IILE 3MBXH 5DD0L 1EVTC 4G6JL 5B4MD 4QYOB 1WIPA 5E8DH 3B9EA 4F8QA 4D94A 4FTVB 4BFIB 3TA3B 4Z7NE 1TIUA 3IS1X 1BZQK 2ZKHL 3BSZL 3EHBD 4KTEH 1IBGL 4M7JL 5B8CC 5AUMB 5C08E 2CUMA 3PNWB 2Y5EA 2BY2A 5F7UA 3V0WL 4WIQA 1BVKB 3B2UC 5HYSB 4RSVA 2VDRL 1G7LA 5CBAB 3GMQB 5JQ6H 4RMSA 4HLZG 4F58H 1IGCH 4JEGB 4OCRL 1LO4L 1MVUB 4GRLA 1NC4D 2R23A 1RULL 3VXPA 1OARH 5JDSB 3ARDD 4HIEA 4NHCH 1KNOB 2OTUB 3QDJB 2QTEA 5EA0L 4PP1C 1BJ1J 4G7YH 2J4WH 4NYLB 1HN1A 2YUXA 2AEPH 3O6KH 4I2XE 5DHVA 5T1KD 5C86A 5I15H 3TBVA 3JWNC 3QHFL 4GRMA 1QVOA 4MCZB 4U2ZA 4MNGE 4DGVL 1RZJC 3DX7A 4YDJB 1G0XA 5GSVB 1UKQA 5DGQA 4ZUSA 1IMHC 3PHQA 5T5NF 4E5XB 1NFDF 1I8KB 3K8LA 1A9EB 5DWUH 3P4NA 5C6TH 1H8SA 2QHRH 1H3PL 3S3PA 1VEOA 2AV1A 1V3LA 3MLUL 3QNZA 4FQJH 5FHAH 3C6LD 5BMFL 3RAJL 4FA8A 1KTDA 2FH8A 2ICWI 1DN0A 4APQB 1NFDE 4JZJB 5FV1L 5DURD 3V6OA 4UQ2A 1GPOH 4HBCH 5F9WC 3PDOB 2GK0A 4GMSL 5FECB 5DSCA 4EDWH 4ACPA 4XBPA 5E7FA 2OTWA 4Y5YA 4DZBA 3OPZL 2HFGL 5KSUA 1EPFA 3HUJA 3ULVC 2FH6A 1VA9A 4X6DA 4L1DA 3IDIB 2VABA 1OB1A 2WINB 4FXLA 1U8LB 25C8H 1N5AB 3P77B 1WFOA 1FL3A 1TVHB 3MLXH 4NO2B 3RRQA 4Q9QL 3ALXA 3QXUA 1JPTL 4GG6B 1DVFC 3S36L 2WIIB 4BELD 3ZKMC 4YJZL 1AC6A 4PJ9A 3PGFH 1PYWA 1CXLA 5F96L 1FZOB 3RTQD 2Z35B